data_1BGB
# 
_entry.id   1BGB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BGB         
RCSB  PD0010       
WWPDB D_1000171721 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BGB 
_pdbx_database_status.recvd_initial_deposition_date   1998-05-28 
_pdbx_database_status.deposit_site                    NDB 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Perona, J.'   1 
'Horton, N.C.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Recognition of flanking DNA sequences by EcoRV endonuclease involves alternative patterns of water-mediated contacts.' 
J.Biol.Chem. 273 21721 21729 1998 JBCHA3 US 0021-9258 0071 ? 9705308 10.1074/jbc.273.34.21721 
1       
;Role of Protein-Induced Bending in the Specificity of DNA Recognition-Crystal Structure of EcoRV Endonuclease Complexed with D(Aaagat) + D(Atctt)
;
J.Mol.Biol.  277 779   ?     1998 JMOBAK UK 0022-2836 0070 ? ?       ?                        
2       'Conformational Transitions and Structural Deformability of EcoRV Endonuclease Revealed by Crystallographic Analysis' 
J.Mol.Biol.  273 207   ?     1997 JMOBAK UK 0022-2836 0070 ? ?       ?                        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Horton, N.C.' 1 
primary 'Perona, J.J.' 2 
1       'Horton, N.C.' 3 
1       'Perona, J.J.' 4 
2       'Perona, J.J.' 5 
2       'Martin, A.M.' 6 
# 
_cell.entry_id           1BGB 
_cell.length_a           49.400 
_cell.length_b           50.200 
_cell.length_c           64.100 
_cell.angle_alpha        96.00 
_cell.angle_beta         109.00 
_cell.angle_gamma        108.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BGB 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     triclinic 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*CP*GP*GP*GP*AP*TP*AP*TP*CP*CP*C)-3')
;
3334.186  2   ?        ? ? ? 
2 polymer man 'ECORV ENDONUCLEASE'                              28559.158 2   3.1.21.4 ? ? ? 
3 water   nat water                                             18.015    236 ?        ? ? ? 
# 
_entity_name_sys.entity_id   2 
_entity_name_sys.name        'EC 3.1.21.4' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DG)(DA)(DT)(DA)(DT)(DC)(DC)(DC)' CGGGATATCCC C,D ? 
2 'polypeptide(L)'        no no 
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DG  n 
1 4   DG  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DC  n 
2 1   SER n 
2 2   LEU n 
2 3   ARG n 
2 4   SER n 
2 5   ASP n 
2 6   LEU n 
2 7   ILE n 
2 8   ASN n 
2 9   ALA n 
2 10  LEU n 
2 11  TYR n 
2 12  ASP n 
2 13  GLU n 
2 14  ASN n 
2 15  GLN n 
2 16  LYS n 
2 17  TYR n 
2 18  ASP n 
2 19  VAL n 
2 20  CYS n 
2 21  GLY n 
2 22  ILE n 
2 23  ILE n 
2 24  SER n 
2 25  ALA n 
2 26  GLU n 
2 27  GLY n 
2 28  LYS n 
2 29  ILE n 
2 30  TYR n 
2 31  PRO n 
2 32  LEU n 
2 33  GLY n 
2 34  SER n 
2 35  ASP n 
2 36  THR n 
2 37  LYS n 
2 38  VAL n 
2 39  LEU n 
2 40  SER n 
2 41  THR n 
2 42  ILE n 
2 43  PHE n 
2 44  GLU n 
2 45  LEU n 
2 46  PHE n 
2 47  SER n 
2 48  ARG n 
2 49  PRO n 
2 50  ILE n 
2 51  ILE n 
2 52  ASN n 
2 53  LYS n 
2 54  ILE n 
2 55  ALA n 
2 56  GLU n 
2 57  LYS n 
2 58  HIS n 
2 59  GLY n 
2 60  TYR n 
2 61  ILE n 
2 62  VAL n 
2 63  GLU n 
2 64  GLU n 
2 65  PRO n 
2 66  LYS n 
2 67  GLN n 
2 68  GLN n 
2 69  ASN n 
2 70  HIS n 
2 71  TYR n 
2 72  PRO n 
2 73  ASP n 
2 74  PHE n 
2 75  THR n 
2 76  LEU n 
2 77  TYR n 
2 78  LYS n 
2 79  PRO n 
2 80  SER n 
2 81  GLU n 
2 82  PRO n 
2 83  ASN n 
2 84  LYS n 
2 85  LYS n 
2 86  ILE n 
2 87  ALA n 
2 88  ILE n 
2 89  ASP n 
2 90  ILE n 
2 91  LYS n 
2 92  THR n 
2 93  THR n 
2 94  TYR n 
2 95  THR n 
2 96  ASN n 
2 97  LYS n 
2 98  GLU n 
2 99  ASN n 
2 100 GLU n 
2 101 LYS n 
2 102 ILE n 
2 103 LYS n 
2 104 PHE n 
2 105 THR n 
2 106 LEU n 
2 107 GLY n 
2 108 GLY n 
2 109 TYR n 
2 110 THR n 
2 111 SER n 
2 112 PHE n 
2 113 ILE n 
2 114 ARG n 
2 115 ASN n 
2 116 ASN n 
2 117 THR n 
2 118 LYS n 
2 119 ASN n 
2 120 ILE n 
2 121 VAL n 
2 122 TYR n 
2 123 PRO n 
2 124 PHE n 
2 125 ASP n 
2 126 GLN n 
2 127 TYR n 
2 128 ILE n 
2 129 ALA n 
2 130 HIS n 
2 131 TRP n 
2 132 ILE n 
2 133 ILE n 
2 134 GLY n 
2 135 TYR n 
2 136 VAL n 
2 137 TYR n 
2 138 THR n 
2 139 ARG n 
2 140 VAL n 
2 141 ALA n 
2 142 THR n 
2 143 ARG n 
2 144 LYS n 
2 145 SER n 
2 146 SER n 
2 147 LEU n 
2 148 LYS n 
2 149 THR n 
2 150 TYR n 
2 151 ASN n 
2 152 ILE n 
2 153 ASN n 
2 154 GLU n 
2 155 LEU n 
2 156 ASN n 
2 157 GLU n 
2 158 ILE n 
2 159 PRO n 
2 160 LYS n 
2 161 PRO n 
2 162 TYR n 
2 163 LYS n 
2 164 GLY n 
2 165 VAL n 
2 166 LYS n 
2 167 VAL n 
2 168 PHE n 
2 169 LEU n 
2 170 GLN n 
2 171 ASP n 
2 172 LYS n 
2 173 TRP n 
2 174 VAL n 
2 175 ILE n 
2 176 ALA n 
2 177 GLY n 
2 178 ASP n 
2 179 LEU n 
2 180 ALA n 
2 181 GLY n 
2 182 SER n 
2 183 GLY n 
2 184 ASN n 
2 185 THR n 
2 186 THR n 
2 187 ASN n 
2 188 ILE n 
2 189 GLY n 
2 190 SER n 
2 191 ILE n 
2 192 HIS n 
2 193 ALA n 
2 194 HIS n 
2 195 TYR n 
2 196 LYS n 
2 197 ASP n 
2 198 PHE n 
2 199 VAL n 
2 200 GLU n 
2 201 GLY n 
2 202 LYS n 
2 203 GLY n 
2 204 ILE n 
2 205 PHE n 
2 206 ASP n 
2 207 SER n 
2 208 GLU n 
2 209 ASP n 
2 210 GLU n 
2 211 PHE n 
2 212 LEU n 
2 213 ASP n 
2 214 TYR n 
2 215 TRP n 
2 216 ARG n 
2 217 ASN n 
2 218 TYR n 
2 219 GLU n 
2 220 ARG n 
2 221 THR n 
2 222 SER n 
2 223 GLN n 
2 224 LEU n 
2 225 ARG n 
2 226 ASN n 
2 227 ASP n 
2 228 LYS n 
2 229 TYR n 
2 230 ASN n 
2 231 ASN n 
2 232 ILE n 
2 233 SER n 
2 234 GLU n 
2 235 TYR n 
2 236 ARG n 
2 237 ASN n 
2 238 TRP n 
2 239 ILE n 
2 240 TYR n 
2 241 ARG n 
2 242 GLY n 
2 243 ARG n 
2 244 LYS n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP T2E5_ECOLI 2 ? ? P04390 ? 
2 PDB 1BGB       1 ? ? 1BGB   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BGB A 1 ? 244 ? P04390 1   ? 244 ? 2   245 
2 1 1BGB B 1 ? 244 ? P04390 1   ? 244 ? 2   245 
3 2 1BGB C 1 ? 11  ? 1BGB   801 ? 811 ? 801 811 
4 2 1BGB D 1 ? 11  ? 1BGB   901 ? 911 ? 901 911 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1BGB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.18 
_exptl_crystal.density_percent_sol   43.63 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'CRYSTALLIZED FROM 15% PEG 4K, 100 MM IMIDAZOLE, (PH 6.5), 150 MM NACL., VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 IMIDAZOLE  ? ? ? 
1 2 1 NACL       ? ? ? 
1 3 1 'PEG 4000' ? ? ? 
1 4 2 'PEG 4000' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1997-08-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BGB 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   25665 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         85.0 
_reflns.pdbx_Rmerge_I_obs            0.0530000 
_reflns.pdbx_Rsym_value              0.0910000 
_reflns.pdbx_netI_over_sigmaI        10 
_reflns.B_iso_Wilson_estimate        28.2 
_reflns.pdbx_redundancy              2.2 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.2 
_reflns_shell.percent_possible_all   71 
_reflns_shell.Rmerge_I_obs           0.0770000 
_reflns_shell.pdbx_Rsym_value        0.2800000 
_reflns_shell.meanI_over_sigI_obs    2.8 
_reflns_shell.pdbx_redundancy        1.9 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1BGB 
_refine.ls_number_reflns_obs                     31018 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               100000. 
_refine.pdbx_data_cutoff_low_absF                0.1 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    88. 
_refine.ls_R_factor_obs                          0.1840000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1840000 
_refine.ls_R_factor_R_free                       0.2460000 
_refine.ls_R_factor_R_free_error                 0.017 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  1512 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               27.7 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'DIFFERENCE FOURIER' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1BGB 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.21 
_refine_analyze.Luzzati_d_res_low_obs           6.0 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            0.22 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3602 
_refine_hist.pdbx_number_atoms_nucleic_acid   426 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             236 
_refine_hist.number_atoms_total               4264 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.86  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      22.12 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.42  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.1 
_refine_ls_shell.d_res_low                        2.2 
_refine_ls_shell.number_reflns_R_work             1211 
_refine_ls_shell.R_factor_R_work                  0.2570000 
_refine_ls_shell.percent_reflns_obs               71. 
_refine_ls_shell.R_factor_R_free                  0.2860000 
_refine_ls_shell.R_factor_R_free_error            0.042 
_refine_ls_shell.percent_reflns_R_free            10.0 
_refine_ls_shell.number_reflns_R_free             112 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARNDBX.DNA0 TOPNDBX.DNA  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1BGB 
_struct.title                     
;ECORV ENDONUCLEASE COMPLEX WITH 5'-CGGGATATCCC DNA
;
_struct.pdbx_descriptor           'ECORV ENDONUCLEASE/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BGB 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'COMPLEX (ENDONUCLEASE-DNA), HYDROLASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU C 2   ? LYS C 16  ? LEU A 3   LYS A 17  1 ? 15 
HELX_P HELX_P2  2  THR C 36  ? LYS C 57  ? THR A 37  LYS A 58  1 ? 22 
HELX_P HELX_P3  3  PRO C 79  ? GLU C 81  ? PRO A 80  GLU A 82  5 ? 3  
HELX_P HELX_P4  4  PHE C 124 ? GLN C 126 ? PHE A 125 GLN A 127 5 ? 3  
HELX_P HELX_P5  5  ILE C 152 ? GLU C 154 ? ILE A 153 GLU A 155 5 ? 3  
HELX_P HELX_P6  6  LYS C 172 ? ILE C 175 ? LYS A 173 ILE A 176 1 ? 4  
HELX_P HELX_P7  7  TYR C 195 ? GLU C 200 ? TYR A 196 GLU A 201 1 ? 6  
HELX_P HELX_P8  8  GLU C 208 ? ARG C 216 ? GLU A 209 ARG A 217 1 ? 9  
HELX_P HELX_P9  9  SER C 222 ? ARG C 225 ? SER A 223 ARG A 226 1 ? 4  
HELX_P HELX_P10 10 ILE C 232 ? ARG C 241 ? ILE A 233 ARG A 242 1 ? 10 
HELX_P HELX_P11 11 LEU D 2   ? ALA D 9   ? LEU B 3   ALA B 10  1 ? 8  
HELX_P HELX_P12 12 THR D 36  ? LYS D 57  ? THR B 37  LYS B 58  1 ? 22 
HELX_P HELX_P13 13 PHE D 124 ? GLN D 126 ? PHE B 125 GLN B 127 5 ? 3  
HELX_P HELX_P14 14 LYS D 172 ? ILE D 175 ? LYS B 173 ILE B 176 1 ? 4  
HELX_P HELX_P15 15 TYR D 195 ? GLU D 200 ? TYR B 196 GLU B 201 1 ? 6  
HELX_P HELX_P16 16 GLU D 208 ? ARG D 216 ? GLU B 209 ARG B 217 1 ? 9  
HELX_P HELX_P17 17 SER D 222 ? ARG D 225 ? SER B 223 ARG B 226 1 ? 4  
HELX_P HELX_P18 18 ILE D 232 ? TYR D 240 ? ILE B 233 TYR B 241 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC 11 N3 ? ? C DG 802 D DC 911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC 11 O2 ? ? C DG 802 D DC 911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC 11 N4 ? ? C DG 802 D DC 911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 10 N3 ? ? C DG 803 D DC 910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 10 O2 ? ? C DG 803 D DC 910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 10 N4 ? ? C DG 803 D DC 910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC 9  N3 ? ? C DG 804 D DC 909 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC 9  O2 ? ? C DG 804 D DC 909 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC 9  N4 ? ? C DG 804 D DC 909 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 8  N3 ? ? C DA 805 D DT 908 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 8  O4 ? ? C DA 805 D DT 908 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 7  N1 ? ? C DT 806 D DA 907 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 7  N6 ? ? C DT 806 D DA 907 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 6  N3 ? ? C DA 807 D DT 906 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 6  O4 ? ? C DA 807 D DT 906 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 5  N1 ? ? C DT 808 D DA 905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 5  N6 ? ? C DT 808 D DA 905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 4  N1 ? ? C DC 809 D DG 904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG 4  O6 ? ? C DC 809 D DG 904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 4  N2 ? ? C DC 809 D DG 904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG 3  N1 ? ? C DC 810 D DG 903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG 3  O6 ? ? C DC 810 D DG 903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG 3  N2 ? ? C DC 810 D DG 903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DC 11 O2 ? ? ? 1_555 B DG 2  N2 ? ? C DC 811 D DG 902 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 71 C . ? TYR 72 A PRO 72 C ? PRO 73 A 1 0.34 
2 TYR 71 D . ? TYR 72 B PRO 72 D ? PRO 73 B 1 0.43 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 2 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY C 21  ? ILE C 23  ? GLY A 22  ILE A 24  
A 2 LYS C 28  ? PRO C 31  ? LYS A 29  PRO A 32  
A 3 THR C 149 ? ASN C 151 ? THR A 150 ASN A 152 
B 1 ILE C 61  ? GLU C 63  ? ILE A 62  GLU A 64  
B 2 PHE C 74  ? TYR C 77  ? PHE A 75  TYR A 78  
B 3 LYS C 85  ? THR C 95  ? LYS A 86  THR A 96  
B 4 TYR C 127 ? THR C 138 ? TYR A 128 THR A 139 
B 5 LYS C 166 ? ASP C 171 ? LYS A 167 ASP A 172 
C 1 LYS D 28  ? TYR D 30  ? LYS B 29  TYR B 31  
C 2 THR D 149 ? ASN D 151 ? THR B 150 ASN B 152 
D 1 ILE D 61  ? GLU D 63  ? ILE B 62  GLU B 64  
D 2 PHE D 74  ? TYR D 77  ? PHE B 75  TYR B 78  
D 3 LYS D 85  ? THR D 95  ? LYS B 86  THR B 96  
D 4 TYR D 127 ? ARG D 139 ? TYR B 128 ARG B 140 
D 5 TYR D 162 ? ASP D 171 ? TYR B 163 ASP B 172 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE C 22  ? O ILE A 23  N TYR C 30  ? N TYR A 31  
A 2 3 O ILE C 29  ? O ILE A 30  N TYR C 150 ? N TYR A 151 
B 1 2 O ILE C 61  ? O ILE A 62  N TYR C 77  ? N TYR A 78  
B 2 3 O PHE C 74  ? O PHE A 75  N ILE C 88  ? N ILE A 89  
B 3 4 O LYS C 85  ? O LYS A 86  N ILE C 128 ? N ILE A 129 
B 4 5 O ILE C 132 ? O ILE A 133 N GLN C 170 ? N GLN A 171 
C 1 2 O ILE D 29  ? O ILE B 30  N TYR D 150 ? N TYR B 151 
D 1 2 O ILE D 61  ? O ILE B 62  N TYR D 77  ? N TYR B 78  
D 2 3 O PHE D 74  ? O PHE B 75  N ILE D 88  ? N ILE B 89  
D 3 4 O LYS D 85  ? O LYS B 86  N ILE D 128 ? N ILE B 129 
D 4 5 O ILE D 132 ? O ILE B 133 N GLN D 170 ? N GLN B 171 
# 
_database_PDB_matrix.entry_id          1BGB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BGB 
_atom_sites.fract_transf_matrix[1][1]   0.020243 
_atom_sites.fract_transf_matrix[1][2]   0.006577 
_atom_sites.fract_transf_matrix[1][3]   0.008700 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020945 
_atom_sites.fract_transf_matrix[2][3]   0.004907 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016946 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DC  A 1 1   ? -22.151 1.048   8.457   1.00 60.33 ? 801 DC  C "O5'" 1 
ATOM   2    C "C5'" . DC  A 1 1   ? -23.390 0.444   8.894   1.00 54.58 ? 801 DC  C "C5'" 1 
ATOM   3    C "C4'" . DC  A 1 1   ? -23.763 -0.709  7.989   1.00 51.41 ? 801 DC  C "C4'" 1 
ATOM   4    O "O4'" . DC  A 1 1   ? -24.116 -0.192  6.689   1.00 45.63 ? 801 DC  C "O4'" 1 
ATOM   5    C "C3'" . DC  A 1 1   ? -22.667 -1.751  7.741   1.00 48.91 ? 801 DC  C "C3'" 1 
ATOM   6    O "O3'" . DC  A 1 1   ? -23.275 -3.049  7.634   1.00 49.05 ? 801 DC  C "O3'" 1 
ATOM   7    C "C2'" . DC  A 1 1   ? -22.057 -1.303  6.424   1.00 43.89 ? 801 DC  C "C2'" 1 
ATOM   8    C "C1'" . DC  A 1 1   ? -23.267 -0.742  5.698   1.00 42.18 ? 801 DC  C "C1'" 1 
ATOM   9    N N1    . DC  A 1 1   ? -23.014 0.316   4.716   1.00 39.75 ? 801 DC  C N1    1 
ATOM   10   C C2    . DC  A 1 1   ? -23.672 0.236   3.485   1.00 38.85 ? 801 DC  C C2    1 
ATOM   11   O O2    . DC  A 1 1   ? -24.403 -0.749  3.264   1.00 37.43 ? 801 DC  C O2    1 
ATOM   12   N N3    . DC  A 1 1   ? -23.512 1.233   2.578   1.00 36.90 ? 801 DC  C N3    1 
ATOM   13   C C4    . DC  A 1 1   ? -22.741 2.283   2.873   1.00 37.80 ? 801 DC  C C4    1 
ATOM   14   N N4    . DC  A 1 1   ? -22.681 3.276   1.977   1.00 33.78 ? 801 DC  C N4    1 
ATOM   15   C C5    . DC  A 1 1   ? -22.021 2.371   4.113   1.00 37.23 ? 801 DC  C C5    1 
ATOM   16   C C6    . DC  A 1 1   ? -22.183 1.369   4.993   1.00 37.03 ? 801 DC  C C6    1 
ATOM   17   P P     . DG  A 1 2   ? -22.376 -4.378  7.771   1.00 51.46 ? 802 DG  C P     1 
ATOM   18   O OP1   . DG  A 1 2   ? -23.184 -5.440  8.454   1.00 46.63 ? 802 DG  C OP1   1 
ATOM   19   O OP2   . DG  A 1 2   ? -21.044 -4.004  8.334   1.00 49.04 ? 802 DG  C OP2   1 
ATOM   20   O "O5'" . DG  A 1 2   ? -22.173 -4.832  6.249   1.00 47.45 ? 802 DG  C "O5'" 1 
ATOM   21   C "C5'" . DG  A 1 2   ? -23.307 -5.116  5.404   1.00 33.91 ? 802 DG  C "C5'" 1 
ATOM   22   C "C4'" . DG  A 1 2   ? -22.887 -5.233  3.955   1.00 31.10 ? 802 DG  C "C4'" 1 
ATOM   23   O "O4'" . DG  A 1 2   ? -22.418 -3.969  3.438   1.00 29.27 ? 802 DG  C "O4'" 1 
ATOM   24   C "C3'" . DG  A 1 2   ? -21.802 -6.246  3.608   1.00 26.95 ? 802 DG  C "C3'" 1 
ATOM   25   O "O3'" . DG  A 1 2   ? -22.091 -6.739  2.304   1.00 37.62 ? 802 DG  C "O3'" 1 
ATOM   26   C "C2'" . DG  A 1 2   ? -20.560 -5.392  3.507   1.00 23.27 ? 802 DG  C "C2'" 1 
ATOM   27   C "C1'" . DG  A 1 2   ? -21.109 -4.114  2.903   1.00 22.24 ? 802 DG  C "C1'" 1 
ATOM   28   N N9    . DG  A 1 2   ? -20.366 -2.907  3.252   1.00 22.60 ? 802 DG  C N9    1 
ATOM   29   C C8    . DG  A 1 2   ? -19.681 -2.663  4.421   1.00 17.91 ? 802 DG  C C8    1 
ATOM   30   N N7    . DG  A 1 2   ? -19.168 -1.463  4.467   1.00 20.22 ? 802 DG  C N7    1 
ATOM   31   C C5    . DG  A 1 2   ? -19.519 -0.880  3.249   1.00 20.51 ? 802 DG  C C5    1 
ATOM   32   C C6    . DG  A 1 2   ? -19.244 0.423   2.725   1.00 23.22 ? 802 DG  C C6    1 
ATOM   33   O O6    . DG  A 1 2   ? -18.618 1.351   3.243   1.00 24.22 ? 802 DG  C O6    1 
ATOM   34   N N1    . DG  A 1 2   ? -19.786 0.593   1.466   1.00 22.75 ? 802 DG  C N1    1 
ATOM   35   C C2    . DG  A 1 2   ? -20.505 -0.362  0.783   1.00 28.29 ? 802 DG  C C2    1 
ATOM   36   N N2    . DG  A 1 2   ? -20.964 -0.008  -0.439  1.00 30.08 ? 802 DG  C N2    1 
ATOM   37   N N3    . DG  A 1 2   ? -20.763 -1.573  1.253   1.00 23.50 ? 802 DG  C N3    1 
ATOM   38   C C4    . DG  A 1 2   ? -20.247 -1.763  2.483   1.00 23.23 ? 802 DG  C C4    1 
ATOM   39   P P     . DG  A 1 3   ? -21.721 -8.251  1.914   1.00 43.77 ? 803 DG  C P     1 
ATOM   40   O OP1   . DG  A 1 3   ? -22.997 -9.010  1.841   1.00 42.97 ? 803 DG  C OP1   1 
ATOM   41   O OP2   . DG  A 1 3   ? -20.659 -8.706  2.837   1.00 45.74 ? 803 DG  C OP2   1 
ATOM   42   O "O5'" . DG  A 1 3   ? -21.132 -8.126  0.439   1.00 38.67 ? 803 DG  C "O5'" 1 
ATOM   43   C "C5'" . DG  A 1 3   ? -21.907 -7.489  -0.563  1.00 30.85 ? 803 DG  C "C5'" 1 
ATOM   44   C "C4'" . DG  A 1 3   ? -21.034 -6.657  -1.470  1.00 30.66 ? 803 DG  C "C4'" 1 
ATOM   45   O "O4'" . DG  A 1 3   ? -20.493 -5.472  -0.816  1.00 25.98 ? 803 DG  C "O4'" 1 
ATOM   46   C "C3'" . DG  A 1 3   ? -19.855 -7.389  -2.095  1.00 30.90 ? 803 DG  C "C3'" 1 
ATOM   47   O "O3'" . DG  A 1 3   ? -20.043 -7.394  -3.505  1.00 32.77 ? 803 DG  C "O3'" 1 
ATOM   48   C "C2'" . DG  A 1 3   ? -18.632 -6.562  -1.686  1.00 26.72 ? 803 DG  C "C2'" 1 
ATOM   49   C "C1'" . DG  A 1 3   ? -19.205 -5.199  -1.334  1.00 22.24 ? 803 DG  C "C1'" 1 
ATOM   50   N N9    . DG  A 1 3   ? -18.451 -4.494  -0.297  1.00 21.18 ? 803 DG  C N9    1 
ATOM   51   C C8    . DG  A 1 3   ? -18.063 -5.004  0.919   1.00 24.57 ? 803 DG  C C8    1 
ATOM   52   N N7    . DG  A 1 3   ? -17.389 -4.145  1.650   1.00 22.15 ? 803 DG  C N7    1 
ATOM   53   C C5    . DG  A 1 3   ? -17.326 -3.003  0.866   1.00 20.33 ? 803 DG  C C5    1 
ATOM   54   C C6    . DG  A 1 3   ? -16.705 -1.740  1.118   1.00 19.51 ? 803 DG  C C6    1 
ATOM   55   O O6    . DG  A 1 3   ? -16.066 -1.381  2.107   1.00 18.46 ? 803 DG  C O6    1 
ATOM   56   N N1    . DG  A 1 3   ? -16.883 -0.860  0.061   1.00 14.69 ? 803 DG  C N1    1 
ATOM   57   C C2    . DG  A 1 3   ? -17.564 -1.158  -1.096  1.00 18.94 ? 803 DG  C C2    1 
ATOM   58   N N2    . DG  A 1 3   ? -17.647 -0.180  -1.988  1.00 20.66 ? 803 DG  C N2    1 
ATOM   59   N N3    . DG  A 1 3   ? -18.133 -2.332  -1.356  1.00 16.36 ? 803 DG  C N3    1 
ATOM   60   C C4    . DG  A 1 3   ? -17.981 -3.198  -0.343  1.00 19.40 ? 803 DG  C C4    1 
ATOM   61   P P     . DG  A 1 4   ? -18.970 -8.104  -4.446  1.00 32.79 ? 804 DG  C P     1 
ATOM   62   O OP1   . DG  A 1 4   ? -19.678 -8.382  -5.725  1.00 42.94 ? 804 DG  C OP1   1 
ATOM   63   O OP2   . DG  A 1 4   ? -18.217 -9.180  -3.759  1.00 27.79 ? 804 DG  C OP2   1 
ATOM   64   O "O5'" . DG  A 1 4   ? -17.932 -6.943  -4.742  1.00 33.78 ? 804 DG  C "O5'" 1 
ATOM   65   C "C5'" . DG  A 1 4   ? -18.387 -5.679  -5.228  1.00 28.08 ? 804 DG  C "C5'" 1 
ATOM   66   C "C4'" . DG  A 1 4   ? -17.231 -4.714  -5.263  1.00 25.61 ? 804 DG  C "C4'" 1 
ATOM   67   O "O4'" . DG  A 1 4   ? -16.848 -4.393  -3.903  1.00 20.83 ? 804 DG  C "O4'" 1 
ATOM   68   C "C3'" . DG  A 1 4   ? -15.969 -5.285  -5.933  1.00 23.37 ? 804 DG  C "C3'" 1 
ATOM   69   O "O3'" . DG  A 1 4   ? -15.310 -4.244  -6.653  1.00 18.45 ? 804 DG  C "O3'" 1 
ATOM   70   C "C2'" . DG  A 1 4   ? -15.096 -5.668  -4.746  1.00 16.31 ? 804 DG  C "C2'" 1 
ATOM   71   C "C1'" . DG  A 1 4   ? -15.437 -4.499  -3.850  1.00 20.27 ? 804 DG  C "C1'" 1 
ATOM   72   N N9    . DG  A 1 4   ? -15.011 -4.540  -2.455  1.00 16.57 ? 804 DG  C N9    1 
ATOM   73   C C8    . DG  A 1 4   ? -14.962 -5.617  -1.619  1.00 19.39 ? 804 DG  C C8    1 
ATOM   74   N N7    . DG  A 1 4   ? -14.463 -5.326  -0.448  1.00 17.06 ? 804 DG  C N7    1 
ATOM   75   C C5    . DG  A 1 4   ? -14.201 -3.971  -0.528  1.00 18.38 ? 804 DG  C C5    1 
ATOM   76   C C6    . DG  A 1 4   ? -13.683 -3.064  0.448   1.00 19.50 ? 804 DG  C C6    1 
ATOM   77   O O6    . DG  A 1 4   ? -13.355 -3.294  1.621   1.00 22.27 ? 804 DG  C O6    1 
ATOM   78   N N1    . DG  A 1 4   ? -13.578 -1.777  -0.054  1.00 15.79 ? 804 DG  C N1    1 
ATOM   79   C C2    . DG  A 1 4   ? -13.931 -1.395  -1.316  1.00 16.74 ? 804 DG  C C2    1 
ATOM   80   N N2    . DG  A 1 4   ? -13.721 -0.103  -1.623  1.00 15.81 ? 804 DG  C N2    1 
ATOM   81   N N3    . DG  A 1 4   ? -14.444 -2.217  -2.216  1.00 16.31 ? 804 DG  C N3    1 
ATOM   82   C C4    . DG  A 1 4   ? -14.545 -3.474  -1.758  1.00 13.01 ? 804 DG  C C4    1 
ATOM   83   P P     . DA  A 1 5   ? -15.404 -4.172  -8.258  1.00 16.74 ? 805 DA  C P     1 
ATOM   84   O OP1   . DA  A 1 5   ? -16.753 -3.691  -8.630  1.00 15.16 ? 805 DA  C OP1   1 
ATOM   85   O OP2   . DA  A 1 5   ? -14.836 -5.413  -8.873  1.00 14.93 ? 805 DA  C OP2   1 
ATOM   86   O "O5'" . DA  A 1 5   ? -14.367 -3.040  -8.607  1.00 16.80 ? 805 DA  C "O5'" 1 
ATOM   87   C "C5'" . DA  A 1 5   ? -13.024 -3.211  -8.281  1.00 13.56 ? 805 DA  C "C5'" 1 
ATOM   88   C "C4'" . DA  A 1 5   ? -12.480 -1.901  -7.795  1.00 16.79 ? 805 DA  C "C4'" 1 
ATOM   89   O "O4'" . DA  A 1 5   ? -12.934 -1.696  -6.437  1.00 20.28 ? 805 DA  C "O4'" 1 
ATOM   90   C "C3'" . DA  A 1 5   ? -10.966 -1.857  -7.749  1.00 18.18 ? 805 DA  C "C3'" 1 
ATOM   91   O "O3'" . DA  A 1 5   ? -10.477 -1.105  -8.823  1.00 17.57 ? 805 DA  C "O3'" 1 
ATOM   92   C "C2'" . DA  A 1 5   ? -10.638 -1.151  -6.449  1.00 19.51 ? 805 DA  C "C2'" 1 
ATOM   93   C "C1'" . DA  A 1 5   ? -11.913 -1.108  -5.636  1.00 19.15 ? 805 DA  C "C1'" 1 
ATOM   94   N N9    . DA  A 1 5   ? -11.686 -1.981  -4.479  1.00 18.79 ? 805 DA  C N9    1 
ATOM   95   C C8    . DA  A 1 5   ? -12.103 -3.281  -4.323  1.00 14.88 ? 805 DA  C C8    1 
ATOM   96   N N7    . DA  A 1 5   ? -11.702 -3.835  -3.203  1.00 17.89 ? 805 DA  C N7    1 
ATOM   97   C C5    . DA  A 1 5   ? -10.991 -2.834  -2.566  1.00 16.06 ? 805 DA  C C5    1 
ATOM   98   C C6    . DA  A 1 5   ? -10.310 -2.798  -1.355  1.00 14.84 ? 805 DA  C C6    1 
ATOM   99   N N6    . DA  A 1 5   ? -10.256 -3.839  -0.518  1.00 9.87  ? 805 DA  C N6    1 
ATOM   100  N N1    . DA  A 1 5   ? -9.664  -1.651  -1.024  1.00 18.30 ? 805 DA  C N1    1 
ATOM   101  C C2    . DA  A 1 5   ? -9.722  -0.613  -1.864  1.00 15.54 ? 805 DA  C C2    1 
ATOM   102  N N3    . DA  A 1 5   ? -10.346 -0.520  -3.040  1.00 16.25 ? 805 DA  C N3    1 
ATOM   103  C C4    . DA  A 1 5   ? -10.970 -1.680  -3.338  1.00 17.00 ? 805 DA  C C4    1 
ATOM   104  P P     . DT  A 1 6   ? -9.028  -1.410  -9.368  1.00 14.62 ? 806 DT  C P     1 
ATOM   105  O OP1   . DT  A 1 6   ? -8.931  -0.902  -10.765 1.00 24.98 ? 806 DT  C OP1   1 
ATOM   106  O OP2   . DT  A 1 6   ? -8.729  -2.817  -9.077  1.00 16.21 ? 806 DT  C OP2   1 
ATOM   107  O "O5'" . DT  A 1 6   ? -8.076  -0.551  -8.427  1.00 21.14 ? 806 DT  C "O5'" 1 
ATOM   108  C "C5'" . DT  A 1 6   ? -8.322  0.848   -8.206  1.00 23.77 ? 806 DT  C "C5'" 1 
ATOM   109  C "C4'" . DT  A 1 6   ? -7.244  1.407   -7.313  1.00 24.48 ? 806 DT  C "C4'" 1 
ATOM   110  O "O4'" . DT  A 1 6   ? -7.628  1.160   -5.941  1.00 19.00 ? 806 DT  C "O4'" 1 
ATOM   111  C "C3'" . DT  A 1 6   ? -5.954  0.624   -7.510  1.00 25.86 ? 806 DT  C "C3'" 1 
ATOM   112  O "O3'" . DT  A 1 6   ? -4.940  1.287   -8.216  1.00 30.74 ? 806 DT  C "O3'" 1 
ATOM   113  C "C2'" . DT  A 1 6   ? -5.449  0.303   -6.120  1.00 23.14 ? 806 DT  C "C2'" 1 
ATOM   114  C "C1'" . DT  A 1 6   ? -6.502  0.782   -5.159  1.00 20.81 ? 806 DT  C "C1'" 1 
ATOM   115  N N1    . DT  A 1 6   ? -6.845  -0.433  -4.436  1.00 23.00 ? 806 DT  C N1    1 
ATOM   116  C C2    . DT  A 1 6   ? -6.447  -0.584  -3.132  1.00 23.36 ? 806 DT  C C2    1 
ATOM   117  O O2    . DT  A 1 6   ? -5.887  0.285   -2.506  1.00 27.30 ? 806 DT  C O2    1 
ATOM   118  N N3    . DT  A 1 6   ? -6.704  -1.815  -2.592  1.00 21.67 ? 806 DT  C N3    1 
ATOM   119  C C4    . DT  A 1 6   ? -7.276  -2.890  -3.230  1.00 22.08 ? 806 DT  C C4    1 
ATOM   120  O O4    . DT  A 1 6   ? -7.375  -3.955  -2.642  1.00 18.63 ? 806 DT  C O4    1 
ATOM   121  C C5    . DT  A 1 6   ? -7.704  -2.656  -4.602  1.00 20.52 ? 806 DT  C C5    1 
ATOM   122  C C7    . DT  A 1 6   ? -8.327  -3.762  -5.386  1.00 19.81 ? 806 DT  C C7    1 
ATOM   123  C C6    . DT  A 1 6   ? -7.494  -1.441  -5.109  1.00 21.72 ? 806 DT  C C6    1 
ATOM   124  P P     . DA  A 1 7   ? -3.923  0.399   -9.071  1.00 23.24 ? 807 DA  C P     1 
ATOM   125  O OP1   . DA  A 1 7   ? -3.300  1.284   -10.075 1.00 35.83 ? 807 DA  C OP1   1 
ATOM   126  O OP2   . DA  A 1 7   ? -4.692  -0.791  -9.515  1.00 35.09 ? 807 DA  C OP2   1 
ATOM   127  O "O5'" . DA  A 1 7   ? -2.855  -0.150  -8.015  1.00 33.92 ? 807 DA  C "O5'" 1 
ATOM   128  C "C5'" . DA  A 1 7   ? -1.988  0.746   -7.265  1.00 28.53 ? 807 DA  C "C5'" 1 
ATOM   129  C "C4'" . DA  A 1 7   ? -0.942  -0.043  -6.506  1.00 24.61 ? 807 DA  C "C4'" 1 
ATOM   130  O "O4'" . DA  A 1 7   ? -1.524  -0.717  -5.363  1.00 23.38 ? 807 DA  C "O4'" 1 
ATOM   131  C "C3'" . DA  A 1 7   ? -0.183  -1.121  -7.283  1.00 23.84 ? 807 DA  C "C3'" 1 
ATOM   132  O "O3'" . DA  A 1 7   ? 1.157   -1.111  -6.813  1.00 23.56 ? 807 DA  C "O3'" 1 
ATOM   133  C "C2'" . DA  A 1 7   ? -0.841  -2.413  -6.831  1.00 20.15 ? 807 DA  C "C2'" 1 
ATOM   134  C "C1'" . DA  A 1 7   ? -1.154  -2.096  -5.376  1.00 22.81 ? 807 DA  C "C1'" 1 
ATOM   135  N N9    . DA  A 1 7   ? -2.256  -2.873  -4.781  1.00 21.35 ? 807 DA  C N9    1 
ATOM   136  C C8    . DA  A 1 7   ? -3.572  -2.928  -5.179  1.00 19.21 ? 807 DA  C C8    1 
ATOM   137  N N7    . DA  A 1 7   ? -4.312  -3.730  -4.450  1.00 14.72 ? 807 DA  C N7    1 
ATOM   138  C C5    . DA  A 1 7   ? -3.432  -4.229  -3.506  1.00 17.76 ? 807 DA  C C5    1 
ATOM   139  C C6    . DA  A 1 7   ? -3.601  -5.139  -2.446  1.00 14.19 ? 807 DA  C C6    1 
ATOM   140  N N6    . DA  A 1 7   ? -4.767  -5.699  -2.139  1.00 16.07 ? 807 DA  C N6    1 
ATOM   141  N N1    . DA  A 1 7   ? -2.517  -5.450  -1.702  1.00 12.13 ? 807 DA  C N1    1 
ATOM   142  C C2    . DA  A 1 7   ? -1.349  -4.867  -1.994  1.00 15.30 ? 807 DA  C C2    1 
ATOM   143  N N3    . DA  A 1 7   ? -1.060  -3.990  -2.956  1.00 20.07 ? 807 DA  C N3    1 
ATOM   144  C C4    . DA  A 1 7   ? -2.160  -3.713  -3.694  1.00 21.57 ? 807 DA  C C4    1 
ATOM   145  P P     . DT  A 1 8   ? 2.319   -1.791  -7.680  1.00 27.68 ? 808 DT  C P     1 
ATOM   146  O OP1   . DT  A 1 8   ? 3.489   -0.825  -7.693  1.00 22.51 ? 808 DT  C OP1   1 
ATOM   147  O OP2   . DT  A 1 8   ? 1.753   -2.288  -8.949  1.00 29.11 ? 808 DT  C OP2   1 
ATOM   148  O "O5'" . DT  A 1 8   ? 2.680   -3.109  -6.867  1.00 31.20 ? 808 DT  C "O5'" 1 
ATOM   149  C "C5'" . DT  A 1 8   ? 3.009   -3.053  -5.474  1.00 22.31 ? 808 DT  C "C5'" 1 
ATOM   150  C "C4'" . DT  A 1 8   ? 3.008   -4.442  -4.889  1.00 16.77 ? 808 DT  C "C4'" 1 
ATOM   151  O "O4'" . DT  A 1 8   ? 1.673   -4.908  -4.586  1.00 16.25 ? 808 DT  C "O4'" 1 
ATOM   152  C "C3'" . DT  A 1 8   ? 3.669   -5.561  -5.696  1.00 17.30 ? 808 DT  C "C3'" 1 
ATOM   153  O "O3'" . DT  A 1 8   ? 4.630   -6.136  -4.833  1.00 17.72 ? 808 DT  C "O3'" 1 
ATOM   154  C "C2'" . DT  A 1 8   ? 2.540   -6.563  -5.900  1.00 16.40 ? 808 DT  C "C2'" 1 
ATOM   155  C "C1'" . DT  A 1 8   ? 1.715   -6.302  -4.659  1.00 12.93 ? 808 DT  C "C1'" 1 
ATOM   156  N N1    . DT  A 1 8   ? 0.342   -6.806  -4.623  1.00 16.85 ? 808 DT  C N1    1 
ATOM   157  C C2    . DT  A 1 8   ? 0.029   -7.740  -3.662  1.00 16.32 ? 808 DT  C C2    1 
ATOM   158  O O2    . DT  A 1 8   ? 0.831   -8.168  -2.861  1.00 19.06 ? 808 DT  C O2    1 
ATOM   159  N N3    . DT  A 1 8   ? -1.259  -8.184  -3.683  1.00 19.44 ? 808 DT  C N3    1 
ATOM   160  C C4    . DT  A 1 8   ? -2.253  -7.821  -4.556  1.00 17.54 ? 808 DT  C C4    1 
ATOM   161  O O4    . DT  A 1 8   ? -3.362  -8.329  -4.445  1.00 19.57 ? 808 DT  C O4    1 
ATOM   162  C C5    . DT  A 1 8   ? -1.871  -6.835  -5.556  1.00 19.04 ? 808 DT  C C5    1 
ATOM   163  C C7    . DT  A 1 8   ? -2.882  -6.387  -6.571  1.00 15.93 ? 808 DT  C C7    1 
ATOM   164  C C6    . DT  A 1 8   ? -0.607  -6.375  -5.529  1.00 18.35 ? 808 DT  C C6    1 
ATOM   165  P P     . DC  A 1 9   ? 5.641   -7.245  -5.349  1.00 17.91 ? 809 DC  C P     1 
ATOM   166  O OP1   . DC  A 1 9   ? 6.991   -6.661  -5.185  1.00 14.76 ? 809 DC  C OP1   1 
ATOM   167  O OP2   . DC  A 1 9   ? 5.228   -7.792  -6.665  1.00 23.20 ? 809 DC  C OP2   1 
ATOM   168  O "O5'" . DC  A 1 9   ? 5.421   -8.380  -4.263  1.00 20.90 ? 809 DC  C "O5'" 1 
ATOM   169  C "C5'" . DC  A 1 9   ? 4.983   -8.010  -2.949  1.00 16.32 ? 809 DC  C "C5'" 1 
ATOM   170  C "C4'" . DC  A 1 9   ? 4.457   -9.207  -2.205  1.00 22.94 ? 809 DC  C "C4'" 1 
ATOM   171  O "O4'" . DC  A 1 9   ? 3.065   -9.444  -2.509  1.00 22.58 ? 809 DC  C "O4'" 1 
ATOM   172  C "C3'" . DC  A 1 9   ? 5.188   -10.514 -2.478  1.00 27.65 ? 809 DC  C "C3'" 1 
ATOM   173  O "O3'" . DC  A 1 9   ? 5.633   -11.087 -1.269  1.00 34.95 ? 809 DC  C "O3'" 1 
ATOM   174  C "C2'" . DC  A 1 9   ? 4.133   -11.424 -3.089  1.00 26.34 ? 809 DC  C "C2'" 1 
ATOM   175  C "C1'" . DC  A 1 9   ? 2.830   -10.840 -2.589  1.00 23.90 ? 809 DC  C "C1'" 1 
ATOM   176  N N1    . DC  A 1 9   ? 1.706   -11.041 -3.522  1.00 26.90 ? 809 DC  C N1    1 
ATOM   177  C C2    . DC  A 1 9   ? 0.533   -11.664 -3.062  1.00 22.14 ? 809 DC  C C2    1 
ATOM   178  O O2    . DC  A 1 9   ? 0.497   -12.123 -1.906  1.00 13.94 ? 809 DC  C O2    1 
ATOM   179  N N3    . DC  A 1 9   ? -0.519  -11.765 -3.907  1.00 18.67 ? 809 DC  C N3    1 
ATOM   180  C C4    . DC  A 1 9   ? -0.415  -11.333 -5.175  1.00 18.36 ? 809 DC  C C4    1 
ATOM   181  N N4    . DC  A 1 9   ? -1.468  -11.470 -5.965  1.00 17.01 ? 809 DC  C N4    1 
ATOM   182  C C5    . DC  A 1 9   ? 0.775   -10.748 -5.678  1.00 21.05 ? 809 DC  C C5    1 
ATOM   183  C C6    . DC  A 1 9   ? 1.798   -10.612 -4.824  1.00 24.34 ? 809 DC  C C6    1 
ATOM   184  P P     . DC  A 1 10  ? 6.666   -12.303 -1.329  1.00 41.79 ? 810 DC  C P     1 
ATOM   185  O OP1   . DC  A 1 10  ? 7.810   -11.882 -0.462  1.00 46.22 ? 810 DC  C OP1   1 
ATOM   186  O OP2   . DC  A 1 10  ? 6.898   -12.688 -2.767  1.00 42.28 ? 810 DC  C OP2   1 
ATOM   187  O "O5'" . DC  A 1 10  ? 5.852   -13.504 -0.667  1.00 45.35 ? 810 DC  C "O5'" 1 
ATOM   188  C "C5'" . DC  A 1 10  ? 5.045   -13.288 0.506   1.00 46.08 ? 810 DC  C "C5'" 1 
ATOM   189  C "C4'" . DC  A 1 10  ? 4.159   -14.484 0.777   1.00 46.56 ? 810 DC  C "C4'" 1 
ATOM   190  O "O4'" . DC  A 1 10  ? 2.987   -14.451 -0.062  1.00 40.67 ? 810 DC  C "O4'" 1 
ATOM   191  C "C3'" . DC  A 1 10  ? 4.795   -15.859 0.582   1.00 47.54 ? 810 DC  C "C3'" 1 
ATOM   192  O "O3'" . DC  A 1 10  ? 4.458   -16.683 1.694   1.00 57.00 ? 810 DC  C "O3'" 1 
ATOM   193  C "C2'" . DC  A 1 10  ? 4.131   -16.387 -0.680  1.00 42.11 ? 810 DC  C "C2'" 1 
ATOM   194  C "C1'" . DC  A 1 10  ? 2.772   -15.716 -0.656  1.00 40.40 ? 810 DC  C "C1'" 1 
ATOM   195  N N1    . DC  A 1 10  ? 2.192   -15.478 -1.987  1.00 42.30 ? 810 DC  C N1    1 
ATOM   196  C C2    . DC  A 1 10  ? 0.918   -16.011 -2.304  1.00 40.21 ? 810 DC  C C2    1 
ATOM   197  O O2    . DC  A 1 10  ? 0.300   -16.656 -1.455  1.00 36.90 ? 810 DC  C O2    1 
ATOM   198  N N3    . DC  A 1 10  ? 0.403   -15.801 -3.538  1.00 42.49 ? 810 DC  C N3    1 
ATOM   199  C C4    . DC  A 1 10  ? 1.094   -15.094 -4.437  1.00 42.11 ? 810 DC  C C4    1 
ATOM   200  N N4    . DC  A 1 10  ? 0.552   -14.926 -5.642  1.00 41.52 ? 810 DC  C N4    1 
ATOM   201  C C5    . DC  A 1 10  ? 2.372   -14.531 -4.139  1.00 41.51 ? 810 DC  C C5    1 
ATOM   202  C C6    . DC  A 1 10  ? 2.880   -14.747 -2.916  1.00 42.63 ? 810 DC  C C6    1 
ATOM   203  P P     . DC  A 1 11  ? 5.366   -17.961 2.050   1.00 61.97 ? 811 DC  C P     1 
ATOM   204  O OP1   . DC  A 1 11  ? 6.028   -17.696 3.350   1.00 61.42 ? 811 DC  C OP1   1 
ATOM   205  O OP2   . DC  A 1 11  ? 6.196   -18.262 0.854   1.00 61.78 ? 811 DC  C OP2   1 
ATOM   206  O "O5'" . DC  A 1 11  ? 4.278   -19.110 2.279   1.00 63.43 ? 811 DC  C "O5'" 1 
ATOM   207  C "C5'" . DC  A 1 11  ? 3.160   -18.878 3.173   1.00 66.00 ? 811 DC  C "C5'" 1 
ATOM   208  C "C4'" . DC  A 1 11  ? 1.915   -19.587 2.689   1.00 68.26 ? 811 DC  C "C4'" 1 
ATOM   209  O "O4'" . DC  A 1 11  ? 1.626   -19.201 1.319   1.00 68.53 ? 811 DC  C "O4'" 1 
ATOM   210  C "C3'" . DC  A 1 11  ? 2.001   -21.113 2.676   1.00 69.88 ? 811 DC  C "C3'" 1 
ATOM   211  O "O3'" . DC  A 1 11  ? 0.689   -21.672 2.805   1.00 68.79 ? 811 DC  C "O3'" 1 
ATOM   212  C "C2'" . DC  A 1 11  ? 2.416   -21.412 1.249   1.00 70.79 ? 811 DC  C "C2'" 1 
ATOM   213  C "C1'" . DC  A 1 11  ? 1.626   -20.358 0.489   1.00 68.19 ? 811 DC  C "C1'" 1 
ATOM   214  N N1    . DC  A 1 11  ? 2.202   -19.986 -0.813  1.00 65.08 ? 811 DC  C N1    1 
ATOM   215  C C2    . DC  A 1 11  ? 1.342   -19.553 -1.826  1.00 64.32 ? 811 DC  C C2    1 
ATOM   216  O O2    . DC  A 1 11  ? 0.119   -19.531 -1.608  1.00 63.93 ? 811 DC  C O2    1 
ATOM   217  N N3    . DC  A 1 11  ? 1.860   -19.172 -3.016  1.00 62.21 ? 811 DC  C N3    1 
ATOM   218  C C4    . DC  A 1 11  ? 3.178   -19.220 -3.211  1.00 59.95 ? 811 DC  C C4    1 
ATOM   219  N N4    . DC  A 1 11  ? 3.645   -18.803 -4.386  1.00 59.42 ? 811 DC  C N4    1 
ATOM   220  C C5    . DC  A 1 11  ? 4.074   -19.686 -2.204  1.00 60.29 ? 811 DC  C C5    1 
ATOM   221  C C6    . DC  A 1 11  ? 3.550   -20.055 -1.033  1.00 61.56 ? 811 DC  C C6    1 
ATOM   222  P P     . DG  B 1 2   ? -4.592  -21.052 -12.687 1.00 65.43 ? 902 DG  D P     1 
ATOM   223  O OP1   . DG  B 1 2   ? -3.144  -21.066 -12.990 1.00 66.68 ? 902 DG  D OP1   1 
ATOM   224  O OP2   . DG  B 1 2   ? -5.484  -20.039 -13.326 1.00 61.99 ? 902 DG  D OP2   1 
ATOM   225  O "O5'" . DG  B 1 2   ? -4.778  -21.016 -11.105 1.00 60.99 ? 902 DG  D "O5'" 1 
ATOM   226  C "C5'" . DG  B 1 2   ? -5.396  -22.121 -10.415 1.00 52.71 ? 902 DG  D "C5'" 1 
ATOM   227  C "C4'" . DG  B 1 2   ? -5.841  -21.708 -9.030  1.00 47.17 ? 902 DG  D "C4'" 1 
ATOM   228  O "O4'" . DG  B 1 2   ? -4.696  -21.280 -8.268  1.00 43.58 ? 902 DG  D "O4'" 1 
ATOM   229  C "C3'" . DG  B 1 2   ? -6.854  -20.567 -8.927  1.00 47.93 ? 902 DG  D "C3'" 1 
ATOM   230  O "O3'" . DG  B 1 2   ? -7.734  -20.842 -7.839  1.00 51.14 ? 902 DG  D "O3'" 1 
ATOM   231  C "C2'" . DG  B 1 2   ? -6.002  -19.355 -8.591  1.00 43.63 ? 902 DG  D "C2'" 1 
ATOM   232  C "C1'" . DG  B 1 2   ? -4.903  -19.972 -7.755  1.00 38.14 ? 902 DG  D "C1'" 1 
ATOM   233  N N9    . DG  B 1 2   ? -3.620  -19.288 -7.803  1.00 31.29 ? 902 DG  D N9    1 
ATOM   234  C C8    . DG  B 1 2   ? -3.114  -18.486 -8.796  1.00 25.10 ? 902 DG  D C8    1 
ATOM   235  N N7    . DG  B 1 2   ? -1.913  -18.045 -8.534  1.00 25.35 ? 902 DG  D N7    1 
ATOM   236  C C5    . DG  B 1 2   ? -1.620  -18.578 -7.280  1.00 26.98 ? 902 DG  D C5    1 
ATOM   237  C C6    . DG  B 1 2   ? -0.479  -18.430 -6.457  1.00 27.35 ? 902 DG  D C6    1 
ATOM   238  O O6    . DG  B 1 2   ? 0.552   -17.803 -6.687  1.00 30.65 ? 902 DG  D O6    1 
ATOM   239  N N1    . DG  B 1 2   ? -0.614  -19.122 -5.258  1.00 27.20 ? 902 DG  D N1    1 
ATOM   240  C C2    . DG  B 1 2   ? -1.702  -19.892 -4.909  1.00 29.35 ? 902 DG  D C2    1 
ATOM   241  N N2    . DG  B 1 2   ? -1.658  -20.513 -3.723  1.00 32.04 ? 902 DG  D N2    1 
ATOM   242  N N3    . DG  B 1 2   ? -2.762  -20.046 -5.668  1.00 28.53 ? 902 DG  D N3    1 
ATOM   243  C C4    . DG  B 1 2   ? -2.661  -19.355 -6.827  1.00 31.19 ? 902 DG  D C4    1 
ATOM   244  P P     . DG  B 1 3   ? -9.156  -20.100 -7.749  1.00 55.24 ? 903 DG  D P     1 
ATOM   245  O OP1   . DG  B 1 3   ? -10.242 -21.013 -8.256  1.00 54.55 ? 903 DG  D OP1   1 
ATOM   246  O OP2   . DG  B 1 3   ? -8.995  -18.750 -8.359  1.00 56.09 ? 903 DG  D OP2   1 
ATOM   247  O "O5'" . DG  B 1 3   ? -9.334  -19.931 -6.177  1.00 52.47 ? 903 DG  D "O5'" 1 
ATOM   248  C "C5'" . DG  B 1 3   ? -8.875  -20.963 -5.289  1.00 46.23 ? 903 DG  D "C5'" 1 
ATOM   249  C "C4'" . DG  B 1 3   ? -8.272  -20.370 -4.036  1.00 38.66 ? 903 DG  D "C4'" 1 
ATOM   250  O "O4'" . DG  B 1 3   ? -6.960  -19.812 -4.292  1.00 35.02 ? 903 DG  D "O4'" 1 
ATOM   251  C "C3'" . DG  B 1 3   ? -9.081  -19.274 -3.335  1.00 36.16 ? 903 DG  D "C3'" 1 
ATOM   252  O "O3'" . DG  B 1 3   ? -9.017  -19.523 -1.941  1.00 36.23 ? 903 DG  D "O3'" 1 
ATOM   253  C "C2'" . DG  B 1 3   ? -8.304  -18.008 -3.649  1.00 32.70 ? 903 DG  D "C2'" 1 
ATOM   254  C "C1'" . DG  B 1 3   ? -6.878  -18.531 -3.681  1.00 28.42 ? 903 DG  D "C1'" 1 
ATOM   255  N N9    . DG  B 1 3   ? -5.946  -17.719 -4.455  1.00 25.29 ? 903 DG  D N9    1 
ATOM   256  C C8    . DG  B 1 3   ? -6.167  -17.140 -5.685  1.00 23.05 ? 903 DG  D C8    1 
ATOM   257  N N7    . DG  B 1 3   ? -5.143  -16.453 -6.117  1.00 25.74 ? 903 DG  D N7    1 
ATOM   258  C C5    . DG  B 1 3   ? -4.185  -16.587 -5.112  1.00 23.15 ? 903 DG  D C5    1 
ATOM   259  C C6    . DG  B 1 3   ? -2.850  -16.067 -5.007  1.00 17.25 ? 903 DG  D C6    1 
ATOM   260  O O6    . DG  B 1 3   ? -2.248  -15.302 -5.771  1.00 19.16 ? 903 DG  D O6    1 
ATOM   261  N N1    . DG  B 1 3   ? -2.221  -16.513 -3.849  1.00 18.82 ? 903 DG  D N1    1 
ATOM   262  C C2    . DG  B 1 3   ? -2.797  -17.315 -2.891  1.00 14.89 ? 903 DG  D C2    1 
ATOM   263  N N2    . DG  B 1 3   ? -2.019  -17.668 -1.881  1.00 14.75 ? 903 DG  D N2    1 
ATOM   264  N N3    . DG  B 1 3   ? -4.039  -17.750 -2.939  1.00 22.44 ? 903 DG  D N3    1 
ATOM   265  C C4    . DG  B 1 3   ? -4.668  -17.371 -4.080  1.00 23.34 ? 903 DG  D C4    1 
ATOM   266  P P     . DG  B 1 4   ? -10.048 -18.813 -0.950  1.00 33.00 ? 904 DG  D P     1 
ATOM   267  O OP1   . DG  B 1 4   ? -10.612 -19.926 -0.108  1.00 37.59 ? 904 DG  D OP1   1 
ATOM   268  O OP2   . DG  B 1 4   ? -10.950 -17.929 -1.721  1.00 25.58 ? 904 DG  D OP2   1 
ATOM   269  O "O5'" . DG  B 1 4   ? -9.108  -17.939 -0.008  1.00 32.51 ? 904 DG  D "O5'" 1 
ATOM   270  C "C5'" . DG  B 1 4   ? -7.868  -18.483 0.489   1.00 27.32 ? 904 DG  D "C5'" 1 
ATOM   271  C "C4'" . DG  B 1 4   ? -6.906  -17.370 0.837   1.00 30.27 ? 904 DG  D "C4'" 1 
ATOM   272  O "O4'" . DG  B 1 4   ? -6.251  -16.829 -0.343  1.00 26.65 ? 904 DG  D "O4'" 1 
ATOM   273  C "C3'" . DG  B 1 4   ? -7.508  -16.166 1.589   1.00 28.53 ? 904 DG  D "C3'" 1 
ATOM   274  O "O3'" . DG  B 1 4   ? -6.571  -15.709 2.573   1.00 26.50 ? 904 DG  D "O3'" 1 
ATOM   275  C "C2'" . DG  B 1 4   ? -7.570  -15.092 0.516   1.00 23.42 ? 904 DG  D "C2'" 1 
ATOM   276  C "C1'" . DG  B 1 4   ? -6.265  -15.416 -0.194  1.00 24.56 ? 904 DG  D "C1'" 1 
ATOM   277  N N9    . DG  B 1 4   ? -6.005  -14.803 -1.486  1.00 20.24 ? 904 DG  D N9    1 
ATOM   278  C C8    . DG  B 1 4   ? -6.880  -14.563 -2.529  1.00 17.23 ? 904 DG  D C8    1 
ATOM   279  N N7    . DG  B 1 4   ? -6.314  -13.967 -3.539  1.00 19.63 ? 904 DG  D N7    1 
ATOM   280  C C5    . DG  B 1 4   ? -4.982  -13.817 -3.141  1.00 17.44 ? 904 DG  D C5    1 
ATOM   281  C C6    . DG  B 1 4   ? -3.853  -13.244 -3.810  1.00 17.89 ? 904 DG  D C6    1 
ATOM   282  O O6    . DG  B 1 4   ? -3.771  -12.738 -4.943  1.00 14.05 ? 904 DG  D O6    1 
ATOM   283  N N1    . DG  B 1 4   ? -2.717  -13.304 -3.012  1.00 19.85 ? 904 DG  D N1    1 
ATOM   284  C C2    . DG  B 1 4   ? -2.651  -13.841 -1.758  1.00 15.84 ? 904 DG  D C2    1 
ATOM   285  N N2    . DG  B 1 4   ? -1.455  -13.789 -1.149  1.00 17.88 ? 904 DG  D N2    1 
ATOM   286  N N3    . DG  B 1 4   ? -3.668  -14.378 -1.146  1.00 15.25 ? 904 DG  D N3    1 
ATOM   287  C C4    . DG  B 1 4   ? -4.795  -14.331 -1.882  1.00 15.25 ? 904 DG  D C4    1 
ATOM   288  P P     . DA  B 1 5   ? -6.729  -16.152 4.113   1.00 18.52 ? 905 DA  D P     1 
ATOM   289  O OP1   . DA  B 1 5   ? -6.441  -17.594 4.199   1.00 18.50 ? 905 DA  D OP1   1 
ATOM   290  O OP2   . DA  B 1 5   ? -8.022  -15.635 4.583   1.00 13.64 ? 905 DA  D OP2   1 
ATOM   291  O "O5'" . DA  B 1 5   ? -5.569  -15.344 4.826   1.00 17.37 ? 905 DA  D "O5'" 1 
ATOM   292  C "C5'" . DA  B 1 5   ? -5.495  -13.941 4.666   1.00 16.37 ? 905 DA  D "C5'" 1 
ATOM   293  C "C4'" . DA  B 1 5   ? -4.055  -13.544 4.522   1.00 19.58 ? 905 DA  D "C4'" 1 
ATOM   294  O "O4'" . DA  B 1 5   ? -3.633  -13.797 3.160   1.00 19.74 ? 905 DA  D "O4'" 1 
ATOM   295  C "C3'" . DA  B 1 5   ? -3.824  -12.066 4.784   1.00 17.35 ? 905 DA  D "C3'" 1 
ATOM   296  O "O3'" . DA  B 1 5   ? -3.181  -11.887 6.036   1.00 22.02 ? 905 DA  D "O3'" 1 
ATOM   297  C "C2'" . DA  B 1 5   ? -2.897  -11.616 3.673   1.00 18.56 ? 905 DA  D "C2'" 1 
ATOM   298  C "C1'" . DA  B 1 5   ? -2.872  -12.713 2.633   1.00 18.05 ? 905 DA  D "C1'" 1 
ATOM   299  N N9    . DA  B 1 5   ? -3.585  -12.170 1.462   1.00 17.20 ? 905 DA  D N9    1 
ATOM   300  C C8    . DA  B 1 5   ? -4.909  -12.298 1.132   1.00 16.47 ? 905 DA  D C8    1 
ATOM   301  N N7    . DA  B 1 5   ? -5.262  -11.607 0.073   1.00 17.66 ? 905 DA  D N7    1 
ATOM   302  C C5    . DA  B 1 5   ? -4.087  -11.011 -0.344  1.00 15.74 ? 905 DA  D C5    1 
ATOM   303  C C6    . DA  B 1 5   ? -3.777  -10.171 -1.431  1.00 16.77 ? 905 DA  D C6    1 
ATOM   304  N N6    . DA  B 1 5   ? -4.669  -9.738  -2.334  1.00 16.15 ? 905 DA  D N6    1 
ATOM   305  N N1    . DA  B 1 5   ? -2.505  -9.764  -1.558  1.00 15.41 ? 905 DA  D N1    1 
ATOM   306  C C2    . DA  B 1 5   ? -1.605  -10.165 -0.653  1.00 20.39 ? 905 DA  D C2    1 
ATOM   307  N N3    . DA  B 1 5   ? -1.766  -10.950 0.400   1.00 22.53 ? 905 DA  D N3    1 
ATOM   308  C C4    . DA  B 1 5   ? -3.043  -11.356 0.497   1.00 18.38 ? 905 DA  D C4    1 
ATOM   309  P P     . DT  B 1 6   ? -3.546  -10.613 6.931   1.00 23.38 ? 906 DT  D P     1 
ATOM   310  O OP1   . DT  B 1 6   ? -3.276  -10.995 8.350   1.00 23.08 ? 906 DT  D OP1   1 
ATOM   311  O OP2   . DT  B 1 6   ? -4.878  -10.088 6.558   1.00 28.18 ? 906 DT  D OP2   1 
ATOM   312  O "O5'" . DT  B 1 6   ? -2.546  -9.505  6.397   1.00 23.93 ? 906 DT  D "O5'" 1 
ATOM   313  C "C5'" . DT  B 1 6   ? -1.149  -9.812  6.192   1.00 25.86 ? 906 DT  D "C5'" 1 
ATOM   314  C "C4'" . DT  B 1 6   ? -0.461  -8.624  5.569   1.00 26.07 ? 906 DT  D "C4'" 1 
ATOM   315  O "O4'" . DT  B 1 6   ? -0.606  -8.759  4.127   1.00 26.21 ? 906 DT  D "O4'" 1 
ATOM   316  C "C3'" . DT  B 1 6   ? -1.194  -7.334  5.941   1.00 26.22 ? 906 DT  D "C3'" 1 
ATOM   317  O "O3'" . DT  B 1 6   ? -0.566  -6.446  6.851   1.00 24.16 ? 906 DT  D "O3'" 1 
ATOM   318  C "C2'" . DT  B 1 6   ? -1.445  -6.618  4.634   1.00 27.31 ? 906 DT  D "C2'" 1 
ATOM   319  C "C1'" . DT  B 1 6   ? -0.857  -7.497  3.540   1.00 23.20 ? 906 DT  D "C1'" 1 
ATOM   320  N N1    . DT  B 1 6   ? -1.942  -7.639  2.569   1.00 19.93 ? 906 DT  D N1    1 
ATOM   321  C C2    . DT  B 1 6   ? -1.819  -7.034  1.338   1.00 18.21 ? 906 DT  D C2    1 
ATOM   322  O O2    . DT  B 1 6   ? -0.790  -6.523  0.931   1.00 23.16 ? 906 DT  D O2    1 
ATOM   323  N N3    . DT  B 1 6   ? -2.960  -7.040  0.592   1.00 17.60 ? 906 DT  D N3    1 
ATOM   324  C C4    . DT  B 1 6   ? -4.176  -7.574  0.935   1.00 16.76 ? 906 DT  D C4    1 
ATOM   325  O O4    . DT  B 1 6   ? -5.132  -7.431  0.186   1.00 18.07 ? 906 DT  D O4    1 
ATOM   326  C C5    . DT  B 1 6   ? -4.218  -8.257  2.209   1.00 18.86 ? 906 DT  D C5    1 
ATOM   327  C C7    . DT  B 1 6   ? -5.493  -8.905  2.654   1.00 15.11 ? 906 DT  D C7    1 
ATOM   328  C C6    . DT  B 1 6   ? -3.097  -8.276  2.942   1.00 18.26 ? 906 DT  D C6    1 
ATOM   329  P P     . DA  B 1 7   ? -1.519  -5.571  7.804   1.00 30.99 ? 907 DA  D P     1 
ATOM   330  O OP1   . DA  B 1 7   ? -0.876  -5.245  9.100   1.00 31.08 ? 907 DA  D OP1   1 
ATOM   331  O OP2   . DA  B 1 7   ? -2.845  -6.275  7.804   1.00 29.39 ? 907 DA  D OP2   1 
ATOM   332  O "O5'" . DA  B 1 7   ? -1.807  -4.243  6.982   1.00 30.06 ? 907 DA  D "O5'" 1 
ATOM   333  C "C5'" . DA  B 1 7   ? -0.735  -3.405  6.552   1.00 28.49 ? 907 DA  D "C5'" 1 
ATOM   334  C "C4'" . DA  B 1 7   ? -1.280  -2.167  5.889   1.00 22.44 ? 907 DA  D "C4'" 1 
ATOM   335  O "O4'" . DA  B 1 7   ? -1.684  -2.469  4.541   1.00 23.30 ? 907 DA  D "O4'" 1 
ATOM   336  C "C3'" . DA  B 1 7   ? -2.493  -1.521  6.563   1.00 23.88 ? 907 DA  D "C3'" 1 
ATOM   337  O "O3'" . DA  B 1 7   ? -2.245  -0.118  6.657   1.00 28.02 ? 907 DA  D "O3'" 1 
ATOM   338  C "C2'" . DA  B 1 7   ? -3.642  -1.797  5.605   1.00 17.87 ? 907 DA  D "C2'" 1 
ATOM   339  C "C1'" . DA  B 1 7   ? -2.948  -1.883  4.263   1.00 18.20 ? 907 DA  D "C1'" 1 
ATOM   340  N N9    . DA  B 1 7   ? -3.650  -2.766  3.328   1.00 22.92 ? 907 DA  D N9    1 
ATOM   341  C C8    . DA  B 1 7   ? -3.813  -4.127  3.471   1.00 21.25 ? 907 DA  D C8    1 
ATOM   342  N N7    . DA  B 1 7   ? -4.571  -4.669  2.557   1.00 20.77 ? 907 DA  D N7    1 
ATOM   343  C C5    . DA  B 1 7   ? -4.909  -3.609  1.729   1.00 21.50 ? 907 DA  D C5    1 
ATOM   344  C C6    . DA  B 1 7   ? -5.715  -3.533  0.570   1.00 19.53 ? 907 DA  D C6    1 
ATOM   345  N N6    . DA  B 1 7   ? -6.346  -4.577  0.046   1.00 18.89 ? 907 DA  D N6    1 
ATOM   346  N N1    . DA  B 1 7   ? -5.845  -2.337  -0.033  1.00 18.12 ? 907 DA  D N1    1 
ATOM   347  C C2    . DA  B 1 7   ? -5.215  -1.278  0.514   1.00 27.08 ? 907 DA  D C2    1 
ATOM   348  N N3    . DA  B 1 7   ? -4.440  -1.215  1.607   1.00 23.92 ? 907 DA  D N3    1 
ATOM   349  C C4    . DA  B 1 7   ? -4.329  -2.431  2.179   1.00 23.13 ? 907 DA  D C4    1 
ATOM   350  P P     . DT  B 1 8   ? -3.172  0.811   7.572   1.00 21.52 ? 908 DT  D P     1 
ATOM   351  O OP1   . DT  B 1 8   ? -2.329  1.953   7.990   1.00 20.26 ? 908 DT  D OP1   1 
ATOM   352  O OP2   . DT  B 1 8   ? -3.860  -0.012  8.597   1.00 26.98 ? 908 DT  D OP2   1 
ATOM   353  O "O5'" . DT  B 1 8   ? -4.255  1.364   6.550   1.00 29.64 ? 908 DT  D "O5'" 1 
ATOM   354  C "C5'" . DT  B 1 8   ? -3.820  2.021   5.354   1.00 25.86 ? 908 DT  D "C5'" 1 
ATOM   355  C "C4'" . DT  B 1 8   ? -4.994  2.414   4.486   1.00 22.35 ? 908 DT  D "C4'" 1 
ATOM   356  O "O4'" . DT  B 1 8   ? -5.463  1.337   3.622   1.00 19.23 ? 908 DT  D "O4'" 1 
ATOM   357  C "C3'" . DT  B 1 8   ? -6.226  3.051   5.138   1.00 21.90 ? 908 DT  D "C3'" 1 
ATOM   358  O "O3'" . DT  B 1 8   ? -6.363  4.348   4.523   1.00 21.88 ? 908 DT  D "O3'" 1 
ATOM   359  C "C2'" . DT  B 1 8   ? -7.352  2.079   4.780   1.00 18.48 ? 908 DT  D "C2'" 1 
ATOM   360  C "C1'" . DT  B 1 8   ? -6.863  1.425   3.489   1.00 15.78 ? 908 DT  D "C1'" 1 
ATOM   361  N N1    . DT  B 1 8   ? -7.361  0.066   3.179   1.00 21.96 ? 908 DT  D N1    1 
ATOM   362  C C2    . DT  B 1 8   ? -7.993  -0.120  1.958   1.00 20.49 ? 908 DT  D C2    1 
ATOM   363  O O2    . DT  B 1 8   ? -8.108  0.759   1.132   1.00 22.41 ? 908 DT  D O2    1 
ATOM   364  N N3    . DT  B 1 8   ? -8.467  -1.383  1.741   1.00 14.18 ? 908 DT  D N3    1 
ATOM   365  C C4    . DT  B 1 8   ? -8.360  -2.472  2.584   1.00 18.40 ? 908 DT  D C4    1 
ATOM   366  O O4    . DT  B 1 8   ? -8.833  -3.550  2.255   1.00 15.26 ? 908 DT  D O4    1 
ATOM   367  C C5    . DT  B 1 8   ? -7.668  -2.230  3.836   1.00 20.59 ? 908 DT  D C5    1 
ATOM   368  C C7    . DT  B 1 8   ? -7.492  -3.369  4.784   1.00 12.46 ? 908 DT  D C7    1 
ATOM   369  C C6    . DT  B 1 8   ? -7.208  -0.986  4.072   1.00 21.05 ? 908 DT  D C6    1 
ATOM   370  P P     . DC  B 1 9   ? -7.585  5.320   4.877   1.00 17.77 ? 909 DC  D P     1 
ATOM   371  O OP1   . DC  B 1 9   ? -7.025  6.678   4.976   1.00 23.35 ? 909 DC  D OP1   1 
ATOM   372  O OP2   . DC  B 1 9   ? -8.389  4.778   5.982   1.00 30.38 ? 909 DC  D OP2   1 
ATOM   373  O "O5'" . DC  B 1 9   ? -8.472  5.261   3.560   1.00 25.19 ? 909 DC  D "O5'" 1 
ATOM   374  C "C5'" . DC  B 1 9   ? -7.858  5.251   2.259   1.00 15.56 ? 909 DC  D "C5'" 1 
ATOM   375  C "C4'" . DC  B 1 9   ? -8.882  4.927   1.196   1.00 20.35 ? 909 DC  D "C4'" 1 
ATOM   376  O "O4'" . DC  B 1 9   ? -9.261  3.541   1.271   1.00 18.74 ? 909 DC  D "O4'" 1 
ATOM   377  C "C3'" . DC  B 1 9   ? -10.183 5.726   1.248   1.00 22.03 ? 909 DC  D "C3'" 1 
ATOM   378  O "O3'" . DC  B 1 9   ? -10.396 6.379   0.017   1.00 26.76 ? 909 DC  D "O3'" 1 
ATOM   379  C "C2'" . DC  B 1 9   ? -11.279 4.697   1.462   1.00 18.50 ? 909 DC  D "C2'" 1 
ATOM   380  C "C1'" . DC  B 1 9   ? -10.647 3.417   0.985   1.00 21.50 ? 909 DC  D "C1'" 1 
ATOM   381  N N1    . DC  B 1 9   ? -11.133 2.184   1.639   1.00 19.50 ? 909 DC  D N1    1 
ATOM   382  C C2    . DC  B 1 9   ? -11.908 1.281   0.866   1.00 20.22 ? 909 DC  D C2    1 
ATOM   383  O O2    . DC  B 1 9   ? -12.246 1.623   -0.298  1.00 21.68 ? 909 DC  D O2    1 
ATOM   384  N N3    . DC  B 1 9   ? -12.280 0.082   1.412   1.00 13.05 ? 909 DC  D N3    1 
ATOM   385  C C4    . DC  B 1 9   ? -11.934 -0.212  2.681   1.00 19.14 ? 909 DC  D C4    1 
ATOM   386  N N4    . DC  B 1 9   ? -12.290 -1.400  3.168   1.00 15.15 ? 909 DC  D N4    1 
ATOM   387  C C5    . DC  B 1 9   ? -11.199 0.719   3.508   1.00 16.11 ? 909 DC  D C5    1 
ATOM   388  C C6    . DC  B 1 9   ? -10.822 1.889   2.947   1.00 17.10 ? 909 DC  D C6    1 
ATOM   389  P P     . DC  B 1 10  ? -11.487 7.541   -0.070  1.00 29.00 ? 910 DC  D P     1 
ATOM   390  O OP1   . DC  B 1 10  ? -10.868 8.619   -0.919  1.00 28.10 ? 910 DC  D OP1   1 
ATOM   391  O OP2   . DC  B 1 10  ? -12.029 7.873   1.261   1.00 25.86 ? 910 DC  D OP2   1 
ATOM   392  O "O5'" . DC  B 1 10  ? -12.643 6.803   -0.866  1.00 32.86 ? 910 DC  D "O5'" 1 
ATOM   393  C "C5'" . DC  B 1 10  ? -12.382 6.246   -2.150  1.00 32.29 ? 910 DC  D "C5'" 1 
ATOM   394  C "C4'" . DC  B 1 10  ? -13.658 5.706   -2.741  1.00 34.16 ? 910 DC  D "C4'" 1 
ATOM   395  O "O4'" . DC  B 1 10  ? -13.876 4.425   -2.121  1.00 32.71 ? 910 DC  D "O4'" 1 
ATOM   396  C "C3'" . DC  B 1 10  ? -14.907 6.552   -2.463  1.00 38.24 ? 910 DC  D "C3'" 1 
ATOM   397  O "O3'" . DC  B 1 10  ? -15.697 6.787   -3.636  1.00 46.62 ? 910 DC  D "O3'" 1 
ATOM   398  C "C2'" . DC  B 1 10  ? -15.706 5.723   -1.473  1.00 37.88 ? 910 DC  D "C2'" 1 
ATOM   399  C "C1'" . DC  B 1 10  ? -15.225 4.301   -1.706  1.00 31.22 ? 910 DC  D "C1'" 1 
ATOM   400  N N1    . DC  B 1 10  ? -15.232 3.465   -0.495  1.00 29.61 ? 910 DC  D N1    1 
ATOM   401  C C2    . DC  B 1 10  ? -15.832 2.204   -0.536  1.00 29.42 ? 910 DC  D C2    1 
ATOM   402  O O2    . DC  B 1 10  ? -16.382 1.837   -1.585  1.00 33.85 ? 910 DC  D O2    1 
ATOM   403  N N3    . DC  B 1 10  ? -15.806 1.418   0.567   1.00 29.71 ? 910 DC  D N3    1 
ATOM   404  C C4    . DC  B 1 10  ? -15.220 1.868   1.682   1.00 29.65 ? 910 DC  D C4    1 
ATOM   405  N N4    . DC  B 1 10  ? -15.208 1.073   2.750   1.00 27.63 ? 910 DC  D N4    1 
ATOM   406  C C5    . DC  B 1 10  ? -14.616 3.157   1.750   1.00 29.46 ? 910 DC  D C5    1 
ATOM   407  C C6    . DC  B 1 10  ? -14.644 3.914   0.655   1.00 26.58 ? 910 DC  D C6    1 
ATOM   408  P P     . DC  B 1 11  ? -16.626 8.109   -3.716  1.00 50.79 ? 911 DC  D P     1 
ATOM   409  O OP1   . DC  B 1 11  ? -16.127 8.969   -4.806  1.00 52.60 ? 911 DC  D OP1   1 
ATOM   410  O OP2   . DC  B 1 11  ? -16.801 8.675   -2.349  1.00 45.74 ? 911 DC  D OP2   1 
ATOM   411  O "O5'" . DC  B 1 11  ? -18.036 7.551   -4.190  1.00 51.76 ? 911 DC  D "O5'" 1 
ATOM   412  C "C5'" . DC  B 1 11  ? -18.116 6.493   -5.162  1.00 52.21 ? 911 DC  D "C5'" 1 
ATOM   413  C "C4'" . DC  B 1 11  ? -19.265 5.569   -4.832  1.00 49.68 ? 911 DC  D "C4'" 1 
ATOM   414  O "O4'" . DC  B 1 11  ? -18.932 4.738   -3.686  1.00 48.39 ? 911 DC  D "O4'" 1 
ATOM   415  C "C3'" . DC  B 1 11  ? -20.561 6.303   -4.471  1.00 49.04 ? 911 DC  D "C3'" 1 
ATOM   416  O "O3'" . DC  B 1 11  ? -21.698 5.654   -5.070  1.00 52.04 ? 911 DC  D "O3'" 1 
ATOM   417  C "C2'" . DC  B 1 11  ? -20.617 6.184   -2.956  1.00 46.20 ? 911 DC  D "C2'" 1 
ATOM   418  C "C1'" . DC  B 1 11  ? -19.989 4.815   -2.747  1.00 45.11 ? 911 DC  D "C1'" 1 
ATOM   419  N N1    . DC  B 1 11  ? -19.445 4.567   -1.403  1.00 41.98 ? 911 DC  D N1    1 
ATOM   420  C C2    . DC  B 1 11  ? -19.497 3.262   -0.877  1.00 41.70 ? 911 DC  D C2    1 
ATOM   421  O O2    . DC  B 1 11  ? -19.892 2.330   -1.602  1.00 41.35 ? 911 DC  D O2    1 
ATOM   422  N N3    . DC  B 1 11  ? -19.106 3.047   0.404   1.00 40.71 ? 911 DC  D N3    1 
ATOM   423  C C4    . DC  B 1 11  ? -18.654 4.070   1.140   1.00 43.66 ? 911 DC  D C4    1 
ATOM   424  N N4    . DC  B 1 11  ? -18.322 3.838   2.412   1.00 40.57 ? 911 DC  D N4    1 
ATOM   425  C C5    . DC  B 1 11  ? -18.535 5.392   0.606   1.00 41.81 ? 911 DC  D C5    1 
ATOM   426  C C6    . DC  B 1 11  ? -18.937 5.590   -0.658  1.00 42.49 ? 911 DC  D C6    1 
ATOM   427  N N     . SER C 2 1   ? 6.973   3.311   32.057  1.00 32.50 ? 2   SER A N     1 
ATOM   428  C CA    . SER C 2 1   ? 7.041   1.920   31.579  1.00 33.09 ? 2   SER A CA    1 
ATOM   429  C C     . SER C 2 1   ? 7.398   1.947   30.094  1.00 32.26 ? 2   SER A C     1 
ATOM   430  O O     . SER C 2 1   ? 7.584   3.024   29.532  1.00 34.01 ? 2   SER A O     1 
ATOM   431  C CB    . SER C 2 1   ? 5.700   1.162   31.807  1.00 26.26 ? 2   SER A CB    1 
ATOM   432  O OG    . SER C 2 1   ? 4.593   1.747   31.130  1.00 27.37 ? 2   SER A OG    1 
ATOM   433  N N     . LEU C 2 2   ? 7.608   0.773   29.497  1.00 30.43 ? 3   LEU A N     1 
ATOM   434  C CA    . LEU C 2 2   ? 7.910   0.681   28.075  1.00 29.76 ? 3   LEU A CA    1 
ATOM   435  C C     . LEU C 2 2   ? 6.767   1.411   27.332  1.00 30.73 ? 3   LEU A C     1 
ATOM   436  O O     . LEU C 2 2   ? 7.019   2.252   26.467  1.00 32.25 ? 3   LEU A O     1 
ATOM   437  C CB    . LEU C 2 2   ? 7.943   -0.785  27.648  1.00 26.60 ? 3   LEU A CB    1 
ATOM   438  C CG    . LEU C 2 2   ? 7.956   -1.082  26.143  1.00 30.42 ? 3   LEU A CG    1 
ATOM   439  C CD1   . LEU C 2 2   ? 9.313   -0.719  25.548  1.00 29.59 ? 3   LEU A CD1   1 
ATOM   440  C CD2   . LEU C 2 2   ? 7.638   -2.557  25.885  1.00 28.77 ? 3   LEU A CD2   1 
ATOM   441  N N     . ARG C 2 3   ? 5.527   1.178   27.766  1.00 27.63 ? 4   ARG A N     1 
ATOM   442  C CA    . ARG C 2 3   ? 4.378   1.797   27.130  1.00 29.28 ? 4   ARG A CA    1 
ATOM   443  C C     . ARG C 2 3   ? 4.198   3.303   27.320  1.00 31.29 ? 4   ARG A C     1 
ATOM   444  O O     . ARG C 2 3   ? 3.885   4.007   26.349  1.00 33.08 ? 4   ARG A O     1 
ATOM   445  C CB    . ARG C 2 3   ? 3.111   1.081   27.545  1.00 32.86 ? 4   ARG A CB    1 
ATOM   446  C CG    . ARG C 2 3   ? 1.909   1.499   26.752  1.00 34.49 ? 4   ARG A CG    1 
ATOM   447  C CD    . ARG C 2 3   ? 0.674   0.811   27.262  1.00 35.10 ? 4   ARG A CD    1 
ATOM   448  N NE    . ARG C 2 3   ? -0.515  1.547   26.854  1.00 35.58 ? 4   ARG A NE    1 
ATOM   449  C CZ    . ARG C 2 3   ? -1.625  0.979   26.404  1.00 32.24 ? 4   ARG A CZ    1 
ATOM   450  N NH1   . ARG C 2 3   ? -1.690  -0.348  26.306  1.00 26.74 ? 4   ARG A NH1   1 
ATOM   451  N NH2   . ARG C 2 3   ? -2.657  1.748   26.052  1.00 33.33 ? 4   ARG A NH2   1 
ATOM   452  N N     . SER C 2 4   ? 4.310   3.790   28.560  1.00 27.10 ? 5   SER A N     1 
ATOM   453  C CA    . SER C 2 4   ? 4.174   5.230   28.842  1.00 27.08 ? 5   SER A CA    1 
ATOM   454  C C     . SER C 2 4   ? 5.238   6.003   28.071  1.00 24.36 ? 5   SER A C     1 
ATOM   455  O O     . SER C 2 4   ? 4.949   6.994   27.398  1.00 25.56 ? 5   SER A O     1 
ATOM   456  C CB    . SER C 2 4   ? 4.304   5.536   30.363  1.00 28.05 ? 5   SER A CB    1 
ATOM   457  O OG    . SER C 2 4   ? 5.553   5.136   30.945  1.00 28.15 ? 5   SER A OG    1 
ATOM   458  N N     . ASP C 2 5   ? 6.460   5.500   28.153  1.00 20.32 ? 6   ASP A N     1 
ATOM   459  C CA    . ASP C 2 5   ? 7.585   6.093   27.482  1.00 23.96 ? 6   ASP A CA    1 
ATOM   460  C C     . ASP C 2 5   ? 7.428   6.081   25.983  1.00 21.36 ? 6   ASP A C     1 
ATOM   461  O O     . ASP C 2 5   ? 7.868   7.025   25.324  1.00 24.13 ? 6   ASP A O     1 
ATOM   462  C CB    . ASP C 2 5   ? 8.873   5.362   27.846  1.00 28.65 ? 6   ASP A CB    1 
ATOM   463  C CG    . ASP C 2 5   ? 9.363   5.691   29.241  1.00 31.61 ? 6   ASP A CG    1 
ATOM   464  O OD1   . ASP C 2 5   ? 8.765   6.568   29.916  1.00 29.24 ? 6   ASP A OD1   1 
ATOM   465  O OD2   . ASP C 2 5   ? 10.361  5.053   29.644  1.00 33.63 ? 6   ASP A OD2   1 
ATOM   466  N N     . LEU C 2 6   ? 6.883   4.991   25.441  1.00 19.07 ? 7   LEU A N     1 
ATOM   467  C CA    . LEU C 2 6   ? 6.677   4.872   23.995  1.00 19.39 ? 7   LEU A CA    1 
ATOM   468  C C     . LEU C 2 6   ? 5.663   5.932   23.504  1.00 17.11 ? 7   LEU A C     1 
ATOM   469  O O     . LEU C 2 6   ? 5.896   6.656   22.535  1.00 19.27 ? 7   LEU A O     1 
ATOM   470  C CB    . LEU C 2 6   ? 6.223   3.449   23.643  1.00 20.42 ? 7   LEU A CB    1 
ATOM   471  C CG    . LEU C 2 6   ? 6.315   3.057   22.159  1.00 27.48 ? 7   LEU A CG    1 
ATOM   472  C CD1   . LEU C 2 6   ? 7.762   3.134   21.648  1.00 25.89 ? 7   LEU A CD1   1 
ATOM   473  C CD2   . LEU C 2 6   ? 5.780   1.639   21.963  1.00 22.51 ? 7   LEU A CD2   1 
ATOM   474  N N     . ILE C 2 7   ? 4.556   6.058   24.211  1.00 17.68 ? 8   ILE A N     1 
ATOM   475  C CA    . ILE C 2 7   ? 3.561   7.057   23.873  1.00 22.96 ? 8   ILE A CA    1 
ATOM   476  C C     . ILE C 2 7   ? 4.161   8.475   24.032  1.00 22.70 ? 8   ILE A C     1 
ATOM   477  O O     . ILE C 2 7   ? 3.909   9.381   23.227  1.00 23.67 ? 8   ILE A O     1 
ATOM   478  C CB    . ILE C 2 7   ? 2.333   6.910   24.794  1.00 24.77 ? 8   ILE A CB    1 
ATOM   479  C CG1   . ILE C 2 7   ? 1.731   5.507   24.635  1.00 25.41 ? 8   ILE A CG1   1 
ATOM   480  C CG2   . ILE C 2 7   ? 1.315   8.001   24.472  1.00 32.02 ? 8   ILE A CG2   1 
ATOM   481  C CD1   . ILE C 2 7   ? 0.395   5.291   25.380  1.00 22.01 ? 8   ILE A CD1   1 
ATOM   482  N N     . ASN C 2 8   ? 4.948   8.665   25.083  1.00 22.62 ? 9   ASN A N     1 
ATOM   483  C CA    . ASN C 2 8   ? 5.589   9.952   25.334  1.00 21.06 ? 9   ASN A CA    1 
ATOM   484  C C     . ASN C 2 8   ? 6.527   10.326  24.187  1.00 15.87 ? 9   ASN A C     1 
ATOM   485  O O     . ASN C 2 8   ? 6.459   11.425  23.669  1.00 15.42 ? 9   ASN A O     1 
ATOM   486  C CB    . ASN C 2 8   ? 6.368   9.922   26.675  1.00 26.26 ? 9   ASN A CB    1 
ATOM   487  C CG    . ASN C 2 8   ? 5.507   10.298  27.880  1.00 28.25 ? 9   ASN A CG    1 
ATOM   488  O OD1   . ASN C 2 8   ? 4.305   10.015  27.929  1.00 33.95 ? 9   ASN A OD1   1 
ATOM   489  N ND2   . ASN C 2 8   ? 6.126   10.932  28.862  1.00 22.82 ? 9   ASN A ND2   1 
ATOM   490  N N     . ALA C 2 9   ? 7.431   9.427   23.823  1.00 14.13 ? 10  ALA A N     1 
ATOM   491  C CA    . ALA C 2 9   ? 8.354   9.690   22.738  1.00 15.44 ? 10  ALA A CA    1 
ATOM   492  C C     . ALA C 2 9   ? 7.583   10.033  21.438  1.00 21.58 ? 10  ALA A C     1 
ATOM   493  O O     . ALA C 2 9   ? 7.812   11.112  20.846  1.00 23.96 ? 10  ALA A O     1 
ATOM   494  C CB    . ALA C 2 9   ? 9.231   8.500   22.525  1.00 13.24 ? 10  ALA A CB    1 
ATOM   495  N N     . LEU C 2 10  ? 6.661   9.147   21.020  1.00 22.40 ? 11  LEU A N     1 
ATOM   496  C CA    . LEU C 2 10  ? 5.832   9.340   19.807  1.00 21.03 ? 11  LEU A CA    1 
ATOM   497  C C     . LEU C 2 10  ? 5.131   10.694  19.732  1.00 22.15 ? 11  LEU A C     1 
ATOM   498  O O     . LEU C 2 10  ? 5.255   11.394  18.728  1.00 22.43 ? 11  LEU A O     1 
ATOM   499  C CB    . LEU C 2 10  ? 4.766   8.240   19.684  1.00 18.54 ? 11  LEU A CB    1 
ATOM   500  C CG    . LEU C 2 10  ? 5.329   6.867   19.342  1.00 23.13 ? 11  LEU A CG    1 
ATOM   501  C CD1   . LEU C 2 10  ? 4.395   5.736   19.760  1.00 22.80 ? 11  LEU A CD1   1 
ATOM   502  C CD2   . LEU C 2 10  ? 5.609   6.856   17.853  1.00 25.20 ? 11  LEU A CD2   1 
ATOM   503  N N     . TYR C 2 11  ? 4.431   11.064  20.808  1.00 26.42 ? 12  TYR A N     1 
ATOM   504  C CA    . TYR C 2 11  ? 3.691   12.332  20.909  1.00 27.68 ? 12  TYR A CA    1 
ATOM   505  C C     . TYR C 2 11  ? 4.605   13.541  20.833  1.00 28.54 ? 12  TYR A C     1 
ATOM   506  O O     . TYR C 2 11  ? 4.255   14.575  20.268  1.00 24.91 ? 12  TYR A O     1 
ATOM   507  C CB    . TYR C 2 11  ? 2.949   12.374  22.234  1.00 31.48 ? 12  TYR A CB    1 
ATOM   508  C CG    . TYR C 2 11  ? 2.027   13.564  22.411  1.00 37.44 ? 12  TYR A CG    1 
ATOM   509  C CD1   . TYR C 2 11  ? 0.699   13.500  22.014  1.00 40.94 ? 12  TYR A CD1   1 
ATOM   510  C CD2   . TYR C 2 11  ? 2.464   14.730  23.041  1.00 40.49 ? 12  TYR A CD2   1 
ATOM   511  C CE1   . TYR C 2 11  ? -0.180  14.561  22.248  1.00 43.39 ? 12  TYR A CE1   1 
ATOM   512  C CE2   . TYR C 2 11  ? 1.596   15.794  23.275  1.00 40.98 ? 12  TYR A CE2   1 
ATOM   513  C CZ    . TYR C 2 11  ? 0.274   15.699  22.879  1.00 42.89 ? 12  TYR A CZ    1 
ATOM   514  O OH    . TYR C 2 11  ? -0.608  16.723  23.137  1.00 47.16 ? 12  TYR A OH    1 
ATOM   515  N N     . ASP C 2 12  ? 5.781   13.397  21.412  1.00 32.61 ? 13  ASP A N     1 
ATOM   516  C CA    . ASP C 2 12  ? 6.741   14.472  21.446  1.00 37.35 ? 13  ASP A CA    1 
ATOM   517  C C     . ASP C 2 12  ? 7.350   14.675  20.071  1.00 37.16 ? 13  ASP A C     1 
ATOM   518  O O     . ASP C 2 12  ? 7.220   15.753  19.482  1.00 36.05 ? 13  ASP A O     1 
ATOM   519  C CB    . ASP C 2 12  ? 7.829   14.164  22.484  1.00 41.56 ? 13  ASP A CB    1 
ATOM   520  C CG    . ASP C 2 12  ? 8.271   15.404  23.253  1.00 47.57 ? 13  ASP A CG    1 
ATOM   521  O OD1   . ASP C 2 12  ? 8.762   16.356  22.594  1.00 47.54 ? 13  ASP A OD1   1 
ATOM   522  O OD2   . ASP C 2 12  ? 8.109   15.424  24.505  1.00 48.05 ? 13  ASP A OD2   1 
ATOM   523  N N     . GLU C 2 13  ? 7.972   13.618  19.542  1.00 37.98 ? 14  GLU A N     1 
ATOM   524  C CA    . GLU C 2 13  ? 8.625   13.671  18.230  1.00 38.42 ? 14  GLU A CA    1 
ATOM   525  C C     . GLU C 2 13  ? 7.657   14.132  17.139  1.00 40.15 ? 14  GLU A C     1 
ATOM   526  O O     . GLU C 2 13  ? 8.031   14.900  16.235  1.00 40.13 ? 14  GLU A O     1 
ATOM   527  C CB    . GLU C 2 13  ? 9.214   12.324  17.884  1.00 36.32 ? 14  GLU A CB    1 
ATOM   528  N N     . ASN C 2 14  ? 6.407   13.681  17.247  1.00 39.53 ? 15  ASN A N     1 
ATOM   529  C CA    . ASN C 2 14  ? 5.378   14.046  16.281  1.00 41.09 ? 15  ASN A CA    1 
ATOM   530  C C     . ASN C 2 14  ? 4.990   15.512  16.427  1.00 39.96 ? 15  ASN A C     1 
ATOM   531  O O     . ASN C 2 14  ? 5.108   16.283  15.479  1.00 38.39 ? 15  ASN A O     1 
ATOM   532  C CB    . ASN C 2 14  ? 4.141   13.138  16.404  1.00 41.36 ? 15  ASN A CB    1 
ATOM   533  C CG    . ASN C 2 14  ? 3.094   13.442  15.343  1.00 39.25 ? 15  ASN A CG    1 
ATOM   534  O OD1   . ASN C 2 14  ? 1.966   13.830  15.652  1.00 35.79 ? 15  ASN A OD1   1 
ATOM   535  N ND2   . ASN C 2 14  ? 3.481   13.301  14.082  1.00 38.68 ? 15  ASN A ND2   1 
ATOM   536  N N     . GLN C 2 15  ? 4.617   15.909  17.640  1.00 41.01 ? 16  GLN A N     1 
ATOM   537  C CA    . GLN C 2 15  ? 4.224   17.289  17.906  1.00 42.88 ? 16  GLN A CA    1 
ATOM   538  C C     . GLN C 2 15  ? 5.378   18.221  17.566  1.00 45.05 ? 16  GLN A C     1 
ATOM   539  O O     . GLN C 2 15  ? 5.235   19.444  17.590  1.00 49.57 ? 16  GLN A O     1 
ATOM   540  C CB    . GLN C 2 15  ? 3.822   17.473  19.374  1.00 38.79 ? 16  GLN A CB    1 
ATOM   541  N N     . LYS C 2 16  ? 6.531   17.643  17.263  1.00 47.05 ? 17  LYS A N     1 
ATOM   542  C CA    . LYS C 2 16  ? 7.672   18.445  16.921  1.00 47.29 ? 17  LYS A CA    1 
ATOM   543  C C     . LYS C 2 16  ? 7.938   18.502  15.419  1.00 50.22 ? 17  LYS A C     1 
ATOM   544  O O     . LYS C 2 16  ? 7.717   19.542  14.793  1.00 52.08 ? 17  LYS A O     1 
ATOM   545  C CB    . LYS C 2 16  ? 8.906   17.948  17.673  1.00 49.20 ? 17  LYS A CB    1 
ATOM   546  N N     . TYR C 2 17  ? 8.320   17.369  14.830  1.00 48.16 ? 18  TYR A N     1 
ATOM   547  C CA    . TYR C 2 17  ? 8.694   17.341  13.417  1.00 45.78 ? 18  TYR A CA    1 
ATOM   548  C C     . TYR C 2 17  ? 7.652   17.078  12.362  1.00 43.89 ? 18  TYR A C     1 
ATOM   549  O O     . TYR C 2 17  ? 6.527   16.660  12.644  1.00 44.96 ? 18  TYR A O     1 
ATOM   550  C CB    . TYR C 2 17  ? 9.875   16.401  13.207  1.00 48.13 ? 18  TYR A CB    1 
ATOM   551  N N     . ASP C 2 18  ? 8.082   17.282  11.124  1.00 41.94 ? 19  ASP A N     1 
ATOM   552  C CA    . ASP C 2 18  ? 7.243   17.078  9.957   1.00 41.83 ? 19  ASP A CA    1 
ATOM   553  C C     . ASP C 2 18  ? 8.085   16.599  8.771   1.00 41.46 ? 19  ASP A C     1 
ATOM   554  O O     . ASP C 2 18  ? 9.021   17.300  8.349   1.00 41.41 ? 19  ASP A O     1 
ATOM   555  C CB    . ASP C 2 18  ? 6.533   18.382  9.575   1.00 40.19 ? 19  ASP A CB    1 
ATOM   556  N N     . VAL C 2 19  ? 7.769   15.400  8.266   1.00 36.70 ? 20  VAL A N     1 
ATOM   557  C CA    . VAL C 2 19  ? 8.459   14.822  7.110   1.00 33.06 ? 20  VAL A CA    1 
ATOM   558  C C     . VAL C 2 19  ? 7.935   15.584  5.897   1.00 33.00 ? 20  VAL A C     1 
ATOM   559  O O     . VAL C 2 19  ? 6.714   15.771  5.758   1.00 31.43 ? 20  VAL A O     1 
ATOM   560  C CB    . VAL C 2 19  ? 8.138   13.327  6.956   1.00 31.67 ? 20  VAL A CB    1 
ATOM   561  C CG1   . VAL C 2 19  ? 8.707   12.762  5.633   1.00 26.18 ? 20  VAL A CG1   1 
ATOM   562  C CG2   . VAL C 2 19  ? 8.732   12.582  8.134   1.00 37.40 ? 20  VAL A CG2   1 
ATOM   563  N N     . CYS C 2 20  ? 8.843   16.069  5.051   1.00 27.92 ? 21  CYS A N     1 
ATOM   564  C CA    . CYS C 2 20  ? 8.409   16.830  3.886   1.00 26.88 ? 21  CYS A CA    1 
ATOM   565  C C     . CYS C 2 20  ? 8.802   16.231  2.540   1.00 22.66 ? 21  CYS A C     1 
ATOM   566  O O     . CYS C 2 20  ? 8.436   16.740  1.490   1.00 21.80 ? 21  CYS A O     1 
ATOM   567  C CB    . CYS C 2 20  ? 8.855   18.292  4.012   1.00 29.78 ? 21  CYS A CB    1 
ATOM   568  S SG    . CYS C 2 20  ? 10.572  18.449  4.430   1.00 33.06 ? 21  CYS A SG    1 
ATOM   569  N N     . GLY C 2 21  ? 9.552   15.145  2.562   1.00 21.76 ? 22  GLY A N     1 
ATOM   570  C CA    . GLY C 2 21  ? 9.900   14.537  1.303   1.00 22.77 ? 22  GLY A CA    1 
ATOM   571  C C     . GLY C 2 21  ? 10.976  13.503  1.429   1.00 23.99 ? 22  GLY A C     1 
ATOM   572  O O     . GLY C 2 21  ? 11.505  13.292  2.530   1.00 22.63 ? 22  GLY A O     1 
ATOM   573  N N     . ILE C 2 22  ? 11.264  12.831  0.310   1.00 20.64 ? 23  ILE A N     1 
ATOM   574  C CA    . ILE C 2 22  ? 12.303  11.833  0.271   1.00 18.82 ? 23  ILE A CA    1 
ATOM   575  C C     . ILE C 2 22  ? 13.525  12.497  -0.340  1.00 18.00 ? 23  ILE A C     1 
ATOM   576  O O     . ILE C 2 22  ? 13.411  13.448  -1.103  1.00 20.33 ? 23  ILE A O     1 
ATOM   577  C CB    . ILE C 2 22  ? 11.871  10.547  -0.473  1.00 19.54 ? 23  ILE A CB    1 
ATOM   578  C CG1   . ILE C 2 22  ? 11.507  10.850  -1.915  1.00 22.78 ? 23  ILE A CG1   1 
ATOM   579  C CG2   . ILE C 2 22  ? 10.719  9.880   0.274   1.00 17.84 ? 23  ILE A CG2   1 
ATOM   580  C CD1   . ILE C 2 22  ? 11.218  9.601   -2.742  1.00 24.99 ? 23  ILE A CD1   1 
ATOM   581  N N     . ILE C 2 23  ? 14.692  11.993  0.020   1.00 20.16 ? 24  ILE A N     1 
ATOM   582  C CA    . ILE C 2 23  ? 15.953  12.566  -0.398  1.00 24.01 ? 24  ILE A CA    1 
ATOM   583  C C     . ILE C 2 23  ? 16.909  11.511  -0.961  1.00 28.43 ? 24  ILE A C     1 
ATOM   584  O O     . ILE C 2 23  ? 16.973  10.380  -0.469  1.00 29.29 ? 24  ILE A O     1 
ATOM   585  C CB    . ILE C 2 23  ? 16.574  13.308  0.833   1.00 24.63 ? 24  ILE A CB    1 
ATOM   586  C CG1   . ILE C 2 23  ? 17.919  13.933  0.517   1.00 19.58 ? 24  ILE A CG1   1 
ATOM   587  C CG2   . ILE C 2 23  ? 16.706  12.357  2.047   1.00 23.32 ? 24  ILE A CG2   1 
ATOM   588  C CD1   . ILE C 2 23  ? 18.322  14.932  1.605   1.00 22.06 ? 24  ILE A CD1   1 
ATOM   589  N N     . SER C 2 24  ? 17.599  11.868  -2.043  1.00 31.79 ? 25  SER A N     1 
ATOM   590  C CA    . SER C 2 24  ? 18.551  10.966  -2.681  1.00 32.34 ? 25  SER A CA    1 
ATOM   591  C C     . SER C 2 24  ? 19.927  11.182  -2.096  1.00 30.48 ? 25  SER A C     1 
ATOM   592  O O     . SER C 2 24  ? 20.162  12.136  -1.357  1.00 26.74 ? 25  SER A O     1 
ATOM   593  C CB    . SER C 2 24  ? 18.577  11.171  -4.217  1.00 33.80 ? 25  SER A CB    1 
ATOM   594  O OG    . SER C 2 24  ? 19.121  12.422  -4.624  1.00 31.81 ? 25  SER A OG    1 
ATOM   595  N N     . ALA C 2 25  ? 20.845  10.301  -2.452  1.00 35.17 ? 26  ALA A N     1 
ATOM   596  C CA    . ALA C 2 25  ? 22.211  10.416  -1.974  1.00 42.30 ? 26  ALA A CA    1 
ATOM   597  C C     . ALA C 2 25  ? 22.816  11.732  -2.487  1.00 43.86 ? 26  ALA A C     1 
ATOM   598  O O     . ALA C 2 25  ? 23.619  12.382  -1.812  1.00 47.00 ? 26  ALA A O     1 
ATOM   599  C CB    . ALA C 2 25  ? 23.020  9.228   -2.447  1.00 43.50 ? 26  ALA A CB    1 
ATOM   600  N N     . GLU C 2 26  ? 22.387  12.128  -3.680  1.00 46.01 ? 27  GLU A N     1 
ATOM   601  C CA    . GLU C 2 26  ? 22.840  13.363  -4.322  1.00 45.05 ? 27  GLU A CA    1 
ATOM   602  C C     . GLU C 2 26  ? 22.310  14.641  -3.640  1.00 42.56 ? 27  GLU A C     1 
ATOM   603  O O     . GLU C 2 26  ? 22.748  15.753  -3.975  1.00 44.45 ? 27  GLU A O     1 
ATOM   604  C CB    . GLU C 2 26  ? 22.433  13.351  -5.811  1.00 44.69 ? 27  GLU A CB    1 
ATOM   605  N N     . GLY C 2 27  ? 21.355  14.484  -2.722  1.00 36.36 ? 28  GLY A N     1 
ATOM   606  C CA    . GLY C 2 27  ? 20.792  15.630  -2.029  1.00 33.09 ? 28  GLY A CA    1 
ATOM   607  C C     . GLY C 2 27  ? 19.525  16.244  -2.615  1.00 29.88 ? 28  GLY A C     1 
ATOM   608  O O     . GLY C 2 27  ? 19.105  17.334  -2.190  1.00 28.17 ? 28  GLY A O     1 
ATOM   609  N N     . LYS C 2 28  ? 18.936  15.589  -3.616  1.00 28.01 ? 29  LYS A N     1 
ATOM   610  C CA    . LYS C 2 28  ? 17.688  16.072  -4.222  1.00 24.27 ? 29  LYS A CA    1 
ATOM   611  C C     . LYS C 2 28  ? 16.488  15.707  -3.326  1.00 22.34 ? 29  LYS A C     1 
ATOM   612  O O     . LYS C 2 28  ? 16.478  14.662  -2.680  1.00 22.43 ? 29  LYS A O     1 
ATOM   613  C CB    . LYS C 2 28  ? 17.523  15.454  -5.580  1.00 27.24 ? 29  LYS A CB    1 
ATOM   614  N N     . ILE C 2 29  ? 15.478  16.551  -3.269  1.00 23.16 ? 30  ILE A N     1 
ATOM   615  C CA    . ILE C 2 29  ? 14.325  16.238  -2.432  1.00 28.47 ? 30  ILE A CA    1 
ATOM   616  C C     . ILE C 2 29  ? 13.008  16.247  -3.188  1.00 30.29 ? 30  ILE A C     1 
ATOM   617  O O     . ILE C 2 29  ? 12.583  17.274  -3.757  1.00 28.59 ? 30  ILE A O     1 
ATOM   618  C CB    . ILE C 2 29  ? 14.189  17.167  -1.197  1.00 31.15 ? 30  ILE A CB    1 
ATOM   619  C CG1   . ILE C 2 29  ? 15.388  16.990  -0.258  1.00 33.72 ? 30  ILE A CG1   1 
ATOM   620  C CG2   . ILE C 2 29  ? 12.862  16.894  -0.472  1.00 27.82 ? 30  ILE A CG2   1 
ATOM   621  C CD1   . ILE C 2 29  ? 16.565  17.922  -0.561  1.00 34.35 ? 30  ILE A CD1   1 
ATOM   622  N N     . TYR C 2 30  ? 12.324  15.109  -3.101  1.00 28.93 ? 31  TYR A N     1 
ATOM   623  C CA    . TYR C 2 30  ? 11.058  14.911  -3.776  1.00 27.36 ? 31  TYR A CA    1 
ATOM   624  C C     . TYR C 2 30  ? 9.930   15.049  -2.777  1.00 26.69 ? 31  TYR A C     1 
ATOM   625  O O     . TYR C 2 30  ? 9.940   14.390  -1.740  1.00 27.34 ? 31  TYR A O     1 
ATOM   626  C CB    . TYR C 2 30  ? 11.037  13.515  -4.431  1.00 27.62 ? 31  TYR A CB    1 
ATOM   627  C CG    . TYR C 2 30  ? 12.136  13.301  -5.470  1.00 29.36 ? 31  TYR A CG    1 
ATOM   628  C CD1   . TYR C 2 30  ? 13.477  13.146  -5.093  1.00 28.67 ? 31  TYR A CD1   1 
ATOM   629  C CD2   . TYR C 2 30  ? 11.836  13.271  -6.833  1.00 28.79 ? 31  TYR A CD2   1 
ATOM   630  C CE1   . TYR C 2 30  ? 14.471  12.970  -6.044  1.00 28.78 ? 31  TYR A CE1   1 
ATOM   631  C CE2   . TYR C 2 30  ? 12.833  13.094  -7.788  1.00 22.46 ? 31  TYR A CE2   1 
ATOM   632  C CZ    . TYR C 2 30  ? 14.135  12.945  -7.395  1.00 26.91 ? 31  TYR A CZ    1 
ATOM   633  O OH    . TYR C 2 30  ? 15.099  12.764  -8.357  1.00 29.20 ? 31  TYR A OH    1 
ATOM   634  N N     . PRO C 2 31  ? 8.949   15.925  -3.065  1.00 28.40 ? 32  PRO A N     1 
ATOM   635  C CA    . PRO C 2 31  ? 7.819   16.107  -2.147  1.00 25.87 ? 32  PRO A CA    1 
ATOM   636  C C     . PRO C 2 31  ? 6.878   14.897  -2.077  1.00 26.98 ? 32  PRO A C     1 
ATOM   637  O O     . PRO C 2 31  ? 6.937   13.983  -2.922  1.00 23.12 ? 32  PRO A O     1 
ATOM   638  C CB    . PRO C 2 31  ? 7.114   17.363  -2.701  1.00 26.56 ? 32  PRO A CB    1 
ATOM   639  C CG    . PRO C 2 31  ? 7.664   17.538  -4.087  1.00 25.88 ? 32  PRO A CG    1 
ATOM   640  C CD    . PRO C 2 31  ? 9.079   17.085  -3.969  1.00 27.82 ? 32  PRO A CD    1 
ATOM   641  N N     . LEU C 2 32  ? 6.001   14.910  -1.074  1.00 27.60 ? 33  LEU A N     1 
ATOM   642  C CA    . LEU C 2 32  ? 5.039   13.831  -0.858  1.00 29.46 ? 33  LEU A CA    1 
ATOM   643  C C     . LEU C 2 32  ? 3.636   14.176  -1.373  1.00 32.46 ? 33  LEU A C     1 
ATOM   644  O O     . LEU C 2 32  ? 3.305   15.352  -1.552  1.00 33.14 ? 33  LEU A O     1 
ATOM   645  C CB    . LEU C 2 32  ? 4.934   13.508  0.634   1.00 26.56 ? 33  LEU A CB    1 
ATOM   646  C CG    . LEU C 2 32  ? 6.193   13.459  1.503   1.00 29.08 ? 33  LEU A CG    1 
ATOM   647  C CD1   . LEU C 2 32  ? 5.778   13.239  2.951   1.00 34.88 ? 33  LEU A CD1   1 
ATOM   648  C CD2   . LEU C 2 32  ? 7.146   12.379  1.066   1.00 27.32 ? 33  LEU A CD2   1 
ATOM   649  N N     . GLY C 2 33  ? 2.828   13.136  -1.595  1.00 34.26 ? 34  GLY A N     1 
ATOM   650  C CA    . GLY C 2 33  ? 1.448   13.284  -2.041  1.00 34.12 ? 34  GLY A CA    1 
ATOM   651  C C     . GLY C 2 33  ? 0.527   13.007  -0.857  1.00 36.43 ? 34  GLY A C     1 
ATOM   652  O O     . GLY C 2 33  ? 0.961   12.426  0.144   1.00 36.98 ? 34  GLY A O     1 
ATOM   653  N N     . SER C 2 34  ? -0.750  13.369  -0.955  1.00 40.29 ? 35  SER A N     1 
ATOM   654  C CA    . SER C 2 34  ? -1.662  13.154  0.176   1.00 40.84 ? 35  SER A CA    1 
ATOM   655  C C     . SER C 2 34  ? -2.540  11.921  0.122   1.00 41.50 ? 35  SER A C     1 
ATOM   656  O O     . SER C 2 34  ? -3.710  11.976  0.499   1.00 42.57 ? 35  SER A O     1 
ATOM   657  C CB    . SER C 2 34  ? -2.539  14.382  0.415   1.00 44.57 ? 35  SER A CB    1 
ATOM   658  N N     . ASP C 2 35  ? -1.985  10.816  -0.363  1.00 41.80 ? 36  ASP A N     1 
ATOM   659  C CA    . ASP C 2 35  ? -2.704  9.546   -0.439  1.00 40.78 ? 36  ASP A CA    1 
ATOM   660  C C     . ASP C 2 35  ? -2.267  8.784   0.794   1.00 40.05 ? 36  ASP A C     1 
ATOM   661  O O     . ASP C 2 35  ? -1.113  8.908   1.215   1.00 40.42 ? 36  ASP A O     1 
ATOM   662  C CB    . ASP C 2 35  ? -2.273  8.769   -1.684  1.00 42.43 ? 36  ASP A CB    1 
ATOM   663  N N     . THR C 2 36  ? -3.143  7.968   1.363   1.00 39.17 ? 37  THR A N     1 
ATOM   664  C CA    . THR C 2 36  ? -2.751  7.232   2.556   1.00 39.72 ? 37  THR A CA    1 
ATOM   665  C C     . THR C 2 36  ? -1.642  6.243   2.271   1.00 36.99 ? 37  THR A C     1 
ATOM   666  O O     . THR C 2 36  ? -0.848  5.964   3.154   1.00 39.61 ? 37  THR A O     1 
ATOM   667  C CB    . THR C 2 36  ? -3.945  6.566   3.280   1.00 44.65 ? 37  THR A CB    1 
ATOM   668  O OG1   . THR C 2 36  ? -4.918  7.576   3.594   1.00 50.77 ? 37  THR A OG1   1 
ATOM   669  C CG2   . THR C 2 36  ? -3.497  5.938   4.595   1.00 41.07 ? 37  THR A CG2   1 
ATOM   670  N N     . LYS C 2 37  ? -1.523  5.770   1.030   1.00 33.83 ? 38  LYS A N     1 
ATOM   671  C CA    . LYS C 2 37  ? -0.428  4.844   0.693   1.00 32.28 ? 38  LYS A CA    1 
ATOM   672  C C     . LYS C 2 37  ? 0.874   5.595   0.982   1.00 28.13 ? 38  LYS A C     1 
ATOM   673  O O     . LYS C 2 37  ? 1.759   5.054   1.621   1.00 33.93 ? 38  LYS A O     1 
ATOM   674  C CB    . LYS C 2 37  ? -0.480  4.384   -0.793  1.00 26.50 ? 38  LYS A CB    1 
ATOM   675  N N     . VAL C 2 38  ? 0.959   6.870   0.592   1.00 26.09 ? 39  VAL A N     1 
ATOM   676  C CA    . VAL C 2 38  ? 2.175   7.623   0.863   1.00 23.62 ? 39  VAL A CA    1 
ATOM   677  C C     . VAL C 2 38  ? 2.300   7.850   2.355   1.00 20.57 ? 39  VAL A C     1 
ATOM   678  O O     . VAL C 2 38  ? 3.238   7.380   2.970   1.00 19.37 ? 39  VAL A O     1 
ATOM   679  C CB    . VAL C 2 38  ? 2.261   8.995   0.116   1.00 23.92 ? 39  VAL A CB    1 
ATOM   680  C CG1   . VAL C 2 38  ? 3.527   9.764   0.540   1.00 20.01 ? 39  VAL A CG1   1 
ATOM   681  C CG2   . VAL C 2 38  ? 2.328   8.770   -1.390  1.00 25.54 ? 39  VAL A CG2   1 
ATOM   682  N N     . LEU C 2 39  ? 1.306   8.492   2.945   1.00 19.52 ? 40  LEU A N     1 
ATOM   683  C CA    . LEU C 2 39  ? 1.369   8.801   4.368   1.00 24.92 ? 40  LEU A CA    1 
ATOM   684  C C     . LEU C 2 39  ? 1.577   7.606   5.289   1.00 26.20 ? 40  LEU A C     1 
ATOM   685  O O     . LEU C 2 39  ? 2.313   7.717   6.278   1.00 26.93 ? 40  LEU A O     1 
ATOM   686  C CB    . LEU C 2 39  ? 0.205   9.711   4.799   1.00 25.11 ? 40  LEU A CB    1 
ATOM   687  C CG    . LEU C 2 39  ? 0.399   11.174  4.330   1.00 27.23 ? 40  LEU A CG    1 
ATOM   688  C CD1   . LEU C 2 39  ? -0.577  11.552  3.225   1.00 25.52 ? 40  LEU A CD1   1 
ATOM   689  C CD2   . LEU C 2 39  ? 0.266   12.146  5.481   1.00 27.77 ? 40  LEU A CD2   1 
ATOM   690  N N     . SER C 2 40  ? 1.028   6.450   4.909   1.00 26.55 ? 41  SER A N     1 
ATOM   691  C CA    . SER C 2 40  ? 1.178   5.211   5.682   1.00 27.32 ? 41  SER A CA    1 
ATOM   692  C C     . SER C 2 40  ? 2.657   4.863   5.726   1.00 25.61 ? 41  SER A C     1 
ATOM   693  O O     . SER C 2 40  ? 3.244   4.666   6.793   1.00 25.65 ? 41  SER A O     1 
ATOM   694  C CB    . SER C 2 40  ? 0.424   4.036   5.022   1.00 26.11 ? 41  SER A CB    1 
ATOM   695  O OG    . SER C 2 40  ? -0.964  4.054   5.332   1.00 35.12 ? 41  SER A OG    1 
ATOM   696  N N     . THR C 2 41  ? 3.243   4.809   4.536   1.00 28.01 ? 42  THR A N     1 
ATOM   697  C CA    . THR C 2 41  ? 4.658   4.497   4.348   1.00 24.89 ? 42  THR A CA    1 
ATOM   698  C C     . THR C 2 41  ? 5.489   5.472   5.192   1.00 21.94 ? 42  THR A C     1 
ATOM   699  O O     . THR C 2 41  ? 6.269   5.065   6.052   1.00 19.89 ? 42  THR A O     1 
ATOM   700  C CB    . THR C 2 41  ? 5.002   4.564   2.812   1.00 21.58 ? 42  THR A CB    1 
ATOM   701  O OG1   . THR C 2 41  ? 4.444   3.419   2.157   1.00 18.38 ? 42  THR A OG1   1 
ATOM   702  C CG2   . THR C 2 41  ? 6.493   4.629   2.547   1.00 15.47 ? 42  THR A CG2   1 
ATOM   703  N N     . ILE C 2 42  ? 5.162   6.749   5.053   1.00 19.59 ? 43  ILE A N     1 
ATOM   704  C CA    . ILE C 2 42  ? 5.846   7.812   5.759   1.00 20.49 ? 43  ILE A CA    1 
ATOM   705  C C     . ILE C 2 42  ? 5.793   7.654   7.269   1.00 20.08 ? 43  ILE A C     1 
ATOM   706  O O     . ILE C 2 42  ? 6.838   7.678   7.893   1.00 19.30 ? 43  ILE A O     1 
ATOM   707  C CB    . ILE C 2 42  ? 5.280   9.203   5.355   1.00 21.51 ? 43  ILE A CB    1 
ATOM   708  C CG1   . ILE C 2 42  ? 5.577   9.480   3.873   1.00 23.94 ? 43  ILE A CG1   1 
ATOM   709  C CG2   . ILE C 2 42  ? 5.822   10.296  6.252   1.00 18.77 ? 43  ILE A CG2   1 
ATOM   710  C CD1   . ILE C 2 42  ? 6.932   8.920   3.363   1.00 17.75 ? 43  ILE A CD1   1 
ATOM   711  N N     . PHE C 2 43  ? 4.586   7.457   7.821   1.00 18.73 ? 44  PHE A N     1 
ATOM   712  C CA    . PHE C 2 43  ? 4.354   7.321   9.257   1.00 18.11 ? 44  PHE A CA    1 
ATOM   713  C C     . PHE C 2 43  ? 4.945   6.029   9.838   1.00 22.83 ? 44  PHE A C     1 
ATOM   714  O O     . PHE C 2 43  ? 5.397   5.998   11.002  1.00 20.03 ? 44  PHE A O     1 
ATOM   715  C CB    . PHE C 2 43  ? 2.855   7.441   9.594   1.00 20.94 ? 44  PHE A CB    1 
ATOM   716  C CG    . PHE C 2 43  ? 2.261   8.826   9.361   1.00 21.35 ? 44  PHE A CG    1 
ATOM   717  C CD1   . PHE C 2 43  ? 2.953   9.975   9.717   1.00 21.79 ? 44  PHE A CD1   1 
ATOM   718  C CD2   . PHE C 2 43  ? 1.014   8.967   8.761   1.00 19.18 ? 44  PHE A CD2   1 
ATOM   719  C CE1   . PHE C 2 43  ? 2.408   11.232  9.464   1.00 20.54 ? 44  PHE A CE1   1 
ATOM   720  C CE2   . PHE C 2 43  ? 0.470   10.205  8.513   1.00 20.95 ? 44  PHE A CE2   1 
ATOM   721  C CZ    . PHE C 2 43  ? 1.167   11.348  8.862   1.00 22.13 ? 44  PHE A CZ    1 
ATOM   722  N N     . GLU C 2 44  ? 4.973   4.962   9.049   1.00 19.27 ? 45  GLU A N     1 
ATOM   723  C CA    . GLU C 2 44  ? 5.603   3.749   9.554   1.00 22.51 ? 45  GLU A CA    1 
ATOM   724  C C     . GLU C 2 44  ? 7.135   3.971   9.701   1.00 20.19 ? 45  GLU A C     1 
ATOM   725  O O     . GLU C 2 44  ? 7.735   3.677   10.749  1.00 17.44 ? 45  GLU A O     1 
ATOM   726  C CB    . GLU C 2 44  ? 5.306   2.542   8.645   1.00 28.09 ? 45  GLU A CB    1 
ATOM   727  C CG    . GLU C 2 44  ? 5.839   1.225   9.213   1.00 38.90 ? 45  GLU A CG    1 
ATOM   728  C CD    . GLU C 2 44  ? 5.638   0.052   8.293   1.00 46.60 ? 45  GLU A CD    1 
ATOM   729  O OE1   . GLU C 2 44  ? 4.727   0.126   7.430   1.00 52.86 ? 45  GLU A OE1   1 
ATOM   730  O OE2   . GLU C 2 44  ? 6.397   -0.948  8.422   1.00 47.94 ? 45  GLU A OE2   1 
ATOM   731  N N     . LEU C 2 45  ? 7.746   4.542   8.668   1.00 13.72 ? 46  LEU A N     1 
ATOM   732  C CA    . LEU C 2 45  ? 9.185   4.814   8.654   1.00 19.32 ? 46  LEU A CA    1 
ATOM   733  C C     . LEU C 2 45  ? 9.658   5.832   9.703   1.00 19.58 ? 46  LEU A C     1 
ATOM   734  O O     . LEU C 2 45  ? 10.773  5.757   10.223  1.00 17.08 ? 46  LEU A O     1 
ATOM   735  C CB    . LEU C 2 45  ? 9.611   5.289   7.252   1.00 23.70 ? 46  LEU A CB    1 
ATOM   736  C CG    . LEU C 2 45  ? 9.455   4.247   6.120   1.00 28.17 ? 46  LEU A CG    1 
ATOM   737  C CD1   . LEU C 2 45  ? 9.927   4.817   4.753   1.00 22.70 ? 46  LEU A CD1   1 
ATOM   738  C CD2   . LEU C 2 45  ? 10.234  2.973   6.506   1.00 25.56 ? 46  LEU A CD2   1 
ATOM   739  N N     . PHE C 2 46  ? 8.809   6.810   9.947   1.00 18.15 ? 47  PHE A N     1 
ATOM   740  C CA    . PHE C 2 46  ? 9.036   7.886   10.891  1.00 21.64 ? 47  PHE A CA    1 
ATOM   741  C C     . PHE C 2 46  ? 9.094   7.327   12.336  1.00 19.66 ? 47  PHE A C     1 
ATOM   742  O O     . PHE C 2 46  ? 9.867   7.815   13.171  1.00 18.58 ? 47  PHE A O     1 
ATOM   743  C CB    . PHE C 2 46  ? 7.885   8.875   10.666  1.00 22.82 ? 47  PHE A CB    1 
ATOM   744  C CG    . PHE C 2 46  ? 7.709   9.889   11.725  1.00 29.65 ? 47  PHE A CG    1 
ATOM   745  C CD1   . PHE C 2 46  ? 6.874   9.626   12.816  1.00 34.83 ? 47  PHE A CD1   1 
ATOM   746  C CD2   . PHE C 2 46  ? 8.299   11.144  11.606  1.00 30.67 ? 47  PHE A CD2   1 
ATOM   747  C CE1   . PHE C 2 46  ? 6.620   10.607  13.776  1.00 37.14 ? 47  PHE A CE1   1 
ATOM   748  C CE2   . PHE C 2 46  ? 8.052   12.135  12.555  1.00 31.65 ? 47  PHE A CE2   1 
ATOM   749  C CZ    . PHE C 2 46  ? 7.208   11.865  13.648  1.00 35.33 ? 47  PHE A CZ    1 
ATOM   750  N N     . SER C 2 47  ? 8.355   6.243   12.571  1.00 21.07 ? 48  SER A N     1 
ATOM   751  C CA    . SER C 2 47  ? 8.254   5.567   13.880  1.00 22.57 ? 48  SER A CA    1 
ATOM   752  C C     . SER C 2 47  ? 9.277   4.480   14.267  1.00 23.01 ? 48  SER A C     1 
ATOM   753  O O     . SER C 2 47  ? 9.543   4.287   15.467  1.00 21.26 ? 48  SER A O     1 
ATOM   754  C CB    . SER C 2 47  ? 6.867   4.957   14.021  1.00 18.23 ? 48  SER A CB    1 
ATOM   755  O OG    . SER C 2 47  ? 5.894   5.965   13.989  1.00 21.32 ? 48  SER A OG    1 
ATOM   756  N N     . ARG C 2 48  ? 9.825   3.763   13.284  1.00 18.98 ? 49  ARG A N     1 
ATOM   757  C CA    . ARG C 2 48  ? 10.782  2.701   13.560  1.00 22.47 ? 49  ARG A CA    1 
ATOM   758  C C     . ARG C 2 48  ? 11.969  3.086   14.453  1.00 23.43 ? 49  ARG A C     1 
ATOM   759  O O     . ARG C 2 48  ? 12.351  2.304   15.321  1.00 25.66 ? 49  ARG A O     1 
ATOM   760  C CB    . ARG C 2 48  ? 11.260  2.057   12.263  1.00 24.67 ? 49  ARG A CB    1 
ATOM   761  C CG    . ARG C 2 48  ? 10.135  1.939   11.231  1.00 30.27 ? 49  ARG A CG    1 
ATOM   762  C CD    . ARG C 2 48  ? 10.387  0.904   10.163  1.00 32.49 ? 49  ARG A CD    1 
ATOM   763  N NE    . ARG C 2 48  ? 11.664  1.055   9.494   1.00 36.30 ? 49  ARG A NE    1 
ATOM   764  C CZ    . ARG C 2 48  ? 12.152  0.155   8.652   1.00 43.11 ? 49  ARG A CZ    1 
ATOM   765  N NH1   . ARG C 2 48  ? 11.455  -0.947  8.404   1.00 45.00 ? 49  ARG A NH1   1 
ATOM   766  N NH2   . ARG C 2 48  ? 13.314  0.363   8.039   1.00 45.58 ? 49  ARG A NH2   1 
ATOM   767  N N     . PRO C 2 49  ? 12.592  4.272   14.232  1.00 24.69 ? 50  PRO A N     1 
ATOM   768  C CA    . PRO C 2 49  ? 13.727  4.654   15.089  1.00 23.94 ? 50  PRO A CA    1 
ATOM   769  C C     . PRO C 2 49  ? 13.303  4.869   16.561  1.00 24.89 ? 50  PRO A C     1 
ATOM   770  O O     . PRO C 2 49  ? 13.957  4.358   17.489  1.00 19.50 ? 50  PRO A O     1 
ATOM   771  C CB    . PRO C 2 49  ? 14.221  5.956   14.438  1.00 23.46 ? 50  PRO A CB    1 
ATOM   772  C CG    . PRO C 2 49  ? 13.930  5.732   13.006  1.00 25.71 ? 50  PRO A CG    1 
ATOM   773  C CD    . PRO C 2 49  ? 12.529  5.168   13.057  1.00 22.47 ? 50  PRO A CD    1 
ATOM   774  N N     . ILE C 2 50  ? 12.191  5.587   16.753  1.00 20.71 ? 51  ILE A N     1 
ATOM   775  C CA    . ILE C 2 50  ? 11.650  5.869   18.084  1.00 22.10 ? 51  ILE A CA    1 
ATOM   776  C C     . ILE C 2 50  ? 11.369  4.552   18.802  1.00 23.15 ? 51  ILE A C     1 
ATOM   777  O O     . ILE C 2 50  ? 11.796  4.349   19.941  1.00 21.11 ? 51  ILE A O     1 
ATOM   778  C CB    . ILE C 2 50  ? 10.346  6.681   17.994  1.00 21.38 ? 51  ILE A CB    1 
ATOM   779  C CG1   . ILE C 2 50  ? 10.573  7.928   17.155  1.00 19.76 ? 51  ILE A CG1   1 
ATOM   780  C CG2   . ILE C 2 50  ? 9.862   7.103   19.404  1.00 21.48 ? 51  ILE A CG2   1 
ATOM   781  C CD1   . ILE C 2 50  ? 9.314   8.741   16.987  1.00 26.77 ? 51  ILE A CD1   1 
ATOM   782  N N     . ILE C 2 51  ? 10.623  3.668   18.138  1.00 24.11 ? 52  ILE A N     1 
ATOM   783  C CA    . ILE C 2 51  ? 10.320  2.354   18.698  1.00 23.64 ? 52  ILE A CA    1 
ATOM   784  C C     . ILE C 2 51  ? 11.645  1.685   19.110  1.00 25.26 ? 52  ILE A C     1 
ATOM   785  O O     . ILE C 2 51  ? 11.827  1.332   20.278  1.00 21.05 ? 52  ILE A O     1 
ATOM   786  C CB    . ILE C 2 51  ? 9.508   1.468   17.682  1.00 26.36 ? 52  ILE A CB    1 
ATOM   787  C CG1   . ILE C 2 51  ? 8.072   2.005   17.553  1.00 20.57 ? 52  ILE A CG1   1 
ATOM   788  C CG2   . ILE C 2 51  ? 9.482   0.008   18.126  1.00 25.84 ? 52  ILE A CG2   1 
ATOM   789  C CD1   . ILE C 2 51  ? 7.198   1.288   16.552  1.00 16.04 ? 52  ILE A CD1   1 
ATOM   790  N N     . ASN C 2 52  ? 12.606  1.621   18.188  1.00 25.12 ? 53  ASN A N     1 
ATOM   791  C CA    . ASN C 2 52  ? 13.898  1.012   18.493  1.00 28.57 ? 53  ASN A CA    1 
ATOM   792  C C     . ASN C 2 52  ? 14.550  1.557   19.761  1.00 27.10 ? 53  ASN A C     1 
ATOM   793  O O     . ASN C 2 52  ? 14.917  0.781   20.635  1.00 28.80 ? 53  ASN A O     1 
ATOM   794  C CB    . ASN C 2 52  ? 14.888  1.153   17.330  1.00 33.52 ? 53  ASN A CB    1 
ATOM   795  C CG    . ASN C 2 52  ? 16.258  0.558   17.656  1.00 33.45 ? 53  ASN A CG    1 
ATOM   796  O OD1   . ASN C 2 52  ? 16.352  -0.599  18.054  1.00 37.11 ? 53  ASN A OD1   1 
ATOM   797  N ND2   . ASN C 2 52  ? 17.318  1.342   17.478  1.00 30.50 ? 53  ASN A ND2   1 
ATOM   798  N N     . LYS C 2 53  ? 14.715  2.875   19.841  1.00 25.06 ? 54  LYS A N     1 
ATOM   799  C CA    . LYS C 2 53  ? 15.326  3.520   21.006  1.00 29.45 ? 54  LYS A CA    1 
ATOM   800  C C     . LYS C 2 53  ? 14.627  3.194   22.351  1.00 30.17 ? 54  LYS A C     1 
ATOM   801  O O     . LYS C 2 53  ? 15.297  2.854   23.337  1.00 30.45 ? 54  LYS A O     1 
ATOM   802  C CB    . LYS C 2 53  ? 15.390  5.036   20.801  1.00 23.76 ? 54  LYS A CB    1 
ATOM   803  N N     . ILE C 2 54  ? 13.297  3.317   22.395  1.00 31.42 ? 55  ILE A N     1 
ATOM   804  C CA    . ILE C 2 54  ? 12.530  3.039   23.616  1.00 28.54 ? 55  ILE A CA    1 
ATOM   805  C C     . ILE C 2 54  ? 12.654  1.573   23.963  1.00 26.53 ? 55  ILE A C     1 
ATOM   806  O O     . ILE C 2 54  ? 12.855  1.213   25.114  1.00 30.63 ? 55  ILE A O     1 
ATOM   807  C CB    . ILE C 2 54  ? 11.012  3.361   23.476  1.00 30.77 ? 55  ILE A CB    1 
ATOM   808  C CG1   . ILE C 2 54  ? 10.785  4.834   23.114  1.00 27.96 ? 55  ILE A CG1   1 
ATOM   809  C CG2   . ILE C 2 54  ? 10.290  3.011   24.789  1.00 33.71 ? 55  ILE A CG2   1 
ATOM   810  C CD1   . ILE C 2 54  ? 11.445  5.801   24.066  1.00 26.39 ? 55  ILE A CD1   1 
ATOM   811  N N     . ALA C 2 55  ? 12.553  0.725   22.957  1.00 24.59 ? 56  ALA A N     1 
ATOM   812  C CA    . ALA C 2 55  ? 12.678  -0.691  23.171  1.00 24.29 ? 56  ALA A CA    1 
ATOM   813  C C     . ALA C 2 55  ? 14.051  -0.969  23.792  1.00 26.76 ? 56  ALA A C     1 
ATOM   814  O O     . ALA C 2 55  ? 14.202  -1.832  24.667  1.00 27.19 ? 56  ALA A O     1 
ATOM   815  C CB    . ALA C 2 55  ? 12.536  -1.403  21.860  1.00 20.57 ? 56  ALA A CB    1 
ATOM   816  N N     . GLU C 2 56  ? 15.046  -0.206  23.360  1.00 29.27 ? 57  GLU A N     1 
ATOM   817  C CA    . GLU C 2 56  ? 16.402  -0.368  23.865  1.00 28.89 ? 57  GLU A CA    1 
ATOM   818  C C     . GLU C 2 56  ? 16.572  0.061   25.319  1.00 25.39 ? 57  GLU A C     1 
ATOM   819  O O     . GLU C 2 56  ? 17.250  -0.606  26.072  1.00 24.23 ? 57  GLU A O     1 
ATOM   820  C CB    . GLU C 2 56  ? 17.392  0.362   22.970  1.00 34.55 ? 57  GLU A CB    1 
ATOM   821  N N     . LYS C 2 57  ? 15.929  1.148   25.715  1.00 26.86 ? 58  LYS A N     1 
ATOM   822  C CA    . LYS C 2 57  ? 16.015  1.631   27.093  1.00 31.76 ? 58  LYS A CA    1 
ATOM   823  C C     . LYS C 2 57  ? 15.476  0.601   28.092  1.00 33.41 ? 58  LYS A C     1 
ATOM   824  O O     . LYS C 2 57  ? 15.873  0.580   29.262  1.00 34.86 ? 58  LYS A O     1 
ATOM   825  C CB    . LYS C 2 57  ? 15.218  2.935   27.267  1.00 34.84 ? 58  LYS A CB    1 
ATOM   826  C CG    . LYS C 2 57  ? 15.217  3.465   28.715  1.00 39.54 ? 58  LYS A CG    1 
ATOM   827  C CD    . LYS C 2 57  ? 14.507  4.816   28.846  1.00 44.66 ? 58  LYS A CD    1 
ATOM   828  C CE    . LYS C 2 57  ? 14.659  5.432   30.262  1.00 48.22 ? 58  LYS A CE    1 
ATOM   829  N NZ    . LYS C 2 57  ? 16.087  5.695   30.713  1.00 47.46 ? 58  LYS A NZ    1 
ATOM   830  N N     . HIS C 2 58  ? 14.508  -0.189  27.642  1.00 33.50 ? 59  HIS A N     1 
ATOM   831  C CA    . HIS C 2 58  ? 13.880  -1.204  28.473  1.00 31.23 ? 59  HIS A CA    1 
ATOM   832  C C     . HIS C 2 58  ? 14.383  -2.610  28.154  1.00 28.13 ? 59  HIS A C     1 
ATOM   833  O O     . HIS C 2 58  ? 13.677  -3.593  28.341  1.00 28.91 ? 59  HIS A O     1 
ATOM   834  C CB    . HIS C 2 58  ? 12.371  -1.128  28.314  1.00 31.51 ? 59  HIS A CB    1 
ATOM   835  C CG    . HIS C 2 58  ? 11.783  0.169   28.769  1.00 31.29 ? 59  HIS A CG    1 
ATOM   836  N ND1   . HIS C 2 58  ? 10.946  0.261   29.857  1.00 34.73 ? 59  HIS A ND1   1 
ATOM   837  C CD2   . HIS C 2 58  ? 11.895  1.423   28.274  1.00 34.85 ? 59  HIS A CD2   1 
ATOM   838  C CE1   . HIS C 2 58  ? 10.564  1.516   30.013  1.00 35.90 ? 59  HIS A CE1   1 
ATOM   839  N NE2   . HIS C 2 58  ? 11.125  2.243   29.065  1.00 33.74 ? 59  HIS A NE2   1 
ATOM   840  N N     . GLY C 2 59  ? 15.584  -2.680  27.607  1.00 28.61 ? 60  GLY A N     1 
ATOM   841  C CA    . GLY C 2 59  ? 16.194  -3.951  27.292  1.00 30.57 ? 60  GLY A CA    1 
ATOM   842  C C     . GLY C 2 59  ? 15.466  -4.886  26.365  1.00 31.43 ? 60  GLY A C     1 
ATOM   843  O O     . GLY C 2 59  ? 15.718  -6.093  26.368  1.00 35.10 ? 60  GLY A O     1 
ATOM   844  N N     . TYR C 2 60  ? 14.539  -4.371  25.585  1.00 32.93 ? 61  TYR A N     1 
ATOM   845  C CA    . TYR C 2 60  ? 13.860  -5.260  24.664  1.00 35.82 ? 61  TYR A CA    1 
ATOM   846  C C     . TYR C 2 60  ? 14.610  -5.250  23.346  1.00 35.75 ? 61  TYR A C     1 
ATOM   847  O O     . TYR C 2 60  ? 15.429  -4.348  23.085  1.00 35.46 ? 61  TYR A O     1 
ATOM   848  C CB    . TYR C 2 60  ? 12.413  -4.835  24.428  1.00 36.64 ? 61  TYR A CB    1 
ATOM   849  C CG    . TYR C 2 60  ? 11.444  -5.086  25.570  1.00 34.37 ? 61  TYR A CG    1 
ATOM   850  C CD1   . TYR C 2 60  ? 11.384  -4.224  26.666  1.00 29.46 ? 61  TYR A CD1   1 
ATOM   851  C CD2   . TYR C 2 60  ? 10.493  -6.111  25.479  1.00 36.11 ? 61  TYR A CD2   1 
ATOM   852  C CE1   . TYR C 2 60  ? 10.402  -4.367  27.630  1.00 28.29 ? 61  TYR A CE1   1 
ATOM   853  C CE2   . TYR C 2 60  ? 9.508   -6.252  26.435  1.00 33.34 ? 61  TYR A CE2   1 
ATOM   854  C CZ    . TYR C 2 60  ? 9.468   -5.372  27.503  1.00 29.27 ? 61  TYR A CZ    1 
ATOM   855  O OH    . TYR C 2 60  ? 8.449   -5.473  28.411  1.00 31.69 ? 61  TYR A OH    1 
ATOM   856  N N     . ILE C 2 61  ? 14.362  -6.290  22.556  1.00 35.82 ? 62  ILE A N     1 
ATOM   857  C CA    . ILE C 2 61  ? 14.950  -6.452  21.231  1.00 35.62 ? 62  ILE A CA    1 
ATOM   858  C C     . ILE C 2 61  ? 13.797  -6.102  20.292  1.00 33.83 ? 62  ILE A C     1 
ATOM   859  O O     . ILE C 2 61  ? 12.624  -6.208  20.685  1.00 34.67 ? 62  ILE A O     1 
ATOM   860  C CB    . ILE C 2 61  ? 15.355  -7.923  20.960  1.00 37.02 ? 62  ILE A CB    1 
ATOM   861  C CG1   . ILE C 2 61  ? 16.098  -8.524  22.156  1.00 35.32 ? 62  ILE A CG1   1 
ATOM   862  C CG2   . ILE C 2 61  ? 16.235  -7.997  19.724  1.00 39.57 ? 62  ILE A CG2   1 
ATOM   863  C CD1   . ILE C 2 61  ? 16.270  -10.025 22.040  1.00 35.38 ? 62  ILE A CD1   1 
ATOM   864  N N     . VAL C 2 62  ? 14.111  -5.641  19.090  1.00 30.98 ? 63  VAL A N     1 
ATOM   865  C CA    . VAL C 2 62  ? 13.061  -5.302  18.139  1.00 31.75 ? 63  VAL A CA    1 
ATOM   866  C C     . VAL C 2 62  ? 13.300  -6.058  16.841  1.00 31.13 ? 63  VAL A C     1 
ATOM   867  O O     . VAL C 2 62  ? 14.393  -6.005  16.300  1.00 36.80 ? 63  VAL A O     1 
ATOM   868  C CB    . VAL C 2 62  ? 12.986  -3.776  17.899  1.00 32.10 ? 63  VAL A CB    1 
ATOM   869  C CG1   . VAL C 2 62  ? 12.045  -3.451  16.759  1.00 32.30 ? 63  VAL A CG1   1 
ATOM   870  C CG2   . VAL C 2 62  ? 12.471  -3.100  19.140  1.00 31.75 ? 63  VAL A CG2   1 
ATOM   871  N N     . GLU C 2 63  ? 12.301  -6.805  16.376  1.00 30.87 ? 64  GLU A N     1 
ATOM   872  C CA    . GLU C 2 63  ? 12.422  -7.581  15.146  1.00 26.60 ? 64  GLU A CA    1 
ATOM   873  C C     . GLU C 2 63  ? 11.284  -7.274  14.203  1.00 24.95 ? 64  GLU A C     1 
ATOM   874  O O     . GLU C 2 63  ? 10.148  -7.164  14.635  1.00 27.61 ? 64  GLU A O     1 
ATOM   875  C CB    . GLU C 2 63  ? 12.383  -9.060  15.463  1.00 26.70 ? 64  GLU A CB    1 
ATOM   876  C CG    . GLU C 2 63  ? 13.605  -9.578  16.183  1.00 32.65 ? 64  GLU A CG    1 
ATOM   877  C CD    . GLU C 2 63  ? 13.579  -11.100 16.384  1.00 35.39 ? 64  GLU A CD    1 
ATOM   878  O OE1   . GLU C 2 63  ? 12.760  -11.811 15.755  1.00 34.25 ? 64  GLU A OE1   1 
ATOM   879  O OE2   . GLU C 2 63  ? 14.404  -11.581 17.177  1.00 35.77 ? 64  GLU A OE2   1 
ATOM   880  N N     . GLU C 2 64  ? 11.589  -7.163  12.917  1.00 22.17 ? 65  GLU A N     1 
ATOM   881  C CA    . GLU C 2 64  ? 10.591  -6.893  11.874  1.00 21.98 ? 65  GLU A CA    1 
ATOM   882  C C     . GLU C 2 64  ? 10.382  -8.153  11.004  1.00 19.63 ? 65  GLU A C     1 
ATOM   883  O O     . GLU C 2 64  ? 11.134  -9.119  11.148  1.00 20.04 ? 65  GLU A O     1 
ATOM   884  C CB    . GLU C 2 64  ? 11.067  -5.692  11.039  1.00 24.40 ? 65  GLU A CB    1 
ATOM   885  C CG    . GLU C 2 64  ? 11.269  -4.461  11.898  1.00 21.53 ? 65  GLU A CG    1 
ATOM   886  C CD    . GLU C 2 64  ? 11.783  -3.293  11.144  1.00 22.75 ? 65  GLU A CD    1 
ATOM   887  O OE1   . GLU C 2 64  ? 13.010  -3.164  11.011  1.00 30.82 ? 65  GLU A OE1   1 
ATOM   888  O OE2   . GLU C 2 64  ? 10.968  -2.482  10.683  1.00 33.84 ? 65  GLU A OE2   1 
ATOM   889  N N     . PRO C 2 65  ? 9.328   -8.189  10.151  1.00 22.31 ? 66  PRO A N     1 
ATOM   890  C CA    . PRO C 2 65  ? 9.118   -9.384  9.314   1.00 25.56 ? 66  PRO A CA    1 
ATOM   891  C C     . PRO C 2 65  ? 10.216  -9.580  8.267   1.00 30.28 ? 66  PRO A C     1 
ATOM   892  O O     . PRO C 2 65  ? 10.792  -8.616  7.756   1.00 34.65 ? 66  PRO A O     1 
ATOM   893  C CB    . PRO C 2 65  ? 7.775   -9.107  8.635   1.00 20.16 ? 66  PRO A CB    1 
ATOM   894  C CG    . PRO C 2 65  ? 7.107   -8.154  9.536   1.00 19.19 ? 66  PRO A CG    1 
ATOM   895  C CD    . PRO C 2 65  ? 8.218   -7.246  9.947   1.00 17.19 ? 66  PRO A CD    1 
ATOM   896  N N     . LYS C 2 66  ? 10.504  -10.836 7.962   1.00 36.22 ? 67  LYS A N     1 
ATOM   897  C CA    . LYS C 2 66  ? 11.535  -11.192 6.993   1.00 39.64 ? 67  LYS A CA    1 
ATOM   898  C C     . LYS C 2 66  ? 10.923  -11.366 5.610   1.00 42.56 ? 67  LYS A C     1 
ATOM   899  O O     . LYS C 2 66  ? 11.622  -11.276 4.598   1.00 43.76 ? 67  LYS A O     1 
ATOM   900  C CB    . LYS C 2 66  ? 12.239  -12.473 7.425   1.00 39.03 ? 67  LYS A CB    1 
ATOM   901  N N     . GLN C 2 67  ? 9.635   -11.707 5.585   1.00 44.02 ? 68  GLN A N     1 
ATOM   902  C CA    . GLN C 2 67  ? 8.878   -11.879 4.345   1.00 43.24 ? 68  GLN A CA    1 
ATOM   903  C C     . GLN C 2 67  ? 7.730   -10.897 4.518   1.00 41.02 ? 68  GLN A C     1 
ATOM   904  O O     . GLN C 2 67  ? 7.350   -10.605 5.656   1.00 37.70 ? 68  GLN A O     1 
ATOM   905  C CB    . GLN C 2 67  ? 8.358   -13.316 4.208   1.00 46.87 ? 68  GLN A CB    1 
ATOM   906  N N     . GLN C 2 68  ? 7.224   -10.345 3.416   1.00 41.48 ? 69  GLN A N     1 
ATOM   907  C CA    . GLN C 2 68  ? 6.129   -9.371  3.489   1.00 41.55 ? 69  GLN A CA    1 
ATOM   908  C C     . GLN C 2 68  ? 4.825   -10.112 3.747   1.00 41.07 ? 69  GLN A C     1 
ATOM   909  O O     . GLN C 2 68  ? 4.803   -11.358 3.756   1.00 40.21 ? 69  GLN A O     1 
ATOM   910  C CB    . GLN C 2 68  ? 6.038   -8.513  2.204   1.00 46.31 ? 69  GLN A CB    1 
ATOM   911  C CG    . GLN C 2 68  ? 5.390   -7.103  2.398   1.00 48.73 ? 69  GLN A CG    1 
ATOM   912  C CD    . GLN C 2 68  ? 5.260   -6.267  1.094   1.00 49.20 ? 69  GLN A CD    1 
ATOM   913  O OE1   . GLN C 2 68  ? 5.979   -5.278  0.893   1.00 47.95 ? 69  GLN A OE1   1 
ATOM   914  N NE2   . GLN C 2 68  ? 4.323   -6.644  0.240   1.00 47.13 ? 69  GLN A NE2   1 
ATOM   915  N N     . ASN C 2 69  ? 3.763   -9.343  4.001   1.00 36.12 ? 70  ASN A N     1 
ATOM   916  C CA    . ASN C 2 69  ? 2.432   -9.883  4.283   1.00 32.79 ? 70  ASN A CA    1 
ATOM   917  C C     . ASN C 2 69  ? 2.346   -10.590 5.630   1.00 26.63 ? 70  ASN A C     1 
ATOM   918  O O     . ASN C 2 69  ? 1.360   -11.249 5.923   1.00 26.32 ? 70  ASN A O     1 
ATOM   919  C CB    . ASN C 2 69  ? 1.955   -10.824 3.153   1.00 36.73 ? 70  ASN A CB    1 
ATOM   920  N N     . HIS C 2 70  ? 3.401   -10.496 6.424   1.00 24.98 ? 71  HIS A N     1 
ATOM   921  C CA    . HIS C 2 70  ? 3.414   -11.101 7.756   1.00 28.15 ? 71  HIS A CA    1 
ATOM   922  C C     . HIS C 2 70  ? 3.285   -10.023 8.823   1.00 26.75 ? 71  HIS A C     1 
ATOM   923  O O     . HIS C 2 70  ? 4.049   -9.059  8.836   1.00 29.69 ? 71  HIS A O     1 
ATOM   924  C CB    . HIS C 2 70  ? 4.706   -11.871 8.009   1.00 31.34 ? 71  HIS A CB    1 
ATOM   925  C CG    . HIS C 2 70  ? 4.791   -13.167 7.270   1.00 34.80 ? 71  HIS A CG    1 
ATOM   926  N ND1   . HIS C 2 70  ? 3.739   -13.681 6.550   1.00 38.97 ? 71  HIS A ND1   1 
ATOM   927  C CD2   . HIS C 2 70  ? 5.789   -14.076 7.177   1.00 39.88 ? 71  HIS A CD2   1 
ATOM   928  C CE1   . HIS C 2 70  ? 4.079   -14.855 6.048   1.00 42.28 ? 71  HIS A CE1   1 
ATOM   929  N NE2   . HIS C 2 70  ? 5.319   -15.117 6.414   1.00 40.96 ? 71  HIS A NE2   1 
ATOM   930  N N     . TYR C 2 71  ? 2.322   -10.208 9.711   1.00 22.54 ? 72  TYR A N     1 
ATOM   931  C CA    . TYR C 2 71  ? 2.050   -9.307  10.815  1.00 20.89 ? 72  TYR A CA    1 
ATOM   932  C C     . TYR C 2 71  ? 3.036   -9.713  11.920  1.00 22.81 ? 72  TYR A C     1 
ATOM   933  O O     . TYR C 2 71  ? 3.408   -10.888 12.007  1.00 22.63 ? 72  TYR A O     1 
ATOM   934  C CB    . TYR C 2 71  ? 0.575   -9.526  11.205  1.00 24.77 ? 72  TYR A CB    1 
ATOM   935  C CG    . TYR C 2 71  ? 0.146   -8.995  12.546  1.00 25.74 ? 72  TYR A CG    1 
ATOM   936  C CD1   . TYR C 2 71  ? 0.283   -9.777  13.694  1.00 24.60 ? 72  TYR A CD1   1 
ATOM   937  C CD2   . TYR C 2 71  ? -0.373  -7.709  12.672  1.00 22.70 ? 72  TYR A CD2   1 
ATOM   938  C CE1   . TYR C 2 71  ? -0.078  -9.295  14.921  1.00 21.42 ? 72  TYR A CE1   1 
ATOM   939  C CE2   . TYR C 2 71  ? -0.736  -7.207  13.912  1.00 23.18 ? 72  TYR A CE2   1 
ATOM   940  C CZ    . TYR C 2 71  ? -0.583  -8.008  15.031  1.00 22.52 ? 72  TYR A CZ    1 
ATOM   941  O OH    . TYR C 2 71  ? -0.924  -7.527  16.268  1.00 24.09 ? 72  TYR A OH    1 
ATOM   942  N N     . PRO C 2 72  ? 3.455   -8.769  12.801  1.00 21.41 ? 73  PRO A N     1 
ATOM   943  C CA    . PRO C 2 72  ? 3.174   -7.346  12.978  1.00 19.01 ? 73  PRO A CA    1 
ATOM   944  C C     . PRO C 2 72  ? 4.351   -6.525  12.468  1.00 17.46 ? 73  PRO A C     1 
ATOM   945  O O     . PRO C 2 72  ? 5.420   -7.076  12.213  1.00 19.56 ? 73  PRO A O     1 
ATOM   946  C CB    . PRO C 2 72  ? 3.092   -7.233  14.496  1.00 15.06 ? 73  PRO A CB    1 
ATOM   947  C CG    . PRO C 2 72  ? 4.256   -8.050  14.903  1.00 17.90 ? 73  PRO A CG    1 
ATOM   948  C CD    . PRO C 2 72  ? 4.242   -9.260  13.949  1.00 18.59 ? 73  PRO A CD    1 
ATOM   949  N N     . ASP C 2 73  ? 4.169   -5.212  12.404  1.00 18.30 ? 74  ASP A N     1 
ATOM   950  C CA    . ASP C 2 73  ? 5.231   -4.317  11.954  1.00 17.80 ? 74  ASP A CA    1 
ATOM   951  C C     . ASP C 2 73  ? 6.449   -4.468  12.827  1.00 17.65 ? 74  ASP A C     1 
ATOM   952  O O     . ASP C 2 73  ? 7.568   -4.456  12.337  1.00 18.15 ? 74  ASP A O     1 
ATOM   953  C CB    . ASP C 2 73  ? 4.776   -2.848  11.946  1.00 16.74 ? 74  ASP A CB    1 
ATOM   954  C CG    . ASP C 2 73  ? 3.752   -2.542  10.847  1.00 18.10 ? 74  ASP A CG    1 
ATOM   955  O OD1   . ASP C 2 73  ? 3.635   -3.326  9.868   1.00 17.16 ? 74  ASP A OD1   1 
ATOM   956  O OD2   . ASP C 2 73  ? 3.067   -1.509  10.968  1.00 9.40  ? 74  ASP A OD2   1 
ATOM   957  N N     . PHE C 2 74  ? 6.244   -4.592  14.134  1.00 23.38 ? 75  PHE A N     1 
ATOM   958  C CA    . PHE C 2 74  ? 7.368   -4.771  15.052  1.00 19.67 ? 75  PHE A CA    1 
ATOM   959  C C     . PHE C 2 74  ? 7.056   -5.767  16.136  1.00 20.94 ? 75  PHE A C     1 
ATOM   960  O O     . PHE C 2 74  ? 5.989   -5.728  16.749  1.00 20.10 ? 75  PHE A O     1 
ATOM   961  C CB    . PHE C 2 74  ? 7.770   -3.452  15.720  1.00 24.85 ? 75  PHE A CB    1 
ATOM   962  C CG    . PHE C 2 74  ? 7.960   -2.345  14.762  1.00 27.34 ? 75  PHE A CG    1 
ATOM   963  C CD1   . PHE C 2 74  ? 9.123   -2.250  14.029  1.00 29.04 ? 75  PHE A CD1   1 
ATOM   964  C CD2   . PHE C 2 74  ? 6.931   -1.443  14.524  1.00 30.83 ? 75  PHE A CD2   1 
ATOM   965  C CE1   . PHE C 2 74  ? 9.257   -1.294  13.080  1.00 26.75 ? 75  PHE A CE1   1 
ATOM   966  C CE2   . PHE C 2 74  ? 7.063   -0.484  13.576  1.00 30.60 ? 75  PHE A CE2   1 
ATOM   967  C CZ    . PHE C 2 74  ? 8.232   -0.411  12.849  1.00 31.47 ? 75  PHE A CZ    1 
ATOM   968  N N     . THR C 2 75  ? 8.008   -6.654  16.383  1.00 22.27 ? 76  THR A N     1 
ATOM   969  C CA    . THR C 2 75  ? 7.863   -7.646  17.428  1.00 21.05 ? 76  THR A CA    1 
ATOM   970  C C     . THR C 2 75  ? 8.920   -7.293  18.452  1.00 19.20 ? 76  THR A C     1 
ATOM   971  O O     . THR C 2 75  ? 10.083  -7.119  18.102  1.00 16.45 ? 76  THR A O     1 
ATOM   972  C CB    . THR C 2 75  ? 8.076   -9.063  16.876  1.00 18.88 ? 76  THR A CB    1 
ATOM   973  O OG1   . THR C 2 75  ? 6.971   -9.410  16.048  1.00 18.31 ? 76  THR A OG1   1 
ATOM   974  C CG2   . THR C 2 75  ? 8.207   -10.077 17.978  1.00 18.09 ? 76  THR A CG2   1 
ATOM   975  N N     . LEU C 2 76  ? 8.488   -7.018  19.679  1.00 22.51 ? 77  LEU A N     1 
ATOM   976  C CA    . LEU C 2 76  ? 9.432   -6.713  20.758  1.00 23.66 ? 77  LEU A CA    1 
ATOM   977  C C     . LEU C 2 76  ? 9.407   -7.828  21.750  1.00 25.35 ? 77  LEU A C     1 
ATOM   978  O O     . LEU C 2 76  ? 8.362   -8.459  21.973  1.00 25.09 ? 77  LEU A O     1 
ATOM   979  C CB    . LEU C 2 76  ? 9.071   -5.459  21.529  1.00 21.73 ? 77  LEU A CB    1 
ATOM   980  C CG    . LEU C 2 76  ? 9.339   -4.135  20.870  1.00 21.64 ? 77  LEU A CG    1 
ATOM   981  C CD1   . LEU C 2 76  ? 8.469   -3.978  19.608  1.00 21.50 ? 77  LEU A CD1   1 
ATOM   982  C CD2   . LEU C 2 76  ? 9.044   -3.060  21.933  1.00 22.49 ? 77  LEU A CD2   1 
ATOM   983  N N     . TYR C 2 77  ? 10.563  -8.061  22.353  1.00 32.24 ? 78  TYR A N     1 
ATOM   984  C CA    . TYR C 2 77  ? 10.702  -9.086  23.378  1.00 32.81 ? 78  TYR A CA    1 
ATOM   985  C C     . TYR C 2 77  ? 12.068  -9.057  24.029  1.00 33.88 ? 78  TYR A C     1 
ATOM   986  O O     . TYR C 2 77  ? 12.955  -8.296  23.639  1.00 35.01 ? 78  TYR A O     1 
ATOM   987  C CB    . TYR C 2 77  ? 10.383  -10.486 22.828  1.00 28.42 ? 78  TYR A CB    1 
ATOM   988  C CG    . TYR C 2 77  ? 11.379  -11.061 21.871  1.00 31.09 ? 78  TYR A CG    1 
ATOM   989  C CD1   . TYR C 2 77  ? 11.531  -10.553 20.586  1.00 30.45 ? 78  TYR A CD1   1 
ATOM   990  C CD2   . TYR C 2 77  ? 12.173  -12.138 22.258  1.00 34.62 ? 78  TYR A CD2   1 
ATOM   991  C CE1   . TYR C 2 77  ? 12.457  -11.113 19.714  1.00 34.09 ? 78  TYR A CE1   1 
ATOM   992  C CE2   . TYR C 2 77  ? 13.090  -12.696 21.414  1.00 31.09 ? 78  TYR A CE2   1 
ATOM   993  C CZ    . TYR C 2 77  ? 13.231  -12.190 20.150  1.00 34.33 ? 78  TYR A CZ    1 
ATOM   994  O OH    . TYR C 2 77  ? 14.162  -12.803 19.357  1.00 37.37 ? 78  TYR A OH    1 
ATOM   995  N N     . LYS C 2 78  ? 12.188  -9.804  25.110  1.00 37.75 ? 79  LYS A N     1 
ATOM   996  C CA    . LYS C 2 78  ? 13.443  -9.908  25.819  1.00 39.65 ? 79  LYS A CA    1 
ATOM   997  C C     . LYS C 2 78  ? 13.918  -11.343 25.568  1.00 40.00 ? 79  LYS A C     1 
ATOM   998  O O     . LYS C 2 78  ? 13.123  -12.294 25.606  1.00 36.97 ? 79  LYS A O     1 
ATOM   999  C CB    . LYS C 2 78  ? 13.221  -9.630  27.298  1.00 39.10 ? 79  LYS A CB    1 
ATOM   1000 C CG    . LYS C 2 78  ? 12.689  -8.250  27.613  1.00 38.91 ? 79  LYS A CG    1 
ATOM   1001 C CD    . LYS C 2 78  ? 12.500  -8.165  29.109  1.00 43.28 ? 79  LYS A CD    1 
ATOM   1002 C CE    . LYS C 2 78  ? 12.125  -6.792  29.591  1.00 46.80 ? 79  LYS A CE    1 
ATOM   1003 N NZ    . LYS C 2 78  ? 11.932  -6.816  31.067  1.00 48.45 ? 79  LYS A NZ    1 
ATOM   1004 N N     . PRO C 2 79  ? 15.205  -11.514 25.245  1.00 43.72 ? 80  PRO A N     1 
ATOM   1005 C CA    . PRO C 2 79  ? 15.565  -12.913 25.015  1.00 46.72 ? 80  PRO A CA    1 
ATOM   1006 C C     . PRO C 2 79  ? 15.258  -13.811 26.215  1.00 48.31 ? 80  PRO A C     1 
ATOM   1007 O O     . PRO C 2 79  ? 14.609  -14.852 26.057  1.00 49.28 ? 80  PRO A O     1 
ATOM   1008 C CB    . PRO C 2 79  ? 17.056  -12.837 24.675  1.00 47.95 ? 80  PRO A CB    1 
ATOM   1009 C CG    . PRO C 2 79  ? 17.525  -11.662 25.437  1.00 46.81 ? 80  PRO A CG    1 
ATOM   1010 C CD    . PRO C 2 79  ? 16.402  -10.658 25.251  1.00 47.52 ? 80  PRO A CD    1 
ATOM   1011 N N     . SER C 2 80  ? 15.591  -13.347 27.419  1.00 46.67 ? 81  SER A N     1 
ATOM   1012 C CA    . SER C 2 80  ? 15.339  -14.124 28.628  1.00 48.08 ? 81  SER A CA    1 
ATOM   1013 C C     . SER C 2 80  ? 13.873  -14.519 28.826  1.00 48.58 ? 81  SER A C     1 
ATOM   1014 O O     . SER C 2 80  ? 13.552  -15.186 29.808  1.00 52.80 ? 81  SER A O     1 
ATOM   1015 C CB    . SER C 2 80  ? 15.811  -13.352 29.858  1.00 48.87 ? 81  SER A CB    1 
ATOM   1016 O OG    . SER C 2 80  ? 15.004  -12.203 30.107  1.00 50.49 ? 81  SER A OG    1 
ATOM   1017 N N     . GLU C 2 81  ? 12.989  -14.076 27.933  1.00 46.68 ? 82  GLU A N     1 
ATOM   1018 C CA    . GLU C 2 81  ? 11.563  -14.373 28.028  1.00 46.31 ? 82  GLU A CA    1 
ATOM   1019 C C     . GLU C 2 81  ? 10.910  -14.346 26.642  1.00 46.62 ? 82  GLU A C     1 
ATOM   1020 O O     . GLU C 2 81  ? 10.089  -13.467 26.355  1.00 44.61 ? 82  GLU A O     1 
ATOM   1021 C CB    . GLU C 2 81  ? 10.890  -13.358 28.943  1.00 43.91 ? 82  GLU A CB    1 
ATOM   1022 N N     . PRO C 2 82  ? 11.213  -15.354 25.792  1.00 50.26 ? 83  PRO A N     1 
ATOM   1023 C CA    . PRO C 2 82  ? 10.759  -15.604 24.409  1.00 50.48 ? 83  PRO A CA    1 
ATOM   1024 C C     . PRO C 2 82  ? 9.280   -15.954 24.174  1.00 47.20 ? 83  PRO A C     1 
ATOM   1025 O O     . PRO C 2 82  ? 8.885   -16.219 23.033  1.00 45.67 ? 83  PRO A O     1 
ATOM   1026 C CB    . PRO C 2 82  ? 11.649  -16.767 23.975  1.00 51.76 ? 83  PRO A CB    1 
ATOM   1027 C CG    . PRO C 2 82  ? 11.732  -17.576 25.241  1.00 52.96 ? 83  PRO A CG    1 
ATOM   1028 C CD    . PRO C 2 82  ? 12.033  -16.487 26.269  1.00 52.66 ? 83  PRO A CD    1 
ATOM   1029 N N     . ASN C 2 83  ? 8.477   -15.951 25.234  1.00 45.09 ? 84  ASN A N     1 
ATOM   1030 C CA    . ASN C 2 83  ? 7.055   -16.284 25.138  1.00 41.40 ? 84  ASN A CA    1 
ATOM   1031 C C     . ASN C 2 83  ? 6.128   -15.105 25.402  1.00 37.90 ? 84  ASN A C     1 
ATOM   1032 O O     . ASN C 2 83  ? 4.945   -15.169 25.107  1.00 37.27 ? 84  ASN A O     1 
ATOM   1033 C CB    . ASN C 2 83  ? 6.729   -17.426 26.092  1.00 46.06 ? 84  ASN A CB    1 
ATOM   1034 N N     . LYS C 2 84  ? 6.657   -14.063 26.034  1.00 35.80 ? 85  LYS A N     1 
ATOM   1035 C CA    . LYS C 2 84  ? 5.883   -12.868 26.332  1.00 35.34 ? 85  LYS A CA    1 
ATOM   1036 C C     . LYS C 2 84  ? 6.269   -11.767 25.316  1.00 34.35 ? 85  LYS A C     1 
ATOM   1037 O O     . LYS C 2 84  ? 6.955   -10.790 25.638  1.00 39.48 ? 85  LYS A O     1 
ATOM   1038 C CB    . LYS C 2 84  ? 6.123   -12.431 27.789  1.00 30.57 ? 85  LYS A CB    1 
ATOM   1039 N N     . LYS C 2 85  ? 5.830   -11.942 24.074  1.00 30.79 ? 86  LYS A N     1 
ATOM   1040 C CA    . LYS C 2 85  ? 6.139   -10.988 23.013  1.00 25.08 ? 86  LYS A CA    1 
ATOM   1041 C C     . LYS C 2 85  ? 5.094   -9.893  22.865  1.00 20.98 ? 86  LYS A C     1 
ATOM   1042 O O     . LYS C 2 85  ? 3.942   -10.049 23.276  1.00 19.89 ? 86  LYS A O     1 
ATOM   1043 C CB    . LYS C 2 85  ? 6.310   -11.724 21.691  1.00 19.73 ? 86  LYS A CB    1 
ATOM   1044 C CG    . LYS C 2 85  ? 7.461   -12.671 21.686  1.00 17.26 ? 86  LYS A CG    1 
ATOM   1045 C CD    . LYS C 2 85  ? 7.531   -13.382 20.366  1.00 15.67 ? 86  LYS A CD    1 
ATOM   1046 C CE    . LYS C 2 85  ? 8.970   -13.661 19.986  1.00 17.32 ? 86  LYS A CE    1 
ATOM   1047 N NZ    . LYS C 2 85  ? 9.359   -15.071 20.215  1.00 18.89 ? 86  LYS A NZ    1 
ATOM   1048 N N     . ILE C 2 86  ? 5.517   -8.761  22.323  1.00 22.71 ? 87  ILE A N     1 
ATOM   1049 C CA    . ILE C 2 86  ? 4.602   -7.648  22.093  1.00 23.71 ? 87  ILE A CA    1 
ATOM   1050 C C     . ILE C 2 86  ? 4.573   -7.320  20.597  1.00 22.22 ? 87  ILE A C     1 
ATOM   1051 O O     . ILE C 2 86  ? 5.623   -7.208  19.942  1.00 19.07 ? 87  ILE A O     1 
ATOM   1052 C CB    . ILE C 2 86  ? 4.970   -6.371  22.933  1.00 27.57 ? 87  ILE A CB    1 
ATOM   1053 C CG1   . ILE C 2 86  ? 5.034   -6.724  24.429  1.00 23.71 ? 87  ILE A CG1   1 
ATOM   1054 C CG2   . ILE C 2 86  ? 3.922   -5.244  22.696  1.00 25.71 ? 87  ILE A CG2   1 
ATOM   1055 C CD1   . ILE C 2 86  ? 5.571   -5.603  25.280  1.00 27.00 ? 87  ILE A CD1   1 
ATOM   1056 N N     . ALA C 2 87  ? 3.356   -7.217  20.071  1.00 21.87 ? 88  ALA A N     1 
ATOM   1057 C CA    . ALA C 2 87  ? 3.106   -6.922  18.665  1.00 21.86 ? 88  ALA A CA    1 
ATOM   1058 C C     . ALA C 2 87  ? 2.715   -5.456  18.504  1.00 19.98 ? 88  ALA A C     1 
ATOM   1059 O O     . ALA C 2 87  ? 1.750   -5.002  19.127  1.00 20.84 ? 88  ALA A O     1 
ATOM   1060 C CB    . ALA C 2 87  ? 1.975   -7.821  18.146  1.00 15.67 ? 88  ALA A CB    1 
ATOM   1061 N N     . ILE C 2 88  ? 3.472   -4.717  17.689  1.00 22.71 ? 89  ILE A N     1 
ATOM   1062 C CA    . ILE C 2 88  ? 3.175   -3.305  17.412  1.00 17.16 ? 89  ILE A CA    1 
ATOM   1063 C C     . ILE C 2 88  ? 2.939   -3.078  15.910  1.00 15.63 ? 89  ILE A C     1 
ATOM   1064 O O     . ILE C 2 88  ? 3.794   -3.367  15.064  1.00 13.12 ? 89  ILE A O     1 
ATOM   1065 C CB    . ILE C 2 88  ? 4.270   -2.360  17.894  1.00 17.67 ? 89  ILE A CB    1 
ATOM   1066 C CG1   . ILE C 2 88  ? 4.517   -2.531  19.415  1.00 20.20 ? 89  ILE A CG1   1 
ATOM   1067 C CG2   . ILE C 2 88  ? 3.868   -0.944  17.512  1.00 15.41 ? 89  ILE A CG2   1 
ATOM   1068 C CD1   . ILE C 2 88  ? 5.638   -1.641  20.007  1.00 19.00 ? 89  ILE A CD1   1 
ATOM   1069 N N     . ASP C 2 89  ? 1.770   -2.539  15.606  1.00 16.68 ? 90  ASP A N     1 
ATOM   1070 C CA    . ASP C 2 89  ? 1.334   -2.293  14.234  1.00 17.67 ? 90  ASP A CA    1 
ATOM   1071 C C     . ASP C 2 89  ? 0.972   -0.822  14.146  1.00 16.97 ? 90  ASP A C     1 
ATOM   1072 O O     . ASP C 2 89  ? 0.261   -0.293  15.034  1.00 14.54 ? 90  ASP A O     1 
ATOM   1073 C CB    . ASP C 2 89  ? 0.076   -3.149  13.937  1.00 20.81 ? 90  ASP A CB    1 
ATOM   1074 C CG    . ASP C 2 89  ? 0.157   -3.932  12.635  1.00 12.22 ? 90  ASP A CG    1 
ATOM   1075 O OD1   . ASP C 2 89  ? 1.217   -4.456  12.254  1.00 15.61 ? 90  ASP A OD1   1 
ATOM   1076 O OD2   . ASP C 2 89  ? -0.895  -4.071  12.005  1.00 22.12 ? 90  ASP A OD2   1 
ATOM   1077 N N     . ILE C 2 90  ? 1.490   -0.170  13.101  1.00 15.68 ? 91  ILE A N     1 
ATOM   1078 C CA    . ILE C 2 90  ? 1.232   1.238   12.844  1.00 15.67 ? 91  ILE A CA    1 
ATOM   1079 C C     . ILE C 2 90  ? 0.137   1.328   11.793  1.00 17.40 ? 91  ILE A C     1 
ATOM   1080 O O     . ILE C 2 90  ? 0.271   0.760   10.697  1.00 17.18 ? 91  ILE A O     1 
ATOM   1081 C CB    . ILE C 2 90  ? 2.524   1.976   12.368  1.00 20.05 ? 91  ILE A CB    1 
ATOM   1082 C CG1   . ILE C 2 90  ? 3.635   1.797   13.418  1.00 14.55 ? 91  ILE A CG1   1 
ATOM   1083 C CG2   . ILE C 2 90  ? 2.254   3.497   12.090  1.00 14.82 ? 91  ILE A CG2   1 
ATOM   1084 C CD1   . ILE C 2 90  ? 4.850   2.535   13.097  1.00 16.93 ? 91  ILE A CD1   1 
ATOM   1085 N N     . LYS C 2 91  ? -0.970  1.986   12.154  1.00 12.11 ? 92  LYS A N     1 
ATOM   1086 C CA    . LYS C 2 91  ? -2.117  2.178   11.266  1.00 13.78 ? 92  LYS A CA    1 
ATOM   1087 C C     . LYS C 2 91  ? -2.403  3.660   11.037  1.00 15.95 ? 92  LYS A C     1 
ATOM   1088 O O     . LYS C 2 91  ? -2.309  4.470   11.945  1.00 15.44 ? 92  LYS A O     1 
ATOM   1089 C CB    . LYS C 2 91  ? -3.350  1.441   11.793  1.00 9.29  ? 92  LYS A CB    1 
ATOM   1090 C CG    . LYS C 2 91  ? -3.041  -0.037  11.950  1.00 15.31 ? 92  LYS A CG    1 
ATOM   1091 C CD    . LYS C 2 91  ? -4.275  -0.893  12.103  1.00 21.77 ? 92  LYS A CD    1 
ATOM   1092 C CE    . LYS C 2 91  ? -3.913  -2.375  11.884  1.00 17.48 ? 92  LYS A CE    1 
ATOM   1093 N NZ    . LYS C 2 91  ? -3.313  -2.626  10.560  1.00 15.31 ? 92  LYS A NZ    1 
ATOM   1094 N N     . THR C 2 92  ? -2.716  4.009   9.799   1.00 15.50 ? 93  THR A N     1 
ATOM   1095 C CA    . THR C 2 92  ? -2.987  5.386   9.462   1.00 14.29 ? 93  THR A CA    1 
ATOM   1096 C C     . THR C 2 92  ? -4.359  5.552   8.746   1.00 16.76 ? 93  THR A C     1 
ATOM   1097 O O     . THR C 2 92  ? -4.906  4.607   8.142   1.00 13.07 ? 93  THR A O     1 
ATOM   1098 C CB    . THR C 2 92  ? -1.832  5.938   8.588   1.00 12.05 ? 93  THR A CB    1 
ATOM   1099 O OG1   . THR C 2 92  ? -0.580  5.614   9.180   1.00 13.15 ? 93  THR A OG1   1 
ATOM   1100 C CG2   . THR C 2 92  ? -1.900  7.429   8.440   1.00 9.07  ? 93  THR A CG2   1 
ATOM   1101 N N     . THR C 2 93  ? -4.933  6.742   8.938   1.00 18.84 ? 94  THR A N     1 
ATOM   1102 C CA    . THR C 2 93  ? -6.191  7.183   8.330   1.00 19.39 ? 94  THR A CA    1 
ATOM   1103 C C     . THR C 2 93  ? -6.166  8.730   8.271   1.00 18.99 ? 94  THR A C     1 
ATOM   1104 O O     . THR C 2 93  ? -5.289  9.390   8.839   1.00 16.68 ? 94  THR A O     1 
ATOM   1105 C CB    . THR C 2 93  ? -7.459  6.636   9.049   1.00 18.12 ? 94  THR A CB    1 
ATOM   1106 O OG1   . THR C 2 93  ? -8.582  6.716   8.155   1.00 16.87 ? 94  THR A OG1   1 
ATOM   1107 C CG2   . THR C 2 93  ? -7.785  7.454   10.311  1.00 16.58 ? 94  THR A CG2   1 
ATOM   1108 N N     . TYR C 2 94  ? -7.124  9.305   7.570   1.00 22.88 ? 95  TYR A N     1 
ATOM   1109 C CA    . TYR C 2 94  ? -7.157  10.741  7.402   1.00 22.97 ? 95  TYR A CA    1 
ATOM   1110 C C     . TYR C 2 94  ? -8.482  11.355  7.766   1.00 25.43 ? 95  TYR A C     1 
ATOM   1111 O O     . TYR C 2 94  ? -9.454  10.651  7.968   1.00 21.43 ? 95  TYR A O     1 
ATOM   1112 C CB    . TYR C 2 94  ? -6.818  11.087  5.972   1.00 29.69 ? 95  TYR A CB    1 
ATOM   1113 N N     . THR C 2 95  ? -8.501  12.683  7.764   1.00 28.30 ? 96  THR A N     1 
ATOM   1114 C CA    . THR C 2 95  ? -9.670  13.481  8.078   1.00 36.12 ? 96  THR A CA    1 
ATOM   1115 C C     . THR C 2 95  ? -9.524  14.852  7.352   1.00 39.23 ? 96  THR A C     1 
ATOM   1116 O O     . THR C 2 95  ? -8.413  15.343  7.152   1.00 39.73 ? 96  THR A O     1 
ATOM   1117 C CB    . THR C 2 95  ? -9.783  13.660  9.614   1.00 36.79 ? 96  THR A CB    1 
ATOM   1118 O OG1   . THR C 2 95  ? -11.162 13.760  9.995   1.00 37.07 ? 96  THR A OG1   1 
ATOM   1119 C CG2   . THR C 2 95  ? -9.011  14.912  10.069  1.00 36.56 ? 96  THR A CG2   1 
ATOM   1120 N N     . ASN C 2 96  ? -10.642 15.429  6.907   1.00 44.36 ? 97  ASN A N     1 
ATOM   1121 C CA    . ASN C 2 96  ? -10.626 16.720  6.194   1.00 46.94 ? 97  ASN A CA    1 
ATOM   1122 C C     . ASN C 2 96  ? -10.833 17.874  7.161   1.00 47.78 ? 97  ASN A C     1 
ATOM   1123 O O     . ASN C 2 96  ? -10.299 18.974  6.978   1.00 48.56 ? 97  ASN A O     1 
ATOM   1124 C CB    . ASN C 2 96  ? -11.727 16.775  5.126   1.00 44.94 ? 97  ASN A CB    1 
ATOM   1125 C CG    . ASN C 2 96  ? -11.927 15.459  4.442   1.00 41.72 ? 97  ASN A CG    1 
ATOM   1126 O OD1   . ASN C 2 96  ? -12.578 14.573  4.980   1.00 44.05 ? 97  ASN A OD1   1 
ATOM   1127 N ND2   . ASN C 2 96  ? -11.333 15.299  3.274   1.00 42.22 ? 97  ASN A ND2   1 
ATOM   1128 N N     . LYS C 2 97  ? -11.694 17.626  8.138   1.00 49.25 ? 98  LYS A N     1 
ATOM   1129 C CA    . LYS C 2 97  ? -12.033 18.591  9.159   1.00 47.57 ? 98  LYS A CA    1 
ATOM   1130 C C     . LYS C 2 97  ? -11.412 17.993  10.381  1.00 46.73 ? 98  LYS A C     1 
ATOM   1131 O O     . LYS C 2 97  ? -11.462 16.776  10.569  1.00 45.10 ? 98  LYS A O     1 
ATOM   1132 C CB    . LYS C 2 97  ? -13.558 18.679  9.323   1.00 47.89 ? 98  LYS A CB    1 
ATOM   1133 N N     . GLU C 2 98  ? -10.823 18.846  11.202  1.00 47.73 ? 99  GLU A N     1 
ATOM   1134 C CA    . GLU C 2 98  ? -10.162 18.402  12.409  1.00 48.95 ? 99  GLU A CA    1 
ATOM   1135 C C     . GLU C 2 98  ? -11.153 17.850  13.444  1.00 49.15 ? 99  GLU A C     1 
ATOM   1136 O O     . GLU C 2 98  ? -12.286 18.333  13.563  1.00 48.77 ? 99  GLU A O     1 
ATOM   1137 C CB    . GLU C 2 98  ? -9.340  19.556  12.995  1.00 50.60 ? 99  GLU A CB    1 
ATOM   1138 C CG    . GLU C 2 98  ? -8.264  19.141  13.999  1.00 51.14 ? 99  GLU A CG    1 
ATOM   1139 C CD    . GLU C 2 98  ? -7.220  18.234  13.393  1.00 50.24 ? 99  GLU A CD    1 
ATOM   1140 O OE1   . GLU C 2 98  ? -7.444  17.000  13.353  1.00 50.21 ? 99  GLU A OE1   1 
ATOM   1141 O OE2   . GLU C 2 98  ? -6.174  18.765  12.971  1.00 54.25 ? 99  GLU A OE2   1 
ATOM   1142 N N     . ASN C 2 99  ? -10.722 16.801  14.146  1.00 47.25 ? 100 ASN A N     1 
ATOM   1143 C CA    . ASN C 2 99  ? -11.503 16.146  15.193  1.00 46.18 ? 100 ASN A CA    1 
ATOM   1144 C C     . ASN C 2 99  ? -12.804 15.481  14.727  1.00 44.51 ? 100 ASN A C     1 
ATOM   1145 O O     . ASN C 2 99  ? -13.731 15.282  15.528  1.00 44.59 ? 100 ASN A O     1 
ATOM   1146 C CB    . ASN C 2 99  ? -11.763 17.120  16.360  1.00 45.38 ? 100 ASN A CB    1 
ATOM   1147 N N     . GLU C 2 100 ? -12.854 15.103  13.448  1.00 41.01 ? 101 GLU A N     1 
ATOM   1148 C CA    . GLU C 2 100 ? -14.029 14.422  12.875  1.00 38.97 ? 101 GLU A CA    1 
ATOM   1149 C C     . GLU C 2 100 ? -13.980 12.940  13.285  1.00 32.53 ? 101 GLU A C     1 
ATOM   1150 O O     . GLU C 2 100 ? -13.015 12.510  13.908  1.00 33.61 ? 101 GLU A O     1 
ATOM   1151 C CB    . GLU C 2 100 ? -14.038 14.566  11.315  1.00 38.33 ? 101 GLU A CB    1 
ATOM   1152 N N     . LYS C 2 101 ? -15.020 12.169  12.988  1.00 28.93 ? 102 LYS A N     1 
ATOM   1153 C CA    . LYS C 2 101 ? -14.995 10.745  13.337  1.00 26.06 ? 102 LYS A CA    1 
ATOM   1154 C C     . LYS C 2 101 ? -14.048 9.991   12.378  1.00 24.70 ? 102 LYS A C     1 
ATOM   1155 O O     . LYS C 2 101 ? -13.957 10.290  11.187  1.00 21.97 ? 102 LYS A O     1 
ATOM   1156 C CB    . LYS C 2 101 ? -16.416 10.147  13.315  1.00 21.83 ? 102 LYS A CB    1 
ATOM   1157 N N     . ILE C 2 102 ? -13.301 9.041   12.904  1.00 22.97 ? 103 ILE A N     1 
ATOM   1158 C CA    . ILE C 2 102 ? -12.370 8.284   12.081  1.00 21.32 ? 103 ILE A CA    1 
ATOM   1159 C C     . ILE C 2 102 ? -12.540 6.801   12.352  1.00 20.66 ? 103 ILE A C     1 
ATOM   1160 O O     . ILE C 2 102 ? -13.308 6.410   13.233  1.00 20.60 ? 103 ILE A O     1 
ATOM   1161 C CB    . ILE C 2 102 ? -10.905 8.677   12.389  1.00 25.39 ? 103 ILE A CB    1 
ATOM   1162 C CG1   . ILE C 2 102 ? -10.644 8.642   13.901  1.00 27.18 ? 103 ILE A CG1   1 
ATOM   1163 C CG2   . ILE C 2 102 ? -10.618 10.075  11.865  1.00 27.62 ? 103 ILE A CG2   1 
ATOM   1164 C CD1   . ILE C 2 102 ? -9.207  8.819   14.288  1.00 24.26 ? 103 ILE A CD1   1 
ATOM   1165 N N     . LYS C 2 103 ? -11.907 5.975   11.528  1.00 19.82 ? 104 LYS A N     1 
ATOM   1166 C CA    . LYS C 2 103 ? -11.962 4.523   11.704  1.00 20.22 ? 104 LYS A CA    1 
ATOM   1167 C C     . LYS C 2 103 ? -10.754 3.947   11.025  1.00 16.38 ? 104 LYS A C     1 
ATOM   1168 O O     . LYS C 2 103 ? -10.189 4.580   10.123  1.00 19.58 ? 104 LYS A O     1 
ATOM   1169 C CB    . LYS C 2 103 ? -13.284 3.885   11.208  1.00 22.29 ? 104 LYS A CB    1 
ATOM   1170 C CG    . LYS C 2 103 ? -13.328 3.420   9.762   1.00 28.73 ? 104 LYS A CG    1 
ATOM   1171 C CD    . LYS C 2 103 ? -14.641 2.696   9.444   1.00 26.59 ? 104 LYS A CD    1 
ATOM   1172 C CE    . LYS C 2 103 ? -15.762 3.646   9.011   1.00 28.14 ? 104 LYS A CE    1 
ATOM   1173 N NZ    . LYS C 2 103 ? -15.505 4.357   7.712   1.00 25.30 ? 104 LYS A NZ    1 
ATOM   1174 N N     . PHE C 2 104 ? -10.292 2.813   11.551  1.00 15.45 ? 105 PHE A N     1 
ATOM   1175 C CA    . PHE C 2 104 ? -9.099  2.136   11.040  1.00 13.88 ? 105 PHE A CA    1 
ATOM   1176 C C     . PHE C 2 104 ? -9.469  0.725   10.656  1.00 12.57 ? 105 PHE A C     1 
ATOM   1177 O O     . PHE C 2 104 ? -10.542 0.250   11.028  1.00 14.19 ? 105 PHE A O     1 
ATOM   1178 C CB    . PHE C 2 104 ? -8.015  2.042   12.134  1.00 11.00 ? 105 PHE A CB    1 
ATOM   1179 C CG    . PHE C 2 104 ? -7.667  3.357   12.751  1.00 11.77 ? 105 PHE A CG    1 
ATOM   1180 C CD1   . PHE C 2 104 ? -8.489  3.922   13.754  1.00 12.66 ? 105 PHE A CD1   1 
ATOM   1181 C CD2   . PHE C 2 104 ? -6.526  4.055   12.346  1.00 13.78 ? 105 PHE A CD2   1 
ATOM   1182 C CE1   . PHE C 2 104 ? -8.171  5.169   14.343  1.00 10.37 ? 105 PHE A CE1   1 
ATOM   1183 C CE2   . PHE C 2 104 ? -6.192  5.334   12.947  1.00 11.09 ? 105 PHE A CE2   1 
ATOM   1184 C CZ    . PHE C 2 104 ? -7.012  5.871   13.931  1.00 12.84 ? 105 PHE A CZ    1 
ATOM   1185 N N     . THR C 2 105 ? -8.623  0.112   9.831   1.00 11.75 ? 106 THR A N     1 
ATOM   1186 C CA    . THR C 2 105 ? -8.780  -1.285  9.449   1.00 15.36 ? 106 THR A CA    1 
ATOM   1187 C C     . THR C 2 105 ? -7.804  -1.876  10.462  1.00 13.82 ? 106 THR A C     1 
ATOM   1188 O O     . THR C 2 105 ? -6.759  -1.306  10.688  1.00 17.95 ? 106 THR A O     1 
ATOM   1189 C CB    . THR C 2 105 ? -8.367  -1.547  7.983   1.00 13.09 ? 106 THR A CB    1 
ATOM   1190 O OG1   . THR C 2 105 ? -7.140  -0.860  7.672   1.00 15.66 ? 106 THR A OG1   1 
ATOM   1191 C CG2   . THR C 2 105 ? -9.457  -1.043  7.062   1.00 16.25 ? 106 THR A CG2   1 
ATOM   1192 N N     . LEU C 2 106 ? -8.188  -2.940  11.153  1.00 19.93 ? 107 LEU A N     1 
ATOM   1193 C CA    . LEU C 2 106 ? -7.347  -3.489  12.204  1.00 15.84 ? 107 LEU A CA    1 
ATOM   1194 C C     . LEU C 2 106 ? -6.772  -4.852  11.968  1.00 15.79 ? 107 LEU A C     1 
ATOM   1195 O O     . LEU C 2 106 ? -6.424  -5.539  12.923  1.00 20.08 ? 107 LEU A O     1 
ATOM   1196 C CB    . LEU C 2 106 ? -8.104  -3.471  13.534  1.00 17.68 ? 107 LEU A CB    1 
ATOM   1197 C CG    . LEU C 2 106 ? -8.298  -2.105  14.208  1.00 17.14 ? 107 LEU A CG    1 
ATOM   1198 C CD1   . LEU C 2 106 ? -9.147  -2.282  15.461  1.00 12.75 ? 107 LEU A CD1   1 
ATOM   1199 C CD2   . LEU C 2 106 ? -6.938  -1.492  14.554  1.00 14.82 ? 107 LEU A CD2   1 
ATOM   1200 N N     . GLY C 2 107 ? -6.657  -5.258  10.713  1.00 14.86 ? 108 GLY A N     1 
ATOM   1201 C CA    . GLY C 2 107 ? -6.064  -6.561  10.450  1.00 13.32 ? 108 GLY A CA    1 
ATOM   1202 C C     . GLY C 2 107 ? -7.067  -7.631  10.099  1.00 11.17 ? 108 GLY A C     1 
ATOM   1203 O O     . GLY C 2 107 ? -8.253  -7.530  10.440  1.00 11.54 ? 108 GLY A O     1 
ATOM   1204 N N     . GLY C 2 108 ? -6.581  -8.655  9.409   1.00 12.09 ? 109 GLY A N     1 
ATOM   1205 C CA    . GLY C 2 108 ? -7.432  -9.732  8.964   1.00 14.56 ? 109 GLY A CA    1 
ATOM   1206 C C     . GLY C 2 108 ? -8.007  -10.505 10.115  1.00 23.43 ? 109 GLY A C     1 
ATOM   1207 O O     . GLY C 2 108 ? -7.385  -10.585 11.191  1.00 20.88 ? 109 GLY A O     1 
ATOM   1208 N N     . TYR C 2 109 ? -9.198  -11.064 9.901   1.00 23.71 ? 110 TYR A N     1 
ATOM   1209 C CA    . TYR C 2 109 ? -9.838  -11.858 10.946  1.00 26.47 ? 110 TYR A CA    1 
ATOM   1210 C C     . TYR C 2 109 ? -9.923  -13.346 10.599  1.00 28.37 ? 110 TYR A C     1 
ATOM   1211 O O     . TYR C 2 109 ? -10.635 -14.106 11.277  1.00 26.64 ? 110 TYR A O     1 
ATOM   1212 C CB    . TYR C 2 109 ? -11.211 -11.301 11.319  1.00 25.63 ? 110 TYR A CB    1 
ATOM   1213 C CG    . TYR C 2 109 ? -12.224 -11.244 10.197  1.00 26.71 ? 110 TYR A CG    1 
ATOM   1214 C CD1   . TYR C 2 109 ? -12.931 -12.397 9.803   1.00 27.07 ? 110 TYR A CD1   1 
ATOM   1215 C CD2   . TYR C 2 109 ? -12.524 -10.038 9.567   1.00 21.91 ? 110 TYR A CD2   1 
ATOM   1216 C CE1   . TYR C 2 109 ? -13.916 -12.343 8.806   1.00 25.59 ? 110 TYR A CE1   1 
ATOM   1217 C CE2   . TYR C 2 109 ? -13.506 -9.971  8.573   1.00 23.05 ? 110 TYR A CE2   1 
ATOM   1218 C CZ    . TYR C 2 109 ? -14.194 -11.125 8.194   1.00 21.91 ? 110 TYR A CZ    1 
ATOM   1219 O OH    . TYR C 2 109 ? -15.134 -11.068 7.203   1.00 16.90 ? 110 TYR A OH    1 
ATOM   1220 N N     . THR C 2 110 ? -9.182  -13.755 9.563   1.00 23.17 ? 111 THR A N     1 
ATOM   1221 C CA    . THR C 2 110 ? -9.157  -15.160 9.122   1.00 23.28 ? 111 THR A CA    1 
ATOM   1222 C C     . THR C 2 110 ? -7.711  -15.681 9.095   1.00 22.50 ? 111 THR A C     1 
ATOM   1223 O O     . THR C 2 110 ? -7.464  -16.824 8.712   1.00 26.42 ? 111 THR A O     1 
ATOM   1224 C CB    . THR C 2 110 ? -9.885  -15.385 7.697   1.00 22.00 ? 111 THR A CB    1 
ATOM   1225 O OG1   . THR C 2 110 ? -9.149  -14.756 6.649   1.00 18.54 ? 111 THR A OG1   1 
ATOM   1226 C CG2   . THR C 2 110 ? -11.312 -14.757 7.662   1.00 18.17 ? 111 THR A CG2   1 
ATOM   1227 N N     . SER C 2 111 ? -6.760  -14.837 9.515   1.00 22.04 ? 112 SER A N     1 
ATOM   1228 C CA    . SER C 2 111 ? -5.341  -15.211 9.536   1.00 22.90 ? 112 SER A CA    1 
ATOM   1229 C C     . SER C 2 111 ? -4.830  -15.756 10.896  1.00 24.65 ? 112 SER A C     1 
ATOM   1230 O O     . SER C 2 111 ? -5.368  -16.748 11.402  1.00 23.28 ? 112 SER A O     1 
ATOM   1231 C CB    . SER C 2 111 ? -4.436  -14.066 9.001   1.00 22.71 ? 112 SER A CB    1 
ATOM   1232 O OG    . SER C 2 111 ? -4.758  -12.794 9.543   1.00 17.99 ? 112 SER A OG    1 
ATOM   1233 N N     . PHE C 2 112 ? -3.822  -15.096 11.478  1.00 22.45 ? 113 PHE A N     1 
ATOM   1234 C CA    . PHE C 2 112 ? -3.199  -15.501 12.743  1.00 22.08 ? 113 PHE A CA    1 
ATOM   1235 C C     . PHE C 2 112 ? -4.103  -15.655 13.950  1.00 24.80 ? 113 PHE A C     1 
ATOM   1236 O O     . PHE C 2 112 ? -3.710  -16.309 14.918  1.00 24.76 ? 113 PHE A O     1 
ATOM   1237 C CB    . PHE C 2 112 ? -2.051  -14.580 13.106  1.00 16.02 ? 113 PHE A CB    1 
ATOM   1238 C CG    . PHE C 2 112 ? -2.411  -13.130 13.063  1.00 20.32 ? 113 PHE A CG    1 
ATOM   1239 C CD1   . PHE C 2 112 ? -3.062  -12.525 14.136  1.00 20.48 ? 113 PHE A CD1   1 
ATOM   1240 C CD2   . PHE C 2 112 ? -2.076  -12.351 11.956  1.00 18.03 ? 113 PHE A CD2   1 
ATOM   1241 C CE1   . PHE C 2 112 ? -3.384  -11.143 14.118  1.00 22.53 ? 113 PHE A CE1   1 
ATOM   1242 C CE2   . PHE C 2 112 ? -2.394  -10.967 11.923  1.00 25.31 ? 113 PHE A CE2   1 
ATOM   1243 C CZ    . PHE C 2 112 ? -3.047  -10.366 13.010  1.00 22.65 ? 113 PHE A CZ    1 
ATOM   1244 N N     . ILE C 2 113 ? -5.266  -15.002 13.958  1.00 24.31 ? 114 ILE A N     1 
ATOM   1245 C CA    . ILE C 2 113 ? -6.152  -15.197 15.097  1.00 29.09 ? 114 ILE A CA    1 
ATOM   1246 C C     . ILE C 2 113 ? -6.901  -16.537 14.951  1.00 29.62 ? 114 ILE A C     1 
ATOM   1247 O O     . ILE C 2 113 ? -7.341  -17.124 15.945  1.00 30.40 ? 114 ILE A O     1 
ATOM   1248 C CB    . ILE C 2 113 ? -7.133  -14.020 15.344  1.00 28.30 ? 114 ILE A CB    1 
ATOM   1249 C CG1   . ILE C 2 113 ? -8.182  -13.923 14.234  1.00 29.66 ? 114 ILE A CG1   1 
ATOM   1250 C CG2   . ILE C 2 113 ? -6.359  -12.732 15.543  1.00 27.58 ? 114 ILE A CG2   1 
ATOM   1251 C CD1   . ILE C 2 113 ? -9.398  -13.132 14.644  1.00 21.14 ? 114 ILE A CD1   1 
ATOM   1252 N N     . ARG C 2 114 ? -6.994  -17.045 13.726  1.00 28.14 ? 115 ARG A N     1 
ATOM   1253 C CA    . ARG C 2 114 ? -7.667  -18.314 13.500  1.00 29.00 ? 115 ARG A CA    1 
ATOM   1254 C C     . ARG C 2 114 ? -6.706  -19.488 13.386  1.00 29.33 ? 115 ARG A C     1 
ATOM   1255 O O     . ARG C 2 114 ? -7.037  -20.622 13.754  1.00 27.19 ? 115 ARG A O     1 
ATOM   1256 C CB    . ARG C 2 114 ? -8.560  -18.233 12.269  1.00 26.05 ? 115 ARG A CB    1 
ATOM   1257 C CG    . ARG C 2 114 ? -10.022 -18.123 12.630  1.00 28.90 ? 115 ARG A CG    1 
ATOM   1258 C CD    . ARG C 2 114 ? -10.888 -17.962 11.428  1.00 24.52 ? 115 ARG A CD    1 
ATOM   1259 N NE    . ARG C 2 114 ? -11.360 -16.600 11.315  1.00 25.69 ? 115 ARG A NE    1 
ATOM   1260 C CZ    . ARG C 2 114 ? -12.640 -16.274 11.279  1.00 26.11 ? 115 ARG A CZ    1 
ATOM   1261 N NH1   . ARG C 2 114 ? -13.550 -17.235 11.354  1.00 31.10 ? 115 ARG A NH1   1 
ATOM   1262 N NH2   . ARG C 2 114 ? -13.003 -15.002 11.153  1.00 27.17 ? 115 ARG A NH2   1 
ATOM   1263 N N     . ASN C 2 115 ? -5.539  -19.228 12.813  1.00 29.26 ? 116 ASN A N     1 
ATOM   1264 C CA    . ASN C 2 115 ? -4.524  -20.258 12.652  1.00 33.89 ? 116 ASN A CA    1 
ATOM   1265 C C     . ASN C 2 115 ? -3.253  -19.740 13.289  1.00 34.44 ? 116 ASN A C     1 
ATOM   1266 O O     . ASN C 2 115 ? -2.531  -18.961 12.675  1.00 38.00 ? 116 ASN A O     1 
ATOM   1267 C CB    . ASN C 2 115 ? -4.276  -20.550 11.181  1.00 38.47 ? 116 ASN A CB    1 
ATOM   1268 C CG    . ASN C 2 115 ? -3.085  -21.464 10.972  1.00 42.75 ? 116 ASN A CG    1 
ATOM   1269 O OD1   . ASN C 2 115 ? -2.352  -21.327 9.992   1.00 45.26 ? 116 ASN A OD1   1 
ATOM   1270 N ND2   . ASN C 2 115 ? -2.879  -22.398 11.900  1.00 42.86 ? 116 ASN A ND2   1 
ATOM   1271 N N     . ASN C 2 116 ? -2.956  -20.235 14.490  1.00 32.23 ? 117 ASN A N     1 
ATOM   1272 C CA    . ASN C 2 116 ? -1.810  -19.800 15.287  1.00 30.71 ? 117 ASN A CA    1 
ATOM   1273 C C     . ASN C 2 116 ? -0.521  -19.372 14.581  1.00 32.26 ? 117 ASN A C     1 
ATOM   1274 O O     . ASN C 2 116 ? 0.178   -18.459 15.054  1.00 29.07 ? 117 ASN A O     1 
ATOM   1275 C CB    . ASN C 2 116 ? -1.491  -20.822 16.377  1.00 31.37 ? 117 ASN A CB    1 
ATOM   1276 C CG    . ASN C 2 116 ? -0.494  -20.291 17.396  1.00 36.11 ? 117 ASN A CG    1 
ATOM   1277 O OD1   . ASN C 2 116 ? -0.710  -19.226 17.981  1.00 39.79 ? 117 ASN A OD1   1 
ATOM   1278 N ND2   . ASN C 2 116 ? 0.607   -21.018 17.602  1.00 28.95 ? 117 ASN A ND2   1 
ATOM   1279 N N     . THR C 2 117 ? -0.221  -19.963 13.431  1.00 31.39 ? 118 THR A N     1 
ATOM   1280 C CA    . THR C 2 117 ? 1.018   -19.602 12.747  1.00 30.92 ? 118 THR A CA    1 
ATOM   1281 C C     . THR C 2 117 ? 0.815   -18.994 11.373  1.00 30.58 ? 118 THR A C     1 
ATOM   1282 O O     . THR C 2 117 ? 1.775   -18.911 10.604  1.00 34.20 ? 118 THR A O     1 
ATOM   1283 C CB    . THR C 2 117 ? 1.959   -20.826 12.608  1.00 30.64 ? 118 THR A CB    1 
ATOM   1284 O OG1   . THR C 2 117 ? 1.636   -21.802 13.608  1.00 29.39 ? 118 THR A OG1   1 
ATOM   1285 C CG2   . THR C 2 117 ? 3.403   -20.393 12.810  1.00 29.44 ? 118 THR A CG2   1 
ATOM   1286 N N     . LYS C 2 118 ? -0.394  -18.504 11.096  1.00 27.61 ? 119 LYS A N     1 
ATOM   1287 C CA    . LYS C 2 118 ? -0.720  -17.946 9.796   1.00 27.95 ? 119 LYS A CA    1 
ATOM   1288 C C     . LYS C 2 118 ? -0.390  -16.461 9.590   1.00 28.69 ? 119 LYS A C     1 
ATOM   1289 O O     . LYS C 2 118 ? -0.907  -15.607 10.287  1.00 32.07 ? 119 LYS A O     1 
ATOM   1290 C CB    . LYS C 2 118 ? -2.188  -18.190 9.499   1.00 29.47 ? 119 LYS A CB    1 
ATOM   1291 C CG    . LYS C 2 118 ? -2.553  -18.184 8.012   1.00 35.61 ? 119 LYS A CG    1 
ATOM   1292 C CD    . LYS C 2 118 ? -4.066  -18.007 7.848   1.00 40.98 ? 119 LYS A CD    1 
ATOM   1293 C CE    . LYS C 2 118 ? -4.556  -18.239 6.441   1.00 39.86 ? 119 LYS A CE    1 
ATOM   1294 N NZ    . LYS C 2 118 ? -4.509  -19.693 6.086   1.00 46.06 ? 119 LYS A NZ    1 
ATOM   1295 N N     . ASN C 2 119 ? 0.494   -16.182 8.632   1.00 26.02 ? 120 ASN A N     1 
ATOM   1296 C CA    . ASN C 2 119 ? 0.895   -14.832 8.269   1.00 23.66 ? 120 ASN A CA    1 
ATOM   1297 C C     . ASN C 2 119 ? 1.372   -14.005 9.419   1.00 25.12 ? 120 ASN A C     1 
ATOM   1298 O O     . ASN C 2 119 ? 1.076   -12.808 9.476   1.00 25.54 ? 120 ASN A O     1 
ATOM   1299 C CB    . ASN C 2 119 ? -0.260  -14.079 7.628   1.00 23.35 ? 120 ASN A CB    1 
ATOM   1300 C CG    . ASN C 2 119 ? -0.530  -14.534 6.242   1.00 23.38 ? 120 ASN A CG    1 
ATOM   1301 O OD1   . ASN C 2 119 ? -1.417  -15.346 6.031   1.00 30.01 ? 120 ASN A OD1   1 
ATOM   1302 N ND2   . ASN C 2 119 ? 0.222   -14.017 5.277   1.00 19.24 ? 120 ASN A ND2   1 
ATOM   1303 N N     . ILE C 2 120 ? 2.127   -14.610 10.322  1.00 25.66 ? 121 ILE A N     1 
ATOM   1304 C CA    . ILE C 2 120 ? 2.615   -13.862 11.471  1.00 24.37 ? 121 ILE A CA    1 
ATOM   1305 C C     . ILE C 2 120 ? 4.065   -14.241 11.690  1.00 26.09 ? 121 ILE A C     1 
ATOM   1306 O O     . ILE C 2 120 ? 4.501   -15.321 11.268  1.00 24.38 ? 121 ILE A O     1 
ATOM   1307 C CB    . ILE C 2 120 ? 1.692   -14.105 12.731  1.00 19.12 ? 121 ILE A CB    1 
ATOM   1308 C CG1   . ILE C 2 120 ? 2.072   -13.186 13.891  1.00 17.18 ? 121 ILE A CG1   1 
ATOM   1309 C CG2   . ILE C 2 120 ? 1.642   -15.593 13.087  1.00 19.13 ? 121 ILE A CG2   1 
ATOM   1310 C CD1   . ILE C 2 120 ? 1.066   -13.167 15.062  1.00 10.37 ? 121 ILE A CD1   1 
ATOM   1311 N N     . VAL C 2 121 ? 4.828   -13.290 12.215  1.00 24.61 ? 122 VAL A N     1 
ATOM   1312 C CA    . VAL C 2 121 ? 6.241   -13.489 12.498  1.00 29.52 ? 122 VAL A CA    1 
ATOM   1313 C C     . VAL C 2 121 ? 6.427   -14.677 13.438  1.00 27.65 ? 122 VAL A C     1 
ATOM   1314 O O     . VAL C 2 121 ? 7.166   -15.601 13.107  1.00 31.96 ? 122 VAL A O     1 
ATOM   1315 C CB    . VAL C 2 121 ? 6.858   -12.203 13.108  1.00 32.56 ? 122 VAL A CB    1 
ATOM   1316 C CG1   . VAL C 2 121 ? 8.327   -12.390 13.414  1.00 34.67 ? 122 VAL A CG1   1 
ATOM   1317 C CG2   . VAL C 2 121 ? 6.702   -11.058 12.130  1.00 35.59 ? 122 VAL A CG2   1 
ATOM   1318 N N     . TYR C 2 122 ? 5.798   -14.622 14.614  1.00 26.00 ? 123 TYR A N     1 
ATOM   1319 C CA    . TYR C 2 122 ? 5.840   -15.714 15.592  1.00 24.88 ? 123 TYR A CA    1 
ATOM   1320 C C     . TYR C 2 122 ? 4.413   -16.254 15.842  1.00 28.83 ? 123 TYR A C     1 
ATOM   1321 O O     . TYR C 2 122 ? 3.418   -15.545 15.609  1.00 27.37 ? 123 TYR A O     1 
ATOM   1322 C CB    . TYR C 2 122 ? 6.422   -15.220 16.923  1.00 15.24 ? 123 TYR A CB    1 
ATOM   1323 C CG    . TYR C 2 122 ? 7.868   -14.923 16.840  1.00 11.91 ? 123 TYR A CG    1 
ATOM   1324 C CD1   . TYR C 2 122 ? 8.791   -15.934 16.982  1.00 11.45 ? 123 TYR A CD1   1 
ATOM   1325 C CD2   . TYR C 2 122 ? 8.327   -13.632 16.587  1.00 14.24 ? 123 TYR A CD2   1 
ATOM   1326 C CE1   . TYR C 2 122 ? 10.146  -15.694 16.880  1.00 11.59 ? 123 TYR A CE1   1 
ATOM   1327 C CE2   . TYR C 2 122 ? 9.686   -13.361 16.475  1.00 14.65 ? 123 TYR A CE2   1 
ATOM   1328 C CZ    . TYR C 2 122 ? 10.588  -14.412 16.629  1.00 20.38 ? 123 TYR A CZ    1 
ATOM   1329 O OH    . TYR C 2 122 ? 11.938  -14.205 16.530  1.00 24.00 ? 123 TYR A OH    1 
ATOM   1330 N N     . PRO C 2 123 ? 4.291   -17.530 16.286  1.00 33.32 ? 124 PRO A N     1 
ATOM   1331 C CA    . PRO C 2 123 ? 2.962   -18.094 16.554  1.00 31.72 ? 124 PRO A CA    1 
ATOM   1332 C C     . PRO C 2 123 ? 2.167   -17.159 17.486  1.00 30.68 ? 124 PRO A C     1 
ATOM   1333 O O     . PRO C 2 123 ? 2.698   -16.680 18.506  1.00 28.71 ? 124 PRO A O     1 
ATOM   1334 C CB    . PRO C 2 123 ? 3.304   -19.416 17.232  1.00 34.01 ? 124 PRO A CB    1 
ATOM   1335 C CG    . PRO C 2 123 ? 4.507   -19.860 16.463  1.00 34.95 ? 124 PRO A CG    1 
ATOM   1336 C CD    . PRO C 2 123 ? 5.327   -18.584 16.355  1.00 38.37 ? 124 PRO A CD    1 
ATOM   1337 N N     . PHE C 2 124 ? 0.916   -16.897 17.103  1.00 29.99 ? 125 PHE A N     1 
ATOM   1338 C CA    . PHE C 2 124 ? -0.009  -16.008 17.811  1.00 29.90 ? 125 PHE A CA    1 
ATOM   1339 C C     . PHE C 2 124 ? 0.013   -16.035 19.339  1.00 31.02 ? 125 PHE A C     1 
ATOM   1340 O O     . PHE C 2 124 ? -0.142  -14.982 19.989  1.00 24.58 ? 125 PHE A O     1 
ATOM   1341 C CB    . PHE C 2 124 ? -1.447  -16.210 17.324  1.00 24.05 ? 125 PHE A CB    1 
ATOM   1342 C CG    . PHE C 2 124 ? -2.409  -15.139 17.802  1.00 28.30 ? 125 PHE A CG    1 
ATOM   1343 C CD1   . PHE C 2 124 ? -2.265  -13.808 17.382  1.00 29.54 ? 125 PHE A CD1   1 
ATOM   1344 C CD2   . PHE C 2 124 ? -3.485  -15.460 18.641  1.00 30.08 ? 125 PHE A CD2   1 
ATOM   1345 C CE1   . PHE C 2 124 ? -3.182  -12.803 17.775  1.00 27.84 ? 125 PHE A CE1   1 
ATOM   1346 C CE2   . PHE C 2 124 ? -4.410  -14.469 19.046  1.00 30.12 ? 125 PHE A CE2   1 
ATOM   1347 C CZ    . PHE C 2 124 ? -4.255  -13.137 18.607  1.00 29.27 ? 125 PHE A CZ    1 
ATOM   1348 N N     . ASP C 2 125 ? 0.175   -17.228 19.899  1.00 29.05 ? 126 ASP A N     1 
ATOM   1349 C CA    . ASP C 2 125 ? 0.202   -17.377 21.338  1.00 33.44 ? 126 ASP A CA    1 
ATOM   1350 C C     . ASP C 2 125 ? 1.492   -16.886 22.018  1.00 33.47 ? 126 ASP A C     1 
ATOM   1351 O O     . ASP C 2 125 ? 1.529   -16.709 23.248  1.00 34.86 ? 126 ASP A O     1 
ATOM   1352 C CB    . ASP C 2 125 ? -0.140  -18.807 21.722  1.00 35.99 ? 126 ASP A CB    1 
ATOM   1353 C CG    . ASP C 2 125 ? 0.604   -19.812 20.910  1.00 40.80 ? 126 ASP A CG    1 
ATOM   1354 O OD1   . ASP C 2 125 ? 1.555   -19.433 20.193  1.00 47.17 ? 126 ASP A OD1   1 
ATOM   1355 O OD2   . ASP C 2 125 ? 0.234   -20.994 20.978  1.00 47.54 ? 126 ASP A OD2   1 
ATOM   1356 N N     . GLN C 2 126 ? 2.550   -16.659 21.242  1.00 32.63 ? 127 GLN A N     1 
ATOM   1357 C CA    . GLN C 2 126 ? 3.792   -16.135 21.820  1.00 28.41 ? 127 GLN A CA    1 
ATOM   1358 C C     . GLN C 2 126 ? 3.676   -14.651 22.196  1.00 27.07 ? 127 GLN A C     1 
ATOM   1359 O O     . GLN C 2 126 ? 4.511   -14.123 22.931  1.00 29.09 ? 127 GLN A O     1 
ATOM   1360 C CB    . GLN C 2 126 ? 4.981   -16.337 20.878  1.00 28.60 ? 127 GLN A CB    1 
ATOM   1361 C CG    . GLN C 2 126 ? 5.381   -17.805 20.677  1.00 29.47 ? 127 GLN A CG    1 
ATOM   1362 C CD    . GLN C 2 126 ? 6.783   -17.972 20.112  1.00 29.35 ? 127 GLN A CD    1 
ATOM   1363 O OE1   . GLN C 2 126 ? 7.468   -16.996 19.806  1.00 35.78 ? 127 GLN A OE1   1 
ATOM   1364 N NE2   . GLN C 2 126 ? 7.222   -19.212 19.983  1.00 32.68 ? 127 GLN A NE2   1 
ATOM   1365 N N     . TYR C 2 127 ? 2.646   -13.971 21.705  1.00 22.50 ? 128 TYR A N     1 
ATOM   1366 C CA    . TYR C 2 127 ? 2.489   -12.547 22.005  1.00 23.42 ? 128 TYR A CA    1 
ATOM   1367 C C     . TYR C 2 127 ? 1.545   -12.420 23.163  1.00 25.19 ? 128 TYR A C     1 
ATOM   1368 O O     . TYR C 2 127 ? 0.616   -13.225 23.283  1.00 29.22 ? 128 TYR A O     1 
ATOM   1369 C CB    . TYR C 2 127 ? 1.906   -11.772 20.803  1.00 18.82 ? 128 TYR A CB    1 
ATOM   1370 C CG    . TYR C 2 127 ? 2.774   -11.773 19.566  1.00 18.41 ? 128 TYR A CG    1 
ATOM   1371 C CD1   . TYR C 2 127 ? 2.650   -12.796 18.608  1.00 19.99 ? 128 TYR A CD1   1 
ATOM   1372 C CD2   . TYR C 2 127 ? 3.751   -10.782 19.362  1.00 12.52 ? 128 TYR A CD2   1 
ATOM   1373 C CE1   . TYR C 2 127 ? 3.481   -12.843 17.487  1.00 17.67 ? 128 TYR A CE1   1 
ATOM   1374 C CE2   . TYR C 2 127 ? 4.588   -10.820 18.232  1.00 17.56 ? 128 TYR A CE2   1 
ATOM   1375 C CZ    . TYR C 2 127 ? 4.441   -11.862 17.302  1.00 13.05 ? 128 TYR A CZ    1 
ATOM   1376 O OH    . TYR C 2 127 ? 5.234   -11.943 16.178  1.00 20.90 ? 128 TYR A OH    1 
ATOM   1377 N N     . ILE C 2 128 ? 1.788   -11.451 24.039  1.00 22.34 ? 129 ILE A N     1 
ATOM   1378 C CA    . ILE C 2 128 ? 0.885   -11.261 25.144  1.00 21.28 ? 129 ILE A CA    1 
ATOM   1379 C C     . ILE C 2 128 ? 0.190   -9.942  24.983  1.00 21.52 ? 129 ILE A C     1 
ATOM   1380 O O     . ILE C 2 128 ? -0.770  -9.666  25.681  1.00 26.17 ? 129 ILE A O     1 
ATOM   1381 C CB    . ILE C 2 128 ? 1.573   -11.308 26.539  1.00 26.20 ? 129 ILE A CB    1 
ATOM   1382 C CG1   . ILE C 2 128 ? 2.883   -10.522 26.529  1.00 27.53 ? 129 ILE A CG1   1 
ATOM   1383 C CG2   . ILE C 2 128 ? 1.707   -12.744 27.035  1.00 25.56 ? 129 ILE A CG2   1 
ATOM   1384 C CD1   . ILE C 2 128 ? 3.114   -9.718  27.801  1.00 24.04 ? 129 ILE A CD1   1 
ATOM   1385 N N     . ALA C 2 129 ? 0.713   -9.094  24.110  1.00 21.55 ? 130 ALA A N     1 
ATOM   1386 C CA    . ALA C 2 129 ? 0.128   -7.771  23.861  1.00 18.72 ? 130 ALA A CA    1 
ATOM   1387 C C     . ALA C 2 129 ? 0.161   -7.424  22.372  1.00 16.18 ? 130 ALA A C     1 
ATOM   1388 O O     . ALA C 2 129 ? 1.094   -7.799  21.656  1.00 14.33 ? 130 ALA A O     1 
ATOM   1389 C CB    . ALA C 2 129 ? 0.867   -6.696  24.665  1.00 18.03 ? 130 ALA A CB    1 
ATOM   1390 N N     . HIS C 2 130 ? -0.874  -6.718  21.920  1.00 13.59 ? 131 HIS A N     1 
ATOM   1391 C CA    . HIS C 2 130 ? -1.035  -6.294  20.512  1.00 15.07 ? 131 HIS A CA    1 
ATOM   1392 C C     . HIS C 2 130 ? -1.413  -4.831  20.526  1.00 8.12  ? 131 HIS A C     1 
ATOM   1393 O O     . HIS C 2 130 ? -2.554  -4.455  20.736  1.00 13.22 ? 131 HIS A O     1 
ATOM   1394 C CB    . HIS C 2 130 ? -2.111  -7.133  19.787  1.00 16.34 ? 131 HIS A CB    1 
ATOM   1395 C CG    . HIS C 2 130 ? -1.830  -8.606  19.798  1.00 21.44 ? 131 HIS A CG    1 
ATOM   1396 N ND1   . HIS C 2 130 ? -0.999  -9.213  18.876  1.00 26.06 ? 131 HIS A ND1   1 
ATOM   1397 C CD2   . HIS C 2 130 ? -2.212  -9.583  20.660  1.00 22.72 ? 131 HIS A CD2   1 
ATOM   1398 C CE1   . HIS C 2 130 ? -0.874  -10.497 19.175  1.00 27.34 ? 131 HIS A CE1   1 
ATOM   1399 N NE2   . HIS C 2 130 ? -1.599  -10.745 20.254  1.00 24.87 ? 131 HIS A NE2   1 
ATOM   1400 N N     . TRP C 2 131 ? -0.411  -4.006  20.309  1.00 15.03 ? 132 TRP A N     1 
ATOM   1401 C CA    . TRP C 2 131 ? -0.556  -2.559  20.313  1.00 16.96 ? 132 TRP A CA    1 
ATOM   1402 C C     . TRP C 2 131 ? -0.651  -1.961  18.919  1.00 15.45 ? 132 TRP A C     1 
ATOM   1403 O O     . TRP C 2 131 ? 0.098   -2.332  18.003  1.00 13.40 ? 132 TRP A O     1 
ATOM   1404 C CB    . TRP C 2 131 ? 0.655   -1.927  21.023  1.00 19.21 ? 132 TRP A CB    1 
ATOM   1405 C CG    . TRP C 2 131 ? 0.745   -2.260  22.480  1.00 24.52 ? 132 TRP A CG    1 
ATOM   1406 C CD1   . TRP C 2 131 ? -0.242  -2.820  23.267  1.00 24.81 ? 132 TRP A CD1   1 
ATOM   1407 C CD2   . TRP C 2 131 ? 1.847   -1.992  23.348  1.00 24.76 ? 132 TRP A CD2   1 
ATOM   1408 N NE1   . TRP C 2 131 ? 0.186   -2.897  24.571  1.00 27.71 ? 132 TRP A NE1   1 
ATOM   1409 C CE2   . TRP C 2 131 ? 1.463   -2.399  24.652  1.00 25.65 ? 132 TRP A CE2   1 
ATOM   1410 C CE3   . TRP C 2 131 ? 3.121   -1.448  23.155  1.00 26.38 ? 132 TRP A CE3   1 
ATOM   1411 C CZ2   . TRP C 2 131 ? 2.313   -2.271  25.763  1.00 25.26 ? 132 TRP A CZ2   1 
ATOM   1412 C CZ3   . TRP C 2 131 ? 3.971   -1.321  24.267  1.00 27.22 ? 132 TRP A CZ3   1 
ATOM   1413 C CH2   . TRP C 2 131 ? 3.556   -1.732  25.549  1.00 25.37 ? 132 TRP A CH2   1 
ATOM   1414 N N     . ILE C 2 132 ? -1.505  -0.964  18.800  1.00 11.25 ? 133 ILE A N     1 
ATOM   1415 C CA    . ILE C 2 132 ? -1.683  -0.264  17.539  1.00 14.13 ? 133 ILE A CA    1 
ATOM   1416 C C     . ILE C 2 132 ? -1.246  1.175   17.746  1.00 13.45 ? 133 ILE A C     1 
ATOM   1417 O O     . ILE C 2 132 ? -1.677  1.837   18.704  1.00 12.05 ? 133 ILE A O     1 
ATOM   1418 C CB    . ILE C 2 132 ? -3.173  -0.168  17.131  1.00 12.46 ? 133 ILE A CB    1 
ATOM   1419 C CG1   . ILE C 2 132 ? -3.837  -1.563  16.932  1.00 15.63 ? 133 ILE A CG1   1 
ATOM   1420 C CG2   . ILE C 2 132 ? -3.338  0.846   15.991  1.00 12.45 ? 133 ILE A CG2   1 
ATOM   1421 C CD1   . ILE C 2 132 ? -3.198  -2.467  15.923  1.00 10.39 ? 133 ILE A CD1   1 
ATOM   1422 N N     . ILE C 2 133 ? -0.354  1.648   16.891  1.00 16.23 ? 134 ILE A N     1 
ATOM   1423 C CA    . ILE C 2 133 ? 0.010   3.055   16.941  1.00 12.39 ? 134 ILE A CA    1 
ATOM   1424 C C     . ILE C 2 133 ? -0.753  3.638   15.745  1.00 13.73 ? 134 ILE A C     1 
ATOM   1425 O O     . ILE C 2 133 ? -0.488  3.298   14.573  1.00 10.78 ? 134 ILE A O     1 
ATOM   1426 C CB    . ILE C 2 133 ? 1.534   3.304   16.878  1.00 15.19 ? 134 ILE A CB    1 
ATOM   1427 C CG1   . ILE C 2 133 ? 2.213   2.616   18.077  1.00 15.77 ? 134 ILE A CG1   1 
ATOM   1428 C CG2   . ILE C 2 133 ? 1.825   4.828   16.928  1.00 17.43 ? 134 ILE A CG2   1 
ATOM   1429 C CD1   . ILE C 2 133 ? 3.708   2.500   17.947  1.00 21.96 ? 134 ILE A CD1   1 
ATOM   1430 N N     . GLY C 2 134 ? -1.811  4.366   16.083  1.00 10.68 ? 135 GLY A N     1 
ATOM   1431 C CA    . GLY C 2 134 ? -2.672  4.989   15.102  1.00 14.52 ? 135 GLY A CA    1 
ATOM   1432 C C     . GLY C 2 134 ? -2.276  6.422   14.827  1.00 19.03 ? 135 GLY A C     1 
ATOM   1433 O O     . GLY C 2 134 ? -1.934  7.174   15.752  1.00 16.84 ? 135 GLY A O     1 
ATOM   1434 N N     . TYR C 2 135 ? -2.270  6.778   13.545  1.00 15.99 ? 136 TYR A N     1 
ATOM   1435 C CA    . TYR C 2 135 ? -1.924  8.123   13.103  1.00 15.66 ? 136 TYR A CA    1 
ATOM   1436 C C     . TYR C 2 135 ? -3.123  8.602   12.353  1.00 12.08 ? 136 TYR A C     1 
ATOM   1437 O O     . TYR C 2 135 ? -3.721  7.842   11.587  1.00 6.58  ? 136 TYR A O     1 
ATOM   1438 C CB    . TYR C 2 135 ? -0.736  8.129   12.143  1.00 17.77 ? 136 TYR A CB    1 
ATOM   1439 C CG    . TYR C 2 135 ? 0.596   8.055   12.780  1.00 14.95 ? 136 TYR A CG    1 
ATOM   1440 C CD1   . TYR C 2 135 ? 1.177   6.821   13.071  1.00 13.47 ? 136 TYR A CD1   1 
ATOM   1441 C CD2   . TYR C 2 135 ? 1.285   9.212   13.086  1.00 17.69 ? 136 TYR A CD2   1 
ATOM   1442 C CE1   . TYR C 2 135 ? 2.407   6.741   13.647  1.00 16.54 ? 136 TYR A CE1   1 
ATOM   1443 C CE2   . TYR C 2 135 ? 2.520   9.158   13.667  1.00 16.54 ? 136 TYR A CE2   1 
ATOM   1444 C CZ    . TYR C 2 135 ? 3.092   7.922   13.952  1.00 20.87 ? 136 TYR A CZ    1 
ATOM   1445 O OH    . TYR C 2 135 ? 4.340   7.867   14.557  1.00 13.52 ? 136 TYR A OH    1 
ATOM   1446 N N     . VAL C 2 136 ? -3.472  9.856   12.614  1.00 11.99 ? 137 VAL A N     1 
ATOM   1447 C CA    . VAL C 2 136 ? -4.608  10.512  11.994  1.00 13.80 ? 137 VAL A CA    1 
ATOM   1448 C C     . VAL C 2 136 ? -4.088  11.806  11.420  1.00 16.40 ? 137 VAL A C     1 
ATOM   1449 O O     . VAL C 2 136 ? -3.433  12.568  12.115  1.00 13.42 ? 137 VAL A O     1 
ATOM   1450 C CB    . VAL C 2 136 ? -5.705  10.831  13.021  1.00 15.58 ? 137 VAL A CB    1 
ATOM   1451 C CG1   . VAL C 2 136 ? -7.021  11.270  12.311  1.00 17.95 ? 137 VAL A CG1   1 
ATOM   1452 C CG2   . VAL C 2 136 ? -5.942  9.617   13.905  1.00 18.94 ? 137 VAL A CG2   1 
ATOM   1453 N N     . TYR C 2 137 ? -4.303  12.008  10.124  1.00 18.66 ? 138 TYR A N     1 
ATOM   1454 C CA    . TYR C 2 137 ? -3.836  13.235  9.482   1.00 23.91 ? 138 TYR A CA    1 
ATOM   1455 C C     . TYR C 2 137 ? -4.969  13.947  8.714   1.00 24.59 ? 138 TYR A C     1 
ATOM   1456 O O     . TYR C 2 137 ? -5.993  13.347  8.402   1.00 23.43 ? 138 TYR A O     1 
ATOM   1457 C CB    . TYR C 2 137 ? -2.629  12.942  8.551   1.00 20.90 ? 138 TYR A CB    1 
ATOM   1458 C CG    . TYR C 2 137 ? -3.011  12.266  7.233   1.00 23.88 ? 138 TYR A CG    1 
ATOM   1459 C CD1   . TYR C 2 137 ? -3.129  10.868  7.146   1.00 21.74 ? 138 TYR A CD1   1 
ATOM   1460 C CD2   . TYR C 2 137 ? -3.320  13.028  6.093   1.00 20.76 ? 138 TYR A CD2   1 
ATOM   1461 C CE1   . TYR C 2 137 ? -3.558  10.243  5.949   1.00 21.70 ? 138 TYR A CE1   1 
ATOM   1462 C CE2   . TYR C 2 137 ? -3.742  12.420  4.910   1.00 23.38 ? 138 TYR A CE2   1 
ATOM   1463 C CZ    . TYR C 2 137 ? -3.866  11.029  4.843   1.00 21.53 ? 138 TYR A CZ    1 
ATOM   1464 O OH    . TYR C 2 137 ? -4.352  10.444  3.688   1.00 19.08 ? 138 TYR A OH    1 
ATOM   1465 N N     . THR C 2 138 ? -4.805  15.248  8.482   1.00 29.09 ? 139 THR A N     1 
ATOM   1466 C CA    . THR C 2 138 ? -5.773  16.012  7.706   1.00 31.80 ? 139 THR A CA    1 
ATOM   1467 C C     . THR C 2 138 ? -5.192  16.275  6.316   1.00 32.33 ? 139 THR A C     1 
ATOM   1468 O O     . THR C 2 138 ? -4.070  16.784  6.193   1.00 26.33 ? 139 THR A O     1 
ATOM   1469 C CB    . THR C 2 138 ? -6.108  17.351  8.348   1.00 33.47 ? 139 THR A CB    1 
ATOM   1470 O OG1   . THR C 2 138 ? -6.766  17.128  9.599   1.00 35.21 ? 139 THR A OG1   1 
ATOM   1471 C CG2   . THR C 2 138 ? -7.015  18.160  7.424   1.00 35.84 ? 139 THR A CG2   1 
ATOM   1472 N N     . ARG C 2 139 ? -5.954  15.915  5.283   1.00 36.02 ? 140 ARG A N     1 
ATOM   1473 C CA    . ARG C 2 139 ? -5.520  16.101  3.892   1.00 40.26 ? 140 ARG A CA    1 
ATOM   1474 C C     . ARG C 2 139 ? -5.698  17.558  3.457   1.00 41.87 ? 140 ARG A C     1 
ATOM   1475 O O     . ARG C 2 139 ? -6.790  18.126  3.590   1.00 42.17 ? 140 ARG A O     1 
ATOM   1476 C CB    . ARG C 2 139 ? -6.300  15.157  2.954   1.00 40.37 ? 140 ARG A CB    1 
ATOM   1477 N N     . VAL C 2 140 ? -4.618  18.153  2.947   1.00 44.33 ? 141 VAL A N     1 
ATOM   1478 C CA    . VAL C 2 140 ? -4.617  19.554  2.492   1.00 45.02 ? 141 VAL A CA    1 
ATOM   1479 C C     . VAL C 2 140 ? -5.253  19.698  1.106   1.00 48.97 ? 141 VAL A C     1 
ATOM   1480 O O     . VAL C 2 140 ? -4.908  18.968  0.170   1.00 54.65 ? 141 VAL A O     1 
ATOM   1481 C CB    . VAL C 2 140 ? -3.171  20.160  2.484   1.00 39.98 ? 141 VAL A CB    1 
ATOM   1482 C CG1   . VAL C 2 140 ? -3.174  21.611  1.984   1.00 34.65 ? 141 VAL A CG1   1 
ATOM   1483 C CG2   . VAL C 2 140 ? -2.587  20.097  3.872   1.00 34.56 ? 141 VAL A CG2   1 
ATOM   1484 N N     . LYS C 2 148 ? 8.055   20.014  -8.431  1.00 41.15 ? 149 LYS A N     1 
ATOM   1485 C CA    . LYS C 2 148 ? 9.463   20.418  -8.463  1.00 39.15 ? 149 LYS A CA    1 
ATOM   1486 C C     . LYS C 2 148 ? 10.298  19.621  -7.451  1.00 41.56 ? 149 LYS A C     1 
ATOM   1487 O O     . LYS C 2 148 ? 9.823   19.268  -6.377  1.00 44.14 ? 149 LYS A O     1 
ATOM   1488 C CB    . LYS C 2 148 ? 9.582   21.917  -8.177  1.00 33.71 ? 149 LYS A CB    1 
ATOM   1489 N N     . THR C 2 149 ? 11.518  19.271  -7.820  1.00 40.80 ? 150 THR A N     1 
ATOM   1490 C CA    . THR C 2 149 ? 12.367  18.571  -6.890  1.00 40.87 ? 150 THR A CA    1 
ATOM   1491 C C     . THR C 2 149 ? 12.912  19.678  -5.989  1.00 41.33 ? 150 THR A C     1 
ATOM   1492 O O     . THR C 2 149 ? 12.637  20.854  -6.227  1.00 39.90 ? 150 THR A O     1 
ATOM   1493 C CB    . THR C 2 149 ? 13.492  17.845  -7.624  1.00 41.23 ? 150 THR A CB    1 
ATOM   1494 O OG1   . THR C 2 149 ? 14.194  18.773  -8.450  1.00 43.53 ? 150 THR A OG1   1 
ATOM   1495 C CG2   . THR C 2 149 ? 12.913  16.760  -8.513  1.00 42.84 ? 150 THR A CG2   1 
ATOM   1496 N N     . TYR C 2 150 ? 13.655  19.328  -4.947  1.00 44.70 ? 151 TYR A N     1 
ATOM   1497 C CA    . TYR C 2 150 ? 14.195  20.351  -4.055  1.00 44.43 ? 151 TYR A CA    1 
ATOM   1498 C C     . TYR C 2 150 ? 15.610  20.099  -3.565  1.00 42.80 ? 151 TYR A C     1 
ATOM   1499 O O     . TYR C 2 150 ? 16.156  19.002  -3.721  1.00 42.50 ? 151 TYR A O     1 
ATOM   1500 C CB    . TYR C 2 150 ? 13.275  20.581  -2.848  1.00 44.22 ? 151 TYR A CB    1 
ATOM   1501 C CG    . TYR C 2 150 ? 11.947  21.205  -3.192  1.00 42.97 ? 151 TYR A CG    1 
ATOM   1502 C CD1   . TYR C 2 150 ? 10.877  20.412  -3.589  1.00 43.97 ? 151 TYR A CD1   1 
ATOM   1503 C CD2   . TYR C 2 150 ? 11.750  22.579  -3.091  1.00 39.39 ? 151 TYR A CD2   1 
ATOM   1504 C CE1   . TYR C 2 150 ? 9.636   20.970  -3.870  1.00 42.72 ? 151 TYR A CE1   1 
ATOM   1505 C CE2   . TYR C 2 150 ? 10.516  23.147  -3.369  1.00 39.10 ? 151 TYR A CE2   1 
ATOM   1506 C CZ    . TYR C 2 150 ? 9.463   22.332  -3.754  1.00 40.83 ? 151 TYR A CZ    1 
ATOM   1507 O OH    . TYR C 2 150 ? 8.220   22.855  -3.996  1.00 38.22 ? 151 TYR A OH    1 
ATOM   1508 N N     . ASN C 2 151 ? 16.192  21.161  -3.014  1.00 40.39 ? 152 ASN A N     1 
ATOM   1509 C CA    . ASN C 2 151 ? 17.530  21.168  -2.467  1.00 35.05 ? 152 ASN A CA    1 
ATOM   1510 C C     . ASN C 2 151 ? 17.343  21.239  -0.964  1.00 35.61 ? 152 ASN A C     1 
ATOM   1511 O O     . ASN C 2 151 ? 16.333  21.783  -0.497  1.00 30.45 ? 152 ASN A O     1 
ATOM   1512 C CB    . ASN C 2 151 ? 18.260  22.433  -2.918  1.00 38.72 ? 152 ASN A CB    1 
ATOM   1513 C CG    . ASN C 2 151 ? 18.386  22.536  -4.412  1.00 39.38 ? 152 ASN A CG    1 
ATOM   1514 O OD1   . ASN C 2 151 ? 19.364  22.081  -4.995  1.00 41.75 ? 152 ASN A OD1   1 
ATOM   1515 N ND2   . ASN C 2 151 ? 17.415  23.176  -5.043  1.00 43.70 ? 152 ASN A ND2   1 
ATOM   1516 N N     . ILE C 2 152 ? 18.338  20.750  -0.214  1.00 37.53 ? 153 ILE A N     1 
ATOM   1517 C CA    . ILE C 2 152 ? 18.313  20.761  1.256   1.00 39.22 ? 153 ILE A CA    1 
ATOM   1518 C C     . ILE C 2 152 ? 18.090  22.152  1.815   1.00 39.31 ? 153 ILE A C     1 
ATOM   1519 O O     . ILE C 2 152 ? 17.335  22.330  2.763   1.00 37.63 ? 153 ILE A O     1 
ATOM   1520 C CB    . ILE C 2 152 ? 19.610  20.203  1.873   1.00 39.90 ? 153 ILE A CB    1 
ATOM   1521 C CG1   . ILE C 2 152 ? 19.540  18.679  1.962   1.00 41.56 ? 153 ILE A CG1   1 
ATOM   1522 C CG2   . ILE C 2 152 ? 19.850  20.806  3.249   1.00 41.03 ? 153 ILE A CG2   1 
ATOM   1523 C CD1   . ILE C 2 152 ? 19.714  18.000  0.636   1.00 43.58 ? 153 ILE A CD1   1 
ATOM   1524 N N     . ASN C 2 153 ? 18.762  23.130  1.214   1.00 42.40 ? 154 ASN A N     1 
ATOM   1525 C CA    . ASN C 2 153 ? 18.654  24.519  1.624   1.00 43.07 ? 154 ASN A CA    1 
ATOM   1526 C C     . ASN C 2 153 ? 17.242  25.041  1.409   1.00 44.50 ? 154 ASN A C     1 
ATOM   1527 O O     . ASN C 2 153 ? 16.960  26.200  1.702   1.00 45.80 ? 154 ASN A O     1 
ATOM   1528 C CB    . ASN C 2 153 ? 19.654  25.368  0.856   1.00 44.57 ? 154 ASN A CB    1 
ATOM   1529 N N     . GLU C 2 154 ? 16.367  24.198  0.871   1.00 45.12 ? 155 GLU A N     1 
ATOM   1530 C CA    . GLU C 2 154 ? 14.987  24.581  0.624   1.00 45.31 ? 155 GLU A CA    1 
ATOM   1531 C C     . GLU C 2 154 ? 14.004  23.860  1.550   1.00 46.15 ? 155 GLU A C     1 
ATOM   1532 O O     . GLU C 2 154 ? 12.805  24.188  1.569   1.00 45.74 ? 155 GLU A O     1 
ATOM   1533 C CB    . GLU C 2 154 ? 14.615  24.322  -0.837  1.00 43.40 ? 155 GLU A CB    1 
ATOM   1534 C CG    . GLU C 2 154 ? 15.270  25.272  -1.809  1.00 45.28 ? 155 GLU A CG    1 
ATOM   1535 C CD    . GLU C 2 154 ? 14.520  25.348  -3.124  1.00 48.66 ? 155 GLU A CD    1 
ATOM   1536 O OE1   . GLU C 2 154 ? 14.687  24.413  -3.940  1.00 48.24 ? 155 GLU A OE1   1 
ATOM   1537 O OE2   . GLU C 2 154 ? 13.751  26.326  -3.331  1.00 47.99 ? 155 GLU A OE2   1 
ATOM   1538 N N     . LEU C 2 155 ? 14.532  22.958  2.382   1.00 44.40 ? 156 LEU A N     1 
ATOM   1539 C CA    . LEU C 2 155 ? 13.734  22.151  3.317   1.00 43.86 ? 156 LEU A CA    1 
ATOM   1540 C C     . LEU C 2 155 ? 12.568  22.804  4.053   1.00 43.22 ? 156 LEU A C     1 
ATOM   1541 O O     . LEU C 2 155 ? 11.701  22.097  4.564   1.00 44.02 ? 156 LEU A O     1 
ATOM   1542 C CB    . LEU C 2 155 ? 14.631  21.475  4.346   1.00 42.92 ? 156 LEU A CB    1 
ATOM   1543 C CG    . LEU C 2 155 ? 15.428  20.271  3.870   1.00 40.91 ? 156 LEU A CG    1 
ATOM   1544 C CD1   . LEU C 2 155 ? 16.348  19.832  4.992   1.00 42.59 ? 156 LEU A CD1   1 
ATOM   1545 C CD2   . LEU C 2 155 ? 14.474  19.157  3.460   1.00 40.63 ? 156 LEU A CD2   1 
ATOM   1546 N N     . ASN C 2 156 ? 12.532  24.130  4.123   1.00 42.70 ? 157 ASN A N     1 
ATOM   1547 C CA    . ASN C 2 156 ? 11.445  24.788  4.828   1.00 41.37 ? 157 ASN A CA    1 
ATOM   1548 C C     . ASN C 2 156 ? 10.345  25.282  3.903   1.00 41.65 ? 157 ASN A C     1 
ATOM   1549 O O     . ASN C 2 156 ? 9.211   25.482  4.331   1.00 41.00 ? 157 ASN A O     1 
ATOM   1550 C CB    . ASN C 2 156 ? 11.980  25.914  5.722   1.00 45.19 ? 157 ASN A CB    1 
ATOM   1551 C CG    . ASN C 2 156 ? 12.133  25.489  7.203   1.00 48.88 ? 157 ASN A CG    1 
ATOM   1552 O OD1   . ASN C 2 156 ? 11.911  26.287  8.113   1.00 48.41 ? 157 ASN A OD1   1 
ATOM   1553 N ND2   . ASN C 2 156 ? 12.514  24.237  7.436   1.00 51.93 ? 157 ASN A ND2   1 
ATOM   1554 N N     . GLU C 2 157 ? 10.652  25.438  2.623   1.00 41.57 ? 158 GLU A N     1 
ATOM   1555 C CA    . GLU C 2 157 ? 9.636   25.917  1.680   1.00 42.79 ? 158 GLU A CA    1 
ATOM   1556 C C     . GLU C 2 157 ? 8.775   24.824  1.017   1.00 40.41 ? 158 GLU A C     1 
ATOM   1557 O O     . GLU C 2 157 ? 7.687   25.099  0.522   1.00 41.31 ? 158 GLU A O     1 
ATOM   1558 C CB    . GLU C 2 157 ? 10.288  26.801  0.610   1.00 44.22 ? 158 GLU A CB    1 
ATOM   1559 N N     . ILE C 2 158 ? 9.268   23.594  0.999   1.00 37.27 ? 159 ILE A N     1 
ATOM   1560 C CA    . ILE C 2 158 ? 8.557   22.482  0.378   1.00 33.22 ? 159 ILE A CA    1 
ATOM   1561 C C     . ILE C 2 158 ? 7.202   22.343  1.052   1.00 32.58 ? 159 ILE A C     1 
ATOM   1562 O O     . ILE C 2 158 ? 7.115   22.309  2.266   1.00 37.12 ? 159 ILE A O     1 
ATOM   1563 C CB    . ILE C 2 158 ? 9.369   21.169  0.542   1.00 30.42 ? 159 ILE A CB    1 
ATOM   1564 C CG1   . ILE C 2 158 ? 10.772  21.347  -0.031  1.00 27.23 ? 159 ILE A CG1   1 
ATOM   1565 C CG2   . ILE C 2 158 ? 8.675   20.002  -0.154  1.00 31.03 ? 159 ILE A CG2   1 
ATOM   1566 C CD1   . ILE C 2 158 ? 11.687  20.206  0.288   1.00 28.00 ? 159 ILE A CD1   1 
ATOM   1567 N N     . PRO C 2 159 ? 6.122   22.323  0.275   1.00 32.73 ? 160 PRO A N     1 
ATOM   1568 C CA    . PRO C 2 159 ? 4.795   22.187  0.879   1.00 36.54 ? 160 PRO A CA    1 
ATOM   1569 C C     . PRO C 2 159 ? 4.403   20.760  1.264   1.00 40.77 ? 160 PRO A C     1 
ATOM   1570 O O     . PRO C 2 159 ? 4.746   19.789  0.572   1.00 40.89 ? 160 PRO A O     1 
ATOM   1571 C CB    . PRO C 2 159 ? 3.878   22.715  -0.207  1.00 35.10 ? 160 PRO A CB    1 
ATOM   1572 C CG    . PRO C 2 159 ? 4.623   22.386  -1.433  1.00 36.31 ? 160 PRO A CG    1 
ATOM   1573 C CD    . PRO C 2 159 ? 5.997   22.869  -1.076  1.00 33.56 ? 160 PRO A CD    1 
ATOM   1574 N N     . LYS C 2 160 ? 3.628   20.657  2.343   1.00 42.91 ? 161 LYS A N     1 
ATOM   1575 C CA    . LYS C 2 160 ? 3.158   19.374  2.858   1.00 44.13 ? 161 LYS A CA    1 
ATOM   1576 C C     . LYS C 2 160 ? 1.732   19.037  2.439   1.00 41.57 ? 161 LYS A C     1 
ATOM   1577 O O     . LYS C 2 160 ? 0.893   19.915  2.285   1.00 42.45 ? 161 LYS A O     1 
ATOM   1578 C CB    . LYS C 2 160 ? 3.278   19.344  4.378   1.00 47.05 ? 161 LYS A CB    1 
ATOM   1579 N N     . PRO C 2 161 ? 1.444   17.742  2.263   1.00 44.02 ? 162 PRO A N     1 
ATOM   1580 C CA    . PRO C 2 161 ? 0.106   17.308  1.860   1.00 42.77 ? 162 PRO A CA    1 
ATOM   1581 C C     . PRO C 2 161 ? -0.751  16.909  3.057   1.00 42.61 ? 162 PRO A C     1 
ATOM   1582 O O     . PRO C 2 161 ? -1.761  16.205  2.890   1.00 41.46 ? 162 PRO A O     1 
ATOM   1583 C CB    . PRO C 2 161 ? 0.406   16.103  0.987   1.00 44.49 ? 162 PRO A CB    1 
ATOM   1584 C CG    . PRO C 2 161 ? 1.561   15.473  1.693   1.00 44.86 ? 162 PRO A CG    1 
ATOM   1585 C CD    . PRO C 2 161 ? 2.434   16.675  2.009   1.00 46.23 ? 162 PRO A CD    1 
ATOM   1586 N N     . TYR C 2 162 ? -0.374  17.393  4.244   1.00 40.44 ? 163 TYR A N     1 
ATOM   1587 C CA    . TYR C 2 162 ? -1.084  17.072  5.480   1.00 40.74 ? 163 TYR A CA    1 
ATOM   1588 C C     . TYR C 2 162 ? -0.986  18.169  6.520   1.00 41.23 ? 163 TYR A C     1 
ATOM   1589 O O     . TYR C 2 162 ? -0.110  19.024  6.452   1.00 41.43 ? 163 TYR A O     1 
ATOM   1590 C CB    . TYR C 2 162 ? -0.521  15.781  6.095   1.00 41.78 ? 163 TYR A CB    1 
ATOM   1591 C CG    . TYR C 2 162 ? 0.922   15.861  6.593   1.00 43.03 ? 163 TYR A CG    1 
ATOM   1592 C CD1   . TYR C 2 162 ? 1.264   16.632  7.715   1.00 42.51 ? 163 TYR A CD1   1 
ATOM   1593 C CD2   . TYR C 2 162 ? 1.939   15.151  5.952   1.00 42.79 ? 163 TYR A CD2   1 
ATOM   1594 C CE1   . TYR C 2 162 ? 2.575   16.694  8.178   1.00 40.14 ? 163 TYR A CE1   1 
ATOM   1595 C CE2   . TYR C 2 162 ? 3.258   15.208  6.411   1.00 42.55 ? 163 TYR A CE2   1 
ATOM   1596 C CZ    . TYR C 2 162 ? 3.565   15.984  7.526   1.00 41.65 ? 163 TYR A CZ    1 
ATOM   1597 O OH    . TYR C 2 162 ? 4.858   16.066  7.971   1.00 39.51 ? 163 TYR A OH    1 
ATOM   1598 N N     . LYS C 2 163 ? -1.826  18.069  7.540   1.00 42.13 ? 164 LYS A N     1 
ATOM   1599 C CA    . LYS C 2 163 ? -1.838  19.022  8.657   1.00 40.97 ? 164 LYS A CA    1 
ATOM   1600 C C     . LYS C 2 163 ? -2.319  18.287  9.912   1.00 38.80 ? 164 LYS A C     1 
ATOM   1601 O O     . LYS C 2 163 ? -2.693  17.097  9.846   1.00 38.06 ? 164 LYS A O     1 
ATOM   1602 C CB    . LYS C 2 163 ? -2.759  20.234  8.369   1.00 39.09 ? 164 LYS A CB    1 
ATOM   1603 N N     . GLY C 2 164 ? -2.258  19.001  11.038  1.00 34.77 ? 165 GLY A N     1 
ATOM   1604 C CA    . GLY C 2 164 ? -2.677  18.499  12.342  1.00 32.27 ? 165 GLY A CA    1 
ATOM   1605 C C     . GLY C 2 164 ? -2.562  17.013  12.594  1.00 28.75 ? 165 GLY A C     1 
ATOM   1606 O O     . GLY C 2 164 ? -3.564  16.360  12.882  1.00 31.39 ? 165 GLY A O     1 
ATOM   1607 N N     . VAL C 2 165 ? -1.354  16.474  12.470  1.00 25.54 ? 166 VAL A N     1 
ATOM   1608 C CA    . VAL C 2 165 ? -1.139  15.049  12.677  1.00 22.85 ? 166 VAL A CA    1 
ATOM   1609 C C     . VAL C 2 165 ? -1.251  14.673  14.147  1.00 25.79 ? 166 VAL A C     1 
ATOM   1610 O O     . VAL C 2 165 ? -0.497  15.181  14.979  1.00 24.88 ? 166 VAL A O     1 
ATOM   1611 C CB    . VAL C 2 165 ? 0.251   14.600  12.170  1.00 19.51 ? 166 VAL A CB    1 
ATOM   1612 C CG1   . VAL C 2 165 ? 0.462   13.134  12.428  1.00 20.01 ? 166 VAL A CG1   1 
ATOM   1613 C CG2   . VAL C 2 165 ? 0.363   14.843  10.686  1.00 25.49 ? 166 VAL A CG2   1 
ATOM   1614 N N     . LYS C 2 166 ? -2.147  13.728  14.438  1.00 26.74 ? 167 LYS A N     1 
ATOM   1615 C CA    . LYS C 2 166 ? -2.376  13.200  15.787  1.00 23.40 ? 167 LYS A CA    1 
ATOM   1616 C C     . LYS C 2 166 ? -1.964  11.708  15.835  1.00 25.73 ? 167 LYS A C     1 
ATOM   1617 O O     . LYS C 2 166 ? -2.057  10.975  14.836  1.00 21.95 ? 167 LYS A O     1 
ATOM   1618 C CB    . LYS C 2 166 ? -3.859  13.303  16.144  1.00 23.00 ? 167 LYS A CB    1 
ATOM   1619 C CG    . LYS C 2 166 ? -4.441  14.689  16.075  1.00 19.57 ? 167 LYS A CG    1 
ATOM   1620 C CD    . LYS C 2 166 ? -5.891  14.622  16.499  1.00 28.52 ? 167 LYS A CD    1 
ATOM   1621 C CE    . LYS C 2 166 ? -6.333  15.892  17.216  1.00 34.39 ? 167 LYS A CE    1 
ATOM   1622 N NZ    . LYS C 2 166 ? -7.709  15.754  17.831  1.00 42.38 ? 167 LYS A NZ    1 
ATOM   1623 N N     . VAL C 2 167 ? -1.500  11.248  16.988  1.00 25.18 ? 168 VAL A N     1 
ATOM   1624 C CA    . VAL C 2 167 ? -1.130  9.846   17.107  1.00 24.90 ? 168 VAL A CA    1 
ATOM   1625 C C     . VAL C 2 167 ? -1.476  9.326   18.493  1.00 24.26 ? 168 VAL A C     1 
ATOM   1626 O O     . VAL C 2 167 ? -1.613  10.108  19.437  1.00 24.00 ? 168 VAL A O     1 
ATOM   1627 C CB    . VAL C 2 167 ? 0.358   9.588   16.680  1.00 30.43 ? 168 VAL A CB    1 
ATOM   1628 C CG1   . VAL C 2 167 ? 1.310   10.593  17.339  1.00 32.07 ? 168 VAL A CG1   1 
ATOM   1629 C CG2   . VAL C 2 167 ? 0.773   8.115   16.945  1.00 30.54 ? 168 VAL A CG2   1 
ATOM   1630 N N     . PHE C 2 168 ? -1.740  8.029   18.588  1.00 21.11 ? 169 PHE A N     1 
ATOM   1631 C CA    . PHE C 2 168 ? -2.098  7.404   19.861  1.00 17.70 ? 169 PHE A CA    1 
ATOM   1632 C C     . PHE C 2 168 ? -1.611  5.965   19.857  1.00 16.78 ? 169 PHE A C     1 
ATOM   1633 O O     . PHE C 2 168 ? -1.287  5.432   18.789  1.00 18.16 ? 169 PHE A O     1 
ATOM   1634 C CB    . PHE C 2 168 ? -3.637  7.413   20.062  1.00 18.02 ? 169 PHE A CB    1 
ATOM   1635 C CG    . PHE C 2 168 ? -4.403  6.570   19.046  1.00 20.52 ? 169 PHE A CG    1 
ATOM   1636 C CD1   . PHE C 2 168 ? -4.469  5.186   19.176  1.00 19.81 ? 169 PHE A CD1   1 
ATOM   1637 C CD2   . PHE C 2 168 ? -5.041  7.167   17.954  1.00 15.73 ? 169 PHE A CD2   1 
ATOM   1638 C CE1   . PHE C 2 168 ? -5.155  4.403   18.235  1.00 18.08 ? 169 PHE A CE1   1 
ATOM   1639 C CE2   . PHE C 2 168 ? -5.718  6.402   17.023  1.00 15.74 ? 169 PHE A CE2   1 
ATOM   1640 C CZ    . PHE C 2 168 ? -5.779  5.004   17.166  1.00 15.25 ? 169 PHE A CZ    1 
ATOM   1641 N N     . LEU C 2 169 ? -1.470  5.371   21.041  1.00 15.45 ? 170 LEU A N     1 
ATOM   1642 C CA    . LEU C 2 169 ? -1.113  3.960   21.154  1.00 12.03 ? 170 LEU A CA    1 
ATOM   1643 C C     . LEU C 2 169 ? -2.185  3.358   22.011  1.00 14.08 ? 170 LEU A C     1 
ATOM   1644 O O     . LEU C 2 169 ? -2.543  3.897   23.041  1.00 13.91 ? 170 LEU A O     1 
ATOM   1645 C CB    . LEU C 2 169 ? 0.257   3.710   21.771  1.00 15.81 ? 170 LEU A CB    1 
ATOM   1646 C CG    . LEU C 2 169 ? 0.629   2.213   21.917  1.00 13.19 ? 170 LEU A CG    1 
ATOM   1647 C CD1   . LEU C 2 169 ? 2.099   2.039   21.819  1.00 17.41 ? 170 LEU A CD1   1 
ATOM   1648 C CD2   . LEU C 2 169 ? 0.163   1.644   23.237  1.00 18.99 ? 170 LEU A CD2   1 
ATOM   1649 N N     . GLN C 2 170 ? -2.695  2.218   21.592  1.00 15.58 ? 171 GLN A N     1 
ATOM   1650 C CA    . GLN C 2 170 ? -3.734  1.562   22.337  1.00 15.39 ? 171 GLN A CA    1 
ATOM   1651 C C     . GLN C 2 170 ? -3.751  0.073   21.981  1.00 18.49 ? 171 GLN A C     1 
ATOM   1652 O O     . GLN C 2 170 ? -3.243  -0.337  20.928  1.00 15.59 ? 171 GLN A O     1 
ATOM   1653 C CB    . GLN C 2 170 ? -5.050  2.242   21.997  1.00 16.25 ? 171 GLN A CB    1 
ATOM   1654 C CG    . GLN C 2 170 ? -6.226  1.837   22.824  1.00 19.37 ? 171 GLN A CG    1 
ATOM   1655 C CD    . GLN C 2 170 ? -6.012  2.086   24.295  1.00 14.01 ? 171 GLN A CD    1 
ATOM   1656 O OE1   . GLN C 2 170 ? -5.392  1.283   24.980  1.00 14.66 ? 171 GLN A OE1   1 
ATOM   1657 N NE2   . GLN C 2 170 ? -6.527  3.208   24.788  1.00 18.93 ? 171 GLN A NE2   1 
ATOM   1658 N N     . ASP C 2 171 ? -4.245  -0.749  22.897  1.00 18.86 ? 172 ASP A N     1 
ATOM   1659 C CA    . ASP C 2 171 ? -4.336  -2.185  22.628  1.00 17.90 ? 172 ASP A CA    1 
ATOM   1660 C C     . ASP C 2 171 ? -5.426  -2.408  21.546  1.00 16.46 ? 172 ASP A C     1 
ATOM   1661 O O     . ASP C 2 171 ? -6.514  -1.786  21.587  1.00 15.92 ? 172 ASP A O     1 
ATOM   1662 C CB    . ASP C 2 171 ? -4.701  -2.961  23.895  1.00 19.15 ? 172 ASP A CB    1 
ATOM   1663 C CG    . ASP C 2 171 ? -3.670  -2.820  24.987  1.00 18.82 ? 172 ASP A CG    1 
ATOM   1664 O OD1   . ASP C 2 171 ? -2.692  -3.611  25.044  1.00 19.14 ? 172 ASP A OD1   1 
ATOM   1665 O OD2   . ASP C 2 171 ? -3.851  -1.918  25.813  1.00 23.38 ? 172 ASP A OD2   1 
ATOM   1666 N N     . LYS C 2 172 ? -5.092  -3.236  20.555  1.00 14.08 ? 173 LYS A N     1 
ATOM   1667 C CA    . LYS C 2 172 ? -6.005  -3.577  19.459  1.00 10.00 ? 173 LYS A CA    1 
ATOM   1668 C C     . LYS C 2 172 ? -7.409  -3.952  19.949  1.00 8.58  ? 173 LYS A C     1 
ATOM   1669 O O     . LYS C 2 172 ? -8.384  -3.305  19.587  1.00 10.95 ? 173 LYS A O     1 
ATOM   1670 C CB    . LYS C 2 172 ? -5.438  -4.761  18.671  1.00 12.86 ? 173 LYS A CB    1 
ATOM   1671 C CG    . LYS C 2 172 ? -6.285  -5.183  17.455  1.00 18.87 ? 173 LYS A CG    1 
ATOM   1672 C CD    . LYS C 2 172 ? -5.856  -6.501  16.816  1.00 21.75 ? 173 LYS A CD    1 
ATOM   1673 C CE    . LYS C 2 172 ? -4.503  -6.417  16.150  1.00 21.57 ? 173 LYS A CE    1 
ATOM   1674 N NZ    . LYS C 2 172 ? -4.255  -7.607  15.288  1.00 31.64 ? 173 LYS A NZ    1 
ATOM   1675 N N     . TRP C 2 173 ? -7.510  -4.936  20.838  1.00 9.47  ? 174 TRP A N     1 
ATOM   1676 C CA    . TRP C 2 173 ? -8.806  -5.395  21.307  1.00 6.09  ? 174 TRP A CA    1 
ATOM   1677 C C     . TRP C 2 173 ? -9.665  -4.275  21.852  1.00 11.98 ? 174 TRP A C     1 
ATOM   1678 O O     . TRP C 2 173 ? -10.872 -4.270  21.660  1.00 11.79 ? 174 TRP A O     1 
ATOM   1679 C CB    . TRP C 2 173 ? -8.620  -6.503  22.340  1.00 10.12 ? 174 TRP A CB    1 
ATOM   1680 C CG    . TRP C 2 173 ? -8.261  -6.035  23.776  1.00 14.47 ? 174 TRP A CG    1 
ATOM   1681 C CD1   . TRP C 2 173 ? -7.010  -6.061  24.389  1.00 15.71 ? 174 TRP A CD1   1 
ATOM   1682 C CD2   . TRP C 2 173 ? -9.190  -5.612  24.798  1.00 12.85 ? 174 TRP A CD2   1 
ATOM   1683 N NE1   . TRP C 2 173 ? -7.127  -5.703  25.720  1.00 14.62 ? 174 TRP A NE1   1 
ATOM   1684 C CE2   . TRP C 2 173 ? -8.446  -5.424  25.995  1.00 17.64 ? 174 TRP A CE2   1 
ATOM   1685 C CE3   . TRP C 2 173 ? -10.575 -5.389  24.821  1.00 9.52  ? 174 TRP A CE3   1 
ATOM   1686 C CZ2   . TRP C 2 173 ? -9.050  -5.028  27.195  1.00 15.74 ? 174 TRP A CZ2   1 
ATOM   1687 C CZ3   . TRP C 2 173 ? -11.174 -4.999  26.010  1.00 15.09 ? 174 TRP A CZ3   1 
ATOM   1688 C CH2   . TRP C 2 173 ? -10.406 -4.823  27.184  1.00 17.88 ? 174 TRP A CH2   1 
ATOM   1689 N N     . VAL C 2 174 ? -9.024  -3.262  22.445  1.00 16.70 ? 175 VAL A N     1 
ATOM   1690 C CA    . VAL C 2 174 ? -9.721  -2.133  23.065  1.00 15.41 ? 175 VAL A CA    1 
ATOM   1691 C C     . VAL C 2 174 ? -10.476 -1.197  22.085  1.00 17.52 ? 175 VAL A C     1 
ATOM   1692 O O     . VAL C 2 174 ? -11.597 -0.721  22.360  1.00 14.38 ? 175 VAL A O     1 
ATOM   1693 C CB    . VAL C 2 174 ? -8.697  -1.321  23.961  1.00 21.22 ? 175 VAL A CB    1 
ATOM   1694 C CG1   . VAL C 2 174 ? -9.395  -0.184  24.685  1.00 16.72 ? 175 VAL A CG1   1 
ATOM   1695 C CG2   . VAL C 2 174 ? -7.994  -2.252  24.956  1.00 16.35 ? 175 VAL A CG2   1 
ATOM   1696 N N     . ILE C 2 175 ? -9.850  -0.931  20.944  1.00 17.61 ? 176 ILE A N     1 
ATOM   1697 C CA    . ILE C 2 175 ? -10.423 -0.057  19.925  1.00 15.80 ? 176 ILE A CA    1 
ATOM   1698 C C     . ILE C 2 175 ? -11.070 -0.852  18.773  1.00 17.98 ? 176 ILE A C     1 
ATOM   1699 O O     . ILE C 2 175 ? -11.451 -0.281  17.745  1.00 17.04 ? 176 ILE A O     1 
ATOM   1700 C CB    . ILE C 2 175 ? -9.350  0.914   19.367  1.00 10.74 ? 176 ILE A CB    1 
ATOM   1701 C CG1   . ILE C 2 175 ? -8.152  0.138   18.830  1.00 8.35  ? 176 ILE A CG1   1 
ATOM   1702 C CG2   . ILE C 2 175 ? -8.873  1.848   20.469  1.00 11.66 ? 176 ILE A CG2   1 
ATOM   1703 C CD1   . ILE C 2 175 ? -7.111  1.012   18.229  1.00 2.45  ? 176 ILE A CD1   1 
ATOM   1704 N N     . ALA C 2 176 ? -11.220 -2.160  18.969  1.00 18.07 ? 177 ALA A N     1 
ATOM   1705 C CA    . ALA C 2 176 ? -11.833 -3.036  17.971  1.00 15.86 ? 177 ALA A CA    1 
ATOM   1706 C C     . ALA C 2 176 ? -13.344 -2.827  17.961  1.00 18.91 ? 177 ALA A C     1 
ATOM   1707 O O     . ALA C 2 176 ? -13.950 -2.571  19.013  1.00 17.54 ? 177 ALA A O     1 
ATOM   1708 C CB    . ALA C 2 176 ? -11.507 -4.484  18.269  1.00 14.87 ? 177 ALA A CB    1 
ATOM   1709 N N     . GLY C 2 177 ? -13.928 -2.895  16.761  1.00 12.19 ? 178 GLY A N     1 
ATOM   1710 C CA    . GLY C 2 177 ? -15.354 -2.709  16.589  1.00 12.66 ? 178 GLY A CA    1 
ATOM   1711 C C     . GLY C 2 177 ? -15.989 -4.053  16.311  1.00 11.98 ? 178 GLY A C     1 
ATOM   1712 O O     . GLY C 2 177 ? -15.314 -5.076  16.355  1.00 14.05 ? 178 GLY A O     1 
ATOM   1713 N N     . ASP C 2 178 ? -17.284 -4.053  16.028  1.00 15.85 ? 179 ASP A N     1 
ATOM   1714 C CA    . ASP C 2 178 ? -18.041 -5.281  15.740  1.00 17.03 ? 179 ASP A CA    1 
ATOM   1715 C C     . ASP C 2 178 ? -18.404 -5.400  14.261  1.00 18.26 ? 179 ASP A C     1 
ATOM   1716 O O     . ASP C 2 178 ? -19.117 -6.294  13.867  1.00 17.24 ? 179 ASP A O     1 
ATOM   1717 C CB    . ASP C 2 178 ? -19.322 -5.337  16.590  1.00 16.37 ? 179 ASP A CB    1 
ATOM   1718 C CG    . ASP C 2 178 ? -20.234 -4.109  16.404  1.00 21.51 ? 179 ASP A CG    1 
ATOM   1719 O OD1   . ASP C 2 178 ? -19.800 -3.101  15.821  1.00 24.76 ? 179 ASP A OD1   1 
ATOM   1720 O OD2   . ASP C 2 178 ? -21.400 -4.115  16.869  1.00 24.05 ? 179 ASP A OD2   1 
ATOM   1721 N N     . LEU C 2 179 ? -17.960 -4.449  13.454  1.00 18.93 ? 180 LEU A N     1 
ATOM   1722 C CA    . LEU C 2 179 ? -18.236 -4.466  12.016  1.00 20.25 ? 180 LEU A CA    1 
ATOM   1723 C C     . LEU C 2 179 ? -16.891 -4.565  11.273  1.00 19.85 ? 180 LEU A C     1 
ATOM   1724 O O     . LEU C 2 179 ? -15.865 -4.051  11.723  1.00 21.31 ? 180 LEU A O     1 
ATOM   1725 C CB    . LEU C 2 179 ? -18.989 -3.181  11.567  1.00 21.37 ? 180 LEU A CB    1 
ATOM   1726 C CG    . LEU C 2 179 ? -20.235 -2.632  12.296  1.00 17.39 ? 180 LEU A CG    1 
ATOM   1727 C CD1   . LEU C 2 179 ? -20.579 -1.297  11.712  1.00 13.57 ? 180 LEU A CD1   1 
ATOM   1728 C CD2   . LEU C 2 179 ? -21.440 -3.584  12.213  1.00 17.73 ? 180 LEU A CD2   1 
ATOM   1729 N N     . ALA C 2 180 ? -16.898 -5.249  10.140  1.00 17.99 ? 181 ALA A N     1 
ATOM   1730 C CA    . ALA C 2 180 ? -15.691 -5.413  9.348   1.00 19.78 ? 181 ALA A CA    1 
ATOM   1731 C C     . ALA C 2 180 ? -15.116 -4.094  8.855   1.00 13.33 ? 181 ALA A C     1 
ATOM   1732 O O     . ALA C 2 180 ? -15.807 -3.085  8.783   1.00 16.49 ? 181 ALA A O     1 
ATOM   1733 C CB    . ALA C 2 180 ? -15.962 -6.327  8.166   1.00 18.79 ? 181 ALA A CB    1 
ATOM   1734 N N     . GLY C 2 181 ? -13.814 -4.091  8.629   1.00 11.64 ? 182 GLY A N     1 
ATOM   1735 C CA    . GLY C 2 181 ? -13.154 -2.913  8.089   1.00 14.25 ? 182 GLY A CA    1 
ATOM   1736 C C     . GLY C 2 181 ? -13.046 -3.053  6.569   1.00 15.26 ? 182 GLY A C     1 
ATOM   1737 O O     . GLY C 2 181 ? -12.920 -2.055  5.849   1.00 16.25 ? 182 GLY A O     1 
ATOM   1738 N N     . SER C 2 182 ? -13.118 -4.289  6.072   1.00 14.27 ? 183 SER A N     1 
ATOM   1739 C CA    . SER C 2 182 ? -13.050 -4.532  4.641   1.00 12.58 ? 183 SER A CA    1 
ATOM   1740 C C     . SER C 2 182 ? -13.839 -5.790  4.220   1.00 13.73 ? 183 SER A C     1 
ATOM   1741 O O     . SER C 2 182 ? -14.156 -6.639  5.056   1.00 15.28 ? 183 SER A O     1 
ATOM   1742 C CB    . SER C 2 182 ? -11.596 -4.583  4.181   1.00 9.59  ? 183 SER A CB    1 
ATOM   1743 O OG    . SER C 2 182 ? -10.888 -5.649  4.785   1.00 14.34 ? 183 SER A OG    1 
ATOM   1744 N N     . GLY C 2 183 ? -14.210 -5.856  2.940   1.00 12.86 ? 184 GLY A N     1 
ATOM   1745 C CA    . GLY C 2 183 ? -14.975 -6.969  2.408   1.00 6.77  ? 184 GLY A CA    1 
ATOM   1746 C C     . GLY C 2 183 ? -14.074 -8.076  1.950   1.00 14.24 ? 184 GLY A C     1 
ATOM   1747 O O     . GLY C 2 183 ? -13.740 -8.979  2.726   1.00 16.56 ? 184 GLY A O     1 
ATOM   1748 N N     . ASN C 2 184 ? -13.581 -7.968  0.727   1.00 16.17 ? 185 ASN A N     1 
ATOM   1749 C CA    . ASN C 2 184 ? -12.716 -9.017  0.160   1.00 20.15 ? 185 ASN A CA    1 
ATOM   1750 C C     . ASN C 2 184 ? -11.414 -9.263  0.883   1.00 16.64 ? 185 ASN A C     1 
ATOM   1751 O O     . ASN C 2 184 ? -10.761 -10.289 0.673   1.00 17.86 ? 185 ASN A O     1 
ATOM   1752 C CB    . ASN C 2 184 ? -12.452 -8.807  -1.351  1.00 22.09 ? 185 ASN A CB    1 
ATOM   1753 C CG    . ASN C 2 184 ? -11.804 -7.456  -1.674  1.00 24.28 ? 185 ASN A CG    1 
ATOM   1754 O OD1   . ASN C 2 184 ? -11.629 -6.597  -0.793  1.00 22.39 ? 185 ASN A OD1   1 
ATOM   1755 N ND2   . ASN C 2 184 ? -11.451 -7.261  -2.956  1.00 22.68 ? 185 ASN A ND2   1 
ATOM   1756 N N     . THR C 2 185 ? -10.983 -8.284  1.656   1.00 15.99 ? 186 THR A N     1 
ATOM   1757 C CA    . THR C 2 185 ? -9.744  -8.442  2.406   1.00 19.74 ? 186 THR A CA    1 
ATOM   1758 C C     . THR C 2 185 ? -10.034 -8.780  3.892   1.00 19.75 ? 186 THR A C     1 
ATOM   1759 O O     . THR C 2 185 ? -9.123  -8.782  4.721   1.00 18.33 ? 186 THR A O     1 
ATOM   1760 C CB    . THR C 2 185 ? -8.809  -7.198  2.274   1.00 15.59 ? 186 THR A CB    1 
ATOM   1761 O OG1   . THR C 2 185 ? -9.597  -6.001  2.373   1.00 21.62 ? 186 THR A OG1   1 
ATOM   1762 C CG2   . THR C 2 185 ? -8.093  -7.214  0.950   1.00 18.81 ? 186 THR A CG2   1 
ATOM   1763 N N     . THR C 2 186 ? -11.304 -9.053  4.198   1.00 17.64 ? 187 THR A N     1 
ATOM   1764 C CA    . THR C 2 186 ? -11.760 -9.449  5.532   1.00 17.91 ? 187 THR A CA    1 
ATOM   1765 C C     . THR C 2 186 ? -10.888 -8.883  6.670   1.00 16.07 ? 187 THR A C     1 
ATOM   1766 O O     . THR C 2 186 ? -10.051 -9.591  7.266   1.00 16.78 ? 187 THR A O     1 
ATOM   1767 C CB    . THR C 2 186 ? -11.844 -11.021 5.670   1.00 17.00 ? 187 THR A CB    1 
ATOM   1768 O OG1   . THR C 2 186 ? -10.574 -11.611 5.362   1.00 13.76 ? 187 THR A OG1   1 
ATOM   1769 C CG2   . THR C 2 186 ? -12.897 -11.601 4.732   1.00 19.90 ? 187 THR A CG2   1 
ATOM   1770 N N     . ASN C 2 187 ? -11.006 -7.581  6.871   1.00 15.81 ? 188 ASN A N     1 
ATOM   1771 C CA    . ASN C 2 187 ? -10.280 -6.909  7.943   1.00 16.34 ? 188 ASN A CA    1 
ATOM   1772 C C     . ASN C 2 187 ? -11.278 -6.562  9.044   1.00 11.89 ? 188 ASN A C     1 
ATOM   1773 O O     . ASN C 2 187 ? -12.463 -6.327  8.798   1.00 8.05  ? 188 ASN A O     1 
ATOM   1774 C CB    . ASN C 2 187 ? -9.594  -5.602  7.452   1.00 11.46 ? 188 ASN A CB    1 
ATOM   1775 C CG    . ASN C 2 187 ? -8.103  -5.739  7.297   1.00 10.64 ? 188 ASN A CG    1 
ATOM   1776 O OD1   . ASN C 2 187 ? -7.334  -4.990  7.925   1.00 12.06 ? 188 ASN A OD1   1 
ATOM   1777 N ND2   . ASN C 2 187 ? -7.666  -6.703  6.483   1.00 7.24  ? 188 ASN A ND2   1 
ATOM   1778 N N     . ILE C 2 188 ? -10.776 -6.571  10.269  1.00 15.46 ? 189 ILE A N     1 
ATOM   1779 C CA    . ILE C 2 188 ? -11.539 -6.186  11.435  1.00 11.49 ? 189 ILE A CA    1 
ATOM   1780 C C     . ILE C 2 188 ? -11.643 -4.647  11.400  1.00 12.14 ? 189 ILE A C     1 
ATOM   1781 O O     . ILE C 2 188 ? -10.687 -3.955  11.036  1.00 11.14 ? 189 ILE A O     1 
ATOM   1782 C CB    . ILE C 2 188 ? -10.790 -6.647  12.692  1.00 14.43 ? 189 ILE A CB    1 
ATOM   1783 C CG1   . ILE C 2 188 ? -10.751 -8.187  12.710  1.00 17.33 ? 189 ILE A CG1   1 
ATOM   1784 C CG2   . ILE C 2 188 ? -11.356 -5.975  13.932  1.00 15.99 ? 189 ILE A CG2   1 
ATOM   1785 C CD1   . ILE C 2 188 ? -9.852  -8.804  13.775  1.00 21.08 ? 189 ILE A CD1   1 
ATOM   1786 N N     . GLY C 2 189 ? -12.841 -4.127  11.626  1.00 8.48  ? 190 GLY A N     1 
ATOM   1787 C CA    . GLY C 2 189 ? -13.009 -2.692  11.640  1.00 7.29  ? 190 GLY A CA    1 
ATOM   1788 C C     . GLY C 2 189 ? -12.854 -2.232  13.087  1.00 11.70 ? 190 GLY A C     1 
ATOM   1789 O O     . GLY C 2 189 ? -13.140 -3.006  14.026  1.00 12.36 ? 190 GLY A O     1 
ATOM   1790 N N     . SER C 2 190 ? -12.343 -1.017  13.277  1.00 12.24 ? 191 SER A N     1 
ATOM   1791 C CA    . SER C 2 190 ? -12.175 -0.452  14.616  1.00 12.41 ? 191 SER A CA    1 
ATOM   1792 C C     . SER C 2 190 ? -13.481 0.230   14.946  1.00 14.36 ? 191 SER A C     1 
ATOM   1793 O O     . SER C 2 190 ? -14.443 0.167   14.196  1.00 12.30 ? 191 SER A O     1 
ATOM   1794 C CB    . SER C 2 190 ? -11.063 0.618   14.631  1.00 8.54  ? 191 SER A CB    1 
ATOM   1795 O OG    . SER C 2 190 ? -11.476 1.847   14.024  1.00 11.19 ? 191 SER A OG    1 
ATOM   1796 N N     . ILE C 2 191 ? -13.536 0.853   16.104  1.00 16.54 ? 192 ILE A N     1 
ATOM   1797 C CA    . ILE C 2 191 ? -14.713 1.625   16.442  1.00 16.32 ? 192 ILE A CA    1 
ATOM   1798 C C     . ILE C 2 191 ? -14.657 2.854   15.503  1.00 13.59 ? 192 ILE A C     1 
ATOM   1799 O O     . ILE C 2 191 ? -13.594 3.271   15.017  1.00 13.76 ? 192 ILE A O     1 
ATOM   1800 C CB    . ILE C 2 191 ? -14.680 2.103   17.947  1.00 16.76 ? 192 ILE A CB    1 
ATOM   1801 C CG1   . ILE C 2 191 ? -13.401 2.928   18.239  1.00 15.03 ? 192 ILE A CG1   1 
ATOM   1802 C CG2   . ILE C 2 191 ? -14.809 0.882   18.855  1.00 13.79 ? 192 ILE A CG2   1 
ATOM   1803 C CD1   . ILE C 2 191 ? -13.120 3.193   19.704  1.00 18.13 ? 192 ILE A CD1   1 
ATOM   1804 N N     . HIS C 2 192 ? -15.819 3.422   15.269  1.00 14.02 ? 193 HIS A N     1 
ATOM   1805 C CA    . HIS C 2 192 ? -15.970 4.581   14.431  1.00 18.90 ? 193 HIS A CA    1 
ATOM   1806 C C     . HIS C 2 192 ? -16.175 5.691   15.432  1.00 16.72 ? 193 HIS A C     1 
ATOM   1807 O O     . HIS C 2 192 ? -17.299 5.929   15.843  1.00 18.24 ? 193 HIS A O     1 
ATOM   1808 C CB    . HIS C 2 192 ? -17.237 4.410   13.611  1.00 20.07 ? 193 HIS A CB    1 
ATOM   1809 C CG    . HIS C 2 192 ? -17.404 5.444   12.560  1.00 27.83 ? 193 HIS A CG    1 
ATOM   1810 N ND1   . HIS C 2 192 ? -16.342 6.166   12.062  1.00 31.60 ? 193 HIS A ND1   1 
ATOM   1811 C CD2   . HIS C 2 192 ? -18.501 5.866   11.892  1.00 28.19 ? 193 HIS A CD2   1 
ATOM   1812 C CE1   . HIS C 2 192 ? -16.777 6.989   11.125  1.00 29.59 ? 193 HIS A CE1   1 
ATOM   1813 N NE2   . HIS C 2 192 ? -18.082 6.824   11.002  1.00 31.69 ? 193 HIS A NE2   1 
ATOM   1814 N N     . ALA C 2 193 ? -15.110 6.400   15.776  1.00 20.41 ? 194 ALA A N     1 
ATOM   1815 C CA    . ALA C 2 193 ? -15.200 7.440   16.787  1.00 18.37 ? 194 ALA A CA    1 
ATOM   1816 C C     . ALA C 2 193 ? -14.209 8.575   16.673  1.00 17.26 ? 194 ALA A C     1 
ATOM   1817 O O     . ALA C 2 193 ? -13.400 8.654   15.754  1.00 17.38 ? 194 ALA A O     1 
ATOM   1818 C CB    . ALA C 2 193 ? -15.052 6.796   18.142  1.00 24.05 ? 194 ALA A CB    1 
ATOM   1819 N N     . HIS C 2 194 ? -14.248 9.454   17.661  1.00 24.26 ? 195 HIS A N     1 
ATOM   1820 C CA    . HIS C 2 194 ? -13.311 10.570  17.706  1.00 22.50 ? 195 HIS A CA    1 
ATOM   1821 C C     . HIS C 2 194 ? -11.984 10.130  18.280  1.00 19.35 ? 195 HIS A C     1 
ATOM   1822 O O     . HIS C 2 194 ? -11.911 9.230   19.089  1.00 18.33 ? 195 HIS A O     1 
ATOM   1823 C CB    . HIS C 2 194 ? -13.866 11.687  18.562  1.00 24.95 ? 195 HIS A CB    1 
ATOM   1824 C CG    . HIS C 2 194 ? -15.030 12.373  17.942  1.00 25.78 ? 195 HIS A CG    1 
ATOM   1825 N ND1   . HIS C 2 194 ? -14.882 13.350  16.979  1.00 29.20 ? 195 HIS A ND1   1 
ATOM   1826 C CD2   . HIS C 2 194 ? -16.359 12.218  18.129  1.00 24.94 ? 195 HIS A CD2   1 
ATOM   1827 C CE1   . HIS C 2 194 ? -16.074 13.771  16.603  1.00 32.48 ? 195 HIS A CE1   1 
ATOM   1828 N NE2   . HIS C 2 194 ? -16.988 13.099  17.283  1.00 32.04 ? 195 HIS A NE2   1 
ATOM   1829 N N     . TYR C 2 195 ? -10.930 10.796  17.854  1.00 21.94 ? 196 TYR A N     1 
ATOM   1830 C CA    . TYR C 2 195 ? -9.575  10.519  18.299  1.00 21.48 ? 196 TYR A CA    1 
ATOM   1831 C C     . TYR C 2 195 ? -9.502  10.289  19.827  1.00 19.45 ? 196 TYR A C     1 
ATOM   1832 O O     . TYR C 2 195 ? -8.768  9.418   20.303  1.00 18.92 ? 196 TYR A O     1 
ATOM   1833 C CB    . TYR C 2 195 ? -8.672  11.698  17.828  1.00 19.94 ? 196 TYR A CB    1 
ATOM   1834 C CG    . TYR C 2 195 ? -7.305  11.760  18.454  1.00 15.31 ? 196 TYR A CG    1 
ATOM   1835 C CD1   . TYR C 2 195 ? -6.265  10.937  18.007  1.00 16.26 ? 196 TYR A CD1   1 
ATOM   1836 C CD2   . TYR C 2 195 ? -7.078  12.580  19.550  1.00 19.20 ? 196 TYR A CD2   1 
ATOM   1837 C CE1   . TYR C 2 195 ? -5.045  10.922  18.637  1.00 10.43 ? 196 TYR A CE1   1 
ATOM   1838 C CE2   . TYR C 2 195 ? -5.867  12.576  20.197  1.00 14.79 ? 196 TYR A CE2   1 
ATOM   1839 C CZ    . TYR C 2 195 ? -4.848  11.755  19.748  1.00 19.26 ? 196 TYR A CZ    1 
ATOM   1840 O OH    . TYR C 2 195 ? -3.651  11.795  20.442  1.00 16.58 ? 196 TYR A OH    1 
ATOM   1841 N N     . LYS C 2 196 ? -10.337 11.009  20.568  1.00 21.43 ? 197 LYS A N     1 
ATOM   1842 C CA    . LYS C 2 196 ? -10.341 10.937  22.034  1.00 24.63 ? 197 LYS A CA    1 
ATOM   1843 C C     . LYS C 2 196 ? -10.698 9.580   22.596  1.00 23.81 ? 197 LYS A C     1 
ATOM   1844 O O     . LYS C 2 196 ? -10.066 9.114   23.550  1.00 24.09 ? 197 LYS A O     1 
ATOM   1845 C CB    . LYS C 2 196 ? -11.248 12.016  22.645  1.00 24.63 ? 197 LYS A CB    1 
ATOM   1846 N N     . ASP C 2 197 ? -11.697 8.941   21.999  1.00 22.60 ? 198 ASP A N     1 
ATOM   1847 C CA    . ASP C 2 197 ? -12.135 7.629   22.447  1.00 19.24 ? 198 ASP A CA    1 
ATOM   1848 C C     . ASP C 2 197 ? -11.046 6.600   22.216  1.00 17.27 ? 198 ASP A C     1 
ATOM   1849 O O     . ASP C 2 197 ? -10.888 5.664   23.012  1.00 20.23 ? 198 ASP A O     1 
ATOM   1850 C CB    . ASP C 2 197 ? -13.423 7.275   21.747  1.00 25.96 ? 198 ASP A CB    1 
ATOM   1851 C CG    . ASP C 2 197 ? -14.473 8.354   21.925  1.00 34.15 ? 198 ASP A CG    1 
ATOM   1852 O OD1   . ASP C 2 197 ? -14.611 8.848   23.067  1.00 41.45 ? 198 ASP A OD1   1 
ATOM   1853 O OD2   . ASP C 2 197 ? -15.126 8.756   20.928  1.00 37.25 ? 198 ASP A OD2   1 
ATOM   1854 N N     . PHE C 2 198 ? -10.238 6.805   21.177  1.00 14.25 ? 199 PHE A N     1 
ATOM   1855 C CA    . PHE C 2 198 ? -9.133  5.902   20.899  1.00 11.54 ? 199 PHE A CA    1 
ATOM   1856 C C     . PHE C 2 198 ? -8.094  6.020   22.027  1.00 12.97 ? 199 PHE A C     1 
ATOM   1857 O O     . PHE C 2 198 ? -7.638  5.015   22.582  1.00 12.78 ? 199 PHE A O     1 
ATOM   1858 C CB    . PHE C 2 198 ? -8.482  6.215   19.540  1.00 12.56 ? 199 PHE A CB    1 
ATOM   1859 C CG    . PHE C 2 198 ? -9.318  5.830   18.371  1.00 17.79 ? 199 PHE A CG    1 
ATOM   1860 C CD1   . PHE C 2 198 ? -9.330  4.512   17.917  1.00 15.93 ? 199 PHE A CD1   1 
ATOM   1861 C CD2   . PHE C 2 198 ? -10.167 6.759   17.768  1.00 19.99 ? 199 PHE A CD2   1 
ATOM   1862 C CE1   . PHE C 2 198 ? -10.189 4.117   16.877  1.00 23.87 ? 199 PHE A CE1   1 
ATOM   1863 C CE2   . PHE C 2 198 ? -11.035 6.367   16.717  1.00 24.36 ? 199 PHE A CE2   1 
ATOM   1864 C CZ    . PHE C 2 198 ? -11.045 5.046   16.275  1.00 20.05 ? 199 PHE A CZ    1 
ATOM   1865 N N     . VAL C 2 199 ? -7.713  7.257   22.342  1.00 14.53 ? 200 VAL A N     1 
ATOM   1866 C CA    . VAL C 2 199 ? -6.735  7.537   23.399  1.00 16.81 ? 200 VAL A CA    1 
ATOM   1867 C C     . VAL C 2 199 ? -7.222  6.968   24.733  1.00 16.28 ? 200 VAL A C     1 
ATOM   1868 O O     . VAL C 2 199 ? -6.512  6.261   25.410  1.00 13.35 ? 200 VAL A O     1 
ATOM   1869 C CB    . VAL C 2 199 ? -6.507  9.070   23.566  1.00 17.05 ? 200 VAL A CB    1 
ATOM   1870 C CG1   . VAL C 2 199 ? -5.652  9.376   24.841  1.00 14.36 ? 200 VAL A CG1   1 
ATOM   1871 C CG2   . VAL C 2 199 ? -5.879  9.645   22.267  1.00 15.54 ? 200 VAL A CG2   1 
ATOM   1872 N N     . GLU C 2 200 ? -8.460  7.285   25.080  1.00 17.34 ? 201 GLU A N     1 
ATOM   1873 C CA    . GLU C 2 200 ? -9.096  6.816   26.308  1.00 23.06 ? 201 GLU A CA    1 
ATOM   1874 C C     . GLU C 2 200 ? -9.509  5.346   26.279  1.00 26.89 ? 201 GLU A C     1 
ATOM   1875 O O     . GLU C 2 200 ? -9.881  4.790   27.320  1.00 28.93 ? 201 GLU A O     1 
ATOM   1876 C CB    . GLU C 2 200 ? -10.330 7.643   26.597  1.00 21.82 ? 201 GLU A CB    1 
ATOM   1877 C CG    . GLU C 2 200 ? -10.030 9.040   26.962  1.00 22.79 ? 201 GLU A CG    1 
ATOM   1878 C CD    . GLU C 2 200 ? -11.285 9.790   27.256  1.00 24.85 ? 201 GLU A CD    1 
ATOM   1879 O OE1   . GLU C 2 200 ? -12.215 9.224   27.873  1.00 32.06 ? 201 GLU A OE1   1 
ATOM   1880 O OE2   . GLU C 2 200 ? -11.363 10.956  26.866  1.00 31.82 ? 201 GLU A OE2   1 
ATOM   1881 N N     . GLY C 2 201 ? -9.534  4.748   25.085  1.00 29.15 ? 202 GLY A N     1 
ATOM   1882 C CA    . GLY C 2 201 ? -9.879  3.346   24.954  1.00 22.40 ? 202 GLY A CA    1 
ATOM   1883 C C     . GLY C 2 201 ? -11.325 3.033   25.255  1.00 23.40 ? 202 GLY A C     1 
ATOM   1884 O O     . GLY C 2 201 ? -11.616 2.082   25.988  1.00 21.91 ? 202 GLY A O     1 
ATOM   1885 N N     . LYS C 2 202 ? -12.236 3.844   24.708  1.00 26.02 ? 203 LYS A N     1 
ATOM   1886 C CA    . LYS C 2 202 ? -13.693 3.653   24.864  1.00 23.58 ? 203 LYS A CA    1 
ATOM   1887 C C     . LYS C 2 202 ? -14.212 2.691   23.780  1.00 21.35 ? 203 LYS A C     1 
ATOM   1888 O O     . LYS C 2 202 ? -14.878 3.101   22.832  1.00 20.00 ? 203 LYS A O     1 
ATOM   1889 C CB    . LYS C 2 202 ? -14.426 5.002   24.767  1.00 19.85 ? 203 LYS A CB    1 
ATOM   1890 N N     . GLY C 2 203 ? -13.864 1.420   23.916  1.00 21.26 ? 204 GLY A N     1 
ATOM   1891 C CA    . GLY C 2 203 ? -14.293 0.432   22.952  1.00 22.10 ? 204 GLY A CA    1 
ATOM   1892 C C     . GLY C 2 203 ? -15.583 -0.256  23.348  1.00 23.47 ? 204 GLY A C     1 
ATOM   1893 O O     . GLY C 2 203 ? -16.205 0.098   24.349  1.00 27.33 ? 204 GLY A O     1 
ATOM   1894 N N     . ILE C 2 204 ? -15.963 -1.281  22.590  1.00 21.14 ? 205 ILE A N     1 
ATOM   1895 C CA    . ILE C 2 204 ? -17.181 -2.003  22.860  1.00 15.75 ? 205 ILE A CA    1 
ATOM   1896 C C     . ILE C 2 204 ? -17.003 -3.365  23.488  1.00 12.95 ? 205 ILE A C     1 
ATOM   1897 O O     . ILE C 2 204 ? -17.940 -3.879  24.074  1.00 17.16 ? 205 ILE A O     1 
ATOM   1898 C CB    . ILE C 2 204 ? -18.021 -2.148  21.628  1.00 20.03 ? 205 ILE A CB    1 
ATOM   1899 C CG1   . ILE C 2 204 ? -17.217 -2.841  20.540  1.00 20.32 ? 205 ILE A CG1   1 
ATOM   1900 C CG2   . ILE C 2 204 ? -18.545 -0.778  21.194  1.00 22.37 ? 205 ILE A CG2   1 
ATOM   1901 C CD1   . ILE C 2 204 ? -18.081 -3.367  19.417  1.00 19.38 ? 205 ILE A CD1   1 
ATOM   1902 N N     . PHE C 2 205 ? -15.860 -3.999  23.292  1.00 11.75 ? 206 PHE A N     1 
ATOM   1903 C CA    . PHE C 2 205 ? -15.608 -5.290  23.920  1.00 15.07 ? 206 PHE A CA    1 
ATOM   1904 C C     . PHE C 2 205 ? -15.320 -5.127  25.440  1.00 20.52 ? 206 PHE A C     1 
ATOM   1905 O O     . PHE C 2 205 ? -14.871 -4.036  25.891  1.00 20.91 ? 206 PHE A O     1 
ATOM   1906 C CB    . PHE C 2 205 ? -14.459 -6.004  23.190  1.00 15.83 ? 206 PHE A CB    1 
ATOM   1907 C CG    . PHE C 2 205 ? -14.829 -6.445  21.797  1.00 17.60 ? 206 PHE A CG    1 
ATOM   1908 C CD1   . PHE C 2 205 ? -15.753 -7.485  21.608  1.00 17.97 ? 206 PHE A CD1   1 
ATOM   1909 C CD2   . PHE C 2 205 ? -14.305 -5.805  20.681  1.00 16.41 ? 206 PHE A CD2   1 
ATOM   1910 C CE1   . PHE C 2 205 ? -16.155 -7.878  20.332  1.00 18.66 ? 206 PHE A CE1   1 
ATOM   1911 C CE2   . PHE C 2 205 ? -14.706 -6.198  19.383  1.00 18.16 ? 206 PHE A CE2   1 
ATOM   1912 C CZ    . PHE C 2 205 ? -15.634 -7.238  19.213  1.00 13.76 ? 206 PHE A CZ    1 
ATOM   1913 N N     . ASP C 2 206 ? -15.607 -6.175  26.220  1.00 20.74 ? 207 ASP A N     1 
ATOM   1914 C CA    . ASP C 2 206 ? -15.402 -6.139  27.670  1.00 28.42 ? 207 ASP A CA    1 
ATOM   1915 C C     . ASP C 2 206 ? -14.056 -6.767  28.062  1.00 31.91 ? 207 ASP A C     1 
ATOM   1916 O O     . ASP C 2 206 ? -13.389 -6.337  29.020  1.00 30.53 ? 207 ASP A O     1 
ATOM   1917 C CB    . ASP C 2 206 ? -16.580 -6.799  28.398  1.00 27.35 ? 207 ASP A CB    1 
ATOM   1918 C CG    . ASP C 2 206 ? -17.820 -5.889  28.479  1.00 32.96 ? 207 ASP A CG    1 
ATOM   1919 O OD1   . ASP C 2 206 ? -17.859 -4.815  27.835  1.00 36.50 ? 207 ASP A OD1   1 
ATOM   1920 O OD2   . ASP C 2 206 ? -18.793 -6.236  29.187  1.00 35.15 ? 207 ASP A OD2   1 
ATOM   1921 N N     . SER C 2 207 ? -13.639 -7.758  27.279  1.00 28.82 ? 208 SER A N     1 
ATOM   1922 C CA    . SER C 2 207 ? -12.373 -8.424  27.503  1.00 25.38 ? 208 SER A CA    1 
ATOM   1923 C C     . SER C 2 207 ? -11.750 -8.753  26.154  1.00 24.29 ? 208 SER A C     1 
ATOM   1924 O O     . SER C 2 207 ? -12.409 -8.658  25.098  1.00 17.87 ? 208 SER A O     1 
ATOM   1925 C CB    . SER C 2 207 ? -12.583 -9.716  28.276  1.00 28.70 ? 208 SER A CB    1 
ATOM   1926 O OG    . SER C 2 207 ? -13.310 -10.652 27.507  1.00 31.22 ? 208 SER A OG    1 
ATOM   1927 N N     . GLU C 2 208 ? -10.494 -9.186  26.212  1.00 20.01 ? 209 GLU A N     1 
ATOM   1928 C CA    . GLU C 2 208 ? -9.744  -9.541  25.028  1.00 22.52 ? 209 GLU A CA    1 
ATOM   1929 C C     . GLU C 2 208 ? -10.220 -10.890 24.509  1.00 19.77 ? 209 GLU A C     1 
ATOM   1930 O O     . GLU C 2 208 ? -10.072 -11.204 23.323  1.00 20.61 ? 209 GLU A O     1 
ATOM   1931 C CB    . GLU C 2 208 ? -8.247  -9.542  25.330  1.00 24.47 ? 209 GLU A CB    1 
ATOM   1932 C CG    . GLU C 2 208 ? -7.361  -9.832  24.117  1.00 25.13 ? 209 GLU A CG    1 
ATOM   1933 C CD    . GLU C 2 208 ? -5.907  -9.537  24.391  1.00 27.35 ? 209 GLU A CD    1 
ATOM   1934 O OE1   . GLU C 2 208 ? -5.558  -9.315  25.574  1.00 26.77 ? 209 GLU A OE1   1 
ATOM   1935 O OE2   . GLU C 2 208 ? -5.112  -9.507  23.426  1.00 26.22 ? 209 GLU A OE2   1 
ATOM   1936 N N     . ASP C 2 209 ? -10.827 -11.661 25.399  1.00 21.81 ? 210 ASP A N     1 
ATOM   1937 C CA    . ASP C 2 209 ? -11.384 -12.967 25.049  1.00 20.67 ? 210 ASP A CA    1 
ATOM   1938 C C     . ASP C 2 209 ? -12.709 -12.771 24.348  1.00 18.04 ? 210 ASP A C     1 
ATOM   1939 O O     . ASP C 2 209 ? -13.112 -13.587 23.521  1.00 20.89 ? 210 ASP A O     1 
ATOM   1940 C CB    . ASP C 2 209 ? -11.608 -13.810 26.292  1.00 22.48 ? 210 ASP A CB    1 
ATOM   1941 C CG    . ASP C 2 209 ? -10.329 -14.145 26.989  1.00 28.97 ? 210 ASP A CG    1 
ATOM   1942 O OD1   . ASP C 2 209 ? -9.246  -14.026 26.366  1.00 35.33 ? 210 ASP A OD1   1 
ATOM   1943 O OD2   . ASP C 2 209 ? -10.412 -14.545 28.163  1.00 35.69 ? 210 ASP A OD2   1 
ATOM   1944 N N     . GLU C 2 210 ? -13.420 -11.722 24.731  1.00 10.93 ? 211 GLU A N     1 
ATOM   1945 C CA    . GLU C 2 210 ? -14.685 -11.445 24.091  1.00 15.68 ? 211 GLU A CA    1 
ATOM   1946 C C     . GLU C 2 210 ? -14.360 -11.064 22.628  1.00 20.45 ? 211 GLU A C     1 
ATOM   1947 O O     . GLU C 2 210 ? -14.947 -11.624 21.672  1.00 19.93 ? 211 GLU A O     1 
ATOM   1948 C CB    . GLU C 2 210 ? -15.429 -10.297 24.790  1.00 17.47 ? 211 GLU A CB    1 
ATOM   1949 C CG    . GLU C 2 210 ? -16.913 -10.316 24.433  1.00 23.76 ? 211 GLU A CG    1 
ATOM   1950 C CD    . GLU C 2 210 ? -17.724 -9.163  24.974  1.00 23.47 ? 211 GLU A CD    1 
ATOM   1951 O OE1   . GLU C 2 210 ? -17.193 -8.040  25.081  1.00 22.90 ? 211 GLU A OE1   1 
ATOM   1952 O OE2   . GLU C 2 210 ? -18.928 -9.365  25.243  1.00 18.15 ? 211 GLU A OE2   1 
ATOM   1953 N N     . PHE C 2 211 ? -13.376 -10.158 22.485  1.00 17.91 ? 212 PHE A N     1 
ATOM   1954 C CA    . PHE C 2 211 ? -12.873 -9.646  21.197  1.00 18.05 ? 212 PHE A CA    1 
ATOM   1955 C C     . PHE C 2 211 ? -12.504 -10.786 20.251  1.00 14.99 ? 212 PHE A C     1 
ATOM   1956 O O     . PHE C 2 211 ? -13.038 -10.898 19.134  1.00 14.23 ? 212 PHE A O     1 
ATOM   1957 C CB    . PHE C 2 211 ? -11.646 -8.710  21.426  1.00 16.34 ? 212 PHE A CB    1 
ATOM   1958 C CG    . PHE C 2 211 ? -10.834 -8.400  20.159  1.00 19.44 ? 212 PHE A CG    1 
ATOM   1959 C CD1   . PHE C 2 211 ? -11.402 -7.711  19.060  1.00 18.40 ? 212 PHE A CD1   1 
ATOM   1960 C CD2   . PHE C 2 211 ? -9.509  -8.821  20.056  1.00 16.65 ? 212 PHE A CD2   1 
ATOM   1961 C CE1   . PHE C 2 211 ? -10.662 -7.464  17.891  1.00 17.14 ? 212 PHE A CE1   1 
ATOM   1962 C CE2   . PHE C 2 211 ? -8.764  -8.569  18.879  1.00 19.69 ? 212 PHE A CE2   1 
ATOM   1963 C CZ    . PHE C 2 211 ? -9.349  -7.891  17.801  1.00 16.38 ? 212 PHE A CZ    1 
ATOM   1964 N N     . LEU C 2 212 ? -11.574 -11.615 20.708  1.00 15.61 ? 213 LEU A N     1 
ATOM   1965 C CA    . LEU C 2 212 ? -11.106 -12.739 19.936  1.00 21.48 ? 213 LEU A CA    1 
ATOM   1966 C C     . LEU C 2 212 ? -12.209 -13.751 19.541  1.00 26.65 ? 213 LEU A C     1 
ATOM   1967 O O     . LEU C 2 212 ? -12.192 -14.299 18.422  1.00 22.16 ? 213 LEU A O     1 
ATOM   1968 C CB    . LEU C 2 212 ? -9.942  -13.419 20.665  1.00 17.76 ? 213 LEU A CB    1 
ATOM   1969 C CG    . LEU C 2 212 ? -8.558  -12.916 20.248  1.00 18.67 ? 213 LEU A CG    1 
ATOM   1970 C CD1   . LEU C 2 212 ? -7.490  -13.799 20.838  1.00 17.87 ? 213 LEU A CD1   1 
ATOM   1971 C CD2   . LEU C 2 212 ? -8.416  -12.963 18.753  1.00 19.47 ? 213 LEU A CD2   1 
ATOM   1972 N N     . ASP C 2 213 ? -13.170 -13.983 20.440  1.00 28.83 ? 214 ASP A N     1 
ATOM   1973 C CA    . ASP C 2 213 ? -14.265 -14.922 20.165  1.00 26.32 ? 214 ASP A CA    1 
ATOM   1974 C C     . ASP C 2 213 ? -15.199 -14.394 19.075  1.00 26.89 ? 214 ASP A C     1 
ATOM   1975 O O     . ASP C 2 213 ? -15.559 -15.127 18.143  1.00 22.07 ? 214 ASP A O     1 
ATOM   1976 C CB    . ASP C 2 213 ? -15.080 -15.227 21.435  1.00 27.75 ? 214 ASP A CB    1 
ATOM   1977 C CG    . ASP C 2 213 ? -15.950 -16.481 21.289  1.00 26.63 ? 214 ASP A CG    1 
ATOM   1978 O OD1   . ASP C 2 213 ? -15.506 -17.451 20.636  1.00 29.76 ? 214 ASP A OD1   1 
ATOM   1979 O OD2   . ASP C 2 213 ? -17.072 -16.538 21.841  1.00 27.80 ? 214 ASP A OD2   1 
ATOM   1980 N N     . TYR C 2 214 ? -15.585 -13.121 19.198  1.00 21.11 ? 215 TYR A N     1 
ATOM   1981 C CA    . TYR C 2 214 ? -16.475 -12.491 18.234  1.00 20.62 ? 215 TYR A CA    1 
ATOM   1982 C C     . TYR C 2 214 ? -15.865 -12.534 16.825  1.00 22.72 ? 215 TYR A C     1 
ATOM   1983 O O     . TYR C 2 214 ? -16.562 -12.867 15.866  1.00 21.40 ? 215 TYR A O     1 
ATOM   1984 C CB    . TYR C 2 214 ? -16.764 -11.044 18.663  1.00 18.93 ? 215 TYR A CB    1 
ATOM   1985 C CG    . TYR C 2 214 ? -17.653 -10.231 17.734  1.00 21.05 ? 215 TYR A CG    1 
ATOM   1986 C CD1   . TYR C 2 214 ? -17.148 -9.685  16.537  1.00 21.11 ? 215 TYR A CD1   1 
ATOM   1987 C CD2   . TYR C 2 214 ? -18.998 -9.993  18.045  1.00 19.94 ? 215 TYR A CD2   1 
ATOM   1988 C CE1   . TYR C 2 214 ? -17.966 -8.932  15.676  1.00 16.29 ? 215 TYR A CE1   1 
ATOM   1989 C CE2   . TYR C 2 214 ? -19.814 -9.248  17.197  1.00 20.71 ? 215 TYR A CE2   1 
ATOM   1990 C CZ    . TYR C 2 214 ? -19.298 -8.720  16.009  1.00 15.94 ? 215 TYR A CZ    1 
ATOM   1991 O OH    . TYR C 2 214 ? -20.139 -8.028  15.162  1.00 9.46  ? 215 TYR A OH    1 
ATOM   1992 N N     . TRP C 2 215 ? -14.566 -12.258 16.693  1.00 18.66 ? 216 TRP A N     1 
ATOM   1993 C CA    . TRP C 2 215 ? -13.959 -12.254 15.358  1.00 18.47 ? 216 TRP A CA    1 
ATOM   1994 C C     . TRP C 2 215 ? -13.555 -13.626 14.773  1.00 20.18 ? 216 TRP A C     1 
ATOM   1995 O O     . TRP C 2 215 ? -13.444 -13.796 13.545  1.00 14.61 ? 216 TRP A O     1 
ATOM   1996 C CB    . TRP C 2 215 ? -12.809 -11.237 15.298  1.00 16.31 ? 216 TRP A CB    1 
ATOM   1997 C CG    . TRP C 2 215 ? -13.315 -9.834  15.228  1.00 12.56 ? 216 TRP A CG    1 
ATOM   1998 C CD1   . TRP C 2 215 ? -13.356 -8.934  16.246  1.00 8.65  ? 216 TRP A CD1   1 
ATOM   1999 C CD2   . TRP C 2 215 ? -13.939 -9.202  14.095  1.00 12.14 ? 216 TRP A CD2   1 
ATOM   2000 N NE1   . TRP C 2 215 ? -13.977 -7.783  15.828  1.00 15.11 ? 216 TRP A NE1   1 
ATOM   2001 C CE2   . TRP C 2 215 ? -14.343 -7.915  14.512  1.00 11.44 ? 216 TRP A CE2   1 
ATOM   2002 C CE3   . TRP C 2 215 ? -14.198 -9.605  12.765  1.00 12.41 ? 216 TRP A CE3   1 
ATOM   2003 C CZ2   . TRP C 2 215 ? -14.995 -7.011  13.653  1.00 8.63  ? 216 TRP A CZ2   1 
ATOM   2004 C CZ3   . TRP C 2 215 ? -14.849 -8.699  11.902  1.00 10.06 ? 216 TRP A CZ3   1 
ATOM   2005 C CH2   . TRP C 2 215 ? -15.236 -7.415  12.362  1.00 14.18 ? 216 TRP A CH2   1 
ATOM   2006 N N     . ARG C 2 216 ? -13.353 -14.599 15.656  1.00 19.35 ? 217 ARG A N     1 
ATOM   2007 C CA    . ARG C 2 216 ? -13.005 -15.960 15.261  1.00 19.62 ? 217 ARG A CA    1 
ATOM   2008 C C     . ARG C 2 216 ? -14.273 -16.691 14.768  1.00 21.62 ? 217 ARG A C     1 
ATOM   2009 O O     . ARG C 2 216 ? -14.212 -17.783 14.216  1.00 22.84 ? 217 ARG A O     1 
ATOM   2010 C CB    . ARG C 2 216 ? -12.430 -16.703 16.468  1.00 18.85 ? 217 ARG A CB    1 
ATOM   2011 C CG    . ARG C 2 216 ? -10.978 -16.432 16.748  1.00 18.08 ? 217 ARG A CG    1 
ATOM   2012 C CD    . ARG C 2 216 ? -10.521 -17.140 18.024  1.00 18.69 ? 217 ARG A CD    1 
ATOM   2013 N NE    . ARG C 2 216 ? -9.065  -17.145 18.082  1.00 17.50 ? 217 ARG A NE    1 
ATOM   2014 C CZ    . ARG C 2 216 ? -8.333  -17.202 19.193  1.00 20.45 ? 217 ARG A CZ    1 
ATOM   2015 N NH1   . ARG C 2 216 ? -8.916  -17.261 20.390  1.00 18.99 ? 217 ARG A NH1   1 
ATOM   2016 N NH2   . ARG C 2 216 ? -7.009  -17.240 19.093  1.00 16.76 ? 217 ARG A NH2   1 
ATOM   2017 N N     . ASN C 2 217 ? -15.432 -16.084 14.986  1.00 22.17 ? 218 ASN A N     1 
ATOM   2018 C CA    . ASN C 2 217 ? -16.678 -16.689 14.578  1.00 24.37 ? 218 ASN A CA    1 
ATOM   2019 C C     . ASN C 2 217 ? -17.496 -15.781 13.667  1.00 25.38 ? 218 ASN A C     1 
ATOM   2020 O O     . ASN C 2 217 ? -18.627 -16.136 13.291  1.00 30.28 ? 218 ASN A O     1 
ATOM   2021 C CB    . ASN C 2 217 ? -17.511 -17.062 15.808  1.00 23.58 ? 218 ASN A CB    1 
ATOM   2022 C CG    . ASN C 2 217 ? -16.871 -18.141 16.624  1.00 26.73 ? 218 ASN A CG    1 
ATOM   2023 O OD1   . ASN C 2 217 ? -17.199 -19.316 16.482  1.00 31.33 ? 218 ASN A OD1   1 
ATOM   2024 N ND2   . ASN C 2 217 ? -15.936 -17.756 17.484  1.00 25.97 ? 218 ASN A ND2   1 
ATOM   2025 N N     . TYR C 2 218 ? -16.946 -14.616 13.335  1.00 19.64 ? 219 TYR A N     1 
ATOM   2026 C CA    . TYR C 2 218 ? -17.618 -13.644 12.477  1.00 17.97 ? 219 TYR A CA    1 
ATOM   2027 C C     . TYR C 2 218 ? -17.736 -14.231 11.088  1.00 17.41 ? 219 TYR A C     1 
ATOM   2028 O O     . TYR C 2 218 ? -16.744 -14.693 10.548  1.00 15.44 ? 219 TYR A O     1 
ATOM   2029 C CB    . TYR C 2 218 ? -16.779 -12.383 12.382  1.00 17.30 ? 219 TYR A CB    1 
ATOM   2030 C CG    . TYR C 2 218 ? -17.442 -11.209 11.699  1.00 21.61 ? 219 TYR A CG    1 
ATOM   2031 C CD1   . TYR C 2 218 ? -18.390 -10.457 12.374  1.00 18.13 ? 219 TYR A CD1   1 
ATOM   2032 C CD2   . TYR C 2 218 ? -17.048 -10.782 10.414  1.00 22.48 ? 219 TYR A CD2   1 
ATOM   2033 C CE1   . TYR C 2 218 ? -18.928 -9.311  11.806  1.00 21.47 ? 219 TYR A CE1   1 
ATOM   2034 C CE2   . TYR C 2 218 ? -17.584 -9.603  9.832   1.00 18.04 ? 219 TYR A CE2   1 
ATOM   2035 C CZ    . TYR C 2 218 ? -18.525 -8.875  10.548  1.00 16.27 ? 219 TYR A CZ    1 
ATOM   2036 O OH    . TYR C 2 218 ? -19.066 -7.688  10.082  1.00 17.18 ? 219 TYR A OH    1 
ATOM   2037 N N     . GLU C 2 219 ? -18.947 -14.286 10.552  1.00 19.44 ? 220 GLU A N     1 
ATOM   2038 C CA    . GLU C 2 219 ? -19.136 -14.818 9.199   1.00 25.77 ? 220 GLU A CA    1 
ATOM   2039 C C     . GLU C 2 219 ? -18.651 -13.801 8.148   1.00 27.83 ? 220 GLU A C     1 
ATOM   2040 O O     . GLU C 2 219 ? -18.810 -12.575 8.314   1.00 30.05 ? 220 GLU A O     1 
ATOM   2041 C CB    . GLU C 2 219 ? -20.591 -15.216 8.950   1.00 22.85 ? 220 GLU A CB    1 
ATOM   2042 C CG    . GLU C 2 219 ? -21.053 -16.461 9.702   1.00 26.99 ? 220 GLU A CG    1 
ATOM   2043 C CD    . GLU C 2 219 ? -20.160 -17.671 9.478   1.00 29.88 ? 220 GLU A CD    1 
ATOM   2044 O OE1   . GLU C 2 219 ? -19.740 -17.911 8.325   1.00 36.58 ? 220 GLU A OE1   1 
ATOM   2045 O OE2   . GLU C 2 219 ? -19.853 -18.392 10.457  1.00 34.65 ? 220 GLU A OE2   1 
ATOM   2046 N N     . ARG C 2 220 ? -18.064 -14.322 7.072   1.00 29.02 ? 221 ARG A N     1 
ATOM   2047 C CA    . ARG C 2 220 ? -17.495 -13.527 5.981   1.00 30.13 ? 221 ARG A CA    1 
ATOM   2048 C C     . ARG C 2 220 ? -18.499 -12.604 5.295   1.00 28.06 ? 221 ARG A C     1 
ATOM   2049 O O     . ARG C 2 220 ? -18.167 -11.465 4.924   1.00 24.21 ? 221 ARG A O     1 
ATOM   2050 C CB    . ARG C 2 220 ? -16.898 -14.482 4.959   1.00 35.81 ? 221 ARG A CB    1 
ATOM   2051 C CG    . ARG C 2 220 ? -15.769 -13.932 4.142   1.00 40.29 ? 221 ARG A CG    1 
ATOM   2052 C CD    . ARG C 2 220 ? -15.041 -15.082 3.497   1.00 43.60 ? 221 ARG A CD    1 
ATOM   2053 N NE    . ARG C 2 220 ? -14.472 -15.965 4.515   1.00 49.33 ? 221 ARG A NE    1 
ATOM   2054 C CZ    . ARG C 2 220 ? -13.551 -16.895 4.273   1.00 52.98 ? 221 ARG A CZ    1 
ATOM   2055 N NH1   . ARG C 2 220 ? -13.087 -17.075 3.031   1.00 54.86 ? 221 ARG A NH1   1 
ATOM   2056 N NH2   . ARG C 2 220 ? -13.093 -17.642 5.274   1.00 52.10 ? 221 ARG A NH2   1 
ATOM   2057 N N     . THR C 2 221 ? -19.723 -13.100 5.129   1.00 25.90 ? 222 THR A N     1 
ATOM   2058 C CA    . THR C 2 221 ? -20.757 -12.318 4.475   1.00 24.87 ? 222 THR A CA    1 
ATOM   2059 C C     . THR C 2 221 ? -21.979 -12.024 5.315   1.00 25.45 ? 222 THR A C     1 
ATOM   2060 O O     . THR C 2 221 ? -22.363 -12.796 6.184   1.00 22.86 ? 222 THR A O     1 
ATOM   2061 C CB    . THR C 2 221 ? -21.213 -12.982 3.189   1.00 24.68 ? 222 THR A CB    1 
ATOM   2062 O OG1   . THR C 2 221 ? -21.628 -14.332 3.469   1.00 18.41 ? 222 THR A OG1   1 
ATOM   2063 C CG2   . THR C 2 221 ? -20.072 -12.941 2.165   1.00 23.86 ? 222 THR A CG2   1 
ATOM   2064 N N     . SER C 2 222 ? -22.628 -10.921 4.974   1.00 26.45 ? 223 SER A N     1 
ATOM   2065 C CA    . SER C 2 222 ? -23.808 -10.464 5.663   1.00 28.01 ? 223 SER A CA    1 
ATOM   2066 C C     . SER C 2 222 ? -24.871 -11.545 5.633   1.00 30.17 ? 223 SER A C     1 
ATOM   2067 O O     . SER C 2 222 ? -25.676 -11.635 6.547   1.00 26.90 ? 223 SER A O     1 
ATOM   2068 C CB    . SER C 2 222 ? -24.323 -9.198  4.984   1.00 25.47 ? 223 SER A CB    1 
ATOM   2069 O OG    . SER C 2 222 ? -25.138 -8.440  5.861   1.00 32.12 ? 223 SER A OG    1 
ATOM   2070 N N     . GLN C 2 223 ? -24.856 -12.371 4.584   1.00 36.79 ? 224 GLN A N     1 
ATOM   2071 C CA    . GLN C 2 223 ? -25.830 -13.466 4.402   1.00 41.20 ? 224 GLN A CA    1 
ATOM   2072 C C     . GLN C 2 223 ? -25.647 -14.564 5.463   1.00 43.16 ? 224 GLN A C     1 
ATOM   2073 O O     . GLN C 2 223 ? -26.634 -15.094 6.007   1.00 43.30 ? 224 GLN A O     1 
ATOM   2074 C CB    . GLN C 2 223 ? -25.712 -14.058 2.983   1.00 40.11 ? 224 GLN A CB    1 
ATOM   2075 N N     . LEU C 2 224 ? -24.382 -14.900 5.733   1.00 41.36 ? 225 LEU A N     1 
ATOM   2076 C CA    . LEU C 2 224 ? -24.028 -15.886 6.742   1.00 40.50 ? 225 LEU A CA    1 
ATOM   2077 C C     . LEU C 2 224 ? -24.152 -15.243 8.130   1.00 40.77 ? 225 LEU A C     1 
ATOM   2078 O O     . LEU C 2 224 ? -24.600 -15.878 9.088   1.00 44.11 ? 225 LEU A O     1 
ATOM   2079 C CB    . LEU C 2 224 ? -22.598 -16.349 6.539   1.00 40.86 ? 225 LEU A CB    1 
ATOM   2080 C CG    . LEU C 2 224 ? -22.282 -17.217 5.336   1.00 42.75 ? 225 LEU A CG    1 
ATOM   2081 C CD1   . LEU C 2 224 ? -20.777 -17.263 5.200   1.00 47.43 ? 225 LEU A CD1   1 
ATOM   2082 C CD2   . LEU C 2 224 ? -22.848 -18.617 5.537   1.00 43.32 ? 225 LEU A CD2   1 
ATOM   2083 N N     . ARG C 2 225 ? -23.756 -13.980 8.238   1.00 36.68 ? 226 ARG A N     1 
ATOM   2084 C CA    . ARG C 2 225 ? -23.839 -13.264 9.500   1.00 33.62 ? 226 ARG A CA    1 
ATOM   2085 C C     . ARG C 2 225 ? -25.291 -13.084 9.916   1.00 33.79 ? 226 ARG A C     1 
ATOM   2086 O O     . ARG C 2 225 ? -25.602 -13.089 11.103  1.00 36.93 ? 226 ARG A O     1 
ATOM   2087 C CB    . ARG C 2 225 ? -23.191 -11.881 9.394   1.00 30.29 ? 226 ARG A CB    1 
ATOM   2088 C CG    . ARG C 2 225 ? -21.695 -11.880 9.221   1.00 29.63 ? 226 ARG A CG    1 
ATOM   2089 C CD    . ARG C 2 225 ? -21.102 -10.497 9.447   1.00 29.11 ? 226 ARG A CD    1 
ATOM   2090 N NE    . ARG C 2 225 ? -21.529 -9.480  8.478   1.00 30.84 ? 226 ARG A NE    1 
ATOM   2091 C CZ    . ARG C 2 225 ? -20.772 -9.002  7.482   1.00 30.56 ? 226 ARG A CZ    1 
ATOM   2092 N NH1   . ARG C 2 225 ? -19.531 -9.456  7.289   1.00 30.06 ? 226 ARG A NH1   1 
ATOM   2093 N NH2   . ARG C 2 225 ? -21.221 -7.995  6.740   1.00 19.63 ? 226 ARG A NH2   1 
ATOM   2094 N N     . ASN C 2 226 ? -26.176 -12.948 8.936   1.00 33.56 ? 227 ASN A N     1 
ATOM   2095 C CA    . ASN C 2 226 ? -27.596 -12.744 9.196   1.00 34.18 ? 227 ASN A CA    1 
ATOM   2096 C C     . ASN C 2 226 ? -28.162 -13.920 9.967   1.00 35.03 ? 227 ASN A C     1 
ATOM   2097 O O     . ASN C 2 226 ? -29.190 -13.811 10.621  1.00 37.06 ? 227 ASN A O     1 
ATOM   2098 C CB    . ASN C 2 226 ? -28.360 -12.571 7.880   1.00 33.39 ? 227 ASN A CB    1 
ATOM   2099 N N     . ASP C 2 227 ? -27.492 -15.056 9.861   1.00 37.88 ? 228 ASP A N     1 
ATOM   2100 C CA    . ASP C 2 227 ? -27.915 -16.263 10.543  1.00 39.40 ? 228 ASP A CA    1 
ATOM   2101 C C     . ASP C 2 227 ? -27.236 -16.365 11.912  1.00 38.85 ? 228 ASP A C     1 
ATOM   2102 O O     . ASP C 2 227 ? -27.789 -16.926 12.862  1.00 38.05 ? 228 ASP A O     1 
ATOM   2103 C CB    . ASP C 2 227 ? -27.539 -17.471 9.682   1.00 42.85 ? 228 ASP A CB    1 
ATOM   2104 N N     . LYS C 2 228 ? -25.991 -15.910 11.955  1.00 34.21 ? 229 LYS A N     1 
ATOM   2105 C CA    . LYS C 2 228 ? -25.184 -15.932 13.160  1.00 32.34 ? 229 LYS A CA    1 
ATOM   2106 C C     . LYS C 2 228 ? -25.411 -14.605 13.878  1.00 30.50 ? 229 LYS A C     1 
ATOM   2107 O O     . LYS C 2 228 ? -26.437 -14.427 14.529  1.00 35.18 ? 229 LYS A O     1 
ATOM   2108 C CB    . LYS C 2 228 ? -23.721 -16.125 12.763  1.00 34.26 ? 229 LYS A CB    1 
ATOM   2109 C CG    . LYS C 2 228 ? -22.864 -16.974 13.688  1.00 33.67 ? 229 LYS A CG    1 
ATOM   2110 C CD    . LYS C 2 228 ? -21.670 -17.486 12.893  1.00 29.50 ? 229 LYS A CD    1 
ATOM   2111 C CE    . LYS C 2 228 ? -20.619 -18.142 13.748  1.00 28.92 ? 229 LYS A CE    1 
ATOM   2112 N NZ    . LYS C 2 228 ? -19.466 -18.620 12.937  1.00 28.91 ? 229 LYS A NZ    1 
ATOM   2113 N N     . TYR C 2 229 ? -24.491 -13.660 13.732  1.00 24.77 ? 230 TYR A N     1 
ATOM   2114 C CA    . TYR C 2 229 ? -24.639 -12.367 14.384  1.00 22.45 ? 230 TYR A CA    1 
ATOM   2115 C C     . TYR C 2 229 ? -23.969 -11.312 13.534  1.00 22.53 ? 230 TYR A C     1 
ATOM   2116 O O     . TYR C 2 229 ? -22.924 -11.575 12.905  1.00 20.06 ? 230 TYR A O     1 
ATOM   2117 C CB    . TYR C 2 229 ? -24.067 -12.362 15.839  1.00 17.97 ? 230 TYR A CB    1 
ATOM   2118 C CG    . TYR C 2 229 ? -22.636 -12.798 15.964  1.00 11.90 ? 230 TYR A CG    1 
ATOM   2119 C CD1   . TYR C 2 229 ? -21.586 -11.885 15.784  1.00 13.39 ? 230 TYR A CD1   1 
ATOM   2120 C CD2   . TYR C 2 229 ? -22.320 -14.134 16.213  1.00 13.52 ? 230 TYR A CD2   1 
ATOM   2121 C CE1   . TYR C 2 229 ? -20.236 -12.301 15.840  1.00 11.47 ? 230 TYR A CE1   1 
ATOM   2122 C CE2   . TYR C 2 229 ? -20.989 -14.567 16.280  1.00 14.11 ? 230 TYR A CE2   1 
ATOM   2123 C CZ    . TYR C 2 229 ? -19.947 -13.641 16.087  1.00 14.73 ? 230 TYR A CZ    1 
ATOM   2124 O OH    . TYR C 2 229 ? -18.631 -14.065 16.165  1.00 9.75  ? 230 TYR A OH    1 
ATOM   2125 N N     . ASN C 2 230 ? -24.570 -10.124 13.544  1.00 24.38 ? 231 ASN A N     1 
ATOM   2126 C CA    . ASN C 2 230 ? -24.092 -8.990  12.765  1.00 29.62 ? 231 ASN A CA    1 
ATOM   2127 C C     . ASN C 2 230 ? -23.532 -7.899  13.626  1.00 27.41 ? 231 ASN A C     1 
ATOM   2128 O O     . ASN C 2 230 ? -23.136 -6.867  13.098  1.00 31.85 ? 231 ASN A O     1 
ATOM   2129 C CB    . ASN C 2 230 ? -25.223 -8.353  11.945  1.00 33.53 ? 231 ASN A CB    1 
ATOM   2130 C CG    . ASN C 2 230 ? -25.684 -9.221  10.808  1.00 36.65 ? 231 ASN A CG    1 
ATOM   2131 O OD1   . ASN C 2 230 ? -24.870 -9.830  10.115  1.00 37.21 ? 231 ASN A OD1   1 
ATOM   2132 N ND2   . ASN C 2 230 ? -26.998 -9.279  10.596  1.00 41.91 ? 231 ASN A ND2   1 
ATOM   2133 N N     . ASN C 2 231 ? -23.602 -8.061  14.936  1.00 24.39 ? 232 ASN A N     1 
ATOM   2134 C CA    . ASN C 2 231 ? -23.092 -7.040  15.835  1.00 22.74 ? 232 ASN A CA    1 
ATOM   2135 C C     . ASN C 2 231 ? -22.896 -7.500  17.287  1.00 25.82 ? 232 ASN A C     1 
ATOM   2136 O O     . ASN C 2 231 ? -23.197 -8.651  17.655  1.00 23.28 ? 232 ASN A O     1 
ATOM   2137 C CB    . ASN C 2 231 ? -23.965 -5.782  15.773  1.00 24.62 ? 232 ASN A CB    1 
ATOM   2138 C CG    . ASN C 2 231 ? -25.378 -6.035  16.195  1.00 23.62 ? 232 ASN A CG    1 
ATOM   2139 O OD1   . ASN C 2 231 ? -25.614 -6.595  17.252  1.00 28.33 ? 232 ASN A OD1   1 
ATOM   2140 N ND2   . ASN C 2 231 ? -26.331 -5.619  15.377  1.00 25.84 ? 232 ASN A ND2   1 
ATOM   2141 N N     . ILE C 2 232 ? -22.353 -6.607  18.104  1.00 24.22 ? 233 ILE A N     1 
ATOM   2142 C CA    . ILE C 2 232 ? -22.077 -6.937  19.483  1.00 20.77 ? 233 ILE A CA    1 
ATOM   2143 C C     . ILE C 2 232 ? -23.329 -7.367  20.242  1.00 19.43 ? 233 ILE A C     1 
ATOM   2144 O O     . ILE C 2 232 ? -23.296 -8.411  20.915  1.00 16.96 ? 233 ILE A O     1 
ATOM   2145 C CB    . ILE C 2 232 ? -21.275 -5.797  20.189  1.00 22.90 ? 233 ILE A CB    1 
ATOM   2146 C CG1   . ILE C 2 232 ? -20.894 -6.212  21.616  1.00 22.84 ? 233 ILE A CG1   1 
ATOM   2147 C CG2   . ILE C 2 232 ? -22.008 -4.477  20.088  1.00 21.84 ? 233 ILE A CG2   1 
ATOM   2148 C CD1   . ILE C 2 232 ? -19.957 -7.431  21.658  1.00 25.12 ? 233 ILE A CD1   1 
ATOM   2149 N N     . SER C 2 233 ? -24.436 -6.638  20.071  1.00 15.28 ? 234 SER A N     1 
ATOM   2150 C CA    . SER C 2 233 ? -25.688 -6.979  20.753  1.00 16.89 ? 234 SER A CA    1 
ATOM   2151 C C     . SER C 2 233 ? -26.108 -8.415  20.449  1.00 18.19 ? 234 SER A C     1 
ATOM   2152 O O     . SER C 2 233 ? -26.311 -9.212  21.355  1.00 18.75 ? 234 SER A O     1 
ATOM   2153 C CB    . SER C 2 233 ? -26.812 -6.042  20.325  1.00 19.62 ? 234 SER A CB    1 
ATOM   2154 O OG    . SER C 2 233 ? -26.485 -4.682  20.528  1.00 27.89 ? 234 SER A OG    1 
ATOM   2155 N N     . GLU C 2 234 ? -26.206 -8.748  19.165  1.00 20.24 ? 235 GLU A N     1 
ATOM   2156 C CA    . GLU C 2 234 ? -26.584 -10.092 18.716  1.00 21.47 ? 235 GLU A CA    1 
ATOM   2157 C C     . GLU C 2 234 ? -25.538 -11.148 19.082  1.00 20.33 ? 235 GLU A C     1 
ATOM   2158 O O     . GLU C 2 234 ? -25.877 -12.323 19.244  1.00 23.41 ? 235 GLU A O     1 
ATOM   2159 C CB    . GLU C 2 234 ? -26.827 -10.095 17.196  1.00 23.75 ? 235 GLU A CB    1 
ATOM   2160 C CG    . GLU C 2 234 ? -27.742 -8.971  16.711  1.00 25.69 ? 235 GLU A CG    1 
ATOM   2161 C CD    . GLU C 2 234 ? -27.941 -8.949  15.199  1.00 31.85 ? 235 GLU A CD    1 
ATOM   2162 O OE1   . GLU C 2 234 ? -27.172 -9.631  14.474  1.00 26.60 ? 235 GLU A OE1   1 
ATOM   2163 O OE2   . GLU C 2 234 ? -28.865 -8.229  14.733  1.00 29.49 ? 235 GLU A OE2   1 
ATOM   2164 N N     . TYR C 2 235 ? -24.269 -10.753 19.188  1.00 19.01 ? 236 TYR A N     1 
ATOM   2165 C CA    . TYR C 2 235 ? -23.224 -11.708 19.573  1.00 19.70 ? 236 TYR A CA    1 
ATOM   2166 C C     . TYR C 2 235 ? -23.500 -12.189 21.009  1.00 20.13 ? 236 TYR A C     1 
ATOM   2167 O O     . TYR C 2 235 ? -23.576 -13.395 21.273  1.00 18.32 ? 236 TYR A O     1 
ATOM   2168 C CB    . TYR C 2 235 ? -21.827 -11.073 19.481  1.00 18.70 ? 236 TYR A CB    1 
ATOM   2169 C CG    . TYR C 2 235 ? -20.753 -11.846 20.244  1.00 16.29 ? 236 TYR A CG    1 
ATOM   2170 C CD1   . TYR C 2 235 ? -20.262 -13.064 19.761  1.00 13.70 ? 236 TYR A CD1   1 
ATOM   2171 C CD2   . TYR C 2 235 ? -20.291 -11.392 21.496  1.00 16.42 ? 236 TYR A CD2   1 
ATOM   2172 C CE1   . TYR C 2 235 ? -19.348 -13.820 20.504  1.00 16.57 ? 236 TYR A CE1   1 
ATOM   2173 C CE2   . TYR C 2 235 ? -19.384 -12.138 22.255  1.00 10.15 ? 236 TYR A CE2   1 
ATOM   2174 C CZ    . TYR C 2 235 ? -18.913 -13.347 21.763  1.00 18.21 ? 236 TYR A CZ    1 
ATOM   2175 O OH    . TYR C 2 235 ? -18.005 -14.089 22.513  1.00 20.68 ? 236 TYR A OH    1 
ATOM   2176 N N     . ARG C 2 236 ? -23.624 -11.235 21.931  1.00 19.36 ? 237 ARG A N     1 
ATOM   2177 C CA    . ARG C 2 236 ? -23.927 -11.527 23.331  1.00 19.86 ? 237 ARG A CA    1 
ATOM   2178 C C     . ARG C 2 236 ? -25.228 -12.344 23.516  1.00 20.94 ? 237 ARG A C     1 
ATOM   2179 O O     . ARG C 2 236 ? -25.302 -13.211 24.385  1.00 18.47 ? 237 ARG A O     1 
ATOM   2180 C CB    . ARG C 2 236 ? -23.968 -10.222 24.088  1.00 13.60 ? 237 ARG A CB    1 
ATOM   2181 C CG    . ARG C 2 236 ? -22.611 -9.620  24.041  1.00 14.31 ? 237 ARG A CG    1 
ATOM   2182 C CD    . ARG C 2 236 ? -22.530 -8.212  24.570  1.00 16.01 ? 237 ARG A CD    1 
ATOM   2183 N NE    . ARG C 2 236 ? -21.119 -7.877  24.731  1.00 16.56 ? 237 ARG A NE    1 
ATOM   2184 C CZ    . ARG C 2 236 ? -20.659 -6.691  25.105  1.00 17.87 ? 237 ARG A CZ    1 
ATOM   2185 N NH1   . ARG C 2 236 ? -21.507 -5.700  25.351  1.00 14.50 ? 237 ARG A NH1   1 
ATOM   2186 N NH2   . ARG C 2 236 ? -19.353 -6.530  25.287  1.00 16.02 ? 237 ARG A NH2   1 
ATOM   2187 N N     . ASN C 2 237 ? -26.237 -12.071 22.685  1.00 21.86 ? 238 ASN A N     1 
ATOM   2188 C CA    . ASN C 2 237 ? -27.484 -12.820 22.731  1.00 23.05 ? 238 ASN A CA    1 
ATOM   2189 C C     . ASN C 2 237 ? -27.151 -14.222 22.249  1.00 26.34 ? 238 ASN A C     1 
ATOM   2190 O O     . ASN C 2 237 ? -27.618 -15.231 22.809  1.00 26.08 ? 238 ASN A O     1 
ATOM   2191 C CB    . ASN C 2 237 ? -28.522 -12.230 21.788  1.00 20.84 ? 238 ASN A CB    1 
ATOM   2192 C CG    . ASN C 2 237 ? -29.028 -10.903 22.249  1.00 34.00 ? 238 ASN A CG    1 
ATOM   2193 O OD1   . ASN C 2 237 ? -28.821 -10.500 23.409  1.00 33.76 ? 238 ASN A OD1   1 
ATOM   2194 N ND2   . ASN C 2 237 ? -29.710 -10.194 21.351  1.00 37.18 ? 238 ASN A ND2   1 
ATOM   2195 N N     . TRP C 2 238 ? -26.314 -14.275 21.213  1.00 26.20 ? 239 TRP A N     1 
ATOM   2196 C CA    . TRP C 2 238 ? -25.899 -15.530 20.610  1.00 25.03 ? 239 TRP A CA    1 
ATOM   2197 C C     . TRP C 2 238 ? -25.235 -16.390 21.667  1.00 23.14 ? 239 TRP A C     1 
ATOM   2198 O O     . TRP C 2 238 ? -25.496 -17.602 21.765  1.00 24.55 ? 239 TRP A O     1 
ATOM   2199 C CB    . TRP C 2 238 ? -24.953 -15.232 19.458  1.00 25.86 ? 239 TRP A CB    1 
ATOM   2200 C CG    . TRP C 2 238 ? -24.465 -16.415 18.730  1.00 28.46 ? 239 TRP A CG    1 
ATOM   2201 C CD1   . TRP C 2 238 ? -25.159 -17.180 17.826  1.00 28.79 ? 239 TRP A CD1   1 
ATOM   2202 C CD2   . TRP C 2 238 ? -23.151 -16.962 18.797  1.00 27.28 ? 239 TRP A CD2   1 
ATOM   2203 N NE1   . TRP C 2 238 ? -24.347 -18.166 17.329  1.00 27.10 ? 239 TRP A NE1   1 
ATOM   2204 C CE2   . TRP C 2 238 ? -23.108 -18.058 17.909  1.00 26.70 ? 239 TRP A CE2   1 
ATOM   2205 C CE3   . TRP C 2 238 ? -21.997 -16.624 19.515  1.00 26.63 ? 239 TRP A CE3   1 
ATOM   2206 C CZ2   . TRP C 2 238 ? -21.955 -18.821 17.724  1.00 27.27 ? 239 TRP A CZ2   1 
ATOM   2207 C CZ3   . TRP C 2 238 ? -20.850 -17.376 19.330  1.00 25.21 ? 239 TRP A CZ3   1 
ATOM   2208 C CH2   . TRP C 2 238 ? -20.838 -18.466 18.442  1.00 29.35 ? 239 TRP A CH2   1 
ATOM   2209 N N     . ILE C 2 239 ? -24.402 -15.740 22.471  1.00 22.85 ? 240 ILE A N     1 
ATOM   2210 C CA    . ILE C 2 239 ? -23.688 -16.384 23.565  1.00 19.48 ? 240 ILE A CA    1 
ATOM   2211 C C     . ILE C 2 239 ? -24.731 -16.841 24.587  1.00 19.63 ? 240 ILE A C     1 
ATOM   2212 O O     . ILE C 2 239 ? -24.825 -18.030 24.898  1.00 20.82 ? 240 ILE A O     1 
ATOM   2213 C CB    . ILE C 2 239 ? -22.660 -15.407 24.194  1.00 20.55 ? 240 ILE A CB    1 
ATOM   2214 C CG1   . ILE C 2 239 ? -21.468 -15.223 23.261  1.00 19.66 ? 240 ILE A CG1   1 
ATOM   2215 C CG2   . ILE C 2 239 ? -22.151 -15.914 25.500  1.00 23.25 ? 240 ILE A CG2   1 
ATOM   2216 C CD1   . ILE C 2 239 ? -20.737 -16.503 22.919  1.00 21.51 ? 240 ILE A CD1   1 
ATOM   2217 N N     . TYR C 2 240 ? -25.578 -15.929 25.034  1.00 17.85 ? 241 TYR A N     1 
ATOM   2218 C CA    . TYR C 2 240 ? -26.602 -16.286 26.009  1.00 22.55 ? 241 TYR A CA    1 
ATOM   2219 C C     . TYR C 2 240 ? -27.387 -17.583 25.679  1.00 24.12 ? 241 TYR A C     1 
ATOM   2220 O O     . TYR C 2 240 ? -27.753 -18.357 26.569  1.00 20.60 ? 241 TYR A O     1 
ATOM   2221 C CB    . TYR C 2 240 ? -27.591 -15.132 26.155  1.00 21.45 ? 241 TYR A CB    1 
ATOM   2222 C CG    . TYR C 2 240 ? -28.584 -15.318 27.291  1.00 26.63 ? 241 TYR A CG    1 
ATOM   2223 C CD1   . TYR C 2 240 ? -28.233 -14.968 28.610  1.00 25.65 ? 241 TYR A CD1   1 
ATOM   2224 C CD2   . TYR C 2 240 ? -29.884 -15.797 27.054  1.00 21.11 ? 241 TYR A CD2   1 
ATOM   2225 C CE1   . TYR C 2 240 ? -29.150 -15.079 29.644  1.00 24.95 ? 241 TYR A CE1   1 
ATOM   2226 C CE2   . TYR C 2 240 ? -30.800 -15.912 28.095  1.00 21.31 ? 241 TYR A CE2   1 
ATOM   2227 C CZ    . TYR C 2 240 ? -30.426 -15.544 29.381  1.00 22.47 ? 241 TYR A CZ    1 
ATOM   2228 O OH    . TYR C 2 240 ? -31.325 -15.563 30.403  1.00 18.51 ? 241 TYR A OH    1 
ATOM   2229 N N     . ARG C 2 241 ? -27.645 -17.810 24.398  1.00 26.53 ? 242 ARG A N     1 
ATOM   2230 C CA    . ARG C 2 241 ? -28.425 -18.973 23.972  1.00 26.29 ? 242 ARG A CA    1 
ATOM   2231 C C     . ARG C 2 241 ? -27.636 -20.269 23.871  1.00 25.36 ? 242 ARG A C     1 
ATOM   2232 O O     . ARG C 2 241 ? -28.208 -21.359 23.806  1.00 29.06 ? 242 ARG A O     1 
ATOM   2233 C CB    . ARG C 2 241 ? -29.132 -18.663 22.642  1.00 29.88 ? 242 ARG A CB    1 
ATOM   2234 N N     . GLY C 2 242 ? -26.321 -20.162 23.893  1.00 23.77 ? 243 GLY A N     1 
ATOM   2235 C CA    . GLY C 2 242 ? -25.509 -21.351 23.786  1.00 28.47 ? 243 GLY A CA    1 
ATOM   2236 C C     . GLY C 2 242 ? -24.895 -21.411 22.402  1.00 32.49 ? 243 GLY A C     1 
ATOM   2237 O O     . GLY C 2 242 ? -24.714 -22.495 21.841  1.00 30.93 ? 243 GLY A O     1 
ATOM   2238 N N     . ARG C 2 243 ? -24.573 -20.232 21.858  1.00 32.97 ? 244 ARG A N     1 
ATOM   2239 C CA    . ARG C 2 243 ? -23.972 -20.112 20.536  1.00 29.95 ? 244 ARG A CA    1 
ATOM   2240 C C     . ARG C 2 243 ? -24.908 -20.759 19.518  1.00 32.21 ? 244 ARG A C     1 
ATOM   2241 O O     . ARG C 2 243 ? -24.553 -21.682 18.796  1.00 28.85 ? 244 ARG A O     1 
ATOM   2242 C CB    . ARG C 2 243 ? -22.580 -20.722 20.562  1.00 24.26 ? 244 ARG A CB    1 
ATOM   2243 C CG    . ARG C 2 243 ? -21.835 -20.177 21.745  1.00 22.49 ? 244 ARG A CG    1 
ATOM   2244 C CD    . ARG C 2 243 ? -20.481 -20.789 21.963  1.00 30.01 ? 244 ARG A CD    1 
ATOM   2245 N NE    . ARG C 2 243 ? -19.482 -20.296 21.010  1.00 35.08 ? 244 ARG A NE    1 
ATOM   2246 C CZ    . ARG C 2 243 ? -18.533 -19.394 21.273  1.00 30.86 ? 244 ARG A CZ    1 
ATOM   2247 N NH1   . ARG C 2 243 ? -18.418 -18.840 22.474  1.00 30.95 ? 244 ARG A NH1   1 
ATOM   2248 N NH2   . ARG C 2 243 ? -17.660 -19.095 20.329  1.00 29.02 ? 244 ARG A NH2   1 
ATOM   2249 N N     . LYS C 2 244 ? -26.131 -20.227 19.499  1.00 33.76 ? 245 LYS A N     1 
ATOM   2250 C CA    . LYS C 2 244 ? -27.205 -20.671 18.621  1.00 34.03 ? 245 LYS A CA    1 
ATOM   2251 C C     . LYS C 2 244 ? -28.435 -19.786 18.848  1.00 33.19 ? 245 LYS A C     1 
ATOM   2252 C CB    . LYS C 2 244 ? -27.552 -22.135 18.903  1.00 35.39 ? 245 LYS A CB    1 
ATOM   2253 N N     . SER D 2 1   ? 9.213   12.648  -29.179 1.00 15.11 ? 2   SER B N     1 
ATOM   2254 C CA    . SER D 2 1   ? 7.796   12.784  -28.817 1.00 16.16 ? 2   SER B CA    1 
ATOM   2255 C C     . SER D 2 1   ? 7.666   12.847  -27.297 1.00 15.98 ? 2   SER B C     1 
ATOM   2256 O O     . SER D 2 1   ? 8.652   12.775  -26.576 1.00 22.32 ? 2   SER B O     1 
ATOM   2257 C CB    . SER D 2 1   ? 7.038   11.547  -29.335 1.00 11.38 ? 2   SER B CB    1 
ATOM   2258 O OG    . SER D 2 1   ? 7.710   10.355  -28.948 1.00 15.03 ? 2   SER B OG    1 
ATOM   2259 N N     . LEU D 2 2   ? 6.446   12.941  -26.808 1.00 18.04 ? 3   LEU B N     1 
ATOM   2260 C CA    . LEU D 2 2   ? 6.234   12.936  -25.386 1.00 21.28 ? 3   LEU B CA    1 
ATOM   2261 C C     . LEU D 2 2   ? 6.840   11.641  -24.856 1.00 24.97 ? 3   LEU B C     1 
ATOM   2262 O O     . LEU D 2 2   ? 7.652   11.659  -23.920 1.00 28.21 ? 3   LEU B O     1 
ATOM   2263 C CB    . LEU D 2 2   ? 4.739   12.953  -25.098 1.00 23.84 ? 3   LEU B CB    1 
ATOM   2264 C CG    . LEU D 2 2   ? 4.309   12.692  -23.651 1.00 28.81 ? 3   LEU B CG    1 
ATOM   2265 C CD1   . LEU D 2 2   ? 5.078   13.585  -22.674 1.00 27.44 ? 3   LEU B CD1   1 
ATOM   2266 C CD2   . LEU D 2 2   ? 2.789   12.890  -23.520 1.00 25.71 ? 3   LEU B CD2   1 
ATOM   2267 N N     . ARG D 2 3   ? 6.506   10.529  -25.521 1.00 24.57 ? 4   ARG B N     1 
ATOM   2268 C CA    . ARG D 2 3   ? 6.984   9.190   -25.141 1.00 22.08 ? 4   ARG B CA    1 
ATOM   2269 C C     . ARG D 2 3   ? 8.501   8.935   -25.152 1.00 22.16 ? 4   ARG B C     1 
ATOM   2270 O O     . ARG D 2 3   ? 9.055   8.442   -24.161 1.00 20.26 ? 4   ARG B O     1 
ATOM   2271 C CB    . ARG D 2 3   ? 6.244   8.120   -25.958 1.00 21.82 ? 4   ARG B CB    1 
ATOM   2272 C CG    . ARG D 2 3   ? 6.633   6.702   -25.624 1.00 16.98 ? 4   ARG B CG    1 
ATOM   2273 C CD    . ARG D 2 3   ? 5.879   5.696   -26.448 1.00 14.55 ? 4   ARG B CD    1 
ATOM   2274 N NE    . ARG D 2 3   ? 6.352   4.356   -26.113 1.00 16.22 ? 4   ARG B NE    1 
ATOM   2275 C CZ    . ARG D 2 3   ? 5.589   3.275   -26.160 1.00 14.09 ? 4   ARG B CZ    1 
ATOM   2276 N NH1   . ARG D 2 3   ? 4.337   3.375   -26.557 1.00 15.30 ? 4   ARG B NH1   1 
ATOM   2277 N NH2   . ARG D 2 3   ? 6.030   2.135   -25.670 1.00 16.24 ? 4   ARG B NH2   1 
ATOM   2278 N N     . SER D 2 4   ? 9.183   9.254   -26.251 1.00 20.74 ? 5   SER B N     1 
ATOM   2279 C CA    . SER D 2 4   ? 10.636  9.030   -26.308 1.00 18.97 ? 5   SER B CA    1 
ATOM   2280 C C     . SER D 2 4   ? 11.313  9.891   -25.238 1.00 19.86 ? 5   SER B C     1 
ATOM   2281 O O     . SER D 2 4   ? 12.223  9.452   -24.537 1.00 19.74 ? 5   SER B O     1 
ATOM   2282 C CB    . SER D 2 4   ? 11.181  9.379   -27.694 1.00 11.40 ? 5   SER B CB    1 
ATOM   2283 O OG    . SER D 2 4   ? 10.911  10.726  -28.018 1.00 17.20 ? 5   SER B OG    1 
ATOM   2284 N N     . ASP D 2 5   ? 10.845  11.123  -25.115 1.00 21.34 ? 6   ASP B N     1 
ATOM   2285 C CA    . ASP D 2 5   ? 11.365  12.055  -24.126 1.00 24.09 ? 6   ASP B CA    1 
ATOM   2286 C C     . ASP D 2 5   ? 11.313  11.516  -22.702 1.00 27.60 ? 6   ASP B C     1 
ATOM   2287 O O     . ASP D 2 5   ? 12.314  11.529  -21.981 1.00 27.59 ? 6   ASP B O     1 
ATOM   2288 C CB    . ASP D 2 5   ? 10.591  13.358  -24.204 1.00 21.78 ? 6   ASP B CB    1 
ATOM   2289 C CG    . ASP D 2 5   ? 11.155  14.266  -25.220 1.00 20.94 ? 6   ASP B CG    1 
ATOM   2290 O OD1   . ASP D 2 5   ? 12.249  13.962  -25.732 1.00 24.36 ? 6   ASP B OD1   1 
ATOM   2291 O OD2   . ASP D 2 5   ? 10.511  15.269  -25.515 1.00 22.09 ? 6   ASP B OD2   1 
ATOM   2292 N N     . LEU D 2 6   ? 10.137  11.039  -22.310 1.00 28.22 ? 7   LEU B N     1 
ATOM   2293 C CA    . LEU D 2 6   ? 9.945   10.483  -20.999 1.00 25.52 ? 7   LEU B CA    1 
ATOM   2294 C C     . LEU D 2 6   ? 10.813  9.249   -20.888 1.00 26.88 ? 7   LEU B C     1 
ATOM   2295 O O     . LEU D 2 6   ? 11.425  8.998   -19.850 1.00 29.12 ? 7   LEU B O     1 
ATOM   2296 C CB    . LEU D 2 6   ? 8.472   10.138  -20.781 1.00 30.16 ? 7   LEU B CB    1 
ATOM   2297 C CG    . LEU D 2 6   ? 8.062   9.872   -19.322 1.00 36.48 ? 7   LEU B CG    1 
ATOM   2298 C CD1   . LEU D 2 6   ? 8.526   10.985  -18.365 1.00 31.59 ? 7   LEU B CD1   1 
ATOM   2299 C CD2   . LEU D 2 6   ? 6.556   9.697   -19.263 1.00 38.49 ? 7   LEU B CD2   1 
ATOM   2300 N N     . ILE D 2 7   ? 10.906  8.488   -21.966 1.00 27.24 ? 8   ILE B N     1 
ATOM   2301 C CA    . ILE D 2 7   ? 11.727  7.287   -21.938 1.00 26.55 ? 8   ILE B CA    1 
ATOM   2302 C C     . ILE D 2 7   ? 13.132  7.716   -21.565 1.00 25.57 ? 8   ILE B C     1 
ATOM   2303 O O     . ILE D 2 7   ? 13.774  7.099   -20.703 1.00 24.52 ? 8   ILE B O     1 
ATOM   2304 C CB    . ILE D 2 7   ? 11.710  6.523   -23.336 1.00 30.94 ? 8   ILE B CB    1 
ATOM   2305 C CG1   . ILE D 2 7   ? 10.434  5.692   -23.464 1.00 30.42 ? 8   ILE B CG1   1 
ATOM   2306 C CG2   . ILE D 2 7   ? 12.944  5.596   -23.527 1.00 21.21 ? 8   ILE B CG2   1 
ATOM   2307 C CD1   . ILE D 2 7   ? 10.375  4.892   -24.740 1.00 31.42 ? 8   ILE B CD1   1 
ATOM   2308 N N     . ASN D 2 8   ? 13.565  8.821   -22.173 1.00 25.90 ? 9   ASN B N     1 
ATOM   2309 C CA    . ASN D 2 8   ? 14.900  9.352   -21.956 1.00 24.36 ? 9   ASN B CA    1 
ATOM   2310 C C     . ASN D 2 8   ? 15.062  9.973   -20.601 1.00 22.85 ? 9   ASN B C     1 
ATOM   2311 O O     . ASN D 2 8   ? 16.022  9.665   -19.918 1.00 26.50 ? 9   ASN B O     1 
ATOM   2312 C CB    . ASN D 2 8   ? 15.308  10.325  -23.059 1.00 28.24 ? 9   ASN B CB    1 
ATOM   2313 C CG    . ASN D 2 8   ? 15.510  9.631   -24.406 1.00 29.79 ? 9   ASN B CG    1 
ATOM   2314 O OD1   . ASN D 2 8   ? 16.164  8.597   -24.493 1.00 35.22 ? 9   ASN B OD1   1 
ATOM   2315 N ND2   . ASN D 2 8   ? 14.960  10.212  -25.462 1.00 32.97 ? 9   ASN B ND2   1 
ATOM   2316 N N     . ALA D 2 9   ? 14.137  10.834  -20.198 1.00 22.17 ? 10  ALA B N     1 
ATOM   2317 C CA    . ALA D 2 9   ? 14.192  11.462  -18.880 1.00 18.26 ? 10  ALA B CA    1 
ATOM   2318 C C     . ALA D 2 9   ? 14.358  10.342  -17.860 1.00 25.71 ? 10  ALA B C     1 
ATOM   2319 O O     . ALA D 2 9   ? 15.078  10.486  -16.888 1.00 28.19 ? 10  ALA B O     1 
ATOM   2320 C CB    . ALA D 2 9   ? 12.932  12.188  -18.613 1.00 15.25 ? 10  ALA B CB    1 
ATOM   2321 N N     . LEU D 2 10  ? 13.712  9.203   -18.116 1.00 28.65 ? 11  LEU B N     1 
ATOM   2322 C CA    . LEU D 2 10  ? 13.796  8.042   -17.241 1.00 26.38 ? 11  LEU B CA    1 
ATOM   2323 C C     . LEU D 2 10  ? 15.114  7.316   -17.341 1.00 27.47 ? 11  LEU B C     1 
ATOM   2324 O O     . LEU D 2 10  ? 15.543  6.707   -16.359 1.00 37.31 ? 11  LEU B O     1 
ATOM   2325 C CB    . LEU D 2 10  ? 12.666  7.066   -17.523 1.00 22.43 ? 11  LEU B CB    1 
ATOM   2326 C CG    . LEU D 2 10  ? 11.367  7.677   -17.068 1.00 16.02 ? 11  LEU B CG    1 
ATOM   2327 C CD1   . LEU D 2 10  ? 10.267  6.805   -17.562 1.00 22.40 ? 11  LEU B CD1   1 
ATOM   2328 C CD2   . LEU D 2 10  ? 11.348  7.783   -15.570 1.00 20.49 ? 11  LEU B CD2   1 
ATOM   2329 N N     . ASP D 2 18  ? 19.280  7.557   -6.345  1.00 42.69 ? 19  ASP B N     1 
ATOM   2330 C CA    . ASP D 2 18  ? 19.533  6.710   -5.175  1.00 43.28 ? 19  ASP B CA    1 
ATOM   2331 C C     . ASP D 2 18  ? 18.907  7.288   -3.884  1.00 40.27 ? 19  ASP B C     1 
ATOM   2332 O O     . ASP D 2 18  ? 19.616  7.811   -3.017  1.00 41.05 ? 19  ASP B O     1 
ATOM   2333 C CB    . ASP D 2 18  ? 21.055  6.503   -5.000  1.00 41.21 ? 19  ASP B CB    1 
ATOM   2334 N N     . VAL D 2 19  ? 17.586  7.211   -3.766  1.00 39.00 ? 20  VAL B N     1 
ATOM   2335 C CA    . VAL D 2 19  ? 16.892  7.742   -2.588  1.00 37.16 ? 20  VAL B CA    1 
ATOM   2336 C C     . VAL D 2 19  ? 17.243  6.903   -1.383  1.00 34.29 ? 20  VAL B C     1 
ATOM   2337 O O     . VAL D 2 19  ? 17.322  5.683   -1.483  1.00 29.82 ? 20  VAL B O     1 
ATOM   2338 C CB    . VAL D 2 19  ? 15.349  7.785   -2.781  1.00 37.96 ? 20  VAL B CB    1 
ATOM   2339 C CG1   . VAL D 2 19  ? 14.651  8.073   -1.446  1.00 37.93 ? 20  VAL B CG1   1 
ATOM   2340 C CG2   . VAL D 2 19  ? 14.975  8.871   -3.804  1.00 35.36 ? 20  VAL B CG2   1 
ATOM   2341 N N     . CYS D 2 20  ? 17.510  7.552   -0.253  1.00 30.54 ? 21  CYS B N     1 
ATOM   2342 C CA    . CYS D 2 20  ? 17.871  6.787   0.931   1.00 31.80 ? 21  CYS B CA    1 
ATOM   2343 C C     . CYS D 2 20  ? 17.199  7.129   2.243   1.00 25.53 ? 21  CYS B C     1 
ATOM   2344 O O     . CYS D 2 20  ? 17.590  6.625   3.286   1.00 28.54 ? 21  CYS B O     1 
ATOM   2345 C CB    . CYS D 2 20  ? 19.382  6.706   1.101   1.00 33.99 ? 21  CYS B CB    1 
ATOM   2346 S SG    . CYS D 2 20  ? 20.190  8.289   1.112   1.00 54.06 ? 21  CYS B SG    1 
ATOM   2347 N N     . GLY D 2 21  ? 16.156  7.933   2.186   1.00 20.45 ? 22  GLY B N     1 
ATOM   2348 C CA    . GLY D 2 21  ? 15.433  8.235   3.395   1.00 18.07 ? 22  GLY B CA    1 
ATOM   2349 C C     . GLY D 2 21  ? 14.397  9.316   3.204   1.00 19.93 ? 22  GLY B C     1 
ATOM   2350 O O     . GLY D 2 21  ? 14.262  9.868   2.109   1.00 20.99 ? 22  GLY B O     1 
ATOM   2351 N N     . ILE D 2 22  ? 13.580  9.537   4.224   1.00 19.96 ? 23  ILE B N     1 
ATOM   2352 C CA    . ILE D 2 22  ? 12.606  10.608  4.180   1.00 19.39 ? 23  ILE B CA    1 
ATOM   2353 C C     . ILE D 2 22  ? 13.254  11.622  5.091   1.00 20.18 ? 23  ILE B C     1 
ATOM   2354 O O     . ILE D 2 22  ? 14.089  11.273  5.957   1.00 16.93 ? 23  ILE B O     1 
ATOM   2355 C CB    . ILE D 2 22  ? 11.184  10.190  4.685   1.00 23.83 ? 23  ILE B CB    1 
ATOM   2356 C CG1   . ILE D 2 22  ? 11.220  9.748   6.158   1.00 28.19 ? 23  ILE B CG1   1 
ATOM   2357 C CG2   . ILE D 2 22  ? 10.607  9.077   3.766   1.00 26.47 ? 23  ILE B CG2   1 
ATOM   2358 C CD1   . ILE D 2 22  ? 9.941   9.025   6.650   1.00 21.24 ? 23  ILE B CD1   1 
ATOM   2359 N N     . ILE D 2 23  ? 12.914  12.880  4.867   1.00 24.57 ? 24  ILE B N     1 
ATOM   2360 C CA    . ILE D 2 23  ? 13.491  13.956  5.643   1.00 25.02 ? 24  ILE B CA    1 
ATOM   2361 C C     . ILE D 2 23  ? 12.450  14.875  6.242   1.00 25.88 ? 24  ILE B C     1 
ATOM   2362 O O     . ILE D 2 23  ? 11.359  15.066  5.677   1.00 25.96 ? 24  ILE B O     1 
ATOM   2363 C CB    . ILE D 2 23  ? 14.506  14.753  4.809   1.00 24.04 ? 24  ILE B CB    1 
ATOM   2364 C CG1   . ILE D 2 23  ? 15.097  15.882  5.650   1.00 21.27 ? 24  ILE B CG1   1 
ATOM   2365 C CG2   . ILE D 2 23  ? 13.858  15.219  3.476   1.00 23.93 ? 24  ILE B CG2   1 
ATOM   2366 C CD1   . ILE D 2 23  ? 16.506  16.228  5.282   1.00 19.97 ? 24  ILE B CD1   1 
ATOM   2367 N N     . SER D 2 24  ? 12.758  15.360  7.441   1.00 25.27 ? 25  SER B N     1 
ATOM   2368 C CA    . SER D 2 24  ? 11.885  16.262  8.149   1.00 28.71 ? 25  SER B CA    1 
ATOM   2369 C C     . SER D 2 24  ? 12.381  17.663  7.820   1.00 30.58 ? 25  SER B C     1 
ATOM   2370 O O     . SER D 2 24  ? 13.566  17.840  7.544   1.00 31.67 ? 25  SER B O     1 
ATOM   2371 C CB    . SER D 2 24  ? 12.013  16.014  9.637   1.00 27.33 ? 25  SER B CB    1 
ATOM   2372 O OG    . SER D 2 24  ? 13.333  16.302  10.039  1.00 31.72 ? 25  SER B OG    1 
ATOM   2373 N N     . ALA D 2 25  ? 11.488  18.651  7.875   1.00 33.92 ? 26  ALA B N     1 
ATOM   2374 C CA    . ALA D 2 25  ? 11.843  20.046  7.595   1.00 36.82 ? 26  ALA B CA    1 
ATOM   2375 C C     . ALA D 2 25  ? 12.997  20.465  8.497   1.00 36.93 ? 26  ALA B C     1 
ATOM   2376 O O     . ALA D 2 25  ? 13.732  21.411  8.203   1.00 40.20 ? 26  ALA B O     1 
ATOM   2377 C CB    . ALA D 2 25  ? 10.634  20.955  7.828   1.00 37.32 ? 26  ALA B CB    1 
ATOM   2378 N N     . GLU D 2 26  ? 13.119  19.745  9.602   1.00 37.24 ? 27  GLU B N     1 
ATOM   2379 C CA    . GLU D 2 26  ? 14.142  19.942  10.598  1.00 38.82 ? 27  GLU B CA    1 
ATOM   2380 C C     . GLU D 2 26  ? 15.523  19.515  10.088  1.00 37.79 ? 27  GLU B C     1 
ATOM   2381 O O     . GLU D 2 26  ? 16.528  20.160  10.407  1.00 38.71 ? 27  GLU B O     1 
ATOM   2382 C CB    . GLU D 2 26  ? 13.767  19.141  11.848  1.00 42.45 ? 27  GLU B CB    1 
ATOM   2383 C CG    . GLU D 2 26  ? 12.608  19.745  12.670  1.00 48.40 ? 27  GLU B CG    1 
ATOM   2384 C CD    . GLU D 2 26  ? 11.230  19.719  11.984  1.00 50.35 ? 27  GLU B CD    1 
ATOM   2385 O OE1   . GLU D 2 26  ? 11.001  18.942  11.027  1.00 50.70 ? 27  GLU B OE1   1 
ATOM   2386 O OE2   . GLU D 2 26  ? 10.349  20.477  12.444  1.00 50.14 ? 27  GLU B OE2   1 
ATOM   2387 N N     . GLY D 2 27  ? 15.571  18.423  9.317   1.00 33.50 ? 28  GLY B N     1 
ATOM   2388 C CA    . GLY D 2 27  ? 16.832  17.928  8.792   1.00 23.58 ? 28  GLY B CA    1 
ATOM   2389 C C     . GLY D 2 27  ? 17.275  16.546  9.275   1.00 24.36 ? 28  GLY B C     1 
ATOM   2390 O O     . GLY D 2 27  ? 18.410  16.130  8.995   1.00 24.10 ? 28  GLY B O     1 
ATOM   2391 N N     . LYS D 2 28  ? 16.414  15.838  10.012  1.00 21.63 ? 29  LYS B N     1 
ATOM   2392 C CA    . LYS D 2 28  ? 16.757  14.498  10.483  1.00 24.30 ? 29  LYS B CA    1 
ATOM   2393 C C     . LYS D 2 28  ? 16.309  13.520  9.401   1.00 21.16 ? 29  LYS B C     1 
ATOM   2394 O O     . LYS D 2 28  ? 15.204  13.592  8.916   1.00 22.83 ? 29  LYS B O     1 
ATOM   2395 C CB    . LYS D 2 28  ? 16.086  14.194  11.827  1.00 18.85 ? 29  LYS B CB    1 
ATOM   2396 N N     . ILE D 2 29  ? 17.196  12.639  8.988   1.00 25.42 ? 30  ILE B N     1 
ATOM   2397 C CA    . ILE D 2 29  ? 16.894  11.697  7.922   1.00 26.10 ? 30  ILE B CA    1 
ATOM   2398 C C     . ILE D 2 29  ? 16.512  10.316  8.450   1.00 30.27 ? 30  ILE B C     1 
ATOM   2399 O O     . ILE D 2 29  ? 17.357  9.613   9.053   1.00 28.91 ? 30  ILE B O     1 
ATOM   2400 C CB    . ILE D 2 29  ? 18.093  11.599  6.944   1.00 26.98 ? 30  ILE B CB    1 
ATOM   2401 C CG1   . ILE D 2 29  ? 18.357  12.986  6.313   1.00 28.48 ? 30  ILE B CG1   1 
ATOM   2402 C CG2   . ILE D 2 29  ? 17.859  10.491  5.892   1.00 21.80 ? 30  ILE B CG2   1 
ATOM   2403 C CD1   . ILE D 2 29  ? 19.637  13.093  5.488   1.00 29.96 ? 30  ILE B CD1   1 
ATOM   2404 N N     . TYR D 2 30  ? 15.251  9.928   8.190   1.00 29.24 ? 31  TYR B N     1 
ATOM   2405 C CA    . TYR D 2 30  ? 14.704  8.636   8.616   1.00 25.32 ? 31  TYR B CA    1 
ATOM   2406 C C     . TYR D 2 30  ? 14.823  7.650   7.466   1.00 21.88 ? 31  TYR B C     1 
ATOM   2407 O O     . TYR D 2 30  ? 14.276  7.863   6.405   1.00 22.32 ? 31  TYR B O     1 
ATOM   2408 C CB    . TYR D 2 30  ? 13.257  8.794   9.066   1.00 26.90 ? 31  TYR B CB    1 
ATOM   2409 C CG    . TYR D 2 30  ? 13.082  9.751   10.234  1.00 27.58 ? 31  TYR B CG    1 
ATOM   2410 C CD1   . TYR D 2 30  ? 13.482  11.079  10.128  1.00 25.73 ? 31  TYR B CD1   1 
ATOM   2411 C CD2   . TYR D 2 30  ? 12.484  9.334   11.429  1.00 30.46 ? 31  TYR B CD2   1 
ATOM   2412 C CE1   . TYR D 2 30  ? 13.295  11.966  11.165  1.00 33.02 ? 31  TYR B CE1   1 
ATOM   2413 C CE2   . TYR D 2 30  ? 12.285  10.225  12.489  1.00 31.00 ? 31  TYR B CE2   1 
ATOM   2414 C CZ    . TYR D 2 30  ? 12.699  11.547  12.348  1.00 32.91 ? 31  TYR B CZ    1 
ATOM   2415 O OH    . TYR D 2 30  ? 12.547  12.465  13.372  1.00 35.02 ? 31  TYR B OH    1 
ATOM   2416 N N     . PRO D 2 31  ? 15.597  6.583   7.660   1.00 22.43 ? 32  PRO B N     1 
ATOM   2417 C CA    . PRO D 2 31  ? 15.875  5.512   6.691   1.00 21.36 ? 32  PRO B CA    1 
ATOM   2418 C C     . PRO D 2 31  ? 14.681  4.755   6.107   1.00 22.18 ? 32  PRO B C     1 
ATOM   2419 O O     . PRO D 2 31  ? 13.539  4.939   6.523   1.00 20.36 ? 32  PRO B O     1 
ATOM   2420 C CB    . PRO D 2 31  ? 16.812  4.568   7.472   1.00 23.52 ? 32  PRO B CB    1 
ATOM   2421 C CG    . PRO D 2 31  ? 17.335  5.438   8.628   1.00 22.23 ? 32  PRO B CG    1 
ATOM   2422 C CD    . PRO D 2 31  ? 16.147  6.256   8.991   1.00 19.22 ? 32  PRO B CD    1 
ATOM   2423 N N     . LEU D 2 32  ? 14.979  3.891   5.136   1.00 24.76 ? 33  LEU B N     1 
ATOM   2424 C CA    . LEU D 2 32  ? 13.981  3.067   4.472   1.00 25.25 ? 33  LEU B CA    1 
ATOM   2425 C C     . LEU D 2 32  ? 13.925  1.627   4.980   1.00 27.93 ? 33  LEU B C     1 
ATOM   2426 O O     . LEU D 2 32  ? 14.916  1.048   5.408   1.00 27.46 ? 33  LEU B O     1 
ATOM   2427 C CB    . LEU D 2 32  ? 14.221  3.027   2.958   1.00 21.80 ? 33  LEU B CB    1 
ATOM   2428 C CG    . LEU D 2 32  ? 14.230  4.333   2.170   1.00 26.13 ? 33  LEU B CG    1 
ATOM   2429 C CD1   . LEU D 2 32  ? 14.285  4.026   0.680   1.00 24.85 ? 33  LEU B CD1   1 
ATOM   2430 C CD2   . LEU D 2 32  ? 13.005  5.195   2.515   1.00 32.21 ? 33  LEU B CD2   1 
ATOM   2431 N N     . GLY D 2 33  ? 12.728  1.058   4.930   1.00 33.34 ? 34  GLY B N     1 
ATOM   2432 C CA    . GLY D 2 33  ? 12.527  -0.321  5.311   1.00 36.05 ? 34  GLY B CA    1 
ATOM   2433 C C     . GLY D 2 33  ? 12.719  -1.182  4.070   1.00 39.27 ? 34  GLY B C     1 
ATOM   2434 O O     . GLY D 2 33  ? 12.342  -0.785  2.958   1.00 37.19 ? 34  GLY B O     1 
ATOM   2435 N N     . SER D 2 34  ? 13.371  -2.329  4.252   1.00 43.86 ? 35  SER B N     1 
ATOM   2436 C CA    . SER D 2 34  ? 13.619  -3.275  3.164   1.00 44.99 ? 35  SER B CA    1 
ATOM   2437 C C     . SER D 2 34  ? 12.320  -4.022  2.907   1.00 46.63 ? 35  SER B C     1 
ATOM   2438 O O     . SER D 2 34  ? 12.135  -5.144  3.383   1.00 47.60 ? 35  SER B O     1 
ATOM   2439 C CB    . SER D 2 34  ? 14.721  -4.266  3.561   1.00 42.56 ? 35  SER B CB    1 
ATOM   2440 N N     . ASP D 2 35  ? 11.416  -3.380  2.179   1.00 46.74 ? 36  ASP B N     1 
ATOM   2441 C CA    . ASP D 2 35  ? 10.117  -3.963  1.882   1.00 47.69 ? 36  ASP B CA    1 
ATOM   2442 C C     . ASP D 2 35  ? 9.663   -3.546  0.476   1.00 47.47 ? 36  ASP B C     1 
ATOM   2443 O O     . ASP D 2 35  ? 10.402  -2.870  -0.238  1.00 51.12 ? 36  ASP B O     1 
ATOM   2444 C CB    . ASP D 2 35  ? 9.100   -3.494  2.933   1.00 50.35 ? 36  ASP B CB    1 
ATOM   2445 N N     . THR D 2 36  ? 8.449   -3.925  0.088   1.00 41.57 ? 37  THR B N     1 
ATOM   2446 C CA    . THR D 2 36  ? 7.948   -3.571  -1.227  1.00 35.44 ? 37  THR B CA    1 
ATOM   2447 C C     . THR D 2 36  ? 6.882   -2.468  -1.174  1.00 31.14 ? 37  THR B C     1 
ATOM   2448 O O     . THR D 2 36  ? 6.758   -1.676  -2.109  1.00 29.61 ? 37  THR B O     1 
ATOM   2449 C CB    . THR D 2 36  ? 7.420   -4.817  -1.941  1.00 38.59 ? 37  THR B CB    1 
ATOM   2450 N N     . LYS D 2 37  ? 6.111   -2.398  -0.091  1.00 26.44 ? 38  LYS B N     1 
ATOM   2451 C CA    . LYS D 2 37  ? 5.102   -1.344  0.023   1.00 24.08 ? 38  LYS B CA    1 
ATOM   2452 C C     . LYS D 2 37  ? 5.821   0.010   0.147   1.00 20.64 ? 38  LYS B C     1 
ATOM   2453 O O     . LYS D 2 37  ? 5.317   1.059   -0.263  1.00 21.09 ? 38  LYS B O     1 
ATOM   2454 C CB    . LYS D 2 37  ? 4.209   -1.597  1.233   1.00 26.99 ? 38  LYS B CB    1 
ATOM   2455 N N     . VAL D 2 38  ? 7.029   -0.042  0.687   1.00 21.05 ? 39  VAL B N     1 
ATOM   2456 C CA    . VAL D 2 38  ? 7.863   1.124   0.877   1.00 20.34 ? 39  VAL B CA    1 
ATOM   2457 C C     . VAL D 2 38  ? 8.357   1.617   -0.476  1.00 22.15 ? 39  VAL B C     1 
ATOM   2458 O O     . VAL D 2 38  ? 8.131   2.764   -0.852  1.00 23.37 ? 39  VAL B O     1 
ATOM   2459 C CB    . VAL D 2 38  ? 9.091   0.763   1.771   1.00 21.27 ? 39  VAL B CB    1 
ATOM   2460 C CG1   . VAL D 2 38  ? 10.125  1.906   1.808   1.00 18.60 ? 39  VAL B CG1   1 
ATOM   2461 C CG2   . VAL D 2 38  ? 8.619   0.405   3.161   1.00 18.95 ? 39  VAL B CG2   1 
ATOM   2462 N N     . LEU D 2 39  ? 9.016   0.729   -1.212  1.00 20.18 ? 40  LEU B N     1 
ATOM   2463 C CA    . LEU D 2 39  ? 9.577   1.062   -2.507  1.00 22.41 ? 40  LEU B CA    1 
ATOM   2464 C C     . LEU D 2 39  ? 8.525   1.452   -3.528  1.00 23.38 ? 40  LEU B C     1 
ATOM   2465 O O     . LEU D 2 39  ? 8.807   2.245   -4.421  1.00 26.34 ? 40  LEU B O     1 
ATOM   2466 C CB    . LEU D 2 39  ? 10.443  -0.090  -3.013  1.00 21.74 ? 40  LEU B CB    1 
ATOM   2467 C CG    . LEU D 2 39  ? 11.582  -0.306  -2.036  1.00 25.41 ? 40  LEU B CG    1 
ATOM   2468 C CD1   . LEU D 2 39  ? 12.192  -1.647  -2.187  1.00 24.04 ? 40  LEU B CD1   1 
ATOM   2469 C CD2   . LEU D 2 39  ? 12.607  0.773   -2.241  1.00 32.12 ? 40  LEU B CD2   1 
ATOM   2470 N N     . SER D 2 40  ? 7.308   0.933   -3.396  1.00 19.51 ? 41  SER B N     1 
ATOM   2471 C CA    . SER D 2 40  ? 6.277   1.307   -4.347  1.00 19.99 ? 41  SER B CA    1 
ATOM   2472 C C     . SER D 2 40  ? 6.068   2.792   -4.214  1.00 17.25 ? 41  SER B C     1 
ATOM   2473 O O     . SER D 2 40  ? 6.095   3.512   -5.192  1.00 18.77 ? 41  SER B O     1 
ATOM   2474 C CB    . SER D 2 40  ? 4.978   0.560   -4.063  1.00 18.15 ? 41  SER B CB    1 
ATOM   2475 O OG    . SER D 2 40  ? 5.154   -0.824  -4.306  1.00 27.64 ? 41  SER B OG    1 
ATOM   2476 N N     . THR D 2 41  ? 5.870   3.225   -2.974  1.00 21.38 ? 42  THR B N     1 
ATOM   2477 C CA    . THR D 2 41  ? 5.649   4.624   -2.588  1.00 22.38 ? 42  THR B CA    1 
ATOM   2478 C C     . THR D 2 41  ? 6.821   5.509   -3.022  1.00 21.38 ? 42  THR B C     1 
ATOM   2479 O O     . THR D 2 41  ? 6.628   6.603   -3.581  1.00 21.39 ? 42  THR B O     1 
ATOM   2480 C CB    . THR D 2 41  ? 5.526   4.714   -1.042  1.00 27.31 ? 42  THR B CB    1 
ATOM   2481 O OG1   . THR D 2 41  ? 4.309   4.075   -0.611  1.00 25.09 ? 42  THR B OG1   1 
ATOM   2482 C CG2   . THR D 2 41  ? 5.608   6.171   -0.550  1.00 28.67 ? 42  THR B CG2   1 
ATOM   2483 N N     . ILE D 2 42  ? 8.028   5.025   -2.745  1.00 17.73 ? 43  ILE B N     1 
ATOM   2484 C CA    . ILE D 2 42  ? 9.263   5.720   -3.084  1.00 21.30 ? 43  ILE B CA    1 
ATOM   2485 C C     . ILE D 2 42  ? 9.257   5.983   -4.583  1.00 22.66 ? 43  ILE B C     1 
ATOM   2486 O O     . ILE D 2 42  ? 9.092   7.133   -5.023  1.00 26.71 ? 43  ILE B O     1 
ATOM   2487 C CB    . ILE D 2 42  ? 10.491  4.843   -2.667  1.00 22.84 ? 43  ILE B CB    1 
ATOM   2488 C CG1   . ILE D 2 42  ? 10.518  4.710   -1.148  1.00 30.47 ? 43  ILE B CG1   1 
ATOM   2489 C CG2   . ILE D 2 42  ? 11.811  5.407   -3.164  1.00 22.62 ? 43  ILE B CG2   1 
ATOM   2490 C CD1   . ILE D 2 42  ? 10.314  6.027   -0.409  1.00 28.36 ? 43  ILE B CD1   1 
ATOM   2491 N N     . PHE D 2 43  ? 9.304   4.900   -5.352  1.00 21.40 ? 44  PHE B N     1 
ATOM   2492 C CA    . PHE D 2 43  ? 9.311   4.968   -6.811  1.00 24.09 ? 44  PHE B CA    1 
ATOM   2493 C C     . PHE D 2 43  ? 8.222   5.817   -7.433  1.00 21.41 ? 44  PHE B C     1 
ATOM   2494 O O     . PHE D 2 43  ? 8.414   6.360   -8.504  1.00 23.35 ? 44  PHE B O     1 
ATOM   2495 C CB    . PHE D 2 43  ? 9.318   3.562   -7.421  1.00 26.18 ? 44  PHE B CB    1 
ATOM   2496 C CG    . PHE D 2 43  ? 10.552  2.791   -7.089  1.00 30.11 ? 44  PHE B CG    1 
ATOM   2497 C CD1   . PHE D 2 43  ? 11.781  3.450   -6.973  1.00 32.62 ? 44  PHE B CD1   1 
ATOM   2498 C CD2   . PHE D 2 43  ? 10.484  1.439   -6.790  1.00 32.25 ? 44  PHE B CD2   1 
ATOM   2499 C CE1   . PHE D 2 43  ? 12.920  2.770   -6.555  1.00 33.96 ? 44  PHE B CE1   1 
ATOM   2500 C CE2   . PHE D 2 43  ? 11.621  0.751   -6.369  1.00 34.57 ? 44  PHE B CE2   1 
ATOM   2501 C CZ    . PHE D 2 43  ? 12.838  1.416   -6.248  1.00 34.11 ? 44  PHE B CZ    1 
ATOM   2502 N N     . GLU D 2 44  ? 7.072   5.914   -6.788  1.00 20.86 ? 45  GLU B N     1 
ATOM   2503 C CA    . GLU D 2 44  ? 6.018   6.751   -7.337  1.00 23.66 ? 45  GLU B CA    1 
ATOM   2504 C C     . GLU D 2 44  ? 6.417   8.200   -7.091  1.00 24.49 ? 45  GLU B C     1 
ATOM   2505 O O     . GLU D 2 44  ? 6.369   9.042   -8.011  1.00 23.76 ? 45  GLU B O     1 
ATOM   2506 C CB    . GLU D 2 44  ? 4.658   6.452   -6.675  1.00 24.64 ? 45  GLU B CB    1 
ATOM   2507 N N     . LEU D 2 45  ? 6.881   8.485   -5.873  1.00 17.30 ? 46  LEU B N     1 
ATOM   2508 C CA    . LEU D 2 45  ? 7.253   9.858   -5.556  1.00 20.45 ? 46  LEU B CA    1 
ATOM   2509 C C     . LEU D 2 45  ? 8.412   10.321  -6.395  1.00 13.74 ? 46  LEU B C     1 
ATOM   2510 O O     . LEU D 2 45  ? 8.431   11.443  -6.857  1.00 19.90 ? 46  LEU B O     1 
ATOM   2511 C CB    . LEU D 2 45  ? 7.543   10.059  -4.053  1.00 21.18 ? 46  LEU B CB    1 
ATOM   2512 C CG    . LEU D 2 45  ? 6.327   10.029  -3.098  1.00 23.19 ? 46  LEU B CG    1 
ATOM   2513 C CD1   . LEU D 2 45  ? 6.750   10.368  -1.652  1.00 19.44 ? 46  LEU B CD1   1 
ATOM   2514 C CD2   . LEU D 2 45  ? 5.239   10.987  -3.580  1.00 21.08 ? 46  LEU B CD2   1 
ATOM   2515 N N     . PHE D 2 46  ? 9.373   9.446   -6.592  1.00 11.67 ? 47  PHE B N     1 
ATOM   2516 C CA    . PHE D 2 46  ? 10.534  9.765   -7.388  1.00 16.94 ? 47  PHE B CA    1 
ATOM   2517 C C     . PHE D 2 46  ? 10.138  10.110  -8.833  1.00 22.10 ? 47  PHE B C     1 
ATOM   2518 O O     . PHE D 2 46  ? 10.755  10.987  -9.467  1.00 22.49 ? 47  PHE B O     1 
ATOM   2519 C CB    . PHE D 2 46  ? 11.467  8.576   -7.368  1.00 13.28 ? 47  PHE B CB    1 
ATOM   2520 C CG    . PHE D 2 46  ? 12.748  8.808   -8.062  1.00 22.17 ? 47  PHE B CG    1 
ATOM   2521 C CD1   . PHE D 2 46  ? 13.821  9.372   -7.388  1.00 25.40 ? 47  PHE B CD1   1 
ATOM   2522 C CD2   . PHE D 2 46  ? 12.913  8.426   -9.387  1.00 27.71 ? 47  PHE B CD2   1 
ATOM   2523 C CE1   . PHE D 2 46  ? 15.054  9.551   -8.032  1.00 31.06 ? 47  PHE B CE1   1 
ATOM   2524 C CE2   . PHE D 2 46  ? 14.146  8.601   -10.043 1.00 29.38 ? 47  PHE B CE2   1 
ATOM   2525 C CZ    . PHE D 2 46  ? 15.215  9.163   -9.363  1.00 29.71 ? 47  PHE B CZ    1 
ATOM   2526 N N     . SER D 2 47  ? 9.065   9.479   -9.316  1.00 20.83 ? 48  SER B N     1 
ATOM   2527 C CA    . SER D 2 47  ? 8.602   9.666   -10.703 1.00 21.87 ? 48  SER B CA    1 
ATOM   2528 C C     . SER D 2 47  ? 7.823   10.931  -11.025 1.00 22.30 ? 48  SER B C     1 
ATOM   2529 O O     . SER D 2 47  ? 8.029   11.533  -12.080 1.00 22.41 ? 48  SER B O     1 
ATOM   2530 C CB    . SER D 2 47  ? 7.801   8.455   -11.161 1.00 15.81 ? 48  SER B CB    1 
ATOM   2531 O OG    . SER D 2 47  ? 8.618   7.311   -11.083 1.00 17.57 ? 48  SER B OG    1 
ATOM   2532 N N     . ARG D 2 48  ? 6.950   11.342  -10.114 1.00 22.07 ? 49  ARG B N     1 
ATOM   2533 C CA    . ARG D 2 48  ? 6.130   12.523  -10.317 1.00 22.05 ? 49  ARG B CA    1 
ATOM   2534 C C     . ARG D 2 48  ? 6.893   13.762  -10.827 1.00 23.26 ? 49  ARG B C     1 
ATOM   2535 O O     . ARG D 2 48  ? 6.436   14.447  -11.759 1.00 21.56 ? 49  ARG B O     1 
ATOM   2536 C CB    . ARG D 2 48  ? 5.396   12.863  -9.018  1.00 23.24 ? 49  ARG B CB    1 
ATOM   2537 C CG    . ARG D 2 48  ? 4.545   11.763  -8.488  1.00 25.04 ? 49  ARG B CG    1 
ATOM   2538 C CD    . ARG D 2 48  ? 4.182   12.035  -7.053  1.00 30.30 ? 49  ARG B CD    1 
ATOM   2539 N NE    . ARG D 2 48  ? 3.296   13.180  -6.903  1.00 34.39 ? 49  ARG B NE    1 
ATOM   2540 C CZ    . ARG D 2 48  ? 3.507   14.180  -6.049  1.00 37.36 ? 49  ARG B CZ    1 
ATOM   2541 N NH1   . ARG D 2 48  ? 4.590   14.180  -5.271  1.00 35.10 ? 49  ARG B NH1   1 
ATOM   2542 N NH2   . ARG D 2 48  ? 2.615   15.162  -5.945  1.00 36.49 ? 49  ARG B NH2   1 
ATOM   2543 N N     . PRO D 2 49  ? 8.073   14.045  -10.245 1.00 20.81 ? 50  PRO B N     1 
ATOM   2544 C CA    . PRO D 2 49  ? 8.686   15.240  -10.805 1.00 22.35 ? 50  PRO B CA    1 
ATOM   2545 C C     . PRO D 2 49  ? 9.065   15.054  -12.261 1.00 21.35 ? 50  PRO B C     1 
ATOM   2546 O O     . PRO D 2 49  ? 8.708   15.874  -13.115 1.00 19.70 ? 50  PRO B O     1 
ATOM   2547 C CB    . PRO D 2 49  ? 9.932   15.434  -9.922  1.00 23.27 ? 50  PRO B CB    1 
ATOM   2548 C CG    . PRO D 2 49  ? 9.554   14.756  -8.632  1.00 21.72 ? 50  PRO B CG    1 
ATOM   2549 C CD    . PRO D 2 49  ? 8.935   13.503  -9.178  1.00 17.47 ? 50  PRO B CD    1 
ATOM   2550 N N     . ILE D 2 50  ? 9.762   13.960  -12.538 1.00 19.89 ? 51  ILE B N     1 
ATOM   2551 C CA    . ILE D 2 50  ? 10.221  13.680  -13.890 1.00 22.30 ? 51  ILE B CA    1 
ATOM   2552 C C     . ILE D 2 50  ? 9.116   13.827  -14.936 1.00 22.52 ? 51  ILE B C     1 
ATOM   2553 O O     . ILE D 2 50  ? 9.255   14.590  -15.898 1.00 20.24 ? 51  ILE B O     1 
ATOM   2554 C CB    . ILE D 2 50  ? 10.835  12.298  -13.944 1.00 22.18 ? 51  ILE B CB    1 
ATOM   2555 C CG1   . ILE D 2 50  ? 12.026  12.254  -12.984 1.00 24.86 ? 51  ILE B CG1   1 
ATOM   2556 C CG2   . ILE D 2 50  ? 11.245  11.972  -15.352 1.00 28.40 ? 51  ILE B CG2   1 
ATOM   2557 C CD1   . ILE D 2 50  ? 12.618  10.877  -12.780 1.00 32.96 ? 51  ILE B CD1   1 
ATOM   2558 N N     . ILE D 2 51  ? 7.993   13.167  -14.665 1.00 20.87 ? 52  ILE B N     1 
ATOM   2559 C CA    . ILE D 2 51  ? 6.811   13.154  -15.526 1.00 20.55 ? 52  ILE B CA    1 
ATOM   2560 C C     . ILE D 2 51  ? 6.261   14.576  -15.720 1.00 21.41 ? 52  ILE B C     1 
ATOM   2561 O O     . ILE D 2 51  ? 5.962   15.017  -16.839 1.00 16.95 ? 52  ILE B O     1 
ATOM   2562 C CB    . ILE D 2 51  ? 5.688   12.152  -14.913 1.00 17.90 ? 52  ILE B CB    1 
ATOM   2563 C CG1   . ILE D 2 51  ? 6.115   10.696  -15.108 1.00 10.09 ? 52  ILE B CG1   1 
ATOM   2564 C CG2   . ILE D 2 51  ? 4.277   12.376  -15.527 1.00 16.26 ? 52  ILE B CG2   1 
ATOM   2565 C CD1   . ILE D 2 51  ? 5.333   9.754   -14.297 1.00 10.89 ? 52  ILE B CD1   1 
ATOM   2566 N N     . ASN D 2 52  ? 6.216   15.339  -14.643 1.00 23.39 ? 53  ASN B N     1 
ATOM   2567 C CA    . ASN D 2 52  ? 5.654   16.657  -14.770 1.00 24.51 ? 53  ASN B CA    1 
ATOM   2568 C C     . ASN D 2 52  ? 6.537   17.610  -15.557 1.00 28.73 ? 53  ASN B C     1 
ATOM   2569 O O     . ASN D 2 52  ? 6.017   18.503  -16.240 1.00 32.36 ? 53  ASN B O     1 
ATOM   2570 C CB    . ASN D 2 52  ? 5.303   17.223  -13.405 1.00 24.07 ? 53  ASN B CB    1 
ATOM   2571 C CG    . ASN D 2 52  ? 4.437   18.431  -13.510 1.00 22.92 ? 53  ASN B CG    1 
ATOM   2572 O OD1   . ASN D 2 52  ? 3.285   18.351  -13.911 1.00 28.22 ? 53  ASN B OD1   1 
ATOM   2573 N ND2   . ASN D 2 52  ? 4.993   19.571  -13.181 1.00 28.27 ? 53  ASN B ND2   1 
ATOM   2574 N N     . LYS D 2 53  ? 7.858   17.429  -15.469 1.00 25.40 ? 54  LYS B N     1 
ATOM   2575 C CA    . LYS D 2 53  ? 8.784   18.278  -16.205 1.00 26.80 ? 54  LYS B CA    1 
ATOM   2576 C C     . LYS D 2 53  ? 8.662   18.035  -17.715 1.00 29.13 ? 54  LYS B C     1 
ATOM   2577 O O     . LYS D 2 53  ? 8.542   18.981  -18.498 1.00 32.36 ? 54  LYS B O     1 
ATOM   2578 C CB    . LYS D 2 53  ? 10.220  18.042  -15.755 1.00 27.68 ? 54  LYS B CB    1 
ATOM   2579 C CG    . LYS D 2 53  ? 11.257  18.532  -16.769 1.00 34.66 ? 54  LYS B CG    1 
ATOM   2580 C CD    . LYS D 2 53  ? 12.526  19.097  -16.133 1.00 41.09 ? 54  LYS B CD    1 
ATOM   2581 C CE    . LYS D 2 53  ? 12.314  20.523  -15.583 1.00 47.56 ? 54  LYS B CE    1 
ATOM   2582 N NZ    . LYS D 2 53  ? 12.082  21.566  -16.638 1.00 46.57 ? 54  LYS B NZ    1 
ATOM   2583 N N     . ILE D 2 54  ? 8.689   16.768  -18.110 1.00 28.37 ? 55  ILE B N     1 
ATOM   2584 C CA    . ILE D 2 54  ? 8.570   16.370  -19.516 1.00 26.32 ? 55  ILE B CA    1 
ATOM   2585 C C     . ILE D 2 54  ? 7.207   16.723  -20.107 1.00 23.78 ? 55  ILE B C     1 
ATOM   2586 O O     . ILE D 2 54  ? 7.117   17.149  -21.256 1.00 19.97 ? 55  ILE B O     1 
ATOM   2587 C CB    . ILE D 2 54  ? 8.857   14.861  -19.668 1.00 25.07 ? 55  ILE B CB    1 
ATOM   2588 C CG1   . ILE D 2 54  ? 10.367  14.633  -19.579 1.00 27.53 ? 55  ILE B CG1   1 
ATOM   2589 C CG2   . ILE D 2 54  ? 8.244   14.298  -20.943 1.00 32.10 ? 55  ILE B CG2   1 
ATOM   2590 C CD1   . ILE D 2 54  ? 11.197  15.512  -20.534 1.00 21.39 ? 55  ILE B CD1   1 
ATOM   2591 N N     . ALA D 2 55  ? 6.160   16.569  -19.299 1.00 27.13 ? 56  ALA B N     1 
ATOM   2592 C CA    . ALA D 2 55  ? 4.774   16.875  -19.698 1.00 29.86 ? 56  ALA B CA    1 
ATOM   2593 C C     . ALA D 2 55  ? 4.597   18.361  -20.086 1.00 30.00 ? 56  ALA B C     1 
ATOM   2594 O O     . ALA D 2 55  ? 3.982   18.705  -21.119 1.00 26.88 ? 56  ALA B O     1 
ATOM   2595 C CB    . ALA D 2 55  ? 3.827   16.500  -18.573 1.00 28.33 ? 56  ALA B CB    1 
ATOM   2596 N N     . GLU D 2 56  ? 5.153   19.226  -19.245 1.00 27.71 ? 57  GLU B N     1 
ATOM   2597 C CA    . GLU D 2 56  ? 5.120   20.659  -19.473 1.00 29.28 ? 57  GLU B CA    1 
ATOM   2598 C C     . GLU D 2 56  ? 5.750   20.953  -20.855 1.00 24.19 ? 57  GLU B C     1 
ATOM   2599 O O     . GLU D 2 56  ? 5.149   21.630  -21.691 1.00 22.24 ? 57  GLU B O     1 
ATOM   2600 C CB    . GLU D 2 56  ? 5.899   21.398  -18.339 1.00 25.84 ? 57  GLU B CB    1 
ATOM   2601 N N     . LYS D 2 57  ? 6.936   20.401  -21.092 1.00 21.77 ? 58  LYS B N     1 
ATOM   2602 C CA    . LYS D 2 57  ? 7.620   20.610  -22.344 1.00 26.35 ? 58  LYS B CA    1 
ATOM   2603 C C     . LYS D 2 57  ? 6.663   20.436  -23.517 1.00 28.10 ? 58  LYS B C     1 
ATOM   2604 O O     . LYS D 2 57  ? 6.554   21.306  -24.375 1.00 30.67 ? 58  LYS B O     1 
ATOM   2605 C CB    . LYS D 2 57  ? 8.799   19.652  -22.475 1.00 25.71 ? 58  LYS B CB    1 
ATOM   2606 N N     . HIS D 2 58  ? 5.854   19.386  -23.475 1.00 35.08 ? 59  HIS B N     1 
ATOM   2607 C CA    . HIS D 2 58  ? 4.931   19.108  -24.586 1.00 35.99 ? 59  HIS B CA    1 
ATOM   2608 C C     . HIS D 2 58  ? 3.535   19.706  -24.486 1.00 38.85 ? 59  HIS B C     1 
ATOM   2609 O O     . HIS D 2 58  ? 2.617   19.255  -25.189 1.00 39.92 ? 59  HIS B O     1 
ATOM   2610 C CB    . HIS D 2 58  ? 4.862   17.600  -24.851 1.00 29.13 ? 59  HIS B CB    1 
ATOM   2611 C CG    . HIS D 2 58  ? 6.200   16.991  -25.120 1.00 26.54 ? 59  HIS B CG    1 
ATOM   2612 N ND1   . HIS D 2 58  ? 6.820   17.051  -26.353 1.00 24.24 ? 59  HIS B ND1   1 
ATOM   2613 C CD2   . HIS D 2 58  ? 7.070   16.367  -24.294 1.00 28.13 ? 59  HIS B CD2   1 
ATOM   2614 C CE1   . HIS D 2 58  ? 8.011   16.495  -26.271 1.00 26.00 ? 59  HIS B CE1   1 
ATOM   2615 N NE2   . HIS D 2 58  ? 8.188   16.072  -25.031 1.00 26.61 ? 59  HIS B NE2   1 
ATOM   2616 N N     . GLY D 2 59  ? 3.385   20.720  -23.632 1.00 40.91 ? 60  GLY B N     1 
ATOM   2617 C CA    . GLY D 2 59  ? 2.098   21.374  -23.473 1.00 42.41 ? 60  GLY B CA    1 
ATOM   2618 C C     . GLY D 2 59  ? 0.982   20.468  -22.983 1.00 44.95 ? 60  GLY B C     1 
ATOM   2619 O O     . GLY D 2 59  ? -0.201  20.663  -23.311 1.00 48.05 ? 60  GLY B O     1 
ATOM   2620 N N     . TYR D 2 60  ? 1.345   19.484  -22.171 1.00 41.83 ? 61  TYR B N     1 
ATOM   2621 C CA    . TYR D 2 60  ? 0.356   18.563  -21.636 1.00 38.93 ? 61  TYR B CA    1 
ATOM   2622 C C     . TYR D 2 60  ? 0.093   18.852  -20.152 1.00 36.82 ? 61  TYR B C     1 
ATOM   2623 O O     . TYR D 2 60  ? 1.027   19.207  -19.408 1.00 34.08 ? 61  TYR B O     1 
ATOM   2624 C CB    . TYR D 2 60  ? 0.867   17.132  -21.809 1.00 40.30 ? 61  TYR B CB    1 
ATOM   2625 C CG    . TYR D 2 60  ? 0.644   16.507  -23.174 1.00 40.50 ? 61  TYR B CG    1 
ATOM   2626 C CD1   . TYR D 2 60  ? 1.482   16.792  -24.246 1.00 38.50 ? 61  TYR B CD1   1 
ATOM   2627 C CD2   . TYR D 2 60  ? -0.377  15.558  -23.361 1.00 42.14 ? 61  TYR B CD2   1 
ATOM   2628 C CE1   . TYR D 2 60  ? 1.317   16.136  -25.480 1.00 44.09 ? 61  TYR B CE1   1 
ATOM   2629 C CE2   . TYR D 2 60  ? -0.556  14.890  -24.578 1.00 41.42 ? 61  TYR B CE2   1 
ATOM   2630 C CZ    . TYR D 2 60  ? 0.292   15.173  -25.638 1.00 43.79 ? 61  TYR B CZ    1 
ATOM   2631 O OH    . TYR D 2 60  ? 0.132   14.477  -26.829 1.00 41.38 ? 61  TYR B OH    1 
ATOM   2632 N N     . ILE D 2 61  ? -1.173  18.804  -19.747 1.00 36.65 ? 62  ILE B N     1 
ATOM   2633 C CA    . ILE D 2 61  ? -1.541  18.988  -18.341 1.00 39.51 ? 62  ILE B CA    1 
ATOM   2634 C C     . ILE D 2 61  ? -1.402  17.630  -17.627 1.00 39.60 ? 62  ILE B C     1 
ATOM   2635 O O     . ILE D 2 61  ? -1.590  16.562  -18.247 1.00 35.97 ? 62  ILE B O     1 
ATOM   2636 C CB    . ILE D 2 61  ? -3.003  19.507  -18.176 1.00 41.51 ? 62  ILE B CB    1 
ATOM   2637 C CG1   . ILE D 2 61  ? -3.028  21.039  -18.187 1.00 43.54 ? 62  ILE B CG1   1 
ATOM   2638 C CG2   . ILE D 2 61  ? -3.627  19.026  -16.863 1.00 39.70 ? 62  ILE B CG2   1 
ATOM   2639 C CD1   . ILE D 2 61  ? -2.112  21.678  -17.141 1.00 48.04 ? 62  ILE B CD1   1 
ATOM   2640 N N     . VAL D 2 62  ? -1.001  17.677  -16.355 1.00 38.51 ? 63  VAL B N     1 
ATOM   2641 C CA    . VAL D 2 62  ? -0.854  16.476  -15.553 1.00 34.36 ? 63  VAL B CA    1 
ATOM   2642 C C     . VAL D 2 62  ? -1.834  16.591  -14.401 1.00 36.12 ? 63  VAL B C     1 
ATOM   2643 O O     . VAL D 2 62  ? -1.844  17.604  -13.706 1.00 37.73 ? 63  VAL B O     1 
ATOM   2644 C CB    . VAL D 2 62  ? 0.567   16.333  -14.956 1.00 34.62 ? 63  VAL B CB    1 
ATOM   2645 C CG1   . VAL D 2 62  ? 0.704   15.013  -14.183 1.00 31.14 ? 63  VAL B CG1   1 
ATOM   2646 C CG2   . VAL D 2 62  ? 1.602   16.372  -16.044 1.00 33.97 ? 63  VAL B CG2   1 
ATOM   2647 N N     . GLU D 2 63  ? -2.698  15.587  -14.249 1.00 35.31 ? 64  GLU B N     1 
ATOM   2648 C CA    . GLU D 2 63  ? -3.667  15.520  -13.153 1.00 34.02 ? 64  GLU B CA    1 
ATOM   2649 C C     . GLU D 2 63  ? -3.465  14.190  -12.450 1.00 30.83 ? 64  GLU B C     1 
ATOM   2650 O O     . GLU D 2 63  ? -3.261  13.162  -13.098 1.00 25.40 ? 64  GLU B O     1 
ATOM   2651 C CB    . GLU D 2 63  ? -5.118  15.603  -13.647 1.00 35.48 ? 64  GLU B CB    1 
ATOM   2652 C CG    . GLU D 2 63  ? -5.670  17.024  -13.801 1.00 43.74 ? 64  GLU B CG    1 
ATOM   2653 C CD    . GLU D 2 63  ? -7.092  17.177  -13.250 1.00 44.63 ? 64  GLU B CD    1 
ATOM   2654 O OE1   . GLU D 2 63  ? -7.980  16.409  -13.677 1.00 41.00 ? 64  GLU B OE1   1 
ATOM   2655 O OE2   . GLU D 2 63  ? -7.318  18.061  -12.381 1.00 47.80 ? 64  GLU B OE2   1 
ATOM   2656 N N     . GLU D 2 64  ? -3.404  14.236  -11.128 1.00 29.51 ? 65  GLU B N     1 
ATOM   2657 C CA    . GLU D 2 64  ? -3.260  13.025  -10.326 1.00 29.89 ? 65  GLU B CA    1 
ATOM   2658 C C     . GLU D 2 64  ? -4.656  12.768  -9.794  1.00 29.21 ? 65  GLU B C     1 
ATOM   2659 O O     . GLU D 2 64  ? -5.572  13.527  -10.126 1.00 24.81 ? 65  GLU B O     1 
ATOM   2660 C CB    . GLU D 2 64  ? -2.258  13.223  -9.184  1.00 27.96 ? 65  GLU B CB    1 
ATOM   2661 C CG    . GLU D 2 64  ? -0.833  13.367  -9.686  1.00 28.13 ? 65  GLU B CG    1 
ATOM   2662 C CD    . GLU D 2 64  ? 0.154   13.512  -8.564  1.00 30.54 ? 65  GLU B CD    1 
ATOM   2663 O OE1   . GLU D 2 64  ? 0.247   14.617  -7.980  1.00 29.40 ? 65  GLU B OE1   1 
ATOM   2664 O OE2   . GLU D 2 64  ? 0.857   12.517  -8.259  1.00 35.40 ? 65  GLU B OE2   1 
ATOM   2665 N N     . PRO D 2 65  ? -4.866  11.649  -9.064  1.00 29.11 ? 66  PRO B N     1 
ATOM   2666 C CA    . PRO D 2 65  ? -6.252  11.496  -8.592  1.00 32.83 ? 66  PRO B CA    1 
ATOM   2667 C C     . PRO D 2 65  ? -6.604  12.338  -7.335  1.00 35.12 ? 66  PRO B C     1 
ATOM   2668 O O     . PRO D 2 65  ? -5.732  12.890  -6.636  1.00 29.39 ? 66  PRO B O     1 
ATOM   2669 C CB    . PRO D 2 65  ? -6.370  9.982   -8.324  1.00 30.04 ? 66  PRO B CB    1 
ATOM   2670 C CG    . PRO D 2 65  ? -5.389  9.384   -9.249  1.00 22.54 ? 66  PRO B CG    1 
ATOM   2671 C CD    . PRO D 2 65  ? -4.208  10.333  -9.139  1.00 24.18 ? 66  PRO B CD    1 
ATOM   2672 N N     . LYS D 2 66  ? -7.912  12.486  -7.138  1.00 38.83 ? 67  LYS B N     1 
ATOM   2673 C CA    . LYS D 2 66  ? -8.502  13.222  -6.030  1.00 40.07 ? 67  LYS B CA    1 
ATOM   2674 C C     . LYS D 2 66  ? -8.984  12.135  -5.089  1.00 42.76 ? 67  LYS B C     1 
ATOM   2675 O O     . LYS D 2 66  ? -8.686  12.154  -3.894  1.00 45.60 ? 67  LYS B O     1 
ATOM   2676 C CB    . LYS D 2 66  ? -9.684  14.054  -6.524  1.00 37.12 ? 67  LYS B CB    1 
ATOM   2677 N N     . GLN D 2 67  ? -9.720  11.174  -5.649  1.00 45.04 ? 68  GLN B N     1 
ATOM   2678 C CA    . GLN D 2 67  ? -10.230 10.044  -4.881  1.00 44.65 ? 68  GLN B CA    1 
ATOM   2679 C C     . GLN D 2 67  ? -9.044  9.114   -4.879  1.00 43.85 ? 68  GLN B C     1 
ATOM   2680 O O     . GLN D 2 67  ? -8.289  9.095   -5.846  1.00 42.09 ? 68  GLN B O     1 
ATOM   2681 C CB    . GLN D 2 67  ? -11.444 9.404   -5.565  1.00 45.77 ? 68  GLN B CB    1 
ATOM   2682 N N     . GLN D 2 68  ? -8.900  8.335   -3.813  1.00 45.30 ? 69  GLN B N     1 
ATOM   2683 C CA    . GLN D 2 68  ? -7.754  7.458   -3.656  1.00 43.56 ? 69  GLN B CA    1 
ATOM   2684 C C     . GLN D 2 68  ? -7.680  6.180   -4.470  1.00 42.50 ? 69  GLN B C     1 
ATOM   2685 O O     . GLN D 2 68  ? -6.649  5.879   -5.078  1.00 43.70 ? 69  GLN B O     1 
ATOM   2686 C CB    . GLN D 2 68  ? -7.505  7.187   -2.172  1.00 45.80 ? 69  GLN B CB    1 
ATOM   2687 C CG    . GLN D 2 68  ? -6.887  8.375   -1.423  1.00 43.37 ? 69  GLN B CG    1 
ATOM   2688 C CD    . GLN D 2 68  ? -6.504  8.023   0.002   1.00 47.55 ? 69  GLN B CD    1 
ATOM   2689 O OE1   . GLN D 2 68  ? -5.570  7.235   0.238   1.00 44.26 ? 69  GLN B OE1   1 
ATOM   2690 N NE2   . GLN D 2 68  ? -7.227  8.591   0.968   1.00 47.71 ? 69  GLN B NE2   1 
ATOM   2691 N N     . ASN D 2 69  ? -8.754  5.413   -4.484  1.00 40.72 ? 70  ASN B N     1 
ATOM   2692 C CA    . ASN D 2 69  ? -8.742  4.176   -5.265  1.00 39.15 ? 70  ASN B CA    1 
ATOM   2693 C C     . ASN D 2 69  ? -9.128  4.433   -6.736  1.00 29.98 ? 70  ASN B C     1 
ATOM   2694 O O     . ASN D 2 69  ? -9.949  3.729   -7.307  1.00 28.25 ? 70  ASN B O     1 
ATOM   2695 C CB    . ASN D 2 69  ? -9.634  3.091   -4.608  1.00 46.68 ? 70  ASN B CB    1 
ATOM   2696 C CG    . ASN D 2 69  ? -10.954 3.640   -4.058  1.00 52.14 ? 70  ASN B CG    1 
ATOM   2697 O OD1   . ASN D 2 69  ? -11.443 4.706   -4.485  1.00 56.63 ? 70  ASN B OD1   1 
ATOM   2698 N ND2   . ASN D 2 69  ? -11.535 2.915   -3.104  1.00 51.26 ? 70  ASN B ND2   1 
ATOM   2699 N N     . HIS D 2 70  ? -8.498  5.440   -7.333  1.00 23.31 ? 71  HIS B N     1 
ATOM   2700 C CA    . HIS D 2 70  ? -8.749  5.853   -8.711  1.00 22.29 ? 71  HIS B CA    1 
ATOM   2701 C C     . HIS D 2 70  ? -7.544  5.845   -9.635  1.00 21.88 ? 71  HIS B C     1 
ATOM   2702 O O     . HIS D 2 70  ? -6.654  6.689   -9.531  1.00 19.32 ? 71  HIS B O     1 
ATOM   2703 C CB    . HIS D 2 70  ? -9.216  7.294   -8.758  1.00 25.08 ? 71  HIS B CB    1 
ATOM   2704 C CG    . HIS D 2 70  ? -10.686 7.467   -8.849  1.00 22.68 ? 71  HIS B CG    1 
ATOM   2705 N ND1   . HIS D 2 70  ? -11.552 6.998   -7.886  1.00 28.71 ? 71  HIS B ND1   1 
ATOM   2706 C CD2   . HIS D 2 70  ? -11.444 8.126   -9.753  1.00 26.86 ? 71  HIS B CD2   1 
ATOM   2707 C CE1   . HIS D 2 70  ? -12.783 7.366   -8.190  1.00 28.78 ? 71  HIS B CE1   1 
ATOM   2708 N NE2   . HIS D 2 70  ? -12.744 8.052   -9.319  1.00 30.24 ? 71  HIS B NE2   1 
ATOM   2709 N N     . TYR D 2 71  ? -7.640  5.003   -10.653 1.00 22.94 ? 72  TYR B N     1 
ATOM   2710 C CA    . TYR D 2 71  ? -6.643  4.893   -11.712 1.00 19.53 ? 72  TYR B CA    1 
ATOM   2711 C C     . TYR D 2 71  ? -6.855  6.151   -12.584 1.00 15.01 ? 72  TYR B C     1 
ATOM   2712 O O     . TYR D 2 71  ? -7.944  6.721   -12.621 1.00 13.42 ? 72  TYR B O     1 
ATOM   2713 C CB    . TYR D 2 71  ? -6.931  3.601   -12.518 1.00 18.95 ? 72  TYR B CB    1 
ATOM   2714 C CG    . TYR D 2 71  ? -6.182  3.447   -13.824 1.00 18.01 ? 72  TYR B CG    1 
ATOM   2715 C CD1   . TYR D 2 71  ? -6.668  4.005   -15.011 1.00 18.07 ? 72  TYR B CD1   1 
ATOM   2716 C CD2   . TYR D 2 71  ? -5.016  2.693   -13.886 1.00 16.59 ? 72  TYR B CD2   1 
ATOM   2717 C CE1   . TYR D 2 71  ? -5.997  3.803   -16.227 1.00 16.93 ? 72  TYR B CE1   1 
ATOM   2718 C CE2   . TYR D 2 71  ? -4.349  2.482   -15.087 1.00 16.56 ? 72  TYR B CE2   1 
ATOM   2719 C CZ    . TYR D 2 71  ? -4.836  3.031   -16.252 1.00 17.56 ? 72  TYR B CZ    1 
ATOM   2720 O OH    . TYR D 2 71  ? -4.173  2.765   -17.436 1.00 23.30 ? 72  TYR B OH    1 
ATOM   2721 N N     . PRO D 2 72  ? -5.795  6.669   -13.191 1.00 13.65 ? 73  PRO B N     1 
ATOM   2722 C CA    . PRO D 2 72  ? -4.418  6.179   -13.142 1.00 13.67 ? 73  PRO B CA    1 
ATOM   2723 C C     . PRO D 2 72  ? -3.644  7.172   -12.263 1.00 16.06 ? 73  PRO B C     1 
ATOM   2724 O O     . PRO D 2 72  ? -4.160  8.257   -11.933 1.00 11.60 ? 73  PRO B O     1 
ATOM   2725 C CB    . PRO D 2 72  ? -3.982  6.260   -14.605 1.00 8.40  ? 73  PRO B CB    1 
ATOM   2726 C CG    . PRO D 2 72  ? -4.719  7.525   -15.073 1.00 5.73  ? 73  PRO B CG    1 
ATOM   2727 C CD    . PRO D 2 72  ? -6.065  7.441   -14.430 1.00 6.89  ? 73  PRO B CD    1 
ATOM   2728 N N     . ASP D 2 73  ? -2.424  6.809   -11.885 1.00 14.23 ? 74  ASP B N     1 
ATOM   2729 C CA    . ASP D 2 73  ? -1.592  7.688   -11.072 1.00 17.57 ? 74  ASP B CA    1 
ATOM   2730 C C     . ASP D 2 73  ? -1.511  9.062   -11.690 1.00 19.71 ? 74  ASP B C     1 
ATOM   2731 O O     . ASP D 2 73  ? -1.619  10.066  -10.995 1.00 17.47 ? 74  ASP B O     1 
ATOM   2732 C CB    . ASP D 2 73  ? -0.181  7.129   -10.953 1.00 14.85 ? 74  ASP B CB    1 
ATOM   2733 C CG    . ASP D 2 73  ? -0.130  5.900   -10.107 1.00 17.51 ? 74  ASP B CG    1 
ATOM   2734 O OD1   . ASP D 2 73  ? -0.982  5.799   -9.196  1.00 16.92 ? 74  ASP B OD1   1 
ATOM   2735 O OD2   . ASP D 2 73  ? 0.764   5.051   -10.336 1.00 18.87 ? 74  ASP B OD2   1 
ATOM   2736 N N     . PHE D 2 74  ? -1.341  9.085   -13.014 1.00 21.57 ? 75  PHE B N     1 
ATOM   2737 C CA    . PHE D 2 74  ? -1.220  10.322  -13.783 1.00 19.15 ? 75  PHE B CA    1 
ATOM   2738 C C     . PHE D 2 74  ? -2.012  10.352  -15.087 1.00 16.95 ? 75  PHE B C     1 
ATOM   2739 O O     . PHE D 2 74  ? -1.975  9.397   -15.855 1.00 11.10 ? 75  PHE B O     1 
ATOM   2740 C CB    . PHE D 2 74  ? 0.251   10.567  -14.158 1.00 23.35 ? 75  PHE B CB    1 
ATOM   2741 C CG    . PHE D 2 74  ? 1.205   10.426  -13.021 1.00 22.92 ? 75  PHE B CG    1 
ATOM   2742 C CD1   . PHE D 2 74  ? 1.736   9.192   -12.708 1.00 22.55 ? 75  PHE B CD1   1 
ATOM   2743 C CD2   . PHE D 2 74  ? 1.540   11.526  -12.241 1.00 28.25 ? 75  PHE B CD2   1 
ATOM   2744 C CE1   . PHE D 2 74  ? 2.578   9.050   -11.641 1.00 22.33 ? 75  PHE B CE1   1 
ATOM   2745 C CE2   . PHE D 2 74  ? 2.382   11.395  -11.176 1.00 24.58 ? 75  PHE B CE2   1 
ATOM   2746 C CZ    . PHE D 2 74  ? 2.905   10.147  -10.875 1.00 27.54 ? 75  PHE B CZ    1 
ATOM   2747 N N     . THR D 2 75  ? -2.735  11.448  -15.296 1.00 19.66 ? 76  THR B N     1 
ATOM   2748 C CA    . THR D 2 75  ? -3.467  11.703  -16.536 1.00 22.63 ? 76  THR B CA    1 
ATOM   2749 C C     . THR D 2 75  ? -2.814  12.964  -17.174 1.00 24.32 ? 76  THR B C     1 
ATOM   2750 O O     . THR D 2 75  ? -2.748  14.034  -16.551 1.00 17.39 ? 76  THR B O     1 
ATOM   2751 C CB    . THR D 2 75  ? -4.994  11.992  -16.326 1.00 23.45 ? 76  THR B CB    1 
ATOM   2752 O OG1   . THR D 2 75  ? -5.612  10.888  -15.670 1.00 26.89 ? 76  THR B OG1   1 
ATOM   2753 C CG2   . THR D 2 75  ? -5.721  12.218  -17.675 1.00 18.29 ? 76  THR B CG2   1 
ATOM   2754 N N     . LEU D 2 76  ? -2.264  12.784  -18.381 1.00 27.57 ? 77  LEU B N     1 
ATOM   2755 C CA    . LEU D 2 76  ? -1.644  13.861  -19.174 1.00 26.28 ? 77  LEU B CA    1 
ATOM   2756 C C     . LEU D 2 76  ? -2.578  14.200  -20.342 1.00 26.49 ? 77  LEU B C     1 
ATOM   2757 O O     . LEU D 2 76  ? -3.337  13.334  -20.815 1.00 25.04 ? 77  LEU B O     1 
ATOM   2758 C CB    . LEU D 2 76  ? -0.296  13.408  -19.742 1.00 19.73 ? 77  LEU B CB    1 
ATOM   2759 C CG    . LEU D 2 76  ? 0.925   13.594  -18.851 1.00 22.65 ? 77  LEU B CG    1 
ATOM   2760 C CD1   . LEU D 2 76  ? 0.717   13.005  -17.458 1.00 23.45 ? 77  LEU B CD1   1 
ATOM   2761 C CD2   . LEU D 2 76  ? 2.115   12.963  -19.529 1.00 23.54 ? 77  LEU B CD2   1 
ATOM   2762 N N     . TYR D 2 77  ? -2.573  15.458  -20.771 1.00 30.97 ? 78  TYR B N     1 
ATOM   2763 C CA    . TYR D 2 77  ? -3.393  15.861  -21.914 1.00 37.01 ? 78  TYR B CA    1 
ATOM   2764 C C     . TYR D 2 77  ? -3.268  17.321  -22.333 1.00 39.27 ? 78  TYR B C     1 
ATOM   2765 O O     . TYR D 2 77  ? -2.989  18.200  -21.511 1.00 36.52 ? 78  TYR B O     1 
ATOM   2766 C CB    . TYR D 2 77  ? -4.880  15.490  -21.722 1.00 36.86 ? 78  TYR B CB    1 
ATOM   2767 C CG    . TYR D 2 77  ? -5.621  16.307  -20.688 1.00 35.78 ? 78  TYR B CG    1 
ATOM   2768 C CD1   . TYR D 2 77  ? -5.594  15.944  -19.352 1.00 37.06 ? 78  TYR B CD1   1 
ATOM   2769 C CD2   . TYR D 2 77  ? -6.377  17.422  -21.053 1.00 33.05 ? 78  TYR B CD2   1 
ATOM   2770 C CE1   . TYR D 2 77  ? -6.299  16.659  -18.402 1.00 38.38 ? 78  TYR B CE1   1 
ATOM   2771 C CE2   . TYR D 2 77  ? -7.089  18.150  -20.107 1.00 35.04 ? 78  TYR B CE2   1 
ATOM   2772 C CZ    . TYR D 2 77  ? -7.042  17.752  -18.781 1.00 37.05 ? 78  TYR B CZ    1 
ATOM   2773 O OH    . TYR D 2 77  ? -7.732  18.433  -17.815 1.00 41.20 ? 78  TYR B OH    1 
ATOM   2774 N N     . LYS D 2 78  ? -3.442  17.562  -23.633 1.00 41.98 ? 79  LYS B N     1 
ATOM   2775 C CA    . LYS D 2 78  ? -3.395  18.922  -24.163 1.00 44.15 ? 79  LYS B CA    1 
ATOM   2776 C C     . LYS D 2 78  ? -4.809  19.470  -23.936 1.00 44.32 ? 79  LYS B C     1 
ATOM   2777 O O     . LYS D 2 78  ? -5.803  18.803  -24.269 1.00 40.16 ? 79  LYS B O     1 
ATOM   2778 C CB    . LYS D 2 78  ? -3.023  18.921  -25.646 1.00 44.91 ? 79  LYS B CB    1 
ATOM   2779 C CG    . LYS D 2 78  ? -1.707  18.213  -25.959 1.00 49.68 ? 79  LYS B CG    1 
ATOM   2780 C CD    . LYS D 2 78  ? -1.111  18.719  -27.268 1.00 52.52 ? 79  LYS B CD    1 
ATOM   2781 C CE    . LYS D 2 78  ? -0.410  17.629  -28.069 1.00 53.84 ? 79  LYS B CE    1 
ATOM   2782 N NZ    . LYS D 2 78  ? -1.335  16.538  -28.538 1.00 55.34 ? 79  LYS B NZ    1 
ATOM   2783 N N     . PRO D 2 79  ? -4.921  20.669  -23.321 1.00 45.06 ? 80  PRO B N     1 
ATOM   2784 C CA    . PRO D 2 79  ? -6.253  21.240  -23.064 1.00 44.47 ? 80  PRO B CA    1 
ATOM   2785 C C     . PRO D 2 79  ? -7.113  21.329  -24.306 1.00 44.62 ? 80  PRO B C     1 
ATOM   2786 O O     . PRO D 2 79  ? -8.319  21.489  -24.224 1.00 48.31 ? 80  PRO B O     1 
ATOM   2787 C CB    . PRO D 2 79  ? -5.932  22.616  -22.478 1.00 42.67 ? 80  PRO B CB    1 
ATOM   2788 C CG    . PRO D 2 79  ? -4.659  22.349  -21.716 1.00 42.50 ? 80  PRO B CG    1 
ATOM   2789 C CD    . PRO D 2 79  ? -3.868  21.515  -22.721 1.00 42.24 ? 80  PRO B CD    1 
ATOM   2790 N N     . SER D 2 80  ? -6.478  21.212  -25.459 1.00 43.61 ? 81  SER B N     1 
ATOM   2791 C CA    . SER D 2 80  ? -7.171  21.264  -26.727 1.00 42.84 ? 81  SER B CA    1 
ATOM   2792 C C     . SER D 2 80  ? -7.924  19.948  -27.027 1.00 43.06 ? 81  SER B C     1 
ATOM   2793 O O     . SER D 2 80  ? -9.149  19.968  -27.258 1.00 45.84 ? 81  SER B O     1 
ATOM   2794 C CB    . SER D 2 80  ? -6.158  21.595  -27.835 1.00 43.61 ? 81  SER B CB    1 
ATOM   2795 O OG    . SER D 2 80  ? -4.816  21.587  -27.343 1.00 45.88 ? 81  SER B OG    1 
ATOM   2796 N N     . GLU D 2 81  ? -7.208  18.816  -26.964 1.00 39.95 ? 82  GLU B N     1 
ATOM   2797 C CA    . GLU D 2 81  ? -7.759  17.480  -27.254 1.00 37.22 ? 82  GLU B CA    1 
ATOM   2798 C C     . GLU D 2 81  ? -8.028  16.600  -26.019 1.00 37.33 ? 82  GLU B C     1 
ATOM   2799 O O     . GLU D 2 81  ? -7.294  15.649  -25.759 1.00 37.13 ? 82  GLU B O     1 
ATOM   2800 C CB    . GLU D 2 81  ? -6.822  16.738  -28.217 1.00 33.64 ? 82  GLU B CB    1 
ATOM   2801 N N     . PRO D 2 82  ? -9.140  16.855  -25.303 1.00 36.82 ? 83  PRO B N     1 
ATOM   2802 C CA    . PRO D 2 82  ? -9.598  16.158  -24.095 1.00 35.97 ? 83  PRO B CA    1 
ATOM   2803 C C     . PRO D 2 82  ? -10.054 14.713  -24.277 1.00 34.99 ? 83  PRO B C     1 
ATOM   2804 O O     . PRO D 2 82  ? -10.530 14.097  -23.321 1.00 34.11 ? 83  PRO B O     1 
ATOM   2805 C CB    . PRO D 2 82  ? -10.768 17.020  -23.642 1.00 38.73 ? 83  PRO B CB    1 
ATOM   2806 C CG    . PRO D 2 82  ? -11.369 17.429  -24.946 1.00 38.76 ? 83  PRO B CG    1 
ATOM   2807 C CD    . PRO D 2 82  ? -10.142 17.854  -25.720 1.00 36.38 ? 83  PRO B CD    1 
ATOM   2808 N N     . ASN D 2 83  ? -10.021 14.207  -25.501 1.00 32.26 ? 84  ASN B N     1 
ATOM   2809 C CA    . ASN D 2 83  ? -10.402 12.821  -25.731 1.00 30.77 ? 84  ASN B CA    1 
ATOM   2810 C C     . ASN D 2 83  ? -9.161  12.084  -26.217 1.00 29.06 ? 84  ASN B C     1 
ATOM   2811 O O     . ASN D 2 83  ? -9.230  11.003  -26.789 1.00 32.60 ? 84  ASN B O     1 
ATOM   2812 C CB    . ASN D 2 83  ? -11.560 12.719  -26.746 1.00 36.34 ? 84  ASN B CB    1 
ATOM   2813 N N     . LYS D 2 84  ? -8.011  12.706  -26.023 1.00 25.69 ? 85  LYS B N     1 
ATOM   2814 C CA    . LYS D 2 84  ? -6.772  12.081  -26.408 1.00 27.07 ? 85  LYS B CA    1 
ATOM   2815 C C     . LYS D 2 84  ? -5.934  11.934  -25.140 1.00 27.40 ? 85  LYS B C     1 
ATOM   2816 O O     . LYS D 2 84  ? -4.710  12.023  -25.168 1.00 30.32 ? 85  LYS B O     1 
ATOM   2817 C CB    . LYS D 2 84  ? -6.063  12.920  -27.435 1.00 28.50 ? 85  LYS B CB    1 
ATOM   2818 N N     . LYS D 2 85  ? -6.601  11.656  -24.031 1.00 26.32 ? 86  LYS B N     1 
ATOM   2819 C CA    . LYS D 2 85  ? -5.902  11.523  -22.761 1.00 25.10 ? 86  LYS B CA    1 
ATOM   2820 C C     . LYS D 2 85  ? -4.947  10.324  -22.679 1.00 22.34 ? 86  LYS B C     1 
ATOM   2821 O O     . LYS D 2 85  ? -5.105  9.328   -23.384 1.00 20.52 ? 86  LYS B O     1 
ATOM   2822 C CB    . LYS D 2 85  ? -6.910  11.514  -21.603 1.00 23.21 ? 86  LYS B CB    1 
ATOM   2823 C CG    . LYS D 2 85  ? -7.765  12.770  -21.503 1.00 20.26 ? 86  LYS B CG    1 
ATOM   2824 C CD    . LYS D 2 85  ? -8.407  12.824  -20.139 1.00 20.67 ? 86  LYS B CD    1 
ATOM   2825 C CE    . LYS D 2 85  ? -9.162  14.142  -19.885 1.00 22.94 ? 86  LYS B CE    1 
ATOM   2826 N NZ    . LYS D 2 85  ? -10.558 14.192  -20.375 1.00 15.95 ? 86  LYS B NZ    1 
ATOM   2827 N N     . ILE D 2 86  ? -3.903  10.473  -21.877 1.00 19.90 ? 87  ILE B N     1 
ATOM   2828 C CA    . ILE D 2 86  ? -2.939  9.410   -21.707 1.00 19.54 ? 87  ILE B CA    1 
ATOM   2829 C C     . ILE D 2 86  ? -2.901  9.045   -20.231 1.00 17.97 ? 87  ILE B C     1 
ATOM   2830 O O     . ILE D 2 86  ? -2.819  9.927   -19.352 1.00 14.07 ? 87  ILE B O     1 
ATOM   2831 C CB    . ILE D 2 86  ? -1.494  9.829   -22.144 1.00 23.95 ? 87  ILE B CB    1 
ATOM   2832 C CG1   . ILE D 2 86  ? -1.489  10.455  -23.554 1.00 19.66 ? 87  ILE B CG1   1 
ATOM   2833 C CG2   . ILE D 2 86  ? -0.543  8.598   -22.096 1.00 19.54 ? 87  ILE B CG2   1 
ATOM   2834 C CD1   . ILE D 2 86  ? -0.282  11.397  -23.804 1.00 17.42 ? 87  ILE B CD1   1 
ATOM   2835 N N     . ALA D 2 87  ? -2.989  7.740   -19.988 1.00 16.14 ? 88  ALA B N     1 
ATOM   2836 C CA    . ALA D 2 87  ? -2.938  7.170   -18.660 1.00 16.05 ? 88  ALA B CA    1 
ATOM   2837 C C     . ALA D 2 87  ? -1.544  6.608   -18.383 1.00 19.36 ? 88  ALA B C     1 
ATOM   2838 O O     . ALA D 2 87  ? -1.001  5.825   -19.184 1.00 14.14 ? 88  ALA B O     1 
ATOM   2839 C CB    . ALA D 2 87  ? -3.979  6.059   -18.512 1.00 15.70 ? 88  ALA B CB    1 
ATOM   2840 N N     . ILE D 2 88  ? -0.954  7.067   -17.272 1.00 20.22 ? 89  ILE B N     1 
ATOM   2841 C CA    . ILE D 2 88  ? 0.329   6.586   -16.811 1.00 18.70 ? 89  ILE B CA    1 
ATOM   2842 C C     . ILE D 2 88  ? 0.204   6.041   -15.389 1.00 19.35 ? 89  ILE B C     1 
ATOM   2843 O O     . ILE D 2 88  ? -0.365  6.682   -14.512 1.00 12.94 ? 89  ILE B O     1 
ATOM   2844 C CB    . ILE D 2 88  ? 1.393   7.640   -16.844 1.00 21.18 ? 89  ILE B CB    1 
ATOM   2845 C CG1   . ILE D 2 88  ? 1.420   8.291   -18.229 1.00 22.12 ? 89  ILE B CG1   1 
ATOM   2846 C CG2   . ILE D 2 88  ? 2.717   6.970   -16.570 1.00 16.68 ? 89  ILE B CG2   1 
ATOM   2847 C CD1   . ILE D 2 88  ? 2.560   9.242   -18.426 1.00 27.28 ? 89  ILE B CD1   1 
ATOM   2848 N N     . ASP D 2 89  ? 0.760   4.859   -15.174 1.00 18.55 ? 90  ASP B N     1 
ATOM   2849 C CA    . ASP D 2 89  ? 0.673   4.211   -13.887 1.00 23.42 ? 90  ASP B CA    1 
ATOM   2850 C C     . ASP D 2 89  ? 2.002   3.558   -13.542 1.00 20.78 ? 90  ASP B C     1 
ATOM   2851 O O     . ASP D 2 89  ? 2.595   2.847   -14.364 1.00 23.07 ? 90  ASP B O     1 
ATOM   2852 C CB    . ASP D 2 89  ? -0.436  3.155   -13.953 1.00 27.32 ? 90  ASP B CB    1 
ATOM   2853 C CG    . ASP D 2 89  ? -1.268  3.086   -12.687 1.00 23.61 ? 90  ASP B CG    1 
ATOM   2854 O OD1   . ASP D 2 89  ? -2.021  4.034   -12.373 1.00 28.07 ? 90  ASP B OD1   1 
ATOM   2855 O OD2   . ASP D 2 89  ? -1.239  2.022   -12.056 1.00 30.12 ? 90  ASP B OD2   1 
ATOM   2856 N N     . ILE D 2 90  ? 2.465   3.813   -12.330 1.00 18.50 ? 91  ILE B N     1 
ATOM   2857 C CA    . ILE D 2 90  ? 3.715   3.269   -11.852 1.00 17.34 ? 91  ILE B CA    1 
ATOM   2858 C C     . ILE D 2 90  ? 3.477   1.904   -11.160 1.00 13.30 ? 91  ILE B C     1 
ATOM   2859 O O     . ILE D 2 90  ? 2.647   1.778   -10.270 1.00 15.45 ? 91  ILE B O     1 
ATOM   2860 C CB    . ILE D 2 90  ? 4.403   4.279   -10.839 1.00 23.54 ? 91  ILE B CB    1 
ATOM   2861 C CG1   . ILE D 2 90  ? 4.326   5.722   -11.349 1.00 23.50 ? 91  ILE B CG1   1 
ATOM   2862 C CG2   . ILE D 2 90  ? 5.877   3.918   -10.601 1.00 22.17 ? 91  ILE B CG2   1 
ATOM   2863 C CD1   . ILE D 2 90  ? 4.932   5.943   -12.744 1.00 22.83 ? 91  ILE B CD1   1 
ATOM   2864 N N     . LYS D 2 91  ? 4.233   0.892   -11.564 1.00 10.13 ? 92  LYS B N     1 
ATOM   2865 C CA    . LYS D 2 91  ? 4.138   -0.430  -10.982 1.00 11.22 ? 92  LYS B CA    1 
ATOM   2866 C C     . LYS D 2 91  ? 5.556   -0.848  -10.571 1.00 13.91 ? 92  LYS B C     1 
ATOM   2867 O O     . LYS D 2 91  ? 6.547   -0.587  -11.282 1.00 15.73 ? 92  LYS B O     1 
ATOM   2868 C CB    . LYS D 2 91  ? 3.596   -1.456  -11.991 1.00 9.24  ? 92  LYS B CB    1 
ATOM   2869 C CG    . LYS D 2 91  ? 2.315   -1.107  -12.676 1.00 8.94  ? 92  LYS B CG    1 
ATOM   2870 C CD    . LYS D 2 91  ? 1.131   -1.208  -11.744 1.00 17.31 ? 92  LYS B CD    1 
ATOM   2871 C CE    . LYS D 2 91  ? -0.176  -0.946  -12.451 1.00 13.15 ? 92  LYS B CE    1 
ATOM   2872 N NZ    . LYS D 2 91  ? -1.337  -0.855  -11.532 1.00 20.90 ? 92  LYS B NZ    1 
ATOM   2873 N N     . THR D 2 92  ? 5.648   -1.552  -9.450  1.00 12.21 ? 93  THR B N     1 
ATOM   2874 C CA    . THR D 2 92  ? 6.932   -2.014  -8.932  1.00 14.00 ? 93  THR B CA    1 
ATOM   2875 C C     . THR D 2 92  ? 6.889   -3.511  -8.631  1.00 14.88 ? 93  THR B C     1 
ATOM   2876 O O     . THR D 2 92  ? 5.822   -4.088  -8.389  1.00 17.19 ? 93  THR B O     1 
ATOM   2877 C CB    . THR D 2 92  ? 7.254   -1.283  -7.607  1.00 17.18 ? 93  THR B CB    1 
ATOM   2878 O OG1   . THR D 2 92  ? 7.151   0.131   -7.812  1.00 22.71 ? 93  THR B OG1   1 
ATOM   2879 C CG2   . THR D 2 92  ? 8.665   -1.631  -7.097  1.00 19.14 ? 93  THR B CG2   1 
ATOM   2880 N N     . THR D 2 93  ? 8.051   -4.140  -8.701  1.00 16.98 ? 94  THR B N     1 
ATOM   2881 C CA    . THR D 2 93  ? 8.192   -5.546  -8.382  1.00 20.44 ? 94  THR B CA    1 
ATOM   2882 C C     . THR D 2 93  ? 9.641   -5.696  -7.897  1.00 21.35 ? 94  THR B C     1 
ATOM   2883 O O     . THR D 2 93  ? 10.420  -4.750  -7.993  1.00 23.36 ? 94  THR B O     1 
ATOM   2884 C CB    . THR D 2 93  ? 7.849   -6.480  -9.592  1.00 23.09 ? 94  THR B CB    1 
ATOM   2885 O OG1   . THR D 2 93  ? 7.615   -7.814  -9.116  1.00 24.84 ? 94  THR B OG1   1 
ATOM   2886 C CG2   . THR D 2 93  ? 8.974   -6.512  -10.621 1.00 20.02 ? 94  THR B CG2   1 
ATOM   2887 N N     . TYR D 2 94  ? 10.008  -6.875  -7.416  1.00 20.34 ? 95  TYR B N     1 
ATOM   2888 C CA    . TYR D 2 94  ? 11.335  -7.090  -6.908  1.00 22.12 ? 95  TYR B CA    1 
ATOM   2889 C C     . TYR D 2 94  ? 11.988  -8.315  -7.506  1.00 27.41 ? 95  TYR B C     1 
ATOM   2890 O O     . TYR D 2 94  ? 11.297  -9.207  -8.011  1.00 24.14 ? 95  TYR B O     1 
ATOM   2891 C CB    . TYR D 2 94  ? 11.231  -7.317  -5.400  1.00 29.90 ? 95  TYR B CB    1 
ATOM   2892 C CG    . TYR D 2 94  ? 10.692  -8.688  -5.006  1.00 29.79 ? 95  TYR B CG    1 
ATOM   2893 C CD1   . TYR D 2 94  ? 11.543  -9.804  -4.936  1.00 35.62 ? 95  TYR B CD1   1 
ATOM   2894 C CD2   . TYR D 2 94  ? 9.349   -8.876  -4.725  1.00 27.14 ? 95  TYR B CD2   1 
ATOM   2895 C CE1   . TYR D 2 94  ? 11.058  -11.067 -4.600  1.00 34.86 ? 95  TYR B CE1   1 
ATOM   2896 C CE2   . TYR D 2 94  ? 8.857   -10.135 -4.388  1.00 32.36 ? 95  TYR B CE2   1 
ATOM   2897 C CZ    . TYR D 2 94  ? 9.717   -11.222 -4.332  1.00 33.84 ? 95  TYR B CZ    1 
ATOM   2898 O OH    . TYR D 2 94  ? 9.242   -12.469 -4.022  1.00 37.53 ? 95  TYR B OH    1 
ATOM   2899 N N     . THR D 2 95  ? 13.300  -8.407  -7.301  1.00 31.55 ? 96  THR B N     1 
ATOM   2900 C CA    . THR D 2 95  ? 14.124  -9.539  -7.714  1.00 39.22 ? 96  THR B CA    1 
ATOM   2901 C C     . THR D 2 95  ? 15.017  -9.835  -6.511  1.00 40.13 ? 96  THR B C     1 
ATOM   2902 O O     . THR D 2 95  ? 15.532  -8.917  -5.874  1.00 36.49 ? 96  THR B O     1 
ATOM   2903 C CB    . THR D 2 95  ? 15.046  -9.229  -8.916  1.00 43.79 ? 96  THR B CB    1 
ATOM   2904 O OG1   . THR D 2 95  ? 15.592  -7.909  -8.791  1.00 47.91 ? 96  THR B OG1   1 
ATOM   2905 C CG2   . THR D 2 95  ? 14.311  -9.424  -10.254 1.00 47.45 ? 96  THR B CG2   1 
ATOM   2906 N N     . ASN D 2 96  ? 15.227  -11.120 -6.232  1.00 44.15 ? 97  ASN B N     1 
ATOM   2907 C CA    . ASN D 2 96  ? 16.038  -11.564 -5.085  1.00 44.65 ? 97  ASN B CA    1 
ATOM   2908 C C     . ASN D 2 96  ? 17.534  -11.208 -5.093  1.00 43.03 ? 97  ASN B C     1 
ATOM   2909 O O     . ASN D 2 96  ? 18.183  -11.177 -4.037  1.00 41.27 ? 97  ASN B O     1 
ATOM   2910 C CB    . ASN D 2 96  ? 15.853  -13.070 -4.867  1.00 42.81 ? 97  ASN B CB    1 
ATOM   2911 N N     . LYS D 2 101 ? 13.221  -13.835 -14.097 1.00 27.96 ? 102 LYS B N     1 
ATOM   2912 C CA    . LYS D 2 101 ? 11.815  -13.698 -14.456 1.00 29.84 ? 102 LYS B CA    1 
ATOM   2913 C C     . LYS D 2 101 ? 11.043  -12.959 -13.374 1.00 29.49 ? 102 LYS B C     1 
ATOM   2914 O O     . LYS D 2 101 ? 11.263  -13.166 -12.185 1.00 33.02 ? 102 LYS B O     1 
ATOM   2915 C CB    . LYS D 2 101 ? 11.196  -15.059 -14.707 1.00 31.06 ? 102 LYS B CB    1 
ATOM   2916 N N     . ILE D 2 102 ? 10.150  -12.077 -13.798 1.00 29.93 ? 103 ILE B N     1 
ATOM   2917 C CA    . ILE D 2 102 ? 9.335   -11.278 -12.878 1.00 27.41 ? 103 ILE B CA    1 
ATOM   2918 C C     . ILE D 2 102 ? 7.943   -11.149 -13.468 1.00 23.00 ? 103 ILE B C     1 
ATOM   2919 O O     . ILE D 2 102 ? 7.731   -11.444 -14.652 1.00 16.76 ? 103 ILE B O     1 
ATOM   2920 C CB    . ILE D 2 102 ? 9.890   -9.810  -12.719 1.00 29.26 ? 103 ILE B CB    1 
ATOM   2921 C CG1   . ILE D 2 102 ? 10.106  -9.183  -14.116 1.00 29.76 ? 103 ILE B CG1   1 
ATOM   2922 C CG2   . ILE D 2 102 ? 11.163  -9.804  -11.885 1.00 31.35 ? 103 ILE B CG2   1 
ATOM   2923 C CD1   . ILE D 2 102 ? 10.622  -7.795  -14.122 1.00 27.08 ? 103 ILE B CD1   1 
ATOM   2924 N N     . LYS D 2 103 ? 7.016   -10.697 -12.628 1.00 21.83 ? 104 LYS B N     1 
ATOM   2925 C CA    . LYS D 2 103 ? 5.626   -10.442 -13.010 1.00 23.88 ? 104 LYS B CA    1 
ATOM   2926 C C     . LYS D 2 103 ? 5.091   -9.241  -12.241 1.00 20.05 ? 104 LYS B C     1 
ATOM   2927 O O     . LYS D 2 103 ? 5.547   -8.947  -11.123 1.00 18.13 ? 104 LYS B O     1 
ATOM   2928 C CB    . LYS D 2 103 ? 4.697   -11.666 -12.831 1.00 21.80 ? 104 LYS B CB    1 
ATOM   2929 C CG    . LYS D 2 103 ? 4.855   -12.437 -11.548 1.00 28.25 ? 104 LYS B CG    1 
ATOM   2930 C CD    . LYS D 2 103 ? 3.826   -13.542 -11.484 1.00 31.03 ? 104 LYS B CD    1 
ATOM   2931 C CE    . LYS D 2 103 ? 4.351   -14.782 -10.753 1.00 34.64 ? 104 LYS B CE    1 
ATOM   2932 N NZ    . LYS D 2 103 ? 4.559   -14.669 -9.290  1.00 36.44 ? 104 LYS B NZ    1 
ATOM   2933 N N     . PHE D 2 104 ? 4.201   -8.495  -12.894 1.00 18.77 ? 105 PHE B N     1 
ATOM   2934 C CA    . PHE D 2 104 ? 3.593   -7.320  -12.297 1.00 13.09 ? 105 PHE B CA    1 
ATOM   2935 C C     . PHE D 2 104 ? 2.123   -7.559  -12.245 1.00 13.17 ? 105 PHE B C     1 
ATOM   2936 O O     . PHE D 2 104 ? 1.602   -8.416  -12.940 1.00 17.35 ? 105 PHE B O     1 
ATOM   2937 C CB    . PHE D 2 104 ? 3.770   -6.095  -13.180 1.00 9.84  ? 105 PHE B CB    1 
ATOM   2938 C CG    . PHE D 2 104 ? 5.166   -5.671  -13.351 1.00 13.11 ? 105 PHE B CG    1 
ATOM   2939 C CD1   . PHE D 2 104 ? 5.967   -6.273  -14.307 1.00 15.32 ? 105 PHE B CD1   1 
ATOM   2940 C CD2   . PHE D 2 104 ? 5.709   -4.702  -12.523 1.00 13.31 ? 105 PHE B CD2   1 
ATOM   2941 C CE1   . PHE D 2 104 ? 7.301   -5.921  -14.442 1.00 18.74 ? 105 PHE B CE1   1 
ATOM   2942 C CE2   . PHE D 2 104 ? 7.039   -4.341  -12.646 1.00 16.97 ? 105 PHE B CE2   1 
ATOM   2943 C CZ    . PHE D 2 104 ? 7.839   -4.955  -13.605 1.00 20.57 ? 105 PHE B CZ    1 
ATOM   2944 N N     . THR D 2 105 ? 1.455   -6.755  -11.439 1.00 16.27 ? 106 THR B N     1 
ATOM   2945 C CA    . THR D 2 105 ? 0.024   -6.772  -11.361 1.00 14.65 ? 106 THR B CA    1 
ATOM   2946 C C     . THR D 2 105 ? -0.242  -5.569  -12.242 1.00 13.43 ? 106 THR B C     1 
ATOM   2947 O O     . THR D 2 105 ? 0.407   -4.547  -12.094 1.00 15.58 ? 106 THR B O     1 
ATOM   2948 C CB    . THR D 2 105 ? -0.478  -6.514  -9.940  1.00 18.67 ? 106 THR B CB    1 
ATOM   2949 O OG1   . THR D 2 105 ? 0.282   -5.449  -9.327  1.00 19.77 ? 106 THR B OG1   1 
ATOM   2950 C CG2   . THR D 2 105 ? -0.428  -7.830  -9.116  1.00 19.01 ? 106 THR B CG2   1 
ATOM   2951 N N     . LEU D 2 106 ? -1.204  -5.672  -13.145 1.00 14.87 ? 107 LEU B N     1 
ATOM   2952 C CA    . LEU D 2 106 ? -1.487  -4.580  -14.069 1.00 12.49 ? 107 LEU B CA    1 
ATOM   2953 C C     . LEU D 2 106 ? -2.839  -3.925  -13.932 1.00 13.18 ? 107 LEU B C     1 
ATOM   2954 O O     . LEU D 2 106 ? -3.305  -3.314  -14.870 1.00 14.43 ? 107 LEU B O     1 
ATOM   2955 C CB    . LEU D 2 106 ? -1.319  -5.052  -15.497 1.00 12.50 ? 107 LEU B CB    1 
ATOM   2956 C CG    . LEU D 2 106 ? 0.089   -5.535  -15.827 1.00 10.85 ? 107 LEU B CG    1 
ATOM   2957 C CD1   . LEU D 2 106 ? 0.116   -6.116  -17.257 1.00 9.79  ? 107 LEU B CD1   1 
ATOM   2958 C CD2   . LEU D 2 106 ? 1.022   -4.348  -15.694 1.00 8.70  ? 107 LEU B CD2   1 
ATOM   2959 N N     . GLY D 2 107 ? -3.486  -4.067  -12.781 1.00 15.74 ? 108 GLY B N     1 
ATOM   2960 C CA    . GLY D 2 107 ? -4.764  -3.404  -12.575 1.00 14.68 ? 108 GLY B CA    1 
ATOM   2961 C C     . GLY D 2 107 ? -5.919  -4.371  -12.551 1.00 14.12 ? 108 GLY B C     1 
ATOM   2962 O O     . GLY D 2 107 ? -5.798  -5.471  -13.071 1.00 11.67 ? 108 GLY B O     1 
ATOM   2963 N N     . GLY D 2 108 ? -7.051  -3.918  -12.029 1.00 9.88  ? 109 GLY B N     1 
ATOM   2964 C CA    . GLY D 2 108 ? -8.206  -4.765  -11.925 1.00 13.44 ? 109 GLY B CA    1 
ATOM   2965 C C     . GLY D 2 108 ? -8.776  -5.065  -13.288 1.00 19.04 ? 109 GLY B C     1 
ATOM   2966 O O     . GLY D 2 108 ? -8.604  -4.270  -14.225 1.00 22.61 ? 109 GLY B O     1 
ATOM   2967 N N     . TYR D 2 109 ? -9.442  -6.206  -13.415 1.00 13.96 ? 110 TYR B N     1 
ATOM   2968 C CA    . TYR D 2 109 ? -10.048 -6.562  -14.689 1.00 15.34 ? 110 TYR B CA    1 
ATOM   2969 C C     . TYR D 2 109 ? -11.567 -6.546  -14.569 1.00 14.94 ? 110 TYR B C     1 
ATOM   2970 O O     . TYR D 2 109 ? -12.291 -6.877  -15.508 1.00 14.91 ? 110 TYR B O     1 
ATOM   2971 C CB    . TYR D 2 109 ? -9.492  -7.886  -15.220 1.00 12.99 ? 110 TYR B CB    1 
ATOM   2972 C CG    . TYR D 2 109 ? -9.750  -9.105  -14.365 1.00 12.35 ? 110 TYR B CG    1 
ATOM   2973 C CD1   . TYR D 2 109 ? -11.039 -9.608  -14.216 1.00 13.40 ? 110 TYR B CD1   1 
ATOM   2974 C CD2   . TYR D 2 109 ? -8.713  -9.744  -13.704 1.00 10.80 ? 110 TYR B CD2   1 
ATOM   2975 C CE1   . TYR D 2 109 ? -11.291 -10.719 -13.422 1.00 17.30 ? 110 TYR B CE1   1 
ATOM   2976 C CE2   . TYR D 2 109 ? -8.950  -10.861 -12.897 1.00 16.59 ? 110 TYR B CE2   1 
ATOM   2977 C CZ    . TYR D 2 109 ? -10.246 -11.340 -12.766 1.00 20.09 ? 110 TYR B CZ    1 
ATOM   2978 O OH    . TYR D 2 109 ? -10.528 -12.439 -11.994 1.00 23.58 ? 110 TYR B OH    1 
ATOM   2979 N N     . THR D 2 110 ? -12.055 -6.030  -13.446 1.00 11.30 ? 111 THR B N     1 
ATOM   2980 C CA    . THR D 2 110 ? -13.487 -5.957  -13.252 1.00 13.89 ? 111 THR B CA    1 
ATOM   2981 C C     . THR D 2 110 ? -13.973 -4.509  -13.131 1.00 19.66 ? 111 THR B C     1 
ATOM   2982 O O     . THR D 2 110 ? -15.179 -4.266  -13.130 1.00 24.60 ? 111 THR B O     1 
ATOM   2983 C CB    . THR D 2 110 ? -13.901 -6.763  -12.020 1.00 15.67 ? 111 THR B CB    1 
ATOM   2984 O OG1   . THR D 2 110 ? -13.301 -6.180  -10.864 1.00 19.78 ? 111 THR B OG1   1 
ATOM   2985 C CG2   . THR D 2 110 ? -13.395 -8.211  -12.130 1.00 14.38 ? 111 THR B CG2   1 
ATOM   2986 N N     . SER D 2 111 ? -13.044 -3.546  -13.037 1.00 20.65 ? 112 SER B N     1 
ATOM   2987 C CA    . SER D 2 111 ? -13.408 -2.127  -12.916 1.00 20.14 ? 112 SER B CA    1 
ATOM   2988 C C     . SER D 2 111 ? -13.580 -1.380  -14.267 1.00 22.08 ? 112 SER B C     1 
ATOM   2989 O O     . SER D 2 111 ? -14.346 -1.818  -15.137 1.00 15.12 ? 112 SER B O     1 
ATOM   2990 C CB    . SER D 2 111 ? -12.426 -1.390  -11.989 1.00 18.11 ? 112 SER B CB    1 
ATOM   2991 O OG    . SER D 2 111 ? -11.106 -1.436  -12.512 1.00 20.53 ? 112 SER B OG    1 
ATOM   2992 N N     . PHE D 2 112 ? -12.887 -0.250  -14.417 1.00 20.78 ? 113 PHE B N     1 
ATOM   2993 C CA    . PHE D 2 112 ? -12.950 0.564   -15.627 1.00 22.08 ? 113 PHE B CA    1 
ATOM   2994 C C     . PHE D 2 112 ? -12.871 -0.177  -16.991 1.00 21.36 ? 113 PHE B C     1 
ATOM   2995 O O     . PHE D 2 112 ? -13.384 0.325   -17.993 1.00 16.55 ? 113 PHE B O     1 
ATOM   2996 C CB    . PHE D 2 112 ? -11.926 1.729   -15.570 1.00 17.11 ? 113 PHE B CB    1 
ATOM   2997 C CG    . PHE D 2 112 ? -10.498 1.297   -15.315 1.00 15.67 ? 113 PHE B CG    1 
ATOM   2998 C CD1   . PHE D 2 112 ? -9.698  0.825   -16.350 1.00 10.30 ? 113 PHE B CD1   1 
ATOM   2999 C CD2   . PHE D 2 112 ? -9.978  1.309   -14.027 1.00 16.38 ? 113 PHE B CD2   1 
ATOM   3000 C CE1   . PHE D 2 112 ? -8.409  0.354   -16.110 1.00 16.85 ? 113 PHE B CE1   1 
ATOM   3001 C CE2   . PHE D 2 112 ? -8.688  0.842   -13.777 1.00 17.86 ? 113 PHE B CE2   1 
ATOM   3002 C CZ    . PHE D 2 112 ? -7.906  0.360   -14.817 1.00 21.26 ? 113 PHE B CZ    1 
ATOM   3003 N N     . ILE D 2 113 ? -12.262 -1.358  -17.044 1.00 20.99 ? 114 ILE B N     1 
ATOM   3004 C CA    . ILE D 2 113 ? -12.193 -2.042  -18.334 1.00 24.57 ? 114 ILE B CA    1 
ATOM   3005 C C     . ILE D 2 113 ? -13.536 -2.698  -18.702 1.00 29.01 ? 114 ILE B C     1 
ATOM   3006 O O     . ILE D 2 113 ? -13.782 -3.054  -19.867 1.00 27.07 ? 114 ILE B O     1 
ATOM   3007 C CB    . ILE D 2 113 ? -11.048 -3.085  -18.421 1.00 24.12 ? 114 ILE B CB    1 
ATOM   3008 C CG1   . ILE D 2 113 ? -11.409 -4.337  -17.638 1.00 21.71 ? 114 ILE B CG1   1 
ATOM   3009 C CG2   . ILE D 2 113 ? -9.704  -2.468  -17.995 1.00 17.21 ? 114 ILE B CG2   1 
ATOM   3010 C CD1   . ILE D 2 113 ? -10.672 -5.544  -18.123 1.00 21.06 ? 114 ILE B CD1   1 
ATOM   3011 N N     . ARG D 2 114 ? -14.397 -2.869  -17.700 1.00 28.55 ? 115 ARG B N     1 
ATOM   3012 C CA    . ARG D 2 114 ? -15.720 -3.434  -17.922 1.00 26.31 ? 115 ARG B CA    1 
ATOM   3013 C C     . ARG D 2 114 ? -16.771 -2.333  -17.729 1.00 26.75 ? 115 ARG B C     1 
ATOM   3014 O O     . ARG D 2 114 ? -17.840 -2.383  -18.339 1.00 28.14 ? 115 ARG B O     1 
ATOM   3015 C CB    . ARG D 2 114 ? -15.946 -4.640  -17.003 1.00 23.57 ? 115 ARG B CB    1 
ATOM   3016 C CG    . ARG D 2 114 ? -14.923 -5.746  -17.250 1.00 16.84 ? 115 ARG B CG    1 
ATOM   3017 C CD    . ARG D 2 114 ? -15.303 -7.022  -16.574 1.00 12.04 ? 115 ARG B CD    1 
ATOM   3018 N NE    . ARG D 2 114 ? -14.261 -8.044  -16.699 1.00 12.46 ? 115 ARG B NE    1 
ATOM   3019 C CZ    . ARG D 2 114 ? -14.458 -9.331  -16.425 1.00 15.81 ? 115 ARG B CZ    1 
ATOM   3020 N NH1   . ARG D 2 114 ? -15.661 -9.745  -16.016 1.00 16.94 ? 115 ARG B NH1   1 
ATOM   3021 N NH2   . ARG D 2 114 ? -13.449 -10.193 -16.498 1.00 15.71 ? 115 ARG B NH2   1 
ATOM   3022 N N     . ASN D 2 115 ? -16.434 -1.306  -16.937 1.00 29.43 ? 116 ASN B N     1 
ATOM   3023 C CA    . ASN D 2 115 ? -17.339 -0.171  -16.687 1.00 31.41 ? 116 ASN B CA    1 
ATOM   3024 C C     . ASN D 2 115 ? -16.635 1.159   -16.892 1.00 31.87 ? 116 ASN B C     1 
ATOM   3025 O O     . ASN D 2 115 ? -16.044 1.696   -15.947 1.00 36.83 ? 116 ASN B O     1 
ATOM   3026 C CB    . ASN D 2 115 ? -17.899 -0.190  -15.266 1.00 31.35 ? 116 ASN B CB    1 
ATOM   3027 C CG    . ASN D 2 115 ? -18.835 0.966   -15.002 1.00 33.42 ? 116 ASN B CG    1 
ATOM   3028 O OD1   . ASN D 2 115 ? -19.255 1.184   -13.874 1.00 41.78 ? 116 ASN B OD1   1 
ATOM   3029 N ND2   . ASN D 2 115 ? -19.192 1.700   -16.045 1.00 35.52 ? 116 ASN B ND2   1 
ATOM   3030 N N     . ASN D 2 116 ? -16.842 1.749   -18.066 1.00 27.99 ? 117 ASN B N     1 
ATOM   3031 C CA    . ASN D 2 116 ? -16.220 3.023   -18.483 1.00 26.93 ? 117 ASN B CA    1 
ATOM   3032 C C     . ASN D 2 116 ? -15.849 4.130   -17.456 1.00 25.67 ? 117 ASN B C     1 
ATOM   3033 O O     . ASN D 2 116 ? -14.789 4.729   -17.550 1.00 22.34 ? 117 ASN B O     1 
ATOM   3034 C CB    . ASN D 2 116 ? -17.034 3.607   -19.648 1.00 32.67 ? 117 ASN B CB    1 
ATOM   3035 C CG    . ASN D 2 116 ? -16.345 4.768   -20.347 1.00 37.10 ? 117 ASN B CG    1 
ATOM   3036 O OD1   . ASN D 2 116 ? -15.303 4.604   -20.993 1.00 40.03 ? 117 ASN B OD1   1 
ATOM   3037 N ND2   . ASN D 2 116 ? -16.949 5.944   -20.255 1.00 37.99 ? 117 ASN B ND2   1 
ATOM   3038 N N     . THR D 2 117 ? -16.689 4.375   -16.462 1.00 24.65 ? 118 THR B N     1 
ATOM   3039 C CA    . THR D 2 117 ? -16.407 5.414   -15.484 1.00 26.67 ? 118 THR B CA    1 
ATOM   3040 C C     . THR D 2 117 ? -16.135 4.920   -14.047 1.00 24.71 ? 118 THR B C     1 
ATOM   3041 O O     . THR D 2 117 ? -16.059 5.725   -13.136 1.00 25.10 ? 118 THR B O     1 
ATOM   3042 C CB    . THR D 2 117 ? -17.573 6.440   -15.445 1.00 26.76 ? 118 THR B CB    1 
ATOM   3043 O OG1   . THR D 2 117 ? -18.790 5.752   -15.175 1.00 32.04 ? 118 THR B OG1   1 
ATOM   3044 C CG2   . THR D 2 117 ? -17.730 7.152   -16.759 1.00 26.46 ? 118 THR B CG2   1 
ATOM   3045 N N     . LYS D 2 118 ? -15.937 3.618   -13.863 1.00 23.58 ? 119 LYS B N     1 
ATOM   3046 C CA    . LYS D 2 118 ? -15.704 3.019   -12.542 1.00 21.49 ? 119 LYS B CA    1 
ATOM   3047 C C     . LYS D 2 118 ? -14.266 3.092   -12.100 1.00 22.46 ? 119 LYS B C     1 
ATOM   3048 O O     . LYS D 2 118 ? -13.408 2.574   -12.821 1.00 25.89 ? 119 LYS B O     1 
ATOM   3049 C CB    . LYS D 2 118 ? -16.124 1.570   -12.562 1.00 22.29 ? 119 LYS B CB    1 
ATOM   3050 N N     . ASN D 2 119 ? -14.026 3.646   -10.897 1.00 18.08 ? 120 ASN B N     1 
ATOM   3051 C CA    . ASN D 2 119 ? -12.684 3.811   -10.276 1.00 20.35 ? 120 ASN B CA    1 
ATOM   3052 C C     . ASN D 2 119 ? -11.609 4.351   -11.194 1.00 19.69 ? 120 ASN B C     1 
ATOM   3053 O O     . ASN D 2 119 ? -10.505 3.798   -11.243 1.00 18.02 ? 120 ASN B O     1 
ATOM   3054 C CB    . ASN D 2 119 ? -12.160 2.498   -9.677  1.00 20.59 ? 120 ASN B CB    1 
ATOM   3055 C CG    . ASN D 2 119 ? -12.922 2.088   -8.446  1.00 27.67 ? 120 ASN B CG    1 
ATOM   3056 O OD1   . ASN D 2 119 ? -14.032 1.572   -8.551  1.00 30.88 ? 120 ASN B OD1   1 
ATOM   3057 N ND2   . ASN D 2 119 ? -12.366 2.358   -7.270  1.00 24.95 ? 120 ASN B ND2   1 
ATOM   3058 N N     . ILE D 2 120 ? -11.933 5.416   -11.923 1.00 17.53 ? 121 ILE B N     1 
ATOM   3059 C CA    . ILE D 2 120 ? -10.999 6.002   -12.886 1.00 18.98 ? 121 ILE B CA    1 
ATOM   3060 C C     . ILE D 2 120 ? -11.233 7.497   -12.898 1.00 14.54 ? 121 ILE B C     1 
ATOM   3061 O O     . ILE D 2 120 ? -12.337 7.956   -12.659 1.00 13.74 ? 121 ILE B O     1 
ATOM   3062 C CB    . ILE D 2 120 ? -11.085 5.289   -14.328 1.00 16.24 ? 121 ILE B CB    1 
ATOM   3063 C CG1   . ILE D 2 120 ? -10.128 5.915   -15.352 1.00 17.88 ? 121 ILE B CG1   1 
ATOM   3064 C CG2   . ILE D 2 120 ? -12.502 5.272   -14.865 1.00 17.26 ? 121 ILE B CG2   1 
ATOM   3065 C CD1   . ILE D 2 120 ? -9.966  5.065   -16.654 1.00 13.69 ? 121 ILE B CD1   1 
ATOM   3066 N N     . VAL D 2 121 ? -10.164 8.257   -13.081 1.00 18.60 ? 122 VAL B N     1 
ATOM   3067 C CA    . VAL D 2 121 ? -10.262 9.713   -13.038 1.00 25.23 ? 122 VAL B CA    1 
ATOM   3068 C C     . VAL D 2 121 ? -11.108 10.289  -14.161 1.00 22.97 ? 122 VAL B C     1 
ATOM   3069 O O     . VAL D 2 121 ? -11.883 11.229  -13.935 1.00 24.12 ? 122 VAL B O     1 
ATOM   3070 C CB    . VAL D 2 121 ? -8.839  10.405  -12.907 1.00 27.56 ? 122 VAL B CB    1 
ATOM   3071 C CG1   . VAL D 2 121 ? -8.973  11.917  -12.674 1.00 26.13 ? 122 VAL B CG1   1 
ATOM   3072 C CG2   . VAL D 2 121 ? -8.066  9.801   -11.721 1.00 27.36 ? 122 VAL B CG2   1 
ATOM   3073 N N     . TYR D 2 122 ? -10.968 9.732   -15.357 1.00 21.06 ? 123 TYR B N     1 
ATOM   3074 C CA    . TYR D 2 122 ? -11.762 10.182  -16.505 1.00 24.87 ? 123 TYR B CA    1 
ATOM   3075 C C     . TYR D 2 122 ? -12.400 8.964   -17.131 1.00 22.16 ? 123 TYR B C     1 
ATOM   3076 O O     . TYR D 2 122 ? -11.961 7.854   -16.868 1.00 25.10 ? 123 TYR B O     1 
ATOM   3077 C CB    . TYR D 2 122 ? -10.892 10.915  -17.526 1.00 20.80 ? 123 TYR B CB    1 
ATOM   3078 C CG    . TYR D 2 122 ? -10.658 12.360  -17.135 1.00 25.44 ? 123 TYR B CG    1 
ATOM   3079 C CD1   . TYR D 2 122 ? -11.613 13.331  -17.422 1.00 24.01 ? 123 TYR B CD1   1 
ATOM   3080 C CD2   . TYR D 2 122 ? -9.507  12.755  -16.426 1.00 25.68 ? 123 TYR B CD2   1 
ATOM   3081 C CE1   . TYR D 2 122 ? -11.443 14.653  -17.016 1.00 24.03 ? 123 TYR B CE1   1 
ATOM   3082 C CE2   . TYR D 2 122 ? -9.343  14.085  -16.012 1.00 24.89 ? 123 TYR B CE2   1 
ATOM   3083 C CZ    . TYR D 2 122 ? -10.326 15.021  -16.316 1.00 22.80 ? 123 TYR B CZ    1 
ATOM   3084 O OH    . TYR D 2 122 ? -10.228 16.332  -15.927 1.00 26.50 ? 123 TYR B OH    1 
ATOM   3085 N N     . PRO D 2 123 ? -13.506 9.143   -17.879 1.00 22.73 ? 124 PRO B N     1 
ATOM   3086 C CA    . PRO D 2 123 ? -14.144 7.971   -18.505 1.00 19.33 ? 124 PRO B CA    1 
ATOM   3087 C C     . PRO D 2 123 ? -13.125 7.238   -19.367 1.00 18.31 ? 124 PRO B C     1 
ATOM   3088 O O     . PRO D 2 123 ? -12.305 7.867   -20.057 1.00 20.01 ? 124 PRO B O     1 
ATOM   3089 C CB    . PRO D 2 123 ? -15.244 8.593   -19.328 1.00 21.46 ? 124 PRO B CB    1 
ATOM   3090 C CG    . PRO D 2 123 ? -15.668 9.765   -18.430 1.00 24.57 ? 124 PRO B CG    1 
ATOM   3091 C CD    . PRO D 2 123 ? -14.361 10.344  -17.980 1.00 22.15 ? 124 PRO B CD    1 
ATOM   3092 N N     . PHE D 2 124 ? -13.110 5.921   -19.254 1.00 16.62 ? 125 PHE B N     1 
ATOM   3093 C CA    . PHE D 2 124 ? -12.153 5.089   -19.970 1.00 20.64 ? 125 PHE B CA    1 
ATOM   3094 C C     . PHE D 2 124 ? -12.052 5.376   -21.477 1.00 20.52 ? 125 PHE B C     1 
ATOM   3095 O O     . PHE D 2 124 ? -10.972 5.259   -22.075 1.00 15.62 ? 125 PHE B O     1 
ATOM   3096 C CB    . PHE D 2 124 ? -12.509 3.624   -19.743 1.00 20.09 ? 125 PHE B CB    1 
ATOM   3097 C CG    . PHE D 2 124 ? -11.454 2.650   -20.200 1.00 16.86 ? 125 PHE B CG    1 
ATOM   3098 C CD1   . PHE D 2 124 ? -10.271 2.510   -19.491 1.00 14.47 ? 125 PHE B CD1   1 
ATOM   3099 C CD2   . PHE D 2 124 ? -11.691 1.829   -21.292 1.00 20.09 ? 125 PHE B CD2   1 
ATOM   3100 C CE1   . PHE D 2 124 ? -9.340  1.566   -19.850 1.00 22.35 ? 125 PHE B CE1   1 
ATOM   3101 C CE2   . PHE D 2 124 ? -10.772 0.873   -21.670 1.00 23.29 ? 125 PHE B CE2   1 
ATOM   3102 C CZ    . PHE D 2 124 ? -9.588  0.735   -20.949 1.00 24.98 ? 125 PHE B CZ    1 
ATOM   3103 N N     . ASP D 2 125 ? -13.174 5.781   -22.060 1.00 22.49 ? 126 ASP B N     1 
ATOM   3104 C CA    . ASP D 2 125 ? -13.244 6.093   -23.482 1.00 26.63 ? 126 ASP B CA    1 
ATOM   3105 C C     . ASP D 2 125 ? -12.414 7.343   -23.869 1.00 27.91 ? 126 ASP B C     1 
ATOM   3106 O O     . ASP D 2 125 ? -12.093 7.527   -25.049 1.00 29.39 ? 126 ASP B O     1 
ATOM   3107 C CB    . ASP D 2 125 ? -14.713 6.241   -23.905 1.00 22.91 ? 126 ASP B CB    1 
ATOM   3108 C CG    . ASP D 2 125 ? -15.430 7.354   -23.149 1.00 25.20 ? 126 ASP B CG    1 
ATOM   3109 O OD1   . ASP D 2 125 ? -14.890 8.455   -23.062 1.00 34.14 ? 126 ASP B OD1   1 
ATOM   3110 O OD2   . ASP D 2 125 ? -16.538 7.162   -22.635 1.00 29.21 ? 126 ASP B OD2   1 
ATOM   3111 N N     . GLN D 2 126 ? -12.063 8.191   -22.894 1.00 25.86 ? 127 GLN B N     1 
ATOM   3112 C CA    . GLN D 2 126 ? -11.280 9.395   -23.181 1.00 24.69 ? 127 GLN B CA    1 
ATOM   3113 C C     . GLN D 2 126 ? -9.769  9.218   -23.198 1.00 25.51 ? 127 GLN B C     1 
ATOM   3114 O O     . GLN D 2 126 ? -9.053  10.182  -23.489 1.00 25.39 ? 127 GLN B O     1 
ATOM   3115 C CB    . GLN D 2 126 ? -11.641 10.530  -22.236 1.00 26.23 ? 127 GLN B CB    1 
ATOM   3116 C CG    . GLN D 2 126 ? -13.122 10.846  -22.233 1.00 24.89 ? 127 GLN B CG    1 
ATOM   3117 C CD    . GLN D 2 126 ? -13.477 12.031  -21.375 1.00 28.62 ? 127 GLN B CD    1 
ATOM   3118 O OE1   . GLN D 2 126 ? -12.834 12.315  -20.346 1.00 27.04 ? 127 GLN B OE1   1 
ATOM   3119 N NE2   . GLN D 2 126 ? -14.511 12.754  -21.794 1.00 34.95 ? 127 GLN B NE2   1 
ATOM   3120 N N     . TYR D 2 127 ? -9.293  8.006   -22.888 1.00 24.69 ? 128 TYR B N     1 
ATOM   3121 C CA    . TYR D 2 127 ? -7.855  7.683   -22.882 1.00 25.79 ? 128 TYR B CA    1 
ATOM   3122 C C     . TYR D 2 127 ? -7.487  6.928   -24.142 1.00 24.63 ? 128 TYR B C     1 
ATOM   3123 O O     . TYR D 2 127 ? -8.106  5.915   -24.472 1.00 25.02 ? 128 TYR B O     1 
ATOM   3124 C CB    . TYR D 2 127 ? -7.438  6.814   -21.681 1.00 22.15 ? 128 TYR B CB    1 
ATOM   3125 C CG    . TYR D 2 127 ? -7.570  7.490   -20.346 1.00 17.16 ? 128 TYR B CG    1 
ATOM   3126 C CD1   . TYR D 2 127 ? -8.794  7.522   -19.688 1.00 12.76 ? 128 TYR B CD1   1 
ATOM   3127 C CD2   . TYR D 2 127 ? -6.481  8.101   -19.749 1.00 18.40 ? 128 TYR B CD2   1 
ATOM   3128 C CE1   . TYR D 2 127 ? -8.937  8.144   -18.475 1.00 16.58 ? 128 TYR B CE1   1 
ATOM   3129 C CE2   . TYR D 2 127 ? -6.609  8.735   -18.505 1.00 18.23 ? 128 TYR B CE2   1 
ATOM   3130 C CZ    . TYR D 2 127 ? -7.839  8.753   -17.876 1.00 18.15 ? 128 TYR B CZ    1 
ATOM   3131 O OH    . TYR D 2 127 ? -7.988  9.392   -16.654 1.00 24.65 ? 128 TYR B OH    1 
ATOM   3132 N N     . ILE D 2 128 ? -6.396  7.364   -24.755 1.00 24.73 ? 129 ILE B N     1 
ATOM   3133 C CA    . ILE D 2 128 ? -5.906  6.799   -25.989 1.00 26.06 ? 129 ILE B CA    1 
ATOM   3134 C C     . ILE D 2 128 ? -4.677  5.917   -25.811 1.00 24.54 ? 129 ILE B C     1 
ATOM   3135 O O     . ILE D 2 128 ? -4.296  5.195   -26.741 1.00 25.25 ? 129 ILE B O     1 
ATOM   3136 C CB    . ILE D 2 128 ? -5.635  7.928   -27.019 1.00 31.96 ? 129 ILE B CB    1 
ATOM   3137 C CG1   . ILE D 2 128 ? -4.566  8.899   -26.494 1.00 28.10 ? 129 ILE B CG1   1 
ATOM   3138 C CG2   . ILE D 2 128 ? -6.939  8.690   -27.284 1.00 29.76 ? 129 ILE B CG2   1 
ATOM   3139 C CD1   . ILE D 2 128 ? -3.858  9.637   -27.579 1.00 29.65 ? 129 ILE B CD1   1 
ATOM   3140 N N     . ALA D 2 129 ? -4.038  6.001   -24.641 1.00 21.77 ? 130 ALA B N     1 
ATOM   3141 C CA    . ALA D 2 129 ? -2.858  5.176   -24.322 1.00 18.71 ? 130 ALA B CA    1 
ATOM   3142 C C     . ALA D 2 129 ? -2.808  4.918   -22.837 1.00 19.46 ? 130 ALA B C     1 
ATOM   3143 O O     . ALA D 2 129 ? -3.214  5.779   -22.038 1.00 15.60 ? 130 ALA B O     1 
ATOM   3144 C CB    . ALA D 2 129 ? -1.565  5.834   -24.761 1.00 18.30 ? 130 ALA B CB    1 
ATOM   3145 N N     . HIS D 2 130 ? -2.400  3.701   -22.475 1.00 19.80 ? 131 HIS B N     1 
ATOM   3146 C CA    . HIS D 2 130 ? -2.282  3.299   -21.062 1.00 18.08 ? 131 HIS B CA    1 
ATOM   3147 C C     . HIS D 2 130 ? -0.882  2.773   -20.927 1.00 18.19 ? 131 HIS B C     1 
ATOM   3148 O O     . HIS D 2 130 ? -0.583  1.655   -21.329 1.00 22.61 ? 131 HIS B O     1 
ATOM   3149 C CB    . HIS D 2 130 ? -3.313  2.229   -20.652 1.00 11.72 ? 131 HIS B CB    1 
ATOM   3150 C CG    . HIS D 2 130 ? -4.743  2.672   -20.796 1.00 11.02 ? 131 HIS B CG    1 
ATOM   3151 N ND1   . HIS D 2 130 ? -5.422  3.338   -19.795 1.00 11.70 ? 131 HIS B ND1   1 
ATOM   3152 C CD2   . HIS D 2 130 ? -5.603  2.592   -21.843 1.00 7.52  ? 131 HIS B CD2   1 
ATOM   3153 C CE1   . HIS D 2 130 ? -6.636  3.656   -20.221 1.00 11.90 ? 131 HIS B CE1   1 
ATOM   3154 N NE2   . HIS D 2 130 ? -6.773  3.213   -21.459 1.00 12.76 ? 131 HIS B NE2   1 
ATOM   3155 N N     . TRP D 2 131 ? 0.005   3.657   -20.488 1.00 22.75 ? 132 TRP B N     1 
ATOM   3156 C CA    . TRP D 2 131 ? 1.403   3.325   -20.308 1.00 24.16 ? 132 TRP B CA    1 
ATOM   3157 C C     . TRP D 2 131 ? 1.627   2.824   -18.882 1.00 21.57 ? 132 TRP B C     1 
ATOM   3158 O O     . TRP D 2 131 ? 0.885   3.174   -17.968 1.00 21.09 ? 132 TRP B O     1 
ATOM   3159 C CB    . TRP D 2 131 ? 2.284   4.560   -20.593 1.00 26.39 ? 132 TRP B CB    1 
ATOM   3160 C CG    . TRP D 2 131 ? 2.174   5.066   -22.013 1.00 27.14 ? 132 TRP B CG    1 
ATOM   3161 C CD1   . TRP D 2 131 ? 1.585   4.421   -23.071 1.00 24.24 ? 132 TRP B CD1   1 
ATOM   3162 C CD2   . TRP D 2 131 ? 2.645   6.330   -22.522 1.00 28.66 ? 132 TRP B CD2   1 
ATOM   3163 N NE1   . TRP D 2 131 ? 1.648   5.210   -24.196 1.00 25.58 ? 132 TRP B NE1   1 
ATOM   3164 C CE2   . TRP D 2 131 ? 2.290   6.384   -23.897 1.00 26.02 ? 132 TRP B CE2   1 
ATOM   3165 C CE3   . TRP D 2 131 ? 3.325   7.426   -21.950 1.00 27.35 ? 132 TRP B CE3   1 
ATOM   3166 C CZ2   . TRP D 2 131 ? 2.585   7.495   -24.717 1.00 24.42 ? 132 TRP B CZ2   1 
ATOM   3167 C CZ3   . TRP D 2 131 ? 3.618   8.531   -22.770 1.00 29.50 ? 132 TRP B CZ3   1 
ATOM   3168 C CH2   . TRP D 2 131 ? 3.241   8.553   -24.145 1.00 21.18 ? 132 TRP B CH2   1 
ATOM   3169 N N     . ILE D 2 132 ? 2.635   1.977   -18.730 1.00 17.19 ? 133 ILE B N     1 
ATOM   3170 C CA    . ILE D 2 132 ? 3.011   1.390   -17.467 1.00 16.02 ? 133 ILE B CA    1 
ATOM   3171 C C     . ILE D 2 132 ? 4.484   1.738   -17.271 1.00 15.17 ? 133 ILE B C     1 
ATOM   3172 O O     . ILE D 2 132 ? 5.295   1.486   -18.151 1.00 11.77 ? 133 ILE B O     1 
ATOM   3173 C CB    . ILE D 2 132 ? 2.872   -0.188  -17.515 1.00 17.91 ? 133 ILE B CB    1 
ATOM   3174 C CG1   . ILE D 2 132 ? 1.408   -0.634  -17.413 1.00 12.28 ? 133 ILE B CG1   1 
ATOM   3175 C CG2   . ILE D 2 132 ? 3.770   -0.874  -16.463 1.00 15.70 ? 133 ILE B CG2   1 
ATOM   3176 C CD1   . ILE D 2 132 ? 0.565   0.123   -16.393 1.00 21.34 ? 133 ILE B CD1   1 
ATOM   3177 N N     . ILE D 2 133 ? 4.815   2.422   -16.182 1.00 14.65 ? 134 ILE B N     1 
ATOM   3178 C CA    . ILE D 2 133 ? 6.220   2.683   -15.899 1.00 13.03 ? 134 ILE B CA    1 
ATOM   3179 C C     . ILE D 2 133 ? 6.535   1.689   -14.817 1.00 13.68 ? 134 ILE B C     1 
ATOM   3180 O O     . ILE D 2 133 ? 5.953   1.726   -13.741 1.00 12.80 ? 134 ILE B O     1 
ATOM   3181 C CB    . ILE D 2 133 ? 6.533   4.138   -15.455 1.00 18.22 ? 134 ILE B CB    1 
ATOM   3182 C CG1   . ILE D 2 133 ? 6.406   5.086   -16.664 1.00 10.66 ? 134 ILE B CG1   1 
ATOM   3183 C CG2   . ILE D 2 133 ? 7.962   4.205   -14.851 1.00 17.30 ? 134 ILE B CG2   1 
ATOM   3184 C CD1   . ILE D 2 133 ? 6.518   6.555   -16.335 1.00 15.32 ? 134 ILE B CD1   1 
ATOM   3185 N N     . GLY D 2 134 ? 7.354   0.712   -15.178 1.00 14.65 ? 135 GLY B N     1 
ATOM   3186 C CA    . GLY D 2 134 ? 7.731   -0.335  -14.256 1.00 18.15 ? 135 GLY B CA    1 
ATOM   3187 C C     . GLY D 2 134 ? 9.099   -0.164  -13.616 1.00 21.21 ? 135 GLY B C     1 
ATOM   3188 O O     . GLY D 2 134 ? 10.055  0.354   -14.215 1.00 18.80 ? 135 GLY B O     1 
ATOM   3189 N N     . TYR D 2 135 ? 9.184   -0.556  -12.355 1.00 19.94 ? 136 TYR B N     1 
ATOM   3190 C CA    . TYR D 2 135 ? 10.440  -0.461  -11.660 1.00 16.62 ? 136 TYR B CA    1 
ATOM   3191 C C     . TYR D 2 135 ? 10.665  -1.844  -11.162 1.00 13.66 ? 136 TYR B C     1 
ATOM   3192 O O     . TYR D 2 135 ? 9.717   -2.513  -10.769 1.00 15.48 ? 136 TYR B O     1 
ATOM   3193 C CB    . TYR D 2 135 ? 10.345  0.527   -10.502 1.00 21.78 ? 136 TYR B CB    1 
ATOM   3194 C CG    . TYR D 2 135 ? 10.395  1.995   -10.903 1.00 20.98 ? 136 TYR B CG    1 
ATOM   3195 C CD1   . TYR D 2 135 ? 11.614  2.646   -11.023 1.00 20.52 ? 136 TYR B CD1   1 
ATOM   3196 C CD2   . TYR D 2 135 ? 9.222   2.741   -11.088 1.00 16.38 ? 136 TYR B CD2   1 
ATOM   3197 C CE1   . TYR D 2 135 ? 11.671  4.004   -11.305 1.00 24.66 ? 136 TYR B CE1   1 
ATOM   3198 C CE2   . TYR D 2 135 ? 9.264   4.094   -11.373 1.00 18.53 ? 136 TYR B CE2   1 
ATOM   3199 C CZ    . TYR D 2 135 ? 10.495  4.723   -11.478 1.00 22.93 ? 136 TYR B CZ    1 
ATOM   3200 O OH    . TYR D 2 135 ? 10.597  6.060   -11.755 1.00 22.38 ? 136 TYR B OH    1 
ATOM   3201 N N     . VAL D 2 136 ? 11.903  -2.300  -11.271 1.00 15.94 ? 137 VAL B N     1 
ATOM   3202 C CA    . VAL D 2 136 ? 12.293  -3.628  -10.815 1.00 18.53 ? 137 VAL B CA    1 
ATOM   3203 C C     . VAL D 2 136 ? 13.483  -3.391  -9.907  1.00 19.23 ? 137 VAL B C     1 
ATOM   3204 O O     . VAL D 2 136 ? 14.434  -2.733  -10.298 1.00 19.27 ? 137 VAL B O     1 
ATOM   3205 C CB    . VAL D 2 136 ? 12.794  -4.532  -11.980 1.00 20.23 ? 137 VAL B CB    1 
ATOM   3206 C CG1   . VAL D 2 136 ? 13.122  -5.921  -11.458 1.00 20.12 ? 137 VAL B CG1   1 
ATOM   3207 C CG2   . VAL D 2 136 ? 11.790  -4.568  -13.133 1.00 22.08 ? 137 VAL B CG2   1 
ATOM   3208 N N     . TYR D 2 137 ? 13.429  -3.885  -8.690  1.00 20.80 ? 138 TYR B N     1 
ATOM   3209 C CA    . TYR D 2 137 ? 14.563  -3.703  -7.797  1.00 28.48 ? 138 TYR B CA    1 
ATOM   3210 C C     . TYR D 2 137 ? 14.980  -5.068  -7.252  1.00 28.20 ? 138 TYR B C     1 
ATOM   3211 O O     . TYR D 2 137 ? 14.182  -6.015  -7.231  1.00 25.86 ? 138 TYR B O     1 
ATOM   3212 C CB    . TYR D 2 137 ? 14.242  -2.723  -6.635  1.00 27.57 ? 138 TYR B CB    1 
ATOM   3213 C CG    . TYR D 2 137 ? 13.298  -3.290  -5.577  1.00 30.00 ? 138 TYR B CG    1 
ATOM   3214 C CD1   . TYR D 2 137 ? 11.898  -3.217  -5.737  1.00 29.14 ? 138 TYR B CD1   1 
ATOM   3215 C CD2   . TYR D 2 137 ? 13.798  -3.925  -4.439  1.00 24.51 ? 138 TYR B CD2   1 
ATOM   3216 C CE1   . TYR D 2 137 ? 11.036  -3.760  -4.794  1.00 26.85 ? 138 TYR B CE1   1 
ATOM   3217 C CE2   . TYR D 2 137 ? 12.941  -4.477  -3.501  1.00 25.57 ? 138 TYR B CE2   1 
ATOM   3218 C CZ    . TYR D 2 137 ? 11.569  -4.386  -3.686  1.00 28.10 ? 138 TYR B CZ    1 
ATOM   3219 O OH    . TYR D 2 137 ? 10.729  -4.917  -2.743  1.00 35.04 ? 138 TYR B OH    1 
ATOM   3220 N N     . THR D 2 138 ? 16.254  -5.170  -6.890  1.00 32.39 ? 139 THR B N     1 
ATOM   3221 C CA    . THR D 2 138 ? 16.808  -6.377  -6.288  1.00 35.07 ? 139 THR B CA    1 
ATOM   3222 C C     . THR D 2 138 ? 16.873  -6.006  -4.807  1.00 34.78 ? 139 THR B C     1 
ATOM   3223 O O     . THR D 2 138 ? 17.474  -4.983  -4.454  1.00 32.76 ? 139 THR B O     1 
ATOM   3224 C CB    . THR D 2 138 ? 18.227  -6.657  -6.800  1.00 33.23 ? 139 THR B CB    1 
ATOM   3225 O OG1   . THR D 2 138 ? 18.496  -5.817  -7.928  1.00 39.30 ? 139 THR B OG1   1 
ATOM   3226 C CG2   . THR D 2 138 ? 18.356  -8.103  -7.213  1.00 34.87 ? 139 THR B CG2   1 
ATOM   3227 N N     . ARG D 2 139 ? 16.192  -6.771  -3.961  1.00 33.74 ? 140 ARG B N     1 
ATOM   3228 C CA    . ARG D 2 139 ? 16.188  -6.487  -2.537  1.00 36.72 ? 140 ARG B CA    1 
ATOM   3229 C C     . ARG D 2 139 ? 17.429  -7.090  -1.904  1.00 38.78 ? 140 ARG B C     1 
ATOM   3230 O O     . ARG D 2 139 ? 17.753  -8.250  -2.165  1.00 40.57 ? 140 ARG B O     1 
ATOM   3231 C CB    . ARG D 2 139 ? 14.942  -7.056  -1.906  1.00 39.11 ? 140 ARG B CB    1 
ATOM   3232 N N     . VAL D 2 140 ? 18.133  -6.306  -1.084  1.00 41.84 ? 141 VAL B N     1 
ATOM   3233 C CA    . VAL D 2 140 ? 19.350  -6.794  -0.422  1.00 41.94 ? 141 VAL B CA    1 
ATOM   3234 C C     . VAL D 2 140 ? 19.076  -8.037  0.436   1.00 44.60 ? 141 VAL B C     1 
ATOM   3235 O O     . VAL D 2 140 ? 19.957  -8.881  0.648   1.00 47.06 ? 141 VAL B O     1 
ATOM   3236 C CB    . VAL D 2 140 ? 20.042  -5.700  0.453   1.00 37.97 ? 141 VAL B CB    1 
ATOM   3237 C CG1   . VAL D 2 140 ? 20.607  -4.620  -0.415  1.00 37.21 ? 141 VAL B CG1   1 
ATOM   3238 C CG2   . VAL D 2 140 ? 19.078  -5.112  1.470   1.00 41.43 ? 141 VAL B CG2   1 
ATOM   3239 N N     . SER D 2 146 ? 18.134  0.628   8.710   1.00 39.16 ? 147 SER B N     1 
ATOM   3240 C CA    . SER D 2 146 ? 18.704  1.133   9.959   1.00 40.52 ? 147 SER B CA    1 
ATOM   3241 C C     . SER D 2 146 ? 17.648  1.797   10.828  1.00 40.63 ? 147 SER B C     1 
ATOM   3242 O O     . SER D 2 146 ? 16.867  2.638   10.365  1.00 39.47 ? 147 SER B O     1 
ATOM   3243 C CB    . SER D 2 146 ? 19.838  2.115   9.691   1.00 39.01 ? 147 SER B CB    1 
ATOM   3244 O OG    . SER D 2 146 ? 20.514  2.420   10.887  1.00 40.25 ? 147 SER B OG    1 
ATOM   3245 N N     . LEU D 2 147 ? 17.635  1.410   12.096  1.00 40.40 ? 148 LEU B N     1 
ATOM   3246 C CA    . LEU D 2 147 ? 16.661  1.939   13.031  1.00 40.71 ? 148 LEU B CA    1 
ATOM   3247 C C     . LEU D 2 147 ? 17.217  3.112   13.853  1.00 39.86 ? 148 LEU B C     1 
ATOM   3248 O O     . LEU D 2 147 ? 16.865  3.318   15.012  1.00 36.86 ? 148 LEU B O     1 
ATOM   3249 C CB    . LEU D 2 147 ? 16.080  0.800   13.892  1.00 40.19 ? 148 LEU B CB    1 
ATOM   3250 C CG    . LEU D 2 147 ? 15.184  -0.248  13.165  1.00 39.63 ? 148 LEU B CG    1 
ATOM   3251 C CD1   . LEU D 2 147 ? 15.984  -1.517  12.893  1.00 35.05 ? 148 LEU B CD1   1 
ATOM   3252 C CD2   . LEU D 2 147 ? 13.909  -0.590  13.976  1.00 28.94 ? 148 LEU B CD2   1 
ATOM   3253 N N     . LYS D 2 148 ? 18.078  3.881   13.190  1.00 41.56 ? 149 LYS B N     1 
ATOM   3254 C CA    . LYS D 2 148 ? 18.737  5.085   13.716  1.00 40.62 ? 149 LYS B CA    1 
ATOM   3255 C C     . LYS D 2 148 ? 18.363  6.201   12.720  1.00 40.65 ? 149 LYS B C     1 
ATOM   3256 O O     . LYS D 2 148 ? 17.861  5.905   11.629  1.00 41.45 ? 149 LYS B O     1 
ATOM   3257 C CB    . LYS D 2 148 ? 20.267  4.891   13.720  1.00 40.76 ? 149 LYS B CB    1 
ATOM   3258 C CG    . LYS D 2 148 ? 21.089  6.098   14.178  1.00 43.74 ? 149 LYS B CG    1 
ATOM   3259 C CD    . LYS D 2 148 ? 22.526  5.718   14.573  1.00 43.50 ? 149 LYS B CD    1 
ATOM   3260 C CE    . LYS D 2 148 ? 23.481  5.646   13.385  1.00 46.02 ? 149 LYS B CE    1 
ATOM   3261 N NZ    . LYS D 2 148 ? 24.814  5.065   13.771  1.00 42.71 ? 149 LYS B NZ    1 
ATOM   3262 N N     . THR D 2 149 ? 18.523  7.462   13.121  1.00 38.78 ? 150 THR B N     1 
ATOM   3263 C CA    . THR D 2 149 ? 18.246  8.599   12.245  1.00 33.41 ? 150 THR B CA    1 
ATOM   3264 C C     . THR D 2 149 ? 19.610  9.112   11.826  1.00 29.85 ? 150 THR B C     1 
ATOM   3265 O O     . THR D 2 149 ? 20.622  8.666   12.356  1.00 28.73 ? 150 THR B O     1 
ATOM   3266 C CB    . THR D 2 149 ? 17.440  9.707   12.955  1.00 34.35 ? 150 THR B CB    1 
ATOM   3267 O OG1   . THR D 2 149 ? 17.904  9.851   14.305  1.00 41.24 ? 150 THR B OG1   1 
ATOM   3268 C CG2   . THR D 2 149 ? 15.964  9.360   12.971  1.00 30.05 ? 150 THR B CG2   1 
ATOM   3269 N N     . TYR D 2 150 ? 19.655  9.985   10.830  1.00 30.01 ? 151 TYR B N     1 
ATOM   3270 C CA    . TYR D 2 150 ? 20.931  10.511  10.353  1.00 28.27 ? 151 TYR B CA    1 
ATOM   3271 C C     . TYR D 2 150 ? 20.751  11.960  9.996   1.00 31.47 ? 151 TYR B C     1 
ATOM   3272 O O     . TYR D 2 150 ? 19.627  12.475  10.055  1.00 25.87 ? 151 TYR B O     1 
ATOM   3273 C CB    . TYR D 2 150 ? 21.404  9.771   9.104   1.00 31.80 ? 151 TYR B CB    1 
ATOM   3274 C CG    . TYR D 2 150 ? 21.620  8.284   9.272   1.00 30.91 ? 151 TYR B CG    1 
ATOM   3275 C CD1   . TYR D 2 150 ? 20.545  7.400   9.277   1.00 31.94 ? 151 TYR B CD1   1 
ATOM   3276 C CD2   . TYR D 2 150 ? 22.903  7.758   9.377   1.00 29.16 ? 151 TYR B CD2   1 
ATOM   3277 C CE1   . TYR D 2 150 ? 20.742  6.019   9.379   1.00 33.78 ? 151 TYR B CE1   1 
ATOM   3278 C CE2   . TYR D 2 150 ? 23.109  6.383   9.477   1.00 33.63 ? 151 TYR B CE2   1 
ATOM   3279 C CZ    . TYR D 2 150 ? 22.021  5.515   9.475   1.00 32.80 ? 151 TYR B CZ    1 
ATOM   3280 O OH    . TYR D 2 150 ? 22.217  4.150   9.550   1.00 27.44 ? 151 TYR B OH    1 
ATOM   3281 N N     . ASN D 2 151 ? 21.856  12.597  9.599   1.00 37.81 ? 152 ASN B N     1 
ATOM   3282 C CA    . ASN D 2 151 ? 21.891  14.015  9.225   1.00 42.66 ? 152 ASN B CA    1 
ATOM   3283 C C     . ASN D 2 151 ? 22.453  14.228  7.818   1.00 46.47 ? 152 ASN B C     1 
ATOM   3284 O O     . ASN D 2 151 ? 23.145  13.359  7.266   1.00 46.87 ? 152 ASN B O     1 
ATOM   3285 C CB    . ASN D 2 151 ? 22.731  14.816  10.232  1.00 42.28 ? 152 ASN B CB    1 
ATOM   3286 N N     . ILE D 2 152 ? 22.127  15.387  7.239   1.00 50.99 ? 153 ILE B N     1 
ATOM   3287 C CA    . ILE D 2 152 ? 22.576  15.775  5.891   1.00 52.78 ? 153 ILE B CA    1 
ATOM   3288 C C     . ILE D 2 152 ? 24.080  16.022  5.885   1.00 53.75 ? 153 ILE B C     1 
ATOM   3289 O O     . ILE D 2 152 ? 24.539  17.141  6.169   1.00 58.39 ? 153 ILE B O     1 
ATOM   3290 C CB    . ILE D 2 152 ? 21.906  17.087  5.408   1.00 53.18 ? 153 ILE B CB    1 
ATOM   3291 C CG1   . ILE D 2 152 ? 20.404  17.060  5.688   1.00 50.87 ? 153 ILE B CG1   1 
ATOM   3292 C CG2   . ILE D 2 152 ? 22.197  17.309  3.915   1.00 53.04 ? 153 ILE B CG2   1 
ATOM   3293 C CD1   . ILE D 2 152 ? 19.798  18.433  5.687   1.00 49.05 ? 153 ILE B CD1   1 
ATOM   3294 N N     . ASN D 2 153 ? 24.818  14.977  5.533   1.00 50.55 ? 154 ASN B N     1 
ATOM   3295 C CA    . ASN D 2 153 ? 26.283  14.955  5.460   1.00 49.48 ? 154 ASN B CA    1 
ATOM   3296 C C     . ASN D 2 153 ? 26.653  13.544  5.879   1.00 49.58 ? 154 ASN B C     1 
ATOM   3297 O O     . ASN D 2 153 ? 27.820  13.157  5.839   1.00 48.55 ? 154 ASN B O     1 
ATOM   3298 C CB    . ASN D 2 153 ? 26.930  15.970  6.402   1.00 49.22 ? 154 ASN B CB    1 
ATOM   3299 N N     . GLU D 2 154 ? 25.635  12.808  6.328   1.00 49.23 ? 155 GLU B N     1 
ATOM   3300 C CA    . GLU D 2 154 ? 25.759  11.414  6.741   1.00 50.36 ? 155 GLU B CA    1 
ATOM   3301 C C     . GLU D 2 154 ? 25.170  10.495  5.661   1.00 49.19 ? 155 GLU B C     1 
ATOM   3302 O O     . GLU D 2 154 ? 25.276  9.270   5.749   1.00 45.79 ? 155 GLU B O     1 
ATOM   3303 C CB    . GLU D 2 154 ? 24.982  11.173  8.027   1.00 51.15 ? 155 GLU B CB    1 
ATOM   3304 C CG    . GLU D 2 154 ? 25.536  11.835  9.251   1.00 52.90 ? 155 GLU B CG    1 
ATOM   3305 C CD    . GLU D 2 154 ? 24.670  11.564  10.451  1.00 55.31 ? 155 GLU B CD    1 
ATOM   3306 O OE1   . GLU D 2 154 ? 24.196  10.419  10.590  1.00 55.68 ? 155 GLU B OE1   1 
ATOM   3307 O OE2   . GLU D 2 154 ? 24.423  12.505  11.236  1.00 60.77 ? 155 GLU B OE2   1 
ATOM   3308 N N     . LEU D 2 155 ? 24.550  11.105  4.651   1.00 47.52 ? 156 LEU B N     1 
ATOM   3309 C CA    . LEU D 2 155 ? 23.910  10.389  3.554   1.00 46.07 ? 156 LEU B CA    1 
ATOM   3310 C C     . LEU D 2 155 ? 24.706  9.230   3.012   1.00 47.12 ? 156 LEU B C     1 
ATOM   3311 O O     . LEU D 2 155 ? 24.136  8.265   2.497   1.00 45.85 ? 156 LEU B O     1 
ATOM   3312 C CB    . LEU D 2 155 ? 23.583  11.346  2.425   1.00 43.95 ? 156 LEU B CB    1 
ATOM   3313 C CG    . LEU D 2 155 ? 22.150  11.838  2.517   1.00 44.22 ? 156 LEU B CG    1 
ATOM   3314 C CD1   . LEU D 2 155 ? 22.108  13.348  2.703   1.00 47.49 ? 156 LEU B CD1   1 
ATOM   3315 C CD2   . LEU D 2 155 ? 21.432  11.403  1.259   1.00 44.72 ? 156 LEU B CD2   1 
ATOM   3316 N N     . ASN D 2 156 ? 26.020  9.328   3.153   1.00 47.15 ? 157 ASN B N     1 
ATOM   3317 C CA    . ASN D 2 156 ? 26.953  8.307   2.694   1.00 51.78 ? 157 ASN B CA    1 
ATOM   3318 C C     . ASN D 2 156 ? 27.114  7.069   3.608   1.00 51.50 ? 157 ASN B C     1 
ATOM   3319 O O     . ASN D 2 156 ? 27.836  6.126   3.258   1.00 51.96 ? 157 ASN B O     1 
ATOM   3320 C CB    . ASN D 2 156 ? 28.317  8.952   2.437   1.00 55.77 ? 157 ASN B CB    1 
ATOM   3321 C CG    . ASN D 2 156 ? 28.648  10.033  3.449   1.00 58.32 ? 157 ASN B CG    1 
ATOM   3322 O OD1   . ASN D 2 156 ? 27.916  11.017  3.565   1.00 58.68 ? 157 ASN B OD1   1 
ATOM   3323 N ND2   . ASN D 2 156 ? 29.747  9.861   4.181   1.00 58.83 ? 157 ASN B ND2   1 
ATOM   3324 N N     . GLU D 2 157 ? 26.442  7.066   4.761   1.00 49.30 ? 158 GLU B N     1 
ATOM   3325 C CA    . GLU D 2 157 ? 26.511  5.952   5.716   1.00 46.13 ? 158 GLU B CA    1 
ATOM   3326 C C     . GLU D 2 157 ? 25.181  5.177   5.856   1.00 43.24 ? 158 GLU B C     1 
ATOM   3327 O O     . GLU D 2 157 ? 25.120  4.145   6.519   1.00 40.99 ? 158 GLU B O     1 
ATOM   3328 C CB    . GLU D 2 157 ? 26.942  6.486   7.088   1.00 43.66 ? 158 GLU B CB    1 
ATOM   3329 N N     . ILE D 2 158 ? 24.121  5.687   5.234   1.00 42.01 ? 159 ILE B N     1 
ATOM   3330 C CA    . ILE D 2 158 ? 22.793  5.074   5.311   1.00 37.02 ? 159 ILE B CA    1 
ATOM   3331 C C     . ILE D 2 158 ? 22.688  3.842   4.413   1.00 36.20 ? 159 ILE B C     1 
ATOM   3332 O O     . ILE D 2 158 ? 22.917  3.925   3.200   1.00 33.50 ? 159 ILE B O     1 
ATOM   3333 C CB    . ILE D 2 158 ? 21.692  6.099   4.901   1.00 36.83 ? 159 ILE B CB    1 
ATOM   3334 C CG1   . ILE D 2 158 ? 21.759  7.335   5.801   1.00 32.21 ? 159 ILE B CG1   1 
ATOM   3335 C CG2   . ILE D 2 158 ? 20.306  5.457   4.912   1.00 35.62 ? 159 ILE B CG2   1 
ATOM   3336 C CD1   . ILE D 2 158 ? 20.566  8.244   5.684   1.00 33.73 ? 159 ILE B CD1   1 
ATOM   3337 N N     . PRO D 2 159 ? 22.339  2.682   4.998   1.00 35.49 ? 160 PRO B N     1 
ATOM   3338 C CA    . PRO D 2 159 ? 22.192  1.414   4.260   1.00 35.49 ? 160 PRO B CA    1 
ATOM   3339 C C     . PRO D 2 159 ? 20.982  1.377   3.345   1.00 34.77 ? 160 PRO B C     1 
ATOM   3340 O O     . PRO D 2 159 ? 19.861  1.713   3.733   1.00 32.88 ? 160 PRO B O     1 
ATOM   3341 C CB    . PRO D 2 159 ? 22.078  0.361   5.368   1.00 34.48 ? 160 PRO B CB    1 
ATOM   3342 C CG    . PRO D 2 159 ? 21.763  1.161   6.616   1.00 36.68 ? 160 PRO B CG    1 
ATOM   3343 C CD    . PRO D 2 159 ? 22.557  2.425   6.429   1.00 34.65 ? 160 PRO B CD    1 
ATOM   3344 N N     . LYS D 2 160 ? 21.201  0.949   2.120   1.00 38.70 ? 161 LYS B N     1 
ATOM   3345 C CA    . LYS D 2 160 ? 20.096  0.908   1.184   1.00 41.93 ? 161 LYS B CA    1 
ATOM   3346 C C     . LYS D 2 160 ? 19.343  -0.427  1.244   1.00 41.37 ? 161 LYS B C     1 
ATOM   3347 O O     . LYS D 2 160 ? 19.945  -1.485  1.450   1.00 41.64 ? 161 LYS B O     1 
ATOM   3348 C CB    . LYS D 2 160 ? 20.602  1.287   -0.207  1.00 45.57 ? 161 LYS B CB    1 
ATOM   3349 C CG    . LYS D 2 160 ? 21.359  2.606   -0.168  1.00 44.49 ? 161 LYS B CG    1 
ATOM   3350 C CD    . LYS D 2 160 ? 21.712  3.144   -1.532  1.00 48.64 ? 161 LYS B CD    1 
ATOM   3351 C CE    . LYS D 2 160 ? 22.538  4.413   -1.376  1.00 52.39 ? 161 LYS B CE    1 
ATOM   3352 N NZ    . LYS D 2 160 ? 21.853  5.458   -0.541  1.00 54.76 ? 161 LYS B NZ    1 
ATOM   3353 N N     . PRO D 2 161 ? 18.000  -0.379  1.127   1.00 40.00 ? 162 PRO B N     1 
ATOM   3354 C CA    . PRO D 2 161 ? 17.202  -1.604  1.184   1.00 37.67 ? 162 PRO B CA    1 
ATOM   3355 C C     . PRO D 2 161 ? 17.089  -2.332  -0.146  1.00 38.05 ? 162 PRO B C     1 
ATOM   3356 O O     . PRO D 2 161 ? 16.418  -3.358  -0.232  1.00 38.18 ? 162 PRO B O     1 
ATOM   3357 C CB    . PRO D 2 161 ? 15.847  -1.090  1.662   1.00 36.40 ? 162 PRO B CB    1 
ATOM   3358 C CG    . PRO D 2 161 ? 15.736  0.205   0.970   1.00 37.39 ? 162 PRO B CG    1 
ATOM   3359 C CD    . PRO D 2 161 ? 17.124  0.809   1.055   1.00 38.17 ? 162 PRO B CD    1 
ATOM   3360 N N     . TYR D 2 162 ? 17.747  -1.802  -1.171  1.00 37.53 ? 163 TYR B N     1 
ATOM   3361 C CA    . TYR D 2 162 ? 17.715  -2.393  -2.493  1.00 36.53 ? 163 TYR B CA    1 
ATOM   3362 C C     . TYR D 2 162 ? 19.085  -2.299  -3.122  1.00 36.57 ? 163 TYR B C     1 
ATOM   3363 O O     . TYR D 2 162 ? 19.807  -1.319  -2.910  1.00 32.58 ? 163 TYR B O     1 
ATOM   3364 C CB    . TYR D 2 162 ? 16.634  -1.738  -3.357  1.00 41.45 ? 163 TYR B CB    1 
ATOM   3365 C CG    . TYR D 2 162 ? 16.695  -0.224  -3.462  1.00 44.28 ? 163 TYR B CG    1 
ATOM   3366 C CD1   . TYR D 2 162 ? 16.575  0.591   -2.334  1.00 46.23 ? 163 TYR B CD1   1 
ATOM   3367 C CD2   . TYR D 2 162 ? 16.833  0.388   -4.700  1.00 43.81 ? 163 TYR B CD2   1 
ATOM   3368 C CE1   . TYR D 2 162 ? 16.588  1.978   -2.448  1.00 48.30 ? 163 TYR B CE1   1 
ATOM   3369 C CE2   . TYR D 2 162 ? 16.844  1.765   -4.822  1.00 48.47 ? 163 TYR B CE2   1 
ATOM   3370 C CZ    . TYR D 2 162 ? 16.718  2.555   -3.704  1.00 47.70 ? 163 TYR B CZ    1 
ATOM   3371 O OH    . TYR D 2 162 ? 16.673  3.918   -3.877  1.00 51.49 ? 163 TYR B OH    1 
ATOM   3372 N N     . LYS D 2 163 ? 19.462  -3.365  -3.828  1.00 40.57 ? 164 LYS B N     1 
ATOM   3373 C CA    . LYS D 2 163 ? 20.774  -3.481  -4.472  1.00 42.94 ? 164 LYS B CA    1 
ATOM   3374 C C     . LYS D 2 163 ? 20.859  -2.883  -5.872  1.00 42.74 ? 164 LYS B C     1 
ATOM   3375 O O     . LYS D 2 163 ? 21.934  -2.430  -6.286  1.00 47.35 ? 164 LYS B O     1 
ATOM   3376 C CB    . LYS D 2 163 ? 21.234  -4.953  -4.507  1.00 41.33 ? 164 LYS B CB    1 
ATOM   3377 N N     . GLY D 2 164 ? 19.749  -2.903  -6.604  1.00 37.11 ? 165 GLY B N     1 
ATOM   3378 C CA    . GLY D 2 164 ? 19.753  -2.352  -7.937  1.00 31.10 ? 165 GLY B CA    1 
ATOM   3379 C C     . GLY D 2 164 ? 18.329  -2.073  -8.323  1.00 33.43 ? 165 GLY B C     1 
ATOM   3380 O O     . GLY D 2 164 ? 17.421  -2.605  -7.682  1.00 33.87 ? 165 GLY B O     1 
ATOM   3381 N N     . VAL D 2 165 ? 18.133  -1.250  -9.354  1.00 30.05 ? 166 VAL B N     1 
ATOM   3382 C CA    . VAL D 2 165 ? 16.803  -0.894  -9.833  1.00 30.16 ? 166 VAL B CA    1 
ATOM   3383 C C     . VAL D 2 165 ? 16.771  -0.550  -11.333 1.00 29.49 ? 166 VAL B C     1 
ATOM   3384 O O     . VAL D 2 165 ? 17.524  0.314   -11.792 1.00 30.50 ? 166 VAL B O     1 
ATOM   3385 C CB    . VAL D 2 165 ? 16.165  0.252   -8.976  1.00 28.42 ? 166 VAL B CB    1 
ATOM   3386 C CG1   . VAL D 2 165 ? 17.223  1.142   -8.406  1.00 25.27 ? 166 VAL B CG1   1 
ATOM   3387 C CG2   . VAL D 2 165 ? 15.177  1.069   -9.797  1.00 28.17 ? 166 VAL B CG2   1 
ATOM   3388 N N     . LYS D 2 166 ? 15.946  -1.285  -12.089 1.00 28.57 ? 167 LYS B N     1 
ATOM   3389 C CA    . LYS D 2 166 ? 15.764  -1.094  -13.541 1.00 25.11 ? 167 LYS B CA    1 
ATOM   3390 C C     . LYS D 2 166 ? 14.407  -0.463  -13.773 1.00 23.38 ? 167 LYS B C     1 
ATOM   3391 O O     . LYS D 2 166 ? 13.478  -0.698  -13.006 1.00 24.52 ? 167 LYS B O     1 
ATOM   3392 C CB    . LYS D 2 166 ? 15.758  -2.435  -14.284 1.00 23.50 ? 167 LYS B CB    1 
ATOM   3393 C CG    . LYS D 2 166 ? 16.904  -3.356  -13.972 1.00 30.64 ? 167 LYS B CG    1 
ATOM   3394 C CD    . LYS D 2 166 ? 17.663  -3.741  -15.239 1.00 38.49 ? 167 LYS B CD    1 
ATOM   3395 C CE    . LYS D 2 166 ? 18.830  -4.685  -14.920 1.00 42.59 ? 167 LYS B CE    1 
ATOM   3396 N NZ    . LYS D 2 166 ? 19.622  -5.119  -16.121 1.00 48.89 ? 167 LYS B NZ    1 
ATOM   3397 N N     . VAL D 2 167 ? 14.270  0.327   -14.825 1.00 23.24 ? 168 VAL B N     1 
ATOM   3398 C CA    . VAL D 2 167 ? 12.972  0.910   -15.115 1.00 24.09 ? 168 VAL B CA    1 
ATOM   3399 C C     . VAL D 2 167 ? 12.624  0.772   -16.596 1.00 26.19 ? 168 VAL B C     1 
ATOM   3400 O O     . VAL D 2 167 ? 13.501  0.681   -17.455 1.00 29.02 ? 168 VAL B O     1 
ATOM   3401 C CB    . VAL D 2 167 ? 12.896  2.378   -14.720 1.00 21.46 ? 168 VAL B CB    1 
ATOM   3402 C CG1   . VAL D 2 167 ? 13.883  3.190   -15.543 1.00 25.46 ? 168 VAL B CG1   1 
ATOM   3403 C CG2   . VAL D 2 167 ? 11.447  2.907   -14.877 1.00 19.80 ? 168 VAL B CG2   1 
ATOM   3404 N N     . PHE D 2 168 ? 11.340  0.706   -16.893 1.00 24.25 ? 169 PHE B N     1 
ATOM   3405 C CA    . PHE D 2 168 ? 10.941  0.611   -18.267 1.00 22.45 ? 169 PHE B CA    1 
ATOM   3406 C C     . PHE D 2 168 ? 9.576   1.239   -18.476 1.00 19.76 ? 169 PHE B C     1 
ATOM   3407 O O     . PHE D 2 168 ? 8.800   1.388   -17.532 1.00 17.24 ? 169 PHE B O     1 
ATOM   3408 C CB    . PHE D 2 168 ? 10.966  -0.859  -18.721 1.00 22.63 ? 169 PHE B CB    1 
ATOM   3409 C CG    . PHE D 2 168 ? 9.869   -1.712  -18.138 1.00 24.90 ? 169 PHE B CG    1 
ATOM   3410 C CD1   . PHE D 2 168 ? 8.572   -1.675  -18.661 1.00 26.40 ? 169 PHE B CD1   1 
ATOM   3411 C CD2   . PHE D 2 168 ? 10.134  -2.581  -17.091 1.00 25.02 ? 169 PHE B CD2   1 
ATOM   3412 C CE1   . PHE D 2 168 ? 7.557   -2.499  -18.141 1.00 27.02 ? 169 PHE B CE1   1 
ATOM   3413 C CE2   . PHE D 2 168 ? 9.120   -3.404  -16.575 1.00 25.57 ? 169 PHE B CE2   1 
ATOM   3414 C CZ    . PHE D 2 168 ? 7.834   -3.361  -17.099 1.00 20.18 ? 169 PHE B CZ    1 
ATOM   3415 N N     . LEU D 2 169 ? 9.343   1.713   -19.697 1.00 16.57 ? 170 LEU B N     1 
ATOM   3416 C CA    . LEU D 2 169 ? 8.055   2.255   -20.061 1.00 14.36 ? 170 LEU B CA    1 
ATOM   3417 C C     . LEU D 2 169 ? 7.512   1.321   -21.165 1.00 16.39 ? 170 LEU B C     1 
ATOM   3418 O O     . LEU D 2 169 ? 8.269   0.810   -22.003 1.00 16.38 ? 170 LEU B O     1 
ATOM   3419 C CB    . LEU D 2 169 ? 8.169   3.726   -20.506 1.00 11.66 ? 170 LEU B CB    1 
ATOM   3420 C CG    . LEU D 2 169 ? 6.830   4.514   -20.456 1.00 16.63 ? 170 LEU B CG    1 
ATOM   3421 C CD1   . LEU D 2 169 ? 7.027   6.016   -20.603 1.00 20.94 ? 170 LEU B CD1   1 
ATOM   3422 C CD2   . LEU D 2 169 ? 5.845   4.027   -21.502 1.00 17.96 ? 170 LEU B CD2   1 
ATOM   3423 N N     . GLN D 2 170 ? 6.227   1.009   -21.089 1.00 18.68 ? 171 GLN B N     1 
ATOM   3424 C CA    . GLN D 2 170 ? 5.607   0.141   -22.074 1.00 18.27 ? 171 GLN B CA    1 
ATOM   3425 C C     . GLN D 2 170 ? 4.101   0.251   -22.064 1.00 18.37 ? 171 GLN B C     1 
ATOM   3426 O O     . GLN D 2 170 ? 3.514   0.758   -21.089 1.00 14.55 ? 171 GLN B O     1 
ATOM   3427 C CB    . GLN D 2 170 ? 6.031   -1.311  -21.858 1.00 21.14 ? 171 GLN B CB    1 
ATOM   3428 C CG    . GLN D 2 170 ? 5.551   -2.277  -22.988 1.00 26.39 ? 171 GLN B CG    1 
ATOM   3429 C CD    . GLN D 2 170 ? 5.967   -1.813  -24.396 1.00 20.28 ? 171 GLN B CD    1 
ATOM   3430 O OE1   . GLN D 2 170 ? 5.268   -1.017  -25.033 1.00 19.25 ? 171 GLN B OE1   1 
ATOM   3431 N NE2   . GLN D 2 170 ? 7.121   -2.274  -24.856 1.00 17.85 ? 171 GLN B NE2   1 
ATOM   3432 N N     . ASP D 2 171 ? 3.475   -0.136  -23.177 1.00 15.41 ? 172 ASP B N     1 
ATOM   3433 C CA    . ASP D 2 171 ? 2.014   -0.115  -23.242 1.00 15.88 ? 172 ASP B CA    1 
ATOM   3434 C C     . ASP D 2 171 ? 1.454   -1.285  -22.407 1.00 12.95 ? 172 ASP B C     1 
ATOM   3435 O O     . ASP D 2 171 ? 1.958   -2.430  -22.463 1.00 12.86 ? 172 ASP B O     1 
ATOM   3436 C CB    . ASP D 2 171 ? 1.498   -0.207  -24.690 1.00 12.81 ? 172 ASP B CB    1 
ATOM   3437 C CG    . ASP D 2 171 ? 1.998   0.921   -25.562 1.00 13.74 ? 172 ASP B CG    1 
ATOM   3438 O OD1   . ASP D 2 171 ? 3.141   0.851   -26.047 1.00 25.11 ? 172 ASP B OD1   1 
ATOM   3439 O OD2   . ASP D 2 171 ? 1.252   1.884   -25.781 1.00 19.21 ? 172 ASP B OD2   1 
ATOM   3440 N N     . LYS D 2 172 ? 0.421   -0.975  -21.628 1.00 13.17 ? 173 LYS B N     1 
ATOM   3441 C CA    . LYS D 2 172 ? -0.216  -1.955  -20.793 1.00 15.51 ? 173 LYS B CA    1 
ATOM   3442 C C     . LYS D 2 172 ? -0.532  -3.233  -21.586 1.00 16.71 ? 173 LYS B C     1 
ATOM   3443 O O     . LYS D 2 172 ? 0.008   -4.283  -21.276 1.00 16.47 ? 173 LYS B O     1 
ATOM   3444 C CB    . LYS D 2 172 ? -1.496  -1.395  -20.164 1.00 13.64 ? 173 LYS B CB    1 
ATOM   3445 C CG    . LYS D 2 172 ? -2.165  -2.434  -19.257 1.00 16.68 ? 173 LYS B CG    1 
ATOM   3446 C CD    . LYS D 2 172 ? -3.472  -1.966  -18.633 1.00 18.53 ? 173 LYS B CD    1 
ATOM   3447 C CE    . LYS D 2 172 ? -3.224  -1.126  -17.397 1.00 19.48 ? 173 LYS B CE    1 
ATOM   3448 N NZ    . LYS D 2 172 ? -4.473  -0.540  -16.821 1.00 19.14 ? 173 LYS B NZ    1 
ATOM   3449 N N     . TRP D 2 173 ? -1.325  -3.125  -22.649 1.00 15.33 ? 174 TRP B N     1 
ATOM   3450 C CA    . TRP D 2 173 ? -1.711  -4.292  -23.438 1.00 16.45 ? 174 TRP B CA    1 
ATOM   3451 C C     . TRP D 2 173 ? -0.574  -5.175  -23.987 1.00 19.72 ? 174 TRP B C     1 
ATOM   3452 O O     . TRP D 2 173 ? -0.742  -6.402  -24.145 1.00 18.30 ? 174 TRP B O     1 
ATOM   3453 C CB    . TRP D 2 173 ? -2.644  -3.859  -24.581 1.00 21.28 ? 174 TRP B CB    1 
ATOM   3454 C CG    . TRP D 2 173 ? -1.927  -3.333  -25.815 1.00 24.72 ? 174 TRP B CG    1 
ATOM   3455 C CD1   . TRP D 2 173 ? -1.678  -2.024  -26.135 1.00 18.93 ? 174 TRP B CD1   1 
ATOM   3456 C CD2   . TRP D 2 173 ? -1.402  -4.119  -26.904 1.00 26.29 ? 174 TRP B CD2   1 
ATOM   3457 N NE1   . TRP D 2 173 ? -1.047  -1.954  -27.348 1.00 25.19 ? 174 TRP B NE1   1 
ATOM   3458 C CE2   . TRP D 2 173 ? -0.866  -3.221  -27.844 1.00 25.22 ? 174 TRP B CE2   1 
ATOM   3459 C CE3   . TRP D 2 173 ? -1.336  -5.499  -27.171 1.00 24.36 ? 174 TRP B CE3   1 
ATOM   3460 C CZ2   . TRP D 2 173 ? -0.273  -3.651  -29.033 1.00 26.67 ? 174 TRP B CZ2   1 
ATOM   3461 C CZ3   . TRP D 2 173 ? -0.747  -5.920  -28.349 1.00 22.37 ? 174 TRP B CZ3   1 
ATOM   3462 C CH2   . TRP D 2 173 ? -0.225  -5.002  -29.264 1.00 22.74 ? 174 TRP B CH2   1 
ATOM   3463 N N     . VAL D 2 174 ? 0.574   -4.563  -24.277 1.00 16.62 ? 175 VAL B N     1 
ATOM   3464 C CA    . VAL D 2 174 ? 1.705   -5.302  -24.844 1.00 16.82 ? 175 VAL B CA    1 
ATOM   3465 C C     . VAL D 2 174 ? 2.340   -6.264  -23.846 1.00 18.47 ? 175 VAL B C     1 
ATOM   3466 O O     . VAL D 2 174 ? 2.800   -7.338  -24.223 1.00 18.82 ? 175 VAL B O     1 
ATOM   3467 C CB    . VAL D 2 174 ? 2.823   -4.329  -25.382 1.00 18.82 ? 175 VAL B CB    1 
ATOM   3468 C CG1   . VAL D 2 174 ? 3.954   -5.084  -25.937 1.00 16.42 ? 175 VAL B CG1   1 
ATOM   3469 C CG2   . VAL D 2 174 ? 2.290   -3.400  -26.436 1.00 21.42 ? 175 VAL B CG2   1 
ATOM   3470 N N     . ILE D 2 175 ? 2.378   -5.884  -22.571 1.00 20.22 ? 176 ILE B N     1 
ATOM   3471 C CA    . ILE D 2 175 ? 3.010   -6.713  -21.536 1.00 16.89 ? 176 ILE B CA    1 
ATOM   3472 C C     . ILE D 2 175 ? 2.027   -7.536  -20.703 1.00 17.78 ? 176 ILE B C     1 
ATOM   3473 O O     . ILE D 2 175 ? 2.371   -8.133  -19.692 1.00 19.65 ? 176 ILE B O     1 
ATOM   3474 C CB    . ILE D 2 175 ? 3.844   -5.825  -20.593 1.00 20.49 ? 176 ILE B CB    1 
ATOM   3475 C CG1   . ILE D 2 175 ? 2.969   -4.725  -19.979 1.00 18.69 ? 176 ILE B CG1   1 
ATOM   3476 C CG2   . ILE D 2 175 ? 5.014   -5.219  -21.364 1.00 21.69 ? 176 ILE B CG2   1 
ATOM   3477 C CD1   . ILE D 2 175 ? 3.499   -4.205  -18.640 1.00 20.74 ? 176 ILE B CD1   1 
ATOM   3478 N N     . ALA D 2 176 ? 0.778   -7.519  -21.105 1.00 18.79 ? 177 ALA B N     1 
ATOM   3479 C CA    . ALA D 2 176 ? -0.249  -8.266  -20.419 1.00 21.67 ? 177 ALA B CA    1 
ATOM   3480 C C     . ALA D 2 176 ? -0.125  -9.784  -20.682 1.00 22.37 ? 177 ALA B C     1 
ATOM   3481 O O     . ALA D 2 176 ? 0.218   -10.208 -21.811 1.00 23.59 ? 177 ALA B O     1 
ATOM   3482 C CB    . ALA D 2 176 ? -1.610  -7.774  -20.884 1.00 21.12 ? 177 ALA B CB    1 
ATOM   3483 N N     . GLY D 2 177 ? -0.354  -10.579 -19.632 1.00 17.58 ? 178 GLY B N     1 
ATOM   3484 C CA    . GLY D 2 177 ? -0.341  -12.027 -19.755 1.00 14.44 ? 178 GLY B CA    1 
ATOM   3485 C C     . GLY D 2 177 ? -1.782  -12.525 -19.801 1.00 14.73 ? 178 GLY B C     1 
ATOM   3486 O O     . GLY D 2 177 ? -2.747  -11.730 -19.867 1.00 11.64 ? 178 GLY B O     1 
ATOM   3487 N N     . ASP D 2 178 ? -1.943  -13.845 -19.775 1.00 17.88 ? 179 ASP B N     1 
ATOM   3488 C CA    . ASP D 2 178 ? -3.272  -14.470 -19.796 1.00 20.79 ? 179 ASP B CA    1 
ATOM   3489 C C     . ASP D 2 178 ? -3.768  -15.036 -18.412 1.00 20.71 ? 179 ASP B C     1 
ATOM   3490 O O     . ASP D 2 178 ? -4.883  -15.541 -18.287 1.00 12.49 ? 179 ASP B O     1 
ATOM   3491 C CB    . ASP D 2 178 ? -3.362  -15.529 -20.939 1.00 19.56 ? 179 ASP B CB    1 
ATOM   3492 C CG    . ASP D 2 178 ? -2.276  -16.618 -20.853 1.00 21.55 ? 179 ASP B CG    1 
ATOM   3493 O OD1   . ASP D 2 178 ? -1.303  -16.498 -20.064 1.00 22.35 ? 179 ASP B OD1   1 
ATOM   3494 O OD2   . ASP D 2 178 ? -2.392  -17.618 -21.581 1.00 18.57 ? 179 ASP B OD2   1 
ATOM   3495 N N     . LEU D 2 179 ? -2.937  -14.914 -17.379 1.00 23.06 ? 180 LEU B N     1 
ATOM   3496 C CA    . LEU D 2 179 ? -3.267  -15.374 -16.022 1.00 23.29 ? 180 LEU B CA    1 
ATOM   3497 C C     . LEU D 2 179 ? -3.407  -14.172 -15.098 1.00 22.50 ? 180 LEU B C     1 
ATOM   3498 O O     . LEU D 2 179 ? -2.654  -13.193 -15.207 1.00 21.66 ? 180 LEU B O     1 
ATOM   3499 C CB    . LEU D 2 179 ? -2.162  -16.263 -15.431 1.00 21.12 ? 180 LEU B CB    1 
ATOM   3500 C CG    . LEU D 2 179 ? -1.743  -17.565 -16.094 1.00 26.31 ? 180 LEU B CG    1 
ATOM   3501 C CD1   . LEU D 2 179 ? -0.615  -18.147 -15.299 1.00 25.01 ? 180 LEU B CD1   1 
ATOM   3502 C CD2   . LEU D 2 179 ? -2.884  -18.546 -16.154 1.00 27.10 ? 180 LEU B CD2   1 
ATOM   3503 N N     . ALA D 2 180 ? -4.360  -14.278 -14.180 1.00 20.41 ? 181 ALA B N     1 
ATOM   3504 C CA    . ALA D 2 180 ? -4.642  -13.240 -13.195 1.00 22.27 ? 181 ALA B CA    1 
ATOM   3505 C C     . ALA D 2 180 ? -3.437  -12.875 -12.312 1.00 23.32 ? 181 ALA B C     1 
ATOM   3506 O O     . ALA D 2 180 ? -2.615  -13.722 -11.951 1.00 24.91 ? 181 ALA B O     1 
ATOM   3507 C CB    . ALA D 2 180 ? -5.799  -13.663 -12.342 1.00 18.90 ? 181 ALA B CB    1 
ATOM   3508 N N     . GLY D 2 181 ? -3.307  -11.588 -12.024 1.00 24.65 ? 182 GLY B N     1 
ATOM   3509 C CA    . GLY D 2 181 ? -2.233  -11.116 -11.175 1.00 27.67 ? 182 GLY B CA    1 
ATOM   3510 C C     . GLY D 2 181 ? -2.613  -11.203 -9.695  1.00 29.44 ? 182 GLY B C     1 
ATOM   3511 O O     . GLY D 2 181 ? -1.760  -10.956 -8.836  1.00 36.28 ? 182 GLY B O     1 
ATOM   3512 N N     . SER D 2 182 ? -3.871  -11.515 -9.383  1.00 23.41 ? 183 SER B N     1 
ATOM   3513 C CA    . SER D 2 182 ? -4.309  -11.645 -7.998  1.00 21.02 ? 183 SER B CA    1 
ATOM   3514 C C     . SER D 2 182 ? -5.666  -12.283 -7.998  1.00 17.27 ? 183 SER B C     1 
ATOM   3515 O O     . SER D 2 182 ? -6.413  -12.126 -8.947  1.00 18.03 ? 183 SER B O     1 
ATOM   3516 C CB    . SER D 2 182 ? -4.393  -10.287 -7.292  1.00 20.09 ? 183 SER B CB    1 
ATOM   3517 O OG    . SER D 2 182 ? -5.352  -9.440  -7.894  1.00 17.91 ? 183 SER B OG    1 
ATOM   3518 N N     . GLY D 2 183 ? -5.980  -12.950 -6.895  1.00 16.30 ? 184 GLY B N     1 
ATOM   3519 C CA    . GLY D 2 183 ? -7.239  -13.630 -6.735  1.00 8.54  ? 184 GLY B CA    1 
ATOM   3520 C C     . GLY D 2 183 ? -8.327  -12.757 -6.196  1.00 13.07 ? 184 GLY B C     1 
ATOM   3521 O O     . GLY D 2 183 ? -9.105  -12.191 -6.975  1.00 15.02 ? 184 GLY B O     1 
ATOM   3522 N N     . ASN D 2 184 ? -8.394  -12.589 -4.877  1.00 13.66 ? 185 ASN B N     1 
ATOM   3523 C CA    . ASN D 2 184 ? -9.491  -11.781 -4.338  1.00 16.43 ? 185 ASN B CA    1 
ATOM   3524 C C     . ASN D 2 184 ? -9.557  -10.339 -4.815  1.00 14.59 ? 185 ASN B C     1 
ATOM   3525 O O     . ASN D 2 184 ? -10.631 -9.755  -4.794  1.00 17.16 ? 185 ASN B O     1 
ATOM   3526 C CB    . ASN D 2 184 ? -9.599  -11.854 -2.807  1.00 18.60 ? 185 ASN B CB    1 
ATOM   3527 C CG    . ASN D 2 184 ? -8.328  -11.491 -2.116  1.00 25.88 ? 185 ASN B CG    1 
ATOM   3528 O OD1   . ASN D 2 184 ? -7.373  -11.023 -2.751  1.00 25.82 ? 185 ASN B OD1   1 
ATOM   3529 N ND2   . ASN D 2 184 ? -8.288  -11.706 -0.793  1.00 24.55 ? 185 ASN B ND2   1 
ATOM   3530 N N     . THR D 2 185 ? -8.441  -9.791  -5.297  1.00 14.12 ? 186 THR B N     1 
ATOM   3531 C CA    . THR D 2 185 ? -8.403  -8.403  -5.772  1.00 16.29 ? 186 THR B CA    1 
ATOM   3532 C C     . THR D 2 185 ? -8.439  -8.279  -7.325  1.00 18.18 ? 186 THR B C     1 
ATOM   3533 O O     . THR D 2 185 ? -8.183  -7.201  -7.906  1.00 13.28 ? 186 THR B O     1 
ATOM   3534 C CB    . THR D 2 185 ? -7.219  -7.617  -5.116  1.00 9.31  ? 186 THR B CB    1 
ATOM   3535 O OG1   . THR D 2 185 ? -6.034  -8.410  -5.180  1.00 13.05 ? 186 THR B OG1   1 
ATOM   3536 C CG2   . THR D 2 185 ? -7.528  -7.333  -3.651  1.00 11.98 ? 186 THR B CG2   1 
ATOM   3537 N N     . THR D 2 186 ? -8.738  -9.413  -7.960  1.00 17.18 ? 187 THR B N     1 
ATOM   3538 C CA    . THR D 2 186 ? -8.907  -9.552  -9.408  1.00 15.75 ? 187 THR B CA    1 
ATOM   3539 C C     . THR D 2 186 ? -8.073  -8.659  -10.341 1.00 11.33 ? 187 THR B C     1 
ATOM   3540 O O     . THR D 2 186 ? -8.601  -7.840  -11.103 1.00 11.66 ? 187 THR B O     1 
ATOM   3541 C CB    . THR D 2 186 ? -10.377 -9.401  -9.745  1.00 12.02 ? 187 THR B CB    1 
ATOM   3542 O OG1   . THR D 2 186 ? -10.894 -8.187  -9.172  1.00 16.99 ? 187 THR B OG1   1 
ATOM   3543 C CG2   . THR D 2 186 ? -11.141 -10.563 -9.187  1.00 14.99 ? 187 THR B CG2   1 
ATOM   3544 N N     . ASN D 2 187 ? -6.768  -8.837  -10.286 1.00 11.55 ? 188 ASN B N     1 
ATOM   3545 C CA    . ASN D 2 187 ? -5.889  -8.061  -11.114 1.00 12.90 ? 188 ASN B CA    1 
ATOM   3546 C C     . ASN D 2 187 ? -5.452  -8.837  -12.321 1.00 15.92 ? 188 ASN B C     1 
ATOM   3547 O O     . ASN D 2 187 ? -5.391  -10.073 -12.288 1.00 13.11 ? 188 ASN B O     1 
ATOM   3548 C CB    . ASN D 2 187 ? -4.636  -7.646  -10.347 1.00 9.48  ? 188 ASN B CB    1 
ATOM   3549 C CG    . ASN D 2 187 ? -4.695  -6.205  -9.855  1.00 10.84 ? 188 ASN B CG    1 
ATOM   3550 O OD1   . ASN D 2 187 ? -3.797  -5.437  -10.136 1.00 12.79 ? 188 ASN B OD1   1 
ATOM   3551 N ND2   . ASN D 2 187 ? -5.730  -5.849  -9.096  1.00 6.77  ? 188 ASN B ND2   1 
ATOM   3552 N N     . ILE D 2 188 ? -5.090  -8.075  -13.358 1.00 15.92 ? 189 ILE B N     1 
ATOM   3553 C CA    . ILE D 2 188 ? -4.564  -8.589  -14.615 1.00 13.61 ? 189 ILE B CA    1 
ATOM   3554 C C     . ILE D 2 188 ? -3.116  -8.958  -14.315 1.00 13.73 ? 189 ILE B C     1 
ATOM   3555 O O     . ILE D 2 188 ? -2.411  -8.235  -13.610 1.00 15.82 ? 189 ILE B O     1 
ATOM   3556 C CB    . ILE D 2 188 ? -4.582  -7.496  -15.733 1.00 11.68 ? 189 ILE B CB    1 
ATOM   3557 C CG1   . ILE D 2 188 ? -6.029  -7.168  -16.130 1.00 10.08 ? 189 ILE B CG1   1 
ATOM   3558 C CG2   . ILE D 2 188 ? -3.781  -7.931  -16.949 1.00 9.33  ? 189 ILE B CG2   1 
ATOM   3559 C CD1   . ILE D 2 188 ? -6.190  -6.036  -17.103 1.00 9.61  ? 189 ILE B CD1   1 
ATOM   3560 N N     . GLY D 2 189 ? -2.700  -10.126 -14.764 1.00 12.11 ? 190 GLY B N     1 
ATOM   3561 C CA    . GLY D 2 189 ? -1.333  -10.520 -14.561 1.00 14.79 ? 190 GLY B CA    1 
ATOM   3562 C C     . GLY D 2 189 ? -0.548  -10.196 -15.822 1.00 18.41 ? 190 GLY B C     1 
ATOM   3563 O O     . GLY D 2 189 ? -1.035  -10.393 -16.949 1.00 20.38 ? 190 GLY B O     1 
ATOM   3564 N N     . SER D 2 190 ? 0.662   -9.689  -15.628 1.00 17.03 ? 191 SER B N     1 
ATOM   3565 C CA    . SER D 2 190 ? 1.562   -9.354  -16.716 1.00 19.10 ? 191 SER B CA    1 
ATOM   3566 C C     . SER D 2 190 ? 2.193   -10.656 -17.203 1.00 21.31 ? 191 SER B C     1 
ATOM   3567 O O     . SER D 2 190 ? 2.063   -11.690 -16.566 1.00 19.84 ? 191 SER B O     1 
ATOM   3568 C CB    . SER D 2 190 ? 2.719   -8.481  -16.182 1.00 15.12 ? 191 SER B CB    1 
ATOM   3569 O OG    . SER D 2 190 ? 3.756   -9.251  -15.515 1.00 10.02 ? 191 SER B OG    1 
ATOM   3570 N N     . ILE D 2 191 ? 2.957   -10.572 -18.287 1.00 23.02 ? 192 ILE B N     1 
ATOM   3571 C CA    . ILE D 2 191 ? 3.703   -11.715 -18.776 1.00 23.20 ? 192 ILE B CA    1 
ATOM   3572 C C     . ILE D 2 191 ? 4.746   -12.014 -17.675 1.00 25.79 ? 192 ILE B C     1 
ATOM   3573 O O     . ILE D 2 191 ? 5.179   -11.113 -16.918 1.00 24.25 ? 192 ILE B O     1 
ATOM   3574 C CB    . ILE D 2 191 ? 4.442   -11.365 -20.087 1.00 24.40 ? 192 ILE B CB    1 
ATOM   3575 C CG1   . ILE D 2 191 ? 5.229   -10.049 -19.904 1.00 25.12 ? 192 ILE B CG1   1 
ATOM   3576 C CG2   . ILE D 2 191 ? 3.425   -11.259 -21.255 1.00 24.11 ? 192 ILE B CG2   1 
ATOM   3577 C CD1   . ILE D 2 191 ? 6.092   -9.650  -21.069 1.00 19.96 ? 192 ILE B CD1   1 
ATOM   3578 N N     . HIS D 2 192 ? 5.136   -13.276 -17.588 1.00 25.37 ? 193 HIS B N     1 
ATOM   3579 C CA    . HIS D 2 192 ? 6.107   -13.735 -16.607 1.00 30.63 ? 193 HIS B CA    1 
ATOM   3580 C C     . HIS D 2 192 ? 7.437   -13.948 -17.340 1.00 30.41 ? 193 HIS B C     1 
ATOM   3581 O O     . HIS D 2 192 ? 7.740   -15.063 -17.781 1.00 25.77 ? 193 HIS B O     1 
ATOM   3582 C CB    . HIS D 2 192 ? 5.584   -15.039 -16.001 1.00 34.11 ? 193 HIS B CB    1 
ATOM   3583 C CG    . HIS D 2 192 ? 6.557   -15.746 -15.106 1.00 41.97 ? 193 HIS B CG    1 
ATOM   3584 N ND1   . HIS D 2 192 ? 7.714   -16.337 -15.571 1.00 45.53 ? 193 HIS B ND1   1 
ATOM   3585 C CD2   . HIS D 2 192 ? 6.485   -16.052 -13.788 1.00 44.84 ? 193 HIS B CD2   1 
ATOM   3586 C CE1   . HIS D 2 192 ? 8.300   -16.990 -14.584 1.00 47.30 ? 193 HIS B CE1   1 
ATOM   3587 N NE2   . HIS D 2 192 ? 7.574   -16.831 -13.491 1.00 47.88 ? 193 HIS B NE2   1 
ATOM   3588 N N     . ALA D 2 193 ? 8.251   -12.893 -17.413 1.00 31.99 ? 194 ALA B N     1 
ATOM   3589 C CA    . ALA D 2 193 ? 9.524   -12.946 -18.138 1.00 32.14 ? 194 ALA B CA    1 
ATOM   3590 C C     . ALA D 2 193 ? 10.634  -12.020 -17.651 1.00 30.98 ? 194 ALA B C     1 
ATOM   3591 O O     . ALA D 2 193 ? 10.556  -11.454 -16.573 1.00 26.57 ? 194 ALA B O     1 
ATOM   3592 C CB    . ALA D 2 193 ? 9.270   -12.687 -19.633 1.00 31.53 ? 194 ALA B CB    1 
ATOM   3593 N N     . HIS D 2 194 ? 11.685  -11.929 -18.473 1.00 33.95 ? 195 HIS B N     1 
ATOM   3594 C CA    . HIS D 2 194 ? 12.867  -11.104 -18.231 1.00 35.38 ? 195 HIS B CA    1 
ATOM   3595 C C     . HIS D 2 194 ? 12.643  -9.647  -18.555 1.00 34.57 ? 195 HIS B C     1 
ATOM   3596 O O     . HIS D 2 194 ? 11.933  -9.305  -19.500 1.00 32.51 ? 195 HIS B O     1 
ATOM   3597 C CB    . HIS D 2 194 ? 14.050  -11.563 -19.082 1.00 38.41 ? 195 HIS B CB    1 
ATOM   3598 C CG    . HIS D 2 194 ? 14.560  -12.916 -18.724 1.00 46.53 ? 195 HIS B CG    1 
ATOM   3599 N ND1   . HIS D 2 194 ? 15.051  -13.219 -17.473 1.00 50.81 ? 195 HIS B ND1   1 
ATOM   3600 C CD2   . HIS D 2 194 ? 14.649  -14.056 -19.452 1.00 50.92 ? 195 HIS B CD2   1 
ATOM   3601 C CE1   . HIS D 2 194 ? 15.420  -14.488 -17.442 1.00 54.53 ? 195 HIS B CE1   1 
ATOM   3602 N NE2   . HIS D 2 194 ? 15.186  -15.019 -18.631 1.00 53.85 ? 195 HIS B NE2   1 
ATOM   3603 N N     . TYR D 2 195 ? 13.330  -8.802  -17.792 1.00 32.01 ? 196 TYR B N     1 
ATOM   3604 C CA    . TYR D 2 195 ? 13.280  -7.362  -17.954 1.00 31.06 ? 196 TYR B CA    1 
ATOM   3605 C C     . TYR D 2 195 ? 13.307  -6.974  -19.455 1.00 29.32 ? 196 TYR B C     1 
ATOM   3606 O O     . TYR D 2 195 ? 12.486  -6.184  -19.922 1.00 29.75 ? 196 TYR B O     1 
ATOM   3607 C CB    . TYR D 2 195 ? 14.472  -6.729  -17.198 1.00 26.00 ? 196 TYR B CB    1 
ATOM   3608 C CG    . TYR D 2 195 ? 14.667  -5.253  -17.496 1.00 28.58 ? 196 TYR B CG    1 
ATOM   3609 C CD1   . TYR D 2 195 ? 13.733  -4.304  -17.063 1.00 23.33 ? 196 TYR B CD1   1 
ATOM   3610 C CD2   . TYR D 2 195 ? 15.725  -4.816  -18.282 1.00 25.98 ? 196 TYR B CD2   1 
ATOM   3611 C CE1   . TYR D 2 195 ? 13.840  -2.971  -17.411 1.00 22.53 ? 196 TYR B CE1   1 
ATOM   3612 C CE2   . TYR D 2 195 ? 15.845  -3.470  -18.637 1.00 26.24 ? 196 TYR B CE2   1 
ATOM   3613 C CZ    . TYR D 2 195 ? 14.901  -2.555  -18.196 1.00 26.26 ? 196 TYR B CZ    1 
ATOM   3614 O OH    . TYR D 2 195 ? 15.039  -1.224  -18.524 1.00 27.39 ? 196 TYR B OH    1 
ATOM   3615 N N     . LYS D 2 196 ? 14.224  -7.588  -20.199 1.00 33.12 ? 197 LYS B N     1 
ATOM   3616 C CA    . LYS D 2 196 ? 14.410  -7.344  -21.627 1.00 32.52 ? 197 LYS B CA    1 
ATOM   3617 C C     . LYS D 2 196 ? 13.136  -7.577  -22.460 1.00 33.86 ? 197 LYS B C     1 
ATOM   3618 O O     . LYS D 2 196 ? 12.867  -6.828  -23.410 1.00 31.61 ? 197 LYS B O     1 
ATOM   3619 C CB    . LYS D 2 196 ? 15.560  -8.187  -22.143 1.00 33.08 ? 197 LYS B CB    1 
ATOM   3620 N N     . ASP D 2 197 ? 12.343  -8.591  -22.105 1.00 34.09 ? 198 ASP B N     1 
ATOM   3621 C CA    . ASP D 2 197 ? 11.091  -8.846  -22.823 1.00 36.10 ? 198 ASP B CA    1 
ATOM   3622 C C     . ASP D 2 197 ? 10.074  -7.729  -22.575 1.00 37.21 ? 198 ASP B C     1 
ATOM   3623 O O     . ASP D 2 197 ? 9.247   -7.415  -23.449 1.00 35.77 ? 198 ASP B O     1 
ATOM   3624 C CB    . ASP D 2 197 ? 10.489  -10.189 -22.430 1.00 36.36 ? 198 ASP B CB    1 
ATOM   3625 C CG    . ASP D 2 197 ? 11.173  -11.340 -23.105 1.00 41.01 ? 198 ASP B CG    1 
ATOM   3626 O OD1   . ASP D 2 197 ? 11.959  -11.117 -24.057 1.00 42.34 ? 198 ASP B OD1   1 
ATOM   3627 O OD2   . ASP D 2 197 ? 10.932  -12.485 -22.677 1.00 47.51 ? 198 ASP B OD2   1 
ATOM   3628 N N     . PHE D 2 198 ? 10.142  -7.129  -21.382 1.00 33.82 ? 199 PHE B N     1 
ATOM   3629 C CA    . PHE D 2 198 ? 9.251   -6.035  -21.021 1.00 29.01 ? 199 PHE B CA    1 
ATOM   3630 C C     . PHE D 2 198 ? 9.613   -4.856  -21.868 1.00 26.53 ? 199 PHE B C     1 
ATOM   3631 O O     . PHE D 2 198 ? 8.749   -4.284  -22.522 1.00 26.17 ? 199 PHE B O     1 
ATOM   3632 C CB    . PHE D 2 198 ? 9.352   -5.673  -19.524 1.00 29.39 ? 199 PHE B CB    1 
ATOM   3633 C CG    . PHE D 2 198 ? 8.502   -6.542  -18.643 1.00 25.21 ? 199 PHE B CG    1 
ATOM   3634 C CD1   . PHE D 2 198 ? 7.173   -6.224  -18.414 1.00 23.81 ? 199 PHE B CD1   1 
ATOM   3635 C CD2   . PHE D 2 198 ? 8.992   -7.755  -18.166 1.00 25.52 ? 199 PHE B CD2   1 
ATOM   3636 C CE1   . PHE D 2 198 ? 6.338   -7.114  -17.736 1.00 23.28 ? 199 PHE B CE1   1 
ATOM   3637 C CE2   . PHE D 2 198 ? 8.165   -8.648  -17.486 1.00 23.97 ? 199 PHE B CE2   1 
ATOM   3638 C CZ    . PHE D 2 198 ? 6.836   -8.334  -17.276 1.00 19.53 ? 199 PHE B CZ    1 
ATOM   3639 N N     . VAL D 2 199 ? 10.898  -4.525  -21.912 1.00 26.78 ? 200 VAL B N     1 
ATOM   3640 C CA    . VAL D 2 199 ? 11.318  -3.378  -22.710 1.00 26.77 ? 200 VAL B CA    1 
ATOM   3641 C C     . VAL D 2 199 ? 11.065  -3.691  -24.181 1.00 30.80 ? 200 VAL B C     1 
ATOM   3642 O O     . VAL D 2 199 ? 10.604  -2.837  -24.938 1.00 33.26 ? 200 VAL B O     1 
ATOM   3643 C CB    . VAL D 2 199 ? 12.797  -2.971  -22.456 1.00 26.98 ? 200 VAL B CB    1 
ATOM   3644 C CG1   . VAL D 2 199 ? 13.411  -3.801  -21.341 1.00 27.72 ? 200 VAL B CG1   1 
ATOM   3645 C CG2   . VAL D 2 199 ? 13.632  -3.060  -23.730 1.00 26.71 ? 200 VAL B CG2   1 
ATOM   3646 N N     . GLU D 2 200 ? 11.298  -4.941  -24.562 1.00 30.91 ? 201 GLU B N     1 
ATOM   3647 C CA    . GLU D 2 200 ? 11.084  -5.355  -25.936 1.00 33.62 ? 201 GLU B CA    1 
ATOM   3648 C C     . GLU D 2 200 ? 9.607   -5.371  -26.265 1.00 32.89 ? 201 GLU B C     1 
ATOM   3649 O O     . GLU D 2 200 ? 9.224   -5.217  -27.426 1.00 36.83 ? 201 GLU B O     1 
ATOM   3650 C CB    . GLU D 2 200 ? 11.680  -6.742  -26.182 1.00 35.26 ? 201 GLU B CB    1 
ATOM   3651 N N     . GLY D 2 201 ? 8.777   -5.522  -25.242 1.00 32.09 ? 202 GLY B N     1 
ATOM   3652 C CA    . GLY D 2 201 ? 7.346   -5.566  -25.462 1.00 31.61 ? 202 GLY B CA    1 
ATOM   3653 C C     . GLY D 2 201 ? 6.976   -6.892  -26.105 1.00 33.65 ? 202 GLY B C     1 
ATOM   3654 O O     . GLY D 2 201 ? 6.125   -6.959  -27.007 1.00 34.99 ? 202 GLY B O     1 
ATOM   3655 N N     . LYS D 2 202 ? 7.641   -7.954  -25.660 1.00 31.65 ? 203 LYS B N     1 
ATOM   3656 C CA    . LYS D 2 202 ? 7.390   -9.297  -26.168 1.00 29.82 ? 203 LYS B CA    1 
ATOM   3657 C C     . LYS D 2 202 ? 6.157   -9.888  -25.465 1.00 32.65 ? 203 LYS B C     1 
ATOM   3658 O O     . LYS D 2 202 ? 6.267   -10.738 -24.583 1.00 28.77 ? 203 LYS B O     1 
ATOM   3659 C CB    . LYS D 2 202 ? 8.617   -10.164 -25.932 1.00 35.84 ? 203 LYS B CB    1 
ATOM   3660 N N     . GLY D 2 203 ? 4.975   -9.429  -25.859 1.00 31.57 ? 204 GLY B N     1 
ATOM   3661 C CA    . GLY D 2 203 ? 3.772   -9.915  -25.219 1.00 30.52 ? 204 GLY B CA    1 
ATOM   3662 C C     . GLY D 2 203 ? 3.203   -11.195 -25.786 1.00 29.69 ? 204 GLY B C     1 
ATOM   3663 O O     . GLY D 2 203 ? 3.852   -11.899 -26.578 1.00 28.18 ? 204 GLY B O     1 
ATOM   3664 N N     . ILE D 2 204 ? 1.990   -11.512 -25.348 1.00 26.01 ? 205 ILE B N     1 
ATOM   3665 C CA    . ILE D 2 204 ? 1.318   -12.697 -25.822 1.00 26.08 ? 205 ILE B CA    1 
ATOM   3666 C C     . ILE D 2 204 ? 0.101   -12.307 -26.657 1.00 27.54 ? 205 ILE B C     1 
ATOM   3667 O O     . ILE D 2 204 ? -0.410  -13.132 -27.427 1.00 29.85 ? 205 ILE B O     1 
ATOM   3668 C CB    . ILE D 2 204 ? 0.843   -13.628 -24.671 1.00 23.79 ? 205 ILE B CB    1 
ATOM   3669 C CG1   . ILE D 2 204 ? -0.369  -13.039 -23.971 1.00 18.88 ? 205 ILE B CG1   1 
ATOM   3670 C CG2   . ILE D 2 204 ? 1.950   -13.845 -23.662 1.00 29.87 ? 205 ILE B CG2   1 
ATOM   3671 C CD1   . ILE D 2 204 ? -1.008  -13.978 -23.043 1.00 18.25 ? 205 ILE B CD1   1 
ATOM   3672 N N     . PHE D 2 205 ? -0.382  -11.077 -26.493 1.00 25.81 ? 206 PHE B N     1 
ATOM   3673 C CA    . PHE D 2 205 ? -1.562  -10.656 -27.226 1.00 25.80 ? 206 PHE B CA    1 
ATOM   3674 C C     . PHE D 2 205 ? -1.224  -10.109 -28.598 1.00 28.28 ? 206 PHE B C     1 
ATOM   3675 O O     . PHE D 2 205 ? -0.141  -9.534  -28.770 1.00 28.61 ? 206 PHE B O     1 
ATOM   3676 C CB    . PHE D 2 205 ? -2.385  -9.659  -26.414 1.00 25.21 ? 206 PHE B CB    1 
ATOM   3677 C CG    . PHE D 2 205 ? -3.147  -10.290 -25.267 1.00 27.11 ? 206 PHE B CG    1 
ATOM   3678 C CD1   . PHE D 2 205 ? -4.240  -11.145 -25.519 1.00 19.67 ? 206 PHE B CD1   1 
ATOM   3679 C CD2   . PHE D 2 205 ? -2.786  -10.020 -23.923 1.00 24.47 ? 206 PHE B CD2   1 
ATOM   3680 C CE1   . PHE D 2 205 ? -4.948  -11.712 -24.458 1.00 20.32 ? 206 PHE B CE1   1 
ATOM   3681 C CE2   . PHE D 2 205 ? -3.500  -10.588 -22.854 1.00 19.21 ? 206 PHE B CE2   1 
ATOM   3682 C CZ    . PHE D 2 205 ? -4.570  -11.427 -23.111 1.00 14.82 ? 206 PHE B CZ    1 
ATOM   3683 N N     . ASP D 2 206 ? -2.126  -10.346 -29.561 1.00 27.90 ? 207 ASP B N     1 
ATOM   3684 C CA    . ASP D 2 206 ? -1.973  -9.906  -30.960 1.00 28.53 ? 207 ASP B CA    1 
ATOM   3685 C C     . ASP D 2 206 ? -2.350  -8.458  -31.170 1.00 27.00 ? 207 ASP B C     1 
ATOM   3686 O O     . ASP D 2 206 ? -1.977  -7.866  -32.183 1.00 25.96 ? 207 ASP B O     1 
ATOM   3687 C CB    . ASP D 2 206 ? -2.880  -10.711 -31.896 1.00 34.45 ? 207 ASP B CB    1 
ATOM   3688 C CG    . ASP D 2 206 ? -2.364  -12.099 -32.179 1.00 40.84 ? 207 ASP B CG    1 
ATOM   3689 O OD1   . ASP D 2 206 ? -1.127  -12.299 -32.217 1.00 46.21 ? 207 ASP B OD1   1 
ATOM   3690 O OD2   . ASP D 2 206 ? -3.214  -12.996 -32.382 1.00 44.53 ? 207 ASP B OD2   1 
ATOM   3691 N N     . SER D 2 207 ? -3.204  -7.934  -30.293 1.00 21.07 ? 208 SER B N     1 
ATOM   3692 C CA    . SER D 2 207 ? -3.648  -6.560  -30.413 1.00 18.87 ? 208 SER B CA    1 
ATOM   3693 C C     . SER D 2 207 ? -4.218  -6.086  -29.080 1.00 21.02 ? 208 SER B C     1 
ATOM   3694 O O     . SER D 2 207 ? -4.357  -6.869  -28.133 1.00 20.59 ? 208 SER B O     1 
ATOM   3695 C CB    . SER D 2 207 ? -4.724  -6.455  -31.491 1.00 19.16 ? 208 SER B CB    1 
ATOM   3696 O OG    . SER D 2 207 ? -5.995  -6.856  -30.998 1.00 24.78 ? 208 SER B OG    1 
ATOM   3697 N N     . GLU D 2 208 ? -4.513  -4.795  -29.002 1.00 21.45 ? 209 GLU B N     1 
ATOM   3698 C CA    . GLU D 2 208 ? -5.086  -4.227  -27.802 1.00 23.45 ? 209 GLU B CA    1 
ATOM   3699 C C     . GLU D 2 208 ? -6.549  -4.648  -27.725 1.00 20.09 ? 209 GLU B C     1 
ATOM   3700 O O     . GLU D 2 208 ? -7.103  -4.788  -26.638 1.00 22.37 ? 209 GLU B O     1 
ATOM   3701 C CB    . GLU D 2 208 ? -4.955  -2.707  -27.806 1.00 22.34 ? 209 GLU B CB    1 
ATOM   3702 C CG    . GLU D 2 208 ? -5.331  -2.087  -26.476 1.00 23.67 ? 209 GLU B CG    1 
ATOM   3703 C CD    . GLU D 2 208 ? -5.080  -0.604  -26.463 1.00 26.78 ? 209 GLU B CD    1 
ATOM   3704 O OE1   . GLU D 2 208 ? -4.209  -0.155  -27.213 1.00 29.10 ? 209 GLU B OE1   1 
ATOM   3705 O OE2   . GLU D 2 208 ? -5.756  0.132   -25.718 1.00 32.26 ? 209 GLU B OE2   1 
ATOM   3706 N N     . ASP D 2 209 ? -7.156  -4.857  -28.887 1.00 15.86 ? 210 ASP B N     1 
ATOM   3707 C CA    . ASP D 2 209 ? -8.545  -5.312  -28.987 1.00 16.68 ? 210 ASP B CA    1 
ATOM   3708 C C     . ASP D 2 209 ? -8.698  -6.717  -28.373 1.00 11.88 ? 210 ASP B C     1 
ATOM   3709 O O     . ASP D 2 209 ? -9.675  -7.021  -27.682 1.00 13.22 ? 210 ASP B O     1 
ATOM   3710 C CB    . ASP D 2 209 ? -8.978  -5.324  -30.463 1.00 20.94 ? 210 ASP B CB    1 
ATOM   3711 C CG    . ASP D 2 209 ? -10.308 -6.018  -30.678 1.00 31.63 ? 210 ASP B CG    1 
ATOM   3712 O OD1   . ASP D 2 209 ? -11.360 -5.458  -30.298 1.00 34.56 ? 210 ASP B OD1   1 
ATOM   3713 O OD2   . ASP D 2 209 ? -10.308 -7.144  -31.233 1.00 39.56 ? 210 ASP B OD2   1 
ATOM   3714 N N     . GLU D 2 210 ? -7.744  -7.582  -28.659 1.00 12.39 ? 211 GLU B N     1 
ATOM   3715 C CA    . GLU D 2 210 ? -7.774  -8.926  -28.119 1.00 14.65 ? 211 GLU B CA    1 
ATOM   3716 C C     . GLU D 2 210 ? -7.452  -8.904  -26.608 1.00 16.81 ? 211 GLU B C     1 
ATOM   3717 O O     . GLU D 2 210 ? -7.990  -9.713  -25.852 1.00 17.09 ? 211 GLU B O     1 
ATOM   3718 C CB    . GLU D 2 210 ? -6.772  -9.814  -28.867 1.00 16.83 ? 211 GLU B CB    1 
ATOM   3719 C CG    . GLU D 2 210 ? -6.866  -11.308 -28.547 1.00 20.71 ? 211 GLU B CG    1 
ATOM   3720 C CD    . GLU D 2 210 ? -5.664  -12.107 -29.062 1.00 25.01 ? 211 GLU B CD    1 
ATOM   3721 O OE1   . GLU D 2 210 ? -4.492  -11.728 -28.797 1.00 27.00 ? 211 GLU B OE1   1 
ATOM   3722 O OE2   . GLU D 2 210 ? -5.889  -13.154 -29.713 1.00 22.78 ? 211 GLU B OE2   1 
ATOM   3723 N N     . PHE D 2 211 ? -6.513  -8.045  -26.190 1.00 16.07 ? 212 PHE B N     1 
ATOM   3724 C CA    . PHE D 2 211 ? -6.157  -7.906  -24.778 1.00 11.41 ? 212 PHE B CA    1 
ATOM   3725 C C     . PHE D 2 211 ? -7.416  -7.536  -23.974 1.00 14.02 ? 212 PHE B C     1 
ATOM   3726 O O     . PHE D 2 211 ? -7.682  -8.134  -22.926 1.00 16.69 ? 212 PHE B O     1 
ATOM   3727 C CB    . PHE D 2 211 ? -5.085  -6.829  -24.621 1.00 16.81 ? 212 PHE B CB    1 
ATOM   3728 C CG    . PHE D 2 211 ? -5.090  -6.129  -23.259 1.00 19.27 ? 212 PHE B CG    1 
ATOM   3729 C CD1   . PHE D 2 211 ? -4.420  -6.675  -22.166 1.00 21.27 ? 212 PHE B CD1   1 
ATOM   3730 C CD2   . PHE D 2 211 ? -5.767  -4.918  -23.080 1.00 19.67 ? 212 PHE B CD2   1 
ATOM   3731 C CE1   . PHE D 2 211 ? -4.427  -6.014  -20.905 1.00 18.12 ? 212 PHE B CE1   1 
ATOM   3732 C CE2   . PHE D 2 211 ? -5.776  -4.263  -21.824 1.00 19.52 ? 212 PHE B CE2   1 
ATOM   3733 C CZ    . PHE D 2 211 ? -5.105  -4.819  -20.743 1.00 14.51 ? 212 PHE B CZ    1 
ATOM   3734 N N     . LEU D 2 212 ? -8.163  -6.544  -24.456 1.00 12.73 ? 213 LEU B N     1 
ATOM   3735 C CA    . LEU D 2 212 ? -9.378  -6.078  -23.809 1.00 11.32 ? 213 LEU B CA    1 
ATOM   3736 C C     . LEU D 2 212 ? -10.489 -7.118  -23.824 1.00 16.62 ? 213 LEU B C     1 
ATOM   3737 O O     . LEU D 2 212 ? -11.214 -7.261  -22.840 1.00 18.96 ? 213 LEU B O     1 
ATOM   3738 C CB    . LEU D 2 212 ? -9.884  -4.768  -24.436 1.00 10.54 ? 213 LEU B CB    1 
ATOM   3739 C CG    . LEU D 2 212 ? -9.145  -3.451  -24.134 1.00 13.59 ? 213 LEU B CG    1 
ATOM   3740 C CD1   . LEU D 2 212 ? -9.907  -2.383  -24.805 1.00 15.76 ? 213 LEU B CD1   1 
ATOM   3741 C CD2   . LEU D 2 212 ? -9.021  -3.128  -22.626 1.00 13.97 ? 213 LEU B CD2   1 
ATOM   3742 N N     . ASP D 2 213 ? -10.673 -7.806  -24.946 1.00 14.47 ? 214 ASP B N     1 
ATOM   3743 C CA    . ASP D 2 213 ? -11.707 -8.831  -25.015 1.00 15.73 ? 214 ASP B CA    1 
ATOM   3744 C C     . ASP D 2 213 ? -11.348 -10.011 -24.082 1.00 12.82 ? 214 ASP B C     1 
ATOM   3745 O O     . ASP D 2 213 ? -12.189 -10.565 -23.401 1.00 19.45 ? 214 ASP B O     1 
ATOM   3746 C CB    . ASP D 2 213 ? -11.918 -9.323  -26.454 1.00 15.21 ? 214 ASP B CB    1 
ATOM   3747 C CG    . ASP D 2 213 ? -13.172 -10.147 -26.593 1.00 12.69 ? 214 ASP B CG    1 
ATOM   3748 O OD1   . ASP D 2 213 ? -14.248 -9.650  -26.180 1.00 14.54 ? 214 ASP B OD1   1 
ATOM   3749 O OD2   . ASP D 2 213 ? -13.104 -11.306 -27.045 1.00 14.56 ? 214 ASP B OD2   1 
ATOM   3750 N N     . TYR D 2 214 ? -10.098 -10.405 -24.054 1.00 8.13  ? 215 TYR B N     1 
ATOM   3751 C CA    . TYR D 2 214 ? -9.714  -11.459 -23.167 1.00 11.06 ? 215 TYR B CA    1 
ATOM   3752 C C     . TYR D 2 214 ? -10.037 -11.058 -21.698 1.00 15.48 ? 215 TYR B C     1 
ATOM   3753 O O     . TYR D 2 214 ? -10.706 -11.797 -20.998 1.00 13.52 ? 215 TYR B O     1 
ATOM   3754 C CB    . TYR D 2 214 ? -8.224  -11.737 -23.324 1.00 8.28  ? 215 TYR B CB    1 
ATOM   3755 C CG    . TYR D 2 214 ? -7.742  -12.890 -22.481 1.00 15.60 ? 215 TYR B CG    1 
ATOM   3756 C CD1   . TYR D 2 214 ? -7.323  -12.695 -21.140 1.00 13.67 ? 215 TYR B CD1   1 
ATOM   3757 C CD2   . TYR D 2 214 ? -7.701  -14.187 -23.014 1.00 11.48 ? 215 TYR B CD2   1 
ATOM   3758 C CE1   . TYR D 2 214 ? -6.882  -13.763 -20.367 1.00 12.42 ? 215 TYR B CE1   1 
ATOM   3759 C CE2   . TYR D 2 214 ? -7.256  -15.263 -22.250 1.00 11.62 ? 215 TYR B CE2   1 
ATOM   3760 C CZ    . TYR D 2 214 ? -6.849  -15.054 -20.935 1.00 12.96 ? 215 TYR B CZ    1 
ATOM   3761 O OH    . TYR D 2 214 ? -6.423  -16.144 -20.220 1.00 8.37  ? 215 TYR B OH    1 
ATOM   3762 N N     . TRP D 2 215 ? -9.598  -9.890  -21.233 1.00 15.34 ? 216 TRP B N     1 
ATOM   3763 C CA    . TRP D 2 215 ? -9.856  -9.512  -19.842 1.00 15.18 ? 216 TRP B CA    1 
ATOM   3764 C C     . TRP D 2 215 ? -11.274 -9.073  -19.501 1.00 17.95 ? 216 TRP B C     1 
ATOM   3765 O O     . TRP D 2 215 ? -11.679 -9.107  -18.322 1.00 17.02 ? 216 TRP B O     1 
ATOM   3766 C CB    . TRP D 2 215 ? -8.830  -8.516  -19.355 1.00 7.09  ? 216 TRP B CB    1 
ATOM   3767 C CG    . TRP D 2 215 ? -7.550  -9.174  -19.215 1.00 9.12  ? 216 TRP B CG    1 
ATOM   3768 C CD1   . TRP D 2 215 ? -6.487  -9.115  -20.084 1.00 12.51 ? 216 TRP B CD1   1 
ATOM   3769 C CD2   . TRP D 2 215 ? -7.171  -10.089 -18.177 1.00 12.34 ? 216 TRP B CD2   1 
ATOM   3770 N NE1   . TRP D 2 215 ? -5.475  -9.950  -19.659 1.00 11.71 ? 216 TRP B NE1   1 
ATOM   3771 C CE2   . TRP D 2 215 ? -5.864  -10.562 -18.491 1.00 15.30 ? 216 TRP B CE2   1 
ATOM   3772 C CE3   . TRP D 2 215 ? -7.806  -10.560 -17.015 1.00 6.76  ? 216 TRP B CE3   1 
ATOM   3773 C CZ2   . TRP D 2 215 ? -5.184  -11.495 -17.683 1.00 10.29 ? 216 TRP B CZ2   1 
ATOM   3774 C CZ3   . TRP D 2 215 ? -7.131  -11.483 -16.214 1.00 8.91  ? 216 TRP B CZ3   1 
ATOM   3775 C CH2   . TRP D 2 215 ? -5.831  -11.941 -16.555 1.00 10.62 ? 216 TRP B CH2   1 
ATOM   3776 N N     . ARG D 2 216 ? -12.062 -8.767  -20.531 1.00 18.88 ? 217 ARG B N     1 
ATOM   3777 C CA    . ARG D 2 216 ? -13.436 -8.365  -20.323 1.00 15.40 ? 217 ARG B CA    1 
ATOM   3778 C C     . ARG D 2 216 ? -14.345 -9.539  -20.049 1.00 14.42 ? 217 ARG B C     1 
ATOM   3779 O O     . ARG D 2 216 ? -15.386 -9.383  -19.427 1.00 10.52 ? 217 ARG B O     1 
ATOM   3780 C CB    . ARG D 2 216 ? -13.959 -7.631  -21.555 1.00 21.53 ? 217 ARG B CB    1 
ATOM   3781 C CG    . ARG D 2 216 ? -13.389 -6.237  -21.675 1.00 22.64 ? 217 ARG B CG    1 
ATOM   3782 C CD    . ARG D 2 216 ? -13.911 -5.484  -22.858 1.00 25.64 ? 217 ARG B CD    1 
ATOM   3783 N NE    . ARG D 2 216 ? -13.924 -4.069  -22.510 1.00 29.32 ? 217 ARG B NE    1 
ATOM   3784 C CZ    . ARG D 2 216 ? -13.595 -3.080  -23.329 1.00 30.82 ? 217 ARG B CZ    1 
ATOM   3785 N NH1   . ARG D 2 216 ? -13.229 -3.349  -24.569 1.00 31.56 ? 217 ARG B NH1   1 
ATOM   3786 N NH2   . ARG D 2 216 ? -13.628 -1.823  -22.899 1.00 33.89 ? 217 ARG B NH2   1 
ATOM   3787 N N     . ASN D 2 217 ? -13.927 -10.722 -20.474 1.00 14.41 ? 218 ASN B N     1 
ATOM   3788 C CA    . ASN D 2 217 ? -14.752 -11.915 -20.347 1.00 18.30 ? 218 ASN B CA    1 
ATOM   3789 C C     . ASN D 2 217 ? -14.111 -12.951 -19.442 1.00 19.42 ? 218 ASN B C     1 
ATOM   3790 O O     . ASN D 2 217 ? -14.549 -14.117 -19.386 1.00 20.96 ? 218 ASN B O     1 
ATOM   3791 C CB    . ASN D 2 217 ? -15.000 -12.525 -21.748 1.00 19.77 ? 218 ASN B CB    1 
ATOM   3792 C CG    . ASN D 2 217 ? -15.827 -11.617 -22.650 1.00 18.24 ? 218 ASN B CG    1 
ATOM   3793 O OD1   . ASN D 2 217 ? -17.013 -11.419 -22.427 1.00 18.74 ? 218 ASN B OD1   1 
ATOM   3794 N ND2   . ASN D 2 217 ? -15.196 -11.056 -23.662 1.00 21.92 ? 218 ASN B ND2   1 
ATOM   3795 N N     . TYR D 2 218 ? -13.062 -12.533 -18.748 1.00 17.72 ? 219 TYR B N     1 
ATOM   3796 C CA    . TYR D 2 218 ? -12.344 -13.418 -17.830 1.00 20.46 ? 219 TYR B CA    1 
ATOM   3797 C C     . TYR D 2 218 ? -13.233 -13.746 -16.626 1.00 20.11 ? 219 TYR B C     1 
ATOM   3798 O O     . TYR D 2 218 ? -13.903 -12.841 -16.082 1.00 21.10 ? 219 TYR B O     1 
ATOM   3799 C CB    . TYR D 2 218 ? -11.083 -12.712 -17.336 1.00 11.75 ? 219 TYR B CB    1 
ATOM   3800 C CG    . TYR D 2 218 ? -10.101 -13.621 -16.631 1.00 12.76 ? 219 TYR B CG    1 
ATOM   3801 C CD1   . TYR D 2 218 ? -9.228  -14.433 -17.370 1.00 9.37  ? 219 TYR B CD1   1 
ATOM   3802 C CD2   . TYR D 2 218 ? -9.984  -13.621 -15.215 1.00 6.36  ? 219 TYR B CD2   1 
ATOM   3803 C CE1   . TYR D 2 218 ? -8.249  -15.216 -16.715 1.00 16.98 ? 219 TYR B CE1   1 
ATOM   3804 C CE2   . TYR D 2 218 ? -9.007  -14.397 -14.559 1.00 7.32  ? 219 TYR B CE2   1 
ATOM   3805 C CZ    . TYR D 2 218 ? -8.142  -15.183 -15.297 1.00 10.71 ? 219 TYR B CZ    1 
ATOM   3806 O OH    . TYR D 2 218 ? -7.145  -15.920 -14.678 1.00 13.36 ? 219 TYR B OH    1 
ATOM   3807 N N     . GLU D 2 219 ? -13.290 -15.018 -16.240 1.00 17.67 ? 220 GLU B N     1 
ATOM   3808 C CA    . GLU D 2 219 ? -14.073 -15.367 -15.061 1.00 23.15 ? 220 GLU B CA    1 
ATOM   3809 C C     . GLU D 2 219 ? -13.166 -15.273 -13.811 1.00 23.51 ? 220 GLU B C     1 
ATOM   3810 O O     . GLU D 2 219 ? -11.937 -15.467 -13.898 1.00 25.90 ? 220 GLU B O     1 
ATOM   3811 C CB    . GLU D 2 219 ? -14.716 -16.742 -15.234 1.00 21.03 ? 220 GLU B CB    1 
ATOM   3812 C CG    . GLU D 2 219 ? -15.762 -16.759 -16.314 1.00 21.80 ? 220 GLU B CG    1 
ATOM   3813 C CD    . GLU D 2 219 ? -16.995 -15.934 -15.980 1.00 25.72 ? 220 GLU B CD    1 
ATOM   3814 O OE1   . GLU D 2 219 ? -17.386 -15.865 -14.798 1.00 31.47 ? 220 GLU B OE1   1 
ATOM   3815 O OE2   . GLU D 2 219 ? -17.602 -15.350 -16.900 1.00 29.90 ? 220 GLU B OE2   1 
ATOM   3816 N N     . ARG D 2 220 ? -13.744 -14.938 -12.661 1.00 26.94 ? 221 ARG B N     1 
ATOM   3817 C CA    . ARG D 2 220 ? -12.937 -14.770 -11.450 1.00 31.55 ? 221 ARG B CA    1 
ATOM   3818 C C     . ARG D 2 220 ? -12.228 -15.996 -10.864 1.00 35.58 ? 221 ARG B C     1 
ATOM   3819 O O     . ARG D 2 220 ? -11.059 -15.919 -10.463 1.00 36.99 ? 221 ARG B O     1 
ATOM   3820 C CB    . ARG D 2 220 ? -13.746 -14.049 -10.376 1.00 31.89 ? 221 ARG B CB    1 
ATOM   3821 C CG    . ARG D 2 220 ? -13.921 -12.565 -10.635 1.00 33.27 ? 221 ARG B CG    1 
ATOM   3822 C CD    . ARG D 2 220 ? -15.373 -12.203 -10.476 1.00 35.63 ? 221 ARG B CD    1 
ATOM   3823 N NE    . ARG D 2 220 ? -15.708 -10.892 -11.024 1.00 39.29 ? 221 ARG B NE    1 
ATOM   3824 C CZ    . ARG D 2 220 ? -16.774 -10.657 -11.787 1.00 41.34 ? 221 ARG B CZ    1 
ATOM   3825 N NH1   . ARG D 2 220 ? -17.605 -11.645 -12.107 1.00 41.50 ? 221 ARG B NH1   1 
ATOM   3826 N NH2   . ARG D 2 220 ? -17.043 -9.423  -12.193 1.00 46.02 ? 221 ARG B NH2   1 
ATOM   3827 N N     . THR D 2 221 ? -12.909 -17.136 -10.853 1.00 40.25 ? 222 THR B N     1 
ATOM   3828 C CA    . THR D 2 221 ? -12.342 -18.364 -10.294 1.00 43.17 ? 222 THR B CA    1 
ATOM   3829 C C     . THR D 2 221 ? -12.011 -19.388 -11.378 1.00 45.93 ? 222 THR B C     1 
ATOM   3830 O O     . THR D 2 221 ? -12.531 -19.319 -12.499 1.00 45.02 ? 222 THR B O     1 
ATOM   3831 C CB    . THR D 2 221 ? -13.327 -19.021 -9.321  1.00 44.01 ? 222 THR B CB    1 
ATOM   3832 O OG1   . THR D 2 221 ? -14.285 -19.801 -10.063 1.00 46.11 ? 222 THR B OG1   1 
ATOM   3833 C CG2   . THR D 2 221 ? -14.062 -17.939 -8.505  1.00 41.70 ? 222 THR B CG2   1 
ATOM   3834 N N     . SER D 2 222 ? -11.164 -20.352 -11.035 1.00 44.71 ? 223 SER B N     1 
ATOM   3835 C CA    . SER D 2 222 ? -10.784 -21.396 -11.981 1.00 47.21 ? 223 SER B CA    1 
ATOM   3836 C C     . SER D 2 222 ? -11.962 -22.284 -12.460 1.00 47.70 ? 223 SER B C     1 
ATOM   3837 O O     . SER D 2 222 ? -12.089 -22.566 -13.650 1.00 50.34 ? 223 SER B O     1 
ATOM   3838 C CB    . SER D 2 222 ? -9.673  -22.268 -11.381 1.00 45.36 ? 223 SER B CB    1 
ATOM   3839 O OG    . SER D 2 222 ? -8.506  -21.503 -11.168 1.00 45.16 ? 223 SER B OG    1 
ATOM   3840 N N     . GLN D 2 223 ? -12.841 -22.684 -11.546 1.00 45.02 ? 224 GLN B N     1 
ATOM   3841 C CA    . GLN D 2 223 ? -13.965 -23.543 -11.894 1.00 42.69 ? 224 GLN B CA    1 
ATOM   3842 C C     . GLN D 2 223 ? -14.873 -22.913 -12.964 1.00 42.01 ? 224 GLN B C     1 
ATOM   3843 O O     . GLN D 2 223 ? -15.427 -23.608 -13.824 1.00 34.11 ? 224 GLN B O     1 
ATOM   3844 C CB    . GLN D 2 223 ? -14.755 -23.868 -10.632 1.00 44.92 ? 224 GLN B CB    1 
ATOM   3845 N N     . LEU D 2 224 ? -15.040 -21.591 -12.865 1.00 43.00 ? 225 LEU B N     1 
ATOM   3846 C CA    . LEU D 2 224 ? -15.854 -20.802 -13.793 1.00 40.27 ? 225 LEU B CA    1 
ATOM   3847 C C     . LEU D 2 224 ? -15.113 -20.558 -15.087 1.00 37.70 ? 225 LEU B C     1 
ATOM   3848 O O     . LEU D 2 224 ? -15.727 -20.303 -16.142 1.00 39.89 ? 225 LEU B O     1 
ATOM   3849 C CB    . LEU D 2 224 ? -16.219 -19.469 -13.164 1.00 40.41 ? 225 LEU B CB    1 
ATOM   3850 C CG    . LEU D 2 224 ? -17.378 -19.538 -12.178 1.00 44.27 ? 225 LEU B CG    1 
ATOM   3851 C CD1   . LEU D 2 224 ? -17.467 -18.205 -11.459 1.00 47.49 ? 225 LEU B CD1   1 
ATOM   3852 C CD2   . LEU D 2 224 ? -18.686 -19.872 -12.906 1.00 41.02 ? 225 LEU B CD2   1 
ATOM   3853 N N     . ARG D 2 225 ? -13.786 -20.577 -14.971 1.00 33.13 ? 226 ARG B N     1 
ATOM   3854 C CA    . ARG D 2 225 ? -12.895 -20.402 -16.102 1.00 27.75 ? 226 ARG B CA    1 
ATOM   3855 C C     . ARG D 2 225 ? -12.681 -21.725 -16.782 1.00 27.35 ? 226 ARG B C     1 
ATOM   3856 O O     . ARG D 2 225 ? -12.281 -21.762 -17.931 1.00 26.52 ? 226 ARG B O     1 
ATOM   3857 C CB    . ARG D 2 225 ? -11.546 -19.882 -15.651 1.00 23.56 ? 226 ARG B CB    1 
ATOM   3858 C CG    . ARG D 2 225 ? -11.581 -18.426 -15.318 1.00 21.17 ? 226 ARG B CG    1 
ATOM   3859 C CD    . ARG D 2 225 ? -10.251 -17.778 -15.497 1.00 16.48 ? 226 ARG B CD    1 
ATOM   3860 N NE    . ARG D 2 225 ? -9.232  -18.319 -14.590 1.00 24.92 ? 226 ARG B NE    1 
ATOM   3861 C CZ    . ARG D 2 225 ? -9.205  -18.141 -13.267 1.00 28.46 ? 226 ARG B CZ    1 
ATOM   3862 N NH1   . ARG D 2 225 ? -10.143 -17.411 -12.655 1.00 24.49 ? 226 ARG B NH1   1 
ATOM   3863 N NH2   . ARG D 2 225 ? -8.216  -18.687 -12.561 1.00 30.31 ? 226 ARG B NH2   1 
ATOM   3864 N N     . ASN D 2 226 ? -12.945 -22.805 -16.053 1.00 25.24 ? 227 ASN B N     1 
ATOM   3865 C CA    . ASN D 2 226 ? -12.770 -24.157 -16.555 1.00 27.75 ? 227 ASN B CA    1 
ATOM   3866 C C     . ASN D 2 226 ? -13.682 -24.497 -17.754 1.00 28.16 ? 227 ASN B C     1 
ATOM   3867 O O     . ASN D 2 226 ? -13.299 -25.282 -18.624 1.00 28.10 ? 227 ASN B O     1 
ATOM   3868 C CB    . ASN D 2 226 ? -12.959 -25.164 -15.406 1.00 28.67 ? 227 ASN B CB    1 
ATOM   3869 N N     . ASP D 2 227 ? -14.870 -23.892 -17.796 1.00 27.64 ? 228 ASP B N     1 
ATOM   3870 C CA    . ASP D 2 227 ? -15.822 -24.111 -18.869 1.00 30.53 ? 228 ASP B CA    1 
ATOM   3871 C C     . ASP D 2 227 ? -15.949 -22.856 -19.748 1.00 32.87 ? 228 ASP B C     1 
ATOM   3872 O O     . ASP D 2 227 ? -17.008 -22.574 -20.331 1.00 36.08 ? 228 ASP B O     1 
ATOM   3873 C CB    . ASP D 2 227 ? -17.180 -24.516 -18.292 1.00 36.12 ? 228 ASP B CB    1 
ATOM   3874 N N     . LYS D 2 228 ? -14.860 -22.087 -19.806 1.00 30.63 ? 229 LYS B N     1 
ATOM   3875 C CA    . LYS D 2 228 ? -14.769 -20.874 -20.622 1.00 24.47 ? 229 LYS B CA    1 
ATOM   3876 C C     . LYS D 2 228 ? -13.338 -20.923 -21.110 1.00 21.71 ? 229 LYS B C     1 
ATOM   3877 O O     . LYS D 2 228 ? -13.044 -21.621 -22.077 1.00 25.17 ? 229 LYS B O     1 
ATOM   3878 C CB    . LYS D 2 228 ? -15.050 -19.622 -19.792 1.00 28.23 ? 229 LYS B CB    1 
ATOM   3879 C CG    . LYS D 2 228 ? -15.488 -18.426 -20.630 1.00 25.64 ? 229 LYS B CG    1 
ATOM   3880 C CD    . LYS D 2 228 ? -16.563 -17.605 -19.940 1.00 19.88 ? 229 LYS B CD    1 
ATOM   3881 C CE    . LYS D 2 228 ? -16.813 -16.325 -20.706 1.00 23.18 ? 229 LYS B CE    1 
ATOM   3882 N NZ    . LYS D 2 228 ? -17.539 -15.325 -19.899 1.00 22.61 ? 229 LYS B NZ    1 
ATOM   3883 N N     . TYR D 2 229 ? -12.428 -20.251 -20.426 1.00 20.23 ? 230 TYR B N     1 
ATOM   3884 C CA    . TYR D 2 229 ? -11.015 -20.310 -20.815 1.00 22.22 ? 230 TYR B CA    1 
ATOM   3885 C C     . TYR D 2 229 ? -10.125 -19.847 -19.660 1.00 25.47 ? 230 TYR B C     1 
ATOM   3886 O O     . TYR D 2 229 ? -10.563 -19.007 -18.851 1.00 23.74 ? 230 TYR B O     1 
ATOM   3887 C CB    . TYR D 2 229 ? -10.746 -19.454 -22.079 1.00 23.27 ? 230 TYR B CB    1 
ATOM   3888 C CG    . TYR D 2 229 ? -11.119 -17.982 -21.997 1.00 16.85 ? 230 TYR B CG    1 
ATOM   3889 C CD1   . TYR D 2 229 ? -12.402 -17.545 -22.335 1.00 16.15 ? 230 TYR B CD1   1 
ATOM   3890 C CD2   . TYR D 2 229 ? -10.177 -17.029 -21.583 1.00 20.45 ? 230 TYR B CD2   1 
ATOM   3891 C CE1   . TYR D 2 229 ? -12.749 -16.183 -22.264 1.00 18.31 ? 230 TYR B CE1   1 
ATOM   3892 C CE2   . TYR D 2 229 ? -10.506 -15.662 -21.502 1.00 15.86 ? 230 TYR B CE2   1 
ATOM   3893 C CZ    . TYR D 2 229 ? -11.780 -15.249 -21.848 1.00 19.22 ? 230 TYR B CZ    1 
ATOM   3894 O OH    . TYR D 2 229 ? -12.069 -13.914 -21.858 1.00 14.75 ? 230 TYR B OH    1 
ATOM   3895 N N     . ASN D 2 230 ? -8.930  -20.427 -19.523 1.00 24.53 ? 231 ASN B N     1 
ATOM   3896 C CA    . ASN D 2 230 ? -8.037  -19.963 -18.469 1.00 27.79 ? 231 ASN B CA    1 
ATOM   3897 C C     . ASN D 2 230 ? -6.692  -19.514 -19.030 1.00 25.66 ? 231 ASN B C     1 
ATOM   3898 O O     . ASN D 2 230 ? -5.812  -19.096 -18.291 1.00 26.79 ? 231 ASN B O     1 
ATOM   3899 C CB    . ASN D 2 230 ? -7.870  -21.003 -17.359 1.00 35.91 ? 231 ASN B CB    1 
ATOM   3900 C CG    . ASN D 2 230 ? -7.666  -20.363 -15.949 1.00 38.70 ? 231 ASN B CG    1 
ATOM   3901 O OD1   . ASN D 2 230 ? -6.895  -19.428 -15.764 1.00 32.02 ? 231 ASN B OD1   1 
ATOM   3902 N ND2   . ASN D 2 230 ? -8.405  -20.867 -14.964 1.00 42.05 ? 231 ASN B ND2   1 
ATOM   3903 N N     . ASN D 2 231 ? -6.545  -19.583 -20.348 1.00 23.67 ? 232 ASN B N     1 
ATOM   3904 C CA    . ASN D 2 231 ? -5.316  -19.143 -21.033 1.00 24.08 ? 232 ASN B CA    1 
ATOM   3905 C C     . ASN D 2 231 ? -5.614  -18.678 -22.482 1.00 23.10 ? 232 ASN B C     1 
ATOM   3906 O O     . ASN D 2 231 ? -6.737  -18.802 -22.984 1.00 22.64 ? 232 ASN B O     1 
ATOM   3907 C CB    . ASN D 2 231 ? -4.279  -20.251 -21.044 1.00 23.19 ? 232 ASN B CB    1 
ATOM   3908 C CG    . ASN D 2 231 ? -4.720  -21.427 -21.867 1.00 23.18 ? 232 ASN B CG    1 
ATOM   3909 O OD1   . ASN D 2 231 ? -5.102  -21.279 -23.027 1.00 24.51 ? 232 ASN B OD1   1 
ATOM   3910 N ND2   . ASN D 2 231 ? -4.696  -22.599 -21.268 1.00 26.67 ? 232 ASN B ND2   1 
ATOM   3911 N N     . ILE D 2 232 ? -4.594  -18.181 -23.160 1.00 23.62 ? 233 ILE B N     1 
ATOM   3912 C CA    . ILE D 2 232 ? -4.766  -17.656 -24.501 1.00 22.79 ? 233 ILE B CA    1 
ATOM   3913 C C     . ILE D 2 232 ? -5.265  -18.710 -25.533 1.00 22.07 ? 233 ILE B C     1 
ATOM   3914 O O     . ILE D 2 232 ? -6.135  -18.401 -26.359 1.00 18.64 ? 233 ILE B O     1 
ATOM   3915 C CB    . ILE D 2 232 ? -3.472  -16.882 -24.941 1.00 20.81 ? 233 ILE B CB    1 
ATOM   3916 C CG1   . ILE D 2 232 ? -3.734  -15.997 -26.161 1.00 19.51 ? 233 ILE B CG1   1 
ATOM   3917 C CG2   . ILE D 2 232 ? -2.346  -17.835 -25.182 1.00 18.52 ? 233 ILE B CG2   1 
ATOM   3918 C CD1   . ILE D 2 232 ? -4.860  -15.004 -25.941 1.00 16.64 ? 233 ILE B CD1   1 
ATOM   3919 N N     . SER D 2 233 ? -4.746  -19.937 -25.465 1.00 20.84 ? 234 SER B N     1 
ATOM   3920 C CA    . SER D 2 233 ? -5.171  -21.007 -26.379 1.00 21.96 ? 234 SER B CA    1 
ATOM   3921 C C     . SER D 2 233 ? -6.672  -21.191 -26.266 1.00 22.30 ? 234 SER B C     1 
ATOM   3922 O O     . SER D 2 233 ? -7.414  -21.130 -27.265 1.00 22.46 ? 234 SER B O     1 
ATOM   3923 C CB    . SER D 2 233 ? -4.503  -22.329 -26.004 1.00 19.40 ? 234 SER B CB    1 
ATOM   3924 O OG    . SER D 2 233 ? -3.091  -22.228 -26.053 1.00 30.82 ? 234 SER B OG    1 
ATOM   3925 N N     . GLU D 2 234 ? -7.117  -21.357 -25.022 1.00 22.41 ? 235 GLU B N     1 
ATOM   3926 C CA    . GLU D 2 234 ? -8.521  -21.552 -24.707 1.00 20.96 ? 235 GLU B CA    1 
ATOM   3927 C C     . GLU D 2 234 ? -9.477  -20.443 -25.160 1.00 19.63 ? 235 GLU B C     1 
ATOM   3928 O O     . GLU D 2 234 ? -10.593 -20.712 -25.632 1.00 23.32 ? 235 GLU B O     1 
ATOM   3929 C CB    . GLU D 2 234 ? -8.656  -21.834 -23.215 1.00 21.69 ? 235 GLU B CB    1 
ATOM   3930 C CG    . GLU D 2 234 ? -8.413  -23.309 -22.935 1.00 21.83 ? 235 GLU B CG    1 
ATOM   3931 C CD    . GLU D 2 234 ? -7.984  -23.602 -21.514 1.00 26.53 ? 235 GLU B CD    1 
ATOM   3932 O OE1   . GLU D 2 234 ? -8.705  -23.206 -20.571 1.00 21.73 ? 235 GLU B OE1   1 
ATOM   3933 O OE2   . GLU D 2 234 ? -6.908  -24.224 -21.351 1.00 24.23 ? 235 GLU B OE2   1 
ATOM   3934 N N     . TYR D 2 235 ? -9.039  -19.201 -25.011 1.00 16.78 ? 236 TYR B N     1 
ATOM   3935 C CA    . TYR D 2 235 ? -9.816  -18.028 -25.406 1.00 13.65 ? 236 TYR B CA    1 
ATOM   3936 C C     . TYR D 2 235 ? -10.080 -18.001 -26.914 1.00 7.99  ? 236 TYR B C     1 
ATOM   3937 O O     . TYR D 2 235 ? -11.095 -17.504 -27.376 1.00 12.24 ? 236 TYR B O     1 
ATOM   3938 C CB    . TYR D 2 235 ? -8.984  -16.804 -25.052 1.00 13.05 ? 236 TYR B CB    1 
ATOM   3939 C CG    . TYR D 2 235 ? -9.434  -15.568 -25.736 1.00 4.92  ? 236 TYR B CG    1 
ATOM   3940 C CD1   . TYR D 2 235 ? -10.594 -14.936 -25.341 1.00 8.84  ? 236 TYR B CD1   1 
ATOM   3941 C CD2   . TYR D 2 235 ? -8.690  -15.021 -26.757 1.00 7.23  ? 236 TYR B CD2   1 
ATOM   3942 C CE1   . TYR D 2 235 ? -11.012 -13.764 -25.942 1.00 14.89 ? 236 TYR B CE1   1 
ATOM   3943 C CE2   . TYR D 2 235 ? -9.101  -13.863 -27.373 1.00 13.60 ? 236 TYR B CE2   1 
ATOM   3944 C CZ    . TYR D 2 235 ? -10.253 -13.245 -26.958 1.00 10.42 ? 236 TYR B CZ    1 
ATOM   3945 O OH    . TYR D 2 235 ? -10.644 -12.100 -27.543 1.00 15.60 ? 236 TYR B OH    1 
ATOM   3946 N N     . ARG D 2 236 ? -9.034  -18.345 -27.647 1.00 14.42 ? 237 ARG B N     1 
ATOM   3947 C CA    . ARG D 2 236 ? -9.060  -18.399 -29.092 1.00 19.39 ? 237 ARG B CA    1 
ATOM   3948 C C     . ARG D 2 236 ? -10.018 -19.525 -29.539 1.00 18.70 ? 237 ARG B C     1 
ATOM   3949 O O     . ARG D 2 236 ? -10.814 -19.316 -30.447 1.00 20.84 ? 237 ARG B O     1 
ATOM   3950 C CB    . ARG D 2 236 ? -7.617  -18.549 -29.626 1.00 14.35 ? 237 ARG B CB    1 
ATOM   3951 C CG    . ARG D 2 236 ? -6.825  -17.249 -29.401 1.00 20.27 ? 237 ARG B CG    1 
ATOM   3952 C CD    . ARG D 2 236 ? -5.391  -17.210 -29.974 1.00 25.62 ? 237 ARG B CD    1 
ATOM   3953 N NE    . ARG D 2 236 ? -4.825  -15.843 -29.914 1.00 26.43 ? 237 ARG B NE    1 
ATOM   3954 C CZ    . ARG D 2 236 ? -3.561  -15.547 -29.610 1.00 25.25 ? 237 ARG B CZ    1 
ATOM   3955 N NH1   . ARG D 2 236 ? -2.699  -16.528 -29.346 1.00 26.54 ? 237 ARG B NH1   1 
ATOM   3956 N NH2   . ARG D 2 236 ? -3.185  -14.271 -29.487 1.00 23.29 ? 237 ARG B NH2   1 
ATOM   3957 N N     . ASN D 2 237 ? -9.995  -20.668 -28.840 1.00 20.59 ? 238 ASN B N     1 
ATOM   3958 C CA    . ASN D 2 237 ? -10.877 -21.796 -29.155 1.00 17.87 ? 238 ASN B CA    1 
ATOM   3959 C C     . ASN D 2 237 ? -12.311 -21.462 -28.819 1.00 18.72 ? 238 ASN B C     1 
ATOM   3960 O O     . ASN D 2 237 ? -13.237 -21.901 -29.504 1.00 19.53 ? 238 ASN B O     1 
ATOM   3961 C CB    . ASN D 2 237 ? -10.446 -23.071 -28.440 1.00 19.12 ? 238 ASN B CB    1 
ATOM   3962 C CG    . ASN D 2 237 ? -11.120 -24.319 -29.030 1.00 23.92 ? 238 ASN B CG    1 
ATOM   3963 O OD1   . ASN D 2 237 ? -12.276 -24.601 -28.725 1.00 22.48 ? 238 ASN B OD1   1 
ATOM   3964 N ND2   . ASN D 2 237 ? -10.396 -25.057 -29.895 1.00 20.74 ? 238 ASN B ND2   1 
ATOM   3965 N N     . TRP D 2 238 ? -12.482 -20.660 -27.768 1.00 17.79 ? 239 TRP B N     1 
ATOM   3966 C CA    . TRP D 2 238 ? -13.790 -20.158 -27.296 1.00 18.57 ? 239 TRP B CA    1 
ATOM   3967 C C     . TRP D 2 238 ? -14.421 -19.161 -28.344 1.00 17.91 ? 239 TRP B C     1 
ATOM   3968 O O     . TRP D 2 238 ? -15.642 -19.104 -28.538 1.00 13.32 ? 239 TRP B O     1 
ATOM   3969 C CB    . TRP D 2 238 ? -13.557 -19.486 -25.902 1.00 15.68 ? 239 TRP B CB    1 
ATOM   3970 C CG    . TRP D 2 238 ? -14.733 -18.808 -25.255 1.00 13.08 ? 239 TRP B CG    1 
ATOM   3971 C CD1   . TRP D 2 238 ? -15.779 -19.414 -24.639 1.00 15.40 ? 239 TRP B CD1   1 
ATOM   3972 C CD2   . TRP D 2 238 ? -15.011 -17.397 -25.212 1.00 14.60 ? 239 TRP B CD2   1 
ATOM   3973 N NE1   . TRP D 2 238 ? -16.700 -18.486 -24.241 1.00 16.03 ? 239 TRP B NE1   1 
ATOM   3974 C CE2   . TRP D 2 238 ? -16.254 -17.239 -24.577 1.00 14.63 ? 239 TRP B CE2   1 
ATOM   3975 C CE3   . TRP D 2 238 ? -14.337 -16.259 -25.663 1.00 16.21 ? 239 TRP B CE3   1 
ATOM   3976 C CZ2   . TRP D 2 238 ? -16.842 -15.996 -24.380 1.00 19.73 ? 239 TRP B CZ2   1 
ATOM   3977 C CZ3   . TRP D 2 238 ? -14.924 -15.019 -25.470 1.00 15.53 ? 239 TRP B CZ3   1 
ATOM   3978 C CH2   . TRP D 2 238 ? -16.164 -14.899 -24.834 1.00 18.79 ? 239 TRP B CH2   1 
ATOM   3979 N N     . ILE D 2 239 ? -13.572 -18.357 -28.984 1.00 21.96 ? 240 ILE B N     1 
ATOM   3980 C CA    . ILE D 2 239 ? -14.016 -17.398 -30.001 1.00 25.31 ? 240 ILE B CA    1 
ATOM   3981 C C     . ILE D 2 239 ? -14.503 -18.224 -31.174 1.00 24.24 ? 240 ILE B C     1 
ATOM   3982 O O     . ILE D 2 239 ? -15.613 -18.026 -31.623 1.00 26.17 ? 240 ILE B O     1 
ATOM   3983 C CB    . ILE D 2 239 ? -12.870 -16.476 -30.509 1.00 28.03 ? 240 ILE B CB    1 
ATOM   3984 C CG1   . ILE D 2 239 ? -12.376 -15.545 -29.391 1.00 24.43 ? 240 ILE B CG1   1 
ATOM   3985 C CG2   . ILE D 2 239 ? -13.353 -15.671 -31.726 1.00 27.22 ? 240 ILE B CG2   1 
ATOM   3986 C CD1   . ILE D 2 239 ? -13.451 -14.682 -28.838 1.00 27.71 ? 240 ILE B CD1   1 
ATOM   3987 N N     . TYR D 2 240 ? -13.678 -19.159 -31.647 1.00 23.22 ? 241 TYR B N     1 
ATOM   3988 C CA    . TYR D 2 240 ? -14.059 -20.040 -32.758 1.00 24.57 ? 241 TYR B CA    1 
ATOM   3989 C C     . TYR D 2 240 ? -15.403 -20.742 -32.453 1.00 26.63 ? 241 TYR B C     1 
ATOM   3990 O O     . TYR D 2 240 ? -16.273 -20.861 -33.328 1.00 26.16 ? 241 TYR B O     1 
ATOM   3991 C CB    . TYR D 2 240 ? -12.956 -21.083 -33.015 1.00 22.59 ? 241 TYR B CB    1 
ATOM   3992 C CG    . TYR D 2 240 ? -13.456 -22.364 -33.662 1.00 26.06 ? 241 TYR B CG    1 
ATOM   3993 C CD1   . TYR D 2 240 ? -13.761 -22.423 -35.039 1.00 26.64 ? 241 TYR B CD1   1 
ATOM   3994 C CD2   . TYR D 2 240 ? -13.695 -23.499 -32.889 1.00 26.64 ? 241 TYR B CD2   1 
ATOM   3995 C CE1   . TYR D 2 240 ? -14.297 -23.576 -35.608 1.00 21.88 ? 241 TYR B CE1   1 
ATOM   3996 C CE2   . TYR D 2 240 ? -14.234 -24.654 -33.453 1.00 23.80 ? 241 TYR B CE2   1 
ATOM   3997 C CZ    . TYR D 2 240 ? -14.532 -24.679 -34.802 1.00 21.04 ? 241 TYR B CZ    1 
ATOM   3998 O OH    . TYR D 2 240 ? -15.111 -25.807 -35.312 1.00 17.86 ? 241 TYR B OH    1 
ATOM   3999 N N     . ARG D 2 241 ? -15.562 -21.184 -31.203 1.00 28.43 ? 242 ARG B N     1 
ATOM   4000 C CA    . ARG D 2 241 ? -16.770 -21.864 -30.729 1.00 28.33 ? 242 ARG B CA    1 
ATOM   4001 C C     . ARG D 2 241 ? -17.981 -20.948 -30.765 1.00 28.94 ? 242 ARG B C     1 
ATOM   4002 O O     . ARG D 2 241 ? -19.119 -21.389 -30.566 1.00 32.36 ? 242 ARG B O     1 
ATOM   4003 C CB    . ARG D 2 241 ? -16.597 -22.319 -29.286 1.00 29.41 ? 242 ARG B CB    1 
ATOM   4004 C CG    . ARG D 2 241 ? -15.830 -23.578 -29.071 1.00 33.29 ? 242 ARG B CG    1 
ATOM   4005 C CD    . ARG D 2 241 ? -15.807 -23.890 -27.573 1.00 38.66 ? 242 ARG B CD    1 
ATOM   4006 N NE    . ARG D 2 241 ? -14.540 -23.540 -26.912 1.00 39.97 ? 242 ARG B NE    1 
ATOM   4007 C CZ    . ARG D 2 241 ? -14.436 -22.855 -25.773 1.00 39.31 ? 242 ARG B CZ    1 
ATOM   4008 N NH1   . ARG D 2 241 ? -15.524 -22.418 -25.163 1.00 41.34 ? 242 ARG B NH1   1 
ATOM   4009 N NH2   . ARG D 2 241 ? -13.244 -22.640 -25.218 1.00 41.71 ? 242 ARG B NH2   1 
ATOM   4010 N N     . GLY D 2 242 ? -17.738 -19.669 -30.999 1.00 29.05 ? 243 GLY B N     1 
ATOM   4011 C CA    . GLY D 2 242 ? -18.828 -18.714 -31.033 1.00 29.07 ? 243 GLY B CA    1 
ATOM   4012 C C     . GLY D 2 242 ? -19.065 -18.130 -29.654 1.00 27.50 ? 243 GLY B C     1 
ATOM   4013 O O     . GLY D 2 242 ? -20.206 -17.918 -29.271 1.00 28.15 ? 243 GLY B O     1 
ATOM   4014 N N     . ARG D 2 243 ? -17.980 -17.923 -28.904 1.00 28.71 ? 244 ARG B N     1 
ATOM   4015 C CA    . ARG D 2 243 ? -18.005 -17.336 -27.561 1.00 29.18 ? 244 ARG B CA    1 
ATOM   4016 C C     . ARG D 2 243 ? -18.923 -18.066 -26.566 1.00 31.36 ? 244 ARG B C     1 
ATOM   4017 O O     . ARG D 2 243 ? -19.699 -17.460 -25.814 1.00 32.08 ? 244 ARG B O     1 
ATOM   4018 C CB    . ARG D 2 243 ? -18.287 -15.823 -27.655 1.00 22.30 ? 244 ARG B CB    1 
ATOM   4019 C CG    . ARG D 2 243 ? -17.259 -15.114 -28.545 1.00 26.83 ? 244 ARG B CG    1 
ATOM   4020 C CD    . ARG D 2 243 ? -17.652 -13.685 -28.977 1.00 30.29 ? 244 ARG B CD    1 
ATOM   4021 N NE    . ARG D 2 243 ? -17.422 -12.713 -27.910 1.00 31.82 ? 244 ARG B NE    1 
ATOM   4022 C CZ    . ARG D 2 243 ? -16.263 -12.108 -27.676 1.00 30.57 ? 244 ARG B CZ    1 
ATOM   4023 N NH1   . ARG D 2 243 ? -15.217 -12.339 -28.461 1.00 27.87 ? 244 ARG B NH1   1 
ATOM   4024 N NH2   . ARG D 2 243 ? -16.114 -11.411 -26.556 1.00 30.09 ? 244 ARG B NH2   1 
ATOM   4025 N N     . LYS D 2 244 ? -18.768 -19.388 -26.523 1.00 33.26 ? 245 LYS B N     1 
ATOM   4026 C CA    . LYS D 2 244 ? -19.548 -20.222 -25.615 1.00 30.98 ? 245 LYS B CA    1 
ATOM   4027 C C     . LYS D 2 244 ? -19.122 -21.691 -25.703 1.00 25.75 ? 245 LYS B C     1 
ATOM   4028 C CB    . LYS D 2 244 ? -21.043 -20.046 -25.890 1.00 26.05 ? 245 LYS B CB    1 
HETATM 4029 O O     . HOH E 3 .   ? -17.469 -8.519  -7.775  1.00 52.11 ? 318 HOH C O     1 
HETATM 4030 O O     . HOH E 3 .   ? -16.802 -6.870  -9.987  1.00 36.54 ? 320 HOH C O     1 
HETATM 4031 O O     . HOH E 3 .   ? -5.858  -2.874  -8.227  1.00 25.97 ? 336 HOH C O     1 
HETATM 4032 O O     . HOH E 3 .   ? -18.257 -8.412  2.449   1.00 24.45 ? 346 HOH C O     1 
HETATM 4033 O O     . HOH E 3 .   ? -17.005 -10.449 -0.281  1.00 37.33 ? 347 HOH C O     1 
HETATM 4034 O O     . HOH E 3 .   ? -15.811 -8.651  -2.596  1.00 28.02 ? 348 HOH C O     1 
HETATM 4035 O O     . HOH E 3 .   ? 4.304   -7.220  -9.005  1.00 25.41 ? 355 HOH C O     1 
HETATM 4036 O O     . HOH E 3 .   ? 5.317   -10.695 -6.967  1.00 34.05 ? 356 HOH C O     1 
HETATM 4037 O O     . HOH E 3 .   ? -15.524 -0.841  -5.226  1.00 28.22 ? 358 HOH C O     1 
HETATM 4038 O O     . HOH E 3 .   ? -19.109 -3.136  -3.994  1.00 36.86 ? 359 HOH C O     1 
HETATM 4039 O O     . HOH E 3 .   ? -22.355 -2.878  -0.518  1.00 46.32 ? 369 HOH C O     1 
HETATM 4040 O O     . HOH E 3 .   ? -18.881 -2.705  7.675   1.00 38.96 ? 370 HOH C O     1 
HETATM 4041 O O     . HOH E 3 .   ? 2.480   -13.890 -7.243  1.00 34.34 ? 371 HOH C O     1 
HETATM 4042 O O     . HOH E 3 .   ? 1.512   -2.920  -1.936  1.00 45.10 ? 381 HOH C O     1 
HETATM 4043 O O     . HOH E 3 .   ? -3.046  0.517   -1.870  1.00 35.22 ? 384 HOH C O     1 
HETATM 4044 O O     . HOH E 3 .   ? -23.587 -11.313 2.282   1.00 44.11 ? 387 HOH C O     1 
HETATM 4045 O O     . HOH E 3 .   ? -6.684  -1.014  -11.843 1.00 32.55 ? 388 HOH C O     1 
HETATM 4046 O O     . HOH E 3 .   ? -19.058 -4.329  -9.664  1.00 53.87 ? 389 HOH C O     1 
HETATM 4047 O O     . HOH E 3 .   ? -0.399  -17.329 1.632   1.00 57.20 ? 397 HOH C O     1 
HETATM 4048 O O     . HOH E 3 .   ? -19.539 2.038   7.902   1.00 61.97 ? 400 HOH C O     1 
HETATM 4049 O O     . HOH E 3 .   ? -17.859 1.865   5.745   1.00 38.10 ? 401 HOH C O     1 
HETATM 4050 O O     . HOH E 3 .   ? 0.664   -12.154 0.779   1.00 44.10 ? 402 HOH C O     1 
HETATM 4051 O O     . HOH F 3 .   ? -5.940  3.026   0.030   1.00 44.61 ? 310 HOH D O     1 
HETATM 4052 O O     . HOH F 3 .   ? -4.531  -7.043  6.123   1.00 15.59 ? 322 HOH D O     1 
HETATM 4053 O O     . HOH F 3 .   ? -8.016  -11.570 2.733   1.00 40.39 ? 324 HOH D O     1 
HETATM 4054 O O     . HOH F 3 .   ? -9.321  -13.722 3.702   1.00 15.30 ? 325 HOH D O     1 
HETATM 4055 O O     . HOH F 3 .   ? -15.641 0.530   5.842   1.00 37.51 ? 328 HOH D O     1 
HETATM 4056 O O     . HOH F 3 .   ? -16.843 6.098   3.466   1.00 29.57 ? 329 HOH D O     1 
HETATM 4057 O O     . HOH F 3 .   ? -3.503  -8.234  9.307   1.00 20.89 ? 332 HOH D O     1 
HETATM 4058 O O     . HOH F 3 .   ? 1.470   -6.012  9.761   1.00 18.56 ? 334 HOH D O     1 
HETATM 4059 O O     . HOH F 3 .   ? -6.106  1.650   9.076   1.00 26.38 ? 335 HOH D O     1 
HETATM 4060 O O     . HOH F 3 .   ? -3.403  1.379   1.665   1.00 19.50 ? 341 HOH D O     1 
HETATM 4061 O O     . HOH F 3 .   ? -2.245  -14.554 -8.393  1.00 26.07 ? 363 HOH D O     1 
HETATM 4062 O O     . HOH F 3 .   ? -10.179 -15.376 -2.831  1.00 24.96 ? 364 HOH D O     1 
HETATM 4063 O O     . HOH F 3 .   ? -2.675  -15.625 1.835   1.00 30.96 ? 365 HOH D O     1 
HETATM 4064 O O     . HOH F 3 .   ? 0.072   2.490   8.656   1.00 32.22 ? 367 HOH D O     1 
HETATM 4065 O O     . HOH F 3 .   ? -11.403 5.058   5.482   1.00 39.23 ? 373 HOH D O     1 
HETATM 4066 O O     . HOH F 3 .   ? -20.751 0.860   -4.200  1.00 48.94 ? 390 HOH D O     1 
HETATM 4067 O O     . HOH F 3 .   ? -9.417  -16.377 -7.294  1.00 38.12 ? 395 HOH D O     1 
HETATM 4068 O O     . HOH F 3 .   ? -4.490  -15.020 -9.087  1.00 39.29 ? 404 HOH D O     1 
HETATM 4069 O O     . HOH F 3 .   ? 0.649   -4.046  2.562   1.00 43.34 ? 405 HOH D O     1 
HETATM 4070 O O     . HOH G 3 .   ? -3.485  -6.235  23.757  1.00 17.08 ? 246 HOH A O     1 
HETATM 4071 O O     . HOH G 3 .   ? -15.270 -8.900  5.614   1.00 16.16 ? 247 HOH A O     1 
HETATM 4072 O O     . HOH G 3 .   ? -5.056  -6.602  21.613  1.00 10.16 ? 248 HOH A O     1 
HETATM 4073 O O     . HOH G 3 .   ? -6.069  -12.841 11.658  1.00 15.45 ? 249 HOH A O     1 
HETATM 4074 O O     . HOH G 3 .   ? -13.427 -2.687  21.567  1.00 16.19 ? 250 HOH A O     1 
HETATM 4075 O O     . HOH G 3 .   ? -21.037 -14.132 12.446  1.00 14.00 ? 251 HOH A O     1 
HETATM 4076 O O     . HOH G 3 .   ? -1.760  -13.344 21.293  1.00 16.91 ? 252 HOH A O     1 
HETATM 4077 O O     . HOH G 3 .   ? -16.436 -10.760 3.240   1.00 37.18 ? 253 HOH A O     1 
HETATM 4078 O O     . HOH G 3 .   ? -17.817 -17.093 6.728   1.00 25.38 ? 254 HOH A O     1 
HETATM 4079 O O     . HOH G 3 .   ? 12.768  4.581   9.303   1.00 15.33 ? 255 HOH A O     1 
HETATM 4080 O O     . HOH G 3 .   ? 7.538   -8.197  13.462  1.00 16.09 ? 256 HOH A O     1 
HETATM 4081 O O     . HOH G 3 .   ? 5.862   17.289  1.064   1.00 24.55 ? 257 HOH A O     1 
HETATM 4082 O O     . HOH G 3 .   ? -15.777 -0.679  9.887   1.00 29.27 ? 258 HOH A O     1 
HETATM 4083 O O     . HOH G 3 .   ? -11.908 -16.529 23.885  1.00 34.46 ? 259 HOH A O     1 
HETATM 4084 O O     . HOH G 3 .   ? -2.713  -10.220 23.590  1.00 26.09 ? 260 HOH A O     1 
HETATM 4085 O O     . HOH G 3 .   ? -8.920  -9.267  28.514  1.00 28.18 ? 261 HOH A O     1 
HETATM 4086 O O     . HOH G 3 .   ? -6.021  -8.433  13.281  1.00 20.41 ? 262 HOH A O     1 
HETATM 4087 O O     . HOH G 3 .   ? -11.496 -17.390 21.178  1.00 23.21 ? 263 HOH A O     1 
HETATM 4088 O O     . HOH G 3 .   ? 10.040  8.791   26.228  1.00 22.43 ? 264 HOH A O     1 
HETATM 4089 O O     . HOH G 3 .   ? -23.940 -12.648 26.536  1.00 35.21 ? 265 HOH A O     1 
HETATM 4090 O O     . HOH G 3 .   ? -16.575 -1.854  13.395  1.00 25.64 ? 266 HOH A O     1 
HETATM 4091 O O     . HOH G 3 .   ? -11.309 7.513   8.996   1.00 20.68 ? 267 HOH A O     1 
HETATM 4092 O O     . HOH G 3 .   ? -1.519  -3.972  27.238  1.00 22.53 ? 268 HOH A O     1 
HETATM 4093 O O     . HOH G 3 .   ? -17.885 -13.827 25.402  1.00 22.53 ? 269 HOH A O     1 
HETATM 4094 O O     . HOH G 3 .   ? 8.814   -4.039  7.941   1.00 33.18 ? 270 HOH A O     1 
HETATM 4095 O O     . HOH G 3 .   ? -3.780  -9.604  17.072  1.00 30.69 ? 271 HOH A O     1 
HETATM 4096 O O     . HOH G 3 .   ? -5.625  -10.625 20.903  1.00 30.16 ? 272 HOH A O     1 
HETATM 4097 O O     . HOH G 3 .   ? -0.669  -7.834  27.719  1.00 32.23 ? 273 HOH A O     1 
HETATM 4098 O O     . HOH G 3 .   ? -31.650 -13.672 32.785  1.00 27.70 ? 274 HOH A O     1 
HETATM 4099 O O     . HOH G 3 .   ? -13.019 -2.138  25.057  1.00 28.18 ? 275 HOH A O     1 
HETATM 4100 O O     . HOH G 3 .   ? -21.319 -12.499 26.403  1.00 47.40 ? 276 HOH A O     1 
HETATM 4101 O O     . HOH G 3 .   ? -5.152  -18.225 17.221  1.00 25.54 ? 277 HOH A O     1 
HETATM 4102 O O     . HOH G 3 .   ? -11.534 13.688  19.628  1.00 37.85 ? 278 HOH A O     1 
HETATM 4103 O O     . HOH G 3 .   ? -1.318  13.772  18.808  1.00 15.88 ? 279 HOH A O     1 
HETATM 4104 O O     . HOH G 3 .   ? -18.181 1.922   16.017  1.00 27.29 ? 280 HOH A O     1 
HETATM 4105 O O     . HOH G 3 .   ? -28.593 -12.987 18.167  1.00 38.99 ? 281 HOH A O     1 
HETATM 4106 O O     . HOH G 3 .   ? -1.465  -4.689  16.612  1.00 25.52 ? 282 HOH A O     1 
HETATM 4107 O O     . HOH G 3 .   ? 10.485  -3.319  31.530  1.00 63.67 ? 283 HOH A O     1 
HETATM 4108 O O     . HOH G 3 .   ? -18.646 -14.175 29.023  1.00 56.64 ? 284 HOH A O     1 
HETATM 4109 O O     . HOH G 3 .   ? -20.509 -4.255  28.749  1.00 31.89 ? 285 HOH A O     1 
HETATM 4110 O O     . HOH G 3 .   ? -4.084  -12.695 22.008  1.00 24.73 ? 286 HOH A O     1 
HETATM 4111 O O     . HOH G 3 .   ? -5.333  -8.420  19.467  1.00 47.00 ? 287 HOH A O     1 
HETATM 4112 O O     . HOH G 3 .   ? -25.080 -3.424  18.856  1.00 37.95 ? 288 HOH A O     1 
HETATM 4113 O O     . HOH G 3 .   ? 4.910   -6.360  29.746  1.00 54.22 ? 289 HOH A O     1 
HETATM 4114 O O     . HOH G 3 .   ? -5.431  6.501   28.026  1.00 52.97 ? 290 HOH A O     1 
HETATM 4115 O O     . HOH G 3 .   ? -11.150 2.120   7.133   1.00 29.20 ? 291 HOH A O     1 
HETATM 4116 O O     . HOH G 3 .   ? -34.584 -20.966 25.912  1.00 53.28 ? 292 HOH A O     1 
HETATM 4117 O O     . HOH G 3 .   ? -12.309 12.934  16.247  1.00 78.86 ? 293 HOH A O     1 
HETATM 4118 O O     . HOH G 3 .   ? 17.135  -11.058 28.120  1.00 46.15 ? 294 HOH A O     1 
HETATM 4119 O O     . HOH G 3 .   ? -27.330 -2.309  20.221  1.00 38.05 ? 295 HOH A O     1 
HETATM 4120 O O     . HOH G 3 .   ? 8.332   9.545   29.063  1.00 44.64 ? 296 HOH A O     1 
HETATM 4121 O O     . HOH G 3 .   ? 1.744   14.960  19.781  1.00 46.70 ? 297 HOH A O     1 
HETATM 4122 O O     . HOH G 3 .   ? -6.847  -13.238 24.673  1.00 43.02 ? 298 HOH A O     1 
HETATM 4123 O O     . HOH G 3 .   ? 0.300   2.494   36.750  1.00 35.17 ? 299 HOH A O     1 
HETATM 4124 O O     . HOH G 3 .   ? 5.050   -22.590 17.090  1.00 61.56 ? 300 HOH A O     1 
HETATM 4125 O O     . HOH G 3 .   ? 11.568  -16.924 20.163  1.00 24.23 ? 301 HOH A O     1 
HETATM 4126 O O     . HOH G 3 .   ? -21.351 -13.975 29.167  1.00 24.09 ? 302 HOH A O     1 
HETATM 4127 O O     . HOH G 3 .   ? -4.954  -5.954  27.471  1.00 30.75 ? 303 HOH A O     1 
HETATM 4128 O O     . HOH G 3 .   ? -0.703  -1.879  28.348  1.00 25.60 ? 304 HOH A O     1 
HETATM 4129 O O     . HOH G 3 .   ? -23.932 -1.780  13.966  1.00 44.97 ? 305 HOH A O     1 
HETATM 4130 O O     . HOH G 3 .   ? -5.745  -0.112  27.359  1.00 22.79 ? 306 HOH A O     1 
HETATM 4131 O O     . HOH G 3 .   ? -12.771 0.277   9.489   1.00 28.34 ? 307 HOH A O     1 
HETATM 4132 O O     . HOH G 3 .   ? -12.597 -19.613 8.796   1.00 53.24 ? 308 HOH A O     1 
HETATM 4133 O O     . HOH G 3 .   ? 24.047  20.734  -1.722  1.00 65.58 ? 309 HOH A O     1 
HETATM 4134 O O     . HOH G 3 .   ? -9.392  13.699  14.717  1.00 29.86 ? 310 HOH A O     1 
HETATM 4135 O O     . HOH G 3 .   ? -7.211  7.581   29.593  1.00 47.90 ? 311 HOH A O     1 
HETATM 4136 O O     . HOH G 3 .   ? 0.786   15.397  25.878  1.00 48.84 ? 312 HOH A O     1 
HETATM 4137 O O     . HOH G 3 .   ? -21.037 -7.089  31.578  1.00 50.09 ? 313 HOH A O     1 
HETATM 4138 O O     . HOH G 3 .   ? 7.234   12.958  27.869  1.00 71.55 ? 314 HOH A O     1 
HETATM 4139 O O     . HOH G 3 .   ? 19.382  4.135   20.557  1.00 43.17 ? 315 HOH A O     1 
HETATM 4140 O O     . HOH G 3 .   ? 19.426  0.406   20.163  1.00 62.15 ? 316 HOH A O     1 
HETATM 4141 O O     . HOH G 3 .   ? 10.285  11.333  25.582  1.00 31.34 ? 317 HOH A O     1 
HETATM 4142 O O     . HOH G 3 .   ? 5.520   13.595  11.664  1.00 48.12 ? 318 HOH A O     1 
HETATM 4143 O O     . HOH G 3 .   ? -0.635  9.741   -3.995  1.00 42.99 ? 319 HOH A O     1 
HETATM 4144 O O     . HOH G 3 .   ? -13.077 -19.942 11.591  1.00 67.35 ? 320 HOH A O     1 
HETATM 4145 O O     . HOH G 3 .   ? 4.196   -5.883  8.694   1.00 36.22 ? 321 HOH A O     1 
HETATM 4146 O O     . HOH G 3 .   ? -24.878 -8.645  29.247  1.00 54.10 ? 322 HOH A O     1 
HETATM 4147 O O     . HOH G 3 .   ? -26.563 -7.335  27.546  1.00 51.72 ? 323 HOH A O     1 
HETATM 4148 O O     . HOH G 3 .   ? -11.347 -6.179  -6.070  1.00 17.33 ? 324 HOH A O     1 
HETATM 4149 O O     . HOH G 3 .   ? -7.375  -10.739 5.249   1.00 13.49 ? 325 HOH A O     1 
HETATM 4150 O O     . HOH G 3 .   ? -7.919  -12.169 7.332   1.00 16.57 ? 326 HOH A O     1 
HETATM 4151 O O     . HOH G 3 .   ? -4.779  -3.676  8.501   1.00 32.71 ? 327 HOH A O     1 
HETATM 4152 O O     . HOH G 3 .   ? 0.857   -2.230  9.309   1.00 63.95 ? 328 HOH A O     1 
HETATM 4153 O O     . HOH G 3 .   ? 3.377   -3.412  5.127   1.00 36.71 ? 329 HOH A O     1 
HETATM 4154 O O     . HOH G 3 .   ? 1.910   -7.719  -0.283  1.00 33.27 ? 330 HOH A O     1 
HETATM 4155 O O     . HOH G 3 .   ? 0.029   4.400   29.311  1.00 46.06 ? 331 HOH A O     1 
HETATM 4156 O O     . HOH G 3 .   ? -21.439 -6.781  10.690  1.00 34.19 ? 332 HOH A O     1 
HETATM 4157 O O     . HOH G 3 .   ? -20.020 -3.461  26.304  1.00 43.19 ? 333 HOH A O     1 
HETATM 4158 O O     . HOH G 3 .   ? -28.597 -11.219 26.084  1.00 45.29 ? 334 HOH A O     1 
HETATM 4159 O O     . HOH G 3 .   ? -22.185 -10.203 28.167  1.00 44.34 ? 335 HOH A O     1 
HETATM 4160 O O     . HOH G 3 .   ? -13.357 0.604   7.038   1.00 47.24 ? 336 HOH A O     1 
HETATM 4161 O O     . HOH G 3 .   ? 6.000   -4.026  7.971   1.00 36.13 ? 337 HOH A O     1 
HETATM 4162 O O     . HOH G 3 .   ? 17.918  -6.890  25.276  1.00 40.93 ? 338 HOH A O     1 
HETATM 4163 O O     . HOH G 3 .   ? 3.102   -4.791  -0.949  1.00 33.17 ? 339 HOH A O     1 
HETATM 4164 O O     . HOH G 3 .   ? -2.864  -5.783  11.338  1.00 43.18 ? 340 HOH A O     1 
HETATM 4165 O O     . HOH G 3 .   ? 4.127   15.426  12.775  1.00 44.79 ? 341 HOH A O     1 
HETATM 4166 O O     . HOH G 3 .   ? -16.737 4.202   5.223   1.00 30.47 ? 342 HOH A O     1 
HETATM 4167 O O     . HOH G 3 .   ? -19.352 4.399   9.719   1.00 51.24 ? 343 HOH A O     1 
HETATM 4168 O O     . HOH G 3 .   ? 11.404  -12.177 2.205   1.00 38.88 ? 344 HOH A O     1 
HETATM 4169 O O     . HOH G 3 .   ? -3.215  -4.920  13.859  1.00 43.45 ? 345 HOH A O     1 
HETATM 4170 O O     . HOH H 3 .   ? -10.354 -2.902  -15.220 1.00 17.70 ? 246 HOH B O     1 
HETATM 4171 O O     . HOH H 3 .   ? -2.429  -0.496  -23.121 1.00 18.65 ? 247 HOH B O     1 
HETATM 4172 O O     . HOH H 3 .   ? -12.796 -16.758 -18.566 1.00 16.21 ? 248 HOH B O     1 
HETATM 4173 O O     . HOH H 3 .   ? -8.693  -13.350 -10.047 1.00 13.43 ? 249 HOH B O     1 
HETATM 4174 O O     . HOH H 3 .   ? 0.154   -9.181  -24.294 1.00 24.52 ? 250 HOH B O     1 
HETATM 4175 O O     . HOH H 3 .   ? -8.976  3.870   -22.911 1.00 11.82 ? 251 HOH B O     1 
HETATM 4176 O O     . HOH H 3 .   ? 17.542  3.855   3.596   1.00 22.15 ? 252 HOH B O     1 
HETATM 4177 O O     . HOH H 3 .   ? -4.803  10.585  -12.739 1.00 14.78 ? 253 HOH B O     1 
HETATM 4178 O O     . HOH H 3 .   ? -6.726  -0.514  -23.432 1.00 17.88 ? 254 HOH B O     1 
HETATM 4179 O O     . HOH H 3 .   ? -16.696 -27.608 -33.953 1.00 18.23 ? 255 HOH B O     1 
HETATM 4180 O O     . HOH H 3 .   ? -2.544  -3.202  -30.452 1.00 33.33 ? 256 HOH B O     1 
HETATM 4181 O O     . HOH H 3 .   ? 7.916   -10.067 -10.005 1.00 32.43 ? 257 HOH B O     1 
HETATM 4182 O O     . HOH H 3 .   ? -5.338  2.521   -25.282 1.00 27.32 ? 258 HOH B O     1 
HETATM 4183 O O     . HOH H 3 .   ? -3.322  -0.677  -29.976 1.00 17.84 ? 259 HOH B O     1 
HETATM 4184 O O     . HOH H 3 .   ? 10.601  -0.571  -22.626 1.00 42.07 ? 260 HOH B O     1 
HETATM 4185 O O     . HOH H 3 .   ? -6.390  -2.720  -15.535 1.00 32.11 ? 261 HOH B O     1 
HETATM 4186 O O     . HOH H 3 .   ? -2.017  1.756   -24.328 1.00 21.29 ? 262 HOH B O     1 
HETATM 4187 O O     . HOH H 3 .   ? 4.313   9.534   -27.585 1.00 28.44 ? 263 HOH B O     1 
HETATM 4188 O O     . HOH H 3 .   ? 6.933   13.463  -5.563  1.00 11.77 ? 264 HOH B O     1 
HETATM 4189 O O     . HOH H 3 .   ? 0.645   -10.842 -11.562 1.00 26.72 ? 265 HOH B O     1 
HETATM 4190 O O     . HOH H 3 .   ? -5.540  -17.305 -16.145 1.00 46.28 ? 266 HOH B O     1 
HETATM 4191 O O     . HOH H 3 .   ? -2.702  2.059   -27.069 1.00 26.12 ? 267 HOH B O     1 
HETATM 4192 O O     . HOH H 3 .   ? -5.593  -0.673  -20.912 1.00 34.45 ? 268 HOH B O     1 
HETATM 4193 O O     . HOH H 3 .   ? -11.268 -14.340 -7.568  1.00 39.86 ? 269 HOH B O     1 
HETATM 4194 O O     . HOH H 3 .   ? -7.914  1.357   -24.868 1.00 37.38 ? 270 HOH B O     1 
HETATM 4195 O O     . HOH H 3 .   ? -1.584  2.291   -17.471 1.00 19.00 ? 271 HOH B O     1 
HETATM 4196 O O     . HOH H 3 .   ? -9.104  -9.699  -31.864 1.00 22.29 ? 272 HOH B O     1 
HETATM 4197 O O     . HOH H 3 .   ? -4.614  15.324  -25.670 1.00 30.03 ? 273 HOH B O     1 
HETATM 4198 O O     . HOH H 3 .   ? -16.800 -13.982 -12.739 1.00 30.48 ? 274 HOH B O     1 
HETATM 4199 O O     . HOH H 3 .   ? -0.264  -13.793 -16.932 1.00 27.19 ? 275 HOH B O     1 
HETATM 4200 O O     . HOH H 3 .   ? -2.096  -20.453 -24.543 1.00 26.32 ? 276 HOH B O     1 
HETATM 4201 O O     . HOH H 3 .   ? -15.427 4.771   -9.015  1.00 38.71 ? 277 HOH B O     1 
HETATM 4202 O O     . HOH H 3 .   ? -16.198 -1.924  -21.600 1.00 66.47 ? 278 HOH B O     1 
HETATM 4203 O O     . HOH H 3 .   ? 6.390   15.632  -30.109 1.00 34.73 ? 279 HOH B O     1 
HETATM 4204 O O     . HOH H 3 .   ? -6.244  0.403   -18.518 1.00 22.67 ? 280 HOH B O     1 
HETATM 4205 O O     . HOH H 3 .   ? -0.056  3.865   -27.417 1.00 34.63 ? 281 HOH B O     1 
HETATM 4206 O O     . HOH H 3 .   ? -14.884 0.351   -20.418 1.00 28.35 ? 282 HOH B O     1 
HETATM 4207 O O     . HOH H 3 .   ? 4.871   17.620  -27.909 1.00 44.75 ? 283 HOH B O     1 
HETATM 4208 O O     . HOH H 3 .   ? -0.727  10.307  -8.438  1.00 31.19 ? 284 HOH B O     1 
HETATM 4209 O O     . HOH H 3 .   ? 8.354   1.310   -25.305 1.00 30.31 ? 285 HOH B O     1 
HETATM 4210 O O     . HOH H 3 .   ? -10.038 11.301  -9.064  1.00 38.79 ? 286 HOH B O     1 
HETATM 4211 O O     . HOH H 3 .   ? -11.957 -9.157  -35.109 1.00 36.07 ? 287 HOH B O     1 
HETATM 4212 O O     . HOH H 3 .   ? -19.075 -13.794 -19.088 1.00 50.56 ? 288 HOH B O     1 
HETATM 4213 O O     . HOH H 3 .   ? 13.275  11.926  -27.571 1.00 31.90 ? 289 HOH B O     1 
HETATM 4214 O O     . HOH H 3 .   ? 16.458  3.891   17.336  1.00 40.70 ? 290 HOH B O     1 
HETATM 4215 O O     . HOH H 3 .   ? -3.504  17.286  -10.507 1.00 26.25 ? 291 HOH B O     1 
HETATM 4216 O O     . HOH H 3 .   ? -13.097 -12.500 -6.953  1.00 20.22 ? 292 HOH B O     1 
HETATM 4217 O O     . HOH H 3 .   ? 6.744   -11.746 -28.649 1.00 41.91 ? 293 HOH B O     1 
HETATM 4218 O O     . HOH H 3 .   ? 16.671  0.821   -16.304 1.00 33.12 ? 294 HOH B O     1 
HETATM 4219 O O     . HOH H 3 .   ? 2.511   -12.559 -38.086 1.00 38.02 ? 295 HOH B O     1 
HETATM 4220 O O     . HOH H 3 .   ? 21.701  13.399  -22.028 1.00 44.93 ? 296 HOH B O     1 
HETATM 4221 O O     . HOH H 3 .   ? -15.376 1.808   -22.645 1.00 22.35 ? 297 HOH B O     1 
HETATM 4222 O O     . HOH H 3 .   ? 16.270  -4.769  -11.111 1.00 54.82 ? 298 HOH B O     1 
HETATM 4223 O O     . HOH H 3 .   ? -15.438 -11.848 -14.502 1.00 29.02 ? 299 HOH B O     1 
HETATM 4224 O O     . HOH H 3 .   ? 16.256  5.027   -20.016 1.00 46.28 ? 300 HOH B O     1 
HETATM 4225 O O     . HOH H 3 .   ? -18.079 -9.009  -28.718 1.00 44.11 ? 301 HOH B O     1 
HETATM 4226 O O     . HOH H 3 .   ? -0.321  8.071   -7.073  1.00 38.38 ? 302 HOH B O     1 
HETATM 4227 O O     . HOH H 3 .   ? -11.600 16.630  -19.840 1.00 35.56 ? 303 HOH B O     1 
HETATM 4228 O O     . HOH H 3 .   ? 13.618  7.339   -26.772 1.00 51.86 ? 304 HOH B O     1 
HETATM 4229 O O     . HOH H 3 .   ? 4.177   -16.378 -7.477  1.00 39.39 ? 305 HOH B O     1 
HETATM 4230 O O     . HOH H 3 .   ? -1.084  -19.239 -19.234 1.00 49.11 ? 306 HOH B O     1 
HETATM 4231 O O     . HOH H 3 .   ? 2.066   5.484   -26.892 1.00 38.87 ? 307 HOH B O     1 
HETATM 4232 O O     . HOH H 3 .   ? 16.796  6.631   -6.900  1.00 47.83 ? 308 HOH B O     1 
HETATM 4233 O O     . HOH H 3 .   ? -20.540 -21.554 -32.811 1.00 38.44 ? 309 HOH B O     1 
HETATM 4234 O O     . HOH H 3 .   ? -16.010 -6.409  -32.582 1.00 30.77 ? 310 HOH B O     1 
HETATM 4235 O O     . HOH H 3 .   ? 0.242   15.969  -3.730  1.00 54.77 ? 311 HOH B O     1 
HETATM 4236 O O     . HOH H 3 .   ? 10.229  14.551  -28.980 1.00 18.12 ? 312 HOH B O     1 
HETATM 4237 O O     . HOH H 3 .   ? -3.525  11.926  -6.413  1.00 35.90 ? 313 HOH B O     1 
HETATM 4238 O O     . HOH H 3 .   ? 11.643  5.565   -27.515 1.00 39.66 ? 314 HOH B O     1 
HETATM 4239 O O     . HOH H 3 .   ? 10.248  -12.065 -7.600  1.00 54.28 ? 315 HOH B O     1 
HETATM 4240 O O     . HOH H 3 .   ? -12.546 -13.064 -4.116  1.00 43.93 ? 316 HOH B O     1 
HETATM 4241 O O     . HOH H 3 .   ? -12.690 -8.918  -5.718  1.00 45.52 ? 317 HOH B O     1 
HETATM 4242 O O     . HOH H 3 .   ? -13.419 -7.758  -7.858  1.00 20.43 ? 318 HOH B O     1 
HETATM 4243 O O     . HOH H 3 .   ? -9.730  -5.301  -8.301  1.00 17.24 ? 319 HOH B O     1 
HETATM 4244 O O     . HOH H 3 .   ? -10.802 -5.179  -10.854 1.00 19.96 ? 320 HOH B O     1 
HETATM 4245 O O     . HOH H 3 .   ? -17.415 -5.263  -12.513 1.00 22.28 ? 321 HOH B O     1 
HETATM 4246 O O     . HOH H 3 .   ? -2.351  -2.517  -9.793  1.00 32.23 ? 322 HOH B O     1 
HETATM 4247 O O     . HOH H 3 .   ? -4.651  4.775   -7.558  1.00 40.70 ? 323 HOH B O     1 
HETATM 4248 O O     . HOH H 3 .   ? -0.281  1.991   -9.548  1.00 22.11 ? 324 HOH B O     1 
HETATM 4249 O O     . HOH H 3 .   ? 1.327   2.970   -7.124  1.00 56.59 ? 325 HOH B O     1 
HETATM 4250 O O     . HOH H 3 .   ? 3.065   -4.936  -9.369  1.00 18.53 ? 326 HOH B O     1 
HETATM 4251 O O     . HOH H 3 .   ? 3.555   2.585   -29.674 1.00 27.70 ? 327 HOH B O     1 
HETATM 4252 O O     . HOH H 3 .   ? -19.580 -3.644  -12.837 1.00 54.26 ? 328 HOH B O     1 
HETATM 4253 O O     . HOH H 3 .   ? 1.346   -11.595 -9.011  1.00 25.32 ? 329 HOH B O     1 
HETATM 4254 O O     . HOH H 3 .   ? -8.317  -16.088 -10.009 1.00 26.57 ? 330 HOH B O     1 
HETATM 4255 O O     . HOH H 3 .   ? -14.287 1.403   -4.732  1.00 22.82 ? 331 HOH B O     1 
HETATM 4256 O O     . HOH H 3 .   ? 4.192   -9.801  -9.075  1.00 41.55 ? 332 HOH B O     1 
HETATM 4257 O O     . HOH H 3 .   ? 10.587  -7.781  4.573   1.00 27.90 ? 333 HOH B O     1 
HETATM 4258 O O     . HOH H 3 .   ? 7.079   -3.280  -4.816  1.00 39.86 ? 334 HOH B O     1 
HETATM 4259 O O     . HOH H 3 .   ? -8.095  3.427   -2.262  1.00 45.76 ? 335 HOH B O     1 
HETATM 4260 O O     . HOH H 3 .   ? -16.131 0.022   -9.544  1.00 39.77 ? 336 HOH B O     1 
HETATM 4261 O O     . HOH H 3 .   ? -17.979 2.227   -9.693  1.00 54.71 ? 337 HOH B O     1 
HETATM 4262 O O     . HOH H 3 .   ? -19.574 3.529   -11.734 1.00 35.66 ? 338 HOH B O     1 
HETATM 4263 O O     . HOH H 3 .   ? 15.819  11.496  -28.119 1.00 55.86 ? 339 HOH B O     1 
HETATM 4264 O O     . HOH H 3 .   ? -4.463  -16.881 -13.095 1.00 61.42 ? 340 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   801 801 DC  C   C . n 
A 1 2   DG  2   802 802 DG  G   C . n 
A 1 3   DG  3   803 803 DG  G   C . n 
A 1 4   DG  4   804 804 DG  G   C . n 
A 1 5   DA  5   805 805 DA  A   C . n 
A 1 6   DT  6   806 806 DT  T   C . n 
A 1 7   DA  7   807 807 DA  A   C . n 
A 1 8   DT  8   808 808 DT  T   C . n 
A 1 9   DC  9   809 809 DC  C   C . n 
A 1 10  DC  10  810 810 DC  C   C . n 
A 1 11  DC  11  811 811 DC  C   C . n 
B 1 1   DC  1   901 ?   ?   ?   D . n 
B 1 2   DG  2   902 902 DG  G   D . n 
B 1 3   DG  3   903 903 DG  G   D . n 
B 1 4   DG  4   904 904 DG  G   D . n 
B 1 5   DA  5   905 905 DA  A   D . n 
B 1 6   DT  6   906 906 DT  T   D . n 
B 1 7   DA  7   907 907 DA  A   D . n 
B 1 8   DT  8   908 908 DT  T   D . n 
B 1 9   DC  9   909 909 DC  C   D . n 
B 1 10  DC  10  910 910 DC  C   D . n 
B 1 11  DC  11  911 911 DC  C   D . n 
C 2 1   SER 1   2   2   SER SER A . n 
C 2 2   LEU 2   3   3   LEU LEU A . n 
C 2 3   ARG 3   4   4   ARG ARG A . n 
C 2 4   SER 4   5   5   SER SER A . n 
C 2 5   ASP 5   6   6   ASP ASP A . n 
C 2 6   LEU 6   7   7   LEU LEU A . n 
C 2 7   ILE 7   8   8   ILE ILE A . n 
C 2 8   ASN 8   9   9   ASN ASN A . n 
C 2 9   ALA 9   10  10  ALA ALA A . n 
C 2 10  LEU 10  11  11  LEU LEU A . n 
C 2 11  TYR 11  12  12  TYR TYR A . n 
C 2 12  ASP 12  13  13  ASP ASP A . n 
C 2 13  GLU 13  14  14  GLU GLU A . n 
C 2 14  ASN 14  15  15  ASN ASN A . n 
C 2 15  GLN 15  16  16  GLN GLN A . n 
C 2 16  LYS 16  17  17  LYS LYS A . n 
C 2 17  TYR 17  18  18  TYR TYR A . n 
C 2 18  ASP 18  19  19  ASP ASP A . n 
C 2 19  VAL 19  20  20  VAL VAL A . n 
C 2 20  CYS 20  21  21  CYS CYS A . n 
C 2 21  GLY 21  22  22  GLY GLY A . n 
C 2 22  ILE 22  23  23  ILE ILE A . n 
C 2 23  ILE 23  24  24  ILE ILE A . n 
C 2 24  SER 24  25  25  SER SER A . n 
C 2 25  ALA 25  26  26  ALA ALA A . n 
C 2 26  GLU 26  27  27  GLU GLU A . n 
C 2 27  GLY 27  28  28  GLY GLY A . n 
C 2 28  LYS 28  29  29  LYS LYS A . n 
C 2 29  ILE 29  30  30  ILE ILE A . n 
C 2 30  TYR 30  31  31  TYR TYR A . n 
C 2 31  PRO 31  32  32  PRO PRO A . n 
C 2 32  LEU 32  33  33  LEU LEU A . n 
C 2 33  GLY 33  34  34  GLY GLY A . n 
C 2 34  SER 34  35  35  SER SER A . n 
C 2 35  ASP 35  36  36  ASP ASP A . n 
C 2 36  THR 36  37  37  THR THR A . n 
C 2 37  LYS 37  38  38  LYS LYS A . n 
C 2 38  VAL 38  39  39  VAL VAL A . n 
C 2 39  LEU 39  40  40  LEU LEU A . n 
C 2 40  SER 40  41  41  SER SER A . n 
C 2 41  THR 41  42  42  THR THR A . n 
C 2 42  ILE 42  43  43  ILE ILE A . n 
C 2 43  PHE 43  44  44  PHE PHE A . n 
C 2 44  GLU 44  45  45  GLU GLU A . n 
C 2 45  LEU 45  46  46  LEU LEU A . n 
C 2 46  PHE 46  47  47  PHE PHE A . n 
C 2 47  SER 47  48  48  SER SER A . n 
C 2 48  ARG 48  49  49  ARG ARG A . n 
C 2 49  PRO 49  50  50  PRO PRO A . n 
C 2 50  ILE 50  51  51  ILE ILE A . n 
C 2 51  ILE 51  52  52  ILE ILE A . n 
C 2 52  ASN 52  53  53  ASN ASN A . n 
C 2 53  LYS 53  54  54  LYS LYS A . n 
C 2 54  ILE 54  55  55  ILE ILE A . n 
C 2 55  ALA 55  56  56  ALA ALA A . n 
C 2 56  GLU 56  57  57  GLU GLU A . n 
C 2 57  LYS 57  58  58  LYS LYS A . n 
C 2 58  HIS 58  59  59  HIS HIS A . n 
C 2 59  GLY 59  60  60  GLY GLY A . n 
C 2 60  TYR 60  61  61  TYR TYR A . n 
C 2 61  ILE 61  62  62  ILE ILE A . n 
C 2 62  VAL 62  63  63  VAL VAL A . n 
C 2 63  GLU 63  64  64  GLU GLU A . n 
C 2 64  GLU 64  65  65  GLU GLU A . n 
C 2 65  PRO 65  66  66  PRO PRO A . n 
C 2 66  LYS 66  67  67  LYS LYS A . n 
C 2 67  GLN 67  68  68  GLN GLN A . n 
C 2 68  GLN 68  69  69  GLN GLN A . n 
C 2 69  ASN 69  70  70  ASN ASN A . n 
C 2 70  HIS 70  71  71  HIS HIS A . n 
C 2 71  TYR 71  72  72  TYR TYR A . n 
C 2 72  PRO 72  73  73  PRO PRO A . n 
C 2 73  ASP 73  74  74  ASP ASP A . n 
C 2 74  PHE 74  75  75  PHE PHE A . n 
C 2 75  THR 75  76  76  THR THR A . n 
C 2 76  LEU 76  77  77  LEU LEU A . n 
C 2 77  TYR 77  78  78  TYR TYR A . n 
C 2 78  LYS 78  79  79  LYS LYS A . n 
C 2 79  PRO 79  80  80  PRO PRO A . n 
C 2 80  SER 80  81  81  SER SER A . n 
C 2 81  GLU 81  82  82  GLU GLU A . n 
C 2 82  PRO 82  83  83  PRO PRO A . n 
C 2 83  ASN 83  84  84  ASN ASN A . n 
C 2 84  LYS 84  85  85  LYS LYS A . n 
C 2 85  LYS 85  86  86  LYS LYS A . n 
C 2 86  ILE 86  87  87  ILE ILE A . n 
C 2 87  ALA 87  88  88  ALA ALA A . n 
C 2 88  ILE 88  89  89  ILE ILE A . n 
C 2 89  ASP 89  90  90  ASP ASP A . n 
C 2 90  ILE 90  91  91  ILE ILE A . n 
C 2 91  LYS 91  92  92  LYS LYS A . n 
C 2 92  THR 92  93  93  THR THR A . n 
C 2 93  THR 93  94  94  THR THR A . n 
C 2 94  TYR 94  95  95  TYR TYR A . n 
C 2 95  THR 95  96  96  THR THR A . n 
C 2 96  ASN 96  97  97  ASN ASN A . n 
C 2 97  LYS 97  98  98  LYS LYS A . n 
C 2 98  GLU 98  99  99  GLU GLU A . n 
C 2 99  ASN 99  100 100 ASN ASN A . n 
C 2 100 GLU 100 101 101 GLU GLU A . n 
C 2 101 LYS 101 102 102 LYS LYS A . n 
C 2 102 ILE 102 103 103 ILE ILE A . n 
C 2 103 LYS 103 104 104 LYS LYS A . n 
C 2 104 PHE 104 105 105 PHE PHE A . n 
C 2 105 THR 105 106 106 THR THR A . n 
C 2 106 LEU 106 107 107 LEU LEU A . n 
C 2 107 GLY 107 108 108 GLY GLY A . n 
C 2 108 GLY 108 109 109 GLY GLY A . n 
C 2 109 TYR 109 110 110 TYR TYR A . n 
C 2 110 THR 110 111 111 THR THR A . n 
C 2 111 SER 111 112 112 SER SER A . n 
C 2 112 PHE 112 113 113 PHE PHE A . n 
C 2 113 ILE 113 114 114 ILE ILE A . n 
C 2 114 ARG 114 115 115 ARG ARG A . n 
C 2 115 ASN 115 116 116 ASN ASN A . n 
C 2 116 ASN 116 117 117 ASN ASN A . n 
C 2 117 THR 117 118 118 THR THR A . n 
C 2 118 LYS 118 119 119 LYS LYS A . n 
C 2 119 ASN 119 120 120 ASN ASN A . n 
C 2 120 ILE 120 121 121 ILE ILE A . n 
C 2 121 VAL 121 122 122 VAL VAL A . n 
C 2 122 TYR 122 123 123 TYR TYR A . n 
C 2 123 PRO 123 124 124 PRO PRO A . n 
C 2 124 PHE 124 125 125 PHE PHE A . n 
C 2 125 ASP 125 126 126 ASP ASP A . n 
C 2 126 GLN 126 127 127 GLN GLN A . n 
C 2 127 TYR 127 128 128 TYR TYR A . n 
C 2 128 ILE 128 129 129 ILE ILE A . n 
C 2 129 ALA 129 130 130 ALA ALA A . n 
C 2 130 HIS 130 131 131 HIS HIS A . n 
C 2 131 TRP 131 132 132 TRP TRP A . n 
C 2 132 ILE 132 133 133 ILE ILE A . n 
C 2 133 ILE 133 134 134 ILE ILE A . n 
C 2 134 GLY 134 135 135 GLY GLY A . n 
C 2 135 TYR 135 136 136 TYR TYR A . n 
C 2 136 VAL 136 137 137 VAL VAL A . n 
C 2 137 TYR 137 138 138 TYR TYR A . n 
C 2 138 THR 138 139 139 THR THR A . n 
C 2 139 ARG 139 140 140 ARG ARG A . n 
C 2 140 VAL 140 141 141 VAL VAL A . n 
C 2 141 ALA 141 142 ?   ?   ?   A . n 
C 2 142 THR 142 143 ?   ?   ?   A . n 
C 2 143 ARG 143 144 ?   ?   ?   A . n 
C 2 144 LYS 144 145 ?   ?   ?   A . n 
C 2 145 SER 145 146 ?   ?   ?   A . n 
C 2 146 SER 146 147 ?   ?   ?   A . n 
C 2 147 LEU 147 148 ?   ?   ?   A . n 
C 2 148 LYS 148 149 149 LYS LYS A . n 
C 2 149 THR 149 150 150 THR THR A . n 
C 2 150 TYR 150 151 151 TYR TYR A . n 
C 2 151 ASN 151 152 152 ASN ASN A . n 
C 2 152 ILE 152 153 153 ILE ILE A . n 
C 2 153 ASN 153 154 154 ASN ASN A . n 
C 2 154 GLU 154 155 155 GLU GLU A . n 
C 2 155 LEU 155 156 156 LEU LEU A . n 
C 2 156 ASN 156 157 157 ASN ASN A . n 
C 2 157 GLU 157 158 158 GLU GLU A . n 
C 2 158 ILE 158 159 159 ILE ILE A . n 
C 2 159 PRO 159 160 160 PRO PRO A . n 
C 2 160 LYS 160 161 161 LYS LYS A . n 
C 2 161 PRO 161 162 162 PRO PRO A . n 
C 2 162 TYR 162 163 163 TYR TYR A . n 
C 2 163 LYS 163 164 164 LYS LYS A . n 
C 2 164 GLY 164 165 165 GLY GLY A . n 
C 2 165 VAL 165 166 166 VAL VAL A . n 
C 2 166 LYS 166 167 167 LYS LYS A . n 
C 2 167 VAL 167 168 168 VAL VAL A . n 
C 2 168 PHE 168 169 169 PHE PHE A . n 
C 2 169 LEU 169 170 170 LEU LEU A . n 
C 2 170 GLN 170 171 171 GLN GLN A . n 
C 2 171 ASP 171 172 172 ASP ASP A . n 
C 2 172 LYS 172 173 173 LYS LYS A . n 
C 2 173 TRP 173 174 174 TRP TRP A . n 
C 2 174 VAL 174 175 175 VAL VAL A . n 
C 2 175 ILE 175 176 176 ILE ILE A . n 
C 2 176 ALA 176 177 177 ALA ALA A . n 
C 2 177 GLY 177 178 178 GLY GLY A . n 
C 2 178 ASP 178 179 179 ASP ASP A . n 
C 2 179 LEU 179 180 180 LEU LEU A . n 
C 2 180 ALA 180 181 181 ALA ALA A . n 
C 2 181 GLY 181 182 182 GLY GLY A . n 
C 2 182 SER 182 183 183 SER SER A . n 
C 2 183 GLY 183 184 184 GLY GLY A . n 
C 2 184 ASN 184 185 185 ASN ASN A . n 
C 2 185 THR 185 186 186 THR THR A . n 
C 2 186 THR 186 187 187 THR THR A . n 
C 2 187 ASN 187 188 188 ASN ASN A . n 
C 2 188 ILE 188 189 189 ILE ILE A . n 
C 2 189 GLY 189 190 190 GLY GLY A . n 
C 2 190 SER 190 191 191 SER SER A . n 
C 2 191 ILE 191 192 192 ILE ILE A . n 
C 2 192 HIS 192 193 193 HIS HIS A . n 
C 2 193 ALA 193 194 194 ALA ALA A . n 
C 2 194 HIS 194 195 195 HIS HIS A . n 
C 2 195 TYR 195 196 196 TYR TYR A . n 
C 2 196 LYS 196 197 197 LYS LYS A . n 
C 2 197 ASP 197 198 198 ASP ASP A . n 
C 2 198 PHE 198 199 199 PHE PHE A . n 
C 2 199 VAL 199 200 200 VAL VAL A . n 
C 2 200 GLU 200 201 201 GLU GLU A . n 
C 2 201 GLY 201 202 202 GLY GLY A . n 
C 2 202 LYS 202 203 203 LYS LYS A . n 
C 2 203 GLY 203 204 204 GLY GLY A . n 
C 2 204 ILE 204 205 205 ILE ILE A . n 
C 2 205 PHE 205 206 206 PHE PHE A . n 
C 2 206 ASP 206 207 207 ASP ASP A . n 
C 2 207 SER 207 208 208 SER SER A . n 
C 2 208 GLU 208 209 209 GLU GLU A . n 
C 2 209 ASP 209 210 210 ASP ASP A . n 
C 2 210 GLU 210 211 211 GLU GLU A . n 
C 2 211 PHE 211 212 212 PHE PHE A . n 
C 2 212 LEU 212 213 213 LEU LEU A . n 
C 2 213 ASP 213 214 214 ASP ASP A . n 
C 2 214 TYR 214 215 215 TYR TYR A . n 
C 2 215 TRP 215 216 216 TRP TRP A . n 
C 2 216 ARG 216 217 217 ARG ARG A . n 
C 2 217 ASN 217 218 218 ASN ASN A . n 
C 2 218 TYR 218 219 219 TYR TYR A . n 
C 2 219 GLU 219 220 220 GLU GLU A . n 
C 2 220 ARG 220 221 221 ARG ARG A . n 
C 2 221 THR 221 222 222 THR THR A . n 
C 2 222 SER 222 223 223 SER SER A . n 
C 2 223 GLN 223 224 224 GLN GLN A . n 
C 2 224 LEU 224 225 225 LEU LEU A . n 
C 2 225 ARG 225 226 226 ARG ARG A . n 
C 2 226 ASN 226 227 227 ASN ASN A . n 
C 2 227 ASP 227 228 228 ASP ASP A . n 
C 2 228 LYS 228 229 229 LYS LYS A . n 
C 2 229 TYR 229 230 230 TYR TYR A . n 
C 2 230 ASN 230 231 231 ASN ASN A . n 
C 2 231 ASN 231 232 232 ASN ASN A . n 
C 2 232 ILE 232 233 233 ILE ILE A . n 
C 2 233 SER 233 234 234 SER SER A . n 
C 2 234 GLU 234 235 235 GLU GLU A . n 
C 2 235 TYR 235 236 236 TYR TYR A . n 
C 2 236 ARG 236 237 237 ARG ARG A . n 
C 2 237 ASN 237 238 238 ASN ASN A . n 
C 2 238 TRP 238 239 239 TRP TRP A . n 
C 2 239 ILE 239 240 240 ILE ILE A . n 
C 2 240 TYR 240 241 241 TYR TYR A . n 
C 2 241 ARG 241 242 242 ARG ARG A . n 
C 2 242 GLY 242 243 243 GLY GLY A . n 
C 2 243 ARG 243 244 244 ARG ARG A . n 
C 2 244 LYS 244 245 245 LYS LYS A . n 
D 2 1   SER 1   2   2   SER SER B . n 
D 2 2   LEU 2   3   3   LEU LEU B . n 
D 2 3   ARG 3   4   4   ARG ARG B . n 
D 2 4   SER 4   5   5   SER SER B . n 
D 2 5   ASP 5   6   6   ASP ASP B . n 
D 2 6   LEU 6   7   7   LEU LEU B . n 
D 2 7   ILE 7   8   8   ILE ILE B . n 
D 2 8   ASN 8   9   9   ASN ASN B . n 
D 2 9   ALA 9   10  10  ALA ALA B . n 
D 2 10  LEU 10  11  11  LEU LEU B . n 
D 2 11  TYR 11  12  ?   ?   ?   B . n 
D 2 12  ASP 12  13  ?   ?   ?   B . n 
D 2 13  GLU 13  14  ?   ?   ?   B . n 
D 2 14  ASN 14  15  ?   ?   ?   B . n 
D 2 15  GLN 15  16  ?   ?   ?   B . n 
D 2 16  LYS 16  17  ?   ?   ?   B . n 
D 2 17  TYR 17  18  ?   ?   ?   B . n 
D 2 18  ASP 18  19  19  ASP ASP B . n 
D 2 19  VAL 19  20  20  VAL VAL B . n 
D 2 20  CYS 20  21  21  CYS CYS B . n 
D 2 21  GLY 21  22  22  GLY GLY B . n 
D 2 22  ILE 22  23  23  ILE ILE B . n 
D 2 23  ILE 23  24  24  ILE ILE B . n 
D 2 24  SER 24  25  25  SER SER B . n 
D 2 25  ALA 25  26  26  ALA ALA B . n 
D 2 26  GLU 26  27  27  GLU GLU B . n 
D 2 27  GLY 27  28  28  GLY GLY B . n 
D 2 28  LYS 28  29  29  LYS LYS B . n 
D 2 29  ILE 29  30  30  ILE ILE B . n 
D 2 30  TYR 30  31  31  TYR TYR B . n 
D 2 31  PRO 31  32  32  PRO PRO B . n 
D 2 32  LEU 32  33  33  LEU LEU B . n 
D 2 33  GLY 33  34  34  GLY GLY B . n 
D 2 34  SER 34  35  35  SER SER B . n 
D 2 35  ASP 35  36  36  ASP ASP B . n 
D 2 36  THR 36  37  37  THR THR B . n 
D 2 37  LYS 37  38  38  LYS LYS B . n 
D 2 38  VAL 38  39  39  VAL VAL B . n 
D 2 39  LEU 39  40  40  LEU LEU B . n 
D 2 40  SER 40  41  41  SER SER B . n 
D 2 41  THR 41  42  42  THR THR B . n 
D 2 42  ILE 42  43  43  ILE ILE B . n 
D 2 43  PHE 43  44  44  PHE PHE B . n 
D 2 44  GLU 44  45  45  GLU GLU B . n 
D 2 45  LEU 45  46  46  LEU LEU B . n 
D 2 46  PHE 46  47  47  PHE PHE B . n 
D 2 47  SER 47  48  48  SER SER B . n 
D 2 48  ARG 48  49  49  ARG ARG B . n 
D 2 49  PRO 49  50  50  PRO PRO B . n 
D 2 50  ILE 50  51  51  ILE ILE B . n 
D 2 51  ILE 51  52  52  ILE ILE B . n 
D 2 52  ASN 52  53  53  ASN ASN B . n 
D 2 53  LYS 53  54  54  LYS LYS B . n 
D 2 54  ILE 54  55  55  ILE ILE B . n 
D 2 55  ALA 55  56  56  ALA ALA B . n 
D 2 56  GLU 56  57  57  GLU GLU B . n 
D 2 57  LYS 57  58  58  LYS LYS B . n 
D 2 58  HIS 58  59  59  HIS HIS B . n 
D 2 59  GLY 59  60  60  GLY GLY B . n 
D 2 60  TYR 60  61  61  TYR TYR B . n 
D 2 61  ILE 61  62  62  ILE ILE B . n 
D 2 62  VAL 62  63  63  VAL VAL B . n 
D 2 63  GLU 63  64  64  GLU GLU B . n 
D 2 64  GLU 64  65  65  GLU GLU B . n 
D 2 65  PRO 65  66  66  PRO PRO B . n 
D 2 66  LYS 66  67  67  LYS LYS B . n 
D 2 67  GLN 67  68  68  GLN GLN B . n 
D 2 68  GLN 68  69  69  GLN GLN B . n 
D 2 69  ASN 69  70  70  ASN ASN B . n 
D 2 70  HIS 70  71  71  HIS HIS B . n 
D 2 71  TYR 71  72  72  TYR TYR B . n 
D 2 72  PRO 72  73  73  PRO PRO B . n 
D 2 73  ASP 73  74  74  ASP ASP B . n 
D 2 74  PHE 74  75  75  PHE PHE B . n 
D 2 75  THR 75  76  76  THR THR B . n 
D 2 76  LEU 76  77  77  LEU LEU B . n 
D 2 77  TYR 77  78  78  TYR TYR B . n 
D 2 78  LYS 78  79  79  LYS LYS B . n 
D 2 79  PRO 79  80  80  PRO PRO B . n 
D 2 80  SER 80  81  81  SER SER B . n 
D 2 81  GLU 81  82  82  GLU GLU B . n 
D 2 82  PRO 82  83  83  PRO PRO B . n 
D 2 83  ASN 83  84  84  ASN ASN B . n 
D 2 84  LYS 84  85  85  LYS LYS B . n 
D 2 85  LYS 85  86  86  LYS LYS B . n 
D 2 86  ILE 86  87  87  ILE ILE B . n 
D 2 87  ALA 87  88  88  ALA ALA B . n 
D 2 88  ILE 88  89  89  ILE ILE B . n 
D 2 89  ASP 89  90  90  ASP ASP B . n 
D 2 90  ILE 90  91  91  ILE ILE B . n 
D 2 91  LYS 91  92  92  LYS LYS B . n 
D 2 92  THR 92  93  93  THR THR B . n 
D 2 93  THR 93  94  94  THR THR B . n 
D 2 94  TYR 94  95  95  TYR TYR B . n 
D 2 95  THR 95  96  96  THR THR B . n 
D 2 96  ASN 96  97  97  ASN ASN B . n 
D 2 97  LYS 97  98  ?   ?   ?   B . n 
D 2 98  GLU 98  99  ?   ?   ?   B . n 
D 2 99  ASN 99  100 ?   ?   ?   B . n 
D 2 100 GLU 100 101 ?   ?   ?   B . n 
D 2 101 LYS 101 102 102 LYS LYS B . n 
D 2 102 ILE 102 103 103 ILE ILE B . n 
D 2 103 LYS 103 104 104 LYS LYS B . n 
D 2 104 PHE 104 105 105 PHE PHE B . n 
D 2 105 THR 105 106 106 THR THR B . n 
D 2 106 LEU 106 107 107 LEU LEU B . n 
D 2 107 GLY 107 108 108 GLY GLY B . n 
D 2 108 GLY 108 109 109 GLY GLY B . n 
D 2 109 TYR 109 110 110 TYR TYR B . n 
D 2 110 THR 110 111 111 THR THR B . n 
D 2 111 SER 111 112 112 SER SER B . n 
D 2 112 PHE 112 113 113 PHE PHE B . n 
D 2 113 ILE 113 114 114 ILE ILE B . n 
D 2 114 ARG 114 115 115 ARG ARG B . n 
D 2 115 ASN 115 116 116 ASN ASN B . n 
D 2 116 ASN 116 117 117 ASN ASN B . n 
D 2 117 THR 117 118 118 THR THR B . n 
D 2 118 LYS 118 119 119 LYS LYS B . n 
D 2 119 ASN 119 120 120 ASN ASN B . n 
D 2 120 ILE 120 121 121 ILE ILE B . n 
D 2 121 VAL 121 122 122 VAL VAL B . n 
D 2 122 TYR 122 123 123 TYR TYR B . n 
D 2 123 PRO 123 124 124 PRO PRO B . n 
D 2 124 PHE 124 125 125 PHE PHE B . n 
D 2 125 ASP 125 126 126 ASP ASP B . n 
D 2 126 GLN 126 127 127 GLN GLN B . n 
D 2 127 TYR 127 128 128 TYR TYR B . n 
D 2 128 ILE 128 129 129 ILE ILE B . n 
D 2 129 ALA 129 130 130 ALA ALA B . n 
D 2 130 HIS 130 131 131 HIS HIS B . n 
D 2 131 TRP 131 132 132 TRP TRP B . n 
D 2 132 ILE 132 133 133 ILE ILE B . n 
D 2 133 ILE 133 134 134 ILE ILE B . n 
D 2 134 GLY 134 135 135 GLY GLY B . n 
D 2 135 TYR 135 136 136 TYR TYR B . n 
D 2 136 VAL 136 137 137 VAL VAL B . n 
D 2 137 TYR 137 138 138 TYR TYR B . n 
D 2 138 THR 138 139 139 THR THR B . n 
D 2 139 ARG 139 140 140 ARG ARG B . n 
D 2 140 VAL 140 141 141 VAL VAL B . n 
D 2 141 ALA 141 142 ?   ?   ?   B . n 
D 2 142 THR 142 143 ?   ?   ?   B . n 
D 2 143 ARG 143 144 ?   ?   ?   B . n 
D 2 144 LYS 144 145 ?   ?   ?   B . n 
D 2 145 SER 145 146 ?   ?   ?   B . n 
D 2 146 SER 146 147 147 SER SER B . n 
D 2 147 LEU 147 148 148 LEU LEU B . n 
D 2 148 LYS 148 149 149 LYS LYS B . n 
D 2 149 THR 149 150 150 THR THR B . n 
D 2 150 TYR 150 151 151 TYR TYR B . n 
D 2 151 ASN 151 152 152 ASN ASN B . n 
D 2 152 ILE 152 153 153 ILE ILE B . n 
D 2 153 ASN 153 154 154 ASN ASN B . n 
D 2 154 GLU 154 155 155 GLU GLU B . n 
D 2 155 LEU 155 156 156 LEU LEU B . n 
D 2 156 ASN 156 157 157 ASN ASN B . n 
D 2 157 GLU 157 158 158 GLU GLU B . n 
D 2 158 ILE 158 159 159 ILE ILE B . n 
D 2 159 PRO 159 160 160 PRO PRO B . n 
D 2 160 LYS 160 161 161 LYS LYS B . n 
D 2 161 PRO 161 162 162 PRO PRO B . n 
D 2 162 TYR 162 163 163 TYR TYR B . n 
D 2 163 LYS 163 164 164 LYS LYS B . n 
D 2 164 GLY 164 165 165 GLY GLY B . n 
D 2 165 VAL 165 166 166 VAL VAL B . n 
D 2 166 LYS 166 167 167 LYS LYS B . n 
D 2 167 VAL 167 168 168 VAL VAL B . n 
D 2 168 PHE 168 169 169 PHE PHE B . n 
D 2 169 LEU 169 170 170 LEU LEU B . n 
D 2 170 GLN 170 171 171 GLN GLN B . n 
D 2 171 ASP 171 172 172 ASP ASP B . n 
D 2 172 LYS 172 173 173 LYS LYS B . n 
D 2 173 TRP 173 174 174 TRP TRP B . n 
D 2 174 VAL 174 175 175 VAL VAL B . n 
D 2 175 ILE 175 176 176 ILE ILE B . n 
D 2 176 ALA 176 177 177 ALA ALA B . n 
D 2 177 GLY 177 178 178 GLY GLY B . n 
D 2 178 ASP 178 179 179 ASP ASP B . n 
D 2 179 LEU 179 180 180 LEU LEU B . n 
D 2 180 ALA 180 181 181 ALA ALA B . n 
D 2 181 GLY 181 182 182 GLY GLY B . n 
D 2 182 SER 182 183 183 SER SER B . n 
D 2 183 GLY 183 184 184 GLY GLY B . n 
D 2 184 ASN 184 185 185 ASN ASN B . n 
D 2 185 THR 185 186 186 THR THR B . n 
D 2 186 THR 186 187 187 THR THR B . n 
D 2 187 ASN 187 188 188 ASN ASN B . n 
D 2 188 ILE 188 189 189 ILE ILE B . n 
D 2 189 GLY 189 190 190 GLY GLY B . n 
D 2 190 SER 190 191 191 SER SER B . n 
D 2 191 ILE 191 192 192 ILE ILE B . n 
D 2 192 HIS 192 193 193 HIS HIS B . n 
D 2 193 ALA 193 194 194 ALA ALA B . n 
D 2 194 HIS 194 195 195 HIS HIS B . n 
D 2 195 TYR 195 196 196 TYR TYR B . n 
D 2 196 LYS 196 197 197 LYS LYS B . n 
D 2 197 ASP 197 198 198 ASP ASP B . n 
D 2 198 PHE 198 199 199 PHE PHE B . n 
D 2 199 VAL 199 200 200 VAL VAL B . n 
D 2 200 GLU 200 201 201 GLU GLU B . n 
D 2 201 GLY 201 202 202 GLY GLY B . n 
D 2 202 LYS 202 203 203 LYS LYS B . n 
D 2 203 GLY 203 204 204 GLY GLY B . n 
D 2 204 ILE 204 205 205 ILE ILE B . n 
D 2 205 PHE 205 206 206 PHE PHE B . n 
D 2 206 ASP 206 207 207 ASP ASP B . n 
D 2 207 SER 207 208 208 SER SER B . n 
D 2 208 GLU 208 209 209 GLU GLU B . n 
D 2 209 ASP 209 210 210 ASP ASP B . n 
D 2 210 GLU 210 211 211 GLU GLU B . n 
D 2 211 PHE 211 212 212 PHE PHE B . n 
D 2 212 LEU 212 213 213 LEU LEU B . n 
D 2 213 ASP 213 214 214 ASP ASP B . n 
D 2 214 TYR 214 215 215 TYR TYR B . n 
D 2 215 TRP 215 216 216 TRP TRP B . n 
D 2 216 ARG 216 217 217 ARG ARG B . n 
D 2 217 ASN 217 218 218 ASN ASN B . n 
D 2 218 TYR 218 219 219 TYR TYR B . n 
D 2 219 GLU 219 220 220 GLU GLU B . n 
D 2 220 ARG 220 221 221 ARG ARG B . n 
D 2 221 THR 221 222 222 THR THR B . n 
D 2 222 SER 222 223 223 SER SER B . n 
D 2 223 GLN 223 224 224 GLN GLN B . n 
D 2 224 LEU 224 225 225 LEU LEU B . n 
D 2 225 ARG 225 226 226 ARG ARG B . n 
D 2 226 ASN 226 227 227 ASN ASN B . n 
D 2 227 ASP 227 228 228 ASP ASP B . n 
D 2 228 LYS 228 229 229 LYS LYS B . n 
D 2 229 TYR 229 230 230 TYR TYR B . n 
D 2 230 ASN 230 231 231 ASN ASN B . n 
D 2 231 ASN 231 232 232 ASN ASN B . n 
D 2 232 ILE 232 233 233 ILE ILE B . n 
D 2 233 SER 233 234 234 SER SER B . n 
D 2 234 GLU 234 235 235 GLU GLU B . n 
D 2 235 TYR 235 236 236 TYR TYR B . n 
D 2 236 ARG 236 237 237 ARG ARG B . n 
D 2 237 ASN 237 238 238 ASN ASN B . n 
D 2 238 TRP 238 239 239 TRP TRP B . n 
D 2 239 ILE 239 240 240 ILE ILE B . n 
D 2 240 TYR 240 241 241 TYR TYR B . n 
D 2 241 ARG 241 242 242 ARG ARG B . n 
D 2 242 GLY 242 243 243 GLY GLY B . n 
D 2 243 ARG 243 244 244 ARG ARG B . n 
D 2 244 LYS 244 245 245 LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1   318 318 HOH HOH C . 
E 3 HOH 2   320 320 HOH HOH C . 
E 3 HOH 3   336 336 HOH HOH C . 
E 3 HOH 4   346 346 HOH HOH C . 
E 3 HOH 5   347 347 HOH HOH C . 
E 3 HOH 6   348 348 HOH HOH C . 
E 3 HOH 7   355 355 HOH HOH C . 
E 3 HOH 8   356 356 HOH HOH C . 
E 3 HOH 9   358 358 HOH HOH C . 
E 3 HOH 10  359 359 HOH HOH C . 
E 3 HOH 11  369 369 HOH HOH C . 
E 3 HOH 12  370 370 HOH HOH C . 
E 3 HOH 13  371 371 HOH HOH C . 
E 3 HOH 14  381 381 HOH HOH C . 
E 3 HOH 15  384 384 HOH HOH C . 
E 3 HOH 16  387 387 HOH HOH C . 
E 3 HOH 17  388 388 HOH HOH C . 
E 3 HOH 18  389 389 HOH HOH C . 
E 3 HOH 19  397 397 HOH HOH C . 
E 3 HOH 20  400 400 HOH HOH C . 
E 3 HOH 21  401 401 HOH HOH C . 
E 3 HOH 22  402 402 HOH HOH C . 
F 3 HOH 1   310 310 HOH HOH D . 
F 3 HOH 2   322 322 HOH HOH D . 
F 3 HOH 3   324 324 HOH HOH D . 
F 3 HOH 4   325 325 HOH HOH D . 
F 3 HOH 5   328 328 HOH HOH D . 
F 3 HOH 6   329 329 HOH HOH D . 
F 3 HOH 7   332 332 HOH HOH D . 
F 3 HOH 8   334 334 HOH HOH D . 
F 3 HOH 9   335 335 HOH HOH D . 
F 3 HOH 10  341 341 HOH HOH D . 
F 3 HOH 11  363 363 HOH HOH D . 
F 3 HOH 12  364 364 HOH HOH D . 
F 3 HOH 13  365 365 HOH HOH D . 
F 3 HOH 14  367 367 HOH HOH D . 
F 3 HOH 15  373 373 HOH HOH D . 
F 3 HOH 16  390 390 HOH HOH D . 
F 3 HOH 17  395 395 HOH HOH D . 
F 3 HOH 18  404 404 HOH HOH D . 
F 3 HOH 19  405 405 HOH HOH D . 
G 3 HOH 1   246 4   HOH HOH A . 
G 3 HOH 2   247 5   HOH HOH A . 
G 3 HOH 3   248 8   HOH HOH A . 
G 3 HOH 4   249 10  HOH HOH A . 
G 3 HOH 5   250 15  HOH HOH A . 
G 3 HOH 6   251 22  HOH HOH A . 
G 3 HOH 7   252 26  HOH HOH A . 
G 3 HOH 8   253 28  HOH HOH A . 
G 3 HOH 9   254 30  HOH HOH A . 
G 3 HOH 10  255 31  HOH HOH A . 
G 3 HOH 11  256 34  HOH HOH A . 
G 3 HOH 12  257 35  HOH HOH A . 
G 3 HOH 13  258 43  HOH HOH A . 
G 3 HOH 14  259 45  HOH HOH A . 
G 3 HOH 15  260 50  HOH HOH A . 
G 3 HOH 16  261 51  HOH HOH A . 
G 3 HOH 17  262 52  HOH HOH A . 
G 3 HOH 18  263 53  HOH HOH A . 
G 3 HOH 19  264 58  HOH HOH A . 
G 3 HOH 20  265 61  HOH HOH A . 
G 3 HOH 21  266 65  HOH HOH A . 
G 3 HOH 22  267 68  HOH HOH A . 
G 3 HOH 23  268 69  HOH HOH A . 
G 3 HOH 24  269 78  HOH HOH A . 
G 3 HOH 25  270 79  HOH HOH A . 
G 3 HOH 26  271 81  HOH HOH A . 
G 3 HOH 27  272 83  HOH HOH A . 
G 3 HOH 28  273 91  HOH HOH A . 
G 3 HOH 29  274 92  HOH HOH A . 
G 3 HOH 30  275 93  HOH HOH A . 
G 3 HOH 31  276 96  HOH HOH A . 
G 3 HOH 32  277 98  HOH HOH A . 
G 3 HOH 33  278 99  HOH HOH A . 
G 3 HOH 34  279 102 HOH HOH A . 
G 3 HOH 35  280 104 HOH HOH A . 
G 3 HOH 36  281 114 HOH HOH A . 
G 3 HOH 37  282 115 HOH HOH A . 
G 3 HOH 38  283 117 HOH HOH A . 
G 3 HOH 39  284 118 HOH HOH A . 
G 3 HOH 40  285 124 HOH HOH A . 
G 3 HOH 41  286 136 HOH HOH A . 
G 3 HOH 42  287 139 HOH HOH A . 
G 3 HOH 43  288 140 HOH HOH A . 
G 3 HOH 44  289 142 HOH HOH A . 
G 3 HOH 45  290 146 HOH HOH A . 
G 3 HOH 46  291 156 HOH HOH A . 
G 3 HOH 47  292 158 HOH HOH A . 
G 3 HOH 48  293 160 HOH HOH A . 
G 3 HOH 49  294 169 HOH HOH A . 
G 3 HOH 50  295 174 HOH HOH A . 
G 3 HOH 51  296 180 HOH HOH A . 
G 3 HOH 52  297 196 HOH HOH A . 
G 3 HOH 53  298 198 HOH HOH A . 
G 3 HOH 54  299 201 HOH HOH A . 
G 3 HOH 55  300 202 HOH HOH A . 
G 3 HOH 56  301 204 HOH HOH A . 
G 3 HOH 57  302 205 HOH HOH A . 
G 3 HOH 58  303 210 HOH HOH A . 
G 3 HOH 59  304 211 HOH HOH A . 
G 3 HOH 60  305 215 HOH HOH A . 
G 3 HOH 61  306 219 HOH HOH A . 
G 3 HOH 62  307 220 HOH HOH A . 
G 3 HOH 63  308 225 HOH HOH A . 
G 3 HOH 64  309 228 HOH HOH A . 
G 3 HOH 65  310 229 HOH HOH A . 
G 3 HOH 66  311 232 HOH HOH A . 
G 3 HOH 67  312 236 HOH HOH A . 
G 3 HOH 68  313 237 HOH HOH A . 
G 3 HOH 69  314 241 HOH HOH A . 
G 3 HOH 70  315 261 HOH HOH A . 
G 3 HOH 71  316 271 HOH HOH A . 
G 3 HOH 72  317 278 HOH HOH A . 
G 3 HOH 73  318 279 HOH HOH A . 
G 3 HOH 74  319 280 HOH HOH A . 
G 3 HOH 75  320 294 HOH HOH A . 
G 3 HOH 76  321 307 HOH HOH A . 
G 3 HOH 77  322 313 HOH HOH A . 
G 3 HOH 78  323 314 HOH HOH A . 
G 3 HOH 79  324 317 HOH HOH A . 
G 3 HOH 80  325 323 HOH HOH A . 
G 3 HOH 81  326 326 HOH HOH A . 
G 3 HOH 82  327 327 HOH HOH A . 
G 3 HOH 83  328 331 HOH HOH A . 
G 3 HOH 84  329 333 HOH HOH A . 
G 3 HOH 85  330 342 HOH HOH A . 
G 3 HOH 86  331 345 HOH HOH A . 
G 3 HOH 87  332 349 HOH HOH A . 
G 3 HOH 88  333 350 HOH HOH A . 
G 3 HOH 89  334 351 HOH HOH A . 
G 3 HOH 90  335 352 HOH HOH A . 
G 3 HOH 91  336 374 HOH HOH A . 
G 3 HOH 92  337 377 HOH HOH A . 
G 3 HOH 93  338 378 HOH HOH A . 
G 3 HOH 94  339 382 HOH HOH A . 
G 3 HOH 95  340 385 HOH HOH A . 
G 3 HOH 96  341 386 HOH HOH A . 
G 3 HOH 97  342 330 HOH HOH A . 
G 3 HOH 98  343 399 HOH HOH A . 
G 3 HOH 99  344 403 HOH HOH A . 
G 3 HOH 100 345 406 HOH HOH A . 
H 3 HOH 1   246 1   HOH HOH B . 
H 3 HOH 2   247 3   HOH HOH B . 
H 3 HOH 3   248 6   HOH HOH B . 
H 3 HOH 4   249 7   HOH HOH B . 
H 3 HOH 5   250 9   HOH HOH B . 
H 3 HOH 6   251 11  HOH HOH B . 
H 3 HOH 7   252 19  HOH HOH B . 
H 3 HOH 8   253 20  HOH HOH B . 
H 3 HOH 9   254 23  HOH HOH B . 
H 3 HOH 10  255 24  HOH HOH B . 
H 3 HOH 11  256 32  HOH HOH B . 
H 3 HOH 12  257 33  HOH HOH B . 
H 3 HOH 13  258 36  HOH HOH B . 
H 3 HOH 14  259 37  HOH HOH B . 
H 3 HOH 15  260 40  HOH HOH B . 
H 3 HOH 16  261 41  HOH HOH B . 
H 3 HOH 17  262 44  HOH HOH B . 
H 3 HOH 18  263 47  HOH HOH B . 
H 3 HOH 19  264 48  HOH HOH B . 
H 3 HOH 20  265 56  HOH HOH B . 
H 3 HOH 21  266 59  HOH HOH B . 
H 3 HOH 22  267 67  HOH HOH B . 
H 3 HOH 23  268 71  HOH HOH B . 
H 3 HOH 24  269 72  HOH HOH B . 
H 3 HOH 25  270 73  HOH HOH B . 
H 3 HOH 26  271 74  HOH HOH B . 
H 3 HOH 27  272 75  HOH HOH B . 
H 3 HOH 28  273 77  HOH HOH B . 
H 3 HOH 29  274 80  HOH HOH B . 
H 3 HOH 30  275 87  HOH HOH B . 
H 3 HOH 31  276 88  HOH HOH B . 
H 3 HOH 32  277 89  HOH HOH B . 
H 3 HOH 33  278 94  HOH HOH B . 
H 3 HOH 34  279 103 HOH HOH B . 
H 3 HOH 35  280 111 HOH HOH B . 
H 3 HOH 36  281 112 HOH HOH B . 
H 3 HOH 37  282 113 HOH HOH B . 
H 3 HOH 38  283 119 HOH HOH B . 
H 3 HOH 39  284 121 HOH HOH B . 
H 3 HOH 40  285 122 HOH HOH B . 
H 3 HOH 41  286 125 HOH HOH B . 
H 3 HOH 42  287 128 HOH HOH B . 
H 3 HOH 43  288 137 HOH HOH B . 
H 3 HOH 44  289 138 HOH HOH B . 
H 3 HOH 45  290 145 HOH HOH B . 
H 3 HOH 46  291 148 HOH HOH B . 
H 3 HOH 47  292 149 HOH HOH B . 
H 3 HOH 48  293 161 HOH HOH B . 
H 3 HOH 49  294 163 HOH HOH B . 
H 3 HOH 50  295 164 HOH HOH B . 
H 3 HOH 51  296 172 HOH HOH B . 
H 3 HOH 52  297 177 HOH HOH B . 
H 3 HOH 53  298 179 HOH HOH B . 
H 3 HOH 54  299 190 HOH HOH B . 
H 3 HOH 55  300 192 HOH HOH B . 
H 3 HOH 56  301 193 HOH HOH B . 
H 3 HOH 57  302 195 HOH HOH B . 
H 3 HOH 58  303 200 HOH HOH B . 
H 3 HOH 59  304 207 HOH HOH B . 
H 3 HOH 60  305 208 HOH HOH B . 
H 3 HOH 61  306 222 HOH HOH B . 
H 3 HOH 62  307 231 HOH HOH B . 
H 3 HOH 63  308 239 HOH HOH B . 
H 3 HOH 64  309 244 HOH HOH B . 
H 3 HOH 65  310 246 HOH HOH B . 
H 3 HOH 66  311 255 HOH HOH B . 
H 3 HOH 67  312 276 HOH HOH B . 
H 3 HOH 68  313 281 HOH HOH B . 
H 3 HOH 69  314 297 HOH HOH B . 
H 3 HOH 70  315 303 HOH HOH B . 
H 3 HOH 71  316 305 HOH HOH B . 
H 3 HOH 72  317 312 HOH HOH B . 
H 3 HOH 73  318 315 HOH HOH B . 
H 3 HOH 74  319 316 HOH HOH B . 
H 3 HOH 75  320 319 HOH HOH B . 
H 3 HOH 76  321 321 HOH HOH B . 
H 3 HOH 77  322 337 HOH HOH B . 
H 3 HOH 78  323 338 HOH HOH B . 
H 3 HOH 79  324 339 HOH HOH B . 
H 3 HOH 80  325 340 HOH HOH B . 
H 3 HOH 81  326 343 HOH HOH B . 
H 3 HOH 82  327 353 HOH HOH B . 
H 3 HOH 83  328 357 HOH HOH B . 
H 3 HOH 84  329 360 HOH HOH B . 
H 3 HOH 85  330 362 HOH HOH B . 
H 3 HOH 86  331 368 HOH HOH B . 
H 3 HOH 87  332 376 HOH HOH B . 
H 3 HOH 88  333 379 HOH HOH B . 
H 3 HOH 89  334 380 HOH HOH B . 
H 3 HOH 90  335 383 HOH HOH B . 
H 3 HOH 91  336 391 HOH HOH B . 
H 3 HOH 92  337 392 HOH HOH B . 
H 3 HOH 93  338 393 HOH HOH B . 
H 3 HOH 94  339 394 HOH HOH B . 
H 3 HOH 95  340 396 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-10-28 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' . ? 1 
X-PLOR    refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
X-PLOR    phasing          . ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   N 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    2 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    312 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    N 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    TYR 
_pdbx_validate_symm_contact.auth_seq_id_1     241 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     312 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_444 
_pdbx_validate_symm_contact.dist              2.17 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              82 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              83 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              83 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.21 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            10.91 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 16  ? ? -59.38  -7.71   
2  1 LYS A 17  ? ? -101.81 -67.01  
3  1 SER A 35  ? ? -98.32  38.85   
4  1 SER A 81  ? ? -56.90  -2.88   
5  1 GLU A 82  ? ? -153.29 70.98   
6  1 PRO A 83  ? ? -67.40  3.01    
7  1 LYS A 85  ? ? -102.71 72.05   
8  1 SER A 112 ? ? -94.80  -121.11 
9  1 ASN A 117 ? ? -33.31  -31.58  
10 1 PHE A 125 ? ? -38.47  -38.65  
11 1 LEU A 156 ? ? -39.85  -18.45  
12 1 THR A 187 ? ? 28.68   71.20   
13 1 LYS A 229 ? ? -90.96  -99.97  
14 1 PRO B 32  ? ? -56.71  173.46  
15 1 ASN B 70  ? ? -85.57  48.36   
16 1 TYR B 78  ? ? -178.27 149.08  
17 1 GLU B 82  ? ? -104.64 78.19   
18 1 SER B 112 ? ? -88.97  -127.30 
19 1 LEU B 148 ? ? -96.43  33.95   
20 1 ILE B 153 ? ? -68.28  93.93   
21 1 ASN B 154 ? ? 145.79  -7.44   
22 1 THR B 187 ? ? 32.22   63.55   
23 1 LYS B 229 ? ? -142.97 -95.08  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DT 
_pdbx_validate_planes.auth_asym_id    D 
_pdbx_validate_planes.auth_seq_id     906 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.082 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 14  ? CG  ? C GLU 13  CG  
2   1 Y 1 A GLU 14  ? CD  ? C GLU 13  CD  
3   1 Y 1 A GLU 14  ? OE1 ? C GLU 13  OE1 
4   1 Y 1 A GLU 14  ? OE2 ? C GLU 13  OE2 
5   1 Y 1 A GLN 16  ? CG  ? C GLN 15  CG  
6   1 Y 1 A GLN 16  ? CD  ? C GLN 15  CD  
7   1 Y 1 A GLN 16  ? OE1 ? C GLN 15  OE1 
8   1 Y 1 A GLN 16  ? NE2 ? C GLN 15  NE2 
9   1 Y 1 A LYS 17  ? CG  ? C LYS 16  CG  
10  1 Y 1 A LYS 17  ? CD  ? C LYS 16  CD  
11  1 Y 1 A LYS 17  ? CE  ? C LYS 16  CE  
12  1 Y 1 A LYS 17  ? NZ  ? C LYS 16  NZ  
13  1 Y 1 A TYR 18  ? CG  ? C TYR 17  CG  
14  1 Y 1 A TYR 18  ? CD1 ? C TYR 17  CD1 
15  1 Y 1 A TYR 18  ? CD2 ? C TYR 17  CD2 
16  1 Y 1 A TYR 18  ? CE1 ? C TYR 17  CE1 
17  1 Y 1 A TYR 18  ? CE2 ? C TYR 17  CE2 
18  1 Y 1 A TYR 18  ? CZ  ? C TYR 17  CZ  
19  1 Y 1 A TYR 18  ? OH  ? C TYR 17  OH  
20  1 Y 1 A ASP 19  ? CG  ? C ASP 18  CG  
21  1 Y 1 A ASP 19  ? OD1 ? C ASP 18  OD1 
22  1 Y 1 A ASP 19  ? OD2 ? C ASP 18  OD2 
23  1 Y 1 A GLU 27  ? CG  ? C GLU 26  CG  
24  1 Y 1 A GLU 27  ? CD  ? C GLU 26  CD  
25  1 Y 1 A GLU 27  ? OE1 ? C GLU 26  OE1 
26  1 Y 1 A GLU 27  ? OE2 ? C GLU 26  OE2 
27  1 Y 1 A LYS 29  ? CG  ? C LYS 28  CG  
28  1 Y 1 A LYS 29  ? CD  ? C LYS 28  CD  
29  1 Y 1 A LYS 29  ? CE  ? C LYS 28  CE  
30  1 Y 1 A LYS 29  ? NZ  ? C LYS 28  NZ  
31  1 Y 1 A SER 35  ? OG  ? C SER 34  OG  
32  1 Y 1 A ASP 36  ? CG  ? C ASP 35  CG  
33  1 Y 1 A ASP 36  ? OD1 ? C ASP 35  OD1 
34  1 Y 1 A ASP 36  ? OD2 ? C ASP 35  OD2 
35  1 Y 1 A LYS 38  ? CG  ? C LYS 37  CG  
36  1 Y 1 A LYS 38  ? CD  ? C LYS 37  CD  
37  1 Y 1 A LYS 38  ? CE  ? C LYS 37  CE  
38  1 Y 1 A LYS 38  ? NZ  ? C LYS 37  NZ  
39  1 Y 1 A LYS 54  ? CG  ? C LYS 53  CG  
40  1 Y 1 A LYS 54  ? CD  ? C LYS 53  CD  
41  1 Y 1 A LYS 54  ? CE  ? C LYS 53  CE  
42  1 Y 1 A LYS 54  ? NZ  ? C LYS 53  NZ  
43  1 Y 1 A GLU 57  ? CG  ? C GLU 56  CG  
44  1 Y 1 A GLU 57  ? CD  ? C GLU 56  CD  
45  1 Y 1 A GLU 57  ? OE1 ? C GLU 56  OE1 
46  1 Y 1 A GLU 57  ? OE2 ? C GLU 56  OE2 
47  1 Y 1 A LYS 67  ? CG  ? C LYS 66  CG  
48  1 Y 1 A LYS 67  ? CD  ? C LYS 66  CD  
49  1 Y 1 A LYS 67  ? CE  ? C LYS 66  CE  
50  1 Y 1 A LYS 67  ? NZ  ? C LYS 66  NZ  
51  1 Y 1 A GLN 68  ? CG  ? C GLN 67  CG  
52  1 Y 1 A GLN 68  ? CD  ? C GLN 67  CD  
53  1 Y 1 A GLN 68  ? OE1 ? C GLN 67  OE1 
54  1 Y 1 A GLN 68  ? NE2 ? C GLN 67  NE2 
55  1 Y 1 A ASN 70  ? CG  ? C ASN 69  CG  
56  1 Y 1 A ASN 70  ? OD1 ? C ASN 69  OD1 
57  1 Y 1 A ASN 70  ? ND2 ? C ASN 69  ND2 
58  1 Y 1 A GLU 82  ? CG  ? C GLU 81  CG  
59  1 Y 1 A GLU 82  ? CD  ? C GLU 81  CD  
60  1 Y 1 A GLU 82  ? OE1 ? C GLU 81  OE1 
61  1 Y 1 A GLU 82  ? OE2 ? C GLU 81  OE2 
62  1 Y 1 A ASN 84  ? CG  ? C ASN 83  CG  
63  1 Y 1 A ASN 84  ? OD1 ? C ASN 83  OD1 
64  1 Y 1 A ASN 84  ? ND2 ? C ASN 83  ND2 
65  1 Y 1 A LYS 85  ? CG  ? C LYS 84  CG  
66  1 Y 1 A LYS 85  ? CD  ? C LYS 84  CD  
67  1 Y 1 A LYS 85  ? CE  ? C LYS 84  CE  
68  1 Y 1 A LYS 85  ? NZ  ? C LYS 84  NZ  
69  1 Y 1 A TYR 95  ? CG  ? C TYR 94  CG  
70  1 Y 1 A TYR 95  ? CD1 ? C TYR 94  CD1 
71  1 Y 1 A TYR 95  ? CD2 ? C TYR 94  CD2 
72  1 Y 1 A TYR 95  ? CE1 ? C TYR 94  CE1 
73  1 Y 1 A TYR 95  ? CE2 ? C TYR 94  CE2 
74  1 Y 1 A TYR 95  ? CZ  ? C TYR 94  CZ  
75  1 Y 1 A TYR 95  ? OH  ? C TYR 94  OH  
76  1 Y 1 A LYS 98  ? CG  ? C LYS 97  CG  
77  1 Y 1 A LYS 98  ? CD  ? C LYS 97  CD  
78  1 Y 1 A LYS 98  ? CE  ? C LYS 97  CE  
79  1 Y 1 A LYS 98  ? NZ  ? C LYS 97  NZ  
80  1 Y 1 A ASN 100 ? CG  ? C ASN 99  CG  
81  1 Y 1 A ASN 100 ? OD1 ? C ASN 99  OD1 
82  1 Y 1 A ASN 100 ? ND2 ? C ASN 99  ND2 
83  1 Y 1 A GLU 101 ? CG  ? C GLU 100 CG  
84  1 Y 1 A GLU 101 ? CD  ? C GLU 100 CD  
85  1 Y 1 A GLU 101 ? OE1 ? C GLU 100 OE1 
86  1 Y 1 A GLU 101 ? OE2 ? C GLU 100 OE2 
87  1 Y 1 A LYS 102 ? CG  ? C LYS 101 CG  
88  1 Y 1 A LYS 102 ? CD  ? C LYS 101 CD  
89  1 Y 1 A LYS 102 ? CE  ? C LYS 101 CE  
90  1 Y 1 A LYS 102 ? NZ  ? C LYS 101 NZ  
91  1 Y 1 A ARG 140 ? CG  ? C ARG 139 CG  
92  1 Y 1 A ARG 140 ? CD  ? C ARG 139 CD  
93  1 Y 1 A ARG 140 ? NE  ? C ARG 139 NE  
94  1 Y 1 A ARG 140 ? CZ  ? C ARG 139 CZ  
95  1 Y 1 A ARG 140 ? NH1 ? C ARG 139 NH1 
96  1 Y 1 A ARG 140 ? NH2 ? C ARG 139 NH2 
97  1 Y 1 A LYS 149 ? CG  ? C LYS 148 CG  
98  1 Y 1 A LYS 149 ? CD  ? C LYS 148 CD  
99  1 Y 1 A LYS 149 ? CE  ? C LYS 148 CE  
100 1 Y 1 A LYS 149 ? NZ  ? C LYS 148 NZ  
101 1 Y 1 A ASN 154 ? CG  ? C ASN 153 CG  
102 1 Y 1 A ASN 154 ? OD1 ? C ASN 153 OD1 
103 1 Y 1 A ASN 154 ? ND2 ? C ASN 153 ND2 
104 1 Y 1 A GLU 158 ? CG  ? C GLU 157 CG  
105 1 Y 1 A GLU 158 ? CD  ? C GLU 157 CD  
106 1 Y 1 A GLU 158 ? OE1 ? C GLU 157 OE1 
107 1 Y 1 A GLU 158 ? OE2 ? C GLU 157 OE2 
108 1 Y 1 A LYS 161 ? CG  ? C LYS 160 CG  
109 1 Y 1 A LYS 161 ? CD  ? C LYS 160 CD  
110 1 Y 1 A LYS 161 ? CE  ? C LYS 160 CE  
111 1 Y 1 A LYS 161 ? NZ  ? C LYS 160 NZ  
112 1 Y 1 A LYS 164 ? CG  ? C LYS 163 CG  
113 1 Y 1 A LYS 164 ? CD  ? C LYS 163 CD  
114 1 Y 1 A LYS 164 ? CE  ? C LYS 163 CE  
115 1 Y 1 A LYS 164 ? NZ  ? C LYS 163 NZ  
116 1 Y 1 A LYS 197 ? CG  ? C LYS 196 CG  
117 1 Y 1 A LYS 197 ? CD  ? C LYS 196 CD  
118 1 Y 1 A LYS 197 ? CE  ? C LYS 196 CE  
119 1 Y 1 A LYS 197 ? NZ  ? C LYS 196 NZ  
120 1 Y 1 A LYS 203 ? CG  ? C LYS 202 CG  
121 1 Y 1 A LYS 203 ? CD  ? C LYS 202 CD  
122 1 Y 1 A LYS 203 ? CE  ? C LYS 202 CE  
123 1 Y 1 A LYS 203 ? NZ  ? C LYS 202 NZ  
124 1 Y 1 A GLN 224 ? CG  ? C GLN 223 CG  
125 1 Y 1 A GLN 224 ? CD  ? C GLN 223 CD  
126 1 Y 1 A GLN 224 ? OE1 ? C GLN 223 OE1 
127 1 Y 1 A GLN 224 ? NE2 ? C GLN 223 NE2 
128 1 Y 1 A ASN 227 ? CG  ? C ASN 226 CG  
129 1 Y 1 A ASN 227 ? OD1 ? C ASN 226 OD1 
130 1 Y 1 A ASN 227 ? ND2 ? C ASN 226 ND2 
131 1 Y 1 A ASP 228 ? CG  ? C ASP 227 CG  
132 1 Y 1 A ASP 228 ? OD1 ? C ASP 227 OD1 
133 1 Y 1 A ASP 228 ? OD2 ? C ASP 227 OD2 
134 1 Y 1 A ARG 242 ? CG  ? C ARG 241 CG  
135 1 Y 1 A ARG 242 ? CD  ? C ARG 241 CD  
136 1 Y 1 A ARG 242 ? NE  ? C ARG 241 NE  
137 1 Y 1 A ARG 242 ? CZ  ? C ARG 241 CZ  
138 1 Y 1 A ARG 242 ? NH1 ? C ARG 241 NH1 
139 1 Y 1 A ARG 242 ? NH2 ? C ARG 241 NH2 
140 1 Y 1 A LYS 245 ? O   ? C LYS 244 O   
141 1 Y 1 A LYS 245 ? CG  ? C LYS 244 CG  
142 1 Y 1 A LYS 245 ? CD  ? C LYS 244 CD  
143 1 Y 1 A LYS 245 ? CE  ? C LYS 244 CE  
144 1 Y 1 A LYS 245 ? NZ  ? C LYS 244 NZ  
145 1 Y 1 B ASP 19  ? CG  ? D ASP 18  CG  
146 1 Y 1 B ASP 19  ? OD1 ? D ASP 18  OD1 
147 1 Y 1 B ASP 19  ? OD2 ? D ASP 18  OD2 
148 1 Y 1 B LYS 29  ? CG  ? D LYS 28  CG  
149 1 Y 1 B LYS 29  ? CD  ? D LYS 28  CD  
150 1 Y 1 B LYS 29  ? CE  ? D LYS 28  CE  
151 1 Y 1 B LYS 29  ? NZ  ? D LYS 28  NZ  
152 1 Y 1 B SER 35  ? OG  ? D SER 34  OG  
153 1 Y 1 B ASP 36  ? CG  ? D ASP 35  CG  
154 1 Y 1 B ASP 36  ? OD1 ? D ASP 35  OD1 
155 1 Y 1 B ASP 36  ? OD2 ? D ASP 35  OD2 
156 1 Y 1 B THR 37  ? OG1 ? D THR 36  OG1 
157 1 Y 1 B THR 37  ? CG2 ? D THR 36  CG2 
158 1 Y 1 B LYS 38  ? CG  ? D LYS 37  CG  
159 1 Y 1 B LYS 38  ? CD  ? D LYS 37  CD  
160 1 Y 1 B LYS 38  ? CE  ? D LYS 37  CE  
161 1 Y 1 B LYS 38  ? NZ  ? D LYS 37  NZ  
162 1 Y 1 B GLU 45  ? CG  ? D GLU 44  CG  
163 1 Y 1 B GLU 45  ? CD  ? D GLU 44  CD  
164 1 Y 1 B GLU 45  ? OE1 ? D GLU 44  OE1 
165 1 Y 1 B GLU 45  ? OE2 ? D GLU 44  OE2 
166 1 Y 1 B GLU 57  ? CG  ? D GLU 56  CG  
167 1 Y 1 B GLU 57  ? CD  ? D GLU 56  CD  
168 1 Y 1 B GLU 57  ? OE1 ? D GLU 56  OE1 
169 1 Y 1 B GLU 57  ? OE2 ? D GLU 56  OE2 
170 1 Y 1 B LYS 58  ? CG  ? D LYS 57  CG  
171 1 Y 1 B LYS 58  ? CD  ? D LYS 57  CD  
172 1 Y 1 B LYS 58  ? CE  ? D LYS 57  CE  
173 1 Y 1 B LYS 58  ? NZ  ? D LYS 57  NZ  
174 1 Y 1 B LYS 67  ? CG  ? D LYS 66  CG  
175 1 Y 1 B LYS 67  ? CD  ? D LYS 66  CD  
176 1 Y 1 B LYS 67  ? CE  ? D LYS 66  CE  
177 1 Y 1 B LYS 67  ? NZ  ? D LYS 66  NZ  
178 1 Y 1 B GLN 68  ? CG  ? D GLN 67  CG  
179 1 Y 1 B GLN 68  ? CD  ? D GLN 67  CD  
180 1 Y 1 B GLN 68  ? OE1 ? D GLN 67  OE1 
181 1 Y 1 B GLN 68  ? NE2 ? D GLN 67  NE2 
182 1 Y 1 B GLU 82  ? CG  ? D GLU 81  CG  
183 1 Y 1 B GLU 82  ? CD  ? D GLU 81  CD  
184 1 Y 1 B GLU 82  ? OE1 ? D GLU 81  OE1 
185 1 Y 1 B GLU 82  ? OE2 ? D GLU 81  OE2 
186 1 Y 1 B ASN 84  ? CG  ? D ASN 83  CG  
187 1 Y 1 B ASN 84  ? OD1 ? D ASN 83  OD1 
188 1 Y 1 B ASN 84  ? ND2 ? D ASN 83  ND2 
189 1 Y 1 B LYS 85  ? CG  ? D LYS 84  CG  
190 1 Y 1 B LYS 85  ? CD  ? D LYS 84  CD  
191 1 Y 1 B LYS 85  ? CE  ? D LYS 84  CE  
192 1 Y 1 B LYS 85  ? NZ  ? D LYS 84  NZ  
193 1 Y 1 B ASN 97  ? CG  ? D ASN 96  CG  
194 1 Y 1 B ASN 97  ? OD1 ? D ASN 96  OD1 
195 1 Y 1 B ASN 97  ? ND2 ? D ASN 96  ND2 
196 1 Y 1 B LYS 102 ? CG  ? D LYS 101 CG  
197 1 Y 1 B LYS 102 ? CD  ? D LYS 101 CD  
198 1 Y 1 B LYS 102 ? CE  ? D LYS 101 CE  
199 1 Y 1 B LYS 102 ? NZ  ? D LYS 101 NZ  
200 1 Y 1 B LYS 119 ? CG  ? D LYS 118 CG  
201 1 Y 1 B LYS 119 ? CD  ? D LYS 118 CD  
202 1 Y 1 B LYS 119 ? CE  ? D LYS 118 CE  
203 1 Y 1 B LYS 119 ? NZ  ? D LYS 118 NZ  
204 1 Y 1 B ARG 140 ? CG  ? D ARG 139 CG  
205 1 Y 1 B ARG 140 ? CD  ? D ARG 139 CD  
206 1 Y 1 B ARG 140 ? NE  ? D ARG 139 NE  
207 1 Y 1 B ARG 140 ? CZ  ? D ARG 139 CZ  
208 1 Y 1 B ARG 140 ? NH1 ? D ARG 139 NH1 
209 1 Y 1 B ARG 140 ? NH2 ? D ARG 139 NH2 
210 1 Y 1 B ASN 152 ? CG  ? D ASN 151 CG  
211 1 Y 1 B ASN 152 ? OD1 ? D ASN 151 OD1 
212 1 Y 1 B ASN 152 ? ND2 ? D ASN 151 ND2 
213 1 Y 1 B ASN 154 ? CG  ? D ASN 153 CG  
214 1 Y 1 B ASN 154 ? OD1 ? D ASN 153 OD1 
215 1 Y 1 B ASN 154 ? ND2 ? D ASN 153 ND2 
216 1 Y 1 B GLU 158 ? CG  ? D GLU 157 CG  
217 1 Y 1 B GLU 158 ? CD  ? D GLU 157 CD  
218 1 Y 1 B GLU 158 ? OE1 ? D GLU 157 OE1 
219 1 Y 1 B GLU 158 ? OE2 ? D GLU 157 OE2 
220 1 Y 1 B LYS 164 ? CG  ? D LYS 163 CG  
221 1 Y 1 B LYS 164 ? CD  ? D LYS 163 CD  
222 1 Y 1 B LYS 164 ? CE  ? D LYS 163 CE  
223 1 Y 1 B LYS 164 ? NZ  ? D LYS 163 NZ  
224 1 Y 1 B LYS 197 ? CG  ? D LYS 196 CG  
225 1 Y 1 B LYS 197 ? CD  ? D LYS 196 CD  
226 1 Y 1 B LYS 197 ? CE  ? D LYS 196 CE  
227 1 Y 1 B LYS 197 ? NZ  ? D LYS 196 NZ  
228 1 Y 1 B GLU 201 ? CG  ? D GLU 200 CG  
229 1 Y 1 B GLU 201 ? CD  ? D GLU 200 CD  
230 1 Y 1 B GLU 201 ? OE1 ? D GLU 200 OE1 
231 1 Y 1 B GLU 201 ? OE2 ? D GLU 200 OE2 
232 1 Y 1 B LYS 203 ? CG  ? D LYS 202 CG  
233 1 Y 1 B LYS 203 ? CD  ? D LYS 202 CD  
234 1 Y 1 B LYS 203 ? CE  ? D LYS 202 CE  
235 1 Y 1 B LYS 203 ? NZ  ? D LYS 202 NZ  
236 1 Y 1 B GLN 224 ? CG  ? D GLN 223 CG  
237 1 Y 1 B GLN 224 ? CD  ? D GLN 223 CD  
238 1 Y 1 B GLN 224 ? OE1 ? D GLN 223 OE1 
239 1 Y 1 B GLN 224 ? NE2 ? D GLN 223 NE2 
240 1 Y 1 B ASN 227 ? CG  ? D ASN 226 CG  
241 1 Y 1 B ASN 227 ? OD1 ? D ASN 226 OD1 
242 1 Y 1 B ASN 227 ? ND2 ? D ASN 226 ND2 
243 1 Y 1 B ASP 228 ? CG  ? D ASP 227 CG  
244 1 Y 1 B ASP 228 ? OD1 ? D ASP 227 OD1 
245 1 Y 1 B ASP 228 ? OD2 ? D ASP 227 OD2 
246 1 Y 1 B LYS 245 ? O   ? D LYS 244 O   
247 1 Y 1 B LYS 245 ? CG  ? D LYS 244 CG  
248 1 Y 1 B LYS 245 ? CD  ? D LYS 244 CD  
249 1 Y 1 B LYS 245 ? CE  ? D LYS 244 CE  
250 1 Y 1 B LYS 245 ? NZ  ? D LYS 244 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 D DC  901 ? B DC  1   
2  1 Y 1 A ALA 142 ? C ALA 141 
3  1 Y 1 A THR 143 ? C THR 142 
4  1 Y 1 A ARG 144 ? C ARG 143 
5  1 Y 1 A LYS 145 ? C LYS 144 
6  1 Y 1 A SER 146 ? C SER 145 
7  1 Y 1 A SER 147 ? C SER 146 
8  1 Y 1 A LEU 148 ? C LEU 147 
9  1 Y 1 B TYR 12  ? D TYR 11  
10 1 Y 1 B ASP 13  ? D ASP 12  
11 1 Y 1 B GLU 14  ? D GLU 13  
12 1 Y 1 B ASN 15  ? D ASN 14  
13 1 Y 1 B GLN 16  ? D GLN 15  
14 1 Y 1 B LYS 17  ? D LYS 16  
15 1 Y 1 B TYR 18  ? D TYR 17  
16 1 Y 1 B LYS 98  ? D LYS 97  
17 1 Y 1 B GLU 99  ? D GLU 98  
18 1 Y 1 B ASN 100 ? D ASN 99  
19 1 Y 1 B GLU 101 ? D GLU 100 
20 1 Y 1 B ALA 142 ? D ALA 141 
21 1 Y 1 B THR 143 ? D THR 142 
22 1 Y 1 B ARG 144 ? D ARG 143 
23 1 Y 1 B LYS 145 ? D LYS 144 
24 1 Y 1 B SER 146 ? D SER 145 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1BGB 'double helix'        
1BGB 'a-form double helix' 
1BGB 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 B DC 11 1_555 -0.278 -0.321 -0.308 -4.965  -9.795  -2.603 1  C_DG802:DC911_D C 802 ? D 911 ? 19 1 
1 A DG 3  1_555 B DC 10 1_555 -0.426 -0.484 0.198  3.725   -6.748  1.655  2  C_DG803:DC910_D C 803 ? D 910 ? 19 1 
1 A DG 4  1_555 B DC 9  1_555 0.040  -0.282 0.129  11.342  -7.323  -0.707 3  C_DG804:DC909_D C 804 ? D 909 ? 19 1 
1 A DA 5  1_555 B DT 8  1_555 -0.189 0.024  0.174  -3.505  3.859   0.163  4  C_DA805:DT908_D C 805 ? D 908 ? 20 1 
1 A DT 6  1_555 B DA 7  1_555 -0.209 -0.145 -0.003 15.682  3.723   2.802  5  C_DT806:DA907_D C 806 ? D 907 ? 20 1 
1 A DA 7  1_555 B DT 6  1_555 -0.288 -0.171 -0.197 -12.213 3.050   0.773  6  C_DA807:DT906_D C 807 ? D 906 ? 20 1 
1 A DT 8  1_555 B DA 5  1_555 -0.499 -0.066 0.475  -5.959  -1.774  -3.175 7  C_DT808:DA905_D C 808 ? D 905 ? 20 1 
1 A DC 9  1_555 B DG 4  1_555 0.149  -0.220 -0.304 -4.312  -8.344  1.834  8  C_DC809:DG904_D C 809 ? D 904 ? 19 1 
1 A DC 10 1_555 B DG 3  1_555 0.171  -0.282 0.504  -6.992  -6.482  0.981  9  C_DC810:DG903_D C 810 ? D 903 ? 19 1 
1 A DC 11 1_555 B DG 2  1_555 0.688  0.444  -0.278 11.966  -28.366 16.434 10 C_DC811:DG902_D C 811 ? D 902 ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 B DC 11 1_555 A DG 3  1_555 B DC 10 1_555 0.073  0.900  3.243 -5.383 -1.009  32.272 1.769  -1.046 3.161 -1.799  
9.597   32.721 1 CC_DG802DG803:DC910DC911_DD C 802 ? D 911 ? C 803 ? D 910 ? 
1 A DG 3  1_555 B DC 10 1_555 A DG 4  1_555 B DC 9  1_555 0.979  -0.212 3.204 3.720  1.045   33.053 -0.544 -1.092 3.284 1.829   
-6.511  33.272 2 CC_DG803DG804:DC909DC910_DD C 803 ? D 910 ? C 804 ? D 909 ? 
1 A DG 4  1_555 B DC 9  1_555 A DA 5  1_555 B DT 8  1_555 -0.276 -0.881 3.842 -4.955 -5.357  37.183 -0.533 -0.338 3.930 -8.303  
7.680   37.867 3 CC_DG804DA805:DT908DC909_DD C 804 ? D 909 ? C 805 ? D 908 ? 
1 A DA 5  1_555 B DT 8  1_555 A DT 6  1_555 B DA 7  1_555 -0.298 -1.354 3.084 -0.077 -1.888  29.497 -2.272 0.569  3.164 -3.703  
0.151   29.556 4 CC_DA805DT806:DA907DT908_DD C 805 ? D 908 ? C 806 ? D 907 ? 
1 A DT 6  1_555 B DA 7  1_555 A DA 7  1_555 B DT 6  1_555 0.072  -1.532 4.261 0.822  48.986  26.813 -4.791 -0.025 0.797 63.021  
-1.057  55.450 5 CC_DT806DA807:DT906DA907_DD C 806 ? D 907 ? C 807 ? D 906 ? 
1 A DA 7  1_555 B DT 6  1_555 A DT 8  1_555 B DA 5  1_555 -0.019 -1.472 3.441 -4.580 1.673   28.046 -3.393 -1.053 3.310 3.419   
9.361   28.459 6 CC_DA807DT808:DA905DT906_DD C 807 ? D 906 ? C 808 ? D 905 ? 
1 A DT 8  1_555 B DA 5  1_555 A DC 9  1_555 B DG 4  1_555 0.480  -0.759 3.415 9.606  -13.719 42.274 0.356  0.317  3.512 -18.190 
-12.737 45.329 7 CC_DT808DC809:DG904DA905_DD C 808 ? D 905 ? C 809 ? D 904 ? 
1 A DC 9  1_555 B DG 4  1_555 A DC 10 1_555 B DG 3  1_555 -0.706 -0.287 3.549 -7.188 3.931   31.569 -1.268 -0.125 3.559 7.077   
12.941  32.588 8 CC_DC809DC810:DG903DG904_DD C 809 ? D 904 ? C 810 ? D 903 ? 
1 A DC 10 1_555 B DG 3  1_555 A DC 11 1_555 B DG 2  1_555 0.382  1.440  2.939 11.008 -8.213  41.325 2.642  0.417  2.634 -11.270 
-15.104 43.453 9 CC_DC810DC811:DG902DG903_DD C 810 ? D 903 ? C 811 ? D 902 ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#