data_1BGO
# 
_entry.id   1BGO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BGO         
WWPDB D_1000171734 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BGO 
_pdbx_database_status.recvd_initial_deposition_date   1998-05-29 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Desjarlais, R.L.'   1  
'Yamashita, D.S.'    2  
'Oh, H.-J.'          3  
'Bondinell, W.E.'    4  
'Uzinskas, I.N.'     5  
'Erhard, K.F.'       6  
'Allen, A.C.'        7  
'Haltiwanger, R.C.'  8  
'Zhao, B.'           9  
'Smith, W.W.'        10 
'Abdel-Meguid, S.S.' 11 
;D'Alessio, K.
;
12 
'Janson, C.A.'       13 
'Mcqueney, M.S.'     14 
'Tomaszek, T.A.'     15 
'Levy, M.A.'         16 
'Veber, D.F.'        17 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Use of X-Ray Co-Crystal Structures and Molecular Modeling to Design Potent and Selective Non-Peptide Inhibitors of Cathepsin K' 
J.Am.Chem.Soc.   120 9114 ? 1998 JACSAT US 0002-7863 0004 ? -1 ? 
1       'Crystal Structure of Human Osteoclast Cathepsin K Complex with E-64' Nat.Struct.Biol. 4   109  ? 1997 NSBIEW US 1072-8368 
2024 ? ?  ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Desjarlais, R.L.'   1  
primary 'Yamashita, D.S.'    2  
primary 'Oh, H.J.'           3  
primary 'Uzinskas, I.N.'     4  
primary 'Erhard, K.F.'       5  
primary 'Allen, A.C.'        6  
primary 'Haltiwanger, R.C.'  7  
primary 'Zhao, B.G.'         8  
primary 'Smith, W.W.'        9  
primary 'Abdel-Meguid, S.S.' 10 
primary 'Dalessio, K.'       11 
primary 'Janson, C.A.'       12 
primary 'Mcqueney, M.S.'     13 
primary 'Tomaszek, T.A.'     14 
primary 'Levy, M.A.'         15 
primary 'Veber, D.F.'        16 
1       'Zhao, B.'           17 
1       'Janson, C.A.'       18 
1       'Amegadzie, B.Y.'    19 
1       
;D'Alessio, K.
;
20 
1       'Griffin, C.'        21 
1       'Hanning, C.R.'      22 
1       'Jones, C.'          23 
1       'Kurdyla, J.'        24 
1       'Mcqueney, M.'       25 
1       'Qiu, X.'            26 
1       'Smith, W.W.'        27 
1       'Abdel-Meguid, S.S.' 28 
# 
_cell.entry_id           1BGO 
_cell.length_a           71.550 
_cell.length_b           71.550 
_cell.length_c           55.090 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BGO 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CATHEPSIN K'                                                                     23523.480 1  3.4.22.38 ? ? 
'INHIBITOR COVALENTLY BOUND TO ACTIVE SITE CYS 25' 
2 non-polymer syn '1-[2-(3-BIPHENYL)-4-METHYLVALERYL)]AMINO-3-(2-PYRIDYLSULFONYL)AMINO-2-PROPANONE' 481.607   1  ?         ? ? ? 
3 water       nat water                                                                             18.015    19 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG
IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL
NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG
IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL
NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   ASP n 
1 4   SER n 
1 5   VAL n 
1 6   ASP n 
1 7   TYR n 
1 8   ARG n 
1 9   LYS n 
1 10  LYS n 
1 11  GLY n 
1 12  TYR n 
1 13  VAL n 
1 14  THR n 
1 15  PRO n 
1 16  VAL n 
1 17  LYS n 
1 18  ASN n 
1 19  GLN n 
1 20  GLY n 
1 21  GLN n 
1 22  CYS n 
1 23  GLY n 
1 24  SER n 
1 25  CYS n 
1 26  TRP n 
1 27  ALA n 
1 28  PHE n 
1 29  SER n 
1 30  SER n 
1 31  VAL n 
1 32  GLY n 
1 33  ALA n 
1 34  LEU n 
1 35  GLU n 
1 36  GLY n 
1 37  GLN n 
1 38  LEU n 
1 39  LYS n 
1 40  LYS n 
1 41  LYS n 
1 42  THR n 
1 43  GLY n 
1 44  LYS n 
1 45  LEU n 
1 46  LEU n 
1 47  ASN n 
1 48  LEU n 
1 49  SER n 
1 50  PRO n 
1 51  GLN n 
1 52  ASN n 
1 53  LEU n 
1 54  VAL n 
1 55  ASP n 
1 56  CYS n 
1 57  VAL n 
1 58  SER n 
1 59  GLU n 
1 60  ASN n 
1 61  ASP n 
1 62  GLY n 
1 63  CYS n 
1 64  GLY n 
1 65  GLY n 
1 66  GLY n 
1 67  TYR n 
1 68  MET n 
1 69  THR n 
1 70  ASN n 
1 71  ALA n 
1 72  PHE n 
1 73  GLN n 
1 74  TYR n 
1 75  VAL n 
1 76  GLN n 
1 77  LYS n 
1 78  ASN n 
1 79  ARG n 
1 80  GLY n 
1 81  ILE n 
1 82  ASP n 
1 83  SER n 
1 84  GLU n 
1 85  ASP n 
1 86  ALA n 
1 87  TYR n 
1 88  PRO n 
1 89  TYR n 
1 90  VAL n 
1 91  GLY n 
1 92  GLN n 
1 93  GLU n 
1 94  GLU n 
1 95  SER n 
1 96  CYS n 
1 97  MET n 
1 98  TYR n 
1 99  ASN n 
1 100 PRO n 
1 101 THR n 
1 102 GLY n 
1 103 LYS n 
1 104 ALA n 
1 105 ALA n 
1 106 LYS n 
1 107 CYS n 
1 108 ARG n 
1 109 GLY n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 ILE n 
1 114 PRO n 
1 115 GLU n 
1 116 GLY n 
1 117 ASN n 
1 118 GLU n 
1 119 LYS n 
1 120 ALA n 
1 121 LEU n 
1 122 LYS n 
1 123 ARG n 
1 124 ALA n 
1 125 VAL n 
1 126 ALA n 
1 127 ARG n 
1 128 VAL n 
1 129 GLY n 
1 130 PRO n 
1 131 VAL n 
1 132 SER n 
1 133 VAL n 
1 134 ALA n 
1 135 ILE n 
1 136 ASP n 
1 137 ALA n 
1 138 SER n 
1 139 LEU n 
1 140 THR n 
1 141 SER n 
1 142 PHE n 
1 143 GLN n 
1 144 PHE n 
1 145 TYR n 
1 146 SER n 
1 147 LYS n 
1 148 GLY n 
1 149 VAL n 
1 150 TYR n 
1 151 TYR n 
1 152 ASP n 
1 153 GLU n 
1 154 SER n 
1 155 CYS n 
1 156 ASN n 
1 157 SER n 
1 158 ASP n 
1 159 ASN n 
1 160 LEU n 
1 161 ASN n 
1 162 HIS n 
1 163 ALA n 
1 164 VAL n 
1 165 LEU n 
1 166 ALA n 
1 167 VAL n 
1 168 GLY n 
1 169 TYR n 
1 170 GLY n 
1 171 ILE n 
1 172 GLN n 
1 173 LYS n 
1 174 GLY n 
1 175 ASN n 
1 176 LYS n 
1 177 HIS n 
1 178 TRP n 
1 179 ILE n 
1 180 ILE n 
1 181 LYS n 
1 182 ASN n 
1 183 SER n 
1 184 TRP n 
1 185 GLY n 
1 186 GLU n 
1 187 ASN n 
1 188 TRP n 
1 189 GLY n 
1 190 ASN n 
1 191 LYS n 
1 192 GLY n 
1 193 TYR n 
1 194 ILE n 
1 195 LEU n 
1 196 MET n 
1 197 ALA n 
1 198 ARG n 
1 199 ASN n 
1 200 LYS n 
1 201 ASN n 
1 202 ASN n 
1 203 ALA n 
1 204 CYS n 
1 205 GLY n 
1 206 ILE n 
1 207 ALA n 
1 208 ASN n 
1 209 LEU n 
1 210 ALA n 
1 211 SER n 
1 212 PHE n 
1 213 PRO n 
1 214 LYS n 
1 215 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            SF21 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 OSTEOCLAST 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF21 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               BACULOVIRUS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CATK_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P43235 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGD
MTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLL
NLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGI
ANLASFPKM
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1BGO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 215 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P43235 
_struct_ref_seq.db_align_beg                  115 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  329 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       215 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                           ? 'C3 H7 N O2'      
89.093  
ARG 'L-peptide linking' y ARGININE                                                                          ? 'C6 H15 N4 O2 1'  
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                        ? 'C4 H8 N2 O3'     
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                   ? 'C4 H7 N O4'      
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                          ? 'C3 H7 N O2 S'    
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                         ? 'C5 H10 N2 O3'    
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                   ? 'C5 H9 N O4'      
147.129 
GLY 'peptide linking'   y GLYCINE                                                                           ? 'C2 H5 N O2'      
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                         ? 'C6 H10 N3 O2 1'  
156.162 
HOH non-polymer         . WATER                                                                             ? 'H2 O'            
18.015  
I10 non-polymer         . '1-[2-(3-BIPHENYL)-4-METHYLVALERYL)]AMINO-3-(2-PYRIDYLSULFONYL)AMINO-2-PROPANONE' ? 'C26 H31 N3 O4 S' 
481.607 
ILE 'L-peptide linking' y ISOLEUCINE                                                                        ? 'C6 H13 N O2'     
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                           ? 'C6 H13 N O2'     
131.173 
LYS 'L-peptide linking' y LYSINE                                                                            ? 'C6 H15 N2 O2 1'  
147.195 
MET 'L-peptide linking' y METHIONINE                                                                        ? 'C5 H11 N O2 S'   
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                     ? 'C9 H11 N O2'     
165.189 
PRO 'L-peptide linking' y PROLINE                                                                           ? 'C5 H9 N O2'      
115.130 
SER 'L-peptide linking' y SERINE                                                                            ? 'C3 H7 N O3'      
105.093 
THR 'L-peptide linking' y THREONINE                                                                         ? 'C4 H9 N O3'      
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                        ? 'C11 H12 N2 O2'   
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                          ? 'C9 H11 N O3'     
181.189 
VAL 'L-peptide linking' y VALINE                                                                            ? 'C5 H11 N O2'     
117.146 
# 
_exptl.entry_id          1BGO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.95 
_exptl_crystal.density_percent_sol   58.0 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 4.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           287 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   XENTRONICS 
_diffrn_detector.pdbx_collection_date   1997-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BGO 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35. 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   11258 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89 
_reflns.pdbx_Rmerge_I_obs            0.089 
_reflns.pdbx_Rsym_value              0.089 
_reflns.pdbx_netI_over_sigmaI        12.4 
_reflns.B_iso_Wilson_estimate        28.9 
_reflns.pdbx_redundancy              3.6 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.4 
_reflns_shell.percent_possible_all   54 
_reflns_shell.Rmerge_I_obs           0.27 
_reflns_shell.pdbx_Rsym_value        0.27 
_reflns_shell.meanI_over_sigI_obs    1.8 
_reflns_shell.pdbx_redundancy        1.5 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1BGO 
_refine.ls_number_reflns_obs                     9666 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.00100 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    79.3 
_refine.ls_R_factor_obs                          0.24 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.24 
_refine.ls_R_factor_R_free                       0.296 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.5 
_refine.ls_number_reflns_R_free                  1016 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               15.0 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1ATK 
_refine.pdbx_method_to_determine_struct          MR 
_refine.pdbx_isotropic_thermal_model             OVERALL 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1BGO 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.31 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.38 
_refine_analyze.Luzzati_sigma_a_free            0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1698 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             19 
_refine_hist.number_atoms_total               1751 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.017 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.9   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.2  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.82  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.40 
_refine_ls_shell.number_reflns_R_work             455 
_refine_ls_shell.R_factor_R_work                  0.275 
_refine_ls_shell.percent_reflns_obs               33.9 
_refine_ls_shell.R_factor_R_free                  0.369 
_refine_ls_shell.R_factor_R_free_error            0.049 
_refine_ls_shell.percent_reflns_R_free            11.0 
_refine_ls_shell.number_reflns_R_free             56 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO ? 'X-RAY DIFFRACTION' 
2 PARAM19.SOL  ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1BGO 
_struct.title                     
'CRYSTAL STRUCTURE OF CYSTEINE PROTEASE HUMAN CATHEPSIN K IN COMPLEX WITH A COVALENT PEPTIDOMIMETIC INHIBITOR' 
_struct.pdbx_descriptor           'CATHEPSIN K, 1-[2-(3-BIPHENYL)-4-METHYLVALERYL)]AMINO-3-(2-PYRIDYLSULFONYL)AMINO-2-PROPANONE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BGO 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, SULFHYDRYL PROTEINASE, THIOL PROTEASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 25  ? THR A 42  ? CYS A 25  THR A 42  1 ? 18 
HELX_P HELX_P2 2 PRO A 50  ? CYS A 56  ? PRO A 50  CYS A 56  1 ? 7  
HELX_P HELX_P3 3 GLY A 62  ? GLY A 64  ? GLY A 62  GLY A 64  5 ? 3  
HELX_P HELX_P4 4 MET A 68  ? LYS A 77  ? MET A 68  LYS A 77  1 ? 10 
HELX_P HELX_P5 5 PRO A 100 ? GLY A 102 ? PRO A 100 GLY A 102 5 ? 3  
HELX_P HELX_P6 6 GLU A 118 ? VAL A 128 ? GLU A 118 VAL A 128 1 ? 11 
HELX_P HELX_P7 7 THR A 140 ? GLN A 143 ? THR A 140 GLN A 143 1 ? 4  
HELX_P HELX_P8 8 ALA A 203 ? GLY A 205 ? ALA A 203 GLY A 205 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22  SG  ? ? ? 1_555 A CYS 63  SG ? ? A CYS 22  A CYS 63  1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf2 disulf ? ? A CYS 56  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 56  A CYS 96  1_555 ? ? ? ? ? ? ? 1.932 ? 
disulf3 disulf ? ? A CYS 155 SG  ? ? ? 1_555 A CYS 204 SG ? ? A CYS 155 A CYS 204 1_555 ? ? ? ? ? ? ? 2.035 ? 
covale1 covale ? ? B I10 .   C31 ? ? ? 1_555 A CYS 25  SG ? ? A I10 300 A CYS 25  1_555 ? ? ? ? ? ? ? 1.896 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 110 ? GLU A 112 ? TYR A 110 GLU A 112 
A 2 SER A 211 ? PRO A 213 ? SER A 211 PRO A 213 
B 1 VAL A 131 ? ILE A 135 ? VAL A 131 ILE A 135 
B 2 HIS A 162 ? ILE A 171 ? HIS A 162 ILE A 171 
B 3 LYS A 176 ? LYS A 181 ? LYS A 176 LYS A 181 
B 4 TYR A 193 ? ALA A 197 ? TYR A 193 ALA A 197 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 111 ? O ARG A 111 N PHE A 212 ? N PHE A 212 
B 1 2 O VAL A 131 ? O VAL A 131 N ALA A 166 ? N ALA A 166 
B 2 3 O LEU A 165 ? O LEU A 165 N LYS A 181 ? N LYS A 181 
B 3 4 O TRP A 178 ? O TRP A 178 N MET A 196 ? N MET A 196 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    19 
_struct_site.details              'BINDING SITE FOR RESIDUE I10 A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 GLN A 19  ? GLN A 19  . ? 1_555 ? 
2  AC1 19 GLY A 23  ? GLY A 23  . ? 1_555 ? 
3  AC1 19 SER A 24  ? SER A 24  . ? 1_555 ? 
4  AC1 19 CYS A 25  ? CYS A 25  . ? 1_555 ? 
5  AC1 19 TRP A 26  ? TRP A 26  . ? 1_555 ? 
6  AC1 19 GLU A 59  ? GLU A 59  . ? 1_555 ? 
7  AC1 19 ASP A 61  ? ASP A 61  . ? 1_555 ? 
8  AC1 19 GLY A 64  ? GLY A 64  . ? 1_555 ? 
9  AC1 19 GLY A 65  ? GLY A 65  . ? 1_555 ? 
10 AC1 19 GLY A 66  ? GLY A 66  . ? 1_555 ? 
11 AC1 19 TYR A 67  ? TYR A 67  . ? 1_555 ? 
12 AC1 19 ARG A 108 ? ARG A 108 . ? 3_654 ? 
13 AC1 19 ALA A 137 ? ALA A 137 . ? 1_555 ? 
14 AC1 19 ASN A 161 ? ASN A 161 . ? 1_555 ? 
15 AC1 19 HIS A 162 ? HIS A 162 . ? 1_555 ? 
16 AC1 19 ALA A 163 ? ALA A 163 . ? 1_555 ? 
17 AC1 19 LYS A 173 ? LYS A 173 . ? 2_654 ? 
18 AC1 19 TRP A 184 ? TRP A 184 . ? 1_555 ? 
19 AC1 19 HOH C .   ? HOH A 331 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1BGO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BGO 
_atom_sites.fract_transf_matrix[1][1]   0.013976 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013976 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018152 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 30.039 16.761 21.414  1.00 15.00 ? 1   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 29.417 15.947 20.334  1.00 15.00 ? 1   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 29.107 14.512 20.776  1.00 15.00 ? 1   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 29.772 13.968 21.666  1.00 15.00 ? 1   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 30.341 15.927 19.131  1.00 15.00 ? 1   ALA A CB  1 
ATOM   6    N N   . PRO A 1 2   ? 28.029 13.924 20.245  1.00 15.00 ? 2   PRO A N   1 
ATOM   7    C CA  . PRO A 1 2   ? 27.738 12.542 20.648  1.00 15.00 ? 2   PRO A CA  1 
ATOM   8    C C   . PRO A 1 2   ? 28.918 11.592 20.269  1.00 15.00 ? 2   PRO A C   1 
ATOM   9    O O   . PRO A 1 2   ? 29.761 11.926 19.427  1.00 15.00 ? 2   PRO A O   1 
ATOM   10   C CB  . PRO A 1 2   ? 26.452 12.227 19.866  1.00 15.00 ? 2   PRO A CB  1 
ATOM   11   C CG  . PRO A 1 2   ? 25.798 13.640 19.664  1.00 15.00 ? 2   PRO A CG  1 
ATOM   12   C CD  . PRO A 1 2   ? 26.972 14.506 19.388  1.00 15.00 ? 2   PRO A CD  1 
ATOM   13   N N   . ASP A 1 3   ? 28.989 10.445 20.945  1.00 15.00 ? 3   ASP A N   1 
ATOM   14   C CA  . ASP A 1 3   ? 30.024 9.416  20.712  1.00 15.00 ? 3   ASP A CA  1 
ATOM   15   C C   . ASP A 1 3   ? 29.887 8.756  19.343  1.00 15.00 ? 3   ASP A C   1 
ATOM   16   O O   . ASP A 1 3   ? 30.842 8.198  18.793  1.00 15.00 ? 3   ASP A O   1 
ATOM   17   C CB  . ASP A 1 3   ? 29.958 8.305  21.774  1.00 15.00 ? 3   ASP A CB  1 
ATOM   18   C CG  . ASP A 1 3   ? 30.675 8.671  23.055  1.00 15.00 ? 3   ASP A CG  1 
ATOM   19   O OD1 . ASP A 1 3   ? 31.859 9.073  22.965  1.00 15.00 ? 3   ASP A OD1 1 
ATOM   20   O OD2 . ASP A 1 3   ? 30.068 8.522  24.143  1.00 15.00 ? 3   ASP A OD2 1 
ATOM   21   N N   . SER A 1 4   ? 28.657 8.730  18.853  1.00 15.00 ? 4   SER A N   1 
ATOM   22   C CA  . SER A 1 4   ? 28.368 8.170  17.555  1.00 15.00 ? 4   SER A CA  1 
ATOM   23   C C   . SER A 1 4   ? 27.062 8.732  17.054  1.00 15.00 ? 4   SER A C   1 
ATOM   24   O O   . SER A 1 4   ? 26.082 8.841  17.815  1.00 15.00 ? 4   SER A O   1 
ATOM   25   C CB  . SER A 1 4   ? 28.313 6.641  17.601  1.00 15.00 ? 4   SER A CB  1 
ATOM   26   O OG  . SER A 1 4   ? 27.243 6.172  18.394  1.00 15.00 ? 4   SER A OG  1 
ATOM   27   N N   . VAL A 1 5   ? 27.040 8.988  15.745  1.00 15.00 ? 5   VAL A N   1 
ATOM   28   C CA  . VAL A 1 5   ? 25.877 9.535  15.066  1.00 15.00 ? 5   VAL A CA  1 
ATOM   29   C C   . VAL A 1 5   ? 25.722 8.806  13.742  1.00 15.00 ? 5   VAL A C   1 
ATOM   30   O O   . VAL A 1 5   ? 26.706 8.399  13.136  1.00 15.00 ? 5   VAL A O   1 
ATOM   31   C CB  . VAL A 1 5   ? 26.025 11.064 14.824  1.00 15.00 ? 5   VAL A CB  1 
ATOM   32   C CG1 . VAL A 1 5   ? 24.708 11.642 14.383  1.00 15.00 ? 5   VAL A CG1 1 
ATOM   33   C CG2 . VAL A 1 5   ? 26.484 11.750 16.098  1.00 15.00 ? 5   VAL A CG2 1 
ATOM   34   N N   . ASP A 1 6   ? 24.481 8.622  13.315  1.00 15.00 ? 6   ASP A N   1 
ATOM   35   C CA  . ASP A 1 6   ? 24.159 7.932  12.066  1.00 15.00 ? 6   ASP A CA  1 
ATOM   36   C C   . ASP A 1 6   ? 22.839 8.528  11.524  1.00 15.00 ? 6   ASP A C   1 
ATOM   37   O O   . ASP A 1 6   ? 21.722 8.197  11.963  1.00 15.00 ? 6   ASP A O   1 
ATOM   38   C CB  . ASP A 1 6   ? 24.059 6.403  12.306  1.00 15.00 ? 6   ASP A CB  1 
ATOM   39   C CG  . ASP A 1 6   ? 24.091 5.569  10.992  1.00 15.00 ? 6   ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 6   ? 24.419 6.114  9.920   1.00 15.00 ? 6   ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 6   ? 23.836 4.340  11.044  1.00 15.00 ? 6   ASP A OD2 1 
ATOM   42   N N   . TYR A 1 7   ? 22.982 9.487  10.625  1.00 15.00 ? 7   TYR A N   1 
ATOM   43   C CA  . TYR A 1 7   ? 21.827 10.165 10.061  1.00 15.00 ? 7   TYR A CA  1 
ATOM   44   C C   . TYR A 1 7   ? 20.963 9.319  9.151   1.00 15.00 ? 7   TYR A C   1 
ATOM   45   O O   . TYR A 1 7   ? 19.967 9.798  8.612   1.00 15.00 ? 7   TYR A O   1 
ATOM   46   C CB  . TYR A 1 7   ? 22.241 11.473 9.365   1.00 15.00 ? 7   TYR A CB  1 
ATOM   47   C CG  . TYR A 1 7   ? 22.657 12.540 10.356  1.00 15.00 ? 7   TYR A CG  1 
ATOM   48   C CD1 . TYR A 1 7   ? 21.692 13.317 11.020  1.00 15.00 ? 7   TYR A CD1 1 
ATOM   49   C CD2 . TYR A 1 7   ? 24.015 12.764 10.639  1.00 15.00 ? 7   TYR A CD2 1 
ATOM   50   C CE1 . TYR A 1 7   ? 22.057 14.286 11.931  1.00 15.00 ? 7   TYR A CE1 1 
ATOM   51   C CE2 . TYR A 1 7   ? 24.402 13.737 11.559  1.00 15.00 ? 7   TYR A CE2 1 
ATOM   52   C CZ  . TYR A 1 7   ? 23.415 14.498 12.197  1.00 15.00 ? 7   TYR A CZ  1 
ATOM   53   O OH  . TYR A 1 7   ? 23.779 15.509 13.061  1.00 15.00 ? 7   TYR A OH  1 
ATOM   54   N N   . ARG A 1 8   ? 21.315 8.050  9.001   1.00 15.00 ? 8   ARG A N   1 
ATOM   55   C CA  . ARG A 1 8   ? 20.539 7.128  8.167   1.00 15.00 ? 8   ARG A CA  1 
ATOM   56   C C   . ARG A 1 8   ? 19.363 6.684  9.004   1.00 15.00 ? 8   ARG A C   1 
ATOM   57   O O   . ARG A 1 8   ? 18.220 6.715  8.567   1.00 15.00 ? 8   ARG A O   1 
ATOM   58   C CB  . ARG A 1 8   ? 21.366 5.906  7.777   1.00 15.00 ? 8   ARG A CB  1 
ATOM   59   C CG  . ARG A 1 8   ? 22.406 6.188  6.714   1.00 15.00 ? 8   ARG A CG  1 
ATOM   60   C CD  . ARG A 1 8   ? 23.235 4.928  6.432   1.00 15.00 ? 8   ARG A CD  1 
ATOM   61   N NE  . ARG A 1 8   ? 23.821 4.391  7.652   1.00 15.00 ? 8   ARG A NE  1 
ATOM   62   C CZ  . ARG A 1 8   ? 24.751 3.456  7.688   1.00 15.00 ? 8   ARG A CZ  1 
ATOM   63   N NH1 . ARG A 1 8   ? 25.211 2.949  6.559   1.00 15.00 ? 8   ARG A NH1 1 
ATOM   64   N NH2 . ARG A 1 8   ? 25.217 3.039  8.859   1.00 15.00 ? 8   ARG A NH2 1 
ATOM   65   N N   . LYS A 1 9   ? 19.647 6.316  10.244  1.00 15.00 ? 9   LYS A N   1 
ATOM   66   C CA  . LYS A 1 9   ? 18.590 5.895  11.166  1.00 15.00 ? 9   LYS A CA  1 
ATOM   67   C C   . LYS A 1 9   ? 17.736 7.104  11.566  1.00 15.00 ? 9   LYS A C   1 
ATOM   68   O O   . LYS A 1 9   ? 16.684 6.954  12.193  1.00 15.00 ? 9   LYS A O   1 
ATOM   69   C CB  . LYS A 1 9   ? 19.220 5.282  12.413  1.00 15.00 ? 9   LYS A CB  1 
ATOM   70   C CG  . LYS A 1 9   ? 20.130 4.145  12.119  1.00 15.00 ? 9   LYS A CG  1 
ATOM   71   C CD  . LYS A 1 9   ? 20.744 3.635  13.412  1.00 15.00 ? 9   LYS A CD  1 
ATOM   72   C CE  . LYS A 1 9   ? 21.446 2.302  13.185  1.00 15.00 ? 9   LYS A CE  1 
ATOM   73   N NZ  . LYS A 1 9   ? 21.923 1.706  14.470  1.00 15.00 ? 9   LYS A NZ  1 
ATOM   74   N N   . LYS A 1 10  ? 18.182 8.305  11.194  1.00 15.00 ? 10  LYS A N   1 
ATOM   75   C CA  . LYS A 1 10  ? 17.446 9.511  11.529  1.00 15.00 ? 10  LYS A CA  1 
ATOM   76   C C   . LYS A 1 10  ? 16.641 10.083 10.367  1.00 15.00 ? 10  LYS A C   1 
ATOM   77   O O   . LYS A 1 10  ? 16.016 11.142 10.498  1.00 15.00 ? 10  LYS A O   1 
ATOM   78   C CB  . LYS A 1 10  ? 18.412 10.539 12.113  1.00 15.00 ? 10  LYS A CB  1 
ATOM   79   C CG  . LYS A 1 10  ? 19.074 10.020 13.383  1.00 15.00 ? 10  LYS A CG  1 
ATOM   80   C CD  . LYS A 1 10  ? 20.260 10.852 13.792  1.00 15.00 ? 10  LYS A CD  1 
ATOM   81   C CE  . LYS A 1 10  ? 19.864 12.323 13.944  1.00 15.00 ? 10  LYS A CE  1 
ATOM   82   N NZ  . LYS A 1 10  ? 18.819 12.524 14.991  1.00 15.00 ? 10  LYS A NZ  1 
ATOM   83   N N   . GLY A 1 11  ? 16.647 9.352  9.252   1.00 15.00 ? 11  GLY A N   1 
ATOM   84   C CA  . GLY A 1 11  ? 15.927 9.752  8.055   1.00 15.00 ? 11  GLY A CA  1 
ATOM   85   C C   . GLY A 1 11  ? 16.499 10.964 7.340   1.00 15.00 ? 11  GLY A C   1 
ATOM   86   O O   . GLY A 1 11  ? 15.742 11.771 6.801   1.00 15.00 ? 11  GLY A O   1 
ATOM   87   N N   . TYR A 1 12  ? 17.822 11.118 7.337   1.00 15.00 ? 12  TYR A N   1 
ATOM   88   C CA  . TYR A 1 12  ? 18.444 12.262 6.669   1.00 15.00 ? 12  TYR A CA  1 
ATOM   89   C C   . TYR A 1 12  ? 18.992 11.914 5.291   1.00 15.00 ? 12  TYR A C   1 
ATOM   90   O O   . TYR A 1 12  ? 19.079 12.746 4.411   1.00 15.00 ? 12  TYR A O   1 
ATOM   91   C CB  . TYR A 1 12  ? 19.589 12.807 7.516   1.00 15.00 ? 12  TYR A CB  1 
ATOM   92   C CG  . TYR A 1 12  ? 19.151 13.710 8.642   1.00 15.00 ? 12  TYR A CG  1 
ATOM   93   C CD1 . TYR A 1 12  ? 18.263 13.263 9.622   1.00 15.00 ? 12  TYR A CD1 1 
ATOM   94   C CD2 . TYR A 1 12  ? 19.622 15.022 8.718   1.00 15.00 ? 12  TYR A CD2 1 
ATOM   95   C CE1 . TYR A 1 12  ? 17.849 14.103 10.640  1.00 15.00 ? 12  TYR A CE1 1 
ATOM   96   C CE2 . TYR A 1 12  ? 19.233 15.874 9.723   1.00 15.00 ? 12  TYR A CE2 1 
ATOM   97   C CZ  . TYR A 1 12  ? 18.338 15.419 10.687  1.00 15.00 ? 12  TYR A CZ  1 
ATOM   98   O OH  . TYR A 1 12  ? 17.889 16.282 11.679  1.00 15.00 ? 12  TYR A OH  1 
ATOM   99   N N   . VAL A 1 13  ? 19.274 10.643 5.091   1.00 15.00 ? 13  VAL A N   1 
ATOM   100  C CA  . VAL A 1 13  ? 19.887 10.148 3.872   1.00 15.00 ? 13  VAL A CA  1 
ATOM   101  C C   . VAL A 1 13  ? 18.906 9.522  2.861   1.00 15.00 ? 13  VAL A C   1 
ATOM   102  O O   . VAL A 1 13  ? 18.003 8.786  3.243   1.00 15.00 ? 13  VAL A O   1 
ATOM   103  C CB  . VAL A 1 13  ? 20.996 9.156  4.321   1.00 15.00 ? 13  VAL A CB  1 
ATOM   104  C CG1 . VAL A 1 13  ? 21.849 8.696  3.164   1.00 15.00 ? 13  VAL A CG1 1 
ATOM   105  C CG2 . VAL A 1 13  ? 21.861 9.829  5.362   1.00 15.00 ? 13  VAL A CG2 1 
ATOM   106  N N   . THR A 1 14  ? 19.020 9.884  1.586   1.00 15.00 ? 14  THR A N   1 
ATOM   107  C CA  . THR A 1 14  ? 18.157 9.309  0.545   1.00 15.00 ? 14  THR A CA  1 
ATOM   108  C C   . THR A 1 14  ? 18.866 8.027  0.026   1.00 15.00 ? 14  THR A C   1 
ATOM   109  O O   . THR A 1 14  ? 19.998 7.731  0.442   1.00 15.00 ? 14  THR A O   1 
ATOM   110  C CB  . THR A 1 14  ? 17.998 10.290 -0.601  1.00 15.00 ? 14  THR A CB  1 
ATOM   111  O OG1 . THR A 1 14  ? 19.273 10.514 -1.207  1.00 15.00 ? 14  THR A OG1 1 
ATOM   112  C CG2 . THR A 1 14  ? 17.454 11.625 -0.080  1.00 15.00 ? 14  THR A CG2 1 
ATOM   113  N N   . PRO A 1 15  ? 18.201 7.206  -0.820  1.00 15.00 ? 15  PRO A N   1 
ATOM   114  C CA  . PRO A 1 15  ? 18.904 5.996  -1.290  1.00 15.00 ? 15  PRO A CA  1 
ATOM   115  C C   . PRO A 1 15  ? 20.289 6.170  -1.922  1.00 15.00 ? 15  PRO A C   1 
ATOM   116  O O   . PRO A 1 15  ? 20.652 7.278  -2.319  1.00 15.00 ? 15  PRO A O   1 
ATOM   117  C CB  . PRO A 1 15  ? 17.921 5.411  -2.291  1.00 15.00 ? 15  PRO A CB  1 
ATOM   118  C CG  . PRO A 1 15  ? 16.632 5.629  -1.578  1.00 15.00 ? 15  PRO A CG  1 
ATOM   119  C CD  . PRO A 1 15  ? 16.757 7.111  -1.134  1.00 15.00 ? 15  PRO A CD  1 
ATOM   120  N N   . VAL A 1 16  ? 21.087 5.099  -1.985  1.00 15.00 ? 16  VAL A N   1 
ATOM   121  C CA  . VAL A 1 16  ? 22.400 5.224  -2.641  1.00 15.00 ? 16  VAL A CA  1 
ATOM   122  C C   . VAL A 1 16  ? 22.121 5.275  -4.148  1.00 15.00 ? 16  VAL A C   1 
ATOM   123  O O   . VAL A 1 16  ? 21.269 4.546  -4.676  1.00 15.00 ? 16  VAL A O   1 
ATOM   124  C CB  . VAL A 1 16  ? 23.410 4.070  -2.288  1.00 15.00 ? 16  VAL A CB  1 
ATOM   125  C CG1 . VAL A 1 16  ? 24.784 4.312  -2.932  1.00 15.00 ? 16  VAL A CG1 1 
ATOM   126  C CG2 . VAL A 1 16  ? 23.586 3.969  -0.775  1.00 15.00 ? 16  VAL A CG2 1 
ATOM   127  N N   . LYS A 1 17  ? 22.824 6.166  -4.830  1.00 15.00 ? 17  LYS A N   1 
ATOM   128  C CA  . LYS A 1 17  ? 22.645 6.336  -6.263  1.00 15.00 ? 17  LYS A CA  1 
ATOM   129  C C   . LYS A 1 17  ? 23.869 5.828  -7.023  1.00 15.00 ? 17  LYS A C   1 
ATOM   130  O O   . LYS A 1 17  ? 24.843 5.332  -6.418  1.00 15.00 ? 17  LYS A O   1 
ATOM   131  C CB  . LYS A 1 17  ? 22.410 7.802  -6.578  1.00 15.00 ? 17  LYS A CB  1 
ATOM   132  C CG  . LYS A 1 17  ? 21.471 8.565  -5.619  1.00 15.00 ? 17  LYS A CG  1 
ATOM   133  C CD  . LYS A 1 17  ? 20.064 8.059  -5.659  1.00 15.00 ? 17  LYS A CD  1 
ATOM   134  C CE  . LYS A 1 17  ? 19.094 9.121  -5.228  1.00 15.00 ? 17  LYS A CE  1 
ATOM   135  N NZ  . LYS A 1 17  ? 19.297 9.478  -3.819  1.00 15.00 ? 17  LYS A NZ  1 
ATOM   136  N N   . ASN A 1 18  ? 23.821 5.957  -8.343  1.00 15.00 ? 18  ASN A N   1 
ATOM   137  C CA  . ASN A 1 18  ? 24.927 5.512  -9.147  1.00 15.00 ? 18  ASN A CA  1 
ATOM   138  C C   . ASN A 1 18  ? 25.228 6.557  -10.177 1.00 15.00 ? 18  ASN A C   1 
ATOM   139  O O   . ASN A 1 18  ? 24.376 6.917  -11.006 1.00 15.00 ? 18  ASN A O   1 
ATOM   140  C CB  . ASN A 1 18  ? 24.622 4.189  -9.830  1.00 15.00 ? 18  ASN A CB  1 
ATOM   141  C CG  . ASN A 1 18  ? 25.823 3.646  -10.572 1.00 15.00 ? 18  ASN A CG  1 
ATOM   142  O OD1 . ASN A 1 18  ? 26.923 4.228  -10.528 1.00 15.00 ? 18  ASN A OD1 1 
ATOM   143  N ND2 . ASN A 1 18  ? 25.646 2.514  -11.224 1.00 15.00 ? 18  ASN A ND2 1 
ATOM   144  N N   . GLN A 1 19  ? 26.430 7.101  -10.085 1.00 15.00 ? 19  GLN A N   1 
ATOM   145  C CA  . GLN A 1 19  ? 26.828 8.129  -11.022 1.00 15.00 ? 19  GLN A CA  1 
ATOM   146  C C   . GLN A 1 19  ? 26.972 7.616  -12.427 1.00 15.00 ? 19  GLN A C   1 
ATOM   147  O O   . GLN A 1 19  ? 26.675 8.315  -13.383 1.00 15.00 ? 19  GLN A O   1 
ATOM   148  C CB  . GLN A 1 19  ? 28.129 8.782  -10.576 1.00 15.00 ? 19  GLN A CB  1 
ATOM   149  C CG  . GLN A 1 19  ? 29.319 7.822  -10.360 1.00 15.00 ? 19  GLN A CG  1 
ATOM   150  C CD  . GLN A 1 19  ? 30.486 8.510  -9.677  1.00 15.00 ? 19  GLN A CD  1 
ATOM   151  O OE1 . GLN A 1 19  ? 30.296 9.313  -8.760  1.00 15.00 ? 19  GLN A OE1 1 
ATOM   152  N NE2 . GLN A 1 19  ? 31.692 8.291  -10.195 1.00 15.00 ? 19  GLN A NE2 1 
ATOM   153  N N   . GLY A 1 20  ? 27.324 6.352  -12.555 1.00 15.00 ? 20  GLY A N   1 
ATOM   154  C CA  . GLY A 1 20  ? 27.538 5.832  -13.885 1.00 15.00 ? 20  GLY A CA  1 
ATOM   155  C C   . GLY A 1 20  ? 28.891 6.327  -14.400 1.00 15.00 ? 20  GLY A C   1 
ATOM   156  O O   . GLY A 1 20  ? 29.857 6.463  -13.625 1.00 15.00 ? 20  GLY A O   1 
ATOM   157  N N   . GLN A 1 21  ? 28.937 6.638  -15.699 1.00 15.00 ? 21  GLN A N   1 
ATOM   158  C CA  . GLN A 1 21  ? 30.116 7.106  -16.486 1.00 15.00 ? 21  GLN A CA  1 
ATOM   159  C C   . GLN A 1 21  ? 30.553 8.558  -16.323 1.00 15.00 ? 21  GLN A C   1 
ATOM   160  O O   . GLN A 1 21  ? 31.690 8.913  -16.635 1.00 15.00 ? 21  GLN A O   1 
ATOM   161  C CB  . GLN A 1 21  ? 29.818 6.880  -17.979 1.00 15.00 ? 21  GLN A CB  1 
ATOM   162  C CG  . GLN A 1 21  ? 28.602 7.692  -18.529 1.00 15.00 ? 21  GLN A CG  1 
ATOM   163  C CD  . GLN A 1 21  ? 27.268 7.380  -17.823 1.00 15.00 ? 21  GLN A CD  1 
ATOM   164  O OE1 . GLN A 1 21  ? 26.779 6.235  -17.848 1.00 15.00 ? 21  GLN A OE1 1 
ATOM   165  N NE2 . GLN A 1 21  ? 26.683 8.391  -17.185 1.00 15.00 ? 21  GLN A NE2 1 
ATOM   166  N N   . CYS A 1 22  ? 29.592 9.400  -15.999 1.00 15.00 ? 22  CYS A N   1 
ATOM   167  C CA  . CYS A 1 22  ? 29.794 10.822 -15.830 1.00 15.00 ? 22  CYS A CA  1 
ATOM   168  C C   . CYS A 1 22  ? 30.593 11.111 -14.560 1.00 15.00 ? 22  CYS A C   1 
ATOM   169  O O   . CYS A 1 22  ? 30.358 10.485 -13.512 1.00 15.00 ? 22  CYS A O   1 
ATOM   170  C CB  . CYS A 1 22  ? 28.418 11.476 -15.711 1.00 15.00 ? 22  CYS A CB  1 
ATOM   171  S SG  . CYS A 1 22  ? 28.390 13.269 -15.391 1.00 15.00 ? 22  CYS A SG  1 
ATOM   172  N N   . GLY A 1 23  ? 31.511 12.070 -14.636 1.00 15.00 ? 23  GLY A N   1 
ATOM   173  C CA  . GLY A 1 23  ? 32.273 12.438 -13.463 1.00 15.00 ? 23  GLY A CA  1 
ATOM   174  C C   . GLY A 1 23  ? 31.420 13.376 -12.640 1.00 15.00 ? 23  GLY A C   1 
ATOM   175  O O   . GLY A 1 23  ? 31.773 14.538 -12.484 1.00 15.00 ? 23  GLY A O   1 
ATOM   176  N N   . SER A 1 24  ? 30.343 12.872 -12.043 1.00 15.00 ? 24  SER A N   1 
ATOM   177  C CA  . SER A 1 24  ? 29.462 13.739 -11.250 1.00 15.00 ? 24  SER A CA  1 
ATOM   178  C C   . SER A 1 24  ? 29.484 13.509 -9.735  1.00 15.00 ? 24  SER A C   1 
ATOM   179  O O   . SER A 1 24  ? 28.576 13.977 -9.008  1.00 15.00 ? 24  SER A O   1 
ATOM   180  C CB  . SER A 1 24  ? 28.031 13.695 -11.787 1.00 15.00 ? 24  SER A CB  1 
ATOM   181  O OG  . SER A 1 24  ? 27.540 12.373 -11.742 1.00 15.00 ? 24  SER A OG  1 
ATOM   182  N N   . CYS A 1 25  ? 30.494 12.762 -9.272  1.00 15.00 ? 25  CYS A N   1 
ATOM   183  C CA  . CYS A 1 25  ? 30.649 12.469 -7.845  1.00 15.00 ? 25  CYS A CA  1 
ATOM   184  C C   . CYS A 1 25  ? 30.341 13.689 -6.999  1.00 15.00 ? 25  CYS A C   1 
ATOM   185  O O   . CYS A 1 25  ? 29.538 13.618 -6.068  1.00 15.00 ? 25  CYS A O   1 
ATOM   186  C CB  . CYS A 1 25  ? 32.047 11.938 -7.503  1.00 15.00 ? 25  CYS A CB  1 
ATOM   187  S SG  . CYS A 1 25  ? 33.502 12.953 -7.964  1.00 15.00 ? 25  CYS A SG  1 
ATOM   188  N N   . TRP A 1 26  ? 31.053 14.778 -7.300  1.00 15.00 ? 26  TRP A N   1 
ATOM   189  C CA  . TRP A 1 26  ? 30.916 16.082 -6.659  1.00 15.00 ? 26  TRP A CA  1 
ATOM   190  C C   . TRP A 1 26  ? 29.410 16.443 -6.572  1.00 15.00 ? 26  TRP A C   1 
ATOM   191  O O   . TRP A 1 26  ? 28.906 16.766 -5.495  1.00 15.00 ? 26  TRP A O   1 
ATOM   192  C CB  . TRP A 1 26  ? 31.725 17.156 -7.468  1.00 15.00 ? 26  TRP A CB  1 
ATOM   193  C CG  . TRP A 1 26  ? 31.251 17.389 -8.962  1.00 15.00 ? 26  TRP A CG  1 
ATOM   194  C CD1 . TRP A 1 26  ? 31.639 16.709 -10.089 1.00 15.00 ? 26  TRP A CD1 1 
ATOM   195  C CD2 . TRP A 1 26  ? 30.326 18.396 -9.423  1.00 15.00 ? 26  TRP A CD2 1 
ATOM   196  N NE1 . TRP A 1 26  ? 31.036 17.239 -11.199 1.00 15.00 ? 26  TRP A NE1 1 
ATOM   197  C CE2 . TRP A 1 26  ? 30.227 18.270 -10.828 1.00 15.00 ? 26  TRP A CE2 1 
ATOM   198  C CE3 . TRP A 1 26  ? 29.537 19.366 -8.776  1.00 15.00 ? 26  TRP A CE3 1 
ATOM   199  C CZ2 . TRP A 1 26  ? 29.380 19.074 -11.610 1.00 15.00 ? 26  TRP A CZ2 1 
ATOM   200  C CZ3 . TRP A 1 26  ? 28.672 20.166 -9.546  1.00 15.00 ? 26  TRP A CZ3 1 
ATOM   201  C CH2 . TRP A 1 26  ? 28.604 20.013 -10.958 1.00 15.00 ? 26  TRP A CH2 1 
ATOM   202  N N   . ALA A 1 27  ? 28.683 16.241 -7.667  1.00 15.00 ? 27  ALA A N   1 
ATOM   203  C CA  . ALA A 1 27  ? 27.253 16.519 -7.708  1.00 15.00 ? 27  ALA A CA  1 
ATOM   204  C C   . ALA A 1 27  ? 26.476 15.665 -6.725  1.00 15.00 ? 27  ALA A C   1 
ATOM   205  O O   . ALA A 1 27  ? 25.517 16.130 -6.100  1.00 15.00 ? 27  ALA A O   1 
ATOM   206  C CB  . ALA A 1 27  ? 26.736 16.279 -9.067  1.00 15.00 ? 27  ALA A CB  1 
ATOM   207  N N   . PHE A 1 28  ? 26.848 14.399 -6.638  1.00 15.00 ? 28  PHE A N   1 
ATOM   208  C CA  . PHE A 1 28  ? 26.172 13.529 -5.702  1.00 15.00 ? 28  PHE A CA  1 
ATOM   209  C C   . PHE A 1 28  ? 26.583 13.876 -4.249  1.00 15.00 ? 28  PHE A C   1 
ATOM   210  O O   . PHE A 1 28  ? 25.727 13.900 -3.356  1.00 15.00 ? 28  PHE A O   1 
ATOM   211  C CB  . PHE A 1 28  ? 26.436 12.057 -6.034  1.00 15.00 ? 28  PHE A CB  1 
ATOM   212  C CG  . PHE A 1 28  ? 25.700 11.565 -7.265  1.00 15.00 ? 28  PHE A CG  1 
ATOM   213  C CD1 . PHE A 1 28  ? 24.370 11.150 -7.183  1.00 15.00 ? 28  PHE A CD1 1 
ATOM   214  C CD2 . PHE A 1 28  ? 26.324 11.535 -8.503  1.00 15.00 ? 28  PHE A CD2 1 
ATOM   215  C CE1 . PHE A 1 28  ? 23.683 10.702 -8.350  1.00 15.00 ? 28  PHE A CE1 1 
ATOM   216  C CE2 . PHE A 1 28  ? 25.655 11.108 -9.641  1.00 15.00 ? 28  PHE A CE2 1 
ATOM   217  C CZ  . PHE A 1 28  ? 24.346 10.689 -9.575  1.00 15.00 ? 28  PHE A CZ  1 
ATOM   218  N N   . SER A 1 29  ? 27.812 14.347 -4.038  1.00 15.00 ? 29  SER A N   1 
ATOM   219  C CA  . SER A 1 29  ? 28.250 14.719 -2.700  1.00 15.00 ? 29  SER A CA  1 
ATOM   220  C C   . SER A 1 29  ? 27.468 15.989 -2.279  1.00 15.00 ? 29  SER A C   1 
ATOM   221  O O   . SER A 1 29  ? 26.938 16.060 -1.160  1.00 15.00 ? 29  SER A O   1 
ATOM   222  C CB  . SER A 1 29  ? 29.761 14.955 -2.754  1.00 15.00 ? 29  SER A CB  1 
ATOM   223  O OG  . SER A 1 29  ? 30.306 15.416 -1.531  1.00 15.00 ? 29  SER A OG  1 
ATOM   224  N N   . SER A 1 30  ? 27.278 16.911 -3.226  1.00 15.00 ? 30  SER A N   1 
ATOM   225  C CA  . SER A 1 30  ? 26.574 18.177 -2.946  1.00 15.00 ? 30  SER A CA  1 
ATOM   226  C C   . SER A 1 30  ? 25.097 18.032 -2.681  1.00 15.00 ? 30  SER A C   1 
ATOM   227  O O   . SER A 1 30  ? 24.511 18.808 -1.920  1.00 15.00 ? 30  SER A O   1 
ATOM   228  C CB  . SER A 1 30  ? 26.701 19.128 -4.125  1.00 15.00 ? 30  SER A CB  1 
ATOM   229  O OG  . SER A 1 30  ? 28.017 19.197 -4.590  1.00 15.00 ? 30  SER A OG  1 
ATOM   230  N N   . VAL A 1 31  ? 24.489 17.161 -3.469  1.00 15.00 ? 31  VAL A N   1 
ATOM   231  C CA  . VAL A 1 31  ? 23.078 16.879 -3.427  1.00 15.00 ? 31  VAL A CA  1 
ATOM   232  C C   . VAL A 1 31  ? 22.738 16.169 -2.136  1.00 15.00 ? 31  VAL A C   1 
ATOM   233  O O   . VAL A 1 31  ? 21.791 16.559 -1.443  1.00 15.00 ? 31  VAL A O   1 
ATOM   234  C CB  . VAL A 1 31  ? 22.716 16.136 -4.711  1.00 15.00 ? 31  VAL A CB  1 
ATOM   235  C CG1 . VAL A 1 31  ? 21.501 15.278 -4.563  1.00 15.00 ? 31  VAL A CG1 1 
ATOM   236  C CG2 . VAL A 1 31  ? 22.470 17.196 -5.778  1.00 15.00 ? 31  VAL A CG2 1 
ATOM   237  N N   . GLY A 1 32  ? 23.620 15.258 -1.724  1.00 15.00 ? 32  GLY A N   1 
ATOM   238  C CA  . GLY A 1 32  ? 23.427 14.529 -0.482  1.00 15.00 ? 32  GLY A CA  1 
ATOM   239  C C   . GLY A 1 32  ? 23.484 15.454 0.720   1.00 15.00 ? 32  GLY A C   1 
ATOM   240  O O   . GLY A 1 32  ? 22.671 15.303 1.625   1.00 15.00 ? 32  GLY A O   1 
ATOM   241  N N   . ALA A 1 33  ? 24.418 16.415 0.751   1.00 15.00 ? 33  ALA A N   1 
ATOM   242  C CA  . ALA A 1 33  ? 24.539 17.372 1.870   1.00 15.00 ? 33  ALA A CA  1 
ATOM   243  C C   . ALA A 1 33  ? 23.322 18.303 1.854   1.00 15.00 ? 33  ALA A C   1 
ATOM   244  O O   . ALA A 1 33  ? 22.860 18.802 2.890   1.00 15.00 ? 33  ALA A O   1 
ATOM   245  C CB  . ALA A 1 33  ? 25.830 18.165 1.754   1.00 15.00 ? 33  ALA A CB  1 
ATOM   246  N N   . LEU A 1 34  ? 22.793 18.535 0.658   1.00 15.00 ? 34  LEU A N   1 
ATOM   247  C CA  . LEU A 1 34  ? 21.624 19.403 0.511   1.00 15.00 ? 34  LEU A CA  1 
ATOM   248  C C   . LEU A 1 34  ? 20.373 18.689 1.022   1.00 15.00 ? 34  LEU A C   1 
ATOM   249  O O   . LEU A 1 34  ? 19.548 19.301 1.723   1.00 15.00 ? 34  LEU A O   1 
ATOM   250  C CB  . LEU A 1 34  ? 21.462 19.869 -0.945  1.00 15.00 ? 34  LEU A CB  1 
ATOM   251  C CG  . LEU A 1 34  ? 22.419 20.961 -1.433  1.00 15.00 ? 34  LEU A CG  1 
ATOM   252  C CD1 . LEU A 1 34  ? 22.145 21.212 -2.917  1.00 15.00 ? 34  LEU A CD1 1 
ATOM   253  C CD2 . LEU A 1 34  ? 22.242 22.223 -0.611  1.00 15.00 ? 34  LEU A CD2 1 
ATOM   254  N N   . GLU A 1 35  ? 20.240 17.401 0.696   1.00 15.00 ? 35  GLU A N   1 
ATOM   255  C CA  . GLU A 1 35  ? 19.097 16.599 1.172   1.00 15.00 ? 35  GLU A CA  1 
ATOM   256  C C   . GLU A 1 35  ? 19.064 16.464 2.710   1.00 15.00 ? 35  GLU A C   1 
ATOM   257  O O   . GLU A 1 35  ? 17.972 16.346 3.313   1.00 15.00 ? 35  GLU A O   1 
ATOM   258  C CB  . GLU A 1 35  ? 19.130 15.197 0.554   1.00 15.00 ? 35  GLU A CB  1 
ATOM   259  C CG  . GLU A 1 35  ? 19.016 15.235 -0.954  1.00 15.00 ? 35  GLU A CG  1 
ATOM   260  C CD  . GLU A 1 35  ? 19.342 13.929 -1.657  1.00 15.00 ? 35  GLU A CD  1 
ATOM   261  O OE1 . GLU A 1 35  ? 19.994 13.007 -1.104  1.00 15.00 ? 35  GLU A OE1 1 
ATOM   262  O OE2 . GLU A 1 35  ? 18.947 13.837 -2.824  1.00 15.00 ? 35  GLU A OE2 1 
ATOM   263  N N   . GLY A 1 36  ? 20.249 16.378 3.324   1.00 15.00 ? 36  GLY A N   1 
ATOM   264  C CA  . GLY A 1 36  ? 20.335 16.266 4.770   1.00 15.00 ? 36  GLY A CA  1 
ATOM   265  C C   . GLY A 1 36  ? 19.832 17.528 5.443   1.00 15.00 ? 36  GLY A C   1 
ATOM   266  O O   . GLY A 1 36  ? 19.109 17.476 6.445   1.00 15.00 ? 36  GLY A O   1 
ATOM   267  N N   . GLN A 1 37  ? 20.236 18.672 4.889   1.00 15.00 ? 37  GLN A N   1 
ATOM   268  C CA  . GLN A 1 37  ? 19.819 19.976 5.394   1.00 15.00 ? 37  GLN A CA  1 
ATOM   269  C C   . GLN A 1 37  ? 18.324 20.267 5.120   1.00 15.00 ? 37  GLN A C   1 
ATOM   270  O O   . GLN A 1 37  ? 17.691 20.895 5.954   1.00 15.00 ? 37  GLN A O   1 
ATOM   271  C CB  . GLN A 1 37  ? 20.693 21.121 4.848   1.00 15.00 ? 37  GLN A CB  1 
ATOM   272  C CG  . GLN A 1 37  ? 22.133 21.215 5.398   1.00 15.00 ? 37  GLN A CG  1 
ATOM   273  C CD  . GLN A 1 37  ? 22.269 20.998 6.897   1.00 15.00 ? 37  GLN A CD  1 
ATOM   274  O OE1 . GLN A 1 37  ? 21.786 21.793 7.711   1.00 15.00 ? 37  GLN A OE1 1 
ATOM   275  N NE2 . GLN A 1 37  ? 23.002 19.952 7.265   1.00 15.00 ? 37  GLN A NE2 1 
ATOM   276  N N   . LEU A 1 38  ? 17.757 19.791 4.001   1.00 15.00 ? 38  LEU A N   1 
ATOM   277  C CA  . LEU A 1 38  ? 16.327 19.993 3.679   1.00 15.00 ? 38  LEU A CA  1 
ATOM   278  C C   . LEU A 1 38  ? 15.415 19.234 4.662   1.00 15.00 ? 38  LEU A C   1 
ATOM   279  O O   . LEU A 1 38  ? 14.333 19.726 5.065   1.00 15.00 ? 38  LEU A O   1 
ATOM   280  C CB  . LEU A 1 38  ? 15.981 19.539 2.241   1.00 15.00 ? 38  LEU A CB  1 
ATOM   281  C CG  . LEU A 1 38  ? 14.523 19.655 1.741   1.00 15.00 ? 38  LEU A CG  1 
ATOM   282  C CD1 . LEU A 1 38  ? 13.981 21.066 1.874   1.00 15.00 ? 38  LEU A CD1 1 
ATOM   283  C CD2 . LEU A 1 38  ? 14.357 19.177 0.293   1.00 15.00 ? 38  LEU A CD2 1 
ATOM   284  N N   . LYS A 1 39  ? 15.867 18.040 5.028   1.00 15.00 ? 39  LYS A N   1 
ATOM   285  C CA  . LYS A 1 39  ? 15.171 17.149 5.945   1.00 15.00 ? 39  LYS A CA  1 
ATOM   286  C C   . LYS A 1 39  ? 15.055 17.820 7.302   1.00 15.00 ? 39  LYS A C   1 
ATOM   287  O O   . LYS A 1 39  ? 13.991 17.834 7.904   1.00 15.00 ? 39  LYS A O   1 
ATOM   288  C CB  . LYS A 1 39  ? 15.979 15.852 6.079   1.00 15.00 ? 39  LYS A CB  1 
ATOM   289  C CG  . LYS A 1 39  ? 15.529 14.907 7.163   1.00 15.00 ? 39  LYS A CG  1 
ATOM   290  C CD  . LYS A 1 39  ? 14.071 14.627 6.984   1.00 15.00 ? 39  LYS A CD  1 
ATOM   291  C CE  . LYS A 1 39  ? 13.467 13.979 8.201   1.00 15.00 ? 39  LYS A CE  1 
ATOM   292  N NZ  . LYS A 1 39  ? 12.355 13.104 7.761   1.00 15.00 ? 39  LYS A NZ  1 
ATOM   293  N N   . LYS A 1 40  ? 16.157 18.390 7.762   1.00 15.00 ? 40  LYS A N   1 
ATOM   294  C CA  . LYS A 1 40  ? 16.221 19.062 9.046   1.00 15.00 ? 40  LYS A CA  1 
ATOM   295  C C   . LYS A 1 40  ? 15.352 20.312 9.080   1.00 15.00 ? 40  LYS A C   1 
ATOM   296  O O   . LYS A 1 40  ? 14.876 20.730 10.127  1.00 15.00 ? 40  LYS A O   1 
ATOM   297  C CB  . LYS A 1 40  ? 17.683 19.398 9.320   1.00 15.00 ? 40  LYS A CB  1 
ATOM   298  C CG  . LYS A 1 40  ? 17.986 19.968 10.686  1.00 15.00 ? 40  LYS A CG  1 
ATOM   299  C CD  . LYS A 1 40  ? 19.490 19.901 10.927  1.00 15.00 ? 40  LYS A CD  1 
ATOM   300  C CE  . LYS A 1 40  ? 19.925 20.815 12.068  1.00 15.00 ? 40  LYS A CE  1 
ATOM   301  N NZ  . LYS A 1 40  ? 21.399 20.672 12.291  1.00 15.00 ? 40  LYS A NZ  1 
ATOM   302  N N   . LYS A 1 41  ? 15.142 20.888 7.906   1.00 15.00 ? 41  LYS A N   1 
ATOM   303  C CA  . LYS A 1 41  ? 14.364 22.104 7.752   1.00 15.00 ? 41  LYS A CA  1 
ATOM   304  C C   . LYS A 1 41  ? 12.858 21.887 7.583   1.00 15.00 ? 41  LYS A C   1 
ATOM   305  O O   . LYS A 1 41  ? 12.062 22.544 8.230   1.00 15.00 ? 41  LYS A O   1 
ATOM   306  C CB  . LYS A 1 41  ? 14.888 22.870 6.541   1.00 15.00 ? 41  LYS A CB  1 
ATOM   307  C CG  . LYS A 1 41  ? 14.342 24.285 6.441   1.00 15.00 ? 41  LYS A CG  1 
ATOM   308  C CD  . LYS A 1 41  ? 14.532 24.873 5.066   1.00 15.00 ? 41  LYS A CD  1 
ATOM   309  C CE  . LYS A 1 41  ? 13.482 25.962 4.816   1.00 15.00 ? 41  LYS A CE  1 
ATOM   310  N NZ  . LYS A 1 41  ? 13.664 27.098 5.757   1.00 15.00 ? 41  LYS A NZ  1 
ATOM   311  N N   . THR A 1 42  ? 12.460 20.995 6.683   1.00 15.00 ? 42  THR A N   1 
ATOM   312  C CA  . THR A 1 42  ? 11.044 20.770 6.454   1.00 15.00 ? 42  THR A CA  1 
ATOM   313  C C   . THR A 1 42  ? 10.464 19.446 6.975   1.00 15.00 ? 42  THR A C   1 
ATOM   314  O O   . THR A 1 42  ? 9.237  19.282 7.038   1.00 15.00 ? 42  THR A O   1 
ATOM   315  C CB  . THR A 1 42  ? 10.719 20.937 4.965   1.00 15.00 ? 42  THR A CB  1 
ATOM   316  O OG1 . THR A 1 42  ? 11.486 20.003 4.196   1.00 15.00 ? 42  THR A OG1 1 
ATOM   317  C CG2 . THR A 1 42  ? 11.062 22.328 4.513   1.00 15.00 ? 42  THR A CG2 1 
ATOM   318  N N   . GLY A 1 43  ? 11.333 18.516 7.368   1.00 15.00 ? 43  GLY A N   1 
ATOM   319  C CA  . GLY A 1 43  ? 10.872 17.232 7.855   1.00 15.00 ? 43  GLY A CA  1 
ATOM   320  C C   . GLY A 1 43  ? 10.608 16.269 6.709   1.00 15.00 ? 43  GLY A C   1 
ATOM   321  O O   . GLY A 1 43  ? 10.144 15.162 6.945   1.00 15.00 ? 43  GLY A O   1 
ATOM   322  N N   . LYS A 1 44  ? 10.829 16.686 5.465   1.00 15.00 ? 44  LYS A N   1 
ATOM   323  C CA  . LYS A 1 44  ? 10.609 15.782 4.348   1.00 15.00 ? 44  LYS A CA  1 
ATOM   324  C C   . LYS A 1 44  ? 11.962 15.379 3.801   1.00 15.00 ? 44  LYS A C   1 
ATOM   325  O O   . LYS A 1 44  ? 12.894 16.197 3.785   1.00 15.00 ? 44  LYS A O   1 
ATOM   326  C CB  . LYS A 1 44  ? 9.837  16.474 3.230   1.00 15.00 ? 44  LYS A CB  1 
ATOM   327  C CG  . LYS A 1 44  ? 8.492  17.031 3.640   1.00 15.00 ? 44  LYS A CG  1 
ATOM   328  C CD  . LYS A 1 44  ? 7.471  15.931 3.910   1.00 15.00 ? 44  LYS A CD  1 
ATOM   329  C CE  . LYS A 1 44  ? 6.050  16.519 3.979   1.00 15.00 ? 44  LYS A CE  1 
ATOM   330  N NZ  . LYS A 1 44  ? 5.722  17.370 2.774   1.00 15.00 ? 44  LYS A NZ  1 
ATOM   331  N N   . LEU A 1 45  ? 12.072 14.123 3.373   1.00 15.00 ? 45  LEU A N   1 
ATOM   332  C CA  . LEU A 1 45  ? 13.307 13.595 2.763   1.00 15.00 ? 45  LEU A CA  1 
ATOM   333  C C   . LEU A 1 45  ? 13.042 13.553 1.256   1.00 15.00 ? 45  LEU A C   1 
ATOM   334  O O   . LEU A 1 45  ? 12.219 12.770 0.802   1.00 15.00 ? 45  LEU A O   1 
ATOM   335  C CB  . LEU A 1 45  ? 13.612 12.165 3.259   1.00 15.00 ? 45  LEU A CB  1 
ATOM   336  C CG  . LEU A 1 45  ? 14.910 11.548 2.712   1.00 15.00 ? 45  LEU A CG  1 
ATOM   337  C CD1 . LEU A 1 45  ? 16.103 12.458 3.105   1.00 15.00 ? 45  LEU A CD1 1 
ATOM   338  C CD2 . LEU A 1 45  ? 15.106 10.118 3.208   1.00 15.00 ? 45  LEU A CD2 1 
ATOM   339  N N   . LEU A 1 46  ? 13.730 14.387 0.489   1.00 15.00 ? 46  LEU A N   1 
ATOM   340  C CA  . LEU A 1 46  ? 13.550 14.429 -0.960  1.00 15.00 ? 46  LEU A CA  1 
ATOM   341  C C   . LEU A 1 46  ? 14.840 14.210 -1.727  1.00 15.00 ? 46  LEU A C   1 
ATOM   342  O O   . LEU A 1 46  ? 15.898 14.623 -1.288  1.00 15.00 ? 46  LEU A O   1 
ATOM   343  C CB  . LEU A 1 46  ? 12.987 15.791 -1.362  1.00 15.00 ? 46  LEU A CB  1 
ATOM   344  C CG  . LEU A 1 46  ? 11.493 15.877 -1.631  1.00 15.00 ? 46  LEU A CG  1 
ATOM   345  C CD1 . LEU A 1 46  ? 11.011 17.310 -1.493  1.00 15.00 ? 46  LEU A CD1 1 
ATOM   346  C CD2 . LEU A 1 46  ? 11.185 15.305 -3.027  1.00 15.00 ? 46  LEU A CD2 1 
ATOM   347  N N   . ASN A 1 47  ? 14.741 13.582 -2.889  1.00 15.00 ? 47  ASN A N   1 
ATOM   348  C CA  . ASN A 1 47  ? 15.903 13.362 -3.744  1.00 15.00 ? 47  ASN A CA  1 
ATOM   349  C C   . ASN A 1 47  ? 16.132 14.634 -4.580  1.00 15.00 ? 47  ASN A C   1 
ATOM   350  O O   . ASN A 1 47  ? 15.258 15.028 -5.332  1.00 15.00 ? 47  ASN A O   1 
ATOM   351  C CB  . ASN A 1 47  ? 15.644 12.164 -4.665  1.00 15.00 ? 47  ASN A CB  1 
ATOM   352  C CG  . ASN A 1 47  ? 16.203 10.865 -4.128  1.00 15.00 ? 47  ASN A CG  1 
ATOM   353  O OD1 . ASN A 1 47  ? 16.701 10.785 -2.998  1.00 15.00 ? 47  ASN A OD1 1 
ATOM   354  N ND2 . ASN A 1 47  ? 16.122 9.821  -4.957  1.00 15.00 ? 47  ASN A ND2 1 
ATOM   355  N N   . LEU A 1 48  ? 17.284 15.292 -4.452  1.00 15.00 ? 48  LEU A N   1 
ATOM   356  C CA  . LEU A 1 48  ? 17.562 16.515 -5.216  1.00 15.00 ? 48  LEU A CA  1 
ATOM   357  C C   . LEU A 1 48  ? 18.321 16.177 -6.503  1.00 15.00 ? 48  LEU A C   1 
ATOM   358  O O   . LEU A 1 48  ? 18.917 15.111 -6.613  1.00 15.00 ? 48  LEU A O   1 
ATOM   359  C CB  . LEU A 1 48  ? 18.300 17.545 -4.349  1.00 15.00 ? 48  LEU A CB  1 
ATOM   360  C CG  . LEU A 1 48  ? 17.674 17.948 -3.006  1.00 15.00 ? 48  LEU A CG  1 
ATOM   361  C CD1 . LEU A 1 48  ? 18.501 19.004 -2.310  1.00 15.00 ? 48  LEU A CD1 1 
ATOM   362  C CD2 . LEU A 1 48  ? 16.289 18.509 -3.234  1.00 15.00 ? 48  LEU A CD2 1 
ATOM   363  N N   . SER A 1 49  ? 18.280 17.087 -7.471  1.00 15.00 ? 49  SER A N   1 
ATOM   364  C CA  . SER A 1 49  ? 18.877 16.917 -8.808  1.00 15.00 ? 49  SER A CA  1 
ATOM   365  C C   . SER A 1 49  ? 20.385 17.085 -9.171  1.00 15.00 ? 49  SER A C   1 
ATOM   366  O O   . SER A 1 49  ? 20.806 18.172 -9.584  1.00 15.00 ? 49  SER A O   1 
ATOM   367  C CB  . SER A 1 49  ? 18.084 17.793 -9.772  1.00 15.00 ? 49  SER A CB  1 
ATOM   368  O OG  . SER A 1 49  ? 18.476 17.574 -11.121 1.00 15.00 ? 49  SER A OG  1 
ATOM   369  N N   . PRO A 1 50  ? 21.200 16.006 -9.103  1.00 15.00 ? 50  PRO A N   1 
ATOM   370  C CA  . PRO A 1 50  ? 22.603 16.202 -9.469  1.00 15.00 ? 50  PRO A CA  1 
ATOM   371  C C   . PRO A 1 50  ? 22.769 16.603 -10.934 1.00 15.00 ? 50  PRO A C   1 
ATOM   372  O O   . PRO A 1 50  ? 23.770 17.251 -11.296 1.00 15.00 ? 50  PRO A O   1 
ATOM   373  C CB  . PRO A 1 50  ? 23.225 14.846 -9.198  1.00 15.00 ? 50  PRO A CB  1 
ATOM   374  C CG  . PRO A 1 50  ? 22.086 13.906 -9.208  1.00 15.00 ? 50  PRO A CG  1 
ATOM   375  C CD  . PRO A 1 50  ? 21.017 14.661 -8.547  1.00 15.00 ? 50  PRO A CD  1 
ATOM   376  N N   . GLN A 1 51  ? 21.767 16.281 -11.764 1.00 15.00 ? 51  GLN A N   1 
ATOM   377  C CA  . GLN A 1 51  ? 21.814 16.652 -13.182 1.00 15.00 ? 51  GLN A CA  1 
ATOM   378  C C   . GLN A 1 51  ? 21.729 18.175 -13.293 1.00 15.00 ? 51  GLN A C   1 
ATOM   379  O O   . GLN A 1 51  ? 22.297 18.758 -14.187 1.00 15.00 ? 51  GLN A O   1 
ATOM   380  C CB  . GLN A 1 51  ? 20.666 16.007 -13.980 1.00 15.00 ? 51  GLN A CB  1 
ATOM   381  C CG  . GLN A 1 51  ? 20.797 16.127 -15.496 1.00 15.00 ? 51  GLN A CG  1 
ATOM   382  C CD  . GLN A 1 51  ? 21.954 15.326 -16.048 1.00 15.00 ? 51  GLN A CD  1 
ATOM   383  O OE1 . GLN A 1 51  ? 22.214 14.225 -15.581 1.00 15.00 ? 51  GLN A OE1 1 
ATOM   384  N NE2 . GLN A 1 51  ? 22.658 15.871 -17.032 1.00 15.00 ? 51  GLN A NE2 1 
ATOM   385  N N   . ASN A 1 52  ? 20.905 18.777 -12.450 1.00 15.00 ? 52  ASN A N   1 
ATOM   386  C CA  . ASN A 1 52  ? 20.699 20.213 -12.387 1.00 15.00 ? 52  ASN A CA  1 
ATOM   387  C C   . ASN A 1 52  ? 22.056 20.858 -12.196 1.00 15.00 ? 52  ASN A C   1 
ATOM   388  O O   . ASN A 1 52  ? 22.344 21.894 -12.794 1.00 15.00 ? 52  ASN A O   1 
ATOM   389  C CB  . ASN A 1 52  ? 19.762 20.536 -11.210 1.00 15.00 ? 52  ASN A CB  1 
ATOM   390  C CG  . ASN A 1 52  ? 19.398 22.009 -11.118 1.00 15.00 ? 52  ASN A CG  1 
ATOM   391  O OD1 . ASN A 1 52  ? 18.460 22.349 -10.426 1.00 15.00 ? 52  ASN A OD1 1 
ATOM   392  N ND2 . ASN A 1 52  ? 20.128 22.887 -11.804 1.00 15.00 ? 52  ASN A ND2 1 
ATOM   393  N N   . LEU A 1 53  ? 22.857 20.278 -11.311 1.00 15.00 ? 53  LEU A N   1 
ATOM   394  C CA  . LEU A 1 53  ? 24.199 20.793 -11.007 1.00 15.00 ? 53  LEU A CA  1 
ATOM   395  C C   . LEU A 1 53  ? 25.160 20.590 -12.180 1.00 15.00 ? 53  LEU A C   1 
ATOM   396  O O   . LEU A 1 53  ? 25.760 21.539 -12.659 1.00 15.00 ? 53  LEU A O   1 
ATOM   397  C CB  . LEU A 1 53  ? 24.736 20.124 -9.735  1.00 15.00 ? 53  LEU A CB  1 
ATOM   398  C CG  . LEU A 1 53  ? 24.343 20.818 -8.425  1.00 15.00 ? 53  LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 53  ? 23.041 21.564 -8.449  1.00 15.00 ? 53  LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 53  ? 24.331 19.754 -7.329  1.00 15.00 ? 53  LEU A CD2 1 
ATOM   401  N N   . VAL A 1 54  ? 25.275 19.343 -12.639 1.00 15.00 ? 54  VAL A N   1 
ATOM   402  C CA  . VAL A 1 54  ? 26.109 19.004 -13.806 1.00 15.00 ? 54  VAL A CA  1 
ATOM   403  C C   . VAL A 1 54  ? 25.856 19.907 -15.061 1.00 15.00 ? 54  VAL A C   1 
ATOM   404  O O   . VAL A 1 54  ? 26.797 20.375 -15.655 1.00 15.00 ? 54  VAL A O   1 
ATOM   405  C CB  . VAL A 1 54  ? 25.915 17.489 -14.174 1.00 15.00 ? 54  VAL A CB  1 
ATOM   406  C CG1 . VAL A 1 54  ? 26.507 17.167 -15.502 1.00 15.00 ? 54  VAL A CG1 1 
ATOM   407  C CG2 . VAL A 1 54  ? 26.582 16.612 -13.102 1.00 15.00 ? 54  VAL A CG2 1 
ATOM   408  N N   . ASP A 1 55  ? 24.592 20.209 -15.385 1.00 15.00 ? 55  ASP A N   1 
ATOM   409  C CA  . ASP A 1 55  ? 24.239 21.029 -16.552 1.00 15.00 ? 55  ASP A CA  1 
ATOM   410  C C   . ASP A 1 55  ? 24.337 22.536 -16.291 1.00 15.00 ? 55  ASP A C   1 
ATOM   411  O O   . ASP A 1 55  ? 24.611 23.335 -17.242 1.00 15.00 ? 55  ASP A O   1 
ATOM   412  C CB  . ASP A 1 55  ? 22.784 20.715 -17.077 1.00 15.00 ? 55  ASP A CB  1 
ATOM   413  C CG  . ASP A 1 55  ? 22.557 19.270 -17.379 1.00 15.00 ? 55  ASP A CG  1 
ATOM   414  O OD1 . ASP A 1 55  ? 23.533 18.549 -17.616 1.00 15.00 ? 55  ASP A OD1 1 
ATOM   415  O OD2 . ASP A 1 55  ? 21.382 18.894 -17.428 1.00 15.00 ? 55  ASP A OD2 1 
ATOM   416  N N   . CYS A 1 56  ? 24.214 22.953 -15.040 1.00 15.00 ? 56  CYS A N   1 
ATOM   417  C CA  . CYS A 1 56  ? 24.125 24.350 -14.798 1.00 15.00 ? 56  CYS A CA  1 
ATOM   418  C C   . CYS A 1 56  ? 25.278 25.057 -14.032 1.00 15.00 ? 56  CYS A C   1 
ATOM   419  O O   . CYS A 1 56  ? 25.278 26.309 -14.042 1.00 15.00 ? 56  CYS A O   1 
ATOM   420  C CB  . CYS A 1 56  ? 22.743 24.672 -14.119 1.00 15.00 ? 56  CYS A CB  1 
ATOM   421  S SG  . CYS A 1 56  ? 21.281 24.020 -14.913 1.00 15.00 ? 56  CYS A SG  1 
ATOM   422  N N   . VAL A 1 57  ? 26.095 24.319 -13.250 1.00 15.00 ? 57  VAL A N   1 
ATOM   423  C CA  . VAL A 1 57  ? 27.147 24.982 -12.488 1.00 15.00 ? 57  VAL A CA  1 
ATOM   424  C C   . VAL A 1 57  ? 28.273 25.228 -13.503 1.00 15.00 ? 57  VAL A C   1 
ATOM   425  O O   . VAL A 1 57  ? 29.145 24.410 -13.712 1.00 15.00 ? 57  VAL A O   1 
ATOM   426  C CB  . VAL A 1 57  ? 27.704 24.098 -11.382 1.00 15.00 ? 57  VAL A CB  1 
ATOM   427  C CG1 . VAL A 1 57  ? 28.750 24.862 -10.482 1.00 15.00 ? 57  VAL A CG1 1 
ATOM   428  C CG2 . VAL A 1 57  ? 26.606 23.558 -10.475 1.00 15.00 ? 57  VAL A CG2 1 
ATOM   429  N N   . SER A 1 58  ? 28.222 26.368 -14.164 1.00 15.00 ? 58  SER A N   1 
ATOM   430  C CA  . SER A 1 58  ? 29.191 26.849 -15.165 1.00 15.00 ? 58  SER A CA  1 
ATOM   431  C C   . SER A 1 58  ? 30.608 27.052 -14.624 1.00 15.00 ? 58  SER A C   1 
ATOM   432  O O   . SER A 1 58  ? 31.534 27.327 -15.407 1.00 15.00 ? 58  SER A O   1 
ATOM   433  C CB  . SER A 1 58  ? 28.755 28.227 -15.754 1.00 15.00 ? 58  SER A CB  1 
ATOM   434  O OG  . SER A 1 58  ? 28.365 29.132 -14.723 1.00 15.00 ? 58  SER A OG  1 
ATOM   435  N N   . GLU A 1 59  ? 30.741 27.084 -13.301 1.00 15.00 ? 59  GLU A N   1 
ATOM   436  C CA  . GLU A 1 59  ? 32.017 27.242 -12.676 1.00 15.00 ? 59  GLU A CA  1 
ATOM   437  C C   . GLU A 1 59  ? 32.653 25.863 -12.620 1.00 15.00 ? 59  GLU A C   1 
ATOM   438  O O   . GLU A 1 59  ? 33.903 25.743 -12.517 1.00 15.00 ? 59  GLU A O   1 
ATOM   439  C CB  . GLU A 1 59  ? 31.794 27.796 -11.277 1.00 15.00 ? 59  GLU A CB  1 
ATOM   440  C CG  . GLU A 1 59  ? 30.775 28.979 -11.202 1.00 15.00 ? 59  GLU A CG  1 
ATOM   441  C CD  . GLU A 1 59  ? 29.360 28.524 -10.701 1.00 15.00 ? 59  GLU A CD  1 
ATOM   442  O OE1 . GLU A 1 59  ? 29.143 28.459 -9.440  1.00 15.00 ? 59  GLU A OE1 1 
ATOM   443  O OE2 . GLU A 1 59  ? 28.459 28.293 -11.567 1.00 15.00 ? 59  GLU A OE2 1 
ATOM   444  N N   . ASN A 1 60  ? 31.833 24.815 -12.736 1.00 15.00 ? 60  ASN A N   1 
ATOM   445  C CA  . ASN A 1 60  ? 32.394 23.484 -12.708 1.00 15.00 ? 60  ASN A CA  1 
ATOM   446  C C   . ASN A 1 60  ? 32.594 22.922 -14.108 1.00 15.00 ? 60  ASN A C   1 
ATOM   447  O O   . ASN A 1 60  ? 32.438 23.642 -15.079 1.00 15.00 ? 60  ASN A O   1 
ATOM   448  C CB  . ASN A 1 60  ? 31.563 22.573 -11.815 1.00 15.00 ? 60  ASN A CB  1 
ATOM   449  C CG  . ASN A 1 60  ? 31.790 22.844 -10.347 1.00 15.00 ? 60  ASN A CG  1 
ATOM   450  O OD1 . ASN A 1 60  ? 32.882 23.210 -9.935  1.00 15.00 ? 60  ASN A OD1 1 
ATOM   451  N ND2 . ASN A 1 60  ? 30.773 22.617 -9.542  1.00 15.00 ? 60  ASN A ND2 1 
ATOM   452  N N   . ASP A 1 61  ? 32.963 21.641 -14.188 1.00 15.00 ? 61  ASP A N   1 
ATOM   453  C CA  . ASP A 1 61  ? 33.238 20.966 -15.460 1.00 15.00 ? 61  ASP A CA  1 
ATOM   454  C C   . ASP A 1 61  ? 32.249 19.874 -15.946 1.00 15.00 ? 61  ASP A C   1 
ATOM   455  O O   . ASP A 1 61  ? 32.590 19.005 -16.774 1.00 15.00 ? 61  ASP A O   1 
ATOM   456  C CB  . ASP A 1 61  ? 34.702 20.491 -15.553 1.00 15.00 ? 61  ASP A CB  1 
ATOM   457  C CG  . ASP A 1 61  ? 35.164 20.323 -17.008 1.00 15.00 ? 61  ASP A CG  1 
ATOM   458  O OD1 . ASP A 1 61  ? 34.541 20.974 -17.877 1.00 15.00 ? 61  ASP A OD1 1 
ATOM   459  O OD2 . ASP A 1 61  ? 36.131 19.568 -17.288 1.00 15.00 ? 61  ASP A OD2 1 
ATOM   460  N N   . GLY A 1 62  ? 31.022 19.907 -15.431 1.00 15.00 ? 62  GLY A N   1 
ATOM   461  C CA  . GLY A 1 62  ? 29.995 18.968 -15.851 1.00 15.00 ? 62  GLY A CA  1 
ATOM   462  C C   . GLY A 1 62  ? 30.392 17.570 -15.476 1.00 15.00 ? 62  GLY A C   1 
ATOM   463  O O   . GLY A 1 62  ? 30.655 17.294 -14.314 1.00 15.00 ? 62  GLY A O   1 
ATOM   464  N N   . CYS A 1 63  ? 30.452 16.699 -16.471 1.00 15.00 ? 63  CYS A N   1 
ATOM   465  C CA  . CYS A 1 63  ? 30.864 15.325 -16.256 1.00 15.00 ? 63  CYS A CA  1 
ATOM   466  C C   . CYS A 1 63  ? 32.378 15.199 -16.254 1.00 15.00 ? 63  CYS A C   1 
ATOM   467  O O   . CYS A 1 63  ? 32.893 14.123 -16.539 1.00 15.00 ? 63  CYS A O   1 
ATOM   468  C CB  . CYS A 1 63  ? 30.343 14.431 -17.362 1.00 15.00 ? 63  CYS A CB  1 
ATOM   469  S SG  . CYS A 1 63  ? 28.592 14.080 -17.231 1.00 15.00 ? 63  CYS A SG  1 
ATOM   470  N N   . GLY A 1 64  ? 33.056 16.337 -16.181 1.00 15.00 ? 64  GLY A N   1 
ATOM   471  C CA  . GLY A 1 64  ? 34.500 16.335 -16.177 1.00 15.00 ? 64  GLY A CA  1 
ATOM   472  C C   . GLY A 1 64  ? 34.955 16.558 -14.740 1.00 15.00 ? 64  GLY A C   1 
ATOM   473  O O   . GLY A 1 64  ? 36.156 16.452 -14.430 1.00 15.00 ? 64  GLY A O   1 
ATOM   474  N N   . GLY A 1 65  ? 34.013 16.966 -13.887 1.00 15.00 ? 65  GLY A N   1 
ATOM   475  C CA  . GLY A 1 65  ? 34.331 17.206 -12.498 1.00 15.00 ? 65  GLY A CA  1 
ATOM   476  C C   . GLY A 1 65  ? 34.028 18.586 -11.992 1.00 15.00 ? 65  GLY A C   1 
ATOM   477  O O   . GLY A 1 65  ? 33.600 19.451 -12.724 1.00 15.00 ? 65  GLY A O   1 
ATOM   478  N N   . GLY A 1 66  ? 34.190 18.775 -10.705 1.00 15.00 ? 66  GLY A N   1 
ATOM   479  C CA  . GLY A 1 66  ? 33.935 20.063 -10.126 1.00 15.00 ? 66  GLY A CA  1 
ATOM   480  C C   . GLY A 1 66  ? 34.020 20.046 -8.632  1.00 15.00 ? 66  GLY A C   1 
ATOM   481  O O   . GLY A 1 66  ? 34.419 19.052 -8.064  1.00 15.00 ? 66  GLY A O   1 
ATOM   482  N N   . TYR A 1 67  ? 33.836 21.228 -8.053  1.00 15.00 ? 67  TYR A N   1 
ATOM   483  C CA  . TYR A 1 67  ? 33.860 21.373 -6.620  1.00 15.00 ? 67  TYR A CA  1 
ATOM   484  C C   . TYR A 1 67  ? 32.484 21.533 -6.004  1.00 15.00 ? 67  TYR A C   1 
ATOM   485  O O   . TYR A 1 67  ? 31.547 22.108 -6.605  1.00 15.00 ? 67  TYR A O   1 
ATOM   486  C CB  . TYR A 1 67  ? 34.756 22.507 -6.147  1.00 15.00 ? 67  TYR A CB  1 
ATOM   487  C CG  . TYR A 1 67  ? 36.217 22.318 -6.361  1.00 15.00 ? 67  TYR A CG  1 
ATOM   488  C CD1 . TYR A 1 67  ? 36.885 21.173 -5.865  1.00 15.00 ? 67  TYR A CD1 1 
ATOM   489  C CD2 . TYR A 1 67  ? 36.935 23.315 -7.040  1.00 15.00 ? 67  TYR A CD2 1 
ATOM   490  C CE1 . TYR A 1 67  ? 38.255 21.021 -6.041  1.00 15.00 ? 67  TYR A CE1 1 
ATOM   491  C CE2 . TYR A 1 67  ? 38.255 23.210 -7.224  1.00 15.00 ? 67  TYR A CE2 1 
ATOM   492  C CZ  . TYR A 1 67  ? 38.929 22.068 -6.730  1.00 15.00 ? 67  TYR A CZ  1 
ATOM   493  O OH  . TYR A 1 67  ? 40.267 22.023 -6.940  1.00 15.00 ? 67  TYR A OH  1 
ATOM   494  N N   . MET A 1 68  ? 32.381 21.020 -4.781  1.00 15.00 ? 68  MET A N   1 
ATOM   495  C CA  . MET A 1 68  ? 31.162 21.063 -3.997  1.00 15.00 ? 68  MET A CA  1 
ATOM   496  C C   . MET A 1 68  ? 30.776 22.464 -3.582  1.00 15.00 ? 68  MET A C   1 
ATOM   497  O O   . MET A 1 68  ? 29.597 22.803 -3.601  1.00 15.00 ? 68  MET A O   1 
ATOM   498  C CB  . MET A 1 68  ? 31.334 20.182 -2.761  1.00 15.00 ? 68  MET A CB  1 
ATOM   499  C CG  . MET A 1 68  ? 31.246 18.642 -3.041  1.00 15.00 ? 68  MET A CG  1 
ATOM   500  S SD  . MET A 1 68  ? 32.808 17.750 -3.430  1.00 15.00 ? 68  MET A SD  1 
ATOM   501  C CE  . MET A 1 68  ? 33.381 17.518 -1.756  1.00 15.00 ? 68  MET A CE  1 
ATOM   502  N N   . THR A 1 69  ? 31.771 23.278 -3.249  1.00 15.00 ? 69  THR A N   1 
ATOM   503  C CA  . THR A 1 69  ? 31.575 24.651 -2.805  1.00 15.00 ? 69  THR A CA  1 
ATOM   504  C C   . THR A 1 69  ? 30.991 25.512 -3.946  1.00 15.00 ? 69  THR A C   1 
ATOM   505  O O   . THR A 1 69  ? 30.295 26.491 -3.672  1.00 15.00 ? 69  THR A O   1 
ATOM   506  C CB  . THR A 1 69  ? 32.904 25.256 -2.333  1.00 15.00 ? 69  THR A CB  1 
ATOM   507  O OG1 . THR A 1 69  ? 33.885 25.093 -3.369  1.00 15.00 ? 69  THR A OG1 1 
ATOM   508  C CG2 . THR A 1 69  ? 33.416 24.600 -1.066  1.00 15.00 ? 69  THR A CG2 1 
ATOM   509  N N   . ASN A 1 70  ? 31.307 25.153 -5.200  1.00 15.00 ? 70  ASN A N   1 
ATOM   510  C CA  . ASN A 1 70  ? 30.836 25.841 -6.404  1.00 15.00 ? 70  ASN A CA  1 
ATOM   511  C C   . ASN A 1 70  ? 29.344 25.560 -6.593  1.00 15.00 ? 70  ASN A C   1 
ATOM   512  O O   . ASN A 1 70  ? 28.572 26.453 -6.962  1.00 15.00 ? 70  ASN A O   1 
ATOM   513  C CB  . ASN A 1 70  ? 31.626 25.398 -7.636  1.00 15.00 ? 70  ASN A CB  1 
ATOM   514  C CG  . ASN A 1 70  ? 32.994 26.056 -7.739  1.00 15.00 ? 70  ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 70  ? 33.411 26.767 -6.836  1.00 15.00 ? 70  ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 70  ? 33.693 25.831 -8.830  1.00 15.00 ? 70  ASN A ND2 1 
ATOM   517  N N   . ALA A 1 71  ? 28.975 24.301 -6.359  1.00 15.00 ? 71  ALA A N   1 
ATOM   518  C CA  . ALA A 1 71  ? 27.616 23.827 -6.469  1.00 15.00 ? 71  ALA A CA  1 
ATOM   519  C C   . ALA A 1 71  ? 26.723 24.450 -5.384  1.00 15.00 ? 71  ALA A C   1 
ATOM   520  O O   . ALA A 1 71  ? 25.560 24.785 -5.655  1.00 15.00 ? 71  ALA A O   1 
ATOM   521  C CB  . ALA A 1 71  ? 27.626 22.344 -6.363  1.00 15.00 ? 71  ALA A CB  1 
ATOM   522  N N   . PHE A 1 72  ? 27.235 24.614 -4.163  1.00 15.00 ? 72  PHE A N   1 
ATOM   523  C CA  . PHE A 1 72  ? 26.406 25.217 -3.097  1.00 15.00 ? 72  PHE A CA  1 
ATOM   524  C C   . PHE A 1 72  ? 26.185 26.695 -3.543  1.00 15.00 ? 72  PHE A C   1 
ATOM   525  O O   . PHE A 1 72  ? 25.076 27.255 -3.559  1.00 15.00 ? 72  PHE A O   1 
ATOM   526  C CB  . PHE A 1 72  ? 27.098 25.152 -1.717  1.00 15.00 ? 72  PHE A CB  1 
ATOM   527  C CG  . PHE A 1 72  ? 27.371 23.743 -1.197  1.00 15.00 ? 72  PHE A CG  1 
ATOM   528  C CD1 . PHE A 1 72  ? 26.447 22.706 -1.378  1.00 15.00 ? 72  PHE A CD1 1 
ATOM   529  C CD2 . PHE A 1 72  ? 28.543 23.485 -0.476  1.00 15.00 ? 72  PHE A CD2 1 
ATOM   530  C CE1 . PHE A 1 72  ? 26.663 21.445 -0.858  1.00 15.00 ? 72  PHE A CE1 1 
ATOM   531  C CE2 . PHE A 1 72  ? 28.797 22.217 0.067   1.00 15.00 ? 72  PHE A CE2 1 
ATOM   532  C CZ  . PHE A 1 72  ? 27.849 21.188 -0.124  1.00 15.00 ? 72  PHE A CZ  1 
ATOM   533  N N   . GLN A 1 73  ? 27.270 27.285 -4.016  1.00 15.00 ? 73  GLN A N   1 
ATOM   534  C CA  . GLN A 1 73  ? 27.290 28.630 -4.522  1.00 15.00 ? 73  GLN A CA  1 
ATOM   535  C C   . GLN A 1 73  ? 26.312 28.826 -5.692  1.00 15.00 ? 73  GLN A C   1 
ATOM   536  O O   . GLN A 1 73  ? 25.669 29.838 -5.769  1.00 15.00 ? 73  GLN A O   1 
ATOM   537  C CB  . GLN A 1 73  ? 28.705 28.976 -4.946  1.00 15.00 ? 73  GLN A CB  1 
ATOM   538  C CG  . GLN A 1 73  ? 28.750 30.318 -5.509  1.00 15.00 ? 73  GLN A CG  1 
ATOM   539  C CD  . GLN A 1 73  ? 28.814 31.330 -4.417  1.00 15.00 ? 73  GLN A CD  1 
ATOM   540  O OE1 . GLN A 1 73  ? 29.857 31.962 -4.191  1.00 15.00 ? 73  GLN A OE1 1 
ATOM   541  N NE2 . GLN A 1 73  ? 27.663 31.591 -3.796  1.00 15.00 ? 73  GLN A NE2 1 
ATOM   542  N N   . TYR A 1 74  ? 26.192 27.875 -6.608  1.00 15.00 ? 74  TYR A N   1 
ATOM   543  C CA  . TYR A 1 74  ? 25.263 28.057 -7.715  1.00 15.00 ? 74  TYR A CA  1 
ATOM   544  C C   . TYR A 1 74  ? 23.797 28.036 -7.210  1.00 15.00 ? 74  TYR A C   1 
ATOM   545  O O   . TYR A 1 74  ? 22.966 28.849 -7.627  1.00 15.00 ? 74  TYR A O   1 
ATOM   546  C CB  . TYR A 1 74  ? 25.535 27.010 -8.797  1.00 15.00 ? 74  TYR A CB  1 
ATOM   547  C CG  . TYR A 1 74  ? 24.340 26.625 -9.622  1.00 15.00 ? 74  TYR A CG  1 
ATOM   548  C CD1 . TYR A 1 74  ? 24.008 27.298 -10.766 1.00 15.00 ? 74  TYR A CD1 1 
ATOM   549  C CD2 . TYR A 1 74  ? 23.522 25.585 -9.233  1.00 15.00 ? 74  TYR A CD2 1 
ATOM   550  C CE1 . TYR A 1 74  ? 22.868 26.944 -11.501 1.00 15.00 ? 74  TYR A CE1 1 
ATOM   551  C CE2 . TYR A 1 74  ? 22.404 25.233 -9.960  1.00 15.00 ? 74  TYR A CE2 1 
ATOM   552  C CZ  . TYR A 1 74  ? 22.070 25.907 -11.088 1.00 15.00 ? 74  TYR A CZ  1 
ATOM   553  O OH  . TYR A 1 74  ? 20.941 25.504 -11.779 1.00 15.00 ? 74  TYR A OH  1 
ATOM   554  N N   . VAL A 1 75  ? 23.494 27.115 -6.298  1.00 15.00 ? 75  VAL A N   1 
ATOM   555  C CA  . VAL A 1 75  ? 22.173 26.991 -5.698  1.00 15.00 ? 75  VAL A CA  1 
ATOM   556  C C   . VAL A 1 75  ? 21.808 28.260 -4.938  1.00 15.00 ? 75  VAL A C   1 
ATOM   557  O O   . VAL A 1 75  ? 20.641 28.644 -4.931  1.00 15.00 ? 75  VAL A O   1 
ATOM   558  C CB  . VAL A 1 75  ? 22.066 25.782 -4.710  1.00 15.00 ? 75  VAL A CB  1 
ATOM   559  C CG1 . VAL A 1 75  ? 20.612 25.676 -4.208  1.00 15.00 ? 75  VAL A CG1 1 
ATOM   560  C CG2 . VAL A 1 75  ? 22.463 24.478 -5.363  1.00 15.00 ? 75  VAL A CG2 1 
ATOM   561  N N   . GLN A 1 76  ? 22.792 28.885 -4.304  1.00 15.00 ? 76  GLN A N   1 
ATOM   562  C CA  . GLN A 1 76  ? 22.609 30.108 -3.542  1.00 15.00 ? 76  GLN A CA  1 
ATOM   563  C C   . GLN A 1 76  ? 22.318 31.287 -4.471  1.00 15.00 ? 76  GLN A C   1 
ATOM   564  O O   . GLN A 1 76  ? 21.339 32.012 -4.292  1.00 15.00 ? 76  GLN A O   1 
ATOM   565  C CB  . GLN A 1 76  ? 23.881 30.393 -2.751  1.00 15.00 ? 76  GLN A CB  1 
ATOM   566  C CG  . GLN A 1 76  ? 23.812 31.560 -1.744  1.00 15.00 ? 76  GLN A CG  1 
ATOM   567  C CD  . GLN A 1 76  ? 25.193 32.063 -1.363  1.00 15.00 ? 76  GLN A CD  1 
ATOM   568  O OE1 . GLN A 1 76  ? 26.207 31.391 -1.594  1.00 15.00 ? 76  GLN A OE1 1 
ATOM   569  N NE2 . GLN A 1 76  ? 25.248 33.245 -0.775  1.00 15.00 ? 76  GLN A NE2 1 
ATOM   570  N N   . LYS A 1 77  ? 23.139 31.447 -5.505  1.00 15.00 ? 77  LYS A N   1 
ATOM   571  C CA  . LYS A 1 77  ? 22.938 32.575 -6.409  1.00 15.00 ? 77  LYS A CA  1 
ATOM   572  C C   . LYS A 1 77  ? 21.672 32.392 -7.221  1.00 15.00 ? 77  LYS A C   1 
ATOM   573  O O   . LYS A 1 77  ? 20.863 33.315 -7.355  1.00 15.00 ? 77  LYS A O   1 
ATOM   574  C CB  . LYS A 1 77  ? 24.152 32.777 -7.331  1.00 15.00 ? 77  LYS A CB  1 
ATOM   575  C CG  . LYS A 1 77  ? 25.370 33.440 -6.641  1.00 15.00 ? 77  LYS A CG  1 
ATOM   576  C CD  . LYS A 1 77  ? 26.548 33.659 -7.631  1.00 15.00 ? 77  LYS A CD  1 
ATOM   577  C CE  . LYS A 1 77  ? 27.680 34.537 -6.983  1.00 15.00 ? 77  LYS A CE  1 
ATOM   578  N NZ  . LYS A 1 77  ? 28.749 35.067 -7.920  1.00 15.00 ? 77  LYS A NZ  1 
ATOM   579  N N   . ASN A 1 78  ? 21.524 31.183 -7.748  1.00 15.00 ? 78  ASN A N   1 
ATOM   580  C CA  . ASN A 1 78  ? 20.401 30.780 -8.586  1.00 15.00 ? 78  ASN A CA  1 
ATOM   581  C C   . ASN A 1 78  ? 19.079 30.761 -7.853  1.00 15.00 ? 78  ASN A C   1 
ATOM   582  O O   . ASN A 1 78  ? 18.031 30.674 -8.479  1.00 15.00 ? 78  ASN A O   1 
ATOM   583  C CB  . ASN A 1 78  ? 20.672 29.400 -9.182  1.00 15.00 ? 78  ASN A CB  1 
ATOM   584  C CG  . ASN A 1 78  ? 19.586 28.968 -10.141 1.00 15.00 ? 78  ASN A CG  1 
ATOM   585  O OD1 . ASN A 1 78  ? 19.525 29.440 -11.282 1.00 15.00 ? 78  ASN A OD1 1 
ATOM   586  N ND2 . ASN A 1 78  ? 18.713 28.078 -9.690  1.00 15.00 ? 78  ASN A ND2 1 
ATOM   587  N N   . ARG A 1 79  ? 19.149 30.788 -6.525  1.00 15.00 ? 79  ARG A N   1 
ATOM   588  C CA  . ARG A 1 79  ? 17.981 30.765 -5.658  1.00 15.00 ? 79  ARG A CA  1 
ATOM   589  C C   . ARG A 1 79  ? 17.247 29.431 -5.698  1.00 15.00 ? 79  ARG A C   1 
ATOM   590  O O   . ARG A 1 79  ? 16.030 29.379 -5.555  1.00 15.00 ? 79  ARG A O   1 
ATOM   591  C CB  . ARG A 1 79  ? 17.019 31.932 -5.949  1.00 15.00 ? 79  ARG A CB  1 
ATOM   592  C CG  . ARG A 1 79  ? 17.611 33.280 -5.622  1.00 15.00 ? 79  ARG A CG  1 
ATOM   593  C CD  . ARG A 1 79  ? 16.824 34.448 -6.173  1.00 15.00 ? 79  ARG A CD  1 
ATOM   594  N NE  . ARG A 1 79  ? 17.524 35.730 -5.961  1.00 15.00 ? 79  ARG A NE  1 
ATOM   595  C CZ  . ARG A 1 79  ? 17.000 36.933 -6.218  1.00 15.00 ? 79  ARG A CZ  1 
ATOM   596  N NH1 . ARG A 1 79  ? 15.765 37.022 -6.689  1.00 15.00 ? 79  ARG A NH1 1 
ATOM   597  N NH2 . ARG A 1 79  ? 17.702 38.046 -6.032  1.00 15.00 ? 79  ARG A NH2 1 
ATOM   598  N N   . GLY A 1 80  ? 17.971 28.335 -5.865  1.00 15.00 ? 80  GLY A N   1 
ATOM   599  C CA  . GLY A 1 80  ? 17.285 27.063 -5.870  1.00 15.00 ? 80  GLY A CA  1 
ATOM   600  C C   . GLY A 1 80  ? 17.878 25.937 -6.665  1.00 15.00 ? 80  GLY A C   1 
ATOM   601  O O   . GLY A 1 80  ? 18.841 26.108 -7.397  1.00 15.00 ? 80  GLY A O   1 
ATOM   602  N N   . ILE A 1 81  ? 17.305 24.763 -6.470  1.00 15.00 ? 81  ILE A N   1 
ATOM   603  C CA  . ILE A 1 81  ? 17.727 23.567 -7.178  1.00 15.00 ? 81  ILE A CA  1 
ATOM   604  C C   . ILE A 1 81  ? 16.487 22.698 -7.285  1.00 15.00 ? 81  ILE A C   1 
ATOM   605  O O   . ILE A 1 81  ? 15.630 22.694 -6.386  1.00 15.00 ? 81  ILE A O   1 
ATOM   606  C CB  . ILE A 1 81  ? 18.894 22.783 -6.442  1.00 15.00 ? 81  ILE A CB  1 
ATOM   607  C CG1 . ILE A 1 81  ? 19.262 21.497 -7.209  1.00 15.00 ? 81  ILE A CG1 1 
ATOM   608  C CG2 . ILE A 1 81  ? 18.526 22.512 -4.992  1.00 15.00 ? 81  ILE A CG2 1 
ATOM   609  C CD1 . ILE A 1 81  ? 20.327 20.562 -6.574  1.00 15.00 ? 81  ILE A CD1 1 
ATOM   610  N N   . ASP A 1 82  ? 16.350 22.044 -8.429  1.00 15.00 ? 82  ASP A N   1 
ATOM   611  C CA  . ASP A 1 82  ? 15.216 21.159 -8.698  1.00 15.00 ? 82  ASP A CA  1 
ATOM   612  C C   . ASP A 1 82  ? 15.305 19.807 -8.005  1.00 15.00 ? 82  ASP A C   1 
ATOM   613  O O   . ASP A 1 82  ? 16.376 19.386 -7.573  1.00 15.00 ? 82  ASP A O   1 
ATOM   614  C CB  . ASP A 1 82  ? 15.109 20.871 -10.192 1.00 15.00 ? 82  ASP A CB  1 
ATOM   615  C CG  . ASP A 1 82  ? 14.464 21.985 -10.951 1.00 15.00 ? 82  ASP A CG  1 
ATOM   616  O OD1 . ASP A 1 82  ? 13.638 22.703 -10.353 1.00 15.00 ? 82  ASP A OD1 1 
ATOM   617  O OD2 . ASP A 1 82  ? 14.791 22.117 -12.145 1.00 15.00 ? 82  ASP A OD2 1 
ATOM   618  N N   . SER A 1 83  ? 14.178 19.107 -7.970  1.00 15.00 ? 83  SER A N   1 
ATOM   619  C CA  . SER A 1 83  ? 14.111 17.774 -7.398  1.00 15.00 ? 83  SER A CA  1 
ATOM   620  C C   . SER A 1 83  ? 14.613 16.784 -8.467  1.00 15.00 ? 83  SER A C   1 
ATOM   621  O O   . SER A 1 83  ? 14.824 17.162 -9.615  1.00 15.00 ? 83  SER A O   1 
ATOM   622  C CB  . SER A 1 83  ? 12.657 17.466 -7.073  1.00 15.00 ? 83  SER A CB  1 
ATOM   623  O OG  . SER A 1 83  ? 11.821 17.672 -8.219  1.00 15.00 ? 83  SER A OG  1 
ATOM   624  N N   . GLU A 1 84  ? 14.823 15.525 -8.103  1.00 15.00 ? 84  GLU A N   1 
ATOM   625  C CA  . GLU A 1 84  ? 15.271 14.543 -9.098  1.00 15.00 ? 84  GLU A CA  1 
ATOM   626  C C   . GLU A 1 84  ? 14.140 14.267 -10.069 1.00 15.00 ? 84  GLU A C   1 
ATOM   627  O O   . GLU A 1 84  ? 14.363 13.864 -11.212 1.00 15.00 ? 84  GLU A O   1 
ATOM   628  C CB  . GLU A 1 84  ? 15.627 13.206 -8.441  1.00 15.00 ? 84  GLU A CB  1 
ATOM   629  C CG  . GLU A 1 84  ? 17.021 12.606 -8.766  1.00 15.00 ? 84  GLU A CG  1 
ATOM   630  C CD  . GLU A 1 84  ? 17.441 12.671 -10.232 1.00 15.00 ? 84  GLU A CD  1 
ATOM   631  O OE1 . GLU A 1 84  ? 16.965 11.848 -11.049 1.00 15.00 ? 84  GLU A OE1 1 
ATOM   632  O OE2 . GLU A 1 84  ? 18.325 13.501 -10.570 1.00 15.00 ? 84  GLU A OE2 1 
ATOM   633  N N   . ASP A 1 85  ? 12.923 14.339 -9.552  1.00 15.00 ? 85  ASP A N   1 
ATOM   634  C CA  . ASP A 1 85  ? 11.754 14.106 -10.376 1.00 15.00 ? 85  ASP A CA  1 
ATOM   635  C C   . ASP A 1 85  ? 11.616 15.168 -11.436 1.00 15.00 ? 85  ASP A C   1 
ATOM   636  O O   . ASP A 1 85  ? 11.411 14.867 -12.606 1.00 15.00 ? 85  ASP A O   1 
ATOM   637  C CB  . ASP A 1 85  ? 10.500 13.974 -9.518  1.00 15.00 ? 85  ASP A CB  1 
ATOM   638  C CG  . ASP A 1 85  ? 10.356 12.555 -8.945  1.00 15.00 ? 85  ASP A CG  1 
ATOM   639  O OD1 . ASP A 1 85  ? 9.860  11.647 -9.655  1.00 15.00 ? 85  ASP A OD1 1 
ATOM   640  O OD2 . ASP A 1 85  ? 10.797 12.329 -7.799  1.00 15.00 ? 85  ASP A OD2 1 
ATOM   641  N N   . ALA A 1 86  ? 11.780 16.418 -11.021 1.00 15.00 ? 86  ALA A N   1 
ATOM   642  C CA  . ALA A 1 86  ? 11.681 17.538 -11.947 1.00 15.00 ? 86  ALA A CA  1 
ATOM   643  C C   . ALA A 1 86  ? 12.887 17.654 -12.874 1.00 15.00 ? 86  ALA A C   1 
ATOM   644  O O   . ALA A 1 86  ? 12.759 18.252 -13.935 1.00 15.00 ? 86  ALA A O   1 
ATOM   645  C CB  . ALA A 1 86  ? 11.446 18.867 -11.209 1.00 15.00 ? 86  ALA A CB  1 
ATOM   646  N N   . TYR A 1 87  ? 14.041 17.090 -12.516 1.00 15.00 ? 87  TYR A N   1 
ATOM   647  C CA  . TYR A 1 87  ? 15.236 17.196 -13.372 1.00 15.00 ? 87  TYR A CA  1 
ATOM   648  C C   . TYR A 1 87  ? 15.967 15.884 -13.173 1.00 15.00 ? 87  TYR A C   1 
ATOM   649  O O   . TYR A 1 87  ? 16.841 15.776 -12.311 1.00 15.00 ? 87  TYR A O   1 
ATOM   650  C CB  . TYR A 1 87  ? 16.079 18.395 -12.898 1.00 15.00 ? 87  TYR A CB  1 
ATOM   651  C CG  . TYR A 1 87  ? 17.017 19.028 -13.900 1.00 15.00 ? 87  TYR A CG  1 
ATOM   652  C CD1 . TYR A 1 87  ? 17.691 18.262 -14.859 1.00 15.00 ? 87  TYR A CD1 1 
ATOM   653  C CD2 . TYR A 1 87  ? 17.264 20.394 -13.876 1.00 15.00 ? 87  TYR A CD2 1 
ATOM   654  C CE1 . TYR A 1 87  ? 18.592 18.844 -15.776 1.00 15.00 ? 87  TYR A CE1 1 
ATOM   655  C CE2 . TYR A 1 87  ? 18.167 20.976 -14.789 1.00 15.00 ? 87  TYR A CE2 1 
ATOM   656  C CZ  . TYR A 1 87  ? 18.815 20.194 -15.725 1.00 15.00 ? 87  TYR A CZ  1 
ATOM   657  O OH  . TYR A 1 87  ? 19.652 20.848 -16.584 1.00 15.00 ? 87  TYR A OH  1 
ATOM   658  N N   . PRO A 1 88  ? 15.492 14.824 -13.857 1.00 15.00 ? 88  PRO A N   1 
ATOM   659  C CA  . PRO A 1 88  ? 16.100 13.499 -13.748 1.00 15.00 ? 88  PRO A CA  1 
ATOM   660  C C   . PRO A 1 88  ? 17.554 13.393 -14.246 1.00 15.00 ? 88  PRO A C   1 
ATOM   661  O O   . PRO A 1 88  ? 17.990 14.107 -15.184 1.00 15.00 ? 88  PRO A O   1 
ATOM   662  C CB  . PRO A 1 88  ? 15.102 12.603 -14.516 1.00 15.00 ? 88  PRO A CB  1 
ATOM   663  C CG  . PRO A 1 88  ? 14.514 13.555 -15.556 1.00 15.00 ? 88  PRO A CG  1 
ATOM   664  C CD  . PRO A 1 88  ? 14.315 14.804 -14.756 1.00 15.00 ? 88  PRO A CD  1 
ATOM   665  N N   . TYR A 1 89  ? 18.283 12.449 -13.655 1.00 15.00 ? 89  TYR A N   1 
ATOM   666  C CA  . TYR A 1 89  ? 19.678 12.261 -14.012 1.00 15.00 ? 89  TYR A CA  1 
ATOM   667  C C   . TYR A 1 89  ? 19.815 11.430 -15.271 1.00 15.00 ? 89  TYR A C   1 
ATOM   668  O O   . TYR A 1 89  ? 19.147 10.401 -15.453 1.00 15.00 ? 89  TYR A O   1 
ATOM   669  C CB  . TYR A 1 89  ? 20.435 11.637 -12.841 1.00 15.00 ? 89  TYR A CB  1 
ATOM   670  C CG  . TYR A 1 89  ? 21.922 11.468 -13.021 1.00 15.00 ? 89  TYR A CG  1 
ATOM   671  C CD1 . TYR A 1 89  ? 22.764 12.547 -13.090 1.00 15.00 ? 89  TYR A CD1 1 
ATOM   672  C CD2 . TYR A 1 89  ? 22.497 10.207 -13.084 1.00 15.00 ? 89  TYR A CD2 1 
ATOM   673  C CE1 . TYR A 1 89  ? 24.150 12.378 -13.214 1.00 15.00 ? 89  TYR A CE1 1 
ATOM   674  C CE2 . TYR A 1 89  ? 23.877 10.038 -13.211 1.00 15.00 ? 89  TYR A CE2 1 
ATOM   675  C CZ  . TYR A 1 89  ? 24.688 11.128 -13.271 1.00 15.00 ? 89  TYR A CZ  1 
ATOM   676  O OH  . TYR A 1 89  ? 26.042 10.998 -13.350 1.00 15.00 ? 89  TYR A OH  1 
ATOM   677  N N   . VAL A 1 90  ? 20.620 11.938 -16.188 1.00 15.00 ? 90  VAL A N   1 
ATOM   678  C CA  . VAL A 1 90  ? 20.860 11.214 -17.419 1.00 15.00 ? 90  VAL A CA  1 
ATOM   679  C C   . VAL A 1 90  ? 22.282 10.618 -17.431 1.00 15.00 ? 90  VAL A C   1 
ATOM   680  O O   . VAL A 1 90  ? 22.484 9.519  -17.951 1.00 15.00 ? 90  VAL A O   1 
ATOM   681  C CB  . VAL A 1 90  ? 20.512 12.040 -18.673 1.00 15.00 ? 90  VAL A CB  1 
ATOM   682  C CG1 . VAL A 1 90  ? 19.063 12.456 -18.611 1.00 15.00 ? 90  VAL A CG1 1 
ATOM   683  C CG2 . VAL A 1 90  ? 21.433 13.241 -18.819 1.00 15.00 ? 90  VAL A CG2 1 
ATOM   684  N N   . GLY A 1 91  ? 23.262 11.307 -16.855 1.00 15.00 ? 91  GLY A N   1 
ATOM   685  C CA  . GLY A 1 91  ? 24.583 10.719 -16.799 1.00 15.00 ? 91  GLY A CA  1 
ATOM   686  C C   . GLY A 1 91  ? 25.514 11.277 -17.813 1.00 15.00 ? 91  GLY A C   1 
ATOM   687  O O   . GLY A 1 91  ? 26.607 10.758 -18.015 1.00 15.00 ? 91  GLY A O   1 
ATOM   688  N N   . GLN A 1 92  ? 25.019 12.240 -18.561 1.00 15.00 ? 92  GLN A N   1 
ATOM   689  C CA  . GLN A 1 92  ? 25.852 12.908 -19.525 1.00 15.00 ? 92  GLN A CA  1 
ATOM   690  C C   . GLN A 1 92  ? 25.462 14.390 -19.566 1.00 15.00 ? 92  GLN A C   1 
ATOM   691  O O   . GLN A 1 92  ? 24.430 14.835 -19.031 1.00 15.00 ? 92  GLN A O   1 
ATOM   692  C CB  . GLN A 1 92  ? 25.794 12.251 -20.922 1.00 15.00 ? 92  GLN A CB  1 
ATOM   693  C CG  . GLN A 1 92  ? 26.481 10.877 -21.015 1.00 15.00 ? 92  GLN A CG  1 
ATOM   694  C CD  . GLN A 1 92  ? 27.976 10.804 -20.570 1.00 15.00 ? 92  GLN A CD  1 
ATOM   695  O OE1 . GLN A 1 92  ? 28.545 11.738 -20.006 1.00 15.00 ? 92  GLN A OE1 1 
ATOM   696  N NE2 . GLN A 1 92  ? 28.588 9.653  -20.811 1.00 15.00 ? 92  GLN A NE2 1 
ATOM   697  N N   . GLU A 1 93  ? 26.369 15.156 -20.142 1.00 15.00 ? 93  GLU A N   1 
ATOM   698  C CA  . GLU A 1 93  ? 26.234 16.603 -20.302 1.00 15.00 ? 93  GLU A CA  1 
ATOM   699  C C   . GLU A 1 93  ? 25.106 17.043 -21.285 1.00 15.00 ? 93  GLU A C   1 
ATOM   700  O O   . GLU A 1 93  ? 25.014 16.529 -22.396 1.00 15.00 ? 93  GLU A O   1 
ATOM   701  C CB  . GLU A 1 93  ? 27.599 17.194 -20.723 1.00 15.00 ? 93  GLU A CB  1 
ATOM   702  C CG  . GLU A 1 93  ? 28.505 17.628 -19.561 1.00 15.00 ? 93  GLU A CG  1 
ATOM   703  C CD  . GLU A 1 93  ? 29.962 17.287 -19.776 1.00 15.00 ? 93  GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 93  ? 30.260 16.198 -20.299 1.00 15.00 ? 93  GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 93  ? 30.845 18.072 -19.392 1.00 15.00 ? 93  GLU A OE2 1 
ATOM   706  N N   . GLU A 1 94  ? 24.267 17.963 -20.828 1.00 15.00 ? 94  GLU A N   1 
ATOM   707  C CA  . GLU A 1 94  ? 23.220 18.519 -21.601 1.00 15.00 ? 94  GLU A CA  1 
ATOM   708  C C   . GLU A 1 94  ? 23.091 19.918 -21.073 1.00 15.00 ? 94  GLU A C   1 
ATOM   709  O O   . GLU A 1 94  ? 23.531 20.257 -20.023 1.00 15.00 ? 94  GLU A O   1 
ATOM   710  C CB  . GLU A 1 94  ? 21.932 17.727 -21.411 1.00 15.00 ? 94  GLU A CB  1 
ATOM   711  C CG  . GLU A 1 94  ? 21.811 17.042 -20.091 1.00 15.00 ? 94  GLU A CG  1 
ATOM   712  C CD  . GLU A 1 94  ? 20.433 16.491 -19.762 1.00 15.00 ? 94  GLU A CD  1 
ATOM   713  O OE1 . GLU A 1 94  ? 19.919 15.636 -20.508 1.00 15.00 ? 94  GLU A OE1 1 
ATOM   714  O OE2 . GLU A 1 94  ? 19.852 16.958 -18.761 1.00 15.00 ? 94  GLU A OE2 1 
ATOM   715  N N   . SER A 1 95  ? 22.452 20.736 -21.857 1.00 15.00 ? 95  SER A N   1 
ATOM   716  C CA  . SER A 1 95  ? 22.214 22.154 -21.549 1.00 15.00 ? 95  SER A CA  1 
ATOM   717  C C   . SER A 1 95  ? 21.413 22.328 -20.282 1.00 15.00 ? 95  SER A C   1 
ATOM   718  O O   . SER A 1 95  ? 20.657 21.451 -19.898 1.00 15.00 ? 95  SER A O   1 
ATOM   719  C CB  . SER A 1 95  ? 21.516 22.892 -22.734 1.00 15.00 ? 95  SER A CB  1 
ATOM   720  O OG  . SER A 1 95  ? 22.356 22.741 -23.894 1.00 15.00 ? 95  SER A OG  1 
ATOM   721  N N   . CYS A 1 96  ? 21.567 23.469 -19.614 1.00 15.00 ? 96  CYS A N   1 
ATOM   722  C CA  . CYS A 1 96  ? 20.825 23.752 -18.386 1.00 15.00 ? 96  CYS A CA  1 
ATOM   723  C C   . CYS A 1 96  ? 19.339 23.859 -18.685 1.00 15.00 ? 96  CYS A C   1 
ATOM   724  O O   . CYS A 1 96  ? 18.888 24.635 -19.555 1.00 15.00 ? 96  CYS A O   1 
ATOM   725  C CB  . CYS A 1 96  ? 21.324 25.038 -17.707 1.00 15.00 ? 96  CYS A CB  1 
ATOM   726  S SG  . CYS A 1 96  ? 20.616 25.405 -16.084 1.00 15.00 ? 96  CYS A SG  1 
ATOM   727  N N   . MET A 1 97  ? 18.614 22.995 -17.986 1.00 15.00 ? 97  MET A N   1 
ATOM   728  C CA  . MET A 1 97  ? 17.171 22.932 -18.074 1.00 15.00 ? 97  MET A CA  1 
ATOM   729  C C   . MET A 1 97  ? 16.533 23.090 -16.693 1.00 15.00 ? 97  MET A C   1 
ATOM   730  O O   . MET A 1 97  ? 15.472 22.507 -16.397 1.00 15.00 ? 97  MET A O   1 
ATOM   731  C CB  . MET A 1 97  ? 16.754 21.619 -18.706 1.00 15.00 ? 97  MET A CB  1 
ATOM   732  C CG  . MET A 1 97  ? 17.130 21.538 -20.136 1.00 15.00 ? 97  MET A CG  1 
ATOM   733  S SD  . MET A 1 97  ? 17.354 19.816 -20.576 1.00 15.00 ? 97  MET A SD  1 
ATOM   734  C CE  . MET A 1 97  ? 15.805 19.150 -19.981 1.00 15.00 ? 97  MET A CE  1 
ATOM   735  N N   . TYR A 1 98  ? 17.183 23.911 -15.869 1.00 15.00 ? 98  TYR A N   1 
ATOM   736  C CA  . TYR A 1 98  ? 16.692 24.211 -14.537 1.00 15.00 ? 98  TYR A CA  1 
ATOM   737  C C   . TYR A 1 98  ? 15.310 24.827 -14.659 1.00 15.00 ? 98  TYR A C   1 
ATOM   738  O O   . TYR A 1 98  ? 15.126 25.805 -15.381 1.00 15.00 ? 98  TYR A O   1 
ATOM   739  C CB  . TYR A 1 98  ? 17.616 25.220 -13.839 1.00 15.00 ? 98  TYR A CB  1 
ATOM   740  C CG  . TYR A 1 98  ? 16.972 25.820 -12.587 1.00 15.00 ? 98  TYR A CG  1 
ATOM   741  C CD1 . TYR A 1 98  ? 16.674 25.081 -11.504 1.00 15.00 ? 98  TYR A CD1 1 
ATOM   742  C CD2 . TYR A 1 98  ? 16.574 27.094 -12.529 1.00 15.00 ? 98  TYR A CD2 1 
ATOM   743  C CE1 . TYR A 1 98  ? 15.988 25.631 -10.411 1.00 15.00 ? 98  TYR A CE1 1 
ATOM   744  C CE2 . TYR A 1 98  ? 15.883 27.588 -11.404 1.00 15.00 ? 98  TYR A CE2 1 
ATOM   745  C CZ  . TYR A 1 98  ? 15.603 26.863 -10.361 1.00 15.00 ? 98  TYR A CZ  1 
ATOM   746  O OH  . TYR A 1 98  ? 14.983 27.390 -9.295  1.00 15.00 ? 98  TYR A OH  1 
ATOM   747  N N   . ASN A 1 99  ? 14.331 24.236 -13.990 1.00 15.00 ? 99  ASN A N   1 
ATOM   748  C CA  . ASN A 1 99  ? 12.981 24.781 -14.038 1.00 15.00 ? 99  ASN A CA  1 
ATOM   749  C C   . ASN A 1 99  ? 12.533 25.253 -12.656 1.00 15.00 ? 99  ASN A C   1 
ATOM   750  O O   . ASN A 1 99  ? 12.339 24.451 -11.747 1.00 15.00 ? 99  ASN A O   1 
ATOM   751  C CB  . ASN A 1 99  ? 12.004 23.790 -14.642 1.00 15.00 ? 99  ASN A CB  1 
ATOM   752  C CG  . ASN A 1 99  ? 10.578 24.297 -14.592 1.00 15.00 ? 99  ASN A CG  1 
ATOM   753  O OD1 . ASN A 1 99  ? 10.334 25.507 -14.562 1.00 15.00 ? 99  ASN A OD1 1 
ATOM   754  N ND2 . ASN A 1 99  ? 9.626  23.378 -14.538 1.00 15.00 ? 99  ASN A ND2 1 
ATOM   755  N N   . PRO A 1 100 ? 12.198 26.548 -12.523 1.00 15.00 ? 100 PRO A N   1 
ATOM   756  C CA  . PRO A 1 100 ? 11.800 26.984 -11.180 1.00 15.00 ? 100 PRO A CA  1 
ATOM   757  C C   . PRO A 1 100 ? 10.535 26.417 -10.548 1.00 15.00 ? 100 PRO A C   1 
ATOM   758  O O   . PRO A 1 100 ? 10.422 26.444 -9.314  1.00 15.00 ? 100 PRO A O   1 
ATOM   759  C CB  . PRO A 1 100 ? 11.708 28.493 -11.310 1.00 15.00 ? 100 PRO A CB  1 
ATOM   760  C CG  . PRO A 1 100 ? 12.394 28.821 -12.659 1.00 15.00 ? 100 PRO A CG  1 
ATOM   761  C CD  . PRO A 1 100 ? 12.019 27.635 -13.497 1.00 15.00 ? 100 PRO A CD  1 
ATOM   762  N N   . THR A 1 101 ? 9.579  25.934 -11.350 1.00 15.00 ? 101 THR A N   1 
ATOM   763  C CA  . THR A 1 101 ? 8.375  25.393 -10.736 1.00 15.00 ? 101 THR A CA  1 
ATOM   764  C C   . THR A 1 101 ? 8.671  24.037 -10.114 1.00 15.00 ? 101 THR A C   1 
ATOM   765  O O   . THR A 1 101 ? 7.836  23.478 -9.402  1.00 15.00 ? 101 THR A O   1 
ATOM   766  C CB  . THR A 1 101 ? 7.150  25.341 -11.698 1.00 15.00 ? 101 THR A CB  1 
ATOM   767  O OG1 . THR A 1 101 ? 7.325  24.304 -12.673 1.00 15.00 ? 101 THR A OG1 1 
ATOM   768  C CG2 . THR A 1 101 ? 6.946  26.690 -12.417 1.00 15.00 ? 101 THR A CG2 1 
ATOM   769  N N   . GLY A 1 102 ? 9.870  23.519 -10.370 1.00 15.00 ? 102 GLY A N   1 
ATOM   770  C CA  . GLY A 1 102 ? 10.265 22.242 -9.798  1.00 15.00 ? 102 GLY A CA  1 
ATOM   771  C C   . GLY A 1 102 ? 11.303 22.427 -8.694  1.00 15.00 ? 102 GLY A C   1 
ATOM   772  O O   . GLY A 1 102 ? 11.985 21.471 -8.314  1.00 15.00 ? 102 GLY A O   1 
ATOM   773  N N   . LYS A 1 103 ? 11.428 23.660 -8.201  1.00 15.00 ? 103 LYS A N   1 
ATOM   774  C CA  . LYS A 1 103 ? 12.379 24.021 -7.157  1.00 15.00 ? 103 LYS A CA  1 
ATOM   775  C C   . LYS A 1 103 ? 12.067 23.224 -5.898  1.00 15.00 ? 103 LYS A C   1 
ATOM   776  O O   . LYS A 1 103 ? 10.964 23.323 -5.356  1.00 15.00 ? 103 LYS A O   1 
ATOM   777  C CB  . LYS A 1 103 ? 12.280 25.522 -6.885  1.00 15.00 ? 103 LYS A CB  1 
ATOM   778  C CG  . LYS A 1 103 ? 13.312 26.060 -5.912  1.00 15.00 ? 103 LYS A CG  1 
ATOM   779  C CD  . LYS A 1 103 ? 12.785 27.313 -5.175  1.00 15.00 ? 103 LYS A CD  1 
ATOM   780  C CE  . LYS A 1 103 ? 11.759 26.980 -4.059  1.00 15.00 ? 103 LYS A CE  1 
ATOM   781  N NZ  . LYS A 1 103 ? 12.338 26.113 -2.973  1.00 15.00 ? 103 LYS A NZ  1 
ATOM   782  N N   . ALA A 1 104 ? 13.015 22.400 -5.456  1.00 15.00 ? 104 ALA A N   1 
ATOM   783  C CA  . ALA A 1 104 ? 12.805 21.575 -4.271  1.00 15.00 ? 104 ALA A CA  1 
ATOM   784  C C   . ALA A 1 104 ? 13.484 22.120 -3.018  1.00 15.00 ? 104 ALA A C   1 
ATOM   785  O O   . ALA A 1 104 ? 13.129 21.709 -1.906  1.00 15.00 ? 104 ALA A O   1 
ATOM   786  C CB  . ALA A 1 104 ? 13.258 20.153 -4.536  1.00 15.00 ? 104 ALA A CB  1 
ATOM   787  N N   . ALA A 1 105 ? 14.435 23.040 -3.202  1.00 15.00 ? 105 ALA A N   1 
ATOM   788  C CA  . ALA A 1 105 ? 15.183 23.612 -2.086  1.00 15.00 ? 105 ALA A CA  1 
ATOM   789  C C   . ALA A 1 105 ? 16.037 24.826 -2.477  1.00 15.00 ? 105 ALA A C   1 
ATOM   790  O O   . ALA A 1 105 ? 16.145 25.139 -3.649  1.00 15.00 ? 105 ALA A O   1 
ATOM   791  C CB  . ALA A 1 105 ? 16.054 22.522 -1.437  1.00 15.00 ? 105 ALA A CB  1 
ATOM   792  N N   . LYS A 1 106 ? 16.565 25.521 -1.465  1.00 15.00 ? 106 LYS A N   1 
ATOM   793  C CA  . LYS A 1 106 ? 17.413 26.707 -1.594  1.00 15.00 ? 106 LYS A CA  1 
ATOM   794  C C   . LYS A 1 106 ? 18.629 26.587 -0.664  1.00 15.00 ? 106 LYS A C   1 
ATOM   795  O O   . LYS A 1 106 ? 18.658 25.706 0.193   1.00 15.00 ? 106 LYS A O   1 
ATOM   796  C CB  . LYS A 1 106 ? 16.615 27.968 -1.254  1.00 15.00 ? 106 LYS A CB  1 
ATOM   797  C CG  . LYS A 1 106 ? 15.494 28.254 -2.228  1.00 15.00 ? 106 LYS A CG  1 
ATOM   798  C CD  . LYS A 1 106 ? 14.909 29.632 -2.013  1.00 15.00 ? 106 LYS A CD  1 
ATOM   799  C CE  . LYS A 1 106 ? 13.945 29.718 -0.832  1.00 15.00 ? 106 LYS A CE  1 
ATOM   800  N NZ  . LYS A 1 106 ? 13.663 31.152 -0.533  1.00 15.00 ? 106 LYS A NZ  1 
ATOM   801  N N   . CYS A 1 107 ? 19.649 27.409 -0.900  1.00 15.00 ? 107 CYS A N   1 
ATOM   802  C CA  . CYS A 1 107 ? 20.872 27.427 -0.092  1.00 15.00 ? 107 CYS A CA  1 
ATOM   803  C C   . CYS A 1 107 ? 21.155 28.885 0.272   1.00 15.00 ? 107 CYS A C   1 
ATOM   804  O O   . CYS A 1 107 ? 20.781 29.794 -0.488  1.00 15.00 ? 107 CYS A O   1 
ATOM   805  C CB  . CYS A 1 107 ? 22.061 26.877 -0.901  1.00 15.00 ? 107 CYS A CB  1 
ATOM   806  S SG  . CYS A 1 107 ? 23.564 26.707 0.061   1.00 15.00 ? 107 CYS A SG  1 
ATOM   807  N N   . ARG A 1 108 ? 21.769 29.102 1.435   1.00 15.00 ? 108 ARG A N   1 
ATOM   808  C CA  . ARG A 1 108 ? 22.114 30.439 1.892   1.00 15.00 ? 108 ARG A CA  1 
ATOM   809  C C   . ARG A 1 108 ? 23.630 30.549 2.037   1.00 15.00 ? 108 ARG A C   1 
ATOM   810  O O   . ARG A 1 108 ? 24.152 31.377 2.804   1.00 15.00 ? 108 ARG A O   1 
ATOM   811  C CB  . ARG A 1 108 ? 21.442 30.707 3.236   1.00 15.00 ? 108 ARG A CB  1 
ATOM   812  C CG  . ARG A 1 108 ? 19.943 30.521 3.251   1.00 15.00 ? 108 ARG A CG  1 
ATOM   813  C CD  . ARG A 1 108 ? 19.407 30.658 4.647   1.00 15.00 ? 108 ARG A CD  1 
ATOM   814  N NE  . ARG A 1 108 ? 17.954 30.606 4.653   1.00 15.00 ? 108 ARG A NE  1 
ATOM   815  C CZ  . ARG A 1 108 ? 17.204 30.646 5.748   1.00 15.00 ? 108 ARG A CZ  1 
ATOM   816  N NH1 . ARG A 1 108 ? 17.759 30.743 6.959   1.00 15.00 ? 108 ARG A NH1 1 
ATOM   817  N NH2 . ARG A 1 108 ? 15.891 30.523 5.625   1.00 15.00 ? 108 ARG A NH2 1 
ATOM   818  N N   . GLY A 1 109 ? 24.316 29.634 1.357   1.00 15.00 ? 109 GLY A N   1 
ATOM   819  C CA  . GLY A 1 109 ? 25.764 29.581 1.377   1.00 15.00 ? 109 GLY A CA  1 
ATOM   820  C C   . GLY A 1 109 ? 26.290 28.230 1.818   1.00 15.00 ? 109 GLY A C   1 
ATOM   821  O O   . GLY A 1 109 ? 25.604 27.217 1.770   1.00 15.00 ? 109 GLY A O   1 
ATOM   822  N N   . TYR A 1 110 ? 27.539 28.237 2.260   1.00 15.00 ? 110 TYR A N   1 
ATOM   823  C CA  . TYR A 1 110 ? 28.236 27.038 2.720   1.00 15.00 ? 110 TYR A CA  1 
ATOM   824  C C   . TYR A 1 110 ? 29.358 27.365 3.715   1.00 15.00 ? 110 TYR A C   1 
ATOM   825  O O   . TYR A 1 110 ? 29.936 28.457 3.684   1.00 15.00 ? 110 TYR A O   1 
ATOM   826  C CB  . TYR A 1 110 ? 28.839 26.281 1.549   1.00 15.00 ? 110 TYR A CB  1 
ATOM   827  C CG  . TYR A 1 110 ? 29.889 27.067 0.816   1.00 15.00 ? 110 TYR A CG  1 
ATOM   828  C CD1 . TYR A 1 110 ? 31.237 27.061 1.251   1.00 15.00 ? 110 TYR A CD1 1 
ATOM   829  C CD2 . TYR A 1 110 ? 29.552 27.826 -0.318  1.00 15.00 ? 110 TYR A CD2 1 
ATOM   830  C CE1 . TYR A 1 110 ? 32.234 27.792 0.573   1.00 15.00 ? 110 TYR A CE1 1 
ATOM   831  C CE2 . TYR A 1 110 ? 30.546 28.571 -1.012  1.00 15.00 ? 110 TYR A CE2 1 
ATOM   832  C CZ  . TYR A 1 110 ? 31.878 28.540 -0.557  1.00 15.00 ? 110 TYR A CZ  1 
ATOM   833  O OH  . TYR A 1 110 ? 32.830 29.241 -1.265  1.00 15.00 ? 110 TYR A OH  1 
ATOM   834  N N   . ARG A 1 111 ? 29.736 26.369 4.510   1.00 15.00 ? 111 ARG A N   1 
ATOM   835  C CA  . ARG A 1 111 ? 30.772 26.510 5.539   1.00 15.00 ? 111 ARG A CA  1 
ATOM   836  C C   . ARG A 1 111 ? 31.857 25.496 5.239   1.00 15.00 ? 111 ARG A C   1 
ATOM   837  O O   . ARG A 1 111 ? 31.557 24.348 4.899   1.00 15.00 ? 111 ARG A O   1 
ATOM   838  C CB  . ARG A 1 111 ? 30.166 26.153 6.907   1.00 15.00 ? 111 ARG A CB  1 
ATOM   839  C CG  . ARG A 1 111 ? 30.579 26.966 8.139   1.00 15.00 ? 111 ARG A CG  1 
ATOM   840  C CD  . ARG A 1 111 ? 32.056 26.841 8.548   1.00 15.00 ? 111 ARG A CD  1 
ATOM   841  N NE  . ARG A 1 111 ? 32.475 25.487 8.930   1.00 15.00 ? 111 ARG A NE  1 
ATOM   842  C CZ  . ARG A 1 111 ? 32.237 24.920 10.117  1.00 15.00 ? 111 ARG A CZ  1 
ATOM   843  N NH1 . ARG A 1 111 ? 31.570 25.573 11.070  1.00 15.00 ? 111 ARG A NH1 1 
ATOM   844  N NH2 . ARG A 1 111 ? 32.665 23.682 10.352  1.00 15.00 ? 111 ARG A NH2 1 
ATOM   845  N N   . GLU A 1 112 ? 33.107 25.879 5.460   1.00 15.00 ? 112 GLU A N   1 
ATOM   846  C CA  . GLU A 1 112 ? 34.200 24.957 5.216   1.00 15.00 ? 112 GLU A CA  1 
ATOM   847  C C   . GLU A 1 112 ? 34.849 24.492 6.518   1.00 15.00 ? 112 GLU A C   1 
ATOM   848  O O   . GLU A 1 112 ? 35.237 25.320 7.351   1.00 15.00 ? 112 GLU A O   1 
ATOM   849  C CB  . GLU A 1 112 ? 35.240 25.603 4.283   1.00 15.00 ? 112 GLU A CB  1 
ATOM   850  C CG  . GLU A 1 112 ? 34.975 25.377 2.799   1.00 15.00 ? 112 GLU A CG  1 
ATOM   851  C CD  . GLU A 1 112 ? 35.728 26.349 1.880   1.00 15.00 ? 112 GLU A CD  1 
ATOM   852  O OE1 . GLU A 1 112 ? 36.930 26.638 2.108   1.00 15.00 ? 112 GLU A OE1 1 
ATOM   853  O OE2 . GLU A 1 112 ? 35.102 26.844 0.921   1.00 15.00 ? 112 GLU A OE2 1 
ATOM   854  N N   . ILE A 1 113 ? 34.918 23.180 6.708   1.00 15.00 ? 113 ILE A N   1 
ATOM   855  C CA  . ILE A 1 113 ? 35.541 22.620 7.893   1.00 15.00 ? 113 ILE A CA  1 
ATOM   856  C C   . ILE A 1 113 ? 37.068 22.829 7.780   1.00 15.00 ? 113 ILE A C   1 
ATOM   857  O O   . ILE A 1 113 ? 37.659 22.575 6.717   1.00 15.00 ? 113 ILE A O   1 
ATOM   858  C CB  . ILE A 1 113 ? 35.171 21.113 8.095   1.00 15.00 ? 113 ILE A CB  1 
ATOM   859  C CG1 . ILE A 1 113 ? 33.735 20.999 8.615   1.00 15.00 ? 113 ILE A CG1 1 
ATOM   860  C CG2 . ILE A 1 113 ? 36.099 20.454 9.097   1.00 15.00 ? 113 ILE A CG2 1 
ATOM   861  C CD1 . ILE A 1 113 ? 32.711 21.583 7.714   1.00 15.00 ? 113 ILE A CD1 1 
ATOM   862  N N   . PRO A 1 114 ? 37.721 23.309 8.866   1.00 15.00 ? 114 PRO A N   1 
ATOM   863  C CA  . PRO A 1 114 ? 39.173 23.563 8.921   1.00 15.00 ? 114 PRO A CA  1 
ATOM   864  C C   . PRO A 1 114 ? 39.953 22.403 8.301   1.00 15.00 ? 114 PRO A C   1 
ATOM   865  O O   . PRO A 1 114 ? 39.877 21.260 8.783   1.00 15.00 ? 114 PRO A O   1 
ATOM   866  C CB  . PRO A 1 114 ? 39.443 23.649 10.426  1.00 15.00 ? 114 PRO A CB  1 
ATOM   867  C CG  . PRO A 1 114 ? 38.205 24.270 10.949  1.00 15.00 ? 114 PRO A CG  1 
ATOM   868  C CD  . PRO A 1 114 ? 37.116 23.509 10.196  1.00 15.00 ? 114 PRO A CD  1 
ATOM   869  N N   . GLU A 1 115 ? 40.717 22.688 7.250   1.00 15.00 ? 115 GLU A N   1 
ATOM   870  C CA  . GLU A 1 115 ? 41.477 21.639 6.581   1.00 15.00 ? 115 GLU A CA  1 
ATOM   871  C C   . GLU A 1 115 ? 42.307 20.748 7.512   1.00 15.00 ? 115 GLU A C   1 
ATOM   872  O O   . GLU A 1 115 ? 42.979 21.245 8.429   1.00 15.00 ? 115 GLU A O   1 
ATOM   873  C CB  . GLU A 1 115 ? 42.381 22.229 5.508   1.00 15.00 ? 115 GLU A CB  1 
ATOM   874  C CG  . GLU A 1 115 ? 43.116 21.165 4.746   1.00 15.00 ? 115 GLU A CG  1 
ATOM   875  C CD  . GLU A 1 115 ? 44.193 21.716 3.838   1.00 15.00 ? 115 GLU A CD  1 
ATOM   876  O OE1 . GLU A 1 115 ? 44.526 22.929 3.936   1.00 15.00 ? 115 GLU A OE1 1 
ATOM   877  O OE2 . GLU A 1 115 ? 44.727 20.920 3.031   1.00 15.00 ? 115 GLU A OE2 1 
ATOM   878  N N   . GLY A 1 116 ? 42.250 19.436 7.266   1.00 15.00 ? 116 GLY A N   1 
ATOM   879  C CA  . GLY A 1 116 ? 42.995 18.471 8.055   1.00 15.00 ? 116 GLY A CA  1 
ATOM   880  C C   . GLY A 1 116 ? 42.512 18.246 9.470   1.00 15.00 ? 116 GLY A C   1 
ATOM   881  O O   . GLY A 1 116 ? 43.108 17.437 10.189  1.00 15.00 ? 116 GLY A O   1 
ATOM   882  N N   . ASN A 1 117 ? 41.440 18.926 9.870   1.00 15.00 ? 117 ASN A N   1 
ATOM   883  C CA  . ASN A 1 117 ? 40.930 18.820 11.242  1.00 15.00 ? 117 ASN A CA  1 
ATOM   884  C C   . ASN A 1 117 ? 39.703 17.913 11.416  1.00 15.00 ? 117 ASN A C   1 
ATOM   885  O O   . ASN A 1 117 ? 38.555 18.349 11.240  1.00 15.00 ? 117 ASN A O   1 
ATOM   886  C CB  . ASN A 1 117 ? 40.678 20.232 11.806  1.00 15.00 ? 117 ASN A CB  1 
ATOM   887  C CG  . ASN A 1 117 ? 40.331 20.240 13.308  1.00 15.00 ? 117 ASN A CG  1 
ATOM   888  O OD1 . ASN A 1 117 ? 39.929 19.230 13.896  1.00 15.00 ? 117 ASN A OD1 1 
ATOM   889  N ND2 . ASN A 1 117 ? 40.423 21.417 13.908  1.00 15.00 ? 117 ASN A ND2 1 
ATOM   890  N N   . GLU A 1 118 ? 39.953 16.667 11.826  1.00 15.00 ? 118 GLU A N   1 
ATOM   891  C CA  . GLU A 1 118 ? 38.896 15.653 12.027  1.00 15.00 ? 118 GLU A CA  1 
ATOM   892  C C   . GLU A 1 118 ? 37.903 15.934 13.159  1.00 15.00 ? 118 GLU A C   1 
ATOM   893  O O   . GLU A 1 118 ? 36.722 15.625 13.024  1.00 15.00 ? 118 GLU A O   1 
ATOM   894  C CB  . GLU A 1 118 ? 39.491 14.243 12.230  1.00 15.00 ? 118 GLU A CB  1 
ATOM   895  C CG  . GLU A 1 118 ? 40.209 13.644 11.004  1.00 15.00 ? 118 GLU A CG  1 
ATOM   896  C CD  . GLU A 1 118 ? 40.458 12.151 11.120  1.00 15.00 ? 118 GLU A CD  1 
ATOM   897  O OE1 . GLU A 1 118 ? 39.512 11.342 11.046  1.00 15.00 ? 118 GLU A OE1 1 
ATOM   898  O OE2 . GLU A 1 118 ? 41.628 11.782 11.280  1.00 15.00 ? 118 GLU A OE2 1 
ATOM   899  N N   . LYS A 1 119 ? 38.387 16.438 14.293  1.00 15.00 ? 119 LYS A N   1 
ATOM   900  C CA  . LYS A 1 119 ? 37.518 16.741 15.437  1.00 15.00 ? 119 LYS A CA  1 
ATOM   901  C C   . LYS A 1 119 ? 36.481 17.736 15.006  1.00 15.00 ? 119 LYS A C   1 
ATOM   902  O O   . LYS A 1 119 ? 35.337 17.691 15.437  1.00 15.00 ? 119 LYS A O   1 
ATOM   903  C CB  . LYS A 1 119 ? 38.309 17.379 16.570  1.00 15.00 ? 119 LYS A CB  1 
ATOM   904  C CG  . LYS A 1 119 ? 39.534 16.635 16.947  1.00 15.00 ? 119 LYS A CG  1 
ATOM   905  C CD  . LYS A 1 119 ? 40.367 17.455 17.907  1.00 15.00 ? 119 LYS A CD  1 
ATOM   906  C CE  . LYS A 1 119 ? 40.796 18.808 17.303  1.00 15.00 ? 119 LYS A CE  1 
ATOM   907  N NZ  . LYS A 1 119 ? 41.734 18.671 16.163  1.00 15.00 ? 119 LYS A NZ  1 
ATOM   908  N N   . ALA A 1 120 ? 36.939 18.663 14.173  1.00 15.00 ? 120 ALA A N   1 
ATOM   909  C CA  . ALA A 1 120 ? 36.130 19.738 13.605  1.00 15.00 ? 120 ALA A CA  1 
ATOM   910  C C   . ALA A 1 120 ? 35.054 19.173 12.702  1.00 15.00 ? 120 ALA A C   1 
ATOM   911  O O   . ALA A 1 120 ? 33.924 19.672 12.677  1.00 15.00 ? 120 ALA A O   1 
ATOM   912  C CB  . ALA A 1 120 ? 37.013 20.701 12.815  1.00 15.00 ? 120 ALA A CB  1 
ATOM   913  N N   . LEU A 1 121 ? 35.458 18.205 11.881  1.00 15.00 ? 121 LEU A N   1 
ATOM   914  C CA  . LEU A 1 121 ? 34.558 17.525 10.959  1.00 15.00 ? 121 LEU A CA  1 
ATOM   915  C C   . LEU A 1 121 ? 33.493 16.781 11.773  1.00 15.00 ? 121 LEU A C   1 
ATOM   916  O O   . LEU A 1 121 ? 32.315 16.736 11.393  1.00 15.00 ? 121 LEU A O   1 
ATOM   917  C CB  . LEU A 1 121 ? 35.355 16.550 10.079  1.00 15.00 ? 121 LEU A CB  1 
ATOM   918  C CG  . LEU A 1 121 ? 34.667 15.624 9.068   1.00 15.00 ? 121 LEU A CG  1 
ATOM   919  C CD1 . LEU A 1 121 ? 33.783 16.470 8.132   1.00 15.00 ? 121 LEU A CD1 1 
ATOM   920  C CD2 . LEU A 1 121 ? 35.742 14.784 8.299   1.00 15.00 ? 121 LEU A CD2 1 
ATOM   921  N N   . LYS A 1 122 ? 33.922 16.216 12.903  1.00 15.00 ? 122 LYS A N   1 
ATOM   922  C CA  . LYS A 1 122 ? 33.043 15.471 13.807  1.00 15.00 ? 122 LYS A CA  1 
ATOM   923  C C   . LYS A 1 122 ? 31.981 16.380 14.373  1.00 15.00 ? 122 LYS A C   1 
ATOM   924  O O   . LYS A 1 122 ? 30.814 16.017 14.375  1.00 15.00 ? 122 LYS A O   1 
ATOM   925  C CB  . LYS A 1 122 ? 33.827 14.858 14.974  1.00 15.00 ? 122 LYS A CB  1 
ATOM   926  C CG  . LYS A 1 122 ? 32.928 14.223 16.054  1.00 15.00 ? 122 LYS A CG  1 
ATOM   927  C CD  . LYS A 1 122 ? 33.700 13.685 17.289  1.00 15.00 ? 122 LYS A CD  1 
ATOM   928  C CE  . LYS A 1 122 ? 32.744 13.053 18.314  1.00 15.00 ? 122 LYS A CE  1 
ATOM   929  N NZ  . LYS A 1 122 ? 33.354 12.762 19.660  1.00 15.00 ? 122 LYS A NZ  1 
ATOM   930  N N   . ARG A 1 123 ? 32.407 17.534 14.897  1.00 15.00 ? 123 ARG A N   1 
ATOM   931  C CA  . ARG A 1 123 ? 31.479 18.492 15.474  1.00 15.00 ? 123 ARG A CA  1 
ATOM   932  C C   . ARG A 1 123 ? 30.549 18.940 14.376  1.00 15.00 ? 123 ARG A C   1 
ATOM   933  O O   . ARG A 1 123 ? 29.369 19.127 14.623  1.00 15.00 ? 123 ARG A O   1 
ATOM   934  C CB  . ARG A 1 123 ? 32.167 19.730 16.031  1.00 15.00 ? 123 ARG A CB  1 
ATOM   935  C CG  . ARG A 1 123 ? 33.468 19.475 16.701  1.00 15.00 ? 123 ARG A CG  1 
ATOM   936  C CD  . ARG A 1 123 ? 33.342 19.530 18.210  1.00 15.00 ? 123 ARG A CD  1 
ATOM   937  N NE  . ARG A 1 123 ? 33.207 18.203 18.817  1.00 15.00 ? 123 ARG A NE  1 
ATOM   938  C CZ  . ARG A 1 123 ? 34.143 17.244 18.793  1.00 15.00 ? 123 ARG A CZ  1 
ATOM   939  N NH1 . ARG A 1 123 ? 35.312 17.434 18.176  1.00 15.00 ? 123 ARG A NH1 1 
ATOM   940  N NH2 . ARG A 1 123 ? 33.917 16.088 19.422  1.00 15.00 ? 123 ARG A NH2 1 
ATOM   941  N N   . ALA A 1 124 ? 31.071 19.109 13.167  1.00 15.00 ? 124 ALA A N   1 
ATOM   942  C CA  . ALA A 1 124 ? 30.240 19.552 12.054  1.00 15.00 ? 124 ALA A CA  1 
ATOM   943  C C   . ALA A 1 124 ? 29.160 18.515 11.755  1.00 15.00 ? 124 ALA A C   1 
ATOM   944  O O   . ALA A 1 124 ? 27.988 18.849 11.680  1.00 15.00 ? 124 ALA A O   1 
ATOM   945  C CB  . ALA A 1 124 ? 31.095 19.814 10.828  1.00 15.00 ? 124 ALA A CB  1 
ATOM   946  N N   . VAL A 1 125 ? 29.526 17.243 11.663  1.00 15.00 ? 125 VAL A N   1 
ATOM   947  C CA  . VAL A 1 125 ? 28.529 16.209 11.387  1.00 15.00 ? 125 VAL A CA  1 
ATOM   948  C C   . VAL A 1 125 ? 27.541 16.183 12.544  1.00 15.00 ? 125 VAL A C   1 
ATOM   949  O O   . VAL A 1 125 ? 26.335 16.212 12.340  1.00 15.00 ? 125 VAL A O   1 
ATOM   950  C CB  . VAL A 1 125 ? 29.177 14.784 11.243  1.00 15.00 ? 125 VAL A CB  1 
ATOM   951  C CG1 . VAL A 1 125 ? 28.114 13.712 11.035  1.00 15.00 ? 125 VAL A CG1 1 
ATOM   952  C CG2 . VAL A 1 125 ? 30.156 14.752 10.121  1.00 15.00 ? 125 VAL A CG2 1 
ATOM   953  N N   . ALA A 1 126 ? 28.076 16.130 13.761  1.00 15.00 ? 126 ALA A N   1 
ATOM   954  C CA  . ALA A 1 126 ? 27.266 16.057 14.980  1.00 15.00 ? 126 ALA A CA  1 
ATOM   955  C C   . ALA A 1 126 ? 26.244 17.170 15.182  1.00 15.00 ? 126 ALA A C   1 
ATOM   956  O O   . ALA A 1 126 ? 25.121 16.914 15.634  1.00 15.00 ? 126 ALA A O   1 
ATOM   957  C CB  . ALA A 1 126 ? 28.158 15.951 16.206  1.00 15.00 ? 126 ALA A CB  1 
ATOM   958  N N   . ARG A 1 127 ? 26.621 18.399 14.827  1.00 15.00 ? 127 ARG A N   1 
ATOM   959  C CA  . ARG A 1 127 ? 25.737 19.545 14.994  1.00 15.00 ? 127 ARG A CA  1 
ATOM   960  C C   . ARG A 1 127 ? 24.941 19.928 13.743  1.00 15.00 ? 127 ARG A C   1 
ATOM   961  O O   . ARG A 1 127 ? 23.855 20.506 13.860  1.00 15.00 ? 127 ARG A O   1 
ATOM   962  C CB  . ARG A 1 127 ? 26.513 20.797 15.458  1.00 15.00 ? 127 ARG A CB  1 
ATOM   963  C CG  . ARG A 1 127 ? 27.782 20.607 16.336  1.00 15.00 ? 127 ARG A CG  1 
ATOM   964  C CD  . ARG A 1 127 ? 27.589 19.899 17.696  1.00 15.00 ? 127 ARG A CD  1 
ATOM   965  N NE  . ARG A 1 127 ? 28.864 19.366 18.219  1.00 15.00 ? 127 ARG A NE  1 
ATOM   966  C CZ  . ARG A 1 127 ? 29.565 19.897 19.224  1.00 15.00 ? 127 ARG A CZ  1 
ATOM   967  N NH1 . ARG A 1 127 ? 29.120 20.977 19.866  1.00 15.00 ? 127 ARG A NH1 1 
ATOM   968  N NH2 . ARG A 1 127 ? 30.710 19.334 19.610  1.00 15.00 ? 127 ARG A NH2 1 
ATOM   969  N N   . VAL A 1 128 ? 25.469 19.595 12.565  1.00 15.00 ? 128 VAL A N   1 
ATOM   970  C CA  . VAL A 1 128 ? 24.847 19.937 11.285  1.00 15.00 ? 128 VAL A CA  1 
ATOM   971  C C   . VAL A 1 128 ? 24.100 18.792 10.563  1.00 15.00 ? 128 VAL A C   1 
ATOM   972  O O   . VAL A 1 128 ? 22.949 18.947 10.160  1.00 15.00 ? 128 VAL A O   1 
ATOM   973  C CB  . VAL A 1 128 ? 25.922 20.492 10.309  1.00 15.00 ? 128 VAL A CB  1 
ATOM   974  C CG1 . VAL A 1 128 ? 25.357 20.732 8.886   1.00 15.00 ? 128 VAL A CG1 1 
ATOM   975  C CG2 . VAL A 1 128 ? 26.487 21.797 10.852  1.00 15.00 ? 128 VAL A CG2 1 
ATOM   976  N N   . GLY A 1 129 ? 24.733 17.637 10.426  1.00 15.00 ? 129 GLY A N   1 
ATOM   977  C CA  . GLY A 1 129 ? 24.123 16.537 9.709   1.00 15.00 ? 129 GLY A CA  1 
ATOM   978  C C   . GLY A 1 129 ? 25.168 16.069 8.699   1.00 15.00 ? 129 GLY A C   1 
ATOM   979  O O   . GLY A 1 129 ? 26.370 16.332 8.888   1.00 15.00 ? 129 GLY A O   1 
ATOM   980  N N   . PRO A 1 130 ? 24.757 15.411 7.595   1.00 15.00 ? 130 PRO A N   1 
ATOM   981  C CA  . PRO A 1 130 ? 25.673 14.917 6.553   1.00 15.00 ? 130 PRO A CA  1 
ATOM   982  C C   . PRO A 1 130 ? 26.663 15.974 6.024   1.00 15.00 ? 130 PRO A C   1 
ATOM   983  O O   . PRO A 1 130 ? 26.260 17.097 5.836   1.00 15.00 ? 130 PRO A O   1 
ATOM   984  C CB  . PRO A 1 130 ? 24.702 14.457 5.474   1.00 15.00 ? 130 PRO A CB  1 
ATOM   985  C CG  . PRO A 1 130 ? 23.551 13.857 6.288   1.00 15.00 ? 130 PRO A CG  1 
ATOM   986  C CD  . PRO A 1 130 ? 23.375 14.918 7.366   1.00 15.00 ? 130 PRO A CD  1 
ATOM   987  N N   . VAL A 1 131 ? 27.938 15.629 5.797   1.00 15.00 ? 131 VAL A N   1 
ATOM   988  C CA  . VAL A 1 131 ? 28.923 16.608 5.314   1.00 15.00 ? 131 VAL A CA  1 
ATOM   989  C C   . VAL A 1 131 ? 29.629 16.189 4.013   1.00 15.00 ? 131 VAL A C   1 
ATOM   990  O O   . VAL A 1 131 ? 30.040 15.054 3.882   1.00 15.00 ? 131 VAL A O   1 
ATOM   991  C CB  . VAL A 1 131 ? 29.995 16.925 6.395   1.00 15.00 ? 131 VAL A CB  1 
ATOM   992  C CG1 . VAL A 1 131 ? 31.041 17.895 5.839   1.00 15.00 ? 131 VAL A CG1 1 
ATOM   993  C CG2 . VAL A 1 131 ? 29.342 17.530 7.614   1.00 15.00 ? 131 VAL A CG2 1 
ATOM   994  N N   . SER A 1 132 ? 29.745 17.095 3.045   1.00 15.00 ? 132 SER A N   1 
ATOM   995  C CA  . SER A 1 132 ? 30.415 16.772 1.783   1.00 15.00 ? 132 SER A CA  1 
ATOM   996  C C   . SER A 1 132 ? 31.932 16.665 2.008   1.00 15.00 ? 132 SER A C   1 
ATOM   997  O O   . SER A 1 132 ? 32.549 17.598 2.543   1.00 15.00 ? 132 SER A O   1 
ATOM   998  C CB  . SER A 1 132 ? 30.175 17.860 0.728   1.00 15.00 ? 132 SER A CB  1 
ATOM   999  O OG  . SER A 1 132 ? 28.816 17.991 0.379   1.00 15.00 ? 132 SER A OG  1 
ATOM   1000 N N   . VAL A 1 133 ? 32.520 15.525 1.643   1.00 15.00 ? 133 VAL A N   1 
ATOM   1001 C CA  . VAL A 1 133 ? 33.972 15.319 1.774   1.00 15.00 ? 133 VAL A CA  1 
ATOM   1002 C C   . VAL A 1 133 ? 34.601 14.823 0.458   1.00 15.00 ? 133 VAL A C   1 
ATOM   1003 O O   . VAL A 1 133 ? 33.905 14.338 -0.432  1.00 15.00 ? 133 VAL A O   1 
ATOM   1004 C CB  . VAL A 1 133 ? 34.337 14.358 2.978   1.00 15.00 ? 133 VAL A CB  1 
ATOM   1005 C CG1 . VAL A 1 133 ? 33.725 14.896 4.293   1.00 15.00 ? 133 VAL A CG1 1 
ATOM   1006 C CG2 . VAL A 1 133 ? 33.878 12.903 2.709   1.00 15.00 ? 133 VAL A CG2 1 
ATOM   1007 N N   . ALA A 1 134 ? 35.925 14.885 0.377   1.00 15.00 ? 134 ALA A N   1 
ATOM   1008 C CA  . ALA A 1 134 ? 36.689 14.447 -0.794  1.00 15.00 ? 134 ALA A CA  1 
ATOM   1009 C C   . ALA A 1 134 ? 37.815 13.591 -0.253  1.00 15.00 ? 134 ALA A C   1 
ATOM   1010 O O   . ALA A 1 134 ? 38.505 13.976 0.694   1.00 15.00 ? 134 ALA A O   1 
ATOM   1011 C CB  . ALA A 1 134 ? 37.243 15.657 -1.584  1.00 15.00 ? 134 ALA A CB  1 
ATOM   1012 N N   . ILE A 1 135 ? 38.020 12.449 -0.888  1.00 15.00 ? 135 ILE A N   1 
ATOM   1013 C CA  . ILE A 1 135 ? 39.023 11.486 -0.462  1.00 15.00 ? 135 ILE A CA  1 
ATOM   1014 C C   . ILE A 1 135 ? 39.833 10.931 -1.628  1.00 15.00 ? 135 ILE A C   1 
ATOM   1015 O O   . ILE A 1 135 ? 39.672 11.366 -2.764  1.00 15.00 ? 135 ILE A O   1 
ATOM   1016 C CB  . ILE A 1 135 ? 38.328 10.266 0.214   1.00 15.00 ? 135 ILE A CB  1 
ATOM   1017 C CG1 . ILE A 1 135 ? 37.225 9.724  -0.724  1.00 15.00 ? 135 ILE A CG1 1 
ATOM   1018 C CG2 . ILE A 1 135 ? 37.789 10.639 1.613   1.00 15.00 ? 135 ILE A CG2 1 
ATOM   1019 C CD1 . ILE A 1 135 ? 36.792 8.294  -0.478  1.00 15.00 ? 135 ILE A CD1 1 
ATOM   1020 N N   . ASP A 1 136 ? 40.775 10.055 -1.298  1.00 15.00 ? 136 ASP A N   1 
ATOM   1021 C CA  . ASP A 1 136 ? 41.589 9.358  -2.274  1.00 15.00 ? 136 ASP A CA  1 
ATOM   1022 C C   . ASP A 1 136 ? 40.815 8.027  -2.344  1.00 15.00 ? 136 ASP A C   1 
ATOM   1023 O O   . ASP A 1 136 ? 40.785 7.297  -1.367  1.00 15.00 ? 136 ASP A O   1 
ATOM   1024 C CB  . ASP A 1 136 ? 43.012 9.139  -1.714  1.00 15.00 ? 136 ASP A CB  1 
ATOM   1025 C CG  . ASP A 1 136 ? 43.892 8.314  -2.641  1.00 15.00 ? 136 ASP A CG  1 
ATOM   1026 O OD1 . ASP A 1 136 ? 43.461 7.857  -3.695  1.00 15.00 ? 136 ASP A OD1 1 
ATOM   1027 O OD2 . ASP A 1 136 ? 45.058 8.165  -2.334  1.00 15.00 ? 136 ASP A OD2 1 
ATOM   1028 N N   . ALA A 1 137 ? 40.186 7.743  -3.484  1.00 15.00 ? 137 ALA A N   1 
ATOM   1029 C CA  . ALA A 1 137 ? 39.435 6.519  -3.678  1.00 15.00 ? 137 ALA A CA  1 
ATOM   1030 C C   . ALA A 1 137 ? 40.023 5.669  -4.820  1.00 15.00 ? 137 ALA A C   1 
ATOM   1031 O O   . ALA A 1 137 ? 39.357 4.769  -5.341  1.00 15.00 ? 137 ALA A O   1 
ATOM   1032 C CB  . ALA A 1 137 ? 37.984 6.845  -3.967  1.00 15.00 ? 137 ALA A CB  1 
ATOM   1033 N N   . SER A 1 138 ? 41.283 5.923  -5.143  1.00 15.00 ? 138 SER A N   1 
ATOM   1034 C CA  . SER A 1 138 ? 41.980 5.225  -6.209  1.00 15.00 ? 138 SER A CA  1 
ATOM   1035 C C   . SER A 1 138 ? 42.538 3.830  -5.878  1.00 15.00 ? 138 SER A C   1 
ATOM   1036 O O   . SER A 1 138 ? 42.739 3.002  -6.746  1.00 15.00 ? 138 SER A O   1 
ATOM   1037 C CB  . SER A 1 138 ? 43.111 6.102  -6.755  1.00 15.00 ? 138 SER A CB  1 
ATOM   1038 O OG  . SER A 1 138 ? 43.941 6.618  -5.727  1.00 15.00 ? 138 SER A OG  1 
ATOM   1039 N N   . LEU A 1 139 ? 42.803 3.580  -4.612  1.00 15.00 ? 139 LEU A N   1 
ATOM   1040 C CA  . LEU A 1 139 ? 43.339 2.298  -4.191  1.00 15.00 ? 139 LEU A CA  1 
ATOM   1041 C C   . LEU A 1 139 ? 42.359 1.148  -4.362  1.00 15.00 ? 139 LEU A C   1 
ATOM   1042 O O   . LEU A 1 139 ? 41.175 1.226  -4.029  1.00 15.00 ? 139 LEU A O   1 
ATOM   1043 C CB  . LEU A 1 139 ? 43.838 2.357  -2.748  1.00 15.00 ? 139 LEU A CB  1 
ATOM   1044 C CG  . LEU A 1 139 ? 45.325 2.596  -2.413  1.00 15.00 ? 139 LEU A CG  1 
ATOM   1045 C CD1 . LEU A 1 139 ? 45.933 3.659  -3.311  1.00 15.00 ? 139 LEU A CD1 1 
ATOM   1046 C CD2 . LEU A 1 139 ? 45.443 3.047  -0.959  1.00 15.00 ? 139 LEU A CD2 1 
ATOM   1047 N N   . THR A 1 140 ? 42.888 0.058  -4.880  1.00 15.00 ? 140 THR A N   1 
ATOM   1048 C CA  . THR A 1 140 ? 42.160 -1.194 -5.136  1.00 15.00 ? 140 THR A CA  1 
ATOM   1049 C C   . THR A 1 140 ? 41.480 -1.756 -3.921  1.00 15.00 ? 140 THR A C   1 
ATOM   1050 O O   . THR A 1 140 ? 40.443 -2.410 -4.003  1.00 15.00 ? 140 THR A O   1 
ATOM   1051 C CB  . THR A 1 140 ? 43.128 -2.253 -5.632  1.00 15.00 ? 140 THR A CB  1 
ATOM   1052 O OG1 . THR A 1 140 ? 43.554 -1.853 -6.930  1.00 15.00 ? 140 THR A OG1 1 
ATOM   1053 C CG2 . THR A 1 140 ? 42.455 -3.634 -5.695  1.00 15.00 ? 140 THR A CG2 1 
ATOM   1054 N N   . SER A 1 141 ? 42.143 -1.606 -2.792  1.00 15.00 ? 141 SER A N   1 
ATOM   1055 C CA  . SER A 1 141 ? 41.607 -2.094 -1.537  1.00 15.00 ? 141 SER A CA  1 
ATOM   1056 C C   . SER A 1 141 ? 40.388 -1.291 -1.212  1.00 15.00 ? 141 SER A C   1 
ATOM   1057 O O   . SER A 1 141 ? 39.449 -1.828 -0.634  1.00 15.00 ? 141 SER A O   1 
ATOM   1058 C CB  . SER A 1 141 ? 42.628 -1.937 -0.417  1.00 15.00 ? 141 SER A CB  1 
ATOM   1059 O OG  . SER A 1 141 ? 43.226 -0.674 -0.538  1.00 15.00 ? 141 SER A OG  1 
ATOM   1060 N N   . PHE A 1 142 ? 40.340 -0.027 -1.635  1.00 15.00 ? 142 PHE A N   1 
ATOM   1061 C CA  . PHE A 1 142 ? 39.152 0.773  -1.343  1.00 15.00 ? 142 PHE A CA  1 
ATOM   1062 C C   . PHE A 1 142 ? 38.064 0.282  -2.294  1.00 15.00 ? 142 PHE A C   1 
ATOM   1063 O O   . PHE A 1 142 ? 36.980 0.024  -1.865  1.00 15.00 ? 142 PHE A O   1 
ATOM   1064 C CB  . PHE A 1 142 ? 39.444 2.306  -1.479  1.00 15.00 ? 142 PHE A CB  1 
ATOM   1065 C CG  . PHE A 1 142 ? 38.221 3.228  -1.324  1.00 15.00 ? 142 PHE A CG  1 
ATOM   1066 C CD1 . PHE A 1 142 ? 37.382 3.421  -2.354  1.00 15.00 ? 142 PHE A CD1 1 
ATOM   1067 C CD2 . PHE A 1 142 ? 37.844 3.789  -0.147  1.00 15.00 ? 142 PHE A CD2 1 
ATOM   1068 C CE1 . PHE A 1 142 ? 36.206 4.113  -2.212  1.00 15.00 ? 142 PHE A CE1 1 
ATOM   1069 C CE2 . PHE A 1 142 ? 36.654 4.471  -0.083  1.00 15.00 ? 142 PHE A CE2 1 
ATOM   1070 C CZ  . PHE A 1 142 ? 35.871 4.608  -1.109  1.00 15.00 ? 142 PHE A CZ  1 
ATOM   1071 N N   . GLN A 1 143 ? 38.367 0.089  -3.567  1.00 15.00 ? 143 GLN A N   1 
ATOM   1072 C CA  . GLN A 1 143 ? 37.345 -0.312 -4.532  1.00 15.00 ? 143 GLN A CA  1 
ATOM   1073 C C   . GLN A 1 143 ? 36.804 -1.720 -4.317  1.00 15.00 ? 143 GLN A C   1 
ATOM   1074 O O   . GLN A 1 143 ? 35.704 -2.022 -4.749  1.00 15.00 ? 143 GLN A O   1 
ATOM   1075 C CB  . GLN A 1 143 ? 37.887 -0.089 -5.947  1.00 15.00 ? 143 GLN A CB  1 
ATOM   1076 C CG  . GLN A 1 143 ? 38.544 1.249  -6.124  1.00 15.00 ? 143 GLN A CG  1 
ATOM   1077 C CD  . GLN A 1 143 ? 38.651 1.688  -7.577  1.00 15.00 ? 143 GLN A CD  1 
ATOM   1078 O OE1 . GLN A 1 143 ? 38.247 0.957  -8.487  1.00 15.00 ? 143 GLN A OE1 1 
ATOM   1079 N NE2 . GLN A 1 143 ? 39.162 2.897  -7.802  1.00 15.00 ? 143 GLN A NE2 1 
ATOM   1080 N N   . PHE A 1 144 ? 37.568 -2.577 -3.641  1.00 15.00 ? 144 PHE A N   1 
ATOM   1081 C CA  . PHE A 1 144 ? 37.090 -3.946 -3.374  1.00 15.00 ? 144 PHE A CA  1 
ATOM   1082 C C   . PHE A 1 144 ? 36.570 -4.086 -1.920  1.00 15.00 ? 144 PHE A C   1 
ATOM   1083 O O   . PHE A 1 144 ? 36.381 -5.189 -1.405  1.00 15.00 ? 144 PHE A O   1 
ATOM   1084 C CB  . PHE A 1 144 ? 38.166 -5.020 -3.641  1.00 15.00 ? 144 PHE A CB  1 
ATOM   1085 C CG  . PHE A 1 144 ? 38.350 -5.383 -5.087  1.00 15.00 ? 144 PHE A CG  1 
ATOM   1086 C CD1 . PHE A 1 144 ? 37.325 -5.981 -5.787  1.00 15.00 ? 144 PHE A CD1 1 
ATOM   1087 C CD2 . PHE A 1 144 ? 39.540 -5.105 -5.745  1.00 15.00 ? 144 PHE A CD2 1 
ATOM   1088 C CE1 . PHE A 1 144 ? 37.462 -6.298 -7.119  1.00 15.00 ? 144 PHE A CE1 1 
ATOM   1089 C CE2 . PHE A 1 144 ? 39.698 -5.415 -7.080  1.00 15.00 ? 144 PHE A CE2 1 
ATOM   1090 C CZ  . PHE A 1 144 ? 38.647 -6.017 -7.769  1.00 15.00 ? 144 PHE A CZ  1 
ATOM   1091 N N   . TYR A 1 145 ? 36.367 -2.960 -1.248  1.00 15.00 ? 145 TYR A N   1 
ATOM   1092 C CA  . TYR A 1 145 ? 35.893 -3.001 0.134   1.00 15.00 ? 145 TYR A CA  1 
ATOM   1093 C C   . TYR A 1 145 ? 34.550 -3.742 0.235   1.00 15.00 ? 145 TYR A C   1 
ATOM   1094 O O   . TYR A 1 145 ? 33.702 -3.625 -0.638  1.00 15.00 ? 145 TYR A O   1 
ATOM   1095 C CB  . TYR A 1 145 ? 35.789 -1.586 0.712   1.00 15.00 ? 145 TYR A CB  1 
ATOM   1096 C CG  . TYR A 1 145 ? 34.976 -1.482 2.006   1.00 15.00 ? 145 TYR A CG  1 
ATOM   1097 C CD1 . TYR A 1 145 ? 33.536 -1.675 1.968   1.00 15.00 ? 145 TYR A CD1 1 
ATOM   1098 C CD2 . TYR A 1 145 ? 35.632 -1.241 3.263   1.00 15.00 ? 145 TYR A CD2 1 
ATOM   1099 C CE1 . TYR A 1 145 ? 32.764 -1.647 3.129   1.00 15.00 ? 145 TYR A CE1 1 
ATOM   1100 C CE2 . TYR A 1 145 ? 34.903 -1.205 4.433   1.00 15.00 ? 145 TYR A CE2 1 
ATOM   1101 C CZ  . TYR A 1 145 ? 33.462 -1.413 4.384   1.00 15.00 ? 145 TYR A CZ  1 
ATOM   1102 O OH  . TYR A 1 145 ? 32.813 -1.416 5.620   1.00 15.00 ? 145 TYR A OH  1 
ATOM   1103 N N   . SER A 1 146 ? 34.320 -4.456 1.330   1.00 15.00 ? 146 SER A N   1 
ATOM   1104 C CA  . SER A 1 146 ? 33.030 -5.138 1.552   1.00 15.00 ? 146 SER A CA  1 
ATOM   1105 C C   . SER A 1 146 ? 32.624 -5.057 3.043   1.00 15.00 ? 146 SER A C   1 
ATOM   1106 O O   . SER A 1 146 ? 31.439 -4.897 3.386   1.00 15.00 ? 146 SER A O   1 
ATOM   1107 C CB  . SER A 1 146 ? 33.061 -6.590 1.050   1.00 15.00 ? 146 SER A CB  1 
ATOM   1108 O OG  . SER A 1 146 ? 34.168 -7.304 1.561   1.00 15.00 ? 146 SER A OG  1 
ATOM   1109 N N   . LYS A 1 147 ? 33.623 -5.034 3.926   1.00 15.00 ? 147 LYS A N   1 
ATOM   1110 C CA  . LYS A 1 147 ? 33.333 -4.992 5.350   1.00 15.00 ? 147 LYS A CA  1 
ATOM   1111 C C   . LYS A 1 147 ? 34.524 -4.451 6.125   1.00 15.00 ? 147 LYS A C   1 
ATOM   1112 O O   . LYS A 1 147 ? 35.615 -4.286 5.572   1.00 15.00 ? 147 LYS A O   1 
ATOM   1113 C CB  . LYS A 1 147 ? 32.962 -6.399 5.882   1.00 15.00 ? 147 LYS A CB  1 
ATOM   1114 C CG  . LYS A 1 147 ? 34.180 -7.285 6.165   1.00 15.00 ? 147 LYS A CG  1 
ATOM   1115 C CD  . LYS A 1 147 ? 33.899 -8.434 7.209   1.00 15.00 ? 147 LYS A CD  1 
ATOM   1116 C CE  . LYS A 1 147 ? 35.207 -8.798 7.997   1.00 15.00 ? 147 LYS A CE  1 
ATOM   1117 N NZ  . LYS A 1 147 ? 35.773 -7.637 8.824   1.00 15.00 ? 147 LYS A NZ  1 
ATOM   1118 N N   . GLY A 1 148 ? 34.281 -4.084 7.379   1.00 15.00 ? 148 GLY A N   1 
ATOM   1119 C CA  . GLY A 1 148 ? 35.350 -3.545 8.207   1.00 15.00 ? 148 GLY A CA  1 
ATOM   1120 C C   . GLY A 1 148 ? 35.500 -2.027 8.185   1.00 15.00 ? 148 GLY A C   1 
ATOM   1121 O O   . GLY A 1 148 ? 34.710 -1.330 7.538   1.00 15.00 ? 148 GLY A O   1 
ATOM   1122 N N   . VAL A 1 149 ? 36.447 -1.514 8.971   1.00 15.00 ? 149 VAL A N   1 
ATOM   1123 C CA  . VAL A 1 149 ? 36.733 -0.074 9.015   1.00 15.00 ? 149 VAL A CA  1 
ATOM   1124 C C   . VAL A 1 149 ? 37.955 0.095  8.100   1.00 15.00 ? 149 VAL A C   1 
ATOM   1125 O O   . VAL A 1 149 ? 39.102 -0.185 8.505   1.00 15.00 ? 149 VAL A O   1 
ATOM   1126 C CB  . VAL A 1 149 ? 37.058 0.454  10.471  1.00 15.00 ? 149 VAL A CB  1 
ATOM   1127 C CG1 . VAL A 1 149 ? 37.460 1.948  10.436  1.00 15.00 ? 149 VAL A CG1 1 
ATOM   1128 C CG2 . VAL A 1 149 ? 35.860 0.273  11.402  1.00 15.00 ? 149 VAL A CG2 1 
ATOM   1129 N N   . TYR A 1 150 ? 37.709 0.481  6.849   1.00 15.00 ? 150 TYR A N   1 
ATOM   1130 C CA  . TYR A 1 150 ? 38.774 0.646  5.874   1.00 15.00 ? 150 TYR A CA  1 
ATOM   1131 C C   . TYR A 1 150 ? 39.969 1.462  6.354   1.00 15.00 ? 150 TYR A C   1 
ATOM   1132 O O   . TYR A 1 150 ? 39.812 2.426  7.075   1.00 15.00 ? 150 TYR A O   1 
ATOM   1133 C CB  . TYR A 1 150 ? 38.210 1.226  4.564   1.00 15.00 ? 150 TYR A CB  1 
ATOM   1134 C CG  . TYR A 1 150 ? 39.249 1.492  3.519   1.00 15.00 ? 150 TYR A CG  1 
ATOM   1135 C CD1 . TYR A 1 150 ? 39.867 0.409  2.842   1.00 15.00 ? 150 TYR A CD1 1 
ATOM   1136 C CD2 . TYR A 1 150 ? 39.695 2.818  3.283   1.00 15.00 ? 150 TYR A CD2 1 
ATOM   1137 C CE1 . TYR A 1 150 ? 40.886 0.607  1.990   1.00 15.00 ? 150 TYR A CE1 1 
ATOM   1138 C CE2 . TYR A 1 150 ? 40.749 3.054  2.410   1.00 15.00 ? 150 TYR A CE2 1 
ATOM   1139 C CZ  . TYR A 1 150 ? 41.351 1.930  1.766   1.00 15.00 ? 150 TYR A CZ  1 
ATOM   1140 O OH  . TYR A 1 150 ? 42.462 2.094  0.942   1.00 15.00 ? 150 TYR A OH  1 
ATOM   1141 N N   . TYR A 1 151 ? 41.165 0.993  6.004   1.00 15.00 ? 151 TYR A N   1 
ATOM   1142 C CA  . TYR A 1 151 ? 42.443 1.656  6.291   1.00 15.00 ? 151 TYR A CA  1 
ATOM   1143 C C   . TYR A 1 151 ? 43.620 1.055  5.480   1.00 15.00 ? 151 TYR A C   1 
ATOM   1144 O O   . TYR A 1 151 ? 43.758 -0.178 5.353   1.00 15.00 ? 151 TYR A O   1 
ATOM   1145 C CB  . TYR A 1 151 ? 42.749 1.689  7.806   1.00 15.00 ? 151 TYR A CB  1 
ATOM   1146 C CG  . TYR A 1 151 ? 44.076 2.282  8.145   1.00 15.00 ? 151 TYR A CG  1 
ATOM   1147 C CD1 . TYR A 1 151 ? 44.240 3.646  8.219   1.00 15.00 ? 151 TYR A CD1 1 
ATOM   1148 C CD2 . TYR A 1 151 ? 45.200 1.478  8.269   1.00 15.00 ? 151 TYR A CD2 1 
ATOM   1149 C CE1 . TYR A 1 151 ? 45.514 4.211  8.391   1.00 15.00 ? 151 TYR A CE1 1 
ATOM   1150 C CE2 . TYR A 1 151 ? 46.470 2.023  8.440   1.00 15.00 ? 151 TYR A CE2 1 
ATOM   1151 C CZ  . TYR A 1 151 ? 46.629 3.397  8.494   1.00 15.00 ? 151 TYR A CZ  1 
ATOM   1152 O OH  . TYR A 1 151 ? 47.899 3.956  8.586   1.00 15.00 ? 151 TYR A OH  1 
ATOM   1153 N N   . ASP A 1 152 ? 44.458 1.930  4.924   1.00 15.00 ? 152 ASP A N   1 
ATOM   1154 C CA  . ASP A 1 152 ? 45.589 1.494  4.116   1.00 15.00 ? 152 ASP A CA  1 
ATOM   1155 C C   . ASP A 1 152 ? 46.632 2.586  4.201   1.00 15.00 ? 152 ASP A C   1 
ATOM   1156 O O   . ASP A 1 152 ? 46.289 3.765  4.071   1.00 15.00 ? 152 ASP A O   1 
ATOM   1157 C CB  . ASP A 1 152 ? 45.142 1.372  2.662   1.00 15.00 ? 152 ASP A CB  1 
ATOM   1158 C CG  . ASP A 1 152 ? 46.084 0.581  1.835   1.00 15.00 ? 152 ASP A CG  1 
ATOM   1159 O OD1 . ASP A 1 152 ? 47.285 0.534  2.161   1.00 15.00 ? 152 ASP A OD1 1 
ATOM   1160 O OD2 . ASP A 1 152 ? 45.612 -0.026 0.855   1.00 15.00 ? 152 ASP A OD2 1 
ATOM   1161 N N   . GLU A 1 153 ? 47.896 2.198  4.388   1.00 15.00 ? 153 GLU A N   1 
ATOM   1162 C CA  . GLU A 1 153 ? 49.018 3.150  4.489   1.00 15.00 ? 153 GLU A CA  1 
ATOM   1163 C C   . GLU A 1 153 ? 49.295 3.850  3.167   1.00 15.00 ? 153 GLU A C   1 
ATOM   1164 O O   . GLU A 1 153 ? 50.002 4.848  3.140   1.00 15.00 ? 153 GLU A O   1 
ATOM   1165 C CB  . GLU A 1 153 ? 50.329 2.462  4.916   1.00 15.00 ? 153 GLU A CB  1 
ATOM   1166 C CG  . GLU A 1 153 ? 50.632 1.082  4.228   1.00 15.00 ? 153 GLU A CG  1 
ATOM   1167 C CD  . GLU A 1 153 ? 50.979 1.140  2.714   1.00 15.00 ? 153 GLU A CD  1 
ATOM   1168 O OE1 . GLU A 1 153 ? 52.057 1.674  2.352   1.00 15.00 ? 153 GLU A OE1 1 
ATOM   1169 O OE2 . GLU A 1 153 ? 50.192 0.601  1.890   1.00 15.00 ? 153 GLU A OE2 1 
ATOM   1170 N N   . SER A 1 154 ? 48.870 3.242  2.065   1.00 15.00 ? 154 SER A N   1 
ATOM   1171 C CA  . SER A 1 154 ? 49.124 3.849  0.786   1.00 15.00 ? 154 SER A CA  1 
ATOM   1172 C C   . SER A 1 154 ? 48.202 4.992  0.463   1.00 15.00 ? 154 SER A C   1 
ATOM   1173 O O   . SER A 1 154 ? 48.468 5.712  -0.498  1.00 15.00 ? 154 SER A O   1 
ATOM   1174 C CB  . SER A 1 154 ? 49.092 2.817  -0.342  1.00 15.00 ? 154 SER A CB  1 
ATOM   1175 O OG  . SER A 1 154 ? 50.204 1.965  -0.252  1.00 15.00 ? 154 SER A OG  1 
ATOM   1176 N N   . CYS A 1 155 ? 47.121 5.159  1.222   1.00 15.00 ? 155 CYS A N   1 
ATOM   1177 C CA  . CYS A 1 155 ? 46.200 6.235  0.936   1.00 15.00 ? 155 CYS A CA  1 
ATOM   1178 C C   . CYS A 1 155 ? 46.914 7.578  0.990   1.00 15.00 ? 155 CYS A C   1 
ATOM   1179 O O   . CYS A 1 155 ? 47.557 7.873  1.983   1.00 15.00 ? 155 CYS A O   1 
ATOM   1180 C CB  . CYS A 1 155 ? 45.047 6.204  1.901   1.00 15.00 ? 155 CYS A CB  1 
ATOM   1181 S SG  . CYS A 1 155 ? 43.494 6.301  0.970   1.00 15.00 ? 155 CYS A SG  1 
ATOM   1182 N N   . ASN A 1 156 ? 46.702 8.428  -0.018  1.00 15.00 ? 156 ASN A N   1 
ATOM   1183 C CA  . ASN A 1 156 ? 47.377 9.724  -0.143  1.00 15.00 ? 156 ASN A CA  1 
ATOM   1184 C C   . ASN A 1 156 ? 46.448 10.884 0.106   1.00 15.00 ? 156 ASN A C   1 
ATOM   1185 O O   . ASN A 1 156 ? 45.654 11.244 -0.755  1.00 15.00 ? 156 ASN A O   1 
ATOM   1186 C CB  . ASN A 1 156 ? 47.994 9.811  -1.548  1.00 15.00 ? 156 ASN A CB  1 
ATOM   1187 C CG  . ASN A 1 156 ? 48.775 11.108 -1.813  1.00 15.00 ? 156 ASN A CG  1 
ATOM   1188 O OD1 . ASN A 1 156 ? 48.858 12.027 -0.981  1.00 15.00 ? 156 ASN A OD1 1 
ATOM   1189 N ND2 . ASN A 1 156 ? 49.373 11.167 -2.988  1.00 15.00 ? 156 ASN A ND2 1 
ATOM   1190 N N   . SER A 1 157 ? 46.590 11.511 1.267   1.00 15.00 ? 157 SER A N   1 
ATOM   1191 C CA  . SER A 1 157 ? 45.731 12.645 1.582   1.00 15.00 ? 157 SER A CA  1 
ATOM   1192 C C   . SER A 1 157 ? 45.873 13.868 0.648   1.00 15.00 ? 157 SER A C   1 
ATOM   1193 O O   . SER A 1 157 ? 45.153 14.854 0.814   1.00 15.00 ? 157 SER A O   1 
ATOM   1194 C CB  . SER A 1 157 ? 45.816 13.030 3.076   1.00 15.00 ? 157 SER A CB  1 
ATOM   1195 O OG  . SER A 1 157 ? 47.125 13.424 3.467   1.00 15.00 ? 157 SER A OG  1 
ATOM   1196 N N   . ASP A 1 158 ? 46.803 13.840 -0.313  1.00 15.00 ? 158 ASP A N   1 
ATOM   1197 C CA  . ASP A 1 158 ? 46.923 14.956 -1.267  1.00 15.00 ? 158 ASP A CA  1 
ATOM   1198 C C   . ASP A 1 158 ? 46.410 14.520 -2.644  1.00 15.00 ? 158 ASP A C   1 
ATOM   1199 O O   . ASP A 1 158 ? 46.427 15.270 -3.627  1.00 15.00 ? 158 ASP A O   1 
ATOM   1200 C CB  . ASP A 1 158 ? 48.354 15.465 -1.402  1.00 15.00 ? 158 ASP A CB  1 
ATOM   1201 C CG  . ASP A 1 158 ? 49.048 15.682 -0.057  1.00 15.00 ? 158 ASP A CG  1 
ATOM   1202 O OD1 . ASP A 1 158 ? 48.714 16.668 0.669   1.00 15.00 ? 158 ASP A OD1 1 
ATOM   1203 O OD2 . ASP A 1 158 ? 49.945 14.840 0.244   1.00 15.00 ? 158 ASP A OD2 1 
ATOM   1204 N N   . ASN A 1 159 ? 45.978 13.279 -2.721  1.00 15.00 ? 159 ASN A N   1 
ATOM   1205 C CA  . ASN A 1 159 ? 45.422 12.763 -3.953  1.00 15.00 ? 159 ASN A CA  1 
ATOM   1206 C C   . ASN A 1 159 ? 43.949 12.640 -3.622  1.00 15.00 ? 159 ASN A C   1 
ATOM   1207 O O   . ASN A 1 159 ? 43.503 11.653 -3.020  1.00 15.00 ? 159 ASN A O   1 
ATOM   1208 C CB  . ASN A 1 159 ? 45.994 11.389 -4.275  1.00 15.00 ? 159 ASN A CB  1 
ATOM   1209 C CG  . ASN A 1 159 ? 45.748 10.981 -5.710  1.00 15.00 ? 159 ASN A CG  1 
ATOM   1210 O OD1 . ASN A 1 159 ? 44.987 11.628 -6.434  1.00 15.00 ? 159 ASN A OD1 1 
ATOM   1211 N ND2 . ASN A 1 159 ? 46.430 9.935  -6.146  1.00 15.00 ? 159 ASN A ND2 1 
ATOM   1212 N N   . LEU A 1 160 ? 43.234 13.738 -3.839  1.00 15.00 ? 160 LEU A N   1 
ATOM   1213 C CA  . LEU A 1 160 ? 41.796 13.781 -3.568  1.00 15.00 ? 160 LEU A CA  1 
ATOM   1214 C C   . LEU A 1 160 ? 41.135 13.571 -4.929  1.00 15.00 ? 160 LEU A C   1 
ATOM   1215 O O   . LEU A 1 160 ? 41.108 14.479 -5.738  1.00 15.00 ? 160 LEU A O   1 
ATOM   1216 C CB  . LEU A 1 160 ? 41.424 15.128 -2.959  1.00 15.00 ? 160 LEU A CB  1 
ATOM   1217 C CG  . LEU A 1 160 ? 42.087 15.448 -1.617  1.00 15.00 ? 160 LEU A CG  1 
ATOM   1218 C CD1 . LEU A 1 160 ? 41.733 16.811 -1.162  1.00 15.00 ? 160 LEU A CD1 1 
ATOM   1219 C CD2 . LEU A 1 160 ? 41.670 14.400 -0.548  1.00 15.00 ? 160 LEU A CD2 1 
ATOM   1220 N N   . ASN A 1 161 ? 40.759 12.330 -5.229  1.00 15.00 ? 161 ASN A N   1 
ATOM   1221 C CA  . ASN A 1 161 ? 40.156 11.971 -6.524  1.00 15.00 ? 161 ASN A CA  1 
ATOM   1222 C C   . ASN A 1 161 ? 38.674 11.569 -6.568  1.00 15.00 ? 161 ASN A C   1 
ATOM   1223 O O   . ASN A 1 161 ? 38.171 11.280 -7.641  1.00 15.00 ? 161 ASN A O   1 
ATOM   1224 C CB  . ASN A 1 161 ? 41.015 10.901 -7.233  1.00 15.00 ? 161 ASN A CB  1 
ATOM   1225 C CG  . ASN A 1 161 ? 41.360 9.737  -6.343  1.00 15.00 ? 161 ASN A CG  1 
ATOM   1226 O OD1 . ASN A 1 161 ? 40.491 9.130  -5.747  1.00 15.00 ? 161 ASN A OD1 1 
ATOM   1227 N ND2 . ASN A 1 161 ? 42.631 9.384  -6.295  1.00 15.00 ? 161 ASN A ND2 1 
ATOM   1228 N N   . HIS A 1 162 ? 37.935 11.641 -5.460  1.00 15.00 ? 162 HIS A N   1 
ATOM   1229 C CA  . HIS A 1 162 ? 36.540 11.246 -5.492  1.00 15.00 ? 162 HIS A CA  1 
ATOM   1230 C C   . HIS A 1 162 ? 35.781 11.971 -4.378  1.00 15.00 ? 162 HIS A C   1 
ATOM   1231 O O   . HIS A 1 162 ? 36.281 12.063 -3.271  1.00 15.00 ? 162 HIS A O   1 
ATOM   1232 C CB  . HIS A 1 162 ? 36.479 9.722  -5.297  1.00 15.00 ? 162 HIS A CB  1 
ATOM   1233 C CG  . HIS A 1 162 ? 35.101 9.134  -5.274  1.00 15.00 ? 162 HIS A CG  1 
ATOM   1234 N ND1 . HIS A 1 162 ? 34.116 9.501  -6.162  1.00 15.00 ? 162 HIS A ND1 1 
ATOM   1235 C CD2 . HIS A 1 162 ? 34.594 8.095  -4.564  1.00 15.00 ? 162 HIS A CD2 1 
ATOM   1236 C CE1 . HIS A 1 162 ? 33.066 8.712  -6.004  1.00 15.00 ? 162 HIS A CE1 1 
ATOM   1237 N NE2 . HIS A 1 162 ? 33.329 7.849  -5.041  1.00 15.00 ? 162 HIS A NE2 1 
ATOM   1238 N N   . ALA A 1 163 ? 34.624 12.540 -4.721  1.00 15.00 ? 163 ALA A N   1 
ATOM   1239 C CA  . ALA A 1 163 ? 33.773 13.263 -3.784  1.00 15.00 ? 163 ALA A CA  1 
ATOM   1240 C C   . ALA A 1 163 ? 32.742 12.319 -3.191  1.00 15.00 ? 163 ALA A C   1 
ATOM   1241 O O   . ALA A 1 163 ? 32.055 11.584 -3.919  1.00 15.00 ? 163 ALA A O   1 
ATOM   1242 C CB  . ALA A 1 163 ? 33.091 14.468 -4.443  1.00 15.00 ? 163 ALA A CB  1 
ATOM   1243 N N   . VAL A 1 164 ? 32.589 12.386 -1.876  1.00 15.00 ? 164 VAL A N   1 
ATOM   1244 C CA  . VAL A 1 164 ? 31.685 11.509 -1.159  1.00 15.00 ? 164 VAL A CA  1 
ATOM   1245 C C   . VAL A 1 164 ? 30.940 12.252 -0.044  1.00 15.00 ? 164 VAL A C   1 
ATOM   1246 O O   . VAL A 1 164 ? 30.930 13.500 -0.001  1.00 15.00 ? 164 VAL A O   1 
ATOM   1247 C CB  . VAL A 1 164 ? 32.472 10.247 -0.663  1.00 15.00 ? 164 VAL A CB  1 
ATOM   1248 C CG1 . VAL A 1 164 ? 32.834 10.317 0.826   1.00 15.00 ? 164 VAL A CG1 1 
ATOM   1249 C CG2 . VAL A 1 164 ? 31.731 8.990  -1.003  1.00 15.00 ? 164 VAL A CG2 1 
ATOM   1250 N N   . LEU A 1 165 ? 30.166 11.501 0.733   1.00 15.00 ? 165 LEU A N   1 
ATOM   1251 C CA  . LEU A 1 165 ? 29.389 12.103 1.819   1.00 15.00 ? 165 LEU A CA  1 
ATOM   1252 C C   . LEU A 1 165 ? 29.603 11.456 3.187   1.00 15.00 ? 165 LEU A C   1 
ATOM   1253 O O   . LEU A 1 165 ? 29.540 10.228 3.308   1.00 15.00 ? 165 LEU A O   1 
ATOM   1254 C CB  . LEU A 1 165 ? 27.875 12.090 1.492   1.00 15.00 ? 165 LEU A CB  1 
ATOM   1255 C CG  . LEU A 1 165 ? 26.888 12.834 2.423   1.00 15.00 ? 165 LEU A CG  1 
ATOM   1256 C CD1 . LEU A 1 165 ? 26.957 14.349 2.216   1.00 15.00 ? 165 LEU A CD1 1 
ATOM   1257 C CD2 . LEU A 1 165 ? 25.467 12.318 2.185   1.00 15.00 ? 165 LEU A CD2 1 
ATOM   1258 N N   . ALA A 1 166 ? 29.893 12.292 4.185   1.00 15.00 ? 166 ALA A N   1 
ATOM   1259 C CA  . ALA A 1 166 ? 30.094 11.834 5.555   1.00 15.00 ? 166 ALA A CA  1 
ATOM   1260 C C   . ALA A 1 166 ? 28.679 11.846 6.162   1.00 15.00 ? 166 ALA A C   1 
ATOM   1261 O O   . ALA A 1 166 ? 28.027 12.876 6.304   1.00 15.00 ? 166 ALA A O   1 
ATOM   1262 C CB  . ALA A 1 166 ? 31.076 12.740 6.327   1.00 15.00 ? 166 ALA A CB  1 
ATOM   1263 N N   . VAL A 1 167 ? 28.190 10.645 6.437   1.00 15.00 ? 167 VAL A N   1 
ATOM   1264 C CA  . VAL A 1 167 ? 26.856 10.397 6.953   1.00 15.00 ? 167 VAL A CA  1 
ATOM   1265 C C   . VAL A 1 167 ? 26.731 10.191 8.459   1.00 15.00 ? 167 VAL A C   1 
ATOM   1266 O O   . VAL A 1 167 ? 25.632 10.125 8.975   1.00 15.00 ? 167 VAL A O   1 
ATOM   1267 C CB  . VAL A 1 167 ? 26.202 9.264  6.106   1.00 15.00 ? 167 VAL A CB  1 
ATOM   1268 C CG1 . VAL A 1 167 ? 25.559 8.213  6.944   1.00 15.00 ? 167 VAL A CG1 1 
ATOM   1269 C CG2 . VAL A 1 167 ? 25.239 9.883  5.145   1.00 15.00 ? 167 VAL A CG2 1 
ATOM   1270 N N   . GLY A 1 168 ? 27.859 10.162 9.160   1.00 15.00 ? 168 GLY A N   1 
ATOM   1271 C CA  . GLY A 1 168 ? 27.860 9.993  10.606  1.00 15.00 ? 168 GLY A CA  1 
ATOM   1272 C C   . GLY A 1 168 ? 29.212 9.427  11.006  1.00 15.00 ? 168 GLY A C   1 
ATOM   1273 O O   . GLY A 1 168 ? 30.099 9.380  10.168  1.00 15.00 ? 168 GLY A O   1 
ATOM   1274 N N   . TYR A 1 169 ? 29.396 9.037  12.264  1.00 15.00 ? 169 TYR A N   1 
ATOM   1275 C CA  . TYR A 1 169 ? 30.660 8.455  12.743  1.00 15.00 ? 169 TYR A CA  1 
ATOM   1276 C C   . TYR A 1 169 ? 30.388 7.547  13.940  1.00 15.00 ? 169 TYR A C   1 
ATOM   1277 O O   . TYR A 1 169 ? 29.287 7.573  14.480  1.00 15.00 ? 169 TYR A O   1 
ATOM   1278 C CB  . TYR A 1 169 ? 31.656 9.537  13.162  1.00 15.00 ? 169 TYR A CB  1 
ATOM   1279 C CG  . TYR A 1 169 ? 31.096 10.488 14.159  1.00 15.00 ? 169 TYR A CG  1 
ATOM   1280 C CD1 . TYR A 1 169 ? 30.397 11.623 13.732  1.00 15.00 ? 169 TYR A CD1 1 
ATOM   1281 C CD2 . TYR A 1 169 ? 31.202 10.230 15.530  1.00 15.00 ? 169 TYR A CD2 1 
ATOM   1282 C CE1 . TYR A 1 169 ? 29.803 12.483 14.644  1.00 15.00 ? 169 TYR A CE1 1 
ATOM   1283 C CE2 . TYR A 1 169 ? 30.608 11.089 16.467  1.00 15.00 ? 169 TYR A CE2 1 
ATOM   1284 C CZ  . TYR A 1 169 ? 29.914 12.207 16.012  1.00 15.00 ? 169 TYR A CZ  1 
ATOM   1285 O OH  . TYR A 1 169 ? 29.326 13.039 16.927  1.00 15.00 ? 169 TYR A OH  1 
ATOM   1286 N N   . GLY A 1 170 ? 31.392 6.802  14.397  1.00 15.00 ? 170 GLY A N   1 
ATOM   1287 C CA  . GLY A 1 170 ? 31.192 5.894  15.517  1.00 15.00 ? 170 GLY A CA  1 
ATOM   1288 C C   . GLY A 1 170 ? 32.386 4.976  15.731  1.00 15.00 ? 170 GLY A C   1 
ATOM   1289 O O   . GLY A 1 170 ? 33.532 5.374  15.468  1.00 15.00 ? 170 GLY A O   1 
ATOM   1290 N N   . ILE A 1 171 ? 32.102 3.736  16.151  1.00 15.00 ? 171 ILE A N   1 
ATOM   1291 C CA  . ILE A 1 171 ? 33.132 2.729  16.430  1.00 15.00 ? 171 ILE A CA  1 
ATOM   1292 C C   . ILE A 1 171 ? 32.625 1.307  16.067  1.00 15.00 ? 171 ILE A C   1 
ATOM   1293 O O   . ILE A 1 171 ? 31.448 1.025  16.263  1.00 15.00 ? 171 ILE A O   1 
ATOM   1294 C CB  . ILE A 1 171 ? 33.591 2.823  17.931  1.00 15.00 ? 171 ILE A CB  1 
ATOM   1295 C CG1 . ILE A 1 171 ? 34.853 1.961  18.181  1.00 15.00 ? 171 ILE A CG1 1 
ATOM   1296 C CG2 . ILE A 1 171 ? 32.393 2.469  18.889  1.00 15.00 ? 171 ILE A CG2 1 
ATOM   1297 C CD1 . ILE A 1 171 ? 35.669 2.380  19.408  1.00 15.00 ? 171 ILE A CD1 1 
ATOM   1298 N N   . GLN A 1 172 ? 33.490 0.468  15.463  1.00 15.00 ? 172 GLN A N   1 
ATOM   1299 C CA  . GLN A 1 172 ? 33.124 -0.904 15.037  1.00 15.00 ? 172 GLN A CA  1 
ATOM   1300 C C   . GLN A 1 172 ? 33.513 -2.009 16.040  1.00 15.00 ? 172 GLN A C   1 
ATOM   1301 O O   . GLN A 1 172 ? 32.678 -2.828 16.474  1.00 15.00 ? 172 GLN A O   1 
ATOM   1302 C CB  . GLN A 1 172 ? 33.725 -1.258 13.665  1.00 15.00 ? 172 GLN A CB  1 
ATOM   1303 C CG  . GLN A 1 172 ? 33.456 -2.720 13.168  1.00 15.00 ? 172 GLN A CG  1 
ATOM   1304 C CD  . GLN A 1 172 ? 32.265 -2.829 12.197  1.00 15.00 ? 172 GLN A CD  1 
ATOM   1305 O OE1 . GLN A 1 172 ? 32.442 -3.143 11.000  1.00 15.00 ? 172 GLN A OE1 1 
ATOM   1306 N NE2 . GLN A 1 172 ? 31.049 -2.583 12.708  1.00 15.00 ? 172 GLN A NE2 1 
ATOM   1307 N N   . LYS A 1 173 ? 34.809 -2.109 16.294  1.00 15.00 ? 173 LYS A N   1 
ATOM   1308 C CA  . LYS A 1 173 ? 35.344 -3.065 17.248  1.00 15.00 ? 173 LYS A CA  1 
ATOM   1309 C C   . LYS A 1 173 ? 36.593 -2.378 17.722  1.00 15.00 ? 173 LYS A C   1 
ATOM   1310 O O   . LYS A 1 173 ? 37.704 -2.738 17.346  1.00 15.00 ? 173 LYS A O   1 
ATOM   1311 C CB  . LYS A 1 173 ? 35.734 -4.365 16.564  1.00 15.00 ? 173 LYS A CB  1 
ATOM   1312 C CG  . LYS A 1 173 ? 34.620 -5.087 15.841  1.00 15.00 ? 173 LYS A CG  1 
ATOM   1313 C CD  . LYS A 1 173 ? 35.281 -6.139 14.996  1.00 15.00 ? 173 LYS A CD  1 
ATOM   1314 C CE  . LYS A 1 173 ? 34.296 -6.995 14.248  1.00 15.00 ? 173 LYS A CE  1 
ATOM   1315 N NZ  . LYS A 1 173 ? 35.034 -7.976 13.394  1.00 15.00 ? 173 LYS A NZ  1 
ATOM   1316 N N   . GLY A 1 174 ? 36.408 -1.325 18.489  1.00 15.00 ? 174 GLY A N   1 
ATOM   1317 C CA  . GLY A 1 174 ? 37.558 -0.589 18.942  1.00 15.00 ? 174 GLY A CA  1 
ATOM   1318 C C   . GLY A 1 174 ? 38.106 0.295  17.842  1.00 15.00 ? 174 GLY A C   1 
ATOM   1319 O O   . GLY A 1 174 ? 39.016 1.070  18.100  1.00 15.00 ? 174 GLY A O   1 
ATOM   1320 N N   . ASN A 1 175 ? 37.561 0.192  16.629  1.00 15.00 ? 175 ASN A N   1 
ATOM   1321 C CA  . ASN A 1 175 ? 38.018 1.031  15.516  1.00 15.00 ? 175 ASN A CA  1 
ATOM   1322 C C   . ASN A 1 175 ? 37.039 2.173  15.236  1.00 15.00 ? 175 ASN A C   1 
ATOM   1323 O O   . ASN A 1 175 ? 35.860 1.954  14.862  1.00 15.00 ? 175 ASN A O   1 
ATOM   1324 C CB  . ASN A 1 175 ? 38.236 0.206  14.252  1.00 15.00 ? 175 ASN A CB  1 
ATOM   1325 C CG  . ASN A 1 175 ? 39.258 -0.870 14.447  1.00 15.00 ? 175 ASN A CG  1 
ATOM   1326 O OD1 . ASN A 1 175 ? 40.414 -0.597 14.753  1.00 15.00 ? 175 ASN A OD1 1 
ATOM   1327 N ND2 . ASN A 1 175 ? 38.838 -2.117 14.283  1.00 15.00 ? 175 ASN A ND2 1 
ATOM   1328 N N   . LYS A 1 176 ? 37.518 3.392  15.452  1.00 15.00 ? 176 LYS A N   1 
ATOM   1329 C CA  . LYS A 1 176 ? 36.695 4.554  15.201  1.00 15.00 ? 176 LYS A CA  1 
ATOM   1330 C C   . LYS A 1 176 ? 36.595 4.722  13.707  1.00 15.00 ? 176 LYS A C   1 
ATOM   1331 O O   . LYS A 1 176 ? 37.546 4.436  12.973  1.00 15.00 ? 176 LYS A O   1 
ATOM   1332 C CB  . LYS A 1 176 ? 37.314 5.794  15.786  1.00 15.00 ? 176 LYS A CB  1 
ATOM   1333 C CG  . LYS A 1 176 ? 37.351 5.824  17.292  1.00 15.00 ? 176 LYS A CG  1 
ATOM   1334 C CD  . LYS A 1 176 ? 38.347 6.882  17.712  1.00 15.00 ? 176 LYS A CD  1 
ATOM   1335 C CE  . LYS A 1 176 ? 38.452 6.996  19.216  1.00 15.00 ? 176 LYS A CE  1 
ATOM   1336 N NZ  . LYS A 1 176 ? 37.434 7.924  19.744  1.00 15.00 ? 176 LYS A NZ  1 
ATOM   1337 N N   . HIS A 1 177 ? 35.493 5.313  13.269  1.00 15.00 ? 177 HIS A N   1 
ATOM   1338 C CA  . HIS A 1 177 ? 35.273 5.462  11.837  1.00 15.00 ? 177 HIS A CA  1 
ATOM   1339 C C   . HIS A 1 177 ? 34.275 6.535  11.430  1.00 15.00 ? 177 HIS A C   1 
ATOM   1340 O O   . HIS A 1 177 ? 33.601 7.113  12.278  1.00 15.00 ? 177 HIS A O   1 
ATOM   1341 C CB  . HIS A 1 177 ? 34.768 4.124  11.307  1.00 15.00 ? 177 HIS A CB  1 
ATOM   1342 C CG  . HIS A 1 177 ? 33.380 3.794  11.752  1.00 15.00 ? 177 HIS A CG  1 
ATOM   1343 N ND1 . HIS A 1 177 ? 33.093 2.805  12.668  1.00 15.00 ? 177 HIS A ND1 1 
ATOM   1344 C CD2 . HIS A 1 177 ? 32.194 4.356  11.427  1.00 15.00 ? 177 HIS A CD2 1 
ATOM   1345 C CE1 . HIS A 1 177 ? 31.787 2.769  12.882  1.00 15.00 ? 177 HIS A CE1 1 
ATOM   1346 N NE2 . HIS A 1 177 ? 31.220 3.703  12.142  1.00 15.00 ? 177 HIS A NE2 1 
ATOM   1347 N N   . TRP A 1 178 ? 34.127 6.666  10.112  1.00 15.00 ? 178 TRP A N   1 
ATOM   1348 C CA  . TRP A 1 178 ? 33.208 7.593  9.497   1.00 15.00 ? 178 TRP A CA  1 
ATOM   1349 C C   . TRP A 1 178 ? 32.349 6.743  8.560   1.00 15.00 ? 178 TRP A C   1 
ATOM   1350 O O   . TRP A 1 178 ? 32.869 5.852  7.859   1.00 15.00 ? 178 TRP A O   1 
ATOM   1351 C CB  . TRP A 1 178 ? 33.951 8.589  8.608   1.00 15.00 ? 178 TRP A CB  1 
ATOM   1352 C CG  . TRP A 1 178 ? 34.938 9.511  9.235   1.00 15.00 ? 178 TRP A CG  1 
ATOM   1353 C CD1 . TRP A 1 178 ? 36.294 9.491  9.062   1.00 15.00 ? 178 TRP A CD1 1 
ATOM   1354 C CD2 . TRP A 1 178 ? 34.654 10.686 10.017  1.00 15.00 ? 178 TRP A CD2 1 
ATOM   1355 N NE1 . TRP A 1 178 ? 36.868 10.573 9.687   1.00 15.00 ? 178 TRP A NE1 1 
ATOM   1356 C CE2 . TRP A 1 178 ? 35.886 11.322 10.283  1.00 15.00 ? 178 TRP A CE2 1 
ATOM   1357 C CE3 . TRP A 1 178 ? 33.473 11.274 10.507  1.00 15.00 ? 178 TRP A CE3 1 
ATOM   1358 C CZ2 . TRP A 1 178 ? 35.971 12.519 11.029  1.00 15.00 ? 178 TRP A CZ2 1 
ATOM   1359 C CZ3 . TRP A 1 178 ? 33.563 12.463 11.240  1.00 15.00 ? 178 TRP A CZ3 1 
ATOM   1360 C CH2 . TRP A 1 178 ? 34.804 13.065 11.492  1.00 15.00 ? 178 TRP A CH2 1 
ATOM   1361 N N   . ILE A 1 179 ? 31.032 6.956  8.624   1.00 15.00 ? 179 ILE A N   1 
ATOM   1362 C CA  . ILE A 1 179 ? 30.070 6.287  7.746   1.00 15.00 ? 179 ILE A CA  1 
ATOM   1363 C C   . ILE A 1 179 ? 30.022 7.192  6.517   1.00 15.00 ? 179 ILE A C   1 
ATOM   1364 O O   . ILE A 1 179 ? 29.699 8.390  6.599   1.00 15.00 ? 179 ILE A O   1 
ATOM   1365 C CB  . ILE A 1 179 ? 28.680 6.103  8.412   1.00 15.00 ? 179 ILE A CB  1 
ATOM   1366 C CG1 . ILE A 1 179 ? 28.892 5.481  9.803   1.00 15.00 ? 179 ILE A CG1 1 
ATOM   1367 C CG2 . ILE A 1 179 ? 27.852 5.113  7.587   1.00 15.00 ? 179 ILE A CG2 1 
ATOM   1368 C CD1 . ILE A 1 179 ? 27.738 5.504  10.774  1.00 15.00 ? 179 ILE A CD1 1 
ATOM   1369 N N   . ILE A 1 180 ? 30.446 6.600  5.410   1.00 15.00 ? 180 ILE A N   1 
ATOM   1370 C CA  . ILE A 1 180 ? 30.565 7.259  4.132   1.00 15.00 ? 180 ILE A CA  1 
ATOM   1371 C C   . ILE A 1 180 ? 29.613 6.660  3.109   1.00 15.00 ? 180 ILE A C   1 
ATOM   1372 O O   . ILE A 1 180 ? 29.564 5.443  2.890   1.00 15.00 ? 180 ILE A O   1 
ATOM   1373 C CB  . ILE A 1 180 ? 32.007 7.072  3.583   1.00 15.00 ? 180 ILE A CB  1 
ATOM   1374 C CG1 . ILE A 1 180 ? 33.057 7.751  4.508   1.00 15.00 ? 180 ILE A CG1 1 
ATOM   1375 C CG2 . ILE A 1 180 ? 32.101 7.426  2.131   1.00 15.00 ? 180 ILE A CG2 1 
ATOM   1376 C CD1 . ILE A 1 180 ? 32.854 9.233  4.829   1.00 15.00 ? 180 ILE A CD1 1 
ATOM   1377 N N   . LYS A 1 181 ? 28.778 7.524  2.569   1.00 15.00 ? 181 LYS A N   1 
ATOM   1378 C CA  . LYS A 1 181 ? 27.840 7.151  1.541   1.00 15.00 ? 181 LYS A CA  1 
ATOM   1379 C C   . LYS A 1 181 ? 28.572 7.289  0.206   1.00 15.00 ? 181 LYS A C   1 
ATOM   1380 O O   . LYS A 1 181 ? 29.158 8.309  -0.088  1.00 15.00 ? 181 LYS A O   1 
ATOM   1381 C CB  . LYS A 1 181 ? 26.684 8.133  1.512   1.00 15.00 ? 181 LYS A CB  1 
ATOM   1382 C CG  . LYS A 1 181 ? 25.571 7.719  0.506   1.00 15.00 ? 181 LYS A CG  1 
ATOM   1383 C CD  . LYS A 1 181 ? 24.430 8.737  0.468   1.00 15.00 ? 181 LYS A CD  1 
ATOM   1384 C CE  . LYS A 1 181 ? 23.245 8.306  -0.368  1.00 15.00 ? 181 LYS A CE  1 
ATOM   1385 N NZ  . LYS A 1 181 ? 22.182 9.343  -0.552  1.00 15.00 ? 181 LYS A NZ  1 
ATOM   1386 N N   . ASN A 1 182 ? 28.490 6.289  -0.649  1.00 15.00 ? 182 ASN A N   1 
ATOM   1387 C CA  . ASN A 1 182 ? 29.181 6.394  -1.944  1.00 15.00 ? 182 ASN A CA  1 
ATOM   1388 C C   . ASN A 1 182 ? 28.158 6.545  -3.078  1.00 15.00 ? 182 ASN A C   1 
ATOM   1389 O O   . ASN A 1 182 ? 26.967 6.429  -2.821  1.00 15.00 ? 182 ASN A O   1 
ATOM   1390 C CB  . ASN A 1 182 ? 30.098 5.188  -2.152  1.00 15.00 ? 182 ASN A CB  1 
ATOM   1391 C CG  . ASN A 1 182 ? 31.175 5.438  -3.195  1.00 15.00 ? 182 ASN A CG  1 
ATOM   1392 O OD1 . ASN A 1 182 ? 31.058 6.328  -4.027  1.00 15.00 ? 182 ASN A OD1 1 
ATOM   1393 N ND2 . ASN A 1 182 ? 32.219 4.632  -3.163  1.00 15.00 ? 182 ASN A ND2 1 
ATOM   1394 N N   . SER A 1 183 ? 28.612 6.915  -4.278  1.00 15.00 ? 183 SER A N   1 
ATOM   1395 C CA  . SER A 1 183 ? 27.744 7.071  -5.453  1.00 15.00 ? 183 SER A CA  1 
ATOM   1396 C C   . SER A 1 183 ? 28.027 5.986  -6.509  1.00 15.00 ? 183 SER A C   1 
ATOM   1397 O O   . SER A 1 183 ? 27.935 6.225  -7.739  1.00 15.00 ? 183 SER A O   1 
ATOM   1398 C CB  . SER A 1 183 ? 27.940 8.455  -6.074  1.00 15.00 ? 183 SER A CB  1 
ATOM   1399 O OG  . SER A 1 183 ? 29.282 8.628  -6.511  1.00 15.00 ? 183 SER A OG  1 
ATOM   1400 N N   . TRP A 1 184 ? 28.377 4.791  -6.015  1.00 15.00 ? 184 TRP A N   1 
ATOM   1401 C CA  . TRP A 1 184 ? 28.725 3.671  -6.884  1.00 15.00 ? 184 TRP A CA  1 
ATOM   1402 C C   . TRP A 1 184 ? 27.613 2.608  -6.963  1.00 15.00 ? 184 TRP A C   1 
ATOM   1403 O O   . TRP A 1 184 ? 27.809 1.547  -7.521  1.00 15.00 ? 184 TRP A O   1 
ATOM   1404 C CB  . TRP A 1 184 ? 30.125 3.083  -6.523  1.00 15.00 ? 184 TRP A CB  1 
ATOM   1405 C CG  . TRP A 1 184 ? 31.301 4.007  -6.804  1.00 15.00 ? 184 TRP A CG  1 
ATOM   1406 C CD1 . TRP A 1 184 ? 31.291 5.180  -7.542  1.00 15.00 ? 184 TRP A CD1 1 
ATOM   1407 C CD2 . TRP A 1 184 ? 32.659 3.831  -6.362  1.00 15.00 ? 184 TRP A CD2 1 
ATOM   1408 N NE1 . TRP A 1 184 ? 32.556 5.741  -7.575  1.00 15.00 ? 184 TRP A NE1 1 
ATOM   1409 C CE2 . TRP A 1 184 ? 33.416 4.942  -6.869  1.00 15.00 ? 184 TRP A CE2 1 
ATOM   1410 C CE3 . TRP A 1 184 ? 33.317 2.840  -5.606  1.00 15.00 ? 184 TRP A CE3 1 
ATOM   1411 C CZ2 . TRP A 1 184 ? 34.798 5.094  -6.644  1.00 15.00 ? 184 TRP A CZ2 1 
ATOM   1412 C CZ3 . TRP A 1 184 ? 34.709 2.985  -5.384  1.00 15.00 ? 184 TRP A CZ3 1 
ATOM   1413 C CH2 . TRP A 1 184 ? 35.434 4.126  -5.914  1.00 15.00 ? 184 TRP A CH2 1 
ATOM   1414 N N   . GLY A 1 185 ? 26.451 2.884  -6.371  1.00 15.00 ? 185 GLY A N   1 
ATOM   1415 C CA  . GLY A 1 185 ? 25.343 1.946  -6.429  1.00 15.00 ? 185 GLY A CA  1 
ATOM   1416 C C   . GLY A 1 185 ? 25.179 1.120  -5.182  1.00 15.00 ? 185 GLY A C   1 
ATOM   1417 O O   . GLY A 1 185 ? 26.179 0.752  -4.564  1.00 15.00 ? 185 GLY A O   1 
ATOM   1418 N N   . GLU A 1 186 ? 23.949 0.738  -4.842  1.00 15.00 ? 186 GLU A N   1 
ATOM   1419 C CA  . GLU A 1 186 ? 23.783 -0.035 -3.622  1.00 15.00 ? 186 GLU A CA  1 
ATOM   1420 C C   . GLU A 1 186 ? 24.486 -1.380 -3.676  1.00 15.00 ? 186 GLU A C   1 
ATOM   1421 O O   . GLU A 1 186 ? 24.726 -2.010 -2.649  1.00 15.00 ? 186 GLU A O   1 
ATOM   1422 C CB  . GLU A 1 186 ? 22.308 -0.148 -3.218  1.00 15.00 ? 186 GLU A CB  1 
ATOM   1423 C CG  . GLU A 1 186 ? 21.567 -1.356 -3.879  1.00 15.00 ? 186 GLU A CG  1 
ATOM   1424 C CD  . GLU A 1 186 ? 20.084 -1.083 -4.364  1.00 15.00 ? 186 GLU A CD  1 
ATOM   1425 O OE1 . GLU A 1 186 ? 19.690 0.148  -4.290  1.00 15.00 ? 186 GLU A OE1 1 
ATOM   1426 O OE2 . GLU A 1 186 ? 19.361 -2.071 -4.695  1.00 15.00 ? 186 GLU A OE2 1 
ATOM   1427 N N   . ASN A 1 187 ? 24.960 -1.756 -4.859  1.00 15.00 ? 187 ASN A N   1 
ATOM   1428 C CA  . ASN A 1 187 ? 25.669 -3.023 -4.976  1.00 15.00 ? 187 ASN A CA  1 
ATOM   1429 C C   . ASN A 1 187 ? 27.162 -2.945 -4.646  1.00 15.00 ? 187 ASN A C   1 
ATOM   1430 O O   . ASN A 1 187 ? 27.842 -3.952 -4.595  1.00 15.00 ? 187 ASN A O   1 
ATOM   1431 C CB  . ASN A 1 187 ? 25.473 -3.633 -6.354  1.00 15.00 ? 187 ASN A CB  1 
ATOM   1432 C CG  . ASN A 1 187 ? 24.488 -4.780 -6.334  1.00 15.00 ? 187 ASN A CG  1 
ATOM   1433 O OD1 . ASN A 1 187 ? 24.854 -5.943 -6.543  1.00 15.00 ? 187 ASN A OD1 1 
ATOM   1434 N ND2 . ASN A 1 187 ? 23.234 -4.466 -6.055  1.00 15.00 ? 187 ASN A ND2 1 
ATOM   1435 N N   . TRP A 1 188 ? 27.677 -1.752 -4.419  1.00 15.00 ? 188 TRP A N   1 
ATOM   1436 C CA  . TRP A 1 188 ? 29.073 -1.610 -4.083  1.00 15.00 ? 188 TRP A CA  1 
ATOM   1437 C C   . TRP A 1 188 ? 29.257 -1.602 -2.572  1.00 15.00 ? 188 TRP A C   1 
ATOM   1438 O O   . TRP A 1 188 ? 28.392 -1.150 -1.836  1.00 15.00 ? 188 TRP A O   1 
ATOM   1439 C CB  . TRP A 1 188 ? 29.609 -0.319 -4.703  1.00 15.00 ? 188 TRP A CB  1 
ATOM   1440 C CG  . TRP A 1 188 ? 30.994 -0.054 -4.303  1.00 15.00 ? 188 TRP A CG  1 
ATOM   1441 C CD1 . TRP A 1 188 ? 32.109 -0.508 -4.908  1.00 15.00 ? 188 TRP A CD1 1 
ATOM   1442 C CD2 . TRP A 1 188 ? 31.420 0.621  -3.120  1.00 15.00 ? 188 TRP A CD2 1 
ATOM   1443 N NE1 . TRP A 1 188 ? 33.219 -0.190 -4.163  1.00 15.00 ? 188 TRP A NE1 1 
ATOM   1444 C CE2 . TRP A 1 188 ? 32.815 0.510  -3.058  1.00 15.00 ? 188 TRP A CE2 1 
ATOM   1445 C CE3 . TRP A 1 188 ? 30.752 1.303  -2.100  1.00 15.00 ? 188 TRP A CE3 1 
ATOM   1446 C CZ2 . TRP A 1 188 ? 33.547 1.050  -2.023  1.00 15.00 ? 188 TRP A CZ2 1 
ATOM   1447 C CZ3 . TRP A 1 188 ? 31.481 1.836  -1.074  1.00 15.00 ? 188 TRP A CZ3 1 
ATOM   1448 C CH2 . TRP A 1 188 ? 32.855 1.709  -1.038  1.00 15.00 ? 188 TRP A CH2 1 
ATOM   1449 N N   . GLY A 1 189 ? 30.362 -2.167 -2.112  1.00 15.00 ? 189 GLY A N   1 
ATOM   1450 C CA  . GLY A 1 189 ? 30.688 -2.190 -0.692  1.00 15.00 ? 189 GLY A CA  1 
ATOM   1451 C C   . GLY A 1 189 ? 29.645 -2.702 0.272   1.00 15.00 ? 189 GLY A C   1 
ATOM   1452 O O   . GLY A 1 189 ? 29.133 -3.806 0.118   1.00 15.00 ? 189 GLY A O   1 
ATOM   1453 N N   . ASN A 1 190 ? 29.359 -1.936 1.310   1.00 15.00 ? 190 ASN A N   1 
ATOM   1454 C CA  . ASN A 1 190 ? 28.359 -2.393 2.261   1.00 15.00 ? 190 ASN A CA  1 
ATOM   1455 C C   . ASN A 1 190 ? 27.059 -1.633 2.062   1.00 15.00 ? 190 ASN A C   1 
ATOM   1456 O O   . ASN A 1 190 ? 26.696 -0.714 2.824   1.00 15.00 ? 190 ASN A O   1 
ATOM   1457 C CB  . ASN A 1 190 ? 28.837 -2.351 3.714   1.00 15.00 ? 190 ASN A CB  1 
ATOM   1458 C CG  . ASN A 1 190 ? 27.962 -3.203 4.638   1.00 15.00 ? 190 ASN A CG  1 
ATOM   1459 O OD1 . ASN A 1 190 ? 26.979 -3.794 4.203   1.00 15.00 ? 190 ASN A OD1 1 
ATOM   1460 N ND2 . ASN A 1 190 ? 28.314 -3.274 5.896   1.00 15.00 ? 190 ASN A ND2 1 
ATOM   1461 N N   . LYS A 1 191 ? 26.323 -2.129 1.068   1.00 15.00 ? 191 LYS A N   1 
ATOM   1462 C CA  . LYS A 1 191 ? 25.030 -1.608 0.644   1.00 15.00 ? 191 LYS A CA  1 
ATOM   1463 C C   . LYS A 1 191 ? 25.188 -0.172 0.268   1.00 15.00 ? 191 LYS A C   1 
ATOM   1464 O O   . LYS A 1 191 ? 24.496 0.688  0.803   1.00 15.00 ? 191 LYS A O   1 
ATOM   1465 C CB  . LYS A 1 191 ? 24.009 -1.703 1.761   1.00 15.00 ? 191 LYS A CB  1 
ATOM   1466 C CG  . LYS A 1 191 ? 23.750 -3.093 2.243   1.00 15.00 ? 191 LYS A CG  1 
ATOM   1467 C CD  . LYS A 1 191 ? 23.100 -3.036 3.618   1.00 15.00 ? 191 LYS A CD  1 
ATOM   1468 C CE  . LYS A 1 191 ? 22.537 -4.391 3.916   1.00 15.00 ? 191 LYS A CE  1 
ATOM   1469 N NZ  . LYS A 1 191 ? 21.160 -4.455 3.391   1.00 15.00 ? 191 LYS A NZ  1 
ATOM   1470 N N   . GLY A 1 192 ? 26.190 0.079  -0.566  1.00 15.00 ? 192 GLY A N   1 
ATOM   1471 C CA  . GLY A 1 192 ? 26.508 1.416  -1.025  1.00 15.00 ? 192 GLY A CA  1 
ATOM   1472 C C   . GLY A 1 192 ? 27.470 2.144  -0.108  1.00 15.00 ? 192 GLY A C   1 
ATOM   1473 O O   . GLY A 1 192 ? 28.006 3.169  -0.478  1.00 15.00 ? 192 GLY A O   1 
ATOM   1474 N N   . TYR A 1 193 ? 27.727 1.596  1.072   1.00 15.00 ? 193 TYR A N   1 
ATOM   1475 C CA  . TYR A 1 193 ? 28.597 2.262  2.022   1.00 15.00 ? 193 TYR A CA  1 
ATOM   1476 C C   . TYR A 1 193 ? 29.903 1.610  2.425   1.00 15.00 ? 193 TYR A C   1 
ATOM   1477 O O   . TYR A 1 193 ? 30.086 0.398  2.335   1.00 15.00 ? 193 TYR A O   1 
ATOM   1478 C CB  . TYR A 1 193 ? 27.832 2.602  3.315   1.00 15.00 ? 193 TYR A CB  1 
ATOM   1479 C CG  . TYR A 1 193 ? 26.583 3.468  3.180   1.00 15.00 ? 193 TYR A CG  1 
ATOM   1480 C CD1 . TYR A 1 193 ? 25.410 2.954  2.637   1.00 15.00 ? 193 TYR A CD1 1 
ATOM   1481 C CD2 . TYR A 1 193 ? 26.557 4.781  3.654   1.00 15.00 ? 193 TYR A CD2 1 
ATOM   1482 C CE1 . TYR A 1 193 ? 24.256 3.709  2.567   1.00 15.00 ? 193 TYR A CE1 1 
ATOM   1483 C CE2 . TYR A 1 193 ? 25.389 5.553  3.580   1.00 15.00 ? 193 TYR A CE2 1 
ATOM   1484 C CZ  . TYR A 1 193 ? 24.254 5.009  3.029   1.00 15.00 ? 193 TYR A CZ  1 
ATOM   1485 O OH  . TYR A 1 193 ? 23.136 5.776  2.829   1.00 15.00 ? 193 TYR A OH  1 
ATOM   1486 N N   . ILE A 1 194 ? 30.706 2.450  3.073   1.00 15.00 ? 194 ILE A N   1 
ATOM   1487 C CA  . ILE A 1 194 ? 32.022 2.140  3.603   1.00 15.00 ? 194 ILE A CA  1 
ATOM   1488 C C   . ILE A 1 194 ? 32.347 2.897  4.915   1.00 15.00 ? 194 ILE A C   1 
ATOM   1489 O O   . ILE A 1 194 ? 32.037 4.084  5.047   1.00 15.00 ? 194 ILE A O   1 
ATOM   1490 C CB  . ILE A 1 194 ? 33.086 2.445  2.531   1.00 15.00 ? 194 ILE A CB  1 
ATOM   1491 C CG1 . ILE A 1 194 ? 34.488 2.306  3.113   1.00 15.00 ? 194 ILE A CG1 1 
ATOM   1492 C CG2 . ILE A 1 194 ? 32.856 3.828  1.878   1.00 15.00 ? 194 ILE A CG2 1 
ATOM   1493 C CD1 . ILE A 1 194 ? 35.499 2.287  2.071   1.00 15.00 ? 194 ILE A CD1 1 
ATOM   1494 N N   . LEU A 1 195 ? 32.892 2.197  5.909   1.00 15.00 ? 195 LEU A N   1 
ATOM   1495 C CA  . LEU A 1 195 ? 33.300 2.840  7.161   1.00 15.00 ? 195 LEU A CA  1 
ATOM   1496 C C   . LEU A 1 195 ? 34.781 3.073  6.911   1.00 15.00 ? 195 LEU A C   1 
ATOM   1497 O O   . LEU A 1 195 ? 35.495 2.128  6.586   1.00 15.00 ? 195 LEU A O   1 
ATOM   1498 C CB  . LEU A 1 195 ? 33.155 1.882  8.359   1.00 15.00 ? 195 LEU A CB  1 
ATOM   1499 C CG  . LEU A 1 195 ? 31.807 1.690  9.055   1.00 15.00 ? 195 LEU A CG  1 
ATOM   1500 C CD1 . LEU A 1 195 ? 30.675 1.889  8.163   1.00 15.00 ? 195 LEU A CD1 1 
ATOM   1501 C CD2 . LEU A 1 195 ? 31.720 0.328  9.712   1.00 15.00 ? 195 LEU A CD2 1 
ATOM   1502 N N   . MET A 1 196 ? 35.232 4.313  7.052   1.00 15.00 ? 196 MET A N   1 
ATOM   1503 C CA  . MET A 1 196 ? 36.626 4.682  6.846   1.00 15.00 ? 196 MET A CA  1 
ATOM   1504 C C   . MET A 1 196 ? 37.296 5.124  8.139   1.00 15.00 ? 196 MET A C   1 
ATOM   1505 O O   . MET A 1 196 ? 36.706 5.857  8.910   1.00 15.00 ? 196 MET A O   1 
ATOM   1506 C CB  . MET A 1 196 ? 36.684 5.805  5.825   1.00 15.00 ? 196 MET A CB  1 
ATOM   1507 C CG  . MET A 1 196 ? 36.480 5.287  4.457   1.00 15.00 ? 196 MET A CG  1 
ATOM   1508 S SD  . MET A 1 196 ? 36.565 6.713  3.422   1.00 15.00 ? 196 MET A SD  1 
ATOM   1509 C CE  . MET A 1 196 ? 38.319 6.940  3.217   1.00 15.00 ? 196 MET A CE  1 
ATOM   1510 N N   . ALA A 1 197 ? 38.464 4.564  8.420   1.00 15.00 ? 197 ALA A N   1 
ATOM   1511 C CA  . ALA A 1 197 ? 39.250 4.903  9.616   1.00 15.00 ? 197 ALA A CA  1 
ATOM   1512 C C   . ALA A 1 197 ? 39.174 6.400  10.054  1.00 15.00 ? 197 ALA A C   1 
ATOM   1513 O O   . ALA A 1 197 ? 39.422 7.300  9.264   1.00 15.00 ? 197 ALA A O   1 
ATOM   1514 C CB  . ALA A 1 197 ? 40.706 4.482  9.392   1.00 15.00 ? 197 ALA A CB  1 
ATOM   1515 N N   . ARG A 1 198 ? 38.808 6.657  11.306  1.00 15.00 ? 198 ARG A N   1 
ATOM   1516 C CA  . ARG A 1 198 ? 38.718 8.016  11.816  1.00 15.00 ? 198 ARG A CA  1 
ATOM   1517 C C   . ARG A 1 198 ? 39.832 8.170  12.815  1.00 15.00 ? 198 ARG A C   1 
ATOM   1518 O O   . ARG A 1 198 ? 40.193 7.212  13.488  1.00 15.00 ? 198 ARG A O   1 
ATOM   1519 C CB  . ARG A 1 198 ? 37.390 8.232  12.504  1.00 15.00 ? 198 ARG A CB  1 
ATOM   1520 C CG  . ARG A 1 198 ? 37.307 9.529  13.273  1.00 15.00 ? 198 ARG A CG  1 
ATOM   1521 C CD  . ARG A 1 198 ? 35.882 9.876  13.520  1.00 15.00 ? 198 ARG A CD  1 
ATOM   1522 N NE  . ARG A 1 198 ? 35.230 8.884  14.341  1.00 15.00 ? 198 ARG A NE  1 
ATOM   1523 C CZ  . ARG A 1 198 ? 35.115 8.980  15.663  1.00 15.00 ? 198 ARG A CZ  1 
ATOM   1524 N NH1 . ARG A 1 198 ? 35.614 10.029 16.293  1.00 15.00 ? 198 ARG A NH1 1 
ATOM   1525 N NH2 . ARG A 1 198 ? 34.499 8.034  16.366  1.00 15.00 ? 198 ARG A NH2 1 
ATOM   1526 N N   . ASN A 1 199 ? 40.332 9.388  12.947  1.00 15.00 ? 199 ASN A N   1 
ATOM   1527 C CA  . ASN A 1 199 ? 41.445 9.740  13.844  1.00 15.00 ? 199 ASN A CA  1 
ATOM   1528 C C   . ASN A 1 199 ? 42.830 9.137  13.496  1.00 15.00 ? 199 ASN A C   1 
ATOM   1529 O O   . ASN A 1 199 ? 43.801 9.346  14.215  1.00 15.00 ? 199 ASN A O   1 
ATOM   1530 C CB  . ASN A 1 199 ? 41.032 9.601  15.327  1.00 15.00 ? 199 ASN A CB  1 
ATOM   1531 C CG  . ASN A 1 199 ? 39.910 10.583 15.706  1.00 15.00 ? 199 ASN A CG  1 
ATOM   1532 O OD1 . ASN A 1 199 ? 39.665 11.581 15.004  1.00 15.00 ? 199 ASN A OD1 1 
ATOM   1533 N ND2 . ASN A 1 199 ? 39.204 10.284 16.776  1.00 15.00 ? 199 ASN A ND2 1 
ATOM   1534 N N   . LYS A 1 200 ? 42.929 8.494  12.328  1.00 15.00 ? 200 LYS A N   1 
ATOM   1535 C CA  . LYS A 1 200 ? 44.194 7.902  11.843  1.00 15.00 ? 200 LYS A CA  1 
ATOM   1536 C C   . LYS A 1 200 ? 44.925 8.871  10.905  1.00 15.00 ? 200 LYS A C   1 
ATOM   1537 O O   . LYS A 1 200 ? 45.136 8.593  9.732   1.00 15.00 ? 200 LYS A O   1 
ATOM   1538 C CB  . LYS A 1 200 ? 43.928 6.566  11.153  1.00 15.00 ? 200 LYS A CB  1 
ATOM   1539 C CG  . LYS A 1 200 ? 43.244 5.597  12.086  1.00 15.00 ? 200 LYS A CG  1 
ATOM   1540 C CD  . LYS A 1 200 ? 43.753 4.173  11.874  1.00 15.00 ? 200 LYS A CD  1 
ATOM   1541 C CE  . LYS A 1 200 ? 45.267 4.090  12.179  1.00 15.00 ? 200 LYS A CE  1 
ATOM   1542 N NZ  . LYS A 1 200 ? 45.947 2.798  11.807  1.00 15.00 ? 200 LYS A NZ  1 
ATOM   1543 N N   . ASN A 1 201 ? 45.341 9.999  11.474  1.00 15.00 ? 201 ASN A N   1 
ATOM   1544 C CA  . ASN A 1 201 ? 46.030 11.088 10.776  1.00 15.00 ? 201 ASN A CA  1 
ATOM   1545 C C   . ASN A 1 201 ? 45.334 11.562 9.520   1.00 15.00 ? 201 ASN A C   1 
ATOM   1546 O O   . ASN A 1 201 ? 45.992 11.940 8.540   1.00 15.00 ? 201 ASN A O   1 
ATOM   1547 C CB  . ASN A 1 201 ? 47.503 10.767 10.506  1.00 15.00 ? 201 ASN A CB  1 
ATOM   1548 C CG  . ASN A 1 201 ? 48.256 10.379 11.772  1.00 15.00 ? 201 ASN A CG  1 
ATOM   1549 O OD1 . ASN A 1 201 ? 47.966 10.873 12.873  1.00 15.00 ? 201 ASN A OD1 1 
ATOM   1550 N ND2 . ASN A 1 201 ? 49.242 9.502  11.621  1.00 15.00 ? 201 ASN A ND2 1 
ATOM   1551 N N   . ASN A 1 202 ? 44.001 11.570 9.548   1.00 15.00 ? 202 ASN A N   1 
ATOM   1552 C CA  . ASN A 1 202 ? 43.221 12.061 8.407   1.00 15.00 ? 202 ASN A CA  1 
ATOM   1553 C C   . ASN A 1 202 ? 43.448 11.182 7.173   1.00 15.00 ? 202 ASN A C   1 
ATOM   1554 O O   . ASN A 1 202 ? 43.756 11.678 6.082   1.00 15.00 ? 202 ASN A O   1 
ATOM   1555 C CB  . ASN A 1 202 ? 43.669 13.497 8.124   1.00 15.00 ? 202 ASN A CB  1 
ATOM   1556 C CG  . ASN A 1 202 ? 42.850 14.189 7.033   1.00 15.00 ? 202 ASN A CG  1 
ATOM   1557 O OD1 . ASN A 1 202 ? 41.736 13.772 6.702   1.00 15.00 ? 202 ASN A OD1 1 
ATOM   1558 N ND2 . ASN A 1 202 ? 43.376 15.286 6.525   1.00 15.00 ? 202 ASN A ND2 1 
ATOM   1559 N N   . ALA A 1 203 ? 43.167 9.890  7.354   1.00 15.00 ? 203 ALA A N   1 
ATOM   1560 C CA  . ALA A 1 203 ? 43.373 8.829  6.359   1.00 15.00 ? 203 ALA A CA  1 
ATOM   1561 C C   . ALA A 1 203 ? 42.661 9.067  5.043   1.00 15.00 ? 203 ALA A C   1 
ATOM   1562 O O   . ALA A 1 203 ? 41.475 9.430  5.016   1.00 15.00 ? 203 ALA A O   1 
ATOM   1563 C CB  . ALA A 1 203 ? 42.973 7.484  6.927   1.00 15.00 ? 203 ALA A CB  1 
ATOM   1564 N N   . CYS A 1 204 ? 43.416 8.937  3.953   1.00 15.00 ? 204 CYS A N   1 
ATOM   1565 C CA  . CYS A 1 204 ? 42.863 9.138  2.619   1.00 15.00 ? 204 CYS A CA  1 
ATOM   1566 C C   . CYS A 1 204 ? 42.412 10.565 2.353   1.00 15.00 ? 204 CYS A C   1 
ATOM   1567 O O   . CYS A 1 204 ? 41.743 10.799 1.354   1.00 15.00 ? 204 CYS A O   1 
ATOM   1568 C CB  . CYS A 1 204 ? 41.670 8.207  2.381   1.00 15.00 ? 204 CYS A CB  1 
ATOM   1569 S SG  . CYS A 1 204 ? 42.044 6.433  2.392   1.00 15.00 ? 204 CYS A SG  1 
ATOM   1570 N N   . GLY A 1 205 ? 42.746 11.492 3.243   1.00 15.00 ? 205 GLY A N   1 
ATOM   1571 C CA  . GLY A 1 205 ? 42.381 12.888 3.059   1.00 15.00 ? 205 GLY A CA  1 
ATOM   1572 C C   . GLY A 1 205 ? 40.977 13.293 3.479   1.00 15.00 ? 205 GLY A C   1 
ATOM   1573 O O   . GLY A 1 205 ? 40.563 14.425 3.178   1.00 15.00 ? 205 GLY A O   1 
ATOM   1574 N N   . ILE A 1 206 ? 40.301 12.425 4.235   1.00 15.00 ? 206 ILE A N   1 
ATOM   1575 C CA  . ILE A 1 206 ? 38.926 12.635 4.726   1.00 15.00 ? 206 ILE A CA  1 
ATOM   1576 C C   . ILE A 1 206 ? 38.524 14.082 5.157   1.00 15.00 ? 206 ILE A C   1 
ATOM   1577 O O   . ILE A 1 206 ? 37.387 14.514 4.882   1.00 15.00 ? 206 ILE A O   1 
ATOM   1578 C CB  . ILE A 1 206 ? 38.589 11.611 5.885   1.00 15.00 ? 206 ILE A CB  1 
ATOM   1579 C CG1 . ILE A 1 206 ? 37.083 11.549 6.105   1.00 15.00 ? 206 ILE A CG1 1 
ATOM   1580 C CG2 . ILE A 1 206 ? 39.236 11.997 7.229   1.00 15.00 ? 206 ILE A CG2 1 
ATOM   1581 C CD1 . ILE A 1 206 ? 36.311 10.997 4.961   1.00 15.00 ? 206 ILE A CD1 1 
ATOM   1582 N N   . ALA A 1 207 ? 39.434 14.836 5.786   1.00 15.00 ? 207 ALA A N   1 
ATOM   1583 C CA  . ALA A 1 207 ? 39.148 16.195 6.249   1.00 15.00 ? 207 ALA A CA  1 
ATOM   1584 C C   . ALA A 1 207 ? 39.806 17.325 5.459   1.00 15.00 ? 207 ALA A C   1 
ATOM   1585 O O   . ALA A 1 207 ? 39.719 18.484 5.846   1.00 15.00 ? 207 ALA A O   1 
ATOM   1586 C CB  . ALA A 1 207 ? 39.489 16.333 7.725   1.00 15.00 ? 207 ALA A CB  1 
ATOM   1587 N N   . ASN A 1 208 ? 40.405 17.031 4.318   1.00 15.00 ? 208 ASN A N   1 
ATOM   1588 C CA  . ASN A 1 208 ? 41.070 18.083 3.564   1.00 15.00 ? 208 ASN A CA  1 
ATOM   1589 C C   . ASN A 1 208 ? 40.177 18.943 2.704   1.00 15.00 ? 208 ASN A C   1 
ATOM   1590 O O   . ASN A 1 208 ? 40.588 20.005 2.303   1.00 15.00 ? 208 ASN A O   1 
ATOM   1591 C CB  . ASN A 1 208 ? 42.230 17.536 2.713   1.00 15.00 ? 208 ASN A CB  1 
ATOM   1592 C CG  . ASN A 1 208 ? 43.436 17.167 3.537   1.00 15.00 ? 208 ASN A CG  1 
ATOM   1593 O OD1 . ASN A 1 208 ? 43.543 17.535 4.711   1.00 15.00 ? 208 ASN A OD1 1 
ATOM   1594 N ND2 . ASN A 1 208 ? 44.361 16.431 2.926   1.00 15.00 ? 208 ASN A ND2 1 
ATOM   1595 N N   . LEU A 1 209 ? 38.992 18.460 2.363   1.00 15.00 ? 209 LEU A N   1 
ATOM   1596 C CA  . LEU A 1 209 ? 38.083 19.223 1.511   1.00 15.00 ? 209 LEU A CA  1 
ATOM   1597 C C   . LEU A 1 209 ? 36.646 19.011 1.934   1.00 15.00 ? 209 LEU A C   1 
ATOM   1598 O O   . LEU A 1 209 ? 35.807 18.625 1.122   1.00 15.00 ? 209 LEU A O   1 
ATOM   1599 C CB  . LEU A 1 209 ? 38.260 18.830 0.029   1.00 15.00 ? 209 LEU A CB  1 
ATOM   1600 C CG  . LEU A 1 209 ? 37.779 19.818 -1.043  1.00 15.00 ? 209 LEU A CG  1 
ATOM   1601 C CD1 . LEU A 1 209 ? 38.647 21.074 -1.105  1.00 15.00 ? 209 LEU A CD1 1 
ATOM   1602 C CD2 . LEU A 1 209 ? 37.781 19.130 -2.401  1.00 15.00 ? 209 LEU A CD2 1 
ATOM   1603 N N   . ALA A 1 210 ? 36.361 19.216 3.215   1.00 15.00 ? 210 ALA A N   1 
ATOM   1604 C CA  . ALA A 1 210 ? 34.994 19.059 3.713   1.00 15.00 ? 210 ALA A CA  1 
ATOM   1605 C C   . ALA A 1 210 ? 34.245 20.416 3.704   1.00 15.00 ? 210 ALA A C   1 
ATOM   1606 O O   . ALA A 1 210 ? 34.862 21.473 3.868   1.00 15.00 ? 210 ALA A O   1 
ATOM   1607 C CB  . ALA A 1 210 ? 35.015 18.437 5.107   1.00 15.00 ? 210 ALA A CB  1 
ATOM   1608 N N   . SER A 1 211 ? 32.933 20.393 3.488   1.00 15.00 ? 211 SER A N   1 
ATOM   1609 C CA  . SER A 1 211 ? 32.125 21.625 3.483   1.00 15.00 ? 211 SER A CA  1 
ATOM   1610 C C   . SER A 1 211 ? 30.640 21.287 3.615   1.00 15.00 ? 211 SER A C   1 
ATOM   1611 O O   . SER A 1 211 ? 30.247 20.149 3.366   1.00 15.00 ? 211 SER A O   1 
ATOM   1612 C CB  . SER A 1 211 ? 32.389 22.471 2.212   1.00 15.00 ? 211 SER A CB  1 
ATOM   1613 O OG  . SER A 1 211 ? 32.156 21.730 1.013   1.00 15.00 ? 211 SER A OG  1 
ATOM   1614 N N   . PHE A 1 212 ? 29.807 22.218 4.059   1.00 15.00 ? 212 PHE A N   1 
ATOM   1615 C CA  . PHE A 1 212 ? 28.376 21.886 4.145   1.00 15.00 ? 212 PHE A CA  1 
ATOM   1616 C C   . PHE A 1 212 ? 27.552 23.121 3.767   1.00 15.00 ? 212 PHE A C   1 
ATOM   1617 O O   . PHE A 1 212 ? 28.014 24.253 3.948   1.00 15.00 ? 212 PHE A O   1 
ATOM   1618 C CB  . PHE A 1 212 ? 28.036 21.365 5.526   1.00 15.00 ? 212 PHE A CB  1 
ATOM   1619 C CG  . PHE A 1 212 ? 28.371 22.312 6.641   1.00 15.00 ? 212 PHE A CG  1 
ATOM   1620 C CD1 . PHE A 1 212 ? 27.442 23.280 7.068   1.00 15.00 ? 212 PHE A CD1 1 
ATOM   1621 C CD2 . PHE A 1 212 ? 29.572 22.172 7.333   1.00 15.00 ? 212 PHE A CD2 1 
ATOM   1622 C CE1 . PHE A 1 212 ? 27.715 24.075 8.175   1.00 15.00 ? 212 PHE A CE1 1 
ATOM   1623 C CE2 . PHE A 1 212 ? 29.853 22.964 8.440   1.00 15.00 ? 212 PHE A CE2 1 
ATOM   1624 C CZ  . PHE A 1 212 ? 28.926 23.910 8.863   1.00 15.00 ? 212 PHE A CZ  1 
ATOM   1625 N N   . PRO A 1 213 ? 26.359 22.933 3.162   1.00 15.00 ? 213 PRO A N   1 
ATOM   1626 C CA  . PRO A 1 213 ? 25.612 24.137 2.797   1.00 15.00 ? 213 PRO A CA  1 
ATOM   1627 C C   . PRO A 1 213 ? 24.777 24.677 3.945   1.00 15.00 ? 213 PRO A C   1 
ATOM   1628 O O   . PRO A 1 213 ? 24.481 23.950 4.875   1.00 15.00 ? 213 PRO A O   1 
ATOM   1629 C CB  . PRO A 1 213 ? 24.727 23.617 1.679   1.00 15.00 ? 213 PRO A CB  1 
ATOM   1630 C CG  . PRO A 1 213 ? 24.361 22.233 2.183   1.00 15.00 ? 213 PRO A CG  1 
ATOM   1631 C CD  . PRO A 1 213 ? 25.557 21.715 2.894   1.00 15.00 ? 213 PRO A CD  1 
ATOM   1632 N N   . LYS A 1 214 ? 24.462 25.966 3.930   1.00 15.00 ? 214 LYS A N   1 
ATOM   1633 C CA  . LYS A 1 214 ? 23.580 26.553 4.967   1.00 15.00 ? 214 LYS A CA  1 
ATOM   1634 C C   . LYS A 1 214 ? 22.169 26.532 4.355   1.00 15.00 ? 214 LYS A C   1 
ATOM   1635 O O   . LYS A 1 214 ? 22.047 26.838 3.182   1.00 15.00 ? 214 LYS A O   1 
ATOM   1636 C CB  . LYS A 1 214 ? 23.963 28.018 5.242   1.00 15.00 ? 214 LYS A CB  1 
ATOM   1637 C CG  . LYS A 1 214 ? 25.261 28.237 6.051   1.00 15.00 ? 214 LYS A CG  1 
ATOM   1638 C CD  . LYS A 1 214 ? 25.832 29.679 5.826   1.00 15.00 ? 214 LYS A CD  1 
ATOM   1639 C CE  . LYS A 1 214 ? 27.333 29.775 6.260   1.00 15.00 ? 214 LYS A CE  1 
ATOM   1640 N NZ  . LYS A 1 214 ? 28.070 31.033 5.867   1.00 15.00 ? 214 LYS A NZ  1 
ATOM   1641 N N   . MET A 1 215 ? 21.106 26.242 5.113   1.00 15.00 ? 215 MET A N   1 
ATOM   1642 C CA  . MET A 1 215 ? 19.774 26.219 4.502   1.00 15.00 ? 215 MET A CA  1 
ATOM   1643 C C   . MET A 1 215 ? 18.716 26.842 5.449   1.00 15.00 ? 215 MET A C   1 
ATOM   1644 O O   . MET A 1 215 ? 17.582 27.124 4.995   1.00 15.00 ? 215 MET A O   1 
ATOM   1645 C CB  . MET A 1 215 ? 19.423 24.782 4.072   1.00 15.00 ? 215 MET A CB  1 
ATOM   1646 C CG  . MET A 1 215 ? 18.319 24.699 3.037   1.00 15.00 ? 215 MET A CG  1 
ATOM   1647 S SD  . MET A 1 215 ? 17.884 22.998 2.656   1.00 15.00 ? 215 MET A SD  1 
ATOM   1648 C CE  . MET A 1 215 ? 18.882 22.782 1.245   1.00 15.00 ? 215 MET A CE  1 
ATOM   1649 O OXT . MET A 1 215 ? 19.093 27.141 6.611   1.00 15.00 ? 215 MET A OXT 1 
HETATM 1650 C C1  . I10 B 2 .   ? 36.506 22.516 -10.583 1.00 15.00 ? 300 I10 A C1  1 
HETATM 1651 C C2  . I10 B 2 .   ? 37.009 21.251 -10.449 1.00 15.00 ? 300 I10 A C2  1 
HETATM 1652 C C3  . I10 B 2 .   ? 37.219 20.436 -11.471 1.00 15.00 ? 300 I10 A C3  1 
HETATM 1653 C C7  . I10 B 2 .   ? 37.729 19.056 -11.289 1.00 15.00 ? 300 I10 A C7  1 
HETATM 1654 C C8  . I10 B 2 .   ? 37.369 18.198 -10.231 1.00 15.00 ? 300 I10 A C8  1 
HETATM 1655 C C9  . I10 B 2 .   ? 37.775 16.820 -10.153 1.00 15.00 ? 300 I10 A C9  1 
HETATM 1656 C C10 . I10 B 2 .   ? 38.594 16.302 -11.207 1.00 15.00 ? 300 I10 A C10 1 
HETATM 1657 C C11 . I10 B 2 .   ? 38.966 17.172 -12.265 1.00 15.00 ? 300 I10 A C11 1 
HETATM 1658 C C12 . I10 B 2 .   ? 38.520 18.526 -12.273 1.00 15.00 ? 300 I10 A C12 1 
HETATM 1659 C C13 . I10 B 2 .   ? 37.126 15.944 -9.057  1.00 15.00 ? 300 I10 A C13 1 
HETATM 1660 C C14 . I10 B 2 .   ? 35.708 15.425 -9.576  1.00 15.00 ? 300 I10 A C14 1 
HETATM 1661 C C16 . I10 B 2 .   ? 36.927 16.722 -7.686  1.00 15.00 ? 300 I10 A C16 1 
HETATM 1662 C C20 . I10 B 2 .   ? 36.172 17.010 -5.192  1.00 15.00 ? 300 I10 A C20 1 
HETATM 1663 C C24 . I10 B 2 .   ? 37.212 14.903 -5.819  1.00 15.00 ? 300 I10 A C24 1 
HETATM 1664 N N29 . I10 B 2 .   ? 35.657 14.121 -10.038 1.00 15.00 ? 300 I10 A N29 1 
HETATM 1665 C C30 . I10 B 2 .   ? 34.446 13.427 -10.564 1.00 15.00 ? 300 I10 A C30 1 
HETATM 1666 C C31 . I10 B 2 .   ? 34.081 12.258 -9.630  1.00 15.00 ? 300 I10 A C31 1 
HETATM 1667 C C35 . I10 B 2 .   ? 35.264 11.326 -9.313  1.00 15.00 ? 300 I10 A C35 1 
HETATM 1668 C C4  . I10 B 2 .   ? 36.907 20.929 -12.703 1.00 15.00 ? 300 I10 A C4  1 
HETATM 1669 C C5  . I10 B 2 .   ? 36.396 22.200 -12.859 1.00 15.00 ? 300 I10 A C5  1 
HETATM 1670 C C6  . I10 B 2 .   ? 36.192 23.006 -11.791 1.00 15.00 ? 300 I10 A C6  1 
HETATM 1671 O O15 . I10 B 2 .   ? 34.753 16.176 -9.548  1.00 15.00 ? 300 I10 A O15 1 
HETATM 1672 C C17 . I10 B 2 .   ? 36.353 16.050 -6.388  1.00 15.00 ? 300 I10 A C17 1 
HETATM 1673 O O34 . I10 B 2 .   ? 33.063 11.480 -10.148 1.00 15.00 ? 300 I10 A O34 1 
HETATM 1674 N N36 . I10 B 2 .   ? 34.932 10.041 -8.720  1.00 15.00 ? 300 I10 A N36 1 
HETATM 1675 S S39 . I10 B 2 .   ? 35.253 8.501  -9.510  1.00 15.00 ? 300 I10 A S39 1 
HETATM 1676 O O40 . I10 B 2 .   ? 35.074 8.764  -10.933 1.00 15.00 ? 300 I10 A O40 1 
HETATM 1677 O O41 . I10 B 2 .   ? 34.411 7.557  -8.892  1.00 15.00 ? 300 I10 A O41 1 
HETATM 1678 C C42 . I10 B 2 .   ? 36.813 8.133  -9.171  1.00 15.00 ? 300 I10 A C42 1 
HETATM 1679 N N43 . I10 B 2 .   ? 37.073 7.364  -8.145  1.00 15.00 ? 300 I10 A N43 1 
HETATM 1680 C C44 . I10 B 2 .   ? 38.365 7.121  -7.818  1.00 15.00 ? 300 I10 A C44 1 
HETATM 1681 C C45 . I10 B 2 .   ? 39.428 7.686  -8.583  1.00 15.00 ? 300 I10 A C45 1 
HETATM 1682 C C46 . I10 B 2 .   ? 39.054 8.517  -9.691  1.00 15.00 ? 300 I10 A C46 1 
HETATM 1683 C C47 . I10 B 2 .   ? 37.703 8.726  -9.971  1.00 15.00 ? 300 I10 A C47 1 
HETATM 1684 H HN2 . I10 B 2 .   ? 36.456 13.561 -10.036 1.00 15.00 ? 300 I10 A HN2 1 
HETATM 1685 H HO3 . I10 B 2 .   ? 33.141 11.018 -10.976 1.00 15.00 ? 300 I10 A HO3 1 
HETATM 1686 H HN3 . I10 B 2 .   ? 34.586 10.152 -7.875  1.00 15.00 ? 300 I10 A HN3 1 
HETATM 1687 O O   . HOH C 3 .   ? 37.813 15.757 2.342   1.00 15.00 ? 316 HOH A O   1 
HETATM 1688 O O   . HOH C 3 .   ? 27.770 10.300 -2.118  1.00 15.00 ? 317 HOH A O   1 
HETATM 1689 O O   . HOH C 3 .   ? 29.376 10.574 -4.245  1.00 15.00 ? 318 HOH A O   1 
HETATM 1690 O O   . HOH C 3 .   ? 41.870 4.610  -1.559  1.00 15.00 ? 319 HOH A O   1 
HETATM 1691 O O   . HOH C 3 .   ? 34.405 21.480 -2.803  1.00 15.00 ? 320 HOH A O   1 
HETATM 1692 O O   . HOH C 3 .   ? 34.309 20.611 -0.088  1.00 15.00 ? 321 HOH A O   1 
HETATM 1693 O O   . HOH C 3 .   ? 29.128 21.850 -14.456 1.00 15.00 ? 322 HOH A O   1 
HETATM 1694 O O   . HOH C 3 .   ? 41.502 9.133  9.799   1.00 15.00 ? 323 HOH A O   1 
HETATM 1695 O O   . HOH C 3 .   ? 37.052 11.005 19.468  1.00 15.00 ? 324 HOH A O   1 
HETATM 1696 O O   . HOH C 3 .   ? 36.979 12.460 15.106  1.00 15.00 ? 325 HOH A O   1 
HETATM 1697 O O   . HOH C 3 .   ? 40.649 5.155  5.595   1.00 15.00 ? 326 HOH A O   1 
HETATM 1698 O O   . HOH C 3 .   ? 39.143 7.690  6.435   1.00 15.00 ? 327 HOH A O   1 
HETATM 1699 O O   . HOH C 3 .   ? 20.336 27.899 -13.502 1.00 15.00 ? 328 HOH A O   1 
HETATM 1700 O O   . HOH C 3 .   ? 19.513 32.871 -2.451  1.00 15.00 ? 329 HOH A O   1 
HETATM 1701 O O   . HOH C 3 .   ? 28.052 2.804  -3.638  1.00 15.00 ? 330 HOH A O   1 
HETATM 1702 O O   . HOH C 3 .   ? 38.247 12.966 -10.155 1.00 15.00 ? 331 HOH A O   1 
HETATM 1703 O O   . HOH C 3 .   ? 41.675 12.999 -11.003 1.00 15.00 ? 332 HOH A O   1 
HETATM 1704 O O   . HOH C 3 .   ? 41.222 20.001 -5.320  1.00 15.00 ? 333 HOH A O   1 
HETATM 1705 O O   . HOH C 3 .   ? 34.985 10.222 -13.670 1.00 15.00 ? 334 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  CYS 25  25  25  CYS CYS A . n 
A 1 26  TRP 26  26  26  TRP TRP A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  CYS 56  56  56  CYS CYS A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  CYS 63  63  63  CYS CYS A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  PHE 72  72  72  PHE PHE A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  MET 97  97  97  MET MET A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 PHE 142 142 142 PHE PHE A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 TYR 145 145 145 TYR TYR A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 CYS 155 155 155 CYS CYS A . n 
A 1 156 ASN 156 156 156 ASN ASN A . n 
A 1 157 SER 157 157 157 SER SER A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 TYR 169 169 169 TYR TYR A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 TRP 178 178 178 TRP TRP A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 TRP 184 184 184 TRP TRP A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 TRP 188 188 188 TRP TRP A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 ILE 194 194 194 ILE ILE A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 MET 196 196 196 MET MET A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ARG 198 198 198 ARG ARG A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 ASN 202 202 202 ASN ASN A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 MET 215 215 215 MET MET A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 I10 1  300 300 I10 I10 A . 
C 3 HOH 1  316 316 HOH HOH A . 
C 3 HOH 2  317 317 HOH HOH A . 
C 3 HOH 3  318 318 HOH HOH A . 
C 3 HOH 4  319 319 HOH HOH A . 
C 3 HOH 5  320 320 HOH HOH A . 
C 3 HOH 6  321 321 HOH HOH A . 
C 3 HOH 7  322 322 HOH HOH A . 
C 3 HOH 8  323 323 HOH HOH A . 
C 3 HOH 9  324 324 HOH HOH A . 
C 3 HOH 10 325 325 HOH HOH A . 
C 3 HOH 11 326 326 HOH HOH A . 
C 3 HOH 12 327 327 HOH HOH A . 
C 3 HOH 13 328 328 HOH HOH A . 
C 3 HOH 14 329 329 HOH HOH A . 
C 3 HOH 15 330 330 HOH HOH A . 
C 3 HOH 16 331 331 HOH HOH A . 
C 3 HOH 17 332 332 HOH HOH A . 
C 3 HOH 18 333 333 HOH HOH A . 
C 3 HOH 19 334 334 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-06-08 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source        
2 4 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.source'              
2 4 'Structure model' '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XENGEN 'data collection' .     ? 1 
CCP4   'data reduction'  .     ? 2 
X-PLOR 'model building'  3.851 ? 3 
X-PLOR refinement        3.851 ? 4 
XENGEN 'data reduction'  .     ? 5 
CCP4   'data scaling'    .     ? 6 
X-PLOR phasing           3.851 ? 7 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CE1 A TYR 98  ? ? CZ  A TYR 98  ? ? 1.292 1.381 -0.089 0.013 N 
2 1 CZ  A TYR 98  ? ? CE2 A TYR 98  ? ? 1.301 1.381 -0.080 0.013 N 
3 1 CE1 A PHE 142 ? ? CZ  A PHE 142 ? ? 1.255 1.369 -0.114 0.019 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 7   ? ? -68.93  2.33   
2 1 SER A 146 ? ? -142.01 -31.28 
3 1 GLN A 172 ? ? -96.80  -60.71 
4 1 LYS A 173 ? ? -151.61 70.94  
5 1 ALA A 197 ? ? -35.32  125.59 
6 1 ILE A 206 ? ? -37.45  -37.53 
7 1 LEU A 209 ? ? -143.77 52.43  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1-[2-(3-BIPHENYL)-4-METHYLVALERYL)]AMINO-3-(2-PYRIDYLSULFONYL)AMINO-2-PROPANONE' I10 
3 water                                                                             HOH 
#