data_1BHL
# 
_entry.id   1BHL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1BHL         pdb_00001bhl 10.2210/pdb1bhl/pdb 
WWPDB D_1000171766 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BHL 
_pdbx_database_status.recvd_initial_deposition_date   1998-06-10 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Maignan, S.'       1 
'Guilloteau, J.P.'  2 
'Zhou-Liu, Q.'      3 
'Clement-Mella, C.' 4 
'Mikol, V.'         5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
;
J.Mol.Biol. 282 359  368 1998 JMOBAK UK 0022-2836 0070 ? 9735293 10.1006/jmbi.1998.2002 
1       'Crystal Structure of the Catalytic Domain of HIV-1 Integrase: Similarity to Other Polynucleotidyl Transferases' Science 
266 1981 ?   1994 SCIEAS US 0036-8075 0038 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Maignan, S.'       1  ? 
primary 'Guilloteau, J.P.'  2  ? 
primary 'Zhou-Liu, Q.'      3  ? 
primary 'Clement-Mella, C.' 4  ? 
primary 'Mikol, V.'         5  ? 
1       'Dyda, F.'          6  ? 
1       'Hickman, A.B.'     7  ? 
1       'Jenkins, T.M.'     8  ? 
1       'Engelman, A.'      9  ? 
1       'Craigie, R.'       10 ? 
1       'Davies, D.R.'      11 ? 
# 
_cell.entry_id           1BHL 
_cell.length_a           72.500 
_cell.length_b           72.500 
_cell.length_c           65.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BHL 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'HIV-1 INTEGRASE' 16756.842 1  2.7.7.49 F185H 'CATALYTIC CORE DOMAIN, RESIDUES 50 - 212' 
'RESIDUES CAS 65 AND CAS 130 ARE CACODYLATED CYSTEINES' 
2 water   nat water             18.015    53 ?        ?     ?                                          ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;SPGIWQLD(CAS)THLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA
(CAS)WWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIA
TD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIK
QEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   PRO n 
1 3   GLY n 
1 4   ILE n 
1 5   TRP n 
1 6   GLN n 
1 7   LEU n 
1 8   ASP n 
1 9   CAS n 
1 10  THR n 
1 11  HIS n 
1 12  LEU n 
1 13  GLU n 
1 14  GLY n 
1 15  LYS n 
1 16  VAL n 
1 17  ILE n 
1 18  LEU n 
1 19  VAL n 
1 20  ALA n 
1 21  VAL n 
1 22  HIS n 
1 23  VAL n 
1 24  ALA n 
1 25  SER n 
1 26  GLY n 
1 27  TYR n 
1 28  ILE n 
1 29  GLU n 
1 30  ALA n 
1 31  GLU n 
1 32  VAL n 
1 33  ILE n 
1 34  PRO n 
1 35  ALA n 
1 36  GLU n 
1 37  THR n 
1 38  GLY n 
1 39  GLN n 
1 40  GLU n 
1 41  THR n 
1 42  ALA n 
1 43  TYR n 
1 44  PHE n 
1 45  LEU n 
1 46  LEU n 
1 47  LYS n 
1 48  LEU n 
1 49  ALA n 
1 50  GLY n 
1 51  ARG n 
1 52  TRP n 
1 53  PRO n 
1 54  VAL n 
1 55  LYS n 
1 56  THR n 
1 57  VAL n 
1 58  HIS n 
1 59  THR n 
1 60  ASP n 
1 61  ASN n 
1 62  GLY n 
1 63  SER n 
1 64  ASN n 
1 65  PHE n 
1 66  THR n 
1 67  SER n 
1 68  THR n 
1 69  THR n 
1 70  VAL n 
1 71  LYS n 
1 72  ALA n 
1 73  ALA n 
1 74  CAS n 
1 75  TRP n 
1 76  TRP n 
1 77  ALA n 
1 78  GLY n 
1 79  ILE n 
1 80  LYS n 
1 81  GLN n 
1 82  GLU n 
1 83  PHE n 
1 84  GLY n 
1 85  ILE n 
1 86  PRO n 
1 87  TYR n 
1 88  ASN n 
1 89  PRO n 
1 90  GLN n 
1 91  SER n 
1 92  GLN n 
1 93  GLY n 
1 94  VAL n 
1 95  ILE n 
1 96  GLU n 
1 97  SER n 
1 98  MET n 
1 99  ASN n 
1 100 LYS n 
1 101 GLU n 
1 102 LEU n 
1 103 LYS n 
1 104 LYS n 
1 105 ILE n 
1 106 ILE n 
1 107 GLY n 
1 108 GLN n 
1 109 VAL n 
1 110 ARG n 
1 111 ASP n 
1 112 GLN n 
1 113 ALA n 
1 114 GLU n 
1 115 HIS n 
1 116 LEU n 
1 117 LYS n 
1 118 THR n 
1 119 ALA n 
1 120 VAL n 
1 121 GLN n 
1 122 MET n 
1 123 ALA n 
1 124 VAL n 
1 125 PHE n 
1 126 ILE n 
1 127 HIS n 
1 128 ASN n 
1 129 HIS n 
1 130 LYS n 
1 131 ARG n 
1 132 LYS n 
1 133 GLY n 
1 134 GLY n 
1 135 ILE n 
1 136 GLY n 
1 137 GLY n 
1 138 TYR n 
1 139 SER n 
1 140 ALA n 
1 141 GLY n 
1 142 GLU n 
1 143 ARG n 
1 144 ILE n 
1 145 VAL n 
1 146 ASP n 
1 147 ILE n 
1 148 ILE n 
1 149 ALA n 
1 150 THR n 
1 151 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Lentivirus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus 1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11676 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            BL21 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-15B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   
'EXPRESSION CLONE FOR CORE, REFER TO PNAS USA, VOL. 90, PP. 3428-3432, APRIL 1993, AND PNAS USA 92, PP. 6057-6061, JUNE 1995' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    POL_HV1N5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P12497 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;FFREDLAFPQGKAREFSSEQTRANSPTRRELQVWGRDNNSLSEAGADRQGTVSFSFPQITLWQRPLVTIKIGGQLKEALL
DTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVGQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPI
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQ
DFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMT
KILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIV
LPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAELELAENREILKEPVHGVYYDPSKDL
IAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGAHTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEY
WQATWIPEWEFVNTPPLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQAIHLA
LQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDGLVSAGIRKVLFLDGI
DKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIE
AEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQV
RDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAKLLWKG
EGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1BHL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 151 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P12497 
_struct_ref_seq.db_align_beg                  772 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  922 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       57 
_struct_ref_seq.pdbx_auth_seq_align_end       207 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1BHL CAS A 9   ? UNP P12497 CYS 780 'modified residue'    65  1 
1 1BHL CAS A 74  ? UNP P12497 CYS 845 'modified residue'    130 2 
1 1BHL HIS A 129 ? UNP P12497 PHE 900 'engineered mutation' 185 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                      ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ? 'C4 H7 N O4'       133.103 
CAS 'L-peptide linking' n 'S-(DIMETHYLARSENIC)CYSTEINE' ? 'C5 H12 As N O2 S' 225.141 
CYS 'L-peptide linking' y CYSTEINE                      ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                     ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                       ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                     ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                         ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                       ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                        ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                    ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                 ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                       ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                        ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                     ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                      ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                        ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1BHL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.14 
_exptl_crystal.density_percent_sol   41.5 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '3-9% PEG 8000, 0.4M AMMONIUM SULFATE, 0.1M SODIUM CACODYLATE PH 6.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MACSCIENCE 
_diffrn_detector.pdbx_collection_date   1996-08-21 
_diffrn_detector.details                'DOUBLE FOCUSING MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ENRAF-NONIUS FR591' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BHL 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   10359 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            0.0430000 
_reflns.pdbx_Rsym_value              0.0430000 
_reflns.pdbx_netI_over_sigmaI        8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.25 
_reflns_shell.percent_possible_all   93.7 
_reflns_shell.Rmerge_I_obs           0.1530000 
_reflns_shell.pdbx_Rsym_value        0.1530000 
_reflns_shell.meanI_over_sigI_obs    7.3 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1BHL 
_refine.ls_number_reflns_obs                     10074 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.0 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    97.47 
_refine.ls_R_factor_obs                          0.2240000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2240000 
_refine.ls_R_factor_R_free                       0.2640000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7 
_refine.ls_number_reflns_R_free                  729 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               33.95 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1ITG' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1048 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             53 
_refine_hist.number_atoms_total               1101 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        15.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.2 
_refine_ls_shell.d_res_low                        2.3 
_refine_ls_shell.number_reflns_R_work             1079 
_refine_ls_shell.R_factor_R_work                  0.2024000 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2714000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            7 
_refine_ls_shell.number_reflns_R_free             83 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 ?                 ?            'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1BHL 
_struct.title                     'CACODYLATED CATALYTIC DOMAIN OF HIV-1 INTEGRASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BHL 
_struct_keywords.pdbx_keywords   'DNA INTEGRATION' 
_struct_keywords.text            
'DNA INTEGRATION, AIDS, POLYPROTEIN, HYDROLASE, ENDONUCLEASE, POLYNUCLEOTIDYL TRANSFERASE, DNA BINDING (VIRAL)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 38  ? ALA A 49  ? GLY A 94  ALA A 105 1 ? 12 
HELX_P HELX_P2 2 GLY A 62  ? PHE A 65  ? GLY A 118 PHE A 121 5 ? 4  
HELX_P HELX_P3 3 THR A 68  ? TRP A 76  ? THR A 124 TRP A 132 1 ? 9  
HELX_P HELX_P4 4 ASN A 99  ? VAL A 109 ? ASN A 155 VAL A 165 1 ? 11 
HELX_P HELX_P5 5 LEU A 116 ? HIS A 129 ? LEU A 172 HIS A 185 1 ? 14 
HELX_P HELX_P6 6 ALA A 140 ? ALA A 149 ? ALA A 196 ALA A 205 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A ASP 8  C ? ? ? 1_555 A CAS 9  N ? ? A ASP 64  A CAS 65  1_555 ? ? ? ? ? ? ? 1.318 ? ? 
covale2 covale both ? A CAS 9  C ? ? ? 1_555 A THR 10 N ? ? A CAS 65  A THR 66  1_555 ? ? ? ? ? ? ? 1.317 ? ? 
covale3 covale both ? A ALA 73 C ? ? ? 1_555 A CAS 74 N ? ? A ALA 129 A CAS 130 1_555 ? ? ? ? ? ? ? 1.335 ? ? 
covale4 covale both ? A CAS 74 C ? ? ? 1_555 A TRP 75 N ? ? A CAS 130 A TRP 131 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 56 ? HIS A 58 ? THR A 112 HIS A 114 
A 2 ILE A 4  ? ASP A 8  ? ILE A 60  ASP A 64  
A 3 VAL A 16 ? HIS A 22 ? VAL A 72  HIS A 78  
A 4 TYR A 27 ? ILE A 33 ? TYR A 83  ILE A 89  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 56 ? O THR A 112 N TRP A 5  ? N TRP A 61 
A 2 3 O GLN A 6  ? O GLN A 62  N VAL A 21 ? N VAL A 77 
A 3 4 O VAL A 16 ? O VAL A 72  N ILE A 33 ? N ILE A 89 
# 
_struct_site.id                   ACT 
_struct_site.pdbx_evidence_code   Unknown 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'ACTIVE SITE.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 ACT 2 ASP A 8  ? ASP A 64  . ? 1_555 ? 
2 ACT 2 ASP A 60 ? ASP A 116 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1BHL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BHL 
_atom_sites.fract_transf_matrix[1][1]   0.013793 
_atom_sites.fract_transf_matrix[1][2]   0.007963 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015927 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015198 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AS 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? -15.276 51.984 19.777 1.00 43.35 ? 57  SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? -14.910 51.903 18.327 1.00 43.16 ? 57  SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? -15.471 50.611 17.749 1.00 41.38 ? 57  SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? -15.249 49.528 18.293 1.00 41.55 ? 57  SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? -13.390 51.957 18.156 1.00 45.21 ? 57  SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? -13.020 51.905 16.789 1.00 48.52 ? 57  SER A OG  1 
ATOM   7    N  N   . PRO A 1 2   ? -16.215 50.714 16.633 1.00 39.27 ? 58  PRO A N   1 
ATOM   8    C  CA  . PRO A 1 2   ? -16.843 49.572 15.949 1.00 37.33 ? 58  PRO A CA  1 
ATOM   9    C  C   . PRO A 1 2   ? -15.916 48.574 15.250 1.00 35.30 ? 58  PRO A C   1 
ATOM   10   O  O   . PRO A 1 2   ? -16.360 47.484 14.901 1.00 34.13 ? 58  PRO A O   1 
ATOM   11   C  CB  . PRO A 1 2   ? -17.800 50.225 14.955 1.00 37.48 ? 58  PRO A CB  1 
ATOM   12   C  CG  . PRO A 1 2   ? -17.183 51.538 14.658 1.00 38.43 ? 58  PRO A CG  1 
ATOM   13   C  CD  . PRO A 1 2   ? -16.489 51.982 15.933 1.00 38.64 ? 58  PRO A CD  1 
ATOM   14   N  N   . GLY A 1 3   ? -14.649 48.945 15.065 1.00 32.30 ? 59  GLY A N   1 
ATOM   15   C  CA  . GLY A 1 3   ? -13.694 48.075 14.393 1.00 31.24 ? 59  GLY A CA  1 
ATOM   16   C  C   . GLY A 1 3   ? -12.805 47.245 15.300 1.00 30.23 ? 59  GLY A C   1 
ATOM   17   O  O   . GLY A 1 3   ? -11.973 46.495 14.789 1.00 30.17 ? 59  GLY A O   1 
ATOM   18   N  N   . ILE A 1 4   ? -12.973 47.372 16.623 1.00 28.70 ? 60  ILE A N   1 
ATOM   19   C  CA  . ILE A 1 4   ? -12.167 46.627 17.601 1.00 26.91 ? 60  ILE A CA  1 
ATOM   20   C  C   . ILE A 1 4   ? -12.728 45.274 18.052 1.00 24.76 ? 60  ILE A C   1 
ATOM   21   O  O   . ILE A 1 4   ? -13.892 45.164 18.457 1.00 23.29 ? 60  ILE A O   1 
ATOM   22   C  CB  . ILE A 1 4   ? -11.903 47.457 18.903 1.00 29.40 ? 60  ILE A CB  1 
ATOM   23   C  CG1 . ILE A 1 4   ? -11.319 48.823 18.547 1.00 28.04 ? 60  ILE A CG1 1 
ATOM   24   C  CG2 . ILE A 1 4   ? -10.897 46.718 19.807 1.00 26.11 ? 60  ILE A CG2 1 
ATOM   25   C  CD1 . ILE A 1 4   ? -11.608 49.897 19.588 1.00 28.23 ? 60  ILE A CD1 1 
ATOM   26   N  N   . TRP A 1 5   ? -11.875 44.257 17.973 1.00 22.73 ? 61  TRP A N   1 
ATOM   27   C  CA  . TRP A 1 5   ? -12.210 42.898 18.371 1.00 24.68 ? 61  TRP A CA  1 
ATOM   28   C  C   . TRP A 1 5   ? -11.137 42.383 19.338 1.00 25.57 ? 61  TRP A C   1 
ATOM   29   O  O   . TRP A 1 5   ? -9.977  42.834 19.318 1.00 25.64 ? 61  TRP A O   1 
ATOM   30   C  CB  . TRP A 1 5   ? -12.241 41.988 17.147 1.00 23.14 ? 61  TRP A CB  1 
ATOM   31   C  CG  . TRP A 1 5   ? -13.417 42.297 16.247 1.00 21.46 ? 61  TRP A CG  1 
ATOM   32   C  CD1 . TRP A 1 5   ? -13.531 43.338 15.383 1.00 20.44 ? 61  TRP A CD1 1 
ATOM   33   C  CD2 . TRP A 1 5   ? -14.634 41.562 16.164 1.00 20.61 ? 61  TRP A CD2 1 
ATOM   34   N  NE1 . TRP A 1 5   ? -14.760 43.296 14.753 1.00 24.70 ? 61  TRP A NE1 1 
ATOM   35   C  CE2 . TRP A 1 5   ? -15.453 42.212 15.217 1.00 21.82 ? 61  TRP A CE2 1 
ATOM   36   C  CE3 . TRP A 1 5   ? -15.118 40.405 16.808 1.00 22.52 ? 61  TRP A CE3 1 
ATOM   37   C  CZ2 . TRP A 1 5   ? -16.727 41.748 14.886 1.00 22.28 ? 61  TRP A CZ2 1 
ATOM   38   C  CZ3 . TRP A 1 5   ? -16.385 39.945 16.481 1.00 20.64 ? 61  TRP A CZ3 1 
ATOM   39   C  CH2 . TRP A 1 5   ? -17.174 40.613 15.527 1.00 19.53 ? 61  TRP A CH2 1 
ATOM   40   N  N   . GLN A 1 6   ? -11.534 41.430 20.165 1.00 24.31 ? 62  GLN A N   1 
ATOM   41   C  CA  . GLN A 1 6   ? -10.642 40.825 21.126 1.00 24.46 ? 62  GLN A CA  1 
ATOM   42   C  C   . GLN A 1 6   ? -10.655 39.348 20.751 1.00 25.42 ? 62  GLN A C   1 
ATOM   43   O  O   . GLN A 1 6   ? -11.706 38.790 20.473 1.00 25.12 ? 62  GLN A O   1 
ATOM   44   C  CB  . GLN A 1 6   ? -11.182 41.015 22.536 1.00 25.63 ? 62  GLN A CB  1 
ATOM   45   C  CG  . GLN A 1 6   ? -10.490 40.146 23.572 1.00 29.47 ? 62  GLN A CG  1 
ATOM   46   C  CD  . GLN A 1 6   ? -9.313  40.854 24.209 1.00 30.85 ? 62  GLN A CD  1 
ATOM   47   O  OE1 . GLN A 1 6   ? -9.226  42.082 24.165 1.00 30.21 ? 62  GLN A OE1 1 
ATOM   48   N  NE2 . GLN A 1 6   ? -8.411  40.085 24.823 1.00 31.54 ? 62  GLN A NE2 1 
ATOM   49   N  N   . LEU A 1 7   ? -9.492  38.703 20.748 1.00 25.35 ? 63  LEU A N   1 
ATOM   50   C  CA  . LEU A 1 7   ? -9.451  37.311 20.349 1.00 24.72 ? 63  LEU A CA  1 
ATOM   51   C  C   . LEU A 1 7   ? -8.518  36.524 21.256 1.00 24.56 ? 63  LEU A C   1 
ATOM   52   O  O   . LEU A 1 7   ? -7.368  36.920 21.445 1.00 22.57 ? 63  LEU A O   1 
ATOM   53   C  CB  . LEU A 1 7   ? -8.993  37.268 18.876 1.00 25.64 ? 63  LEU A CB  1 
ATOM   54   C  CG  . LEU A 1 7   ? -8.798  35.917 18.220 1.00 28.06 ? 63  LEU A CG  1 
ATOM   55   C  CD1 . LEU A 1 7   ? -10.029 35.070 18.481 1.00 28.96 ? 63  LEU A CD1 1 
ATOM   56   C  CD2 . LEU A 1 7   ? -8.573  36.088 16.695 1.00 27.92 ? 63  LEU A CD2 1 
ATOM   57   N  N   . ASP A 1 8   ? -9.023  35.423 21.821 1.00 27.08 ? 64  ASP A N   1 
ATOM   58   C  CA  . ASP A 1 8   ? -8.258  34.562 22.740 1.00 26.31 ? 64  ASP A CA  1 
ATOM   59   C  C   . ASP A 1 8   ? -8.679  33.108 22.650 1.00 26.99 ? 64  ASP A C   1 
ATOM   60   O  O   . ASP A 1 8   ? -9.728  32.764 22.107 1.00 26.54 ? 64  ASP A O   1 
ATOM   61   C  CB  . ASP A 1 8   ? -8.463  34.977 24.206 1.00 26.46 ? 64  ASP A CB  1 
ATOM   62   C  CG  . ASP A 1 8   ? -7.994  36.362 24.485 1.00 27.98 ? 64  ASP A CG  1 
ATOM   63   O  OD1 . ASP A 1 8   ? -6.808  36.525 24.832 1.00 29.54 ? 64  ASP A OD1 1 
ATOM   64   O  OD2 . ASP A 1 8   ? -8.810  37.290 24.360 1.00 28.77 ? 64  ASP A OD2 1 
HETATM 65   N  N   . CAS A 1 9   ? -7.861  32.245 23.218 1.00 27.85 ? 65  CAS A N   1 
HETATM 66   C  CA  . CAS A 1 9   ? -8.196  30.838 23.221 1.00 30.24 ? 65  CAS A CA  1 
HETATM 67   C  CB  . CAS A 1 9   ? -7.065  30.001 22.650 1.00 29.30 ? 65  CAS A CB  1 
HETATM 68   C  C   . CAS A 1 9   ? -8.437  30.453 24.673 1.00 31.56 ? 65  CAS A C   1 
HETATM 69   O  O   . CAS A 1 9   ? -7.861  31.032 25.586 1.00 31.93 ? 65  CAS A O   1 
HETATM 70   S  SG  . CAS A 1 9   ? -6.986  30.054 20.850 1.00 29.12 ? 65  CAS A SG  1 
HETATM 71   AS AS  . CAS A 1 9   ? -5.285  31.520 20.786 1.00 33.77 ? 65  CAS A AS  1 
HETATM 72   C  CE1 . CAS A 1 9   ? -4.226  30.623 19.486 1.00 30.89 ? 65  CAS A CE1 1 
HETATM 73   C  CE2 . CAS A 1 9   ? -6.111  33.029 19.868 1.00 29.21 ? 65  CAS A CE2 1 
ATOM   74   N  N   . THR A 1 10  ? -9.327  29.503 24.870 1.00 32.94 ? 66  THR A N   1 
ATOM   75   C  CA  . THR A 1 10  ? -9.630  29.022 26.188 1.00 37.37 ? 66  THR A CA  1 
ATOM   76   C  C   . THR A 1 10  ? -9.671  27.501 26.021 1.00 37.96 ? 66  THR A C   1 
ATOM   77   O  O   . THR A 1 10  ? -9.778  27.011 24.909 1.00 37.15 ? 66  THR A O   1 
ATOM   78   C  CB  . THR A 1 10  ? -10.965 29.637 26.702 1.00 37.82 ? 66  THR A CB  1 
ATOM   79   O  OG1 . THR A 1 10  ? -11.090 29.379 28.099 1.00 41.73 ? 66  THR A OG1 1 
ATOM   80   C  CG2 . THR A 1 10  ? -12.145 29.077 25.967 1.00 36.29 ? 66  THR A CG2 1 
ATOM   81   N  N   . HIS A 1 11  ? -9.549  26.757 27.111 1.00 39.94 ? 67  HIS A N   1 
ATOM   82   C  CA  . HIS A 1 11  ? -9.523  25.301 27.024 1.00 41.18 ? 67  HIS A CA  1 
ATOM   83   C  C   . HIS A 1 11  ? -10.632 24.602 27.796 1.00 41.04 ? 67  HIS A C   1 
ATOM   84   O  O   . HIS A 1 11  ? -11.037 25.035 28.869 1.00 40.90 ? 67  HIS A O   1 
ATOM   85   C  CB  . HIS A 1 11  ? -8.158  24.781 27.492 1.00 45.12 ? 67  HIS A CB  1 
ATOM   86   C  CG  . HIS A 1 11  ? -7.003  25.422 26.793 1.00 47.01 ? 67  HIS A CG  1 
ATOM   87   N  ND1 . HIS A 1 11  ? -6.267  24.772 25.827 1.00 48.61 ? 67  HIS A ND1 1 
ATOM   88   C  CD2 . HIS A 1 11  ? -6.496  26.676 26.874 1.00 47.94 ? 67  HIS A CD2 1 
ATOM   89   C  CE1 . HIS A 1 11  ? -5.360  25.599 25.341 1.00 48.91 ? 67  HIS A CE1 1 
ATOM   90   N  NE2 . HIS A 1 11  ? -5.479  26.761 25.957 1.00 47.73 ? 67  HIS A NE2 1 
ATOM   91   N  N   . LEU A 1 12  ? -11.104 23.504 27.224 1.00 41.64 ? 68  LEU A N   1 
ATOM   92   C  CA  . LEU A 1 12  ? -12.183 22.713 27.795 1.00 41.32 ? 68  LEU A CA  1 
ATOM   93   C  C   . LEU A 1 12  ? -12.099 21.292 27.251 1.00 40.93 ? 68  LEU A C   1 
ATOM   94   O  O   . LEU A 1 12  ? -11.929 21.085 26.042 1.00 40.85 ? 68  LEU A O   1 
ATOM   95   C  CB  . LEU A 1 12  ? -13.533 23.320 27.403 1.00 41.52 ? 68  LEU A CB  1 
ATOM   96   C  CG  . LEU A 1 12  ? -14.753 23.216 28.317 1.00 41.08 ? 68  LEU A CG  1 
ATOM   97   C  CD1 . LEU A 1 12  ? -14.365 23.446 29.786 1.00 40.38 ? 68  LEU A CD1 1 
ATOM   98   C  CD2 . LEU A 1 12  ? -15.753 24.252 27.864 1.00 41.18 ? 68  LEU A CD2 1 
ATOM   99   N  N   . GLU A 1 13  ? -12.210 20.322 28.152 1.00 40.80 ? 69  GLU A N   1 
ATOM   100  C  CA  . GLU A 1 13  ? -12.168 18.914 27.782 1.00 40.85 ? 69  GLU A CA  1 
ATOM   101  C  C   . GLU A 1 13  ? -11.020 18.610 26.824 1.00 41.53 ? 69  GLU A C   1 
ATOM   102  O  O   . GLU A 1 13  ? -11.222 17.918 25.832 1.00 43.13 ? 69  GLU A O   1 
ATOM   103  C  CB  . GLU A 1 13  ? -13.496 18.500 27.126 1.00 40.44 ? 69  GLU A CB  1 
ATOM   104  C  CG  . GLU A 1 13  ? -14.747 18.956 27.882 1.00 38.24 ? 69  GLU A CG  1 
ATOM   105  C  CD  . GLU A 1 13  ? -16.043 18.539 27.198 1.00 39.52 ? 69  GLU A CD  1 
ATOM   106  O  OE1 . GLU A 1 13  ? -15.997 17.816 26.173 1.00 39.18 ? 69  GLU A OE1 1 
ATOM   107  O  OE2 . GLU A 1 13  ? -17.115 18.939 27.689 1.00 37.47 ? 69  GLU A OE2 1 
ATOM   108  N  N   . GLY A 1 14  ? -9.833  19.142 27.113 1.00 42.67 ? 70  GLY A N   1 
ATOM   109  C  CA  . GLY A 1 14  ? -8.665  18.897 26.273 1.00 42.69 ? 70  GLY A CA  1 
ATOM   110  C  C   . GLY A 1 14  ? -8.736  19.449 24.859 1.00 43.16 ? 70  GLY A C   1 
ATOM   111  O  O   . GLY A 1 14  ? -7.903  19.115 23.988 1.00 42.34 ? 70  GLY A O   1 
ATOM   112  N  N   . LYS A 1 15  ? -9.741  20.291 24.627 1.00 42.42 ? 71  LYS A N   1 
ATOM   113  C  CA  . LYS A 1 15  ? -9.957  20.921 23.326 1.00 40.37 ? 71  LYS A CA  1 
ATOM   114  C  C   . LYS A 1 15  ? -9.680  22.418 23.445 1.00 37.59 ? 71  LYS A C   1 
ATOM   115  O  O   . LYS A 1 15  ? -9.617  22.964 24.537 1.00 39.28 ? 71  LYS A O   1 
ATOM   116  C  CB  . LYS A 1 15  ? -11.401 20.685 22.868 1.00 41.83 ? 71  LYS A CB  1 
ATOM   117  C  CG  . LYS A 1 15  ? -11.893 19.263 23.074 0.00 43.25 ? 71  LYS A CG  1 
ATOM   118  C  CD  . LYS A 1 15  ? -12.358 18.646 21.766 0.00 44.61 ? 71  LYS A CD  1 
ATOM   119  C  CE  . LYS A 1 15  ? -12.422 17.130 21.861 0.00 45.47 ? 71  LYS A CE  1 
ATOM   120  N  NZ  . LYS A 1 15  ? -13.826 16.640 21.936 0.00 45.67 ? 71  LYS A NZ  1 
ATOM   121  N  N   . VAL A 1 16  ? -9.520  23.087 22.316 1.00 35.78 ? 72  VAL A N   1 
ATOM   122  C  CA  . VAL A 1 16  ? -9.247  24.503 22.325 1.00 31.84 ? 72  VAL A CA  1 
ATOM   123  C  C   . VAL A 1 16  ? -10.402 25.289 21.718 1.00 29.83 ? 72  VAL A C   1 
ATOM   124  O  O   . VAL A 1 16  ? -10.912 24.942 20.657 1.00 27.53 ? 72  VAL A O   1 
ATOM   125  C  CB  . VAL A 1 16  ? -7.960  24.789 21.545 1.00 32.37 ? 72  VAL A CB  1 
ATOM   126  C  CG1 . VAL A 1 16  ? -7.706  26.272 21.496 1.00 30.18 ? 72  VAL A CG1 1 
ATOM   127  C  CG2 . VAL A 1 16  ? -6.796  24.042 22.195 1.00 32.53 ? 72  VAL A CG2 1 
ATOM   128  N  N   . ILE A 1 17  ? -10.819 26.355 22.393 1.00 28.55 ? 73  ILE A N   1 
ATOM   129  C  CA  . ILE A 1 17  ? -11.913 27.164 21.857 1.00 26.55 ? 73  ILE A CA  1 
ATOM   130  C  C   . ILE A 1 17  ? -11.417 28.548 21.552 1.00 24.99 ? 73  ILE A C   1 
ATOM   131  O  O   . ILE A 1 17  ? -10.900 29.237 22.428 1.00 24.82 ? 73  ILE A O   1 
ATOM   132  C  CB  . ILE A 1 17  ? -13.123 27.280 22.830 1.00 26.25 ? 73  ILE A CB  1 
ATOM   133  C  CG1 . ILE A 1 17  ? -13.594 25.879 23.257 1.00 25.46 ? 73  ILE A CG1 1 
ATOM   134  C  CG2 . ILE A 1 17  ? -14.266 28.031 22.131 1.00 22.06 ? 73  ILE A CG2 1 
ATOM   135  C  CD1 . ILE A 1 17  ? -14.358 25.882 24.563 1.00 31.25 ? 73  ILE A CD1 1 
ATOM   136  N  N   . LEU A 1 18  ? -11.555 28.924 20.286 1.00 26.15 ? 74  LEU A N   1 
ATOM   137  C  CA  . LEU A 1 18  ? -11.157 30.229 19.795 1.00 27.20 ? 74  LEU A CA  1 
ATOM   138  C  C   . LEU A 1 18  ? -12.369 31.116 20.043 1.00 26.36 ? 74  LEU A C   1 
ATOM   139  O  O   . LEU A 1 18  ? -13.462 30.781 19.631 1.00 24.37 ? 74  LEU A O   1 
ATOM   140  C  CB  . LEU A 1 18  ? -10.818 30.144 18.292 1.00 29.35 ? 74  LEU A CB  1 
ATOM   141  C  CG  . LEU A 1 18  ? -9.766  31.091 17.691 1.00 32.97 ? 74  LEU A CG  1 
ATOM   142  C  CD1 . LEU A 1 18  ? -8.968  31.738 18.774 1.00 36.88 ? 74  LEU A CD1 1 
ATOM   143  C  CD2 . LEU A 1 18  ? -8.847  30.328 16.775 1.00 35.77 ? 74  LEU A CD2 1 
ATOM   144  N  N   . VAL A 1 19  ? -12.178 32.228 20.756 1.00 26.08 ? 75  VAL A N   1 
ATOM   145  C  CA  . VAL A 1 19  ? -13.289 33.131 21.059 1.00 25.70 ? 75  VAL A CA  1 
ATOM   146  C  C   . VAL A 1 19  ? -12.989 34.567 20.601 1.00 25.72 ? 75  VAL A C   1 
ATOM   147  O  O   . VAL A 1 19  ? -11.954 35.130 20.969 1.00 23.68 ? 75  VAL A O   1 
ATOM   148  C  CB  . VAL A 1 19  ? -13.581 33.204 22.602 1.00 26.61 ? 75  VAL A CB  1 
ATOM   149  C  CG1 . VAL A 1 19  ? -14.919 33.952 22.838 1.00 27.80 ? 75  VAL A CG1 1 
ATOM   150  C  CG2 . VAL A 1 19  ? -13.659 31.785 23.214 1.00 24.74 ? 75  VAL A CG2 1 
ATOM   151  N  N   . ALA A 1 20  ? -13.885 35.142 19.796 1.00 24.75 ? 76  ALA A N   1 
ATOM   152  C  CA  . ALA A 1 20  ? -13.736 36.528 19.344 1.00 23.56 ? 76  ALA A CA  1 
ATOM   153  C  C   . ALA A 1 20  ? -14.894 37.339 19.946 1.00 23.85 ? 76  ALA A C   1 
ATOM   154  O  O   . ALA A 1 20  ? -16.070 36.904 19.919 1.00 24.07 ? 76  ALA A O   1 
ATOM   155  C  CB  . ALA A 1 20  ? -13.779 36.619 17.815 1.00 22.34 ? 76  ALA A CB  1 
ATOM   156  N  N   . VAL A 1 21  ? -14.554 38.523 20.457 1.00 21.04 ? 77  VAL A N   1 
ATOM   157  C  CA  . VAL A 1 21  ? -15.524 39.409 21.072 1.00 21.10 ? 77  VAL A CA  1 
ATOM   158  C  C   . VAL A 1 21  ? -15.455 40.782 20.429 1.00 22.30 ? 77  VAL A C   1 
ATOM   159  O  O   . VAL A 1 21  ? -14.387 41.378 20.314 1.00 21.36 ? 77  VAL A O   1 
ATOM   160  C  CB  . VAL A 1 21  ? -15.286 39.557 22.613 1.00 20.81 ? 77  VAL A CB  1 
ATOM   161  C  CG1 . VAL A 1 21  ? -16.447 40.323 23.249 1.00 21.50 ? 77  VAL A CG1 1 
ATOM   162  C  CG2 . VAL A 1 21  ? -15.162 38.163 23.260 1.00 19.67 ? 77  VAL A CG2 1 
ATOM   163  N  N   . HIS A 1 22  ? -16.599 41.241 19.947 1.00 21.51 ? 78  HIS A N   1 
ATOM   164  C  CA  . HIS A 1 22  ? -16.678 42.566 19.376 1.00 23.62 ? 78  HIS A CA  1 
ATOM   165  C  C   . HIS A 1 22  ? -16.847 43.430 20.639 1.00 24.67 ? 78  HIS A C   1 
ATOM   166  O  O   . HIS A 1 22  ? -17.903 43.423 21.297 1.00 23.30 ? 78  HIS A O   1 
ATOM   167  C  CB  . HIS A 1 22  ? -17.902 42.670 18.475 1.00 21.68 ? 78  HIS A CB  1 
ATOM   168  C  CG  . HIS A 1 22  ? -18.082 44.026 17.876 1.00 21.97 ? 78  HIS A CG  1 
ATOM   169  N  ND1 . HIS A 1 22  ? -19.156 44.837 18.168 1.00 23.14 ? 78  HIS A ND1 1 
ATOM   170  C  CD2 . HIS A 1 22  ? -17.327 44.704 16.987 1.00 21.50 ? 78  HIS A CD2 1 
ATOM   171  C  CE1 . HIS A 1 22  ? -19.056 45.958 17.477 1.00 22.89 ? 78  HIS A CE1 1 
ATOM   172  N  NE2 . HIS A 1 22  ? -17.954 45.901 16.750 1.00 23.68 ? 78  HIS A NE2 1 
ATOM   173  N  N   . VAL A 1 23  ? -15.786 44.136 20.995 1.00 28.01 ? 79  VAL A N   1 
ATOM   174  C  CA  . VAL A 1 23  ? -15.768 44.932 22.220 1.00 29.74 ? 79  VAL A CA  1 
ATOM   175  C  C   . VAL A 1 23  ? -16.952 45.848 22.508 1.00 30.98 ? 79  VAL A C   1 
ATOM   176  O  O   . VAL A 1 23  ? -17.547 45.782 23.583 1.00 31.58 ? 79  VAL A O   1 
ATOM   177  C  CB  . VAL A 1 23  ? -14.477 45.780 22.292 1.00 32.31 ? 79  VAL A CB  1 
ATOM   178  C  CG1 . VAL A 1 23  ? -14.383 46.464 23.657 1.00 31.49 ? 79  VAL A CG1 1 
ATOM   179  C  CG2 . VAL A 1 23  ? -13.266 44.893 22.055 1.00 32.89 ? 79  VAL A CG2 1 
ATOM   180  N  N   . ALA A 1 24  ? -17.295 46.697 21.551 1.00 30.70 ? 80  ALA A N   1 
ATOM   181  C  CA  . ALA A 1 24  ? -18.381 47.652 21.743 1.00 31.77 ? 80  ALA A CA  1 
ATOM   182  C  C   . ALA A 1 24  ? -19.759 47.042 22.010 1.00 31.86 ? 80  ALA A C   1 
ATOM   183  O  O   . ALA A 1 24  ? -20.593 47.641 22.694 1.00 33.64 ? 80  ALA A O   1 
ATOM   184  C  CB  . ALA A 1 24  ? -18.449 48.600 20.528 1.00 27.87 ? 80  ALA A CB  1 
ATOM   185  N  N   . SER A 1 25  ? -19.995 45.846 21.487 1.00 31.67 ? 81  SER A N   1 
ATOM   186  C  CA  . SER A 1 25  ? -21.304 45.205 21.637 1.00 29.24 ? 81  SER A CA  1 
ATOM   187  C  C   . SER A 1 25  ? -21.372 43.974 22.522 1.00 28.42 ? 81  SER A C   1 
ATOM   188  O  O   . SER A 1 25  ? -22.434 43.667 23.030 1.00 29.49 ? 81  SER A O   1 
ATOM   189  C  CB  . SER A 1 25  ? -21.833 44.808 20.266 1.00 30.59 ? 81  SER A CB  1 
ATOM   190  O  OG  . SER A 1 25  ? -20.993 43.812 19.693 1.00 26.60 ? 81  SER A OG  1 
ATOM   191  N  N   . GLY A 1 26  ? -20.259 43.268 22.710 1.00 26.25 ? 82  GLY A N   1 
ATOM   192  C  CA  . GLY A 1 26  ? -20.306 42.050 23.516 1.00 24.14 ? 82  GLY A CA  1 
ATOM   193  C  C   . GLY A 1 26  ? -20.653 40.823 22.669 1.00 23.74 ? 82  GLY A C   1 
ATOM   194  O  O   . GLY A 1 26  ? -20.764 39.709 23.178 1.00 22.67 ? 82  GLY A O   1 
ATOM   195  N  N   . TYR A 1 27  ? -20.847 41.033 21.363 1.00 23.54 ? 83  TYR A N   1 
ATOM   196  C  CA  . TYR A 1 27  ? -21.152 39.943 20.417 1.00 22.10 ? 83  TYR A CA  1 
ATOM   197  C  C   . TYR A 1 27  ? -19.950 38.984 20.323 1.00 22.87 ? 83  TYR A C   1 
ATOM   198  O  O   . TYR A 1 27  ? -18.811 39.435 20.288 1.00 23.15 ? 83  TYR A O   1 
ATOM   199  C  CB  . TYR A 1 27  ? -21.423 40.552 19.036 1.00 21.87 ? 83  TYR A CB  1 
ATOM   200  C  CG  . TYR A 1 27  ? -21.355 39.578 17.856 1.00 23.95 ? 83  TYR A CG  1 
ATOM   201  C  CD1 . TYR A 1 27  ? -20.141 39.327 17.221 1.00 21.18 ? 83  TYR A CD1 1 
ATOM   202  C  CD2 . TYR A 1 27  ? -22.503 38.904 17.392 1.00 19.81 ? 83  TYR A CD2 1 
ATOM   203  C  CE1 . TYR A 1 27  ? -20.048 38.432 16.164 1.00 22.61 ? 83  TYR A CE1 1 
ATOM   204  C  CE2 . TYR A 1 27  ? -22.424 37.984 16.310 1.00 24.00 ? 83  TYR A CE2 1 
ATOM   205  C  CZ  . TYR A 1 27  ? -21.168 37.765 15.717 1.00 23.48 ? 83  TYR A CZ  1 
ATOM   206  O  OH  . TYR A 1 27  ? -20.978 36.844 14.725 1.00 26.28 ? 83  TYR A OH  1 
ATOM   207  N  N   . ILE A 1 28  ? -20.176 37.673 20.335 1.00 23.85 ? 84  ILE A N   1 
ATOM   208  C  CA  . ILE A 1 28  ? -19.048 36.767 20.149 1.00 25.76 ? 84  ILE A CA  1 
ATOM   209  C  C   . ILE A 1 28  ? -19.276 35.754 19.011 1.00 26.68 ? 84  ILE A C   1 
ATOM   210  O  O   . ILE A 1 28  ? -20.404 35.515 18.579 1.00 24.14 ? 84  ILE A O   1 
ATOM   211  C  CB  . ILE A 1 28  ? -18.647 35.945 21.439 1.00 27.84 ? 84  ILE A CB  1 
ATOM   212  C  CG1 . ILE A 1 28  ? -19.360 34.599 21.448 1.00 29.29 ? 84  ILE A CG1 1 
ATOM   213  C  CG2 . ILE A 1 28  ? -18.882 36.743 22.721 1.00 28.93 ? 84  ILE A CG2 1 
ATOM   214  C  CD1 . ILE A 1 28  ? -20.591 34.546 22.312 1.00 30.48 ? 84  ILE A CD1 1 
ATOM   215  N  N   . GLU A 1 29  ? -18.164 35.198 18.538 1.00 25.69 ? 85  GLU A N   1 
ATOM   216  C  CA  . GLU A 1 29  ? -18.116 34.159 17.517 1.00 28.16 ? 85  GLU A CA  1 
ATOM   217  C  C   . GLU A 1 29  ? -17.097 33.193 18.095 1.00 27.68 ? 85  GLU A C   1 
ATOM   218  O  O   . GLU A 1 29  ? -16.100 33.630 18.666 1.00 27.10 ? 85  GLU A O   1 
ATOM   219  C  CB  . GLU A 1 29  ? -17.590 34.693 16.168 1.00 26.95 ? 85  GLU A CB  1 
ATOM   220  C  CG  . GLU A 1 29  ? -18.688 35.201 15.291 1.00 30.69 ? 85  GLU A CG  1 
ATOM   221  C  CD  . GLU A 1 29  ? -18.221 35.701 13.919 1.00 31.96 ? 85  GLU A CD  1 
ATOM   222  O  OE1 . GLU A 1 29  ? -17.165 35.272 13.432 1.00 29.59 ? 85  GLU A OE1 1 
ATOM   223  O  OE2 . GLU A 1 29  ? -18.933 36.527 13.324 1.00 33.13 ? 85  GLU A OE2 1 
ATOM   224  N  N   . ALA A 1 30  ? -17.332 31.891 17.956 1.00 28.84 ? 86  ALA A N   1 
ATOM   225  C  CA  . ALA A 1 30  ? -16.382 30.922 18.473 1.00 29.71 ? 86  ALA A CA  1 
ATOM   226  C  C   . ALA A 1 30  ? -16.207 29.715 17.566 1.00 31.43 ? 86  ALA A C   1 
ATOM   227  O  O   . ALA A 1 30  ? -17.058 29.406 16.723 1.00 34.01 ? 86  ALA A O   1 
ATOM   228  C  CB  . ALA A 1 30  ? -16.790 30.470 19.857 1.00 30.65 ? 86  ALA A CB  1 
ATOM   229  N  N   . GLU A 1 31  ? -15.086 29.035 17.755 1.00 31.81 ? 87  GLU A N   1 
ATOM   230  C  CA  . GLU A 1 31  ? -14.750 27.858 16.987 1.00 32.97 ? 87  GLU A CA  1 
ATOM   231  C  C   . GLU A 1 31  ? -13.955 26.921 17.887 1.00 33.26 ? 87  GLU A C   1 
ATOM   232  O  O   . GLU A 1 31  ? -13.133 27.363 18.697 1.00 29.85 ? 87  GLU A O   1 
ATOM   233  C  CB  . GLU A 1 31  ? -13.895 28.253 15.787 1.00 36.32 ? 87  GLU A CB  1 
ATOM   234  C  CG  . GLU A 1 31  ? -14.049 27.356 14.609 1.00 38.48 ? 87  GLU A CG  1 
ATOM   235  C  CD  . GLU A 1 31  ? -15.337 27.620 13.877 1.00 41.62 ? 87  GLU A CD  1 
ATOM   236  O  OE1 . GLU A 1 31  ? -15.635 28.803 13.613 1.00 42.49 ? 87  GLU A OE1 1 
ATOM   237  O  OE2 . GLU A 1 31  ? -16.051 26.643 13.568 1.00 42.83 ? 87  GLU A OE2 1 
ATOM   238  N  N   . VAL A 1 32  ? -14.210 25.630 17.756 1.00 32.30 ? 88  VAL A N   1 
ATOM   239  C  CA  . VAL A 1 32  ? -13.482 24.651 18.535 1.00 35.28 ? 88  VAL A CA  1 
ATOM   240  C  C   . VAL A 1 32  ? -12.421 24.140 17.589 1.00 35.99 ? 88  VAL A C   1 
ATOM   241  O  O   . VAL A 1 32  ? -12.743 23.653 16.510 1.00 35.72 ? 88  VAL A O   1 
ATOM   242  C  CB  . VAL A 1 32  ? -14.371 23.458 18.988 1.00 33.94 ? 88  VAL A CB  1 
ATOM   243  C  CG1 . VAL A 1 32  ? -13.496 22.315 19.504 1.00 30.99 ? 88  VAL A CG1 1 
ATOM   244  C  CG2 . VAL A 1 32  ? -15.305 23.914 20.086 1.00 34.91 ? 88  VAL A CG2 1 
ATOM   245  N  N   . ILE A 1 33  ? -11.156 24.285 17.974 1.00 37.63 ? 89  ILE A N   1 
ATOM   246  C  CA  . ILE A 1 33  ? -10.073 23.809 17.133 1.00 39.78 ? 89  ILE A CA  1 
ATOM   247  C  C   . ILE A 1 33  ? -9.283  22.693 17.833 1.00 41.55 ? 89  ILE A C   1 
ATOM   248  O  O   . ILE A 1 33  ? -9.348  22.532 19.064 1.00 40.84 ? 89  ILE A O   1 
ATOM   249  C  CB  . ILE A 1 33  ? -9.145  24.971 16.717 1.00 40.74 ? 89  ILE A CB  1 
ATOM   250  C  CG1 . ILE A 1 33  ? -8.666  25.747 17.942 1.00 38.60 ? 89  ILE A CG1 1 
ATOM   251  C  CG2 . ILE A 1 33  ? -9.893  25.925 15.790 1.00 39.71 ? 89  ILE A CG2 1 
ATOM   252  C  CD1 . ILE A 1 33  ? -7.547  26.711 17.633 1.00 35.75 ? 89  ILE A CD1 1 
ATOM   253  N  N   . PRO A 1 34  ? -8.540  21.888 17.053 1.00 43.26 ? 90  PRO A N   1 
ATOM   254  C  CA  . PRO A 1 34  ? -7.766  20.799 17.656 1.00 43.98 ? 90  PRO A CA  1 
ATOM   255  C  C   . PRO A 1 34  ? -6.687  21.374 18.552 1.00 44.63 ? 90  PRO A C   1 
ATOM   256  O  O   . PRO A 1 34  ? -6.629  21.074 19.759 1.00 44.46 ? 90  PRO A O   1 
ATOM   257  C  CB  . PRO A 1 34  ? -7.183  20.050 16.457 1.00 44.80 ? 90  PRO A CB  1 
ATOM   258  C  CG  . PRO A 1 34  ? -7.943  20.553 15.270 1.00 43.56 ? 90  PRO A CG  1 
ATOM   259  C  CD  . PRO A 1 34  ? -8.346  21.950 15.597 1.00 44.56 ? 90  PRO A CD  1 
ATOM   260  N  N   . ALA A 1 35  ? -5.854  22.232 17.969 1.00 44.36 ? 91  ALA A N   1 
ATOM   261  C  CA  . ALA A 1 35  ? -4.782  22.838 18.740 1.00 43.97 ? 91  ALA A CA  1 
ATOM   262  C  C   . ALA A 1 35  ? -4.623  24.316 18.474 1.00 42.07 ? 91  ALA A C   1 
ATOM   263  O  O   . ALA A 1 35  ? -5.040  24.813 17.444 1.00 43.45 ? 91  ALA A O   1 
ATOM   264  C  CB  . ALA A 1 35  ? -3.465  22.117 18.459 1.00 44.26 ? 91  ALA A CB  1 
ATOM   265  N  N   . GLU A 1 36  ? -4.011  24.988 19.441 1.00 39.74 ? 92  GLU A N   1 
ATOM   266  C  CA  . GLU A 1 36  ? -3.715  26.409 19.430 1.00 40.27 ? 92  GLU A CA  1 
ATOM   267  C  C   . GLU A 1 36  ? -2.606  26.713 18.441 1.00 40.62 ? 92  GLU A C   1 
ATOM   268  O  O   . GLU A 1 36  ? -1.493  27.004 18.865 1.00 43.20 ? 92  GLU A O   1 
ATOM   269  C  CB  . GLU A 1 36  ? -3.229  26.821 20.818 1.00 41.10 ? 92  GLU A CB  1 
ATOM   270  C  CG  . GLU A 1 36  ? -3.747  28.122 21.354 1.00 42.29 ? 92  GLU A CG  1 
ATOM   271  C  CD  . GLU A 1 36  ? -3.730  28.167 22.866 1.00 44.28 ? 92  GLU A CD  1 
ATOM   272  O  OE1 . GLU A 1 36  ? -4.061  27.147 23.501 1.00 44.79 ? 92  GLU A OE1 1 
ATOM   273  O  OE2 . GLU A 1 36  ? -3.383  29.224 23.434 1.00 49.38 ? 92  GLU A OE2 1 
ATOM   274  N  N   . THR A 1 37  ? -2.887  26.661 17.141 1.00 38.97 ? 93  THR A N   1 
ATOM   275  C  CA  . THR A 1 37  ? -1.859  26.949 16.143 1.00 38.08 ? 93  THR A CA  1 
ATOM   276  C  C   . THR A 1 37  ? -2.053  28.296 15.442 1.00 36.37 ? 93  THR A C   1 
ATOM   277  O  O   . THR A 1 37  ? -3.165  28.834 15.394 1.00 34.58 ? 93  THR A O   1 
ATOM   278  C  CB  . THR A 1 37  ? -1.826  25.874 15.052 1.00 39.16 ? 93  THR A CB  1 
ATOM   279  O  OG1 . THR A 1 37  ? -2.959  26.034 14.185 1.00 40.88 ? 93  THR A OG1 1 
ATOM   280  C  CG2 . THR A 1 37  ? -1.872  24.475 15.676 1.00 41.89 ? 93  THR A CG2 1 
ATOM   281  N  N   . GLY A 1 38  ? -0.959  28.822 14.896 1.00 33.86 ? 94  GLY A N   1 
ATOM   282  C  CA  . GLY A 1 38  ? -0.994  30.088 14.179 1.00 33.00 ? 94  GLY A CA  1 
ATOM   283  C  C   . GLY A 1 38  ? -1.818  29.976 12.906 1.00 30.81 ? 94  GLY A C   1 
ATOM   284  O  O   . GLY A 1 38  ? -2.475  30.936 12.495 1.00 31.05 ? 94  GLY A O   1 
ATOM   285  N  N   . GLN A 1 39  ? -1.785  28.802 12.284 1.00 29.02 ? 95  GLN A N   1 
ATOM   286  C  CA  . GLN A 1 39  ? -2.560  28.562 11.080 1.00 30.21 ? 95  GLN A CA  1 
ATOM   287  C  C   . GLN A 1 39  ? -4.063  28.620 11.434 1.00 28.94 ? 95  GLN A C   1 
ATOM   288  O  O   . GLN A 1 39  ? -4.860  29.115 10.667 1.00 25.34 ? 95  GLN A O   1 
ATOM   289  C  CB  . GLN A 1 39  ? -2.209  27.187 10.480 1.00 32.10 ? 95  GLN A CB  1 
ATOM   290  C  CG  . GLN A 1 39  ? -0.757  27.060 10.036 0.00 32.25 ? 95  GLN A CG  1 
ATOM   291  C  CD  . GLN A 1 39  ? -0.439  25.703 9.437  0.00 32.65 ? 95  GLN A CD  1 
ATOM   292  O  OE1 . GLN A 1 39  ? 0.689   25.449 9.011  0.00 33.18 ? 95  GLN A OE1 1 
ATOM   293  N  NE2 . GLN A 1 39  ? -1.432  24.822 9.400  0.00 33.01 ? 95  GLN A NE2 1 
ATOM   294  N  N   . GLU A 1 40  ? -4.447  28.115 12.604 1.00 28.98 ? 96  GLU A N   1 
ATOM   295  C  CA  . GLU A 1 40  ? -5.855  28.171 12.996 1.00 26.83 ? 96  GLU A CA  1 
ATOM   296  C  C   . GLU A 1 40  ? -6.302  29.606 13.241 1.00 24.48 ? 96  GLU A C   1 
ATOM   297  O  O   . GLU A 1 40  ? -7.420  29.979 12.894 1.00 23.01 ? 96  GLU A O   1 
ATOM   298  C  CB  . GLU A 1 40  ? -6.102  27.358 14.266 1.00 29.62 ? 96  GLU A CB  1 
ATOM   299  C  CG  . GLU A 1 40  ? -6.018  25.849 14.068 1.00 34.09 ? 96  GLU A CG  1 
ATOM   300  C  CD  . GLU A 1 40  ? -7.080  25.310 13.111 1.00 37.62 ? 96  GLU A CD  1 
ATOM   301  O  OE1 . GLU A 1 40  ? -8.029  26.046 12.755 1.00 39.17 ? 96  GLU A OE1 1 
ATOM   302  O  OE2 . GLU A 1 40  ? -6.975  24.134 12.714 1.00 42.44 ? 96  GLU A OE2 1 
ATOM   303  N  N   . THR A 1 41  ? -5.432  30.397 13.858 1.00 21.18 ? 97  THR A N   1 
ATOM   304  C  CA  . THR A 1 41  ? -5.723  31.789 14.181 1.00 24.45 ? 97  THR A CA  1 
ATOM   305  C  C   . THR A 1 41  ? -5.889  32.675 12.939 1.00 22.98 ? 97  THR A C   1 
ATOM   306  O  O   . THR A 1 41  ? -6.843  33.439 12.866 1.00 23.51 ? 97  THR A O   1 
ATOM   307  C  CB  . THR A 1 41  ? -4.616  32.380 15.099 1.00 24.77 ? 97  THR A CB  1 
ATOM   308  O  OG1 . THR A 1 41  ? -4.666  31.698 16.357 1.00 26.96 ? 97  THR A OG1 1 
ATOM   309  C  CG2 . THR A 1 41  ? -4.810  33.903 15.315 1.00 23.13 ? 97  THR A CG2 1 
ATOM   310  N  N   . ALA A 1 42  ? -4.967  32.546 11.979 1.00 24.02 ? 98  ALA A N   1 
ATOM   311  C  CA  . ALA A 1 42  ? -4.993  33.295 10.703 1.00 21.42 ? 98  ALA A CA  1 
ATOM   312  C  C   . ALA A 1 42  ? -6.269  33.004 9.949  1.00 21.38 ? 98  ALA A C   1 
ATOM   313  O  O   . ALA A 1 42  ? -6.895  33.906 9.401  1.00 21.93 ? 98  ALA A O   1 
ATOM   314  C  CB  . ALA A 1 42  ? -3.792  32.884 9.836  1.00 19.71 ? 98  ALA A CB  1 
ATOM   315  N  N   . TYR A 1 43  ? -6.636  31.719 9.899  1.00 21.50 ? 99  TYR A N   1 
ATOM   316  C  CA  . TYR A 1 43  ? -7.840  31.261 9.205  1.00 22.06 ? 99  TYR A CA  1 
ATOM   317  C  C   . TYR A 1 43  ? -9.087  31.876 9.815  1.00 22.48 ? 99  TYR A C   1 
ATOM   318  O  O   . TYR A 1 43  ? -9.963  32.408 9.111  1.00 20.65 ? 99  TYR A O   1 
ATOM   319  C  CB  . TYR A 1 43  ? -7.940  29.720 9.267  1.00 22.51 ? 99  TYR A CB  1 
ATOM   320  C  CG  . TYR A 1 43  ? -9.113  29.177 8.497  1.00 24.86 ? 99  TYR A CG  1 
ATOM   321  C  CD1 . TYR A 1 43  ? -9.175  29.297 7.109  1.00 25.61 ? 99  TYR A CD1 1 
ATOM   322  C  CD2 . TYR A 1 43  ? -10.165 28.537 9.150  1.00 27.92 ? 99  TYR A CD2 1 
ATOM   323  C  CE1 . TYR A 1 43  ? -10.249 28.794 6.390  1.00 27.84 ? 99  TYR A CE1 1 
ATOM   324  C  CE2 . TYR A 1 43  ? -11.255 28.024 8.431  1.00 30.49 ? 99  TYR A CE2 1 
ATOM   325  C  CZ  . TYR A 1 43  ? -11.284 28.158 7.047  1.00 29.36 ? 99  TYR A CZ  1 
ATOM   326  O  OH  . TYR A 1 43  ? -12.340 27.640 6.327  1.00 34.07 ? 99  TYR A OH  1 
ATOM   327  N  N   . PHE A 1 44  ? -9.157  31.807 11.148 1.00 22.32 ? 100 PHE A N   1 
ATOM   328  C  CA  . PHE A 1 44  ? -10.279 32.359 11.878 1.00 20.70 ? 100 PHE A CA  1 
ATOM   329  C  C   . PHE A 1 44  ? -10.415 33.841 11.617 1.00 19.45 ? 100 PHE A C   1 
ATOM   330  O  O   . PHE A 1 44  ? -11.521 34.328 11.414 1.00 19.59 ? 100 PHE A O   1 
ATOM   331  C  CB  . PHE A 1 44  ? -10.118 32.126 13.394 1.00 24.15 ? 100 PHE A CB  1 
ATOM   332  C  CG  . PHE A 1 44  ? -11.323 32.551 14.194 1.00 26.10 ? 100 PHE A CG  1 
ATOM   333  C  CD1 . PHE A 1 44  ? -11.473 33.873 14.599 1.00 28.07 ? 100 PHE A CD1 1 
ATOM   334  C  CD2 . PHE A 1 44  ? -12.316 31.626 14.525 1.00 26.82 ? 100 PHE A CD2 1 
ATOM   335  C  CE1 . PHE A 1 44  ? -12.606 34.280 15.330 1.00 31.47 ? 100 PHE A CE1 1 
ATOM   336  C  CE2 . PHE A 1 44  ? -13.441 32.012 15.250 1.00 28.87 ? 100 PHE A CE2 1 
ATOM   337  C  CZ  . PHE A 1 44  ? -13.594 33.341 15.656 1.00 29.37 ? 100 PHE A CZ  1 
ATOM   338  N  N   . LEU A 1 45  ? -9.294  34.566 11.621 1.00 19.92 ? 101 LEU A N   1 
ATOM   339  C  CA  . LEU A 1 45  ? -9.296  36.024 11.390 1.00 20.34 ? 101 LEU A CA  1 
ATOM   340  C  C   . LEU A 1 45  ? -9.763  36.356 9.964  1.00 21.66 ? 101 LEU A C   1 
ATOM   341  O  O   . LEU A 1 45  ? -10.490 37.336 9.742  1.00 23.17 ? 101 LEU A O   1 
ATOM   342  C  CB  . LEU A 1 45  ? -7.891  36.598 11.607 1.00 20.04 ? 101 LEU A CB  1 
ATOM   343  C  CG  . LEU A 1 45  ? -7.331  36.738 13.048 1.00 23.67 ? 101 LEU A CG  1 
ATOM   344  C  CD1 . LEU A 1 45  ? -5.795  36.874 13.018 1.00 22.48 ? 101 LEU A CD1 1 
ATOM   345  C  CD2 . LEU A 1 45  ? -7.933  37.964 13.702 1.00 22.33 ? 101 LEU A CD2 1 
ATOM   346  N  N   . LEU A 1 46  ? -9.332  35.551 9.001  1.00 21.67 ? 102 LEU A N   1 
ATOM   347  C  CA  . LEU A 1 46  ? -9.735  35.759 7.601  1.00 24.38 ? 102 LEU A CA  1 
ATOM   348  C  C   . LEU A 1 46  ? -11.264 35.683 7.496  1.00 21.61 ? 102 LEU A C   1 
ATOM   349  O  O   . LEU A 1 46  ? -11.893 36.520 6.839  1.00 22.42 ? 102 LEU A O   1 
ATOM   350  C  CB  . LEU A 1 46  ? -9.101  34.694 6.706  1.00 27.18 ? 102 LEU A CB  1 
ATOM   351  C  CG  . LEU A 1 46  ? -8.583  35.094 5.324  1.00 34.10 ? 102 LEU A CG  1 
ATOM   352  C  CD1 . LEU A 1 46  ? -7.831  36.443 5.416  1.00 36.19 ? 102 LEU A CD1 1 
ATOM   353  C  CD2 . LEU A 1 46  ? -7.652  33.974 4.795  1.00 31.69 ? 102 LEU A CD2 1 
ATOM   354  N  N   . LYS A 1 47  ? -11.854 34.681 8.145  1.00 21.90 ? 103 LYS A N   1 
ATOM   355  C  CA  . LYS A 1 47  ? -13.319 34.489 8.153  1.00 24.21 ? 103 LYS A CA  1 
ATOM   356  C  C   . LYS A 1 47  ? -14.059 35.662 8.796  1.00 23.74 ? 103 LYS A C   1 
ATOM   357  O  O   . LYS A 1 47  ? -15.058 36.174 8.261  1.00 24.50 ? 103 LYS A O   1 
ATOM   358  C  CB  . LYS A 1 47  ? -13.676 33.210 8.913  1.00 22.80 ? 103 LYS A CB  1 
ATOM   359  C  CG  . LYS A 1 47  ? -12.933 31.981 8.418  1.00 30.34 ? 103 LYS A CG  1 
ATOM   360  C  CD  . LYS A 1 47  ? -13.755 30.693 8.599  1.00 32.24 ? 103 LYS A CD  1 
ATOM   361  C  CE  . LYS A 1 47  ? -13.482 30.075 9.957  1.00 37.05 ? 103 LYS A CE  1 
ATOM   362  N  NZ  . LYS A 1 47  ? -14.212 28.784 10.184 1.00 36.67 ? 103 LYS A NZ  1 
ATOM   363  N  N   . LEU A 1 48  ? -13.564 36.070 9.967  1.00 22.88 ? 104 LEU A N   1 
ATOM   364  C  CA  . LEU A 1 48  ? -14.102 37.196 10.731 1.00 22.88 ? 104 LEU A CA  1 
ATOM   365  C  C   . LEU A 1 48  ? -14.066 38.476 9.897  1.00 22.97 ? 104 LEU A C   1 
ATOM   366  O  O   . LEU A 1 48  ? -15.037 39.251 9.849  1.00 22.16 ? 104 LEU A O   1 
ATOM   367  C  CB  . LEU A 1 48  ? -13.239 37.425 11.980 1.00 23.93 ? 104 LEU A CB  1 
ATOM   368  C  CG  . LEU A 1 48  ? -13.881 38.301 13.051 1.00 23.09 ? 104 LEU A CG  1 
ATOM   369  C  CD1 . LEU A 1 48  ? -14.917 37.436 13.779 1.00 22.77 ? 104 LEU A CD1 1 
ATOM   370  C  CD2 . LEU A 1 48  ? -12.819 38.831 14.044 1.00 24.15 ? 104 LEU A CD2 1 
ATOM   371  N  N   . ALA A 1 49  ? -12.920 38.712 9.259  1.00 22.14 ? 105 ALA A N   1 
ATOM   372  C  CA  . ALA A 1 49  ? -12.747 39.913 8.450  1.00 19.92 ? 105 ALA A CA  1 
ATOM   373  C  C   . ALA A 1 49  ? -13.640 39.970 7.206  1.00 20.02 ? 105 ALA A C   1 
ATOM   374  O  O   . ALA A 1 49  ? -14.022 41.052 6.762  1.00 20.26 ? 105 ALA A O   1 
ATOM   375  C  CB  . ALA A 1 49  ? -11.290 40.046 8.041  1.00 17.84 ? 105 ALA A CB  1 
ATOM   376  N  N   . GLY A 1 50  ? -13.978 38.830 6.622  1.00 22.27 ? 106 GLY A N   1 
ATOM   377  C  CA  . GLY A 1 50  ? -14.818 38.909 5.421  1.00 23.86 ? 106 GLY A CA  1 
ATOM   378  C  C   . GLY A 1 50  ? -16.273 39.108 5.754  1.00 26.40 ? 106 GLY A C   1 
ATOM   379  O  O   . GLY A 1 50  ? -17.118 39.278 4.863  1.00 24.43 ? 106 GLY A O   1 
ATOM   380  N  N   . ARG A 1 51  ? -16.566 39.121 7.061  1.00 27.31 ? 107 ARG A N   1 
ATOM   381  C  CA  . ARG A 1 51  ? -17.939 39.238 7.548  1.00 27.38 ? 107 ARG A CA  1 
ATOM   382  C  C   . ARG A 1 51  ? -18.223 40.539 8.294  1.00 29.04 ? 107 ARG A C   1 
ATOM   383  O  O   . ARG A 1 51  ? -19.311 41.077 8.158  1.00 27.33 ? 107 ARG A O   1 
ATOM   384  C  CB  . ARG A 1 51  ? -18.268 38.002 8.410  1.00 28.53 ? 107 ARG A CB  1 
ATOM   385  C  CG  . ARG A 1 51  ? -19.216 38.191 9.590  1.00 34.58 ? 107 ARG A CG  1 
ATOM   386  C  CD  . ARG A 1 51  ? -19.194 36.930 10.476 1.00 35.44 ? 107 ARG A CD  1 
ATOM   387  N  NE  . ARG A 1 51  ? -19.132 35.768 9.613  1.00 40.27 ? 107 ARG A NE  1 
ATOM   388  C  CZ  . ARG A 1 51  ? -18.335 34.725 9.777  1.00 40.85 ? 107 ARG A CZ  1 
ATOM   389  N  NH1 . ARG A 1 51  ? -17.487 34.647 10.797 1.00 39.44 ? 107 ARG A NH1 1 
ATOM   390  N  NH2 . ARG A 1 51  ? -18.370 33.768 8.868  1.00 41.90 ? 107 ARG A NH2 1 
ATOM   391  N  N   . TRP A 1 52  ? -17.253 41.042 9.066  1.00 26.87 ? 108 TRP A N   1 
ATOM   392  C  CA  . TRP A 1 52  ? -17.422 42.297 9.795  1.00 25.56 ? 108 TRP A CA  1 
ATOM   393  C  C   . TRP A 1 52  ? -16.263 43.198 9.397  1.00 25.79 ? 108 TRP A C   1 
ATOM   394  O  O   . TRP A 1 52  ? -15.222 42.727 8.922  1.00 24.87 ? 108 TRP A O   1 
ATOM   395  C  CB  . TRP A 1 52  ? -17.396 42.108 11.352 1.00 23.04 ? 108 TRP A CB  1 
ATOM   396  C  CG  . TRP A 1 52  ? -18.365 41.059 11.912 1.00 18.98 ? 108 TRP A CG  1 
ATOM   397  C  CD1 . TRP A 1 52  ? -18.052 39.773 12.280 1.00 18.02 ? 108 TRP A CD1 1 
ATOM   398  C  CD2 . TRP A 1 52  ? -19.792 41.171 12.051 1.00 18.25 ? 108 TRP A CD2 1 
ATOM   399  N  NE1 . TRP A 1 52  ? -19.185 39.088 12.617 1.00 18.49 ? 108 TRP A NE1 1 
ATOM   400  C  CE2 . TRP A 1 52  ? -20.268 39.919 12.493 1.00 19.76 ? 108 TRP A CE2 1 
ATOM   401  C  CE3 . TRP A 1 52  ? -20.714 42.210 11.844 1.00 18.96 ? 108 TRP A CE3 1 
ATOM   402  C  CZ2 . TRP A 1 52  ? -21.624 39.674 12.732 1.00 19.59 ? 108 TRP A CZ2 1 
ATOM   403  C  CZ3 . TRP A 1 52  ? -22.055 41.971 12.078 1.00 17.82 ? 108 TRP A CZ3 1 
ATOM   404  C  CH2 . TRP A 1 52  ? -22.502 40.714 12.515 1.00 19.88 ? 108 TRP A CH2 1 
ATOM   405  N  N   . PRO A 1 53  ? -16.427 44.522 9.563  1.00 27.44 ? 109 PRO A N   1 
ATOM   406  C  CA  . PRO A 1 53  ? -15.316 45.405 9.199  1.00 28.28 ? 109 PRO A CA  1 
ATOM   407  C  C   . PRO A 1 53  ? -14.312 45.490 10.368 1.00 30.33 ? 109 PRO A C   1 
ATOM   408  O  O   . PRO A 1 53  ? -14.369 46.426 11.170 1.00 31.52 ? 109 PRO A O   1 
ATOM   409  C  CB  . PRO A 1 53  ? -16.003 46.737 8.911  1.00 29.08 ? 109 PRO A CB  1 
ATOM   410  C  CG  . PRO A 1 53  ? -17.240 46.706 9.798  1.00 29.31 ? 109 PRO A CG  1 
ATOM   411  C  CD  . PRO A 1 53  ? -17.606 45.262 10.045 1.00 27.55 ? 109 PRO A CD  1 
ATOM   412  N  N   . VAL A 1 54  ? -13.394 44.512 10.414 1.00 28.77 ? 110 VAL A N   1 
ATOM   413  C  CA  . VAL A 1 54  ? -12.348 44.343 11.425 1.00 27.21 ? 110 VAL A CA  1 
ATOM   414  C  C   . VAL A 1 54  ? -11.109 45.242 11.203 1.00 29.02 ? 110 VAL A C   1 
ATOM   415  O  O   . VAL A 1 54  ? -10.296 45.029 10.299 1.00 25.71 ? 110 VAL A O   1 
ATOM   416  C  CB  . VAL A 1 54  ? -11.899 42.823 11.481 1.00 25.85 ? 110 VAL A CB  1 
ATOM   417  C  CG1 . VAL A 1 54  ? -10.846 42.607 12.580 1.00 25.52 ? 110 VAL A CG1 1 
ATOM   418  C  CG2 . VAL A 1 54  ? -13.142 41.897 11.760 1.00 20.48 ? 110 VAL A CG2 1 
ATOM   419  N  N   . LYS A 1 55  ? -10.948 46.241 12.056 1.00 29.62 ? 111 LYS A N   1 
ATOM   420  C  CA  . LYS A 1 55  ? -9.816  47.142 11.905 1.00 31.26 ? 111 LYS A CA  1 
ATOM   421  C  C   . LYS A 1 55  ? -8.622  46.809 12.775 1.00 30.53 ? 111 LYS A C   1 
ATOM   422  O  O   . LYS A 1 55  ? -7.483  46.857 12.318 1.00 31.73 ? 111 LYS A O   1 
ATOM   423  C  CB  . LYS A 1 55  ? -10.261 48.582 12.157 1.00 32.54 ? 111 LYS A CB  1 
ATOM   424  C  CG  . LYS A 1 55  ? -10.609 49.317 10.870 1.00 37.94 ? 111 LYS A CG  1 
ATOM   425  C  CD  . LYS A 1 55  ? -10.906 50.783 11.144 0.00 39.98 ? 111 LYS A CD  1 
ATOM   426  C  CE  . LYS A 1 55  ? -12.300 51.165 10.671 0.00 42.39 ? 111 LYS A CE  1 
ATOM   427  N  NZ  . LYS A 1 55  ? -12.366 52.591 10.242 0.00 43.40 ? 111 LYS A NZ  1 
ATOM   428  N  N   . THR A 1 56  ? -8.873  46.471 14.029 1.00 28.84 ? 112 THR A N   1 
ATOM   429  C  CA  . THR A 1 56  ? -7.803  46.140 14.942 1.00 28.09 ? 112 THR A CA  1 
ATOM   430  C  C   . THR A 1 56  ? -8.253  44.957 15.802 1.00 29.07 ? 112 THR A C   1 
ATOM   431  O  O   . THR A 1 56  ? -9.449  44.709 15.963 1.00 28.65 ? 112 THR A O   1 
ATOM   432  C  CB  . THR A 1 56  ? -7.459  47.348 15.856 1.00 27.73 ? 112 THR A CB  1 
ATOM   433  O  OG1 . THR A 1 56  ? -8.565  47.618 16.702 1.00 30.61 ? 112 THR A OG1 1 
ATOM   434  C  CG2 . THR A 1 56  ? -7.182  48.624 15.028 1.00 26.33 ? 112 THR A CG2 1 
ATOM   435  N  N   . VAL A 1 57  ? -7.293  44.232 16.359 1.00 27.55 ? 113 VAL A N   1 
ATOM   436  C  CA  . VAL A 1 57  ? -7.602  43.076 17.180 1.00 29.18 ? 113 VAL A CA  1 
ATOM   437  C  C   . VAL A 1 57  ? -6.657  43.086 18.368 1.00 29.75 ? 113 VAL A C   1 
ATOM   438  O  O   . VAL A 1 57  ? -5.459  43.370 18.222 1.00 29.26 ? 113 VAL A O   1 
ATOM   439  C  CB  . VAL A 1 57  ? -7.387  41.744 16.405 1.00 28.31 ? 113 VAL A CB  1 
ATOM   440  C  CG1 . VAL A 1 57  ? -7.578  40.556 17.351 1.00 30.46 ? 113 VAL A CG1 1 
ATOM   441  C  CG2 . VAL A 1 57  ? -8.381  41.637 15.252 1.00 29.28 ? 113 VAL A CG2 1 
ATOM   442  N  N   . HIS A 1 58  ? -7.211  42.776 19.534 1.00 28.99 ? 114 HIS A N   1 
ATOM   443  C  CA  . HIS A 1 58  ? -6.453  42.714 20.774 1.00 29.73 ? 114 HIS A CA  1 
ATOM   444  C  C   . HIS A 1 58  ? -6.534  41.290 21.268 1.00 27.96 ? 114 HIS A C   1 
ATOM   445  O  O   . HIS A 1 58  ? -7.398  40.534 20.863 1.00 28.14 ? 114 HIS A O   1 
ATOM   446  C  CB  . HIS A 1 58  ? -7.074  43.642 21.828 1.00 34.27 ? 114 HIS A CB  1 
ATOM   447  C  CG  . HIS A 1 58  ? -6.334  43.655 23.127 1.00 38.35 ? 114 HIS A CG  1 
ATOM   448  N  ND1 . HIS A 1 58  ? -5.101  44.259 23.277 1.00 41.22 ? 114 HIS A ND1 1 
ATOM   449  C  CD2 . HIS A 1 58  ? -6.640  43.122 24.334 1.00 40.59 ? 114 HIS A CD2 1 
ATOM   450  C  CE1 . HIS A 1 58  ? -4.683  44.096 24.521 1.00 43.03 ? 114 HIS A CE1 1 
ATOM   451  N  NE2 . HIS A 1 58  ? -5.597  43.409 25.183 1.00 41.66 ? 114 HIS A NE2 1 
ATOM   452  N  N   . THR A 1 59  ? -5.631  40.937 22.158 1.00 28.06 ? 115 THR A N   1 
ATOM   453  C  CA  . THR A 1 59  ? -5.584  39.617 22.749 1.00 27.35 ? 115 THR A CA  1 
ATOM   454  C  C   . THR A 1 59  ? -4.934  39.785 24.114 1.00 29.11 ? 115 THR A C   1 
ATOM   455  O  O   . THR A 1 59  ? -4.244  40.780 24.358 1.00 29.59 ? 115 THR A O   1 
ATOM   456  C  CB  . THR A 1 59  ? -4.705  38.648 21.900 1.00 26.30 ? 115 THR A CB  1 
ATOM   457  O  OG1 . THR A 1 59  ? -4.901  37.300 22.340 1.00 23.40 ? 115 THR A OG1 1 
ATOM   458  C  CG2 . THR A 1 59  ? -3.213  38.997 22.053 1.00 26.48 ? 115 THR A CG2 1 
ATOM   459  N  N   . ASP A 1 60  ? -5.159  38.813 24.988 1.00 29.74 ? 116 ASP A N   1 
ATOM   460  C  CA  . ASP A 1 60  ? -4.564  38.789 26.328 1.00 32.72 ? 116 ASP A CA  1 
ATOM   461  C  C   . ASP A 1 60  ? -3.226  38.020 26.279 1.00 32.14 ? 116 ASP A C   1 
ATOM   462  O  O   . ASP A 1 60  ? -2.507  37.942 27.270 1.00 34.91 ? 116 ASP A O   1 
ATOM   463  C  CB  . ASP A 1 60  ? -5.494  38.058 27.306 1.00 33.87 ? 116 ASP A CB  1 
ATOM   464  C  CG  . ASP A 1 60  ? -6.510  38.977 27.962 1.00 35.88 ? 116 ASP A CG  1 
ATOM   465  O  OD1 . ASP A 1 60  ? -6.501  40.206 27.706 1.00 35.92 ? 116 ASP A OD1 1 
ATOM   466  O  OD2 . ASP A 1 60  ? -7.323  38.448 28.750 1.00 39.91 ? 116 ASP A OD2 1 
ATOM   467  N  N   . ASN A 1 61  ? -2.919  37.396 25.148 1.00 28.06 ? 117 ASN A N   1 
ATOM   468  C  CA  . ASN A 1 61  ? -1.672  36.661 25.031 1.00 27.71 ? 117 ASN A CA  1 
ATOM   469  C  C   . ASN A 1 61  ? -1.066  37.104 23.715 1.00 26.18 ? 117 ASN A C   1 
ATOM   470  O  O   . ASN A 1 61  ? -1.365  36.541 22.645 1.00 27.59 ? 117 ASN A O   1 
ATOM   471  C  CB  . ASN A 1 61  ? -1.942  35.151 25.052 1.00 26.00 ? 117 ASN A CB  1 
ATOM   472  C  CG  . ASN A 1 61  ? -0.663  34.311 25.072 1.00 26.58 ? 117 ASN A CG  1 
ATOM   473  O  OD1 . ASN A 1 61  ? -0.706  33.110 25.353 1.00 28.09 ? 117 ASN A OD1 1 
ATOM   474  N  ND2 . ASN A 1 61  ? 0.474   34.931 24.768 1.00 22.67 ? 117 ASN A ND2 1 
ATOM   475  N  N   . GLY A 1 62  ? -0.234  38.136 23.800 1.00 24.66 ? 118 GLY A N   1 
ATOM   476  C  CA  . GLY A 1 62  ? 0.408   38.703 22.625 1.00 21.92 ? 118 GLY A CA  1 
ATOM   477  C  C   . GLY A 1 62  ? 1.205   37.749 21.766 1.00 23.68 ? 118 GLY A C   1 
ATOM   478  O  O   . GLY A 1 62  ? 1.292   37.941 20.551 1.00 24.44 ? 118 GLY A O   1 
ATOM   479  N  N   . SER A 1 63  ? 1.792   36.715 22.367 1.00 22.42 ? 119 SER A N   1 
ATOM   480  C  CA  . SER A 1 63  ? 2.579   35.776 21.582 1.00 24.95 ? 119 SER A CA  1 
ATOM   481  C  C   . SER A 1 63  ? 1.671   35.024 20.587 1.00 26.06 ? 119 SER A C   1 
ATOM   482  O  O   . SER A 1 63  ? 2.145   34.402 19.656 1.00 26.95 ? 119 SER A O   1 
ATOM   483  C  CB  . SER A 1 63  ? 3.323   34.805 22.507 1.00 21.21 ? 119 SER A CB  1 
ATOM   484  O  OG  . SER A 1 63  ? 2.438   33.897 23.122 1.00 25.64 ? 119 SER A OG  1 
ATOM   485  N  N   . ASN A 1 64  ? 0.359   35.085 20.816 1.00 28.88 ? 120 ASN A N   1 
ATOM   486  C  CA  . ASN A 1 64  ? -0.652  34.469 19.935 1.00 29.55 ? 120 ASN A CA  1 
ATOM   487  C  C   . ASN A 1 64  ? -0.548  34.919 18.459 1.00 29.45 ? 120 ASN A C   1 
ATOM   488  O  O   . ASN A 1 64  ? -0.929  34.189 17.526 1.00 30.15 ? 120 ASN A O   1 
ATOM   489  C  CB  . ASN A 1 64  ? -2.053  34.905 20.376 1.00 28.48 ? 120 ASN A CB  1 
ATOM   490  C  CG  . ASN A 1 64  ? -2.663  33.978 21.371 1.00 30.35 ? 120 ASN A CG  1 
ATOM   491  O  OD1 . ASN A 1 64  ? -2.180  32.861 21.547 1.00 30.09 ? 120 ASN A OD1 1 
ATOM   492  N  ND2 . ASN A 1 64  ? -3.733  34.428 22.039 1.00 25.73 ? 120 ASN A ND2 1 
ATOM   493  N  N   . PHE A 1 65  ? -0.116  36.162 18.296 1.00 27.71 ? 121 PHE A N   1 
ATOM   494  C  CA  . PHE A 1 65  ? -0.040  36.840 17.019 1.00 29.04 ? 121 PHE A CA  1 
ATOM   495  C  C   . PHE A 1 65  ? 1.332   36.982 16.351 1.00 30.69 ? 121 PHE A C   1 
ATOM   496  O  O   . PHE A 1 65  ? 1.441   37.676 15.354 1.00 31.86 ? 121 PHE A O   1 
ATOM   497  C  CB  . PHE A 1 65  ? -0.629  38.251 17.191 1.00 26.01 ? 121 PHE A CB  1 
ATOM   498  C  CG  . PHE A 1 65  ? -2.127  38.293 17.480 1.00 22.86 ? 121 PHE A CG  1 
ATOM   499  C  CD1 . PHE A 1 65  ? -2.922  37.157 17.373 1.00 22.23 ? 121 PHE A CD1 1 
ATOM   500  C  CD2 . PHE A 1 65  ? -2.725  39.492 17.867 1.00 22.16 ? 121 PHE A CD2 1 
ATOM   501  C  CE1 . PHE A 1 65  ? -4.280  37.204 17.645 1.00 24.62 ? 121 PHE A CE1 1 
ATOM   502  C  CE2 . PHE A 1 65  ? -4.085  39.551 18.141 1.00 24.44 ? 121 PHE A CE2 1 
ATOM   503  C  CZ  . PHE A 1 65  ? -4.861  38.413 18.032 1.00 25.29 ? 121 PHE A CZ  1 
ATOM   504  N  N   . THR A 1 66  ? 2.374   36.340 16.868 1.00 32.55 ? 122 THR A N   1 
ATOM   505  C  CA  . THR A 1 66  ? 3.702   36.493 16.271 1.00 34.03 ? 122 THR A CA  1 
ATOM   506  C  C   . THR A 1 66  ? 4.039   35.681 15.010 1.00 34.35 ? 122 THR A C   1 
ATOM   507  O  O   . THR A 1 66  ? 5.013   35.993 14.306 1.00 36.15 ? 122 THR A O   1 
ATOM   508  C  CB  . THR A 1 66  ? 4.776   36.175 17.283 1.00 35.55 ? 122 THR A CB  1 
ATOM   509  O  OG1 . THR A 1 66  ? 4.736   34.771 17.557 1.00 39.62 ? 122 THR A OG1 1 
ATOM   510  C  CG2 . THR A 1 66  ? 4.545   36.958 18.569 1.00 32.34 ? 122 THR A CG2 1 
ATOM   511  N  N   . SER A 1 67  ? 3.258   34.662 14.688 1.00 33.73 ? 123 SER A N   1 
ATOM   512  C  CA  . SER A 1 67  ? 3.599   33.861 13.518 1.00 34.03 ? 123 SER A CA  1 
ATOM   513  C  C   . SER A 1 67  ? 3.524   34.639 12.195 1.00 33.95 ? 123 SER A C   1 
ATOM   514  O  O   . SER A 1 67  ? 2.825   35.647 12.086 1.00 33.42 ? 123 SER A O   1 
ATOM   515  C  CB  . SER A 1 67  ? 2.717   32.603 13.458 1.00 33.80 ? 123 SER A CB  1 
ATOM   516  O  OG  . SER A 1 67  ? 1.352   32.933 13.309 1.00 37.86 ? 123 SER A OG  1 
ATOM   517  N  N   . THR A 1 68  ? 4.277   34.192 11.192 1.00 33.28 ? 124 THR A N   1 
ATOM   518  C  CA  . THR A 1 68  ? 4.230   34.889 9.912  1.00 33.68 ? 124 THR A CA  1 
ATOM   519  C  C   . THR A 1 68  ? 2.864   34.591 9.270  1.00 29.64 ? 124 THR A C   1 
ATOM   520  O  O   . THR A 1 68  ? 2.287   35.437 8.592  1.00 29.44 ? 124 THR A O   1 
ATOM   521  C  CB  . THR A 1 68  ? 5.438   34.493 8.993  1.00 34.71 ? 124 THR A CB  1 
ATOM   522  O  OG1 . THR A 1 68  ? 5.058   33.483 8.063  1.00 38.83 ? 124 THR A OG1 1 
ATOM   523  C  CG2 . THR A 1 68  ? 6.565   33.976 9.816  1.00 35.46 ? 124 THR A CG2 1 
ATOM   524  N  N   . THR A 1 69  ? 2.332   33.404 9.541  1.00 27.69 ? 125 THR A N   1 
ATOM   525  C  CA  . THR A 1 69  ? 1.026   33.012 9.026  1.00 27.80 ? 125 THR A CA  1 
ATOM   526  C  C   . THR A 1 69  ? -0.060  33.982 9.510  1.00 26.06 ? 125 THR A C   1 
ATOM   527  O  O   . THR A 1 69  ? -0.889  34.421 8.724  1.00 27.56 ? 125 THR A O   1 
ATOM   528  C  CB  . THR A 1 69  ? 0.642   31.603 9.494  1.00 30.10 ? 125 THR A CB  1 
ATOM   529  O  OG1 . THR A 1 69  ? 1.648   30.669 9.084  1.00 36.94 ? 125 THR A OG1 1 
ATOM   530  C  CG2 . THR A 1 69  ? -0.681  31.206 8.906  1.00 30.48 ? 125 THR A CG2 1 
ATOM   531  N  N   . VAL A 1 70  ? -0.064  34.308 10.804 1.00 23.78 ? 126 VAL A N   1 
ATOM   532  C  CA  . VAL A 1 70  ? -1.053  35.238 11.344 1.00 22.53 ? 126 VAL A CA  1 
ATOM   533  C  C   . VAL A 1 70  ? -0.800  36.633 10.799 1.00 22.28 ? 126 VAL A C   1 
ATOM   534  O  O   . VAL A 1 70  ? -1.727  37.339 10.425 1.00 22.73 ? 126 VAL A O   1 
ATOM   535  C  CB  . VAL A 1 70  ? -1.010  35.312 12.911 1.00 24.36 ? 126 VAL A CB  1 
ATOM   536  C  CG1 . VAL A 1 70  ? -1.829  36.511 13.395 1.00 21.39 ? 126 VAL A CG1 1 
ATOM   537  C  CG2 . VAL A 1 70  ? -1.559  34.005 13.519 1.00 22.77 ? 126 VAL A CG2 1 
ATOM   538  N  N   . LYS A 1 71  ? 0.461   37.038 10.773 1.00 20.54 ? 127 LYS A N   1 
ATOM   539  C  CA  . LYS A 1 71  ? 0.797   38.344 10.251 1.00 23.14 ? 127 LYS A CA  1 
ATOM   540  C  C   . LYS A 1 71  ? 0.391   38.469 8.765  1.00 22.51 ? 127 LYS A C   1 
ATOM   541  O  O   . LYS A 1 71  ? 0.057   39.553 8.311  1.00 22.14 ? 127 LYS A O   1 
ATOM   542  C  CB  . LYS A 1 71  ? 2.299   38.590 10.388 1.00 23.02 ? 127 LYS A CB  1 
ATOM   543  C  CG  . LYS A 1 71  ? 2.759   39.032 11.790 1.00 27.49 ? 127 LYS A CG  1 
ATOM   544  C  CD  . LYS A 1 71  ? 4.271   38.844 11.931 1.00 30.86 ? 127 LYS A CD  1 
ATOM   545  C  CE  . LYS A 1 71  ? 4.809   39.640 13.123 1.00 36.33 ? 127 LYS A CE  1 
ATOM   546  N  NZ  . LYS A 1 71  ? 6.255   39.362 13.418 1.00 36.09 ? 127 LYS A NZ  1 
ATOM   547  N  N   . ALA A 1 72  ? 0.455   37.365 8.025  1.00 22.39 ? 128 ALA A N   1 
ATOM   548  C  CA  . ALA A 1 72  ? 0.091   37.370 6.615  1.00 22.85 ? 128 ALA A CA  1 
ATOM   549  C  C   . ALA A 1 72  ? -1.416  37.576 6.459  1.00 22.44 ? 128 ALA A C   1 
ATOM   550  O  O   . ALA A 1 72  ? -1.850  38.329 5.594  1.00 23.97 ? 128 ALA A O   1 
ATOM   551  C  CB  . ALA A 1 72  ? 0.536   36.035 5.934  1.00 22.15 ? 128 ALA A CB  1 
ATOM   552  N  N   . ALA A 1 73  ? -2.212  36.946 7.323  1.00 22.17 ? 129 ALA A N   1 
ATOM   553  C  CA  . ALA A 1 73  ? -3.660  37.088 7.252  1.00 20.33 ? 129 ALA A CA  1 
ATOM   554  C  C   . ALA A 1 73  ? -4.070  38.518 7.611  1.00 21.56 ? 129 ALA A C   1 
ATOM   555  O  O   . ALA A 1 73  ? -4.950  39.100 6.973  1.00 20.93 ? 129 ALA A O   1 
ATOM   556  C  CB  . ALA A 1 73  ? -4.338  36.085 8.195  1.00 20.13 ? 129 ALA A CB  1 
HETATM 557  N  N   . CAS A 1 74  ? -3.451  39.078 8.653  1.00 21.90 ? 130 CAS A N   1 
HETATM 558  C  CA  . CAS A 1 74  ? -3.740  40.455 9.054  1.00 22.55 ? 130 CAS A CA  1 
HETATM 559  C  CB  . CAS A 1 74  ? -3.018  40.800 10.354 1.00 23.76 ? 130 CAS A CB  1 
HETATM 560  C  C   . CAS A 1 74  ? -3.349  41.449 7.983  1.00 21.68 ? 130 CAS A C   1 
HETATM 561  O  O   . CAS A 1 74  ? -4.076  42.399 7.739  1.00 22.45 ? 130 CAS A O   1 
HETATM 562  S  SG  . CAS A 1 74  ? -3.872  40.076 11.756 1.00 28.11 ? 130 CAS A SG  1 
HETATM 563  AS AS  . CAS A 1 74  ? -2.964  41.309 13.475 1.00 37.27 ? 130 CAS A AS  1 
HETATM 564  C  CE1 . CAS A 1 74  ? -2.669  42.967 13.010 1.00 29.23 ? 130 CAS A CE1 1 
HETATM 565  C  CE2 . CAS A 1 74  ? -1.321  40.502 13.689 1.00 27.20 ? 130 CAS A CE2 1 
ATOM   566  N  N   . TRP A 1 75  ? -2.181  41.258 7.382  1.00 22.16 ? 131 TRP A N   1 
ATOM   567  C  CA  . TRP A 1 75  ? -1.743  42.115 6.276  1.00 24.77 ? 131 TRP A CA  1 
ATOM   568  C  C   . TRP A 1 75  ? -2.756  42.069 5.111  1.00 24.40 ? 131 TRP A C   1 
ATOM   569  O  O   . TRP A 1 75  ? -3.180  43.112 4.600  1.00 27.25 ? 131 TRP A O   1 
ATOM   570  C  CB  . TRP A 1 75  ? -0.371  41.651 5.748  1.00 24.52 ? 131 TRP A CB  1 
ATOM   571  C  CG  . TRP A 1 75  ? -0.010  42.184 4.332  1.00 26.74 ? 131 TRP A CG  1 
ATOM   572  C  CD1 . TRP A 1 75  ? 0.469   43.421 4.021  1.00 25.61 ? 131 TRP A CD1 1 
ATOM   573  C  CD2 . TRP A 1 75  ? -0.101  41.469 3.083  1.00 25.17 ? 131 TRP A CD2 1 
ATOM   574  N  NE1 . TRP A 1 75  ? 0.682   43.528 2.667  1.00 26.40 ? 131 TRP A NE1 1 
ATOM   575  C  CE2 . TRP A 1 75  ? 0.343   42.349 2.064  1.00 27.15 ? 131 TRP A CE2 1 
ATOM   576  C  CE3 . TRP A 1 75  ? -0.513  40.178 2.727  1.00 24.21 ? 131 TRP A CE3 1 
ATOM   577  C  CZ2 . TRP A 1 75  ? 0.385   41.976 0.712  1.00 25.10 ? 131 TRP A CZ2 1 
ATOM   578  C  CZ3 . TRP A 1 75  ? -0.476  39.805 1.367  1.00 25.44 ? 131 TRP A CZ3 1 
ATOM   579  C  CH2 . TRP A 1 75  ? -0.030  40.706 0.385  1.00 22.88 ? 131 TRP A CH2 1 
ATOM   580  N  N   . TRP A 1 76  ? -3.155  40.869 4.704  1.00 24.24 ? 132 TRP A N   1 
ATOM   581  C  CA  . TRP A 1 76  ? -4.078  40.722 3.569  1.00 24.38 ? 132 TRP A CA  1 
ATOM   582  C  C   . TRP A 1 76  ? -5.457  41.314 3.820  1.00 24.47 ? 132 TRP A C   1 
ATOM   583  O  O   . TRP A 1 76  ? -5.999  42.035 2.967  1.00 23.93 ? 132 TRP A O   1 
ATOM   584  C  CB  . TRP A 1 76  ? -4.187  39.252 3.145  1.00 23.18 ? 132 TRP A CB  1 
ATOM   585  C  CG  . TRP A 1 76  ? -4.923  39.106 1.825  1.00 21.72 ? 132 TRP A CG  1 
ATOM   586  C  CD1 . TRP A 1 76  ? -4.371  39.123 0.563  1.00 22.38 ? 132 TRP A CD1 1 
ATOM   587  C  CD2 . TRP A 1 76  ? -6.341  38.963 1.638  1.00 20.65 ? 132 TRP A CD2 1 
ATOM   588  N  NE1 . TRP A 1 76  ? -5.373  38.998 -0.396 1.00 21.29 ? 132 TRP A NE1 1 
ATOM   589  C  CE2 . TRP A 1 76  ? -6.582  38.897 0.235  1.00 21.69 ? 132 TRP A CE2 1 
ATOM   590  C  CE3 . TRP A 1 76  ? -7.434  38.880 2.513  1.00 18.10 ? 132 TRP A CE3 1 
ATOM   591  C  CZ2 . TRP A 1 76  ? -7.866  38.755 -0.295 1.00 23.72 ? 132 TRP A CZ2 1 
ATOM   592  C  CZ3 . TRP A 1 76  ? -8.705  38.742 1.984  1.00 21.28 ? 132 TRP A CZ3 1 
ATOM   593  C  CH2 . TRP A 1 76  ? -8.914  38.680 0.596  1.00 19.66 ? 132 TRP A CH2 1 
ATOM   594  N  N   . ALA A 1 77  ? -6.016  41.038 4.996  1.00 23.93 ? 133 ALA A N   1 
ATOM   595  C  CA  . ALA A 1 77  ? -7.318  41.574 5.379  1.00 23.60 ? 133 ALA A CA  1 
ATOM   596  C  C   . ALA A 1 77  ? -7.213  43.029 5.833  1.00 25.78 ? 133 ALA A C   1 
ATOM   597  O  O   . ALA A 1 77  ? -8.225  43.692 6.035  1.00 25.06 ? 133 ALA A O   1 
ATOM   598  C  CB  . ALA A 1 77  ? -7.932  40.725 6.487  1.00 23.84 ? 133 ALA A CB  1 
ATOM   599  N  N   . GLY A 1 78  ? -5.991  43.542 5.987  1.00 27.29 ? 134 GLY A N   1 
ATOM   600  C  CA  . GLY A 1 78  ? -5.852  44.932 6.407  1.00 27.30 ? 134 GLY A CA  1 
ATOM   601  C  C   . GLY A 1 78  ? -6.166  45.122 7.887  1.00 28.90 ? 134 GLY A C   1 
ATOM   602  O  O   . GLY A 1 78  ? -6.784  46.103 8.275  1.00 27.55 ? 134 GLY A O   1 
ATOM   603  N  N   . ILE A 1 79  ? -5.734  44.181 8.722  1.00 30.02 ? 135 ILE A N   1 
ATOM   604  C  CA  . ILE A 1 79  ? -5.999  44.268 10.157 1.00 30.08 ? 135 ILE A CA  1 
ATOM   605  C  C   . ILE A 1 79  ? -4.757  44.743 10.912 1.00 31.73 ? 135 ILE A C   1 
ATOM   606  O  O   . ILE A 1 79  ? -3.635  44.353 10.605 1.00 29.83 ? 135 ILE A O   1 
ATOM   607  C  CB  . ILE A 1 79  ? -6.427  42.878 10.741 1.00 28.14 ? 135 ILE A CB  1 
ATOM   608  C  CG1 . ILE A 1 79  ? -7.716  42.397 10.072 1.00 27.14 ? 135 ILE A CG1 1 
ATOM   609  C  CG2 . ILE A 1 79  ? -6.626  42.969 12.263 1.00 27.70 ? 135 ILE A CG2 1 
ATOM   610  C  CD1 . ILE A 1 79  ? -7.975  40.905 10.182 1.00 23.25 ? 135 ILE A CD1 1 
ATOM   611  N  N   . LYS A 1 80  ? -4.954  45.609 11.890 1.00 33.06 ? 136 LYS A N   1 
ATOM   612  C  CA  . LYS A 1 80  ? -3.826  46.061 12.684 1.00 35.50 ? 136 LYS A CA  1 
ATOM   613  C  C   . LYS A 1 80  ? -4.014  45.502 14.085 1.00 35.42 ? 136 LYS A C   1 
ATOM   614  O  O   . LYS A 1 80  ? -5.116  45.107 14.465 1.00 31.37 ? 136 LYS A O   1 
ATOM   615  C  CB  . LYS A 1 80  ? -3.774  47.589 12.757 1.00 38.65 ? 136 LYS A CB  1 
ATOM   616  C  CG  . LYS A 1 80  ? -3.528  48.313 11.439 1.00 43.43 ? 136 LYS A CG  1 
ATOM   617  C  CD  . LYS A 1 80  ? -2.652  47.521 10.484 1.00 48.69 ? 136 LYS A CD  1 
ATOM   618  C  CE  . LYS A 1 80  ? -1.185  47.712 10.815 1.00 51.43 ? 136 LYS A CE  1 
ATOM   619  N  NZ  . LYS A 1 80  ? -0.860  46.996 12.078 1.00 55.23 ? 136 LYS A NZ  1 
ATOM   620  N  N   . GLN A 1 81  ? -2.927  45.413 14.832 1.00 38.27 ? 137 GLN A N   1 
ATOM   621  C  CA  . GLN A 1 81  ? -3.018  44.934 16.193 1.00 42.53 ? 137 GLN A CA  1 
ATOM   622  C  C   . GLN A 1 81  ? -3.459  46.148 17.004 1.00 44.27 ? 137 GLN A C   1 
ATOM   623  O  O   . GLN A 1 81  ? -2.873  47.244 16.798 1.00 44.15 ? 137 GLN A O   1 
ATOM   624  C  CB  . GLN A 1 81  ? -1.662  44.426 16.693 1.00 44.94 ? 137 GLN A CB  1 
ATOM   625  C  CG  . GLN A 1 81  ? -1.776  43.393 17.817 1.00 46.72 ? 137 GLN A CG  1 
ATOM   626  C  CD  . GLN A 1 81  ? -0.515  42.569 18.020 1.00 48.23 ? 137 GLN A CD  1 
ATOM   627  O  OE1 . GLN A 1 81  ? -0.241  42.099 19.130 1.00 48.25 ? 137 GLN A OE1 1 
ATOM   628  N  NE2 . GLN A 1 81  ? 0.253   42.380 16.953 1.00 47.66 ? 137 GLN A NE2 1 
ATOM   629  N  N   . MET A 1 98  ? -15.825 37.119 28.832 1.00 68.28 ? 154 MET A N   1 
ATOM   630  C  CA  . MET A 1 98  ? -17.006 36.283 28.481 1.00 67.77 ? 154 MET A CA  1 
ATOM   631  C  C   . MET A 1 98  ? -16.655 34.824 28.689 1.00 66.50 ? 154 MET A C   1 
ATOM   632  O  O   . MET A 1 98  ? -17.527 33.965 28.693 1.00 65.36 ? 154 MET A O   1 
ATOM   633  C  CB  . MET A 1 98  ? -17.398 36.505 27.018 1.00 69.21 ? 154 MET A CB  1 
ATOM   634  C  CG  . MET A 1 98  ? -17.173 37.914 26.539 1.00 70.73 ? 154 MET A CG  1 
ATOM   635  S  SD  . MET A 1 98  ? -18.568 38.980 26.921 1.00 72.32 ? 154 MET A SD  1 
ATOM   636  C  CE  . MET A 1 98  ? -19.244 39.175 25.327 1.00 73.09 ? 154 MET A CE  1 
ATOM   637  N  N   . ASN A 1 99  ? -15.366 34.558 28.872 1.00 65.57 ? 155 ASN A N   1 
ATOM   638  C  CA  . ASN A 1 99  ? -14.881 33.198 29.065 1.00 65.08 ? 155 ASN A CA  1 
ATOM   639  C  C   . ASN A 1 99  ? -15.554 32.469 30.232 1.00 64.64 ? 155 ASN A C   1 
ATOM   640  O  O   . ASN A 1 99  ? -15.929 31.301 30.097 1.00 64.66 ? 155 ASN A O   1 
ATOM   641  C  CB  . ASN A 1 99  ? -13.359 33.217 29.227 1.00 64.84 ? 155 ASN A CB  1 
ATOM   642  C  CG  . ASN A 1 99  ? -12.656 33.776 28.002 0.00 64.19 ? 155 ASN A CG  1 
ATOM   643  O  OD1 . ASN A 1 99  ? -12.517 34.990 27.852 0.00 63.75 ? 155 ASN A OD1 1 
ATOM   644  N  ND2 . ASN A 1 99  ? -12.214 32.890 27.116 0.00 64.03 ? 155 ASN A ND2 1 
ATOM   645  N  N   . LYS A 1 100 ? -15.711 33.146 31.370 1.00 63.68 ? 156 LYS A N   1 
ATOM   646  C  CA  . LYS A 1 100 ? -16.379 32.535 32.518 1.00 62.96 ? 156 LYS A CA  1 
ATOM   647  C  C   . LYS A 1 100 ? -17.836 32.324 32.107 1.00 62.23 ? 156 LYS A C   1 
ATOM   648  O  O   . LYS A 1 100 ? -18.366 31.216 32.195 1.00 62.59 ? 156 LYS A O   1 
ATOM   649  C  CB  . LYS A 1 100 ? -16.313 33.458 33.741 1.00 63.00 ? 156 LYS A CB  1 
ATOM   650  C  CG  . LYS A 1 100 ? -15.448 32.938 34.874 0.00 62.74 ? 156 LYS A CG  1 
ATOM   651  C  CD  . LYS A 1 100 ? -14.035 32.648 34.399 0.00 63.39 ? 156 LYS A CD  1 
ATOM   652  C  CE  . LYS A 1 100 ? -13.057 32.639 35.559 0.00 63.05 ? 156 LYS A CE  1 
ATOM   653  N  NZ  . LYS A 1 100 ? -12.476 33.988 35.801 0.00 63.42 ? 156 LYS A NZ  1 
ATOM   654  N  N   . GLU A 1 101 ? -18.468 33.404 31.648 1.00 60.97 ? 157 GLU A N   1 
ATOM   655  C  CA  . GLU A 1 101 ? -19.858 33.387 31.191 1.00 59.29 ? 157 GLU A CA  1 
ATOM   656  C  C   . GLU A 1 101 ? -20.089 32.300 30.133 1.00 56.05 ? 157 GLU A C   1 
ATOM   657  O  O   . GLU A 1 101 ? -20.871 31.369 30.334 1.00 55.47 ? 157 GLU A O   1 
ATOM   658  C  CB  . GLU A 1 101 ? -20.216 34.756 30.603 1.00 63.12 ? 157 GLU A CB  1 
ATOM   659  C  CG  . GLU A 1 101 ? -21.646 34.868 30.101 1.00 68.51 ? 157 GLU A CG  1 
ATOM   660  C  CD  . GLU A 1 101 ? -22.622 35.213 31.209 1.00 71.38 ? 157 GLU A CD  1 
ATOM   661  O  OE1 . GLU A 1 101 ? -22.176 35.698 32.276 1.00 72.67 ? 157 GLU A OE1 1 
ATOM   662  O  OE2 . GLU A 1 101 ? -23.838 34.998 31.016 1.00 73.87 ? 157 GLU A OE2 1 
ATOM   663  N  N   . LEU A 1 102 ? -19.399 32.434 29.004 1.00 51.49 ? 158 LEU A N   1 
ATOM   664  C  CA  . LEU A 1 102 ? -19.510 31.484 27.910 1.00 47.82 ? 158 LEU A CA  1 
ATOM   665  C  C   . LEU A 1 102 ? -19.317 30.074 28.449 1.00 44.34 ? 158 LEU A C   1 
ATOM   666  O  O   . LEU A 1 102 ? -20.076 29.172 28.117 1.00 42.40 ? 158 LEU A O   1 
ATOM   667  C  CB  . LEU A 1 102 ? -18.450 31.772 26.836 1.00 46.65 ? 158 LEU A CB  1 
ATOM   668  C  CG  . LEU A 1 102 ? -18.449 30.768 25.682 1.00 47.44 ? 158 LEU A CG  1 
ATOM   669  C  CD1 . LEU A 1 102 ? -19.720 30.983 24.870 1.00 44.28 ? 158 LEU A CD1 1 
ATOM   670  C  CD2 . LEU A 1 102 ? -17.206 30.938 24.811 1.00 45.44 ? 158 LEU A CD2 1 
ATOM   671  N  N   . LYS A 1 103 ? -18.300 29.899 29.288 1.00 42.13 ? 159 LYS A N   1 
ATOM   672  C  CA  . LYS A 1 103 ? -18.011 28.601 29.873 1.00 40.91 ? 159 LYS A CA  1 
ATOM   673  C  C   . LYS A 1 103 ? -19.178 28.149 30.760 1.00 39.83 ? 159 LYS A C   1 
ATOM   674  O  O   . LYS A 1 103 ? -19.500 26.949 30.817 1.00 40.11 ? 159 LYS A O   1 
ATOM   675  C  CB  . LYS A 1 103 ? -16.708 28.667 30.687 1.00 42.35 ? 159 LYS A CB  1 
ATOM   676  C  CG  . LYS A 1 103 ? -15.598 27.756 30.177 1.00 41.73 ? 159 LYS A CG  1 
ATOM   677  C  CD  . LYS A 1 103 ? -14.227 28.405 30.310 1.00 43.49 ? 159 LYS A CD  1 
ATOM   678  C  CE  . LYS A 1 103 ? -13.152 27.559 29.635 1.00 44.27 ? 159 LYS A CE  1 
ATOM   679  N  NZ  . LYS A 1 103 ? -11.971 27.273 30.496 1.00 41.85 ? 159 LYS A NZ  1 
ATOM   680  N  N   . LYS A 1 104 ? -19.819 29.096 31.442 1.00 37.31 ? 160 LYS A N   1 
ATOM   681  C  CA  . LYS A 1 104 ? -20.949 28.740 32.289 1.00 38.57 ? 160 LYS A CA  1 
ATOM   682  C  C   . LYS A 1 104 ? -22.077 28.244 31.410 1.00 38.54 ? 160 LYS A C   1 
ATOM   683  O  O   . LYS A 1 104 ? -22.533 27.103 31.559 1.00 38.73 ? 160 LYS A O   1 
ATOM   684  C  CB  . LYS A 1 104 ? -21.450 29.934 33.099 1.00 41.64 ? 160 LYS A CB  1 
ATOM   685  C  CG  . LYS A 1 104 ? -22.667 29.569 33.988 1.00 44.48 ? 160 LYS A CG  1 
ATOM   686  C  CD  . LYS A 1 104 ? -23.455 30.781 34.499 1.00 47.23 ? 160 LYS A CD  1 
ATOM   687  C  CE  . LYS A 1 104 ? -23.114 32.076 33.759 1.00 50.56 ? 160 LYS A CE  1 
ATOM   688  N  NZ  . LYS A 1 104 ? -23.410 33.305 34.573 1.00 50.77 ? 160 LYS A NZ  1 
ATOM   689  N  N   . ILE A 1 105 ? -22.530 29.109 30.495 1.00 38.20 ? 161 ILE A N   1 
ATOM   690  C  CA  . ILE A 1 105 ? -23.597 28.740 29.574 1.00 37.86 ? 161 ILE A CA  1 
ATOM   691  C  C   . ILE A 1 105 ? -23.272 27.399 28.946 1.00 36.86 ? 161 ILE A C   1 
ATOM   692  O  O   . ILE A 1 105 ? -24.133 26.519 28.874 1.00 36.84 ? 161 ILE A O   1 
ATOM   693  C  CB  . ILE A 1 105 ? -23.778 29.777 28.453 1.00 39.32 ? 161 ILE A CB  1 
ATOM   694  C  CG1 . ILE A 1 105 ? -24.125 31.141 29.063 1.00 39.76 ? 161 ILE A CG1 1 
ATOM   695  C  CG2 . ILE A 1 105 ? -24.878 29.298 27.487 1.00 40.64 ? 161 ILE A CG2 1 
ATOM   696  C  CD1 . ILE A 1 105 ? -23.918 32.326 28.120 1.00 38.03 ? 161 ILE A CD1 1 
ATOM   697  N  N   . ILE A 1 106 ? -22.020 27.230 28.517 1.00 36.75 ? 162 ILE A N   1 
ATOM   698  C  CA  . ILE A 1 106 ? -21.595 25.968 27.915 1.00 37.13 ? 162 ILE A CA  1 
ATOM   699  C  C   . ILE A 1 106 ? -21.810 24.833 28.921 1.00 37.93 ? 162 ILE A C   1 
ATOM   700  O  O   . ILE A 1 106 ? -22.216 23.728 28.546 1.00 39.81 ? 162 ILE A O   1 
ATOM   701  C  CB  . ILE A 1 106 ? -20.084 25.993 27.501 1.00 36.96 ? 162 ILE A CB  1 
ATOM   702  C  CG1 . ILE A 1 106 ? -19.864 26.895 26.278 1.00 35.67 ? 162 ILE A CG1 1 
ATOM   703  C  CG2 . ILE A 1 106 ? -19.608 24.582 27.173 1.00 34.72 ? 162 ILE A CG2 1 
ATOM   704  C  CD1 . ILE A 1 106 ? -18.399 27.088 25.941 1.00 34.15 ? 162 ILE A CD1 1 
ATOM   705  N  N   . GLY A 1 107 ? -21.525 25.099 30.198 1.00 38.78 ? 163 GLY A N   1 
ATOM   706  C  CA  . GLY A 1 107 ? -21.715 24.080 31.218 1.00 38.48 ? 163 GLY A CA  1 
ATOM   707  C  C   . GLY A 1 107 ? -23.181 23.688 31.309 1.00 39.26 ? 163 GLY A C   1 
ATOM   708  O  O   . GLY A 1 107 ? -23.534 22.513 31.412 1.00 38.47 ? 163 GLY A O   1 
ATOM   709  N  N   . GLN A 1 108 ? -24.041 24.696 31.236 1.00 40.29 ? 164 GLN A N   1 
ATOM   710  C  CA  . GLN A 1 108 ? -25.483 24.503 31.313 1.00 40.60 ? 164 GLN A CA  1 
ATOM   711  C  C   . GLN A 1 108 ? -26.127 23.676 30.209 1.00 41.48 ? 164 GLN A C   1 
ATOM   712  O  O   . GLN A 1 108 ? -27.077 22.923 30.456 1.00 41.21 ? 164 GLN A O   1 
ATOM   713  C  CB  . GLN A 1 108 ? -26.141 25.867 31.378 1.00 41.55 ? 164 GLN A CB  1 
ATOM   714  C  CG  . GLN A 1 108 ? -25.508 26.741 32.449 1.00 45.66 ? 164 GLN A CG  1 
ATOM   715  C  CD  . GLN A 1 108 ? -26.133 28.110 32.516 1.00 47.19 ? 164 GLN A CD  1 
ATOM   716  O  OE1 . GLN A 1 108 ? -26.439 28.714 31.488 1.00 49.70 ? 164 GLN A OE1 1 
ATOM   717  N  NE2 . GLN A 1 108 ? -26.329 28.613 33.729 1.00 49.16 ? 164 GLN A NE2 1 
ATOM   718  N  N   . VAL A 1 109 ? -25.616 23.810 28.988 1.00 42.11 ? 165 VAL A N   1 
ATOM   719  C  CA  . VAL A 1 109 ? -26.177 23.090 27.857 1.00 41.88 ? 165 VAL A CA  1 
ATOM   720  C  C   . VAL A 1 109 ? -25.396 21.853 27.475 1.00 43.15 ? 165 VAL A C   1 
ATOM   721  O  O   . VAL A 1 109 ? -25.818 21.110 26.592 1.00 43.62 ? 165 VAL A O   1 
ATOM   722  C  CB  . VAL A 1 109 ? -26.258 24.012 26.606 1.00 42.19 ? 165 VAL A CB  1 
ATOM   723  C  CG1 . VAL A 1 109 ? -26.866 25.358 26.989 1.00 39.94 ? 165 VAL A CG1 1 
ATOM   724  C  CG2 . VAL A 1 109 ? -24.858 24.232 26.021 1.00 38.85 ? 165 VAL A CG2 1 
ATOM   725  N  N   . ARG A 1 110 ? -24.277 21.616 28.152 1.00 45.45 ? 166 ARG A N   1 
ATOM   726  C  CA  . ARG A 1 110 ? -23.411 20.488 27.811 1.00 47.40 ? 166 ARG A CA  1 
ATOM   727  C  C   . ARG A 1 110 ? -24.037 19.110 27.638 1.00 50.20 ? 166 ARG A C   1 
ATOM   728  O  O   . ARG A 1 110 ? -23.610 18.343 26.768 1.00 48.55 ? 166 ARG A O   1 
ATOM   729  C  CB  . ARG A 1 110 ? -22.257 20.373 28.806 1.00 46.06 ? 166 ARG A CB  1 
ATOM   730  C  CG  . ARG A 1 110 ? -21.218 19.350 28.345 1.00 44.16 ? 166 ARG A CG  1 
ATOM   731  C  CD  . ARG A 1 110 ? -20.654 19.754 26.975 1.00 40.83 ? 166 ARG A CD  1 
ATOM   732  N  NE  . ARG A 1 110 ? -19.594 18.864 26.516 1.00 39.56 ? 166 ARG A NE  1 
ATOM   733  C  CZ  . ARG A 1 110 ? -19.778 17.809 25.721 1.00 39.66 ? 166 ARG A CZ  1 
ATOM   734  N  NH1 . ARG A 1 110 ? -20.987 17.480 25.295 1.00 41.67 ? 166 ARG A NH1 1 
ATOM   735  N  NH2 . ARG A 1 110 ? -18.752 17.063 25.357 1.00 38.70 ? 166 ARG A NH2 1 
ATOM   736  N  N   . ASP A 1 111 ? -25.025 18.780 28.467 1.00 53.80 ? 167 ASP A N   1 
ATOM   737  C  CA  . ASP A 1 111 ? -25.669 17.474 28.364 1.00 57.87 ? 167 ASP A CA  1 
ATOM   738  C  C   . ASP A 1 111 ? -26.604 17.422 27.160 1.00 58.32 ? 167 ASP A C   1 
ATOM   739  O  O   . ASP A 1 111 ? -26.740 16.381 26.509 1.00 59.12 ? 167 ASP A O   1 
ATOM   740  C  CB  . ASP A 1 111 ? -26.431 17.139 29.661 1.00 60.43 ? 167 ASP A CB  1 
ATOM   741  C  CG  . ASP A 1 111 ? -27.795 17.799 29.734 1.00 63.88 ? 167 ASP A CG  1 
ATOM   742  O  OD1 . ASP A 1 111 ? -27.851 19.026 29.960 1.00 66.38 ? 167 ASP A OD1 1 
ATOM   743  O  OD2 . ASP A 1 111 ? -28.816 17.090 29.575 1.00 65.14 ? 167 ASP A OD2 1 
ATOM   744  N  N   . GLN A 1 112 ? -27.226 18.553 26.852 1.00 58.94 ? 168 GLN A N   1 
ATOM   745  C  CA  . GLN A 1 112 ? -28.145 18.646 25.719 1.00 59.25 ? 168 GLN A CA  1 
ATOM   746  C  C   . GLN A 1 112 ? -27.433 18.390 24.385 1.00 58.54 ? 168 GLN A C   1 
ATOM   747  O  O   . GLN A 1 112 ? -28.053 17.958 23.409 1.00 58.34 ? 168 GLN A O   1 
ATOM   748  C  CB  . GLN A 1 112 ? -28.802 20.029 25.697 1.00 60.89 ? 168 GLN A CB  1 
ATOM   749  C  CG  . GLN A 1 112 ? -30.326 19.998 25.683 1.00 62.66 ? 168 GLN A CG  1 
ATOM   750  C  CD  . GLN A 1 112 ? -30.936 21.034 24.749 1.00 62.46 ? 168 GLN A CD  1 
ATOM   751  O  OE1 . GLN A 1 112 ? -30.939 22.231 25.047 1.00 61.71 ? 168 GLN A OE1 1 
ATOM   752  N  NE2 . GLN A 1 112 ? -31.457 20.576 23.614 1.00 63.49 ? 168 GLN A NE2 1 
ATOM   753  N  N   . ALA A 1 113 ? -26.128 18.653 24.346 1.00 56.81 ? 169 ALA A N   1 
ATOM   754  C  CA  . ALA A 1 113 ? -25.350 18.453 23.129 1.00 54.61 ? 169 ALA A CA  1 
ATOM   755  C  C   . ALA A 1 113 ? -24.426 17.243 23.230 1.00 53.00 ? 169 ALA A C   1 
ATOM   756  O  O   . ALA A 1 113 ? -23.781 17.026 24.253 1.00 52.39 ? 169 ALA A O   1 
ATOM   757  C  CB  . ALA A 1 113 ? -24.538 19.703 22.828 1.00 55.30 ? 169 ALA A CB  1 
ATOM   758  N  N   . GLU A 1 114 ? -24.359 16.469 22.157 1.00 50.71 ? 170 GLU A N   1 
ATOM   759  C  CA  . GLU A 1 114 ? -23.518 15.281 22.121 1.00 50.03 ? 170 GLU A CA  1 
ATOM   760  C  C   . GLU A 1 114 ? -22.029 15.627 22.144 1.00 50.37 ? 170 GLU A C   1 
ATOM   761  O  O   . GLU A 1 114 ? -21.238 14.957 22.814 1.00 53.19 ? 170 GLU A O   1 
ATOM   762  C  CB  . GLU A 1 114 ? -23.834 14.455 20.871 0.00 48.52 ? 170 GLU A CB  1 
ATOM   763  C  CG  . GLU A 1 114 ? -24.935 13.425 21.068 0.00 46.10 ? 170 GLU A CG  1 
ATOM   764  C  CD  . GLU A 1 114 ? -26.250 14.049 21.495 0.00 44.93 ? 170 GLU A CD  1 
ATOM   765  O  OE1 . GLU A 1 114 ? -26.858 14.773 20.679 0.00 44.09 ? 170 GLU A OE1 1 
ATOM   766  O  OE2 . GLU A 1 114 ? -26.675 13.816 22.646 0.00 44.20 ? 170 GLU A OE2 1 
ATOM   767  N  N   . HIS A 1 115 ? -21.647 16.675 21.421 1.00 47.79 ? 171 HIS A N   1 
ATOM   768  C  CA  . HIS A 1 115 ? -20.253 17.085 21.357 1.00 45.21 ? 171 HIS A CA  1 
ATOM   769  C  C   . HIS A 1 115 ? -20.034 18.488 21.893 1.00 41.39 ? 171 HIS A C   1 
ATOM   770  O  O   . HIS A 1 115 ? -20.950 19.307 21.903 1.00 40.45 ? 171 HIS A O   1 
ATOM   771  C  CB  . HIS A 1 115 ? -19.755 17.012 19.914 1.00 48.67 ? 171 HIS A CB  1 
ATOM   772  C  CG  . HIS A 1 115 ? -20.122 15.742 19.218 1.00 53.43 ? 171 HIS A CG  1 
ATOM   773  N  ND1 . HIS A 1 115 ? -19.447 14.558 19.430 1.00 55.91 ? 171 HIS A ND1 1 
ATOM   774  C  CD2 . HIS A 1 115 ? -21.114 15.459 18.341 1.00 55.54 ? 171 HIS A CD2 1 
ATOM   775  C  CE1 . HIS A 1 115 ? -20.010 13.601 18.714 1.00 56.08 ? 171 HIS A CE1 1 
ATOM   776  N  NE2 . HIS A 1 115 ? -21.023 14.121 18.045 1.00 55.62 ? 171 HIS A NE2 1 
ATOM   777  N  N   . LEU A 1 116 ? -18.814 18.747 22.353 1.00 36.63 ? 172 LEU A N   1 
ATOM   778  C  CA  . LEU A 1 116 ? -18.447 20.060 22.869 1.00 35.70 ? 172 LEU A CA  1 
ATOM   779  C  C   . LEU A 1 116 ? -18.666 21.096 21.775 1.00 33.55 ? 172 LEU A C   1 
ATOM   780  O  O   . LEU A 1 116 ? -19.130 22.189 22.034 1.00 32.47 ? 172 LEU A O   1 
ATOM   781  C  CB  . LEU A 1 116 ? -16.970 20.081 23.291 1.00 32.28 ? 172 LEU A CB  1 
ATOM   782  C  CG  . LEU A 1 116 ? -16.483 21.460 23.696 1.00 31.09 ? 172 LEU A CG  1 
ATOM   783  C  CD1 . LEU A 1 116 ? -17.201 21.839 24.982 1.00 29.72 ? 172 LEU A CD1 1 
ATOM   784  C  CD2 . LEU A 1 116 ? -14.951 21.487 23.872 1.00 31.63 ? 172 LEU A CD2 1 
ATOM   785  N  N   . LYS A 1 117 ? -18.311 20.728 20.548 1.00 34.35 ? 173 LYS A N   1 
ATOM   786  C  CA  . LYS A 1 117 ? -18.443 21.603 19.384 1.00 35.69 ? 173 LYS A CA  1 
ATOM   787  C  C   . LYS A 1 117 ? -19.849 22.198 19.364 1.00 34.36 ? 173 LYS A C   1 
ATOM   788  O  O   . LYS A 1 117 ? -20.039 23.412 19.268 1.00 31.97 ? 173 LYS A O   1 
ATOM   789  C  CB  . LYS A 1 117 ? -18.228 20.782 18.104 1.00 36.76 ? 173 LYS A CB  1 
ATOM   790  C  CG  . LYS A 1 117 ? -17.138 21.282 17.202 1.00 42.16 ? 173 LYS A CG  1 
ATOM   791  C  CD  . LYS A 1 117 ? -16.728 20.195 16.201 1.00 44.61 ? 173 LYS A CD  1 
ATOM   792  C  CE  . LYS A 1 117 ? -17.355 20.404 14.825 1.00 45.79 ? 173 LYS A CE  1 
ATOM   793  N  NZ  . LYS A 1 117 ? -16.300 20.605 13.768 1.00 46.76 ? 173 LYS A NZ  1 
ATOM   794  N  N   . THR A 1 118 ? -20.828 21.308 19.442 1.00 33.57 ? 174 THR A N   1 
ATOM   795  C  CA  . THR A 1 118 ? -22.223 21.687 19.423 1.00 32.79 ? 174 THR A CA  1 
ATOM   796  C  C   . THR A 1 118 ? -22.646 22.469 20.665 1.00 31.63 ? 174 THR A C   1 
ATOM   797  O  O   . THR A 1 118 ? -23.428 23.409 20.546 1.00 30.06 ? 174 THR A O   1 
ATOM   798  C  CB  . THR A 1 118 ? -23.088 20.437 19.218 1.00 33.60 ? 174 THR A CB  1 
ATOM   799  O  OG1 . THR A 1 118 ? -22.588 19.732 18.075 1.00 34.76 ? 174 THR A OG1 1 
ATOM   800  C  CG2 . THR A 1 118 ? -24.555 20.814 18.956 1.00 33.09 ? 174 THR A CG2 1 
ATOM   801  N  N   . ALA A 1 119 ? -22.146 22.106 21.850 1.00 29.71 ? 175 ALA A N   1 
ATOM   802  C  CA  . ALA A 1 119 ? -22.494 22.876 23.058 1.00 28.83 ? 175 ALA A CA  1 
ATOM   803  C  C   . ALA A 1 119 ? -21.980 24.319 22.929 1.00 27.23 ? 175 ALA A C   1 
ATOM   804  O  O   . ALA A 1 119 ? -22.637 25.268 23.336 1.00 27.38 ? 175 ALA A O   1 
ATOM   805  C  CB  . ALA A 1 119 ? -21.879 22.219 24.323 1.00 28.74 ? 175 ALA A CB  1 
ATOM   806  N  N   . VAL A 1 120 ? -20.781 24.473 22.368 1.00 27.20 ? 176 VAL A N   1 
ATOM   807  C  CA  . VAL A 1 120 ? -20.178 25.787 22.188 1.00 23.89 ? 176 VAL A CA  1 
ATOM   808  C  C   . VAL A 1 120 ? -21.019 26.704 21.276 1.00 22.52 ? 176 VAL A C   1 
ATOM   809  O  O   . VAL A 1 120 ? -21.242 27.862 21.595 1.00 21.65 ? 176 VAL A O   1 
ATOM   810  C  CB  . VAL A 1 120 ? -18.743 25.648 21.601 1.00 24.13 ? 176 VAL A CB  1 
ATOM   811  C  CG1 . VAL A 1 120 ? -18.225 27.030 21.134 1.00 22.26 ? 176 VAL A CG1 1 
ATOM   812  C  CG2 . VAL A 1 120 ? -17.787 25.019 22.667 1.00 25.05 ? 176 VAL A CG2 1 
ATOM   813  N  N   . GLN A 1 121 ? -21.484 26.190 20.143 1.00 23.04 ? 177 GLN A N   1 
ATOM   814  C  CA  . GLN A 1 121 ? -22.271 27.021 19.230 1.00 23.60 ? 177 GLN A CA  1 
ATOM   815  C  C   . GLN A 1 121 ? -23.621 27.314 19.870 1.00 23.71 ? 177 GLN A C   1 
ATOM   816  O  O   . GLN A 1 121 ? -24.201 28.364 19.638 1.00 24.57 ? 177 GLN A O   1 
ATOM   817  C  CB  . GLN A 1 121 ? -22.442 26.328 17.873 1.00 24.06 ? 177 GLN A CB  1 
ATOM   818  C  CG  . GLN A 1 121 ? -21.145 26.132 17.108 1.00 25.68 ? 177 GLN A CG  1 
ATOM   819  C  CD  . GLN A 1 121 ? -20.216 27.347 17.177 1.00 24.48 ? 177 GLN A CD  1 
ATOM   820  O  OE1 . GLN A 1 121 ? -20.662 28.474 17.384 1.00 25.76 ? 177 GLN A OE1 1 
ATOM   821  N  NE2 . GLN A 1 121 ? -18.924 27.112 17.007 1.00 23.57 ? 177 GLN A NE2 1 
ATOM   822  N  N   . MET A 1 122 ? -24.121 26.390 20.690 1.00 24.36 ? 178 MET A N   1 
ATOM   823  C  CA  . MET A 1 122 ? -25.392 26.629 21.391 1.00 24.82 ? 178 MET A CA  1 
ATOM   824  C  C   . MET A 1 122 ? -25.184 27.765 22.387 1.00 22.32 ? 178 MET A C   1 
ATOM   825  O  O   . MET A 1 122 ? -26.027 28.639 22.506 1.00 22.56 ? 178 MET A O   1 
ATOM   826  C  CB  . MET A 1 122 ? -25.863 25.371 22.135 1.00 24.90 ? 178 MET A CB  1 
ATOM   827  C  CG  . MET A 1 122 ? -26.522 24.318 21.234 1.00 27.13 ? 178 MET A CG  1 
ATOM   828  S  SD  . MET A 1 122 ? -26.650 22.646 21.996 1.00 32.62 ? 178 MET A SD  1 
ATOM   829  C  CE  . MET A 1 122 ? -28.041 22.829 23.100 1.00 29.40 ? 178 MET A CE  1 
ATOM   830  N  N   . ALA A 1 123 ? -24.050 27.751 23.092 1.00 23.70 ? 179 ALA A N   1 
ATOM   831  C  CA  . ALA A 1 123 ? -23.702 28.787 24.066 1.00 21.70 ? 179 ALA A CA  1 
ATOM   832  C  C   . ALA A 1 123 ? -23.579 30.152 23.386 1.00 22.22 ? 179 ALA A C   1 
ATOM   833  O  O   . ALA A 1 123 ? -24.056 31.161 23.912 1.00 25.12 ? 179 ALA A O   1 
ATOM   834  C  CB  . ALA A 1 123 ? -22.387 28.435 24.749 1.00 23.31 ? 179 ALA A CB  1 
ATOM   835  N  N   . VAL A 1 124 ? -22.921 30.183 22.226 1.00 21.54 ? 180 VAL A N   1 
ATOM   836  C  CA  . VAL A 1 124 ? -22.747 31.417 21.449 1.00 19.50 ? 180 VAL A CA  1 
ATOM   837  C  C   . VAL A 1 124 ? -24.130 31.956 21.086 1.00 19.31 ? 180 VAL A C   1 
ATOM   838  O  O   . VAL A 1 124 ? -24.420 33.124 21.283 1.00 20.62 ? 180 VAL A O   1 
ATOM   839  C  CB  . VAL A 1 124 ? -21.911 31.136 20.162 1.00 20.09 ? 180 VAL A CB  1 
ATOM   840  C  CG1 . VAL A 1 124 ? -22.118 32.256 19.139 1.00 17.39 ? 180 VAL A CG1 1 
ATOM   841  C  CG2 . VAL A 1 124 ? -20.401 30.960 20.526 1.00 20.64 ? 180 VAL A CG2 1 
ATOM   842  N  N   . PHE A 1 125 ? -25.001 31.081 20.584 1.00 20.71 ? 181 PHE A N   1 
ATOM   843  C  CA  . PHE A 1 125 ? -26.376 31.474 20.232 1.00 22.37 ? 181 PHE A CA  1 
ATOM   844  C  C   . PHE A 1 125 ? -27.065 32.086 21.470 1.00 24.46 ? 181 PHE A C   1 
ATOM   845  O  O   . PHE A 1 125 ? -27.587 33.205 21.432 1.00 24.51 ? 181 PHE A O   1 
ATOM   846  C  CB  . PHE A 1 125 ? -27.125 30.221 19.735 1.00 19.65 ? 181 PHE A CB  1 
ATOM   847  C  CG  . PHE A 1 125 ? -28.575 30.459 19.359 1.00 24.27 ? 181 PHE A CG  1 
ATOM   848  C  CD1 . PHE A 1 125 ? -29.548 30.661 20.349 1.00 23.56 ? 181 PHE A CD1 1 
ATOM   849  C  CD2 . PHE A 1 125 ? -28.989 30.348 18.025 1.00 23.07 ? 181 PHE A CD2 1 
ATOM   850  C  CE1 . PHE A 1 125 ? -30.911 30.734 20.035 1.00 23.94 ? 181 PHE A CE1 1 
ATOM   851  C  CE2 . PHE A 1 125 ? -30.350 30.416 17.697 1.00 23.27 ? 181 PHE A CE2 1 
ATOM   852  C  CZ  . PHE A 1 125 ? -31.316 30.607 18.696 1.00 24.23 ? 181 PHE A CZ  1 
ATOM   853  N  N   . ILE A 1 126 ? -27.062 31.351 22.579 1.00 25.19 ? 182 ILE A N   1 
ATOM   854  C  CA  . ILE A 1 126 ? -27.680 31.853 23.822 1.00 23.67 ? 182 ILE A CA  1 
ATOM   855  C  C   . ILE A 1 126 ? -27.120 33.213 24.236 1.00 21.13 ? 182 ILE A C   1 
ATOM   856  O  O   . ILE A 1 126 ? -27.855 34.196 24.455 1.00 21.80 ? 182 ILE A O   1 
ATOM   857  C  CB  . ILE A 1 126 ? -27.473 30.827 24.984 1.00 24.19 ? 182 ILE A CB  1 
ATOM   858  C  CG1 . ILE A 1 126 ? -28.412 29.634 24.784 1.00 22.61 ? 182 ILE A CG1 1 
ATOM   859  C  CG2 . ILE A 1 126 ? -27.762 31.500 26.349 1.00 24.64 ? 182 ILE A CG2 1 
ATOM   860  C  CD1 . ILE A 1 126 ? -27.831 28.324 25.278 1.00 26.01 ? 182 ILE A CD1 1 
ATOM   861  N  N   . HIS A 1 127 ? -25.803 33.309 24.291 1.00 22.51 ? 183 HIS A N   1 
ATOM   862  C  CA  . HIS A 1 127 ? -25.211 34.572 24.689 1.00 24.21 ? 183 HIS A CA  1 
ATOM   863  C  C   . HIS A 1 127 ? -25.553 35.752 23.770 1.00 25.89 ? 183 HIS A C   1 
ATOM   864  O  O   . HIS A 1 127 ? -25.873 36.845 24.254 1.00 27.36 ? 183 HIS A O   1 
ATOM   865  C  CB  . HIS A 1 127 ? -23.693 34.433 24.790 1.00 26.38 ? 183 HIS A CB  1 
ATOM   866  C  CG  . HIS A 1 127 ? -22.967 35.745 24.771 1.00 29.97 ? 183 HIS A CG  1 
ATOM   867  N  ND1 . HIS A 1 127 ? -22.610 36.419 25.923 1.00 31.92 ? 183 HIS A ND1 1 
ATOM   868  C  CD2 . HIS A 1 127 ? -22.563 36.524 23.739 1.00 29.04 ? 183 HIS A CD2 1 
ATOM   869  C  CE1 . HIS A 1 127 ? -22.018 37.553 25.599 1.00 32.22 ? 183 HIS A CE1 1 
ATOM   870  N  NE2 . HIS A 1 127 ? -21.977 37.641 24.281 1.00 31.03 ? 183 HIS A NE2 1 
ATOM   871  N  N   . ASN A 1 128 ? -25.495 35.547 22.452 1.00 25.73 ? 184 ASN A N   1 
ATOM   872  C  CA  . ASN A 1 128 ? -25.750 36.646 21.511 1.00 26.33 ? 184 ASN A CA  1 
ATOM   873  C  C   . ASN A 1 128 ? -27.206 37.112 21.480 1.00 29.61 ? 184 ASN A C   1 
ATOM   874  O  O   . ASN A 1 128 ? -27.478 38.272 21.178 1.00 31.17 ? 184 ASN A O   1 
ATOM   875  C  CB  . ASN A 1 128 ? -25.315 36.235 20.091 1.00 22.17 ? 184 ASN A CB  1 
ATOM   876  C  CG  . ASN A 1 128 ? -23.790 36.295 19.884 1.00 23.52 ? 184 ASN A CG  1 
ATOM   877  O  OD1 . ASN A 1 128 ? -23.035 36.780 20.733 1.00 20.18 ? 184 ASN A OD1 1 
ATOM   878  N  ND2 . ASN A 1 128 ? -23.342 35.805 18.737 1.00 20.76 ? 184 ASN A ND2 1 
ATOM   879  N  N   . HIS A 1 129 ? -28.135 36.210 21.787 1.00 33.04 ? 185 HIS A N   1 
ATOM   880  C  CA  . HIS A 1 129 ? -29.567 36.528 21.786 1.00 38.14 ? 185 HIS A CA  1 
ATOM   881  C  C   . HIS A 1 129 ? -30.129 37.037 23.124 1.00 40.46 ? 185 HIS A C   1 
ATOM   882  O  O   . HIS A 1 129 ? -31.248 37.537 23.167 1.00 40.82 ? 185 HIS A O   1 
ATOM   883  C  CB  . HIS A 1 129 ? -30.377 35.300 21.357 1.00 38.87 ? 185 HIS A CB  1 
ATOM   884  C  CG  . HIS A 1 129 ? -30.157 34.894 19.933 1.00 40.14 ? 185 HIS A CG  1 
ATOM   885  N  ND1 . HIS A 1 129 ? -29.172 35.444 19.142 1.00 43.01 ? 185 HIS A ND1 1 
ATOM   886  C  CD2 . HIS A 1 129 ? -30.786 33.978 19.165 1.00 41.78 ? 185 HIS A CD2 1 
ATOM   887  C  CE1 . HIS A 1 129 ? -29.203 34.882 17.950 1.00 42.45 ? 185 HIS A CE1 1 
ATOM   888  N  NE2 . HIS A 1 129 ? -30.173 33.989 17.937 1.00 41.79 ? 185 HIS A NE2 1 
ATOM   889  N  N   . LYS A 1 130 ? -29.360 36.893 24.203 1.00 42.84 ? 186 LYS A N   1 
ATOM   890  C  CA  . LYS A 1 130 ? -29.768 37.337 25.531 1.00 43.89 ? 186 LYS A CA  1 
ATOM   891  C  C   . LYS A 1 130 ? -29.997 38.846 25.528 1.00 45.52 ? 186 LYS A C   1 
ATOM   892  O  O   . LYS A 1 130 ? -29.076 39.613 25.285 1.00 44.66 ? 186 LYS A O   1 
ATOM   893  C  CB  . LYS A 1 130 ? -28.675 36.978 26.546 1.00 45.86 ? 186 LYS A CB  1 
ATOM   894  C  CG  . LYS A 1 130 ? -29.158 36.837 27.981 1.00 48.03 ? 186 LYS A CG  1 
ATOM   895  C  CD  . LYS A 1 130 ? -28.177 36.040 28.822 0.00 48.38 ? 186 LYS A CD  1 
ATOM   896  C  CE  . LYS A 1 130 ? -28.798 34.738 29.297 0.00 49.17 ? 186 LYS A CE  1 
ATOM   897  N  NZ  . LYS A 1 130 ? -27.764 33.742 29.690 0.00 49.16 ? 186 LYS A NZ  1 
ATOM   898  N  N   . ARG A 1 131 ? -31.227 39.283 25.784 1.00 47.61 ? 187 ARG A N   1 
ATOM   899  C  CA  . ARG A 1 131 ? -31.499 40.721 25.801 1.00 49.40 ? 187 ARG A CA  1 
ATOM   900  C  C   . ARG A 1 131 ? -31.060 41.313 27.135 1.00 50.54 ? 187 ARG A C   1 
ATOM   901  O  O   . ARG A 1 131 ? -31.176 40.658 28.168 1.00 51.92 ? 187 ARG A O   1 
ATOM   902  C  CB  . ARG A 1 131 ? -32.986 40.993 25.559 1.00 47.87 ? 187 ARG A CB  1 
ATOM   903  C  CG  . ARG A 1 131 ? -33.357 41.047 24.084 0.00 45.85 ? 187 ARG A CG  1 
ATOM   904  C  CD  . ARG A 1 131 ? -34.809 40.666 23.848 0.00 43.81 ? 187 ARG A CD  1 
ATOM   905  N  NE  . ARG A 1 131 ? -35.062 40.340 22.447 0.00 41.59 ? 187 ARG A NE  1 
ATOM   906  C  CZ  . ARG A 1 131 ? -36.151 40.706 21.777 0.00 40.20 ? 187 ARG A CZ  1 
ATOM   907  N  NH1 . ARG A 1 131 ? -37.097 41.413 22.379 0.00 39.38 ? 187 ARG A NH1 1 
ATOM   908  N  NH2 . ARG A 1 131 ? -36.294 40.364 20.504 0.00 39.56 ? 187 ARG A NH2 1 
ATOM   909  N  N   . LYS A 1 132 ? -30.542 42.541 27.110 1.00 51.93 ? 188 LYS A N   1 
ATOM   910  C  CA  . LYS A 1 132 ? -30.073 43.216 28.333 1.00 53.14 ? 188 LYS A CA  1 
ATOM   911  C  C   . LYS A 1 132 ? -31.182 43.344 29.382 1.00 52.95 ? 188 LYS A C   1 
ATOM   912  O  O   . LYS A 1 132 ? -30.927 43.732 30.527 1.00 54.59 ? 188 LYS A O   1 
ATOM   913  C  CB  . LYS A 1 132 ? -29.526 44.616 28.000 1.00 53.40 ? 188 LYS A CB  1 
ATOM   914  C  CG  . LYS A 1 132 ? -28.732 45.280 29.119 1.00 52.83 ? 188 LYS A CG  1 
ATOM   915  C  CD  . LYS A 1 132 ? -27.326 45.637 28.670 0.00 53.26 ? 188 LYS A CD  1 
ATOM   916  C  CE  . LYS A 1 132 ? -26.391 45.785 29.859 0.00 53.53 ? 188 LYS A CE  1 
ATOM   917  N  NZ  . LYS A 1 132 ? -24.979 45.984 29.434 0.00 54.31 ? 188 LYS A NZ  1 
ATOM   918  N  N   . GLY A 1 133 ? -32.409 43.021 28.984 0.00 50.62 ? 189 GLY A N   1 
ATOM   919  C  CA  . GLY A 1 133 ? -33.533 43.098 29.901 0.00 47.27 ? 189 GLY A CA  1 
ATOM   920  C  C   . GLY A 1 133 ? -34.154 44.479 29.993 0.00 45.36 ? 189 GLY A C   1 
ATOM   921  O  O   . GLY A 1 133 ? -33.493 45.485 29.739 0.00 45.04 ? 189 GLY A O   1 
ATOM   922  N  N   . GLY A 1 134 ? -35.432 44.525 30.358 0.00 43.16 ? 190 GLY A N   1 
ATOM   923  C  CA  . GLY A 1 134 ? -36.125 45.795 30.482 0.00 41.04 ? 190 GLY A CA  1 
ATOM   924  C  C   . GLY A 1 134 ? -36.911 46.167 29.240 0.00 39.29 ? 190 GLY A C   1 
ATOM   925  O  O   . GLY A 1 134 ? -36.884 45.449 28.240 0.00 39.20 ? 190 GLY A O   1 
ATOM   926  N  N   . ILE A 1 135 ? -37.614 47.294 29.305 0.00 38.15 ? 191 ILE A N   1 
ATOM   927  C  CA  . ILE A 1 135 ? -38.412 47.770 28.181 0.00 36.98 ? 191 ILE A CA  1 
ATOM   928  C  C   . ILE A 1 135 ? -37.536 47.939 26.944 0.00 36.93 ? 191 ILE A C   1 
ATOM   929  O  O   . ILE A 1 135 ? -36.685 48.826 26.890 0.00 36.48 ? 191 ILE A O   1 
ATOM   930  C  CB  . ILE A 1 135 ? -39.085 49.121 28.509 0.00 36.10 ? 191 ILE A CB  1 
ATOM   931  C  CG1 . ILE A 1 135 ? -39.909 48.996 29.794 0.00 35.44 ? 191 ILE A CG1 1 
ATOM   932  C  CG2 . ILE A 1 135 ? -39.968 49.560 27.350 0.00 35.81 ? 191 ILE A CG2 1 
ATOM   933  C  CD1 . ILE A 1 135 ? -41.005 47.947 29.730 0.00 34.69 ? 191 ILE A CD1 1 
ATOM   934  N  N   . GLY A 1 136 ? -37.755 47.081 25.952 0.00 36.98 ? 192 GLY A N   1 
ATOM   935  C  CA  . GLY A 1 136 ? -36.972 47.137 24.731 0.00 37.60 ? 192 GLY A CA  1 
ATOM   936  C  C   . GLY A 1 136 ? -35.948 46.020 24.725 0.00 38.05 ? 192 GLY A C   1 
ATOM   937  O  O   . GLY A 1 136 ? -36.010 45.111 23.897 0.00 37.84 ? 192 GLY A O   1 
ATOM   938  N  N   . GLY A 1 137 ? -35.006 46.098 25.660 0.00 38.83 ? 193 GLY A N   1 
ATOM   939  C  CA  . GLY A 1 137 ? -33.966 45.092 25.789 0.00 39.69 ? 193 GLY A CA  1 
ATOM   940  C  C   . GLY A 1 137 ? -33.302 44.623 24.510 0.00 40.18 ? 193 GLY A C   1 
ATOM   941  O  O   . GLY A 1 137 ? -33.896 43.878 23.730 0.00 40.56 ? 193 GLY A O   1 
ATOM   942  N  N   . TYR A 1 138 ? -32.064 45.055 24.288 1.00 41.01 ? 194 TYR A N   1 
ATOM   943  C  CA  . TYR A 1 138 ? -31.333 44.635 23.095 1.00 39.25 ? 194 TYR A CA  1 
ATOM   944  C  C   . TYR A 1 138 ? -30.256 43.617 23.475 1.00 37.54 ? 194 TYR A C   1 
ATOM   945  O  O   . TYR A 1 138 ? -29.711 43.644 24.578 1.00 35.31 ? 194 TYR A O   1 
ATOM   946  C  CB  . TYR A 1 138 ? -30.744 45.860 22.376 1.00 40.11 ? 194 TYR A CB  1 
ATOM   947  C  CG  . TYR A 1 138 ? -31.766 46.970 22.210 0.00 38.55 ? 194 TYR A CG  1 
ATOM   948  C  CD1 . TYR A 1 138 ? -32.168 47.744 23.300 0.00 38.37 ? 194 TYR A CD1 1 
ATOM   949  C  CD2 . TYR A 1 138 ? -32.371 47.210 20.977 0.00 38.44 ? 194 TYR A CD2 1 
ATOM   950  C  CE1 . TYR A 1 138 ? -33.150 48.724 23.169 0.00 37.83 ? 194 TYR A CE1 1 
ATOM   951  C  CE2 . TYR A 1 138 ? -33.355 48.190 20.834 0.00 37.90 ? 194 TYR A CE2 1 
ATOM   952  C  CZ  . TYR A 1 138 ? -33.740 48.940 21.934 0.00 37.75 ? 194 TYR A CZ  1 
ATOM   953  O  OH  . TYR A 1 138 ? -34.720 49.897 21.802 0.00 37.05 ? 194 TYR A OH  1 
ATOM   954  N  N   . SER A 1 139 ? -29.999 42.681 22.570 1.00 36.27 ? 195 SER A N   1 
ATOM   955  C  CA  . SER A 1 139 ? -28.999 41.646 22.794 1.00 34.60 ? 195 SER A CA  1 
ATOM   956  C  C   . SER A 1 139 ? -27.681 42.049 22.145 1.00 33.51 ? 195 SER A C   1 
ATOM   957  O  O   . SER A 1 139 ? -27.629 43.013 21.399 1.00 32.66 ? 195 SER A O   1 
ATOM   958  C  CB  . SER A 1 139 ? -29.480 40.342 22.179 1.00 36.45 ? 195 SER A CB  1 
ATOM   959  O  OG  . SER A 1 139 ? -29.798 40.549 20.819 1.00 37.25 ? 195 SER A OG  1 
ATOM   960  N  N   . ALA A 1 140 ? -26.611 41.318 22.433 1.00 32.35 ? 196 ALA A N   1 
ATOM   961  C  CA  . ALA A 1 140 ? -25.322 41.624 21.827 1.00 31.10 ? 196 ALA A CA  1 
ATOM   962  C  C   . ALA A 1 140 ? -25.454 41.527 20.298 1.00 30.20 ? 196 ALA A C   1 
ATOM   963  O  O   . ALA A 1 140 ? -24.871 42.327 19.553 1.00 30.07 ? 196 ALA A O   1 
ATOM   964  C  CB  . ALA A 1 140 ? -24.260 40.646 22.349 1.00 29.10 ? 196 ALA A CB  1 
ATOM   965  N  N   . GLY A 1 141 ? -26.242 40.556 19.840 1.00 29.79 ? 197 GLY A N   1 
ATOM   966  C  CA  . GLY A 1 141 ? -26.447 40.369 18.417 1.00 29.67 ? 197 GLY A CA  1 
ATOM   967  C  C   . GLY A 1 141 ? -27.148 41.531 17.743 1.00 30.49 ? 197 GLY A C   1 
ATOM   968  O  O   . GLY A 1 141 ? -26.849 41.882 16.591 1.00 27.70 ? 197 GLY A O   1 
ATOM   969  N  N   . GLU A 1 142 ? -28.109 42.122 18.444 1.00 31.46 ? 198 GLU A N   1 
ATOM   970  C  CA  . GLU A 1 142 ? -28.834 43.278 17.899 1.00 32.11 ? 198 GLU A CA  1 
ATOM   971  C  C   . GLU A 1 142 ? -27.901 44.490 17.921 1.00 32.03 ? 198 GLU A C   1 
ATOM   972  O  O   . GLU A 1 142 ? -27.830 45.275 16.956 1.00 30.96 ? 198 GLU A O   1 
ATOM   973  C  CB  . GLU A 1 142 ? -30.090 43.549 18.746 1.00 33.42 ? 198 GLU A CB  1 
ATOM   974  C  CG  . GLU A 1 142 ? -31.304 42.748 18.272 1.00 36.57 ? 198 GLU A CG  1 
ATOM   975  C  CD  . GLU A 1 142 ? -32.362 42.564 19.325 1.00 36.14 ? 198 GLU A CD  1 
ATOM   976  O  OE1 . GLU A 1 142 ? -32.111 42.875 20.503 1.00 39.62 ? 198 GLU A OE1 1 
ATOM   977  O  OE2 . GLU A 1 142 ? -33.462 42.099 18.971 1.00 38.62 ? 198 GLU A OE2 1 
ATOM   978  N  N   . ARG A 1 143 ? -27.164 44.621 19.019 1.00 31.46 ? 199 ARG A N   1 
ATOM   979  C  CA  . ARG A 1 143 ? -26.215 45.717 19.200 1.00 32.98 ? 199 ARG A CA  1 
ATOM   980  C  C   . ARG A 1 143 ? -25.128 45.752 18.145 1.00 32.67 ? 199 ARG A C   1 
ATOM   981  O  O   . ARG A 1 143 ? -24.807 46.827 17.655 1.00 33.75 ? 199 ARG A O   1 
ATOM   982  C  CB  . ARG A 1 143 ? -25.526 45.632 20.561 1.00 35.34 ? 199 ARG A CB  1 
ATOM   983  C  CG  . ARG A 1 143 ? -26.226 46.345 21.667 1.00 39.03 ? 199 ARG A CG  1 
ATOM   984  C  CD  . ARG A 1 143 ? -25.203 46.778 22.689 1.00 44.76 ? 199 ARG A CD  1 
ATOM   985  N  NE  . ARG A 1 143 ? -24.593 45.610 23.308 1.00 47.96 ? 199 ARG A NE  1 
ATOM   986  C  CZ  . ARG A 1 143 ? -25.263 44.743 24.059 1.00 49.52 ? 199 ARG A CZ  1 
ATOM   987  N  NH1 . ARG A 1 143 ? -26.560 44.930 24.272 1.00 50.81 ? 199 ARG A NH1 1 
ATOM   988  N  NH2 . ARG A 1 143 ? -24.646 43.685 24.584 1.00 49.85 ? 199 ARG A NH2 1 
ATOM   989  N  N   . ILE A 1 144 ? -24.546 44.603 17.782 1.00 31.16 ? 200 ILE A N   1 
ATOM   990  C  CA  . ILE A 1 144 ? -23.487 44.657 16.777 1.00 29.84 ? 200 ILE A CA  1 
ATOM   991  C  C   . ILE A 1 144 ? -23.995 45.121 15.404 1.00 29.79 ? 200 ILE A C   1 
ATOM   992  O  O   . ILE A 1 144 ? -23.358 45.942 14.740 1.00 28.87 ? 200 ILE A O   1 
ATOM   993  C  CB  . ILE A 1 144 ? -22.699 43.286 16.660 1.00 29.06 ? 200 ILE A CB  1 
ATOM   994  C  CG1 . ILE A 1 144 ? -21.547 43.428 15.651 1.00 24.48 ? 200 ILE A CG1 1 
ATOM   995  C  CG2 . ILE A 1 144 ? -23.633 42.151 16.326 1.00 26.16 ? 200 ILE A CG2 1 
ATOM   996  C  CD1 . ILE A 1 144 ? -20.506 42.309 15.688 1.00 20.77 ? 200 ILE A CD1 1 
ATOM   997  N  N   . VAL A 1 145 ? -25.136 44.613 14.968 1.00 30.09 ? 201 VAL A N   1 
ATOM   998  C  CA  . VAL A 1 145 ? -25.667 45.028 13.679 1.00 32.67 ? 201 VAL A CA  1 
ATOM   999  C  C   . VAL A 1 145 ? -25.995 46.535 13.674 1.00 32.89 ? 201 VAL A C   1 
ATOM   1000 O  O   . VAL A 1 145 ? -25.744 47.234 12.694 1.00 32.44 ? 201 VAL A O   1 
ATOM   1001 C  CB  . VAL A 1 145 ? -26.914 44.196 13.304 1.00 33.34 ? 201 VAL A CB  1 
ATOM   1002 C  CG1 . VAL A 1 145 ? -27.825 44.996 12.405 1.00 36.82 ? 201 VAL A CG1 1 
ATOM   1003 C  CG2 . VAL A 1 145 ? -26.481 42.940 12.590 1.00 33.75 ? 201 VAL A CG2 1 
ATOM   1004 N  N   . ASP A 1 146 ? -26.540 47.039 14.772 1.00 35.46 ? 202 ASP A N   1 
ATOM   1005 C  CA  . ASP A 1 146 ? -26.860 48.460 14.850 1.00 37.85 ? 202 ASP A CA  1 
ATOM   1006 C  C   . ASP A 1 146 ? -25.594 49.308 14.836 1.00 37.67 ? 202 ASP A C   1 
ATOM   1007 O  O   . ASP A 1 146 ? -25.498 50.298 14.103 1.00 37.99 ? 202 ASP A O   1 
ATOM   1008 C  CB  . ASP A 1 146 ? -27.640 48.768 16.125 1.00 40.20 ? 202 ASP A CB  1 
ATOM   1009 C  CG  . ASP A 1 146 ? -28.286 50.145 16.086 1.00 43.04 ? 202 ASP A CG  1 
ATOM   1010 O  OD1 . ASP A 1 146 ? -29.092 50.392 15.162 1.00 46.68 ? 202 ASP A OD1 1 
ATOM   1011 O  OD2 . ASP A 1 146 ? -27.988 50.970 16.971 1.00 43.15 ? 202 ASP A OD2 1 
ATOM   1012 N  N   . ILE A 1 147 ? -24.612 48.925 15.644 1.00 37.19 ? 203 ILE A N   1 
ATOM   1013 C  CA  . ILE A 1 147 ? -23.382 49.695 15.681 1.00 36.33 ? 203 ILE A CA  1 
ATOM   1014 C  C   . ILE A 1 147 ? -22.712 49.729 14.313 1.00 37.01 ? 203 ILE A C   1 
ATOM   1015 O  O   . ILE A 1 147 ? -22.264 50.795 13.880 1.00 38.07 ? 203 ILE A O   1 
ATOM   1016 C  CB  . ILE A 1 147 ? -22.379 49.141 16.731 1.00 34.92 ? 203 ILE A CB  1 
ATOM   1017 C  CG1 . ILE A 1 147 ? -22.792 49.592 18.141 1.00 36.50 ? 203 ILE A CG1 1 
ATOM   1018 C  CG2 . ILE A 1 147 ? -20.993 49.704 16.477 1.00 33.56 ? 203 ILE A CG2 1 
ATOM   1019 C  CD1 . ILE A 1 147 ? -22.591 48.552 19.231 1.00 30.44 ? 203 ILE A CD1 1 
ATOM   1020 N  N   . ILE A 1 148 ? -22.639 48.577 13.633 1.00 35.64 ? 204 ILE A N   1 
ATOM   1021 C  CA  . ILE A 1 148 ? -21.990 48.519 12.317 1.00 35.39 ? 204 ILE A CA  1 
ATOM   1022 C  C   . ILE A 1 148 ? -22.810 49.254 11.264 1.00 37.22 ? 204 ILE A C   1 
ATOM   1023 O  O   . ILE A 1 148 ? -22.243 49.967 10.417 1.00 35.01 ? 204 ILE A O   1 
ATOM   1024 C  CB  . ILE A 1 148 ? -21.764 47.060 11.803 1.00 34.95 ? 204 ILE A CB  1 
ATOM   1025 C  CG1 . ILE A 1 148 ? -20.920 46.234 12.796 1.00 33.40 ? 204 ILE A CG1 1 
ATOM   1026 C  CG2 . ILE A 1 148 ? -21.070 47.113 10.458 1.00 34.57 ? 204 ILE A CG2 1 
ATOM   1027 C  CD1 . ILE A 1 148 ? -19.581 46.871 13.133 1.00 34.85 ? 204 ILE A CD1 1 
ATOM   1028 N  N   . ALA A 1 149 ? -24.133 49.058 11.307 1.00 37.29 ? 205 ALA A N   1 
ATOM   1029 C  CA  . ALA A 1 149 ? -25.043 49.714 10.362 1.00 41.03 ? 205 ALA A CA  1 
ATOM   1030 C  C   . ALA A 1 149 ? -24.897 51.221 10.478 1.00 43.40 ? 205 ALA A C   1 
ATOM   1031 O  O   . ALA A 1 149 ? -24.538 51.908 9.521  1.00 44.84 ? 205 ALA A O   1 
ATOM   1032 C  CB  . ALA A 1 149 ? -26.482 49.332 10.652 1.00 37.70 ? 205 ALA A CB  1 
ATOM   1033 N  N   . THR A 1 150 ? -25.192 51.729 11.664 1.00 45.24 ? 206 THR A N   1 
ATOM   1034 C  CA  . THR A 1 150 ? -25.093 53.150 11.927 1.00 47.30 ? 206 THR A CA  1 
ATOM   1035 C  C   . THR A 1 150 ? -23.766 53.731 11.454 1.00 47.93 ? 206 THR A C   1 
ATOM   1036 O  O   . THR A 1 150 ? -23.722 54.846 10.941 1.00 48.21 ? 206 THR A O   1 
ATOM   1037 C  CB  . THR A 1 150 ? -25.228 53.424 13.424 1.00 47.26 ? 206 THR A CB  1 
ATOM   1038 O  OG1 . THR A 1 150 ? -26.441 52.837 13.901 1.00 48.83 ? 206 THR A OG1 1 
ATOM   1039 C  CG2 . THR A 1 150 ? -25.252 54.927 13.695 1.00 47.98 ? 206 THR A CG2 1 
ATOM   1040 N  N   . ASP A 1 151 ? -22.694 52.962 11.629 1.00 49.21 ? 207 ASP A N   1 
ATOM   1041 C  CA  . ASP A 1 151 ? -21.347 53.384 11.262 1.00 49.92 ? 207 ASP A CA  1 
ATOM   1042 C  C   . ASP A 1 151 ? -21.092 53.337 9.759  1.00 49.72 ? 207 ASP A C   1 
ATOM   1043 O  O   . ASP A 1 151 ? -20.078 53.921 9.331  1.00 49.65 ? 207 ASP A O   1 
ATOM   1044 C  CB  . ASP A 1 151 ? -20.327 52.503 11.994 1.00 52.28 ? 207 ASP A CB  1 
ATOM   1045 C  CG  . ASP A 1 151 ? -18.906 53.030 11.887 1.00 53.92 ? 207 ASP A CG  1 
ATOM   1046 O  OD1 . ASP A 1 151 ? -18.645 54.152 12.363 1.00 56.22 ? 207 ASP A OD1 1 
ATOM   1047 O  OD2 . ASP A 1 151 ? -18.039 52.323 11.336 1.00 54.50 ? 207 ASP A OD2 1 
ATOM   1048 O  OXT . ASP A 1 151 ? -21.900 52.730 9.025  1.00 49.68 ? 207 ASP A OXT 1 
HETATM 1049 O  O   . HOH B 2 .   ? -2.072  32.109 17.096 1.00 25.03 ? 208 HOH A O   1 
HETATM 1050 O  O   . HOH B 2 .   ? -31.270 38.745 19.258 1.00 33.95 ? 209 HOH A O   1 
HETATM 1051 O  O   . HOH B 2 .   ? -19.801 31.060 16.462 1.00 24.70 ? 210 HOH A O   1 
HETATM 1052 O  O   . HOH B 2 .   ? -30.547 34.083 24.689 1.00 45.17 ? 211 HOH A O   1 
HETATM 1053 O  O   . HOH B 2 .   ? -24.189 29.794 17.292 1.00 21.20 ? 212 HOH A O   1 
HETATM 1054 O  O   . HOH B 2 .   ? -15.711 47.101 19.061 1.00 24.35 ? 213 HOH A O   1 
HETATM 1055 O  O   . HOH B 2 .   ? -16.189 45.450 13.158 1.00 35.06 ? 214 HOH A O   1 
HETATM 1056 O  O   . HOH B 2 .   ? -26.782 39.236 24.508 1.00 32.12 ? 215 HOH A O   1 
HETATM 1057 O  O   . HOH B 2 .   ? -5.399  35.400 26.253 1.00 40.39 ? 216 HOH A O   1 
HETATM 1058 O  O   . HOH B 2 .   ? -11.809 36.340 23.618 1.00 40.17 ? 217 HOH A O   1 
HETATM 1059 O  O   . HOH B 2 .   ? -18.997 30.976 13.774 1.00 36.31 ? 218 HOH A O   1 
HETATM 1060 O  O   . HOH B 2 .   ? -11.655 20.445 31.127 1.00 56.42 ? 219 HOH A O   1 
HETATM 1061 O  O   . HOH B 2 .   ? -8.766  21.047 28.657 1.00 51.18 ? 220 HOH A O   1 
HETATM 1062 O  O   . HOH B 2 .   ? -5.272  33.435 24.366 1.00 32.04 ? 221 HOH A O   1 
HETATM 1063 O  O   . HOH B 2 .   ? -21.915 34.124 16.136 1.00 38.06 ? 222 HOH A O   1 
HETATM 1064 O  O   . HOH B 2 .   ? -16.403 15.732 21.978 1.00 41.32 ? 223 HOH A O   1 
HETATM 1065 O  O   . HOH B 2 .   ? -31.471 31.902 23.768 1.00 40.41 ? 224 HOH A O   1 
HETATM 1066 O  O   . HOH B 2 .   ? -9.470  28.206 12.740 1.00 29.41 ? 225 HOH A O   1 
HETATM 1067 O  O   . HOH B 2 .   ? -0.525  30.155 18.620 1.00 42.81 ? 226 HOH A O   1 
HETATM 1068 O  O   . HOH B 2 .   ? -12.953 43.428 7.090  1.00 24.55 ? 227 HOH A O   1 
HETATM 1069 O  O   . HOH B 2 .   ? -22.454 31.494 16.098 1.00 21.40 ? 228 HOH A O   1 
HETATM 1070 O  O   . HOH B 2 .   ? 1.813   31.445 22.823 1.00 38.95 ? 229 HOH A O   1 
HETATM 1071 O  O   . HOH B 2 .   ? -0.540  31.067 20.994 1.00 44.82 ? 230 HOH A O   1 
HETATM 1072 O  O   . HOH B 2 .   ? -12.068 28.443 12.196 1.00 39.45 ? 231 HOH A O   1 
HETATM 1073 O  O   . HOH B 2 .   ? 0.148   46.086 14.083 1.00 43.63 ? 232 HOH A O   1 
HETATM 1074 O  O   . HOH B 2 .   ? 1.779   40.086 19.429 1.00 30.89 ? 233 HOH A O   1 
HETATM 1075 O  O   . HOH B 2 .   ? -29.331 29.964 29.461 1.00 45.35 ? 234 HOH A O   1 
HETATM 1076 O  O   . HOH B 2 .   ? -32.633 30.916 14.109 1.00 26.52 ? 235 HOH A O   1 
HETATM 1077 O  O   . HOH B 2 .   ? 1.676   31.551 27.021 1.00 38.46 ? 236 HOH A O   1 
HETATM 1078 O  O   . HOH B 2 .   ? -19.162 17.875 12.593 1.00 49.27 ? 237 HOH A O   1 
HETATM 1079 O  O   . HOH B 2 .   ? -5.338  28.901 16.985 1.00 43.30 ? 238 HOH A O   1 
HETATM 1080 O  O   . HOH B 2 .   ? -22.204 54.471 7.032  1.00 42.44 ? 239 HOH A O   1 
HETATM 1081 O  O   . HOH B 2 .   ? -15.042 37.620 31.776 1.00 51.09 ? 240 HOH A O   1 
HETATM 1082 O  O   . HOH B 2 .   ? -28.399 31.865 35.080 1.00 51.44 ? 241 HOH A O   1 
HETATM 1083 O  O   . HOH B 2 .   ? -39.320 39.224 21.971 1.00 43.07 ? 242 HOH A O   1 
HETATM 1084 O  O   . HOH B 2 .   ? -30.074 31.164 32.057 1.00 43.02 ? 243 HOH A O   1 
HETATM 1085 O  O   . HOH B 2 .   ? -12.080 49.478 23.358 1.00 41.10 ? 244 HOH A O   1 
HETATM 1086 O  O   . HOH B 2 .   ? -8.466  28.531 29.962 1.00 46.52 ? 245 HOH A O   1 
HETATM 1087 O  O   . HOH B 2 .   ? -1.621  39.740 31.456 1.00 38.37 ? 246 HOH A O   1 
HETATM 1088 O  O   . HOH B 2 .   ? -26.819 37.103 17.389 1.00 37.86 ? 247 HOH A O   1 
HETATM 1089 O  O   . HOH B 2 .   ? -9.169  46.143 23.663 1.00 54.49 ? 248 HOH A O   1 
HETATM 1090 O  O   . HOH B 2 .   ? -3.042  43.013 21.479 1.00 47.41 ? 249 HOH A O   1 
HETATM 1091 O  O   . HOH B 2 .   ? 2.641   29.239 12.325 1.00 43.76 ? 250 HOH A O   1 
HETATM 1092 O  O   . HOH B 2 .   ? -18.350 24.256 31.163 1.00 45.20 ? 251 HOH A O   1 
HETATM 1093 O  O   . HOH B 2 .   ? 1.382   30.524 24.977 1.00 51.26 ? 252 HOH A O   1 
HETATM 1094 O  O   . HOH B 2 .   ? -28.317 20.206 18.465 1.00 42.05 ? 253 HOH A O   1 
HETATM 1095 O  O   . HOH B 2 .   ? -17.706 49.828 10.964 1.00 32.57 ? 254 HOH A O   1 
HETATM 1096 O  O   . HOH B 2 .   ? -7.694  49.409 19.384 1.00 42.13 ? 255 HOH A O   1 
HETATM 1097 O  O   . HOH B 2 .   ? -3.277  40.411 29.592 1.00 36.06 ? 256 HOH A O   1 
HETATM 1098 O  O   . HOH B 2 .   ? -15.704 51.839 22.962 1.00 43.14 ? 257 HOH A O   1 
HETATM 1099 O  O   . HOH B 2 .   ? -29.543 38.693 18.009 1.00 41.05 ? 258 HOH A O   1 
HETATM 1100 O  O   . HOH B 2 .   ? -16.256 18.969 19.941 1.00 41.08 ? 259 HOH A O   1 
HETATM 1101 O  O   . HOH B 2 .   ? -27.973 39.921 14.487 1.00 44.65 ? 260 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   57  57  SER SER A . n 
A 1 2   PRO 2   58  58  PRO PRO A . n 
A 1 3   GLY 3   59  59  GLY GLY A . n 
A 1 4   ILE 4   60  60  ILE ILE A . n 
A 1 5   TRP 5   61  61  TRP TRP A . n 
A 1 6   GLN 6   62  62  GLN GLN A . n 
A 1 7   LEU 7   63  63  LEU LEU A . n 
A 1 8   ASP 8   64  64  ASP ASP A . n 
A 1 9   CAS 9   65  65  CAS CAS A . n 
A 1 10  THR 10  66  66  THR THR A . n 
A 1 11  HIS 11  67  67  HIS HIS A . n 
A 1 12  LEU 12  68  68  LEU LEU A . n 
A 1 13  GLU 13  69  69  GLU GLU A . n 
A 1 14  GLY 14  70  70  GLY GLY A . n 
A 1 15  LYS 15  71  71  LYS LYS A . n 
A 1 16  VAL 16  72  72  VAL VAL A . n 
A 1 17  ILE 17  73  73  ILE ILE A . n 
A 1 18  LEU 18  74  74  LEU LEU A . n 
A 1 19  VAL 19  75  75  VAL VAL A . n 
A 1 20  ALA 20  76  76  ALA ALA A . n 
A 1 21  VAL 21  77  77  VAL VAL A . n 
A 1 22  HIS 22  78  78  HIS HIS A . n 
A 1 23  VAL 23  79  79  VAL VAL A . n 
A 1 24  ALA 24  80  80  ALA ALA A . n 
A 1 25  SER 25  81  81  SER SER A . n 
A 1 26  GLY 26  82  82  GLY GLY A . n 
A 1 27  TYR 27  83  83  TYR TYR A . n 
A 1 28  ILE 28  84  84  ILE ILE A . n 
A 1 29  GLU 29  85  85  GLU GLU A . n 
A 1 30  ALA 30  86  86  ALA ALA A . n 
A 1 31  GLU 31  87  87  GLU GLU A . n 
A 1 32  VAL 32  88  88  VAL VAL A . n 
A 1 33  ILE 33  89  89  ILE ILE A . n 
A 1 34  PRO 34  90  90  PRO PRO A . n 
A 1 35  ALA 35  91  91  ALA ALA A . n 
A 1 36  GLU 36  92  92  GLU GLU A . n 
A 1 37  THR 37  93  93  THR THR A . n 
A 1 38  GLY 38  94  94  GLY GLY A . n 
A 1 39  GLN 39  95  95  GLN GLN A . n 
A 1 40  GLU 40  96  96  GLU GLU A . n 
A 1 41  THR 41  97  97  THR THR A . n 
A 1 42  ALA 42  98  98  ALA ALA A . n 
A 1 43  TYR 43  99  99  TYR TYR A . n 
A 1 44  PHE 44  100 100 PHE PHE A . n 
A 1 45  LEU 45  101 101 LEU LEU A . n 
A 1 46  LEU 46  102 102 LEU LEU A . n 
A 1 47  LYS 47  103 103 LYS LYS A . n 
A 1 48  LEU 48  104 104 LEU LEU A . n 
A 1 49  ALA 49  105 105 ALA ALA A . n 
A 1 50  GLY 50  106 106 GLY GLY A . n 
A 1 51  ARG 51  107 107 ARG ARG A . n 
A 1 52  TRP 52  108 108 TRP TRP A . n 
A 1 53  PRO 53  109 109 PRO PRO A . n 
A 1 54  VAL 54  110 110 VAL VAL A . n 
A 1 55  LYS 55  111 111 LYS LYS A . n 
A 1 56  THR 56  112 112 THR THR A . n 
A 1 57  VAL 57  113 113 VAL VAL A . n 
A 1 58  HIS 58  114 114 HIS HIS A . n 
A 1 59  THR 59  115 115 THR THR A . n 
A 1 60  ASP 60  116 116 ASP ASP A . n 
A 1 61  ASN 61  117 117 ASN ASN A . n 
A 1 62  GLY 62  118 118 GLY GLY A . n 
A 1 63  SER 63  119 119 SER SER A . n 
A 1 64  ASN 64  120 120 ASN ASN A . n 
A 1 65  PHE 65  121 121 PHE PHE A . n 
A 1 66  THR 66  122 122 THR THR A . n 
A 1 67  SER 67  123 123 SER SER A . n 
A 1 68  THR 68  124 124 THR THR A . n 
A 1 69  THR 69  125 125 THR THR A . n 
A 1 70  VAL 70  126 126 VAL VAL A . n 
A 1 71  LYS 71  127 127 LYS LYS A . n 
A 1 72  ALA 72  128 128 ALA ALA A . n 
A 1 73  ALA 73  129 129 ALA ALA A . n 
A 1 74  CAS 74  130 130 CAS CAS A . n 
A 1 75  TRP 75  131 131 TRP TRP A . n 
A 1 76  TRP 76  132 132 TRP TRP A . n 
A 1 77  ALA 77  133 133 ALA ALA A . n 
A 1 78  GLY 78  134 134 GLY GLY A . n 
A 1 79  ILE 79  135 135 ILE ILE A . n 
A 1 80  LYS 80  136 136 LYS LYS A . n 
A 1 81  GLN 81  137 137 GLN GLN A . n 
A 1 82  GLU 82  138 ?   ?   ?   A . n 
A 1 83  PHE 83  139 ?   ?   ?   A . n 
A 1 84  GLY 84  140 ?   ?   ?   A . n 
A 1 85  ILE 85  141 ?   ?   ?   A . n 
A 1 86  PRO 86  142 ?   ?   ?   A . n 
A 1 87  TYR 87  143 ?   ?   ?   A . n 
A 1 88  ASN 88  144 ?   ?   ?   A . n 
A 1 89  PRO 89  145 ?   ?   ?   A . n 
A 1 90  GLN 90  146 ?   ?   ?   A . n 
A 1 91  SER 91  147 ?   ?   ?   A . n 
A 1 92  GLN 92  148 ?   ?   ?   A . n 
A 1 93  GLY 93  149 ?   ?   ?   A . n 
A 1 94  VAL 94  150 ?   ?   ?   A . n 
A 1 95  ILE 95  151 ?   ?   ?   A . n 
A 1 96  GLU 96  152 ?   ?   ?   A . n 
A 1 97  SER 97  153 ?   ?   ?   A . n 
A 1 98  MET 98  154 154 MET MET A . n 
A 1 99  ASN 99  155 155 ASN ASN A . n 
A 1 100 LYS 100 156 156 LYS LYS A . n 
A 1 101 GLU 101 157 157 GLU GLU A . n 
A 1 102 LEU 102 158 158 LEU LEU A . n 
A 1 103 LYS 103 159 159 LYS LYS A . n 
A 1 104 LYS 104 160 160 LYS LYS A . n 
A 1 105 ILE 105 161 161 ILE ILE A . n 
A 1 106 ILE 106 162 162 ILE ILE A . n 
A 1 107 GLY 107 163 163 GLY GLY A . n 
A 1 108 GLN 108 164 164 GLN GLN A . n 
A 1 109 VAL 109 165 165 VAL VAL A . n 
A 1 110 ARG 110 166 166 ARG ARG A . n 
A 1 111 ASP 111 167 167 ASP ASP A . n 
A 1 112 GLN 112 168 168 GLN GLN A . n 
A 1 113 ALA 113 169 169 ALA ALA A . n 
A 1 114 GLU 114 170 170 GLU GLU A . n 
A 1 115 HIS 115 171 171 HIS HIS A . n 
A 1 116 LEU 116 172 172 LEU LEU A . n 
A 1 117 LYS 117 173 173 LYS LYS A . n 
A 1 118 THR 118 174 174 THR THR A . n 
A 1 119 ALA 119 175 175 ALA ALA A . n 
A 1 120 VAL 120 176 176 VAL VAL A . n 
A 1 121 GLN 121 177 177 GLN GLN A . n 
A 1 122 MET 122 178 178 MET MET A . n 
A 1 123 ALA 123 179 179 ALA ALA A . n 
A 1 124 VAL 124 180 180 VAL VAL A . n 
A 1 125 PHE 125 181 181 PHE PHE A . n 
A 1 126 ILE 126 182 182 ILE ILE A . n 
A 1 127 HIS 127 183 183 HIS HIS A . n 
A 1 128 ASN 128 184 184 ASN ASN A . n 
A 1 129 HIS 129 185 185 HIS HIS A . n 
A 1 130 LYS 130 186 186 LYS LYS A . n 
A 1 131 ARG 131 187 187 ARG ARG A . n 
A 1 132 LYS 132 188 188 LYS LYS A . n 
A 1 133 GLY 133 189 189 GLY GLY A . n 
A 1 134 GLY 134 190 190 GLY GLY A . n 
A 1 135 ILE 135 191 191 ILE ILE A . n 
A 1 136 GLY 136 192 192 GLY GLY A . n 
A 1 137 GLY 137 193 193 GLY GLY A . n 
A 1 138 TYR 138 194 194 TYR TYR A . n 
A 1 139 SER 139 195 195 SER SER A . n 
A 1 140 ALA 140 196 196 ALA ALA A . n 
A 1 141 GLY 141 197 197 GLY GLY A . n 
A 1 142 GLU 142 198 198 GLU GLU A . n 
A 1 143 ARG 143 199 199 ARG ARG A . n 
A 1 144 ILE 144 200 200 ILE ILE A . n 
A 1 145 VAL 145 201 201 VAL VAL A . n 
A 1 146 ASP 146 202 202 ASP ASP A . n 
A 1 147 ILE 147 203 203 ILE ILE A . n 
A 1 148 ILE 148 204 204 ILE ILE A . n 
A 1 149 ALA 149 205 205 ALA ALA A . n 
A 1 150 THR 150 206 206 THR THR A . n 
A 1 151 ASP 151 207 207 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  208 2  HOH HOH A . 
B 2 HOH 2  209 3  HOH HOH A . 
B 2 HOH 3  210 4  HOH HOH A . 
B 2 HOH 4  211 5  HOH HOH A . 
B 2 HOH 5  212 6  HOH HOH A . 
B 2 HOH 6  213 8  HOH HOH A . 
B 2 HOH 7  214 9  HOH HOH A . 
B 2 HOH 8  215 10 HOH HOH A . 
B 2 HOH 9  216 11 HOH HOH A . 
B 2 HOH 10 217 12 HOH HOH A . 
B 2 HOH 11 218 13 HOH HOH A . 
B 2 HOH 12 219 16 HOH HOH A . 
B 2 HOH 13 220 17 HOH HOH A . 
B 2 HOH 14 221 18 HOH HOH A . 
B 2 HOH 15 222 19 HOH HOH A . 
B 2 HOH 16 223 20 HOH HOH A . 
B 2 HOH 17 224 23 HOH HOH A . 
B 2 HOH 18 225 24 HOH HOH A . 
B 2 HOH 19 226 26 HOH HOH A . 
B 2 HOH 20 227 29 HOH HOH A . 
B 2 HOH 21 228 31 HOH HOH A . 
B 2 HOH 22 229 32 HOH HOH A . 
B 2 HOH 23 230 33 HOH HOH A . 
B 2 HOH 24 231 34 HOH HOH A . 
B 2 HOH 25 232 35 HOH HOH A . 
B 2 HOH 26 233 36 HOH HOH A . 
B 2 HOH 27 234 37 HOH HOH A . 
B 2 HOH 28 235 38 HOH HOH A . 
B 2 HOH 29 236 39 HOH HOH A . 
B 2 HOH 30 237 40 HOH HOH A . 
B 2 HOH 31 238 41 HOH HOH A . 
B 2 HOH 32 239 42 HOH HOH A . 
B 2 HOH 33 240 43 HOH HOH A . 
B 2 HOH 34 241 44 HOH HOH A . 
B 2 HOH 35 242 45 HOH HOH A . 
B 2 HOH 36 243 46 HOH HOH A . 
B 2 HOH 37 244 47 HOH HOH A . 
B 2 HOH 38 245 48 HOH HOH A . 
B 2 HOH 39 246 49 HOH HOH A . 
B 2 HOH 40 247 50 HOH HOH A . 
B 2 HOH 41 248 51 HOH HOH A . 
B 2 HOH 42 249 52 HOH HOH A . 
B 2 HOH 43 250 53 HOH HOH A . 
B 2 HOH 44 251 54 HOH HOH A . 
B 2 HOH 45 252 55 HOH HOH A . 
B 2 HOH 46 253 56 HOH HOH A . 
B 2 HOH 47 254 57 HOH HOH A . 
B 2 HOH 48 255 58 HOH HOH A . 
B 2 HOH 49 256 59 HOH HOH A . 
B 2 HOH 50 257 60 HOH HOH A . 
B 2 HOH 51 258 61 HOH HOH A . 
B 2 HOH 52 259 62 HOH HOH A . 
B 2 HOH 53 260 63 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CAS 9  A CAS 65  ? CYS 'S-(DIMETHYLARSENIC)CYSTEINE' 
2 A CAS 74 A CAS 130 ? CYS 'S-(DIMETHYLARSENIC)CYSTEINE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2500  ? 
1 MORE         -17   ? 
1 'SSA (A^2)'  12980 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 6_555 -x,-x+y,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 
0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 21.9333333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-10-14 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2           
2 4 'Structure model' pdbx_database_status 
3 4 'Structure model' struct_conn          
4 4 'Structure model' struct_ref_seq_dif   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                
2  4 'Structure model' '_database_2.pdbx_database_accession' 
3  4 'Structure model' '_pdbx_database_status.process_site'  
4  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
6  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
7  4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
8  4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
9  4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
15 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' 3.851 ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
X-PLOR    phasing          3.851 ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    209 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    258 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LYS 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     188 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -57.97 
_pdbx_validate_torsion.psi             -9.27 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A LYS 71  ? CG  ? A LYS 15  CG  
2  1 Y 0 A LYS 71  ? CD  ? A LYS 15  CD  
3  1 Y 0 A LYS 71  ? CE  ? A LYS 15  CE  
4  1 Y 0 A LYS 71  ? NZ  ? A LYS 15  NZ  
5  1 Y 0 A GLN 95  ? CG  ? A GLN 39  CG  
6  1 Y 0 A GLN 95  ? CD  ? A GLN 39  CD  
7  1 Y 0 A GLN 95  ? OE1 ? A GLN 39  OE1 
8  1 Y 0 A GLN 95  ? NE2 ? A GLN 39  NE2 
9  1 Y 0 A LYS 111 ? CD  ? A LYS 55  CD  
10 1 Y 0 A LYS 111 ? CE  ? A LYS 55  CE  
11 1 Y 0 A LYS 111 ? NZ  ? A LYS 55  NZ  
12 1 Y 0 A ASN 155 ? CG  ? A ASN 99  CG  
13 1 Y 0 A ASN 155 ? OD1 ? A ASN 99  OD1 
14 1 Y 0 A ASN 155 ? ND2 ? A ASN 99  ND2 
15 1 Y 0 A LYS 156 ? CG  ? A LYS 100 CG  
16 1 Y 0 A LYS 156 ? CD  ? A LYS 100 CD  
17 1 Y 0 A LYS 156 ? CE  ? A LYS 100 CE  
18 1 Y 0 A LYS 156 ? NZ  ? A LYS 100 NZ  
19 1 Y 0 A GLU 170 ? CB  ? A GLU 114 CB  
20 1 Y 0 A GLU 170 ? CG  ? A GLU 114 CG  
21 1 Y 0 A GLU 170 ? CD  ? A GLU 114 CD  
22 1 Y 0 A GLU 170 ? OE1 ? A GLU 114 OE1 
23 1 Y 0 A GLU 170 ? OE2 ? A GLU 114 OE2 
24 1 Y 0 A LYS 186 ? CD  ? A LYS 130 CD  
25 1 Y 0 A LYS 186 ? CE  ? A LYS 130 CE  
26 1 Y 0 A LYS 186 ? NZ  ? A LYS 130 NZ  
27 1 Y 0 A ARG 187 ? CG  ? A ARG 131 CG  
28 1 Y 0 A ARG 187 ? CD  ? A ARG 131 CD  
29 1 Y 0 A ARG 187 ? NE  ? A ARG 131 NE  
30 1 Y 0 A ARG 187 ? CZ  ? A ARG 131 CZ  
31 1 Y 0 A ARG 187 ? NH1 ? A ARG 131 NH1 
32 1 Y 0 A ARG 187 ? NH2 ? A ARG 131 NH2 
33 1 Y 0 A LYS 188 ? CD  ? A LYS 132 CD  
34 1 Y 0 A LYS 188 ? CE  ? A LYS 132 CE  
35 1 Y 0 A LYS 188 ? NZ  ? A LYS 132 NZ  
36 1 Y 0 A TYR 194 ? CG  ? A TYR 138 CG  
37 1 Y 0 A TYR 194 ? CD1 ? A TYR 138 CD1 
38 1 Y 0 A TYR 194 ? CD2 ? A TYR 138 CD2 
39 1 Y 0 A TYR 194 ? CE1 ? A TYR 138 CE1 
40 1 Y 0 A TYR 194 ? CE2 ? A TYR 138 CE2 
41 1 Y 0 A TYR 194 ? CZ  ? A TYR 138 CZ  
42 1 Y 0 A TYR 194 ? OH  ? A TYR 138 OH  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 138 ? A GLU 82  
2  1 Y 1 A PHE 139 ? A PHE 83  
3  1 Y 1 A GLY 140 ? A GLY 84  
4  1 Y 1 A ILE 141 ? A ILE 85  
5  1 Y 1 A PRO 142 ? A PRO 86  
6  1 Y 1 A TYR 143 ? A TYR 87  
7  1 Y 1 A ASN 144 ? A ASN 88  
8  1 Y 1 A PRO 145 ? A PRO 89  
9  1 Y 1 A GLN 146 ? A GLN 90  
10 1 Y 1 A SER 147 ? A SER 91  
11 1 Y 1 A GLN 148 ? A GLN 92  
12 1 Y 1 A GLY 149 ? A GLY 93  
13 1 Y 1 A VAL 150 ? A VAL 94  
14 1 Y 1 A ILE 151 ? A ILE 95  
15 1 Y 1 A GLU 152 ? A GLU 96  
16 1 Y 1 A SER 153 ? A SER 97  
17 1 Y 0 A GLY 189 ? A GLY 133 
18 1 Y 0 A GLY 190 ? A GLY 134 
19 1 Y 0 A ILE 191 ? A ILE 135 
20 1 Y 0 A GLY 192 ? A GLY 136 
21 1 Y 0 A GLY 193 ? A GLY 137 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#