data_1BK6
# 
_entry.id   1BK6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BK6         
WWPDB D_1000171851 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BK6 
_pdbx_database_status.recvd_initial_deposition_date   1998-07-14 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Conti, E.'    1 
'Uy, M.'       2 
'Leighton, L.' 3 
'Blobel, G.'   4 
'Kuriyan, J.'  5 
# 
_citation.id                        primary 
_citation.title                     
'Crystallographic analysis of the recognition of a nuclear localization signal by the nuclear import factor karyopherin alpha.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            94 
_citation.page_first                193 
_citation.page_last                 204 
_citation.year                      1998 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9695948 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(00)81419-1' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Conti, E.'    1 
primary 'Uy, M.'       2 
primary 'Leighton, L.' 3 
primary 'Blobel, G.'   4 
primary 'Kuriyan, J.'  5 
# 
_cell.entry_id           1BK6 
_cell.length_a           161.120 
_cell.length_b           75.750 
_cell.length_c           84.460 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BK6 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'KARYOPHERIN ALPHA' 46718.426 2  ? ? 'ARMADILLO DOMAIN'                  ? 
2 polymer man 'LARGE T ANTIGEN'   791.059   2  ? ? 'NLS (NUCLEAR LOCALIZATION SIGNAL)' 
'NLS PEPTIDE AT THE LARGER (FUNCTIONAL) BINDING SITE' 
3 polymer man 'LARGE T ANTIGEN'   489.608   2  ? ? 'NLS (NUCLEAR LOCALIZATION SIGNAL)' 'NLS PEPTIDE AT THE SMALLER BINDING SITE' 
4 water   nat water               18.015    12 ? ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IMPORTIN ALPHA, SRP1P' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;LPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKV
VVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKP
QPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVT
GNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAIS
NASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENIIKMGEADKEARGLNINENADFIEKAGGMEKIFN
CQQNENDKIYEKAYKIIETYFG
;
;LPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKV
VVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKP
QPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVT
GNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAIS
NASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENIIKMGEADKEARGLNINENADFIEKAGGMEKIFN
CQQNENDKIYEKAYKIIETYFG
;
A,B ? 
2 'polypeptide(L)' no no KKKRKV KKKRKV C,E ? 
3 'polypeptide(L)' no no AKKAA AKKAA D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LEU n 
1 2   PRO n 
1 3   GLN n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   GLN n 
1 8   LEU n 
1 9   ASN n 
1 10  SER n 
1 11  ASP n 
1 12  ASP n 
1 13  MET n 
1 14  GLN n 
1 15  GLU n 
1 16  GLN n 
1 17  LEU n 
1 18  SER n 
1 19  ALA n 
1 20  THR n 
1 21  VAL n 
1 22  LYS n 
1 23  PHE n 
1 24  ARG n 
1 25  GLN n 
1 26  ILE n 
1 27  LEU n 
1 28  SER n 
1 29  ARG n 
1 30  GLU n 
1 31  HIS n 
1 32  ARG n 
1 33  PRO n 
1 34  PRO n 
1 35  ILE n 
1 36  ASP n 
1 37  VAL n 
1 38  VAL n 
1 39  ILE n 
1 40  GLN n 
1 41  ALA n 
1 42  GLY n 
1 43  VAL n 
1 44  VAL n 
1 45  PRO n 
1 46  ARG n 
1 47  LEU n 
1 48  VAL n 
1 49  GLU n 
1 50  PHE n 
1 51  MET n 
1 52  ARG n 
1 53  GLU n 
1 54  ASN n 
1 55  GLN n 
1 56  PRO n 
1 57  GLU n 
1 58  MET n 
1 59  LEU n 
1 60  GLN n 
1 61  LEU n 
1 62  GLU n 
1 63  ALA n 
1 64  ALA n 
1 65  TRP n 
1 66  ALA n 
1 67  LEU n 
1 68  THR n 
1 69  ASN n 
1 70  ILE n 
1 71  ALA n 
1 72  SER n 
1 73  GLY n 
1 74  THR n 
1 75  SER n 
1 76  ALA n 
1 77  GLN n 
1 78  THR n 
1 79  LYS n 
1 80  VAL n 
1 81  VAL n 
1 82  VAL n 
1 83  ASP n 
1 84  ALA n 
1 85  ASP n 
1 86  ALA n 
1 87  VAL n 
1 88  PRO n 
1 89  LEU n 
1 90  PHE n 
1 91  ILE n 
1 92  GLN n 
1 93  LEU n 
1 94  LEU n 
1 95  TYR n 
1 96  THR n 
1 97  GLY n 
1 98  SER n 
1 99  VAL n 
1 100 GLU n 
1 101 VAL n 
1 102 LYS n 
1 103 GLU n 
1 104 GLN n 
1 105 ALA n 
1 106 ILE n 
1 107 TRP n 
1 108 ALA n 
1 109 LEU n 
1 110 GLY n 
1 111 ASN n 
1 112 VAL n 
1 113 ALA n 
1 114 GLY n 
1 115 ASP n 
1 116 SER n 
1 117 THR n 
1 118 ASP n 
1 119 TYR n 
1 120 ARG n 
1 121 ASP n 
1 122 TYR n 
1 123 VAL n 
1 124 LEU n 
1 125 GLN n 
1 126 CYS n 
1 127 ASN n 
1 128 ALA n 
1 129 MET n 
1 130 GLU n 
1 131 PRO n 
1 132 ILE n 
1 133 LEU n 
1 134 GLY n 
1 135 LEU n 
1 136 PHE n 
1 137 ASN n 
1 138 SER n 
1 139 ASN n 
1 140 LYS n 
1 141 PRO n 
1 142 SER n 
1 143 LEU n 
1 144 ILE n 
1 145 ARG n 
1 146 THR n 
1 147 ALA n 
1 148 THR n 
1 149 TRP n 
1 150 THR n 
1 151 LEU n 
1 152 SER n 
1 153 ASN n 
1 154 LEU n 
1 155 CYS n 
1 156 ARG n 
1 157 GLY n 
1 158 LYS n 
1 159 LYS n 
1 160 PRO n 
1 161 GLN n 
1 162 PRO n 
1 163 ASP n 
1 164 TRP n 
1 165 SER n 
1 166 VAL n 
1 167 VAL n 
1 168 SER n 
1 169 GLN n 
1 170 ALA n 
1 171 LEU n 
1 172 PRO n 
1 173 THR n 
1 174 LEU n 
1 175 ALA n 
1 176 LYS n 
1 177 LEU n 
1 178 ILE n 
1 179 TYR n 
1 180 SER n 
1 181 MET n 
1 182 ASP n 
1 183 THR n 
1 184 GLU n 
1 185 THR n 
1 186 LEU n 
1 187 VAL n 
1 188 ASP n 
1 189 ALA n 
1 190 CYS n 
1 191 TRP n 
1 192 ALA n 
1 193 ILE n 
1 194 SER n 
1 195 TYR n 
1 196 LEU n 
1 197 SER n 
1 198 ASP n 
1 199 GLY n 
1 200 PRO n 
1 201 GLN n 
1 202 GLU n 
1 203 ALA n 
1 204 ILE n 
1 205 GLN n 
1 206 ALA n 
1 207 VAL n 
1 208 ILE n 
1 209 ASP n 
1 210 VAL n 
1 211 ARG n 
1 212 ILE n 
1 213 PRO n 
1 214 LYS n 
1 215 ARG n 
1 216 LEU n 
1 217 VAL n 
1 218 GLU n 
1 219 LEU n 
1 220 LEU n 
1 221 SER n 
1 222 HIS n 
1 223 GLU n 
1 224 SER n 
1 225 THR n 
1 226 LEU n 
1 227 VAL n 
1 228 GLN n 
1 229 THR n 
1 230 PRO n 
1 231 ALA n 
1 232 LEU n 
1 233 ARG n 
1 234 ALA n 
1 235 VAL n 
1 236 GLY n 
1 237 ASN n 
1 238 ILE n 
1 239 VAL n 
1 240 THR n 
1 241 GLY n 
1 242 ASN n 
1 243 ASP n 
1 244 LEU n 
1 245 GLN n 
1 246 THR n 
1 247 GLN n 
1 248 VAL n 
1 249 VAL n 
1 250 ILE n 
1 251 ASN n 
1 252 ALA n 
1 253 GLY n 
1 254 VAL n 
1 255 LEU n 
1 256 PRO n 
1 257 ALA n 
1 258 LEU n 
1 259 ARG n 
1 260 LEU n 
1 261 LEU n 
1 262 LEU n 
1 263 SER n 
1 264 SER n 
1 265 PRO n 
1 266 LYS n 
1 267 GLU n 
1 268 ASN n 
1 269 ILE n 
1 270 LYS n 
1 271 LYS n 
1 272 GLU n 
1 273 ALA n 
1 274 CYS n 
1 275 TRP n 
1 276 THR n 
1 277 ILE n 
1 278 SER n 
1 279 ASN n 
1 280 ILE n 
1 281 THR n 
1 282 ALA n 
1 283 GLY n 
1 284 ASN n 
1 285 THR n 
1 286 GLU n 
1 287 GLN n 
1 288 ILE n 
1 289 GLN n 
1 290 ALA n 
1 291 VAL n 
1 292 ILE n 
1 293 ASP n 
1 294 ALA n 
1 295 ASN n 
1 296 LEU n 
1 297 ILE n 
1 298 PRO n 
1 299 PRO n 
1 300 LEU n 
1 301 VAL n 
1 302 LYS n 
1 303 LEU n 
1 304 LEU n 
1 305 GLU n 
1 306 VAL n 
1 307 ALA n 
1 308 GLU n 
1 309 TYR n 
1 310 LYS n 
1 311 THR n 
1 312 LYS n 
1 313 LYS n 
1 314 GLU n 
1 315 ALA n 
1 316 CYS n 
1 317 TRP n 
1 318 ALA n 
1 319 ILE n 
1 320 SER n 
1 321 ASN n 
1 322 ALA n 
1 323 SER n 
1 324 SER n 
1 325 GLY n 
1 326 GLY n 
1 327 LEU n 
1 328 GLN n 
1 329 ARG n 
1 330 PRO n 
1 331 ASP n 
1 332 ILE n 
1 333 ILE n 
1 334 ARG n 
1 335 TYR n 
1 336 LEU n 
1 337 VAL n 
1 338 SER n 
1 339 GLN n 
1 340 GLY n 
1 341 CYS n 
1 342 ILE n 
1 343 LYS n 
1 344 PRO n 
1 345 LEU n 
1 346 CYS n 
1 347 ASP n 
1 348 LEU n 
1 349 LEU n 
1 350 GLU n 
1 351 ILE n 
1 352 ALA n 
1 353 ASP n 
1 354 ASN n 
1 355 ARG n 
1 356 ILE n 
1 357 ILE n 
1 358 GLU n 
1 359 VAL n 
1 360 THR n 
1 361 LEU n 
1 362 ASP n 
1 363 ALA n 
1 364 LEU n 
1 365 GLU n 
1 366 ASN n 
1 367 ILE n 
1 368 ILE n 
1 369 LYS n 
1 370 MET n 
1 371 GLY n 
1 372 GLU n 
1 373 ALA n 
1 374 ASP n 
1 375 LYS n 
1 376 GLU n 
1 377 ALA n 
1 378 ARG n 
1 379 GLY n 
1 380 LEU n 
1 381 ASN n 
1 382 ILE n 
1 383 ASN n 
1 384 GLU n 
1 385 ASN n 
1 386 ALA n 
1 387 ASP n 
1 388 PHE n 
1 389 ILE n 
1 390 GLU n 
1 391 LYS n 
1 392 ALA n 
1 393 GLY n 
1 394 GLY n 
1 395 MET n 
1 396 GLU n 
1 397 LYS n 
1 398 ILE n 
1 399 PHE n 
1 400 ASN n 
1 401 CYS n 
1 402 GLN n 
1 403 GLN n 
1 404 ASN n 
1 405 GLU n 
1 406 ASN n 
1 407 ASP n 
1 408 LYS n 
1 409 ILE n 
1 410 TYR n 
1 411 GLU n 
1 412 LYS n 
1 413 ALA n 
1 414 TYR n 
1 415 LYS n 
1 416 ILE n 
1 417 ILE n 
1 418 GLU n 
1 419 THR n 
1 420 TYR n 
1 421 PHE n 
1 422 GLY n 
2 1   LYS n 
2 2   LYS n 
2 3   LYS n 
2 4   ARG n 
2 5   LYS n 
2 6   VAL n 
3 1   ALA n 
3 2   LYS n 
3 3   LYS n 
3 4   ALA n 
3 5   ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 SRP1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    W303 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            BL21 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    CYTOPLASMIC/NUCLEAR 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PPROEX-HTB 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP IMA1_YEAST 1 Q02821 1 
;MDNGTDSSTSKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDESSVSADQQ
FYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIAS
GTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLS
NLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPAL
RAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTK
KEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKA
GGMEKIFNCQQNENDKIYEKAYKIIETYFGEEEDAVDETMAPQNAGNTFGFGSNVNQQFNFN
;
? 
2 PDB 1BK6       2 1BK6   ? ? ? 
3 PDB 1BK6       3 1BK6   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BK6 A 1 ? 422 ? Q02821 89  ? 510 ? 89  510 
2 1 1BK6 B 1 ? 422 ? Q02821 89  ? 510 ? 89  510 
3 2 1BK6 C 1 ? 6   ? 1BK6   127 ? 132 ? 127 132 
4 3 1BK6 D 1 ? 5   ? 1BK6   127 ? 131 ? 127 131 
5 2 1BK6 E 1 ? 6   ? 1BK6   127 ? 132 ? 127 132 
6 3 1BK6 F 1 ? 5   ? 1BK6   127 ? 131 ? 127 131 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1BK6 ILE A 368 ? UNP Q02821 LEU 456 CONFLICT 456 1 
2 1BK6 ILE B 368 ? UNP Q02821 LEU 456 CONFLICT 456 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1BK6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   BRANDEIS 
_diffrn_detector.pdbx_collection_date   1997-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             0.9 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BK6 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.1 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   22717 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         86.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0640000 
_reflns.pdbx_netI_over_sigmaI        17.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.5 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.9 
_reflns_shell.percent_possible_all   82.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.1880000 
_reflns_shell.meanI_over_sigI_obs    9.9 
_reflns_shell.pdbx_redundancy        2.4 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1BK6 
_refine.ls_number_reflns_obs                     22717 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.1 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    86.8 
_refine.ls_R_factor_obs                          0.2560000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2560000 
_refine.ls_R_factor_R_free                       0.3070000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.5 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            15.043 
_refine.aniso_B[2][2]                            -19.147 
_refine.aniso_B[3][3]                            4.105 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'UNLIGANDED KARYOPHERIN ALPHA' 
_refine.pdbx_method_to_determine_struct          'DIFFERENCE FOURIER' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6488 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             12 
_refine_hist.number_atoms_total               6500 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        29.1 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.45  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      16.87 ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.737 ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   18 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.85 
_refine_ls_shell.number_reflns_R_work             1072 
_refine_ls_shell.R_factor_R_work                  0.2960000 
_refine_ls_shell.percent_reflns_obs               82.2 
_refine_ls_shell.R_factor_R_free                  0.3530000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            3.5 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 
2 ?            ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1BK6 
_struct.title                     'KARYOPHERIN ALPHA (YEAST) + SV40 T ANTIGEN NLS' 
_struct.pdbx_descriptor           'KARYOPHERIN ALPHA, LARGE T ANTIGEN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BK6 
_struct_keywords.pdbx_keywords   'COMPLEX (PROTEIN TRANSPORT/PEPTIDE)' 
_struct_keywords.text            
;PROTEIN TRANSPORT, NLS NUCLEAR IMPORT, ARMADILLO REPEAT CONTAINING PROTEIN, COMPLEX (PROTEIN TRANSPORT-PEPTIDE), COMPLEX (PROTEIN TRANSPORT-PEPTIDE) complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 2   ? ASN A 9   ? PRO A 90  ASN A 97  1 ? 8  
HELX_P HELX_P2  2  MET A 13  ? LEU A 27  ? MET A 101 LEU A 115 1 ? 15 
HELX_P HELX_P3  3  ILE A 35  ? GLN A 40  ? ILE A 123 GLN A 128 1 ? 6  
HELX_P HELX_P4  4  VAL A 44  ? MET A 51  ? VAL A 132 MET A 139 1 ? 8  
HELX_P HELX_P5  5  GLU A 57  ? SER A 72  ? GLU A 145 SER A 160 1 ? 16 
HELX_P HELX_P6  6  SER A 75  ? VAL A 82  ? SER A 163 VAL A 170 1 ? 8  
HELX_P HELX_P7  7  ALA A 86  ? THR A 96  ? ALA A 174 THR A 184 1 ? 11 
HELX_P HELX_P8  8  VAL A 99  ? ASP A 115 ? VAL A 187 ASP A 203 1 ? 17 
HELX_P HELX_P9  9  THR A 117 ? CYS A 126 ? THR A 205 CYS A 214 1 ? 10 
HELX_P HELX_P10 10 ALA A 128 ? ASN A 137 ? ALA A 216 ASN A 225 1 ? 10 
HELX_P HELX_P11 11 PRO A 141 ? CYS A 155 ? PRO A 229 CYS A 243 1 ? 15 
HELX_P HELX_P12 12 TRP A 164 ? TYR A 179 ? TRP A 252 TYR A 267 1 ? 16 
HELX_P HELX_P13 13 THR A 183 ? SER A 197 ? THR A 271 SER A 285 1 ? 15 
HELX_P HELX_P14 14 GLN A 201 ? ASP A 209 ? GLN A 289 ASP A 297 1 ? 9  
HELX_P HELX_P15 15 PRO A 213 ? SER A 221 ? PRO A 301 SER A 309 1 ? 9  
HELX_P HELX_P16 16 THR A 225 ? THR A 240 ? THR A 313 THR A 328 1 ? 16 
HELX_P HELX_P17 17 ASP A 243 ? ASN A 251 ? ASP A 331 ASN A 339 1 ? 9  
HELX_P HELX_P18 18 VAL A 254 ? SER A 263 ? VAL A 342 SER A 351 1 ? 10 
HELX_P HELX_P19 19 GLU A 267 ? ILE A 280 ? GLU A 355 ILE A 368 1 ? 14 
HELX_P HELX_P20 20 THR A 285 ? ALA A 294 ? THR A 373 ALA A 382 1 ? 10 
HELX_P HELX_P21 21 ILE A 297 ? VAL A 306 ? ILE A 385 VAL A 394 1 ? 10 
HELX_P HELX_P22 22 TYR A 309 ? GLY A 326 ? TYR A 397 GLY A 414 1 ? 18 
HELX_P HELX_P23 23 PRO A 330 ? SER A 338 ? PRO A 418 SER A 426 1 ? 9  
HELX_P HELX_P24 24 CYS A 341 ? GLU A 350 ? CYS A 429 GLU A 438 1 ? 10 
HELX_P HELX_P25 25 ASN A 354 ? ALA A 377 ? ASN A 442 ALA A 465 1 ? 24 
HELX_P HELX_P26 26 GLU A 384 ? LYS A 391 ? GLU A 472 LYS A 479 1 ? 8  
HELX_P HELX_P27 27 GLY A 394 ? GLN A 403 ? GLY A 482 GLN A 491 1 ? 10 
HELX_P HELX_P28 28 ASP A 407 ? TYR A 420 ? ASP A 495 TYR A 508 1 ? 14 
HELX_P HELX_P29 29 PRO D 2   ? ASN D 9   ? PRO B 90  ASN B 97  1 ? 8  
HELX_P HELX_P30 30 MET D 13  ? LEU D 27  ? MET B 101 LEU B 115 1 ? 15 
HELX_P HELX_P31 31 ILE D 35  ? GLN D 40  ? ILE B 123 GLN B 128 1 ? 6  
HELX_P HELX_P32 32 VAL D 44  ? MET D 51  ? VAL B 132 MET B 139 1 ? 8  
HELX_P HELX_P33 33 GLU D 57  ? SER D 72  ? GLU B 145 SER B 160 1 ? 16 
HELX_P HELX_P34 34 SER D 75  ? ASP D 83  ? SER B 163 ASP B 171 1 ? 9  
HELX_P HELX_P35 35 ALA D 86  ? THR D 96  ? ALA B 174 THR B 184 1 ? 11 
HELX_P HELX_P36 36 VAL D 99  ? ASP D 115 ? VAL B 187 ASP B 203 1 ? 17 
HELX_P HELX_P37 37 THR D 117 ? CYS D 126 ? THR B 205 CYS B 214 1 ? 10 
HELX_P HELX_P38 38 ALA D 128 ? ASN D 137 ? ALA B 216 ASN B 225 1 ? 10 
HELX_P HELX_P39 39 PRO D 141 ? CYS D 155 ? PRO B 229 CYS B 243 1 ? 15 
HELX_P HELX_P40 40 TRP D 164 ? TYR D 179 ? TRP B 252 TYR B 267 1 ? 16 
HELX_P HELX_P41 41 THR D 183 ? SER D 197 ? THR B 271 SER B 285 1 ? 15 
HELX_P HELX_P42 42 GLN D 201 ? ASP D 209 ? GLN B 289 ASP B 297 1 ? 9  
HELX_P HELX_P43 43 PRO D 213 ? SER D 221 ? PRO B 301 SER B 309 1 ? 9  
HELX_P HELX_P44 44 THR D 225 ? THR D 240 ? THR B 313 THR B 328 1 ? 16 
HELX_P HELX_P45 45 ASP D 243 ? ASN D 251 ? ASP B 331 ASN B 339 1 ? 9  
HELX_P HELX_P46 46 VAL D 254 ? SER D 263 ? VAL B 342 SER B 351 1 ? 10 
HELX_P HELX_P47 47 GLU D 267 ? ILE D 280 ? GLU B 355 ILE B 368 1 ? 14 
HELX_P HELX_P48 48 THR D 285 ? ASP D 293 ? THR B 373 ASP B 381 1 ? 9  
HELX_P HELX_P49 49 ILE D 297 ? VAL D 306 ? ILE B 385 VAL B 394 1 ? 10 
HELX_P HELX_P50 50 TYR D 309 ? GLY D 326 ? TYR B 397 GLY B 414 1 ? 18 
HELX_P HELX_P51 51 PRO D 330 ? SER D 338 ? PRO B 418 SER B 426 1 ? 9  
HELX_P HELX_P52 52 CYS D 341 ? GLU D 350 ? CYS B 429 GLU B 438 1 ? 10 
HELX_P HELX_P53 53 ASN D 354 ? ALA D 377 ? ASN B 442 ALA B 465 1 ? 24 
HELX_P HELX_P54 54 GLU D 384 ? LYS D 391 ? GLU B 472 LYS B 479 1 ? 8  
HELX_P HELX_P55 55 GLY D 394 ? GLN D 403 ? GLY B 482 GLN B 491 1 ? 10 
HELX_P HELX_P56 56 ASP D 407 ? TYR D 420 ? ASP B 495 TYR B 508 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1BK6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BK6 
_atom_sites.fract_transf_matrix[1][1]   0.006207 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013201 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011840 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 1   ? 101.750 38.353 100.771 1.00 73.11 ? 89  LEU A N   1 
ATOM   2    C CA  . LEU A 1 1   ? 101.870 38.744 102.168 1.00 73.12 ? 89  LEU A CA  1 
ATOM   3    C C   . LEU A 1 1   ? 102.132 40.248 102.277 1.00 73.16 ? 89  LEU A C   1 
ATOM   4    O O   . LEU A 1 1   ? 102.812 40.838 101.436 1.00 73.58 ? 89  LEU A O   1 
ATOM   5    C CB  . LEU A 1 1   ? 103.009 37.963 102.840 1.00 72.65 ? 89  LEU A CB  1 
ATOM   6    N N   . PRO A 1 2   ? 101.558 40.896 103.299 1.00 72.85 ? 90  PRO A N   1 
ATOM   7    C CA  . PRO A 1 2   ? 101.745 42.335 103.509 1.00 72.05 ? 90  PRO A CA  1 
ATOM   8    C C   . PRO A 1 2   ? 103.202 42.631 103.867 1.00 71.01 ? 90  PRO A C   1 
ATOM   9    O O   . PRO A 1 2   ? 103.743 43.670 103.504 1.00 71.10 ? 90  PRO A O   1 
ATOM   10   C CB  . PRO A 1 2   ? 100.792 42.631 104.672 1.00 72.45 ? 90  PRO A CB  1 
ATOM   11   C CG  . PRO A 1 2   ? 99.728  41.529 104.524 1.00 72.83 ? 90  PRO A CG  1 
ATOM   12   C CD  . PRO A 1 2   ? 100.649 40.354 104.322 1.00 72.89 ? 90  PRO A CD  1 
ATOM   13   N N   . GLN A 1 3   ? 103.828 41.700 104.582 1.00 70.05 ? 91  GLN A N   1 
ATOM   14   C CA  . GLN A 1 3   ? 105.220 41.840 104.998 1.00 68.92 ? 91  GLN A CA  1 
ATOM   15   C C   . GLN A 1 3   ? 106.099 42.170 103.797 1.00 68.22 ? 91  GLN A C   1 
ATOM   16   O O   . GLN A 1 3   ? 107.006 42.995 103.887 1.00 67.79 ? 91  GLN A O   1 
ATOM   17   C CB  . GLN A 1 3   ? 105.704 40.540 105.653 1.00 68.91 ? 91  GLN A CB  1 
ATOM   18   N N   . MET A 1 4   ? 105.817 41.513 102.674 1.00 67.65 ? 92  MET A N   1 
ATOM   19   C CA  . MET A 1 4   ? 106.560 41.713 101.435 1.00 66.55 ? 92  MET A CA  1 
ATOM   20   C C   . MET A 1 4   ? 106.488 43.157 100.974 1.00 66.41 ? 92  MET A C   1 
ATOM   21   O O   . MET A 1 4   ? 107.500 43.765 100.621 1.00 66.33 ? 92  MET A O   1 
ATOM   22   C CB  . MET A 1 4   ? 105.999 40.825 100.328 1.00 65.51 ? 92  MET A CB  1 
ATOM   23   C CG  . MET A 1 4   ? 106.204 39.342 100.522 1.00 64.94 ? 92  MET A CG  1 
ATOM   24   S SD  . MET A 1 4   ? 105.441 38.411 99.171  1.00 63.76 ? 92  MET A SD  1 
ATOM   25   C CE  . MET A 1 4   ? 106.207 39.192 97.760  1.00 64.36 ? 92  MET A CE  1 
ATOM   26   N N   . THR A 1 5   ? 105.276 43.695 100.967 1.00 66.21 ? 93  THR A N   1 
ATOM   27   C CA  . THR A 1 5   ? 105.059 45.063 100.536 1.00 66.01 ? 93  THR A CA  1 
ATOM   28   C C   . THR A 1 5   ? 105.872 46.016 101.393 1.00 65.92 ? 93  THR A C   1 
ATOM   29   O O   . THR A 1 5   ? 106.532 46.919 100.879 1.00 65.98 ? 93  THR A O   1 
ATOM   30   C CB  . THR A 1 5   ? 103.577 45.438 100.624 1.00 66.06 ? 93  THR A CB  1 
ATOM   31   O OG1 . THR A 1 5   ? 102.811 44.529 99.823  1.00 65.51 ? 93  THR A OG1 1 
ATOM   32   C CG2 . THR A 1 5   ? 103.363 46.857 100.123 1.00 66.10 ? 93  THR A CG2 1 
ATOM   33   N N   . GLN A 1 6   ? 105.827 45.811 102.703 1.00 65.75 ? 94  GLN A N   1 
ATOM   34   C CA  . GLN A 1 6   ? 106.586 46.656 103.610 1.00 65.66 ? 94  GLN A CA  1 
ATOM   35   C C   . GLN A 1 6   ? 108.036 46.681 103.167 1.00 64.54 ? 94  GLN A C   1 
ATOM   36   O O   . GLN A 1 6   ? 108.620 47.748 102.993 1.00 64.29 ? 94  GLN A O   1 
ATOM   37   C CB  . GLN A 1 6   ? 106.494 46.126 105.036 1.00 66.88 ? 94  GLN A CB  1 
ATOM   38   C CG  . GLN A 1 6   ? 105.101 46.191 105.615 1.00 68.70 ? 94  GLN A CG  1 
ATOM   39   C CD  . GLN A 1 6   ? 105.057 45.695 107.046 1.00 70.06 ? 94  GLN A CD  1 
ATOM   40   O OE1 . GLN A 1 6   ? 105.780 46.198 107.910 1.00 70.88 ? 94  GLN A OE1 1 
ATOM   41   N NE2 . GLN A 1 6   ? 104.205 44.708 107.308 1.00 70.54 ? 94  GLN A NE2 1 
ATOM   42   N N   . GLN A 1 7   ? 108.613 45.498 102.986 1.00 63.61 ? 95  GLN A N   1 
ATOM   43   C CA  . GLN A 1 7   ? 109.995 45.406 102.547 1.00 62.88 ? 95  GLN A CA  1 
ATOM   44   C C   . GLN A 1 7   ? 110.226 46.192 101.269 1.00 62.14 ? 95  GLN A C   1 
ATOM   45   O O   . GLN A 1 7   ? 111.077 47.083 101.222 1.00 62.13 ? 95  GLN A O   1 
ATOM   46   C CB  . GLN A 1 7   ? 110.400 43.955 102.296 1.00 62.89 ? 95  GLN A CB  1 
ATOM   47   C CG  . GLN A 1 7   ? 110.800 43.160 103.518 1.00 63.65 ? 95  GLN A CG  1 
ATOM   48   C CD  . GLN A 1 7   ? 111.321 41.781 103.143 1.00 64.52 ? 95  GLN A CD  1 
ATOM   49   O OE1 . GLN A 1 7   ? 110.563 40.919 102.685 1.00 64.61 ? 95  GLN A OE1 1 
ATOM   50   N NE2 . GLN A 1 7   ? 112.628 41.576 103.311 1.00 64.36 ? 95  GLN A NE2 1 
ATOM   51   N N   . LEU A 1 8   ? 109.457 45.862 100.236 1.00 61.14 ? 96  LEU A N   1 
ATOM   52   C CA  . LEU A 1 8   ? 109.603 46.497 98.931  1.00 60.16 ? 96  LEU A CA  1 
ATOM   53   C C   . LEU A 1 8   ? 109.719 48.007 99.010  1.00 59.97 ? 96  LEU A C   1 
ATOM   54   O O   . LEU A 1 8   ? 110.367 48.626 98.168  1.00 59.96 ? 96  LEU A O   1 
ATOM   55   C CB  . LEU A 1 8   ? 108.434 46.133 98.024  1.00 59.38 ? 96  LEU A CB  1 
ATOM   56   C CG  . LEU A 1 8   ? 108.671 46.417 96.546  1.00 58.45 ? 96  LEU A CG  1 
ATOM   57   C CD1 . LEU A 1 8   ? 109.746 45.486 96.035  1.00 58.43 ? 96  LEU A CD1 1 
ATOM   58   C CD2 . LEU A 1 8   ? 107.393 46.201 95.768  1.00 58.55 ? 96  LEU A CD2 1 
ATOM   59   N N   . ASN A 1 9   ? 109.093 48.598 100.023 1.00 59.64 ? 97  ASN A N   1 
ATOM   60   C CA  . ASN A 1 9   ? 109.125 50.045 100.197 1.00 59.39 ? 97  ASN A CA  1 
ATOM   61   C C   . ASN A 1 9   ? 110.162 50.497 101.227 1.00 59.12 ? 97  ASN A C   1 
ATOM   62   O O   . ASN A 1 9   ? 110.131 51.634 101.691 1.00 59.19 ? 97  ASN A O   1 
ATOM   63   C CB  . ASN A 1 9   ? 107.740 50.558 100.610 1.00 59.78 ? 97  ASN A CB  1 
ATOM   64   C CG  . ASN A 1 9   ? 106.666 50.271 99.566  1.00 60.68 ? 97  ASN A CG  1 
ATOM   65   O OD1 . ASN A 1 9   ? 106.802 50.641 98.398  1.00 61.76 ? 97  ASN A OD1 1 
ATOM   66   N ND2 . ASN A 1 9   ? 105.587 49.623 99.989  1.00 60.47 ? 97  ASN A ND2 1 
ATOM   67   N N   . SER A 1 10  ? 111.079 49.604 101.574 1.00 58.73 ? 98  SER A N   1 
ATOM   68   C CA  . SER A 1 10  ? 112.119 49.902 102.547 1.00 58.30 ? 98  SER A CA  1 
ATOM   69   C C   . SER A 1 10  ? 113.266 50.661 101.891 1.00 58.18 ? 98  SER A C   1 
ATOM   70   O O   . SER A 1 10  ? 113.503 50.511 100.695 1.00 58.28 ? 98  SER A O   1 
ATOM   71   C CB  . SER A 1 10  ? 112.641 48.594 103.149 1.00 58.24 ? 98  SER A CB  1 
ATOM   72   O OG  . SER A 1 10  ? 113.687 48.825 104.078 1.00 58.76 ? 98  SER A OG  1 
ATOM   73   N N   . ASP A 1 11  ? 113.967 51.482 102.671 1.00 57.87 ? 99  ASP A N   1 
ATOM   74   C CA  . ASP A 1 11  ? 115.110 52.231 102.155 1.00 57.90 ? 99  ASP A CA  1 
ATOM   75   C C   . ASP A 1 11  ? 116.317 51.304 102.046 1.00 57.33 ? 99  ASP A C   1 
ATOM   76   O O   . ASP A 1 11  ? 117.291 51.601 101.348 1.00 57.23 ? 99  ASP A O   1 
ATOM   77   C CB  . ASP A 1 11  ? 115.469 53.395 103.086 1.00 59.11 ? 99  ASP A CB  1 
ATOM   78   C CG  . ASP A 1 11  ? 114.471 54.538 103.019 1.00 60.27 ? 99  ASP A CG  1 
ATOM   79   O OD1 . ASP A 1 11  ? 114.265 55.091 101.915 1.00 60.98 ? 99  ASP A OD1 1 
ATOM   80   O OD2 . ASP A 1 11  ? 113.899 54.893 104.072 1.00 60.78 ? 99  ASP A OD2 1 
ATOM   81   N N   . ASP A 1 12  ? 116.235 50.179 102.747 1.00 56.63 ? 100 ASP A N   1 
ATOM   82   C CA  . ASP A 1 12  ? 117.301 49.192 102.770 1.00 55.79 ? 100 ASP A CA  1 
ATOM   83   C C   . ASP A 1 12  ? 117.386 48.396 101.483 1.00 54.83 ? 100 ASP A C   1 
ATOM   84   O O   . ASP A 1 12  ? 116.523 47.573 101.192 1.00 54.67 ? 100 ASP A O   1 
ATOM   85   C CB  . ASP A 1 12  ? 117.089 48.233 103.931 1.00 56.71 ? 100 ASP A CB  1 
ATOM   86   C CG  . ASP A 1 12  ? 118.256 47.314 104.130 1.00 57.48 ? 100 ASP A CG  1 
ATOM   87   O OD1 . ASP A 1 12  ? 118.657 46.650 103.154 1.00 58.83 ? 100 ASP A OD1 1 
ATOM   88   O OD2 . ASP A 1 12  ? 118.775 47.256 105.263 1.00 58.39 ? 100 ASP A OD2 1 
ATOM   89   N N   . MET A 1 13  ? 118.448 48.644 100.729 1.00 54.19 ? 101 MET A N   1 
ATOM   90   C CA  . MET A 1 13  ? 118.706 47.972 99.464  1.00 53.64 ? 101 MET A CA  1 
ATOM   91   C C   . MET A 1 13  ? 118.397 46.475 99.533  1.00 52.23 ? 101 MET A C   1 
ATOM   92   O O   . MET A 1 13  ? 117.551 45.961 98.814  1.00 51.54 ? 101 MET A O   1 
ATOM   93   C CB  . MET A 1 13  ? 120.176 48.181 99.083  1.00 55.23 ? 101 MET A CB  1 
ATOM   94   C CG  . MET A 1 13  ? 120.616 47.546 97.780  1.00 57.44 ? 101 MET A CG  1 
ATOM   95   S SD  . MET A 1 13  ? 119.767 48.218 96.319  1.00 61.00 ? 101 MET A SD  1 
ATOM   96   C CE  . MET A 1 13  ? 118.147 47.469 96.419  1.00 59.02 ? 101 MET A CE  1 
ATOM   97   N N   . GLN A 1 14  ? 119.095 45.784 100.419 1.00 50.99 ? 102 GLN A N   1 
ATOM   98   C CA  . GLN A 1 14  ? 118.939 44.351 100.588 1.00 49.82 ? 102 GLN A CA  1 
ATOM   99   C C   . GLN A 1 14  ? 117.494 43.884 100.769 1.00 48.35 ? 102 GLN A C   1 
ATOM   100  O O   . GLN A 1 14  ? 117.086 42.889 100.180 1.00 48.51 ? 102 GLN A O   1 
ATOM   101  C CB  . GLN A 1 14  ? 119.804 43.904 101.767 1.00 50.67 ? 102 GLN A CB  1 
ATOM   102  C CG  . GLN A 1 14  ? 119.919 42.405 101.971 1.00 51.69 ? 102 GLN A CG  1 
ATOM   103  C CD  . GLN A 1 14  ? 121.053 42.057 102.912 1.00 52.50 ? 102 GLN A CD  1 
ATOM   104  O OE1 . GLN A 1 14  ? 121.269 40.896 103.245 1.00 53.45 ? 102 GLN A OE1 1 
ATOM   105  N NE2 . GLN A 1 14  ? 121.796 43.070 103.337 1.00 53.56 ? 102 GLN A NE2 1 
ATOM   106  N N   . GLU A 1 15  ? 116.721 44.592 101.581 1.00 46.64 ? 103 GLU A N   1 
ATOM   107  C CA  . GLU A 1 15  ? 115.332 44.217 101.805 1.00 44.70 ? 103 GLU A CA  1 
ATOM   108  C C   . GLU A 1 15  ? 114.475 44.402 100.560 1.00 43.42 ? 103 GLU A C   1 
ATOM   109  O O   . GLU A 1 15  ? 113.465 43.728 100.401 1.00 42.77 ? 103 GLU A O   1 
ATOM   110  C CB  . GLU A 1 15  ? 114.732 45.022 102.962 1.00 44.72 ? 103 GLU A CB  1 
ATOM   111  C CG  . GLU A 1 15  ? 115.259 44.642 104.335 1.00 43.96 ? 103 GLU A CG  1 
ATOM   112  N N   . GLN A 1 16  ? 114.877 45.315 99.679  1.00 42.40 ? 104 GLN A N   1 
ATOM   113  C CA  . GLN A 1 16  ? 114.136 45.567 98.441  1.00 40.87 ? 104 GLN A CA  1 
ATOM   114  C C   . GLN A 1 16  ? 114.338 44.446 97.414  1.00 40.32 ? 104 GLN A C   1 
ATOM   115  O O   . GLN A 1 16  ? 113.398 44.054 96.716  1.00 40.11 ? 104 GLN A O   1 
ATOM   116  C CB  . GLN A 1 16  ? 114.593 46.868 97.801  1.00 40.74 ? 104 GLN A CB  1 
ATOM   117  C CG  . GLN A 1 16  ? 114.624 48.053 98.719  1.00 41.12 ? 104 GLN A CG  1 
ATOM   118  C CD  . GLN A 1 16  ? 115.037 49.314 97.984  1.00 41.04 ? 104 GLN A CD  1 
ATOM   119  O OE1 . GLN A 1 16  ? 116.054 49.340 97.294  1.00 41.32 ? 104 GLN A OE1 1 
ATOM   120  N NE2 . GLN A 1 16  ? 114.253 50.369 98.137  1.00 41.43 ? 104 GLN A NE2 1 
ATOM   121  N N   . LEU A 1 17  ? 115.578 43.963 97.313  1.00 39.47 ? 105 LEU A N   1 
ATOM   122  C CA  . LEU A 1 17  ? 115.940 42.899 96.382  1.00 38.67 ? 105 LEU A CA  1 
ATOM   123  C C   . LEU A 1 17  ? 115.278 41.613 96.828  1.00 38.41 ? 105 LEU A C   1 
ATOM   124  O O   . LEU A 1 17  ? 114.890 40.780 96.010  1.00 38.42 ? 105 LEU A O   1 
ATOM   125  C CB  . LEU A 1 17  ? 117.462 42.706 96.345  1.00 37.87 ? 105 LEU A CB  1 
ATOM   126  C CG  . LEU A 1 17  ? 117.981 41.580 95.442  1.00 37.12 ? 105 LEU A CG  1 
ATOM   127  C CD1 . LEU A 1 17  ? 117.542 41.806 94.003  1.00 35.50 ? 105 LEU A CD1 1 
ATOM   128  C CD2 . LEU A 1 17  ? 119.501 41.517 95.548  1.00 36.67 ? 105 LEU A CD2 1 
ATOM   129  N N   . SER A 1 18  ? 115.151 41.464 98.139  1.00 37.66 ? 106 SER A N   1 
ATOM   130  C CA  . SER A 1 18  ? 114.532 40.283 98.705  1.00 37.48 ? 106 SER A CA  1 
ATOM   131  C C   . SER A 1 18  ? 113.050 40.247 98.324  1.00 37.10 ? 106 SER A C   1 
ATOM   132  O O   . SER A 1 18  ? 112.498 39.190 97.971  1.00 36.21 ? 106 SER A O   1 
ATOM   133  C CB  . SER A 1 18  ? 114.697 40.309 100.221 1.00 37.81 ? 106 SER A CB  1 
ATOM   134  O OG  . SER A 1 18  ? 113.961 39.266 100.828 1.00 40.26 ? 106 SER A OG  1 
ATOM   135  N N   . ALA A 1 19  ? 112.426 41.420 98.381  1.00 36.41 ? 107 ALA A N   1 
ATOM   136  C CA  . ALA A 1 19  ? 111.016 41.574 98.059  1.00 35.89 ? 107 ALA A CA  1 
ATOM   137  C C   . ALA A 1 19  ? 110.722 41.449 96.572  1.00 35.90 ? 107 ALA A C   1 
ATOM   138  O O   . ALA A 1 19  ? 109.720 40.850 96.186  1.00 35.20 ? 107 ALA A O   1 
ATOM   139  C CB  . ALA A 1 19  ? 110.521 42.906 98.562  1.00 35.60 ? 107 ALA A CB  1 
ATOM   140  N N   . THR A 1 20  ? 111.582 42.014 95.730  1.00 36.11 ? 108 THR A N   1 
ATOM   141  C CA  . THR A 1 20  ? 111.342 41.930 94.296  1.00 36.20 ? 108 THR A CA  1 
ATOM   142  C C   . THR A 1 20  ? 111.465 40.483 93.853  1.00 36.63 ? 108 THR A C   1 
ATOM   143  O O   . THR A 1 20  ? 110.742 40.044 92.962  1.00 36.75 ? 108 THR A O   1 
ATOM   144  C CB  . THR A 1 20  ? 112.315 42.831 93.502  1.00 35.88 ? 108 THR A CB  1 
ATOM   145  O OG1 . THR A 1 20  ? 112.149 44.187 93.924  1.00 35.47 ? 108 THR A OG1 1 
ATOM   146  C CG2 . THR A 1 20  ? 112.026 42.758 92.020  1.00 35.41 ? 108 THR A CG2 1 
ATOM   147  N N   . VAL A 1 21  ? 112.371 39.740 94.491  1.00 37.30 ? 109 VAL A N   1 
ATOM   148  C CA  . VAL A 1 21  ? 112.568 38.330 94.171  1.00 37.57 ? 109 VAL A CA  1 
ATOM   149  C C   . VAL A 1 21  ? 111.329 37.540 94.584  1.00 38.33 ? 109 VAL A C   1 
ATOM   150  O O   . VAL A 1 21  ? 110.796 36.754 93.799  1.00 38.19 ? 109 VAL A O   1 
ATOM   151  C CB  . VAL A 1 21  ? 113.802 37.742 94.895  1.00 37.32 ? 109 VAL A CB  1 
ATOM   152  C CG1 . VAL A 1 21  ? 113.850 36.229 94.686  1.00 36.50 ? 109 VAL A CG1 1 
ATOM   153  C CG2 . VAL A 1 21  ? 115.079 38.373 94.344  1.00 37.06 ? 109 VAL A CG2 1 
ATOM   154  N N   . LYS A 1 22  ? 110.873 37.747 95.818  1.00 39.05 ? 110 LYS A N   1 
ATOM   155  C CA  . LYS A 1 22  ? 109.681 37.055 96.297  1.00 39.78 ? 110 LYS A CA  1 
ATOM   156  C C   . LYS A 1 22  ? 108.491 37.406 95.398  1.00 40.53 ? 110 LYS A C   1 
ATOM   157  O O   . LYS A 1 22  ? 107.731 36.521 94.997  1.00 41.44 ? 110 LYS A O   1 
ATOM   158  C CB  . LYS A 1 22  ? 109.361 37.436 97.747  1.00 39.53 ? 110 LYS A CB  1 
ATOM   159  C CG  . LYS A 1 22  ? 110.383 36.985 98.772  1.00 39.75 ? 110 LYS A CG  1 
ATOM   160  N N   . PHE A 1 23  ? 108.320 38.688 95.078  1.00 40.78 ? 111 PHE A N   1 
ATOM   161  C CA  . PHE A 1 23  ? 107.217 39.089 94.204  1.00 40.93 ? 111 PHE A CA  1 
ATOM   162  C C   . PHE A 1 23  ? 107.303 38.431 92.839  1.00 41.23 ? 111 PHE A C   1 
ATOM   163  O O   . PHE A 1 23  ? 106.291 37.993 92.293  1.00 41.00 ? 111 PHE A O   1 
ATOM   164  C CB  . PHE A 1 23  ? 107.174 40.605 93.989  1.00 40.68 ? 111 PHE A CB  1 
ATOM   165  C CG  . PHE A 1 23  ? 106.311 41.333 94.969  1.00 40.08 ? 111 PHE A CG  1 
ATOM   166  C CD1 . PHE A 1 23  ? 104.930 41.267 94.866  1.00 39.47 ? 111 PHE A CD1 1 
ATOM   167  C CD2 . PHE A 1 23  ? 106.871 42.072 96.005  1.00 40.61 ? 111 PHE A CD2 1 
ATOM   168  C CE1 . PHE A 1 23  ? 104.110 41.923 95.784  1.00 39.44 ? 111 PHE A CE1 1 
ATOM   169  C CE2 . PHE A 1 23  ? 106.058 42.734 96.932  1.00 40.37 ? 111 PHE A CE2 1 
ATOM   170  C CZ  . PHE A 1 23  ? 104.672 42.658 96.817  1.00 39.33 ? 111 PHE A CZ  1 
ATOM   171  N N   . ARG A 1 24  ? 108.511 38.366 92.288  1.00 41.55 ? 112 ARG A N   1 
ATOM   172  C CA  . ARG A 1 24  ? 108.702 37.763 90.975  1.00 42.18 ? 112 ARG A CA  1 
ATOM   173  C C   . ARG A 1 24  ? 108.475 36.252 91.019  1.00 42.87 ? 112 ARG A C   1 
ATOM   174  O O   . ARG A 1 24  ? 107.998 35.661 90.051  1.00 42.38 ? 112 ARG A O   1 
ATOM   175  C CB  . ARG A 1 24  ? 110.099 38.116 90.437  1.00 41.13 ? 112 ARG A CB  1 
ATOM   176  C CG  . ARG A 1 24  ? 110.419 37.544 89.068  1.00 40.40 ? 112 ARG A CG  1 
ATOM   177  C CD  . ARG A 1 24  ? 110.957 36.138 89.199  1.00 39.50 ? 112 ARG A CD  1 
ATOM   178  N NE  . ARG A 1 24  ? 112.191 36.154 89.967  1.00 38.26 ? 112 ARG A NE  1 
ATOM   179  C CZ  . ARG A 1 24  ? 112.899 35.077 90.279  1.00 38.16 ? 112 ARG A CZ  1 
ATOM   180  N NH1 . ARG A 1 24  ? 112.492 33.878 89.885  1.00 38.32 ? 112 ARG A NH1 1 
ATOM   181  N NH2 . ARG A 1 24  ? 114.013 35.202 90.990  1.00 36.84 ? 112 ARG A NH2 1 
ATOM   182  N N   . GLN A 1 25  ? 108.795 35.640 92.154  1.00 44.30 ? 113 GLN A N   1 
ATOM   183  C CA  . GLN A 1 25  ? 108.610 34.205 92.328  1.00 45.55 ? 113 GLN A CA  1 
ATOM   184  C C   . GLN A 1 25  ? 107.146 33.782 92.242  1.00 46.17 ? 113 GLN A C   1 
ATOM   185  O O   . GLN A 1 25  ? 106.825 32.810 91.554  1.00 46.45 ? 113 GLN A O   1 
ATOM   186  C CB  . GLN A 1 25  ? 109.192 33.756 93.670  1.00 45.78 ? 113 GLN A CB  1 
ATOM   187  C CG  . GLN A 1 25  ? 110.712 33.626 93.688  1.00 47.14 ? 113 GLN A CG  1 
ATOM   188  C CD  . GLN A 1 25  ? 111.270 33.375 95.089  1.00 47.94 ? 113 GLN A CD  1 
ATOM   189  O OE1 . GLN A 1 25  ? 112.460 33.085 95.261  1.00 47.86 ? 113 GLN A OE1 1 
ATOM   190  N NE2 . GLN A 1 25  ? 110.414 33.504 96.096  1.00 48.15 ? 113 GLN A NE2 1 
ATOM   191  N N   . ILE A 1 26  ? 106.254 34.507 92.916  1.00 46.34 ? 114 ILE A N   1 
ATOM   192  C CA  . ILE A 1 26  ? 104.844 34.128 92.895  1.00 46.91 ? 114 ILE A CA  1 
ATOM   193  C C   . ILE A 1 26  ? 104.115 34.493 91.618  1.00 47.48 ? 114 ILE A C   1 
ATOM   194  O O   . ILE A 1 26  ? 102.931 34.188 91.470  1.00 47.69 ? 114 ILE A O   1 
ATOM   195  C CB  . ILE A 1 26  ? 104.057 34.720 94.076  1.00 46.74 ? 114 ILE A CB  1 
ATOM   196  C CG1 . ILE A 1 26  ? 103.964 36.236 93.939  1.00 46.82 ? 114 ILE A CG1 1 
ATOM   197  C CG2 . ILE A 1 26  ? 104.720 34.323 95.387  1.00 46.52 ? 114 ILE A CG2 1 
ATOM   198  C CD1 . ILE A 1 26  ? 103.109 36.870 95.001  1.00 46.40 ? 114 ILE A CD1 1 
ATOM   199  N N   . LEU A 1 27  ? 104.805 35.169 90.707  1.00 48.21 ? 115 LEU A N   1 
ATOM   200  C CA  . LEU A 1 27  ? 104.209 35.518 89.425  1.00 48.95 ? 115 LEU A CA  1 
ATOM   201  C C   . LEU A 1 27  ? 104.780 34.542 88.398  1.00 49.93 ? 115 LEU A C   1 
ATOM   202  O O   . LEU A 1 27  ? 104.386 34.550 87.234  1.00 50.02 ? 115 LEU A O   1 
ATOM   203  C CB  . LEU A 1 27  ? 104.533 36.966 89.032  1.00 47.97 ? 115 LEU A CB  1 
ATOM   204  C CG  . LEU A 1 27  ? 103.940 38.091 89.894  1.00 47.22 ? 115 LEU A CG  1 
ATOM   205  C CD1 . LEU A 1 27  ? 104.376 39.439 89.377  1.00 46.71 ? 115 LEU A CD1 1 
ATOM   206  C CD2 . LEU A 1 27  ? 102.439 38.013 89.873  1.00 47.39 ? 115 LEU A CD2 1 
ATOM   207  N N   . SER A 1 28  ? 105.701 33.690 88.853  1.00 51.27 ? 116 SER A N   1 
ATOM   208  C CA  . SER A 1 28  ? 106.337 32.693 88.000  1.00 52.74 ? 116 SER A CA  1 
ATOM   209  C C   . SER A 1 28  ? 105.938 31.260 88.344  1.00 54.31 ? 116 SER A C   1 
ATOM   210  O O   . SER A 1 28  ? 106.595 30.311 87.909  1.00 54.74 ? 116 SER A O   1 
ATOM   211  C CB  . SER A 1 28  ? 107.855 32.820 88.080  1.00 52.29 ? 116 SER A CB  1 
ATOM   212  O OG  . SER A 1 28  ? 108.280 34.069 87.585  1.00 52.01 ? 116 SER A OG  1 
ATOM   213  N N   . ARG A 1 29  ? 104.871 31.099 89.127  1.00 56.02 ? 117 ARG A N   1 
ATOM   214  C CA  . ARG A 1 29  ? 104.388 29.769 89.495  1.00 57.12 ? 117 ARG A CA  1 
ATOM   215  C C   . ARG A 1 29  ? 104.122 29.020 88.207  1.00 57.06 ? 117 ARG A C   1 
ATOM   216  O O   . ARG A 1 29  ? 104.304 29.551 87.109  1.00 57.15 ? 117 ARG A O   1 
ATOM   217  C CB  . ARG A 1 29  ? 103.048 29.821 90.238  1.00 58.66 ? 117 ARG A CB  1 
ATOM   218  C CG  . ARG A 1 29  ? 102.995 30.560 91.556  1.00 60.64 ? 117 ARG A CG  1 
ATOM   219  C CD  . ARG A 1 29  ? 101.568 30.473 92.088  1.00 62.30 ? 117 ARG A CD  1 
ATOM   220  N NE  . ARG A 1 29  ? 101.341 31.254 93.302  1.00 63.71 ? 117 ARG A NE  1 
ATOM   221  C CZ  . ARG A 1 29  ? 100.158 31.356 93.906  1.00 64.57 ? 117 ARG A CZ  1 
ATOM   222  N NH1 . ARG A 1 29  ? 99.096  30.725 93.407  1.00 64.18 ? 117 ARG A NH1 1 
ATOM   223  N NH2 . ARG A 1 29  ? 100.029 32.088 95.007  1.00 64.86 ? 117 ARG A NH2 1 
ATOM   224  N N   . GLU A 1 30  ? 103.663 27.785 88.350  1.00 56.72 ? 118 GLU A N   1 
ATOM   225  C CA  . GLU A 1 30  ? 103.328 26.983 87.195  1.00 56.28 ? 118 GLU A CA  1 
ATOM   226  C C   . GLU A 1 30  ? 101.817 27.137 87.022  1.00 55.96 ? 118 GLU A C   1 
ATOM   227  O O   . GLU A 1 30  ? 101.297 27.055 85.906  1.00 56.44 ? 118 GLU A O   1 
ATOM   228  C CB  . GLU A 1 30  ? 103.701 25.515 87.439  1.00 56.02 ? 118 GLU A CB  1 
ATOM   229  N N   . HIS A 1 31  ? 101.127 27.401 88.133  1.00 55.09 ? 119 HIS A N   1 
ATOM   230  C CA  . HIS A 1 31  ? 99.669  27.544 88.138  1.00 54.22 ? 119 HIS A CA  1 
ATOM   231  C C   . HIS A 1 31  ? 99.137  28.958 87.871  1.00 53.57 ? 119 HIS A C   1 
ATOM   232  O O   . HIS A 1 31  ? 99.744  29.733 87.133  1.00 53.69 ? 119 HIS A O   1 
ATOM   233  C CB  . HIS A 1 31  ? 99.114  27.029 89.471  1.00 54.28 ? 119 HIS A CB  1 
ATOM   234  N N   . ARG A 1 32  ? 97.991  29.280 88.472  1.00 52.80 ? 120 ARG A N   1 
ATOM   235  C CA  . ARG A 1 32  ? 97.355  30.594 88.308  1.00 51.54 ? 120 ARG A CA  1 
ATOM   236  C C   . ARG A 1 32  ? 98.056  31.698 89.094  1.00 50.10 ? 120 ARG A C   1 
ATOM   237  O O   . ARG A 1 32  ? 97.910  31.803 90.312  1.00 49.94 ? 120 ARG A O   1 
ATOM   238  C CB  . ARG A 1 32  ? 95.887  30.518 88.727  1.00 51.71 ? 120 ARG A CB  1 
ATOM   239  N N   . PRO A 1 33  ? 98.822  32.547 88.397  1.00 48.77 ? 121 PRO A N   1 
ATOM   240  C CA  . PRO A 1 33  ? 99.550  33.649 89.021  1.00 47.64 ? 121 PRO A CA  1 
ATOM   241  C C   . PRO A 1 33  ? 98.604  34.699 89.590  1.00 46.66 ? 121 PRO A C   1 
ATOM   242  O O   . PRO A 1 33  ? 97.748  35.229 88.888  1.00 46.39 ? 121 PRO A O   1 
ATOM   243  C CB  . PRO A 1 33  ? 100.377 34.184 87.865  1.00 48.19 ? 121 PRO A CB  1 
ATOM   244  C CG  . PRO A 1 33  ? 99.418  33.988 86.707  1.00 48.58 ? 121 PRO A CG  1 
ATOM   245  C CD  . PRO A 1 33  ? 99.076  32.540 86.950  1.00 48.73 ? 121 PRO A CD  1 
ATOM   246  N N   . PRO A 1 34  ? 98.737  34.999 90.884  1.00 46.29 ? 122 PRO A N   1 
ATOM   247  C CA  . PRO A 1 34  ? 97.889  35.991 91.551  1.00 45.97 ? 122 PRO A CA  1 
ATOM   248  C C   . PRO A 1 34  ? 98.196  37.410 91.058  1.00 45.64 ? 122 PRO A C   1 
ATOM   249  O O   . PRO A 1 34  ? 98.715  38.237 91.803  1.00 45.71 ? 122 PRO A O   1 
ATOM   250  C CB  . PRO A 1 34  ? 98.254  35.795 93.018  1.00 45.42 ? 122 PRO A CB  1 
ATOM   251  C CG  . PRO A 1 34  ? 99.732  35.474 92.911  1.00 45.37 ? 122 PRO A CG  1 
ATOM   252  C CD  . PRO A 1 34  ? 99.674  34.402 91.852  1.00 45.87 ? 122 PRO A CD  1 
ATOM   253  N N   . ILE A 1 35  ? 97.873  37.695 89.805  1.00 45.06 ? 123 ILE A N   1 
ATOM   254  C CA  . ILE A 1 35  ? 98.158  39.009 89.269  1.00 45.25 ? 123 ILE A CA  1 
ATOM   255  C C   . ILE A 1 35  ? 97.377  40.121 89.972  1.00 45.60 ? 123 ILE A C   1 
ATOM   256  O O   . ILE A 1 35  ? 97.969  41.063 90.502  1.00 45.26 ? 123 ILE A O   1 
ATOM   257  C CB  . ILE A 1 35  ? 97.910  39.046 87.740  1.00 45.27 ? 123 ILE A CB  1 
ATOM   258  C CG1 . ILE A 1 35  ? 98.883  38.090 87.037  1.00 45.43 ? 123 ILE A CG1 1 
ATOM   259  C CG2 . ILE A 1 35  ? 98.118  40.451 87.208  1.00 45.04 ? 123 ILE A CG2 1 
ATOM   260  C CD1 . ILE A 1 35  ? 98.744  38.053 85.524  1.00 44.99 ? 123 ILE A CD1 1 
ATOM   261  N N   . ASP A 1 36  ? 96.054  40.017 89.999  1.00 46.23 ? 124 ASP A N   1 
ATOM   262  C CA  . ASP A 1 36  ? 95.259  41.048 90.650  1.00 46.37 ? 124 ASP A CA  1 
ATOM   263  C C   . ASP A 1 36  ? 95.671  41.334 92.078  1.00 46.16 ? 124 ASP A C   1 
ATOM   264  O O   . ASP A 1 36  ? 95.732  42.489 92.487  1.00 46.43 ? 124 ASP A O   1 
ATOM   265  C CB  . ASP A 1 36  ? 93.775  40.698 90.619  1.00 46.92 ? 124 ASP A CB  1 
ATOM   266  C CG  . ASP A 1 36  ? 93.140  41.031 89.296  1.00 48.14 ? 124 ASP A CG  1 
ATOM   267  O OD1 . ASP A 1 36  ? 93.370  42.162 88.804  1.00 49.06 ? 124 ASP A OD1 1 
ATOM   268  O OD2 . ASP A 1 36  ? 92.399  40.182 88.758  1.00 48.85 ? 124 ASP A OD2 1 
ATOM   269  N N   . VAL A 1 37  ? 95.955  40.290 92.844  1.00 46.00 ? 125 VAL A N   1 
ATOM   270  C CA  . VAL A 1 37  ? 96.352  40.493 94.225  1.00 45.72 ? 125 VAL A CA  1 
ATOM   271  C C   . VAL A 1 37  ? 97.558  41.428 94.266  1.00 45.33 ? 125 VAL A C   1 
ATOM   272  O O   . VAL A 1 37  ? 97.555  42.440 94.977  1.00 45.48 ? 125 VAL A O   1 
ATOM   273  C CB  . VAL A 1 37  ? 96.718  39.162 94.907  1.00 45.85 ? 125 VAL A CB  1 
ATOM   274  C CG1 . VAL A 1 37  ? 97.007  39.404 96.377  1.00 46.15 ? 125 VAL A CG1 1 
ATOM   275  C CG2 . VAL A 1 37  ? 95.588  38.172 94.755  1.00 45.33 ? 125 VAL A CG2 1 
ATOM   276  N N   . VAL A 1 38  ? 98.578  41.094 93.481  1.00 44.36 ? 126 VAL A N   1 
ATOM   277  C CA  . VAL A 1 38  ? 99.790  41.896 93.423  1.00 43.97 ? 126 VAL A CA  1 
ATOM   278  C C   . VAL A 1 38  ? 99.493  43.345 93.030  1.00 43.61 ? 126 VAL A C   1 
ATOM   279  O O   . VAL A 1 38  ? 100.000 44.280 93.638  1.00 43.40 ? 126 VAL A O   1 
ATOM   280  C CB  . VAL A 1 38  ? 100.797 41.291 92.420  1.00 43.71 ? 126 VAL A CB  1 
ATOM   281  C CG1 . VAL A 1 38  ? 102.040 42.150 92.346  1.00 43.82 ? 126 VAL A CG1 1 
ATOM   282  C CG2 . VAL A 1 38  ? 101.167 39.883 92.845  1.00 43.92 ? 126 VAL A CG2 1 
ATOM   283  N N   . ILE A 1 39  ? 98.673  43.528 92.007  1.00 43.18 ? 127 ILE A N   1 
ATOM   284  C CA  . ILE A 1 39  ? 98.333  44.864 91.558  1.00 43.40 ? 127 ILE A CA  1 
ATOM   285  C C   . ILE A 1 39  ? 97.662  45.618 92.705  1.00 44.73 ? 127 ILE A C   1 
ATOM   286  O O   . ILE A 1 39  ? 97.920  46.803 92.936  1.00 44.18 ? 127 ILE A O   1 
ATOM   287  C CB  . ILE A 1 39  ? 97.357  44.805 90.368  1.00 42.62 ? 127 ILE A CB  1 
ATOM   288  C CG1 . ILE A 1 39  ? 98.004  44.065 89.198  1.00 41.81 ? 127 ILE A CG1 1 
ATOM   289  C CG2 . ILE A 1 39  ? 96.952  46.200 89.953  1.00 41.54 ? 127 ILE A CG2 1 
ATOM   290  C CD1 . ILE A 1 39  ? 97.067  43.861 88.022  1.00 42.00 ? 127 ILE A CD1 1 
ATOM   291  N N   . GLN A 1 40  ? 96.798  44.910 93.425  1.00 45.52 ? 128 GLN A N   1 
ATOM   292  C CA  . GLN A 1 40  ? 96.064  45.488 94.539  1.00 46.22 ? 128 GLN A CA  1 
ATOM   293  C C   . GLN A 1 40  ? 96.937  45.957 95.675  1.00 45.85 ? 128 GLN A C   1 
ATOM   294  O O   . GLN A 1 40  ? 96.594  46.914 96.368  1.00 46.08 ? 128 GLN A O   1 
ATOM   295  C CB  . GLN A 1 40  ? 95.022  44.495 95.043  1.00 47.52 ? 128 GLN A CB  1 
ATOM   296  C CG  . GLN A 1 40  ? 93.737  44.528 94.223  1.00 50.29 ? 128 GLN A CG  1 
ATOM   297  C CD  . GLN A 1 40  ? 92.835  43.333 94.474  1.00 51.81 ? 128 GLN A CD  1 
ATOM   298  O OE1 . GLN A 1 40  ? 92.611  42.935 95.622  1.00 52.96 ? 128 GLN A OE1 1 
ATOM   299  N NE2 . GLN A 1 40  ? 92.291  42.764 93.398  1.00 52.08 ? 128 GLN A NE2 1 
ATOM   300  N N   . ALA A 1 41  ? 98.063  45.285 95.875  1.00 45.56 ? 129 ALA A N   1 
ATOM   301  C CA  . ALA A 1 41  ? 98.984  45.681 96.928  1.00 45.45 ? 129 ALA A CA  1 
ATOM   302  C C   . ALA A 1 41  ? 99.528  47.089 96.627  1.00 45.28 ? 129 ALA A C   1 
ATOM   303  O O   . ALA A 1 41  ? 100.076 47.750 97.513  1.00 44.84 ? 129 ALA A O   1 
ATOM   304  C CB  . ALA A 1 41  ? 100.118 44.680 97.017  1.00 45.52 ? 129 ALA A CB  1 
ATOM   305  N N   . GLY A 1 42  ? 99.361  47.527 95.374  1.00 44.89 ? 130 GLY A N   1 
ATOM   306  C CA  . GLY A 1 42  ? 99.808  48.842 94.935  1.00 44.54 ? 130 GLY A CA  1 
ATOM   307  C C   . GLY A 1 42  ? 101.311 48.936 94.781  1.00 44.22 ? 130 GLY A C   1 
ATOM   308  O O   . GLY A 1 42  ? 101.912 49.957 95.105  1.00 45.07 ? 130 GLY A O   1 
ATOM   309  N N   . VAL A 1 43  ? 101.925 47.878 94.270  1.00 43.17 ? 131 VAL A N   1 
ATOM   310  C CA  . VAL A 1 43  ? 103.369 47.866 94.138  1.00 42.36 ? 131 VAL A CA  1 
ATOM   311  C C   . VAL A 1 43  ? 103.947 48.089 92.739  1.00 42.13 ? 131 VAL A C   1 
ATOM   312  O O   . VAL A 1 43  ? 105.143 48.345 92.597  1.00 42.31 ? 131 VAL A O   1 
ATOM   313  C CB  . VAL A 1 43  ? 103.928 46.550 94.719  1.00 42.26 ? 131 VAL A CB  1 
ATOM   314  C CG1 . VAL A 1 43  ? 103.591 46.465 96.206  1.00 41.89 ? 131 VAL A CG1 1 
ATOM   315  C CG2 . VAL A 1 43  ? 103.343 45.360 93.976  1.00 40.76 ? 131 VAL A CG2 1 
ATOM   316  N N   . VAL A 1 44  ? 103.106 48.015 91.713  1.00 41.40 ? 132 VAL A N   1 
ATOM   317  C CA  . VAL A 1 44  ? 103.560 48.184 90.334  1.00 40.43 ? 132 VAL A CA  1 
ATOM   318  C C   . VAL A 1 44  ? 104.450 49.413 90.080  1.00 40.62 ? 132 VAL A C   1 
ATOM   319  O O   . VAL A 1 44  ? 105.524 49.304 89.477  1.00 40.83 ? 132 VAL A O   1 
ATOM   320  C CB  . VAL A 1 44  ? 102.355 48.208 89.362  1.00 39.20 ? 132 VAL A CB  1 
ATOM   321  C CG1 . VAL A 1 44  ? 102.818 48.491 87.949  1.00 39.10 ? 132 VAL A CG1 1 
ATOM   322  C CG2 . VAL A 1 44  ? 101.653 46.885 89.396  1.00 38.59 ? 132 VAL A CG2 1 
ATOM   323  N N   . PRO A 1 45  ? 104.017 50.600 90.526  1.00 40.36 ? 133 PRO A N   1 
ATOM   324  C CA  . PRO A 1 45  ? 104.831 51.803 90.305  1.00 39.93 ? 133 PRO A CA  1 
ATOM   325  C C   . PRO A 1 45  ? 106.181 51.719 91.026  1.00 39.09 ? 133 PRO A C   1 
ATOM   326  O O   . PRO A 1 45  ? 107.198 52.268 90.566  1.00 39.10 ? 133 PRO A O   1 
ATOM   327  C CB  . PRO A 1 45  ? 103.923 52.920 90.840  1.00 39.94 ? 133 PRO A CB  1 
ATOM   328  C CG  . PRO A 1 45  ? 103.188 52.213 91.961  1.00 40.65 ? 133 PRO A CG  1 
ATOM   329  C CD  . PRO A 1 45  ? 102.773 50.948 91.230  1.00 40.28 ? 133 PRO A CD  1 
ATOM   330  N N   . ARG A 1 46  ? 106.181 51.021 92.156  1.00 38.12 ? 134 ARG A N   1 
ATOM   331  C CA  . ARG A 1 46  ? 107.395 50.843 92.947  1.00 37.76 ? 134 ARG A CA  1 
ATOM   332  C C   . ARG A 1 46  ? 108.385 49.931 92.212  1.00 36.75 ? 134 ARG A C   1 
ATOM   333  O O   . ARG A 1 46  ? 109.595 50.098 92.333  1.00 36.82 ? 134 ARG A O   1 
ATOM   334  C CB  . ARG A 1 46  ? 107.035 50.254 94.320  1.00 38.03 ? 134 ARG A CB  1 
ATOM   335  C CG  . ARG A 1 46  ? 108.204 49.999 95.265  1.00 38.44 ? 134 ARG A CG  1 
ATOM   336  C CD  . ARG A 1 46  ? 108.999 51.262 95.571  1.00 38.49 ? 134 ARG A CD  1 
ATOM   337  N NE  . ARG A 1 46  ? 109.987 51.038 96.627  1.00 38.31 ? 134 ARG A NE  1 
ATOM   338  C CZ  . ARG A 1 46  ? 110.892 51.934 97.016  1.00 38.30 ? 134 ARG A CZ  1 
ATOM   339  N NH1 . ARG A 1 46  ? 110.946 53.122 96.435  1.00 37.86 ? 134 ARG A NH1 1 
ATOM   340  N NH2 . ARG A 1 46  ? 111.741 51.648 97.992  1.00 38.43 ? 134 ARG A NH2 1 
ATOM   341  N N   . LEU A 1 47  ? 107.859 48.979 91.446  1.00 35.80 ? 135 LEU A N   1 
ATOM   342  C CA  . LEU A 1 47  ? 108.688 48.057 90.691  1.00 35.47 ? 135 LEU A CA  1 
ATOM   343  C C   . LEU A 1 47  ? 109.196 48.743 89.434  1.00 35.47 ? 135 LEU A C   1 
ATOM   344  O O   . LEU A 1 47  ? 110.239 48.382 88.889  1.00 34.88 ? 135 LEU A O   1 
ATOM   345  C CB  . LEU A 1 47  ? 107.886 46.805 90.326  1.00 35.39 ? 135 LEU A CB  1 
ATOM   346  C CG  . LEU A 1 47  ? 107.417 45.912 91.480  1.00 35.14 ? 135 LEU A CG  1 
ATOM   347  C CD1 . LEU A 1 47  ? 106.478 44.845 90.952  1.00 35.09 ? 135 LEU A CD1 1 
ATOM   348  C CD2 . LEU A 1 47  ? 108.612 45.284 92.168  1.00 34.38 ? 135 LEU A CD2 1 
ATOM   349  N N   . VAL A 1 48  ? 108.450 49.739 88.979  1.00 35.55 ? 136 VAL A N   1 
ATOM   350  C CA  . VAL A 1 48  ? 108.842 50.485 87.802  1.00 36.79 ? 136 VAL A CA  1 
ATOM   351  C C   . VAL A 1 48  ? 110.057 51.368 88.108  1.00 37.57 ? 136 VAL A C   1 
ATOM   352  O O   . VAL A 1 48  ? 110.855 51.662 87.221  1.00 37.15 ? 136 VAL A O   1 
ATOM   353  C CB  . VAL A 1 48  ? 107.681 51.346 87.279  1.00 36.50 ? 136 VAL A CB  1 
ATOM   354  C CG1 . VAL A 1 48  ? 108.128 52.148 86.073  1.00 35.77 ? 136 VAL A CG1 1 
ATOM   355  C CG2 . VAL A 1 48  ? 106.509 50.441 86.888  1.00 36.87 ? 136 VAL A CG2 1 
ATOM   356  N N   . GLU A 1 49  ? 110.205 51.782 89.363  1.00 38.66 ? 137 GLU A N   1 
ATOM   357  C CA  . GLU A 1 49  ? 111.356 52.601 89.751  1.00 39.96 ? 137 GLU A CA  1 
ATOM   358  C C   . GLU A 1 49  ? 112.649 51.811 89.658  1.00 39.76 ? 137 GLU A C   1 
ATOM   359  O O   . GLU A 1 49  ? 113.667 52.322 89.201  1.00 39.68 ? 137 GLU A O   1 
ATOM   360  C CB  . GLU A 1 49  ? 111.229 53.076 91.192  1.00 41.86 ? 137 GLU A CB  1 
ATOM   361  C CG  . GLU A 1 49  ? 110.108 54.030 91.457  1.00 43.98 ? 137 GLU A CG  1 
ATOM   362  C CD  . GLU A 1 49  ? 110.083 54.441 92.907  1.00 45.40 ? 137 GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 49  ? 111.161 54.835 93.412  1.00 45.72 ? 137 GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 49  ? 108.997 54.375 93.534  1.00 46.25 ? 137 GLU A OE2 1 
ATOM   365  N N   . PHE A 1 50  ? 112.601 50.563 90.115  1.00 39.15 ? 138 PHE A N   1 
ATOM   366  C CA  . PHE A 1 50  ? 113.776 49.715 90.104  1.00 38.57 ? 138 PHE A CA  1 
ATOM   367  C C   . PHE A 1 50  ? 114.378 49.449 88.740  1.00 38.33 ? 138 PHE A C   1 
ATOM   368  O O   . PHE A 1 50  ? 115.382 48.754 88.649  1.00 39.09 ? 138 PHE A O   1 
ATOM   369  C CB  . PHE A 1 50  ? 113.474 48.381 90.785  1.00 38.70 ? 138 PHE A CB  1 
ATOM   370  C CG  . PHE A 1 50  ? 113.034 48.510 92.221  1.00 37.69 ? 138 PHE A CG  1 
ATOM   371  C CD1 . PHE A 1 50  ? 113.360 49.641 92.969  1.00 36.75 ? 138 PHE A CD1 1 
ATOM   372  C CD2 . PHE A 1 50  ? 112.378 47.452 92.854  1.00 36.82 ? 138 PHE A CD2 1 
ATOM   373  C CE1 . PHE A 1 50  ? 113.051 49.711 94.330  1.00 36.66 ? 138 PHE A CE1 1 
ATOM   374  C CE2 . PHE A 1 50  ? 112.066 47.514 94.216  1.00 36.79 ? 138 PHE A CE2 1 
ATOM   375  C CZ  . PHE A 1 50  ? 112.402 48.643 94.956  1.00 36.42 ? 138 PHE A CZ  1 
ATOM   376  N N   . MET A 1 51  ? 113.778 49.981 87.678  1.00 38.52 ? 139 MET A N   1 
ATOM   377  C CA  . MET A 1 51  ? 114.330 49.767 86.338  1.00 39.27 ? 139 MET A CA  1 
ATOM   378  C C   . MET A 1 51  ? 115.055 51.008 85.836  1.00 40.05 ? 139 MET A C   1 
ATOM   379  O O   . MET A 1 51  ? 115.428 51.100 84.660  1.00 39.17 ? 139 MET A O   1 
ATOM   380  C CB  . MET A 1 51  ? 113.240 49.375 85.332  1.00 38.20 ? 139 MET A CB  1 
ATOM   381  C CG  . MET A 1 51  ? 112.584 48.037 85.592  1.00 36.66 ? 139 MET A CG  1 
ATOM   382  S SD  . MET A 1 51  ? 111.499 47.570 84.253  1.00 35.45 ? 139 MET A SD  1 
ATOM   383  C CE  . MET A 1 51  ? 110.414 48.976 84.195  1.00 34.93 ? 139 MET A CE  1 
ATOM   384  N N   . ARG A 1 52  ? 115.250 51.960 86.743  1.00 41.43 ? 140 ARG A N   1 
ATOM   385  C CA  . ARG A 1 52  ? 115.937 53.204 86.416  1.00 42.93 ? 140 ARG A CA  1 
ATOM   386  C C   . ARG A 1 52  ? 117.452 53.049 86.306  1.00 43.46 ? 140 ARG A C   1 
ATOM   387  O O   . ARG A 1 52  ? 118.029 52.089 86.824  1.00 43.76 ? 140 ARG A O   1 
ATOM   388  C CB  . ARG A 1 52  ? 115.580 54.272 87.443  1.00 43.43 ? 140 ARG A CB  1 
ATOM   389  C CG  . ARG A 1 52  ? 114.130 54.711 87.335  1.00 44.28 ? 140 ARG A CG  1 
ATOM   390  C CD  . ARG A 1 52  ? 113.716 55.660 88.445  1.00 45.29 ? 140 ARG A CD  1 
ATOM   391  N NE  . ARG A 1 52  ? 112.333 56.101 88.268  1.00 46.53 ? 140 ARG A NE  1 
ATOM   392  C CZ  . ARG A 1 52  ? 111.626 56.783 89.174  1.00 47.31 ? 140 ARG A CZ  1 
ATOM   393  N NH1 . ARG A 1 52  ? 112.155 57.117 90.347  1.00 47.29 ? 140 ARG A NH1 1 
ATOM   394  N NH2 . ARG A 1 52  ? 110.375 57.125 88.904  1.00 47.36 ? 140 ARG A NH2 1 
ATOM   395  N N   . GLU A 1 53  ? 118.074 54.003 85.615  1.00 43.74 ? 141 GLU A N   1 
ATOM   396  C CA  . GLU A 1 53  ? 119.517 54.032 85.371  1.00 44.66 ? 141 GLU A CA  1 
ATOM   397  C C   . GLU A 1 53  ? 120.451 53.629 86.526  1.00 44.72 ? 141 GLU A C   1 
ATOM   398  O O   . GLU A 1 53  ? 121.225 52.672 86.417  1.00 44.05 ? 141 GLU A O   1 
ATOM   399  C CB  . GLU A 1 53  ? 119.907 55.434 84.874  1.00 44.56 ? 141 GLU A CB  1 
ATOM   400  C CG  . GLU A 1 53  ? 121.407 55.644 84.659  1.00 46.27 ? 141 GLU A CG  1 
ATOM   401  N N   . ASN A 1 54  ? 120.374 54.372 87.625  1.00 45.27 ? 142 ASN A N   1 
ATOM   402  C CA  . ASN A 1 54  ? 121.230 54.146 88.789  1.00 45.69 ? 142 ASN A CA  1 
ATOM   403  C C   . ASN A 1 54  ? 121.012 52.872 89.592  1.00 44.92 ? 142 ASN A C   1 
ATOM   404  O O   . ASN A 1 54  ? 121.890 52.475 90.357  1.00 45.75 ? 142 ASN A O   1 
ATOM   405  C CB  . ASN A 1 54  ? 121.122 55.333 89.733  1.00 46.47 ? 142 ASN A CB  1 
ATOM   406  C CG  . ASN A 1 54  ? 119.690 55.746 89.955  1.00 48.60 ? 142 ASN A CG  1 
ATOM   407  O OD1 . ASN A 1 54  ? 118.807 54.899 90.118  1.00 49.79 ? 142 ASN A OD1 1 
ATOM   408  N ND2 . ASN A 1 54  ? 119.447 57.053 89.975  1.00 49.45 ? 142 ASN A ND2 1 
ATOM   409  N N   . GLN A 1 55  ? 119.857 52.240 89.435  1.00 43.54 ? 143 GLN A N   1 
ATOM   410  C CA  . GLN A 1 55  ? 119.557 51.011 90.166  1.00 42.30 ? 143 GLN A CA  1 
ATOM   411  C C   . GLN A 1 55  ? 120.500 49.837 89.869  1.00 41.14 ? 143 GLN A C   1 
ATOM   412  O O   . GLN A 1 55  ? 120.988 49.681 88.744  1.00 41.12 ? 143 GLN A O   1 
ATOM   413  C CB  . GLN A 1 55  ? 118.132 50.575 89.846  1.00 42.35 ? 143 GLN A CB  1 
ATOM   414  C CG  . GLN A 1 55  ? 117.098 51.555 90.280  1.00 42.83 ? 143 GLN A CG  1 
ATOM   415  C CD  . GLN A 1 55  ? 117.143 51.786 91.769  1.00 43.52 ? 143 GLN A CD  1 
ATOM   416  O OE1 . GLN A 1 55  ? 117.139 50.843 92.558  1.00 44.54 ? 143 GLN A OE1 1 
ATOM   417  N NE2 . GLN A 1 55  ? 117.178 53.041 92.163  1.00 43.96 ? 143 GLN A NE2 1 
ATOM   418  N N   . PRO A 1 56  ? 120.772 49.000 90.887  1.00 39.62 ? 144 PRO A N   1 
ATOM   419  C CA  . PRO A 1 56  ? 121.642 47.834 90.721  1.00 38.97 ? 144 PRO A CA  1 
ATOM   420  C C   . PRO A 1 56  ? 121.028 46.948 89.643  1.00 38.49 ? 144 PRO A C   1 
ATOM   421  O O   . PRO A 1 56  ? 119.807 46.808 89.574  1.00 38.00 ? 144 PRO A O   1 
ATOM   422  C CB  . PRO A 1 56  ? 121.590 47.184 92.103  1.00 38.80 ? 144 PRO A CB  1 
ATOM   423  C CG  . PRO A 1 56  ? 121.436 48.381 93.001  1.00 39.22 ? 144 PRO A CG  1 
ATOM   424  C CD  . PRO A 1 56  ? 120.309 49.087 92.275  1.00 39.09 ? 144 PRO A CD  1 
ATOM   425  N N   . GLU A 1 57  ? 121.870 46.356 88.802  1.00 38.16 ? 145 GLU A N   1 
ATOM   426  C CA  . GLU A 1 57  ? 121.379 45.515 87.726  1.00 38.15 ? 145 GLU A CA  1 
ATOM   427  C C   . GLU A 1 57  ? 120.487 44.347 88.190  1.00 37.67 ? 145 GLU A C   1 
ATOM   428  O O   . GLU A 1 57  ? 119.505 44.021 87.513  1.00 37.78 ? 145 GLU A O   1 
ATOM   429  C CB  . GLU A 1 57  ? 122.576 45.030 86.888  1.00 39.28 ? 145 GLU A CB  1 
ATOM   430  C CG  . GLU A 1 57  ? 122.253 44.113 85.711  1.00 40.68 ? 145 GLU A CG  1 
ATOM   431  C CD  . GLU A 1 57  ? 123.339 44.143 84.642  1.00 41.69 ? 145 GLU A CD  1 
ATOM   432  O OE1 . GLU A 1 57  ? 123.409 45.162 83.911  1.00 41.81 ? 145 GLU A OE1 1 
ATOM   433  O OE2 . GLU A 1 57  ? 124.125 43.165 84.543  1.00 42.45 ? 145 GLU A OE2 1 
ATOM   434  N N   . MET A 1 58  ? 120.788 43.741 89.342  1.00 36.19 ? 146 MET A N   1 
ATOM   435  C CA  . MET A 1 58  ? 119.986 42.609 89.816  1.00 34.96 ? 146 MET A CA  1 
ATOM   436  C C   . MET A 1 58  ? 118.562 43.023 90.105  1.00 33.53 ? 146 MET A C   1 
ATOM   437  O O   . MET A 1 58  ? 117.603 42.305 89.806  1.00 33.57 ? 146 MET A O   1 
ATOM   438  C CB  . MET A 1 58  ? 120.570 41.996 91.092  1.00 35.70 ? 146 MET A CB  1 
ATOM   439  C CG  . MET A 1 58  ? 119.917 40.671 91.496  1.00 35.16 ? 146 MET A CG  1 
ATOM   440  S SD  . MET A 1 58  ? 120.502 39.262 90.521  1.00 37.03 ? 146 MET A SD  1 
ATOM   441  C CE  . MET A 1 58  ? 120.108 39.710 88.871  1.00 36.52 ? 146 MET A CE  1 
ATOM   442  N N   . LEU A 1 59  ? 118.440 44.190 90.712  1.00 32.32 ? 147 LEU A N   1 
ATOM   443  C CA  . LEU A 1 59  ? 117.157 44.759 91.073  1.00 31.00 ? 147 LEU A CA  1 
ATOM   444  C C   . LEU A 1 59  ? 116.349 45.128 89.825  1.00 30.67 ? 147 LEU A C   1 
ATOM   445  O O   . LEU A 1 59  ? 115.123 45.115 89.850  1.00 30.64 ? 147 LEU A O   1 
ATOM   446  C CB  . LEU A 1 59  ? 117.386 45.996 91.920  1.00 30.44 ? 147 LEU A CB  1 
ATOM   447  C CG  . LEU A 1 59  ? 116.151 46.482 92.659  1.00 30.81 ? 147 LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 59  ? 115.783 45.462 93.747  1.00 29.40 ? 147 LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 59  ? 116.431 47.855 93.266  1.00 29.39 ? 147 LEU A CD2 1 
ATOM   450  N N   . GLN A 1 60  ? 117.045 45.469 88.742  1.00 30.42 ? 148 GLN A N   1 
ATOM   451  C CA  . GLN A 1 60  ? 116.404 45.817 87.474  1.00 29.94 ? 148 GLN A CA  1 
ATOM   452  C C   . GLN A 1 60  ? 115.839 44.578 86.791  1.00 30.02 ? 148 GLN A C   1 
ATOM   453  O O   . GLN A 1 60  ? 114.689 44.577 86.349  1.00 29.32 ? 148 GLN A O   1 
ATOM   454  C CB  . GLN A 1 60  ? 117.410 46.466 86.521  1.00 30.74 ? 148 GLN A CB  1 
ATOM   455  C CG  . GLN A 1 60  ? 117.843 47.876 86.865  1.00 29.84 ? 148 GLN A CG  1 
ATOM   456  C CD  . GLN A 1 60  ? 118.941 48.381 85.943  1.00 29.75 ? 148 GLN A CD  1 
ATOM   457  O OE1 . GLN A 1 60  ? 119.183 49.580 85.861  1.00 29.93 ? 148 GLN A OE1 1 
ATOM   458  N NE2 . GLN A 1 60  ? 119.624 47.466 85.264  1.00 29.35 ? 148 GLN A NE2 1 
ATOM   459  N N   . LEU A 1 61  ? 116.672 43.540 86.683  1.00 29.93 ? 149 LEU A N   1 
ATOM   460  C CA  . LEU A 1 61  ? 116.282 42.282 86.062  1.00 30.19 ? 149 LEU A CA  1 
ATOM   461  C C   . LEU A 1 61  ? 115.045 41.734 86.755  1.00 31.02 ? 149 LEU A C   1 
ATOM   462  O O   . LEU A 1 61  ? 114.024 41.450 86.118  1.00 30.24 ? 149 LEU A O   1 
ATOM   463  C CB  . LEU A 1 61  ? 117.414 41.254 86.186  1.00 30.61 ? 149 LEU A CB  1 
ATOM   464  C CG  . LEU A 1 61  ? 117.147 39.848 85.632  1.00 30.69 ? 149 LEU A CG  1 
ATOM   465  C CD1 . LEU A 1 61  ? 116.910 39.937 84.129  1.00 31.42 ? 149 LEU A CD1 1 
ATOM   466  C CD2 . LEU A 1 61  ? 118.318 38.948 85.917  1.00 30.28 ? 149 LEU A CD2 1 
ATOM   467  N N   . GLU A 1 62  ? 115.155 41.589 88.074  1.00 31.65 ? 150 GLU A N   1 
ATOM   468  C CA  . GLU A 1 62  ? 114.078 41.045 88.883  1.00 32.18 ? 150 GLU A CA  1 
ATOM   469  C C   . GLU A 1 62  ? 112.793 41.815 88.688  1.00 32.08 ? 150 GLU A C   1 
ATOM   470  O O   . GLU A 1 62  ? 111.748 41.239 88.380  1.00 33.17 ? 150 GLU A O   1 
ATOM   471  C CB  . GLU A 1 62  ? 114.471 41.063 90.360  1.00 33.50 ? 150 GLU A CB  1 
ATOM   472  C CG  . GLU A 1 62  ? 115.560 40.059 90.761  1.00 35.53 ? 150 GLU A CG  1 
ATOM   473  C CD  . GLU A 1 62  ? 115.128 38.616 90.547  1.00 36.36 ? 150 GLU A CD  1 
ATOM   474  O OE1 . GLU A 1 62  ? 113.950 38.316 90.847  1.00 38.03 ? 150 GLU A OE1 1 
ATOM   475  O OE2 . GLU A 1 62  ? 115.962 37.786 90.112  1.00 35.97 ? 150 GLU A OE2 1 
ATOM   476  N N   . ALA A 1 63  ? 112.868 43.126 88.867  1.00 30.80 ? 151 ALA A N   1 
ATOM   477  C CA  . ALA A 1 63  ? 111.694 43.968 88.713  1.00 29.03 ? 151 ALA A CA  1 
ATOM   478  C C   . ALA A 1 63  ? 111.048 43.755 87.342  1.00 28.50 ? 151 ALA A C   1 
ATOM   479  O O   . ALA A 1 63  ? 109.861 43.460 87.243  1.00 28.62 ? 151 ALA A O   1 
ATOM   480  C CB  . ALA A 1 63  ? 112.081 45.421 88.901  1.00 28.65 ? 151 ALA A CB  1 
ATOM   481  N N   . ALA A 1 64  ? 111.833 43.895 86.281  1.00 27.98 ? 152 ALA A N   1 
ATOM   482  C CA  . ALA A 1 64  ? 111.322 43.716 84.928  1.00 27.09 ? 152 ALA A CA  1 
ATOM   483  C C   . ALA A 1 64  ? 110.648 42.369 84.756  1.00 26.21 ? 152 ALA A C   1 
ATOM   484  O O   . ALA A 1 64  ? 109.641 42.260 84.080  1.00 26.13 ? 152 ALA A O   1 
ATOM   485  C CB  . ALA A 1 64  ? 112.466 43.867 83.910  1.00 27.57 ? 152 ALA A CB  1 
ATOM   486  N N   . TRP A 1 65  ? 111.212 41.340 85.373  1.00 26.61 ? 153 TRP A N   1 
ATOM   487  C CA  . TRP A 1 65  ? 110.665 39.990 85.277  1.00 25.82 ? 153 TRP A CA  1 
ATOM   488  C C   . TRP A 1 65  ? 109.250 39.991 85.831  1.00 24.85 ? 153 TRP A C   1 
ATOM   489  O O   . TRP A 1 65  ? 108.302 39.602 85.153  1.00 24.43 ? 153 TRP A O   1 
ATOM   490  C CB  . TRP A 1 65  ? 111.537 39.009 86.074  1.00 26.15 ? 153 TRP A CB  1 
ATOM   491  C CG  . TRP A 1 65  ? 111.161 37.559 85.907  1.00 26.78 ? 153 TRP A CG  1 
ATOM   492  C CD1 . TRP A 1 65  ? 109.930 37.060 85.565  1.00 26.88 ? 153 TRP A CD1 1 
ATOM   493  C CD2 . TRP A 1 65  ? 111.984 36.423 86.198  1.00 27.03 ? 153 TRP A CD2 1 
ATOM   494  N NE1 . TRP A 1 65  ? 109.933 35.689 85.629  1.00 26.86 ? 153 TRP A NE1 1 
ATOM   495  C CE2 . TRP A 1 65  ? 111.176 35.266 86.019  1.00 26.69 ? 153 TRP A CE2 1 
ATOM   496  C CE3 . TRP A 1 65  ? 113.321 36.264 86.599  1.00 26.42 ? 153 TRP A CE3 1 
ATOM   497  C CZ2 . TRP A 1 65  ? 111.666 33.964 86.222  1.00 26.95 ? 153 TRP A CZ2 1 
ATOM   498  C CZ3 . TRP A 1 65  ? 113.809 34.972 86.805  1.00 26.69 ? 153 TRP A CZ3 1 
ATOM   499  C CH2 . TRP A 1 65  ? 112.982 33.836 86.604  1.00 27.17 ? 153 TRP A CH2 1 
ATOM   500  N N   . ALA A 1 66  ? 109.107 40.427 87.073  1.00 24.64 ? 154 ALA A N   1 
ATOM   501  C CA  . ALA A 1 66  ? 107.790 40.460 87.688  1.00 24.91 ? 154 ALA A CA  1 
ATOM   502  C C   . ALA A 1 66  ? 106.822 41.249 86.812  1.00 25.22 ? 154 ALA A C   1 
ATOM   503  O O   . ALA A 1 66  ? 105.712 40.797 86.539  1.00 24.95 ? 154 ALA A O   1 
ATOM   504  C CB  . ALA A 1 66  ? 107.881 41.076 89.061  1.00 25.01 ? 154 ALA A CB  1 
ATOM   505  N N   . LEU A 1 67  ? 107.260 42.429 86.369  1.00 25.50 ? 155 LEU A N   1 
ATOM   506  C CA  . LEU A 1 67  ? 106.449 43.287 85.513  1.00 25.38 ? 155 LEU A CA  1 
ATOM   507  C C   . LEU A 1 67  ? 106.077 42.676 84.172  1.00 25.99 ? 155 LEU A C   1 
ATOM   508  O O   . LEU A 1 67  ? 104.993 42.965 83.656  1.00 26.90 ? 155 LEU A O   1 
ATOM   509  C CB  . LEU A 1 67  ? 107.147 44.623 85.266  1.00 25.62 ? 155 LEU A CB  1 
ATOM   510  C CG  . LEU A 1 67  ? 107.103 45.679 86.375  1.00 25.16 ? 155 LEU A CG  1 
ATOM   511  C CD1 . LEU A 1 67  ? 107.958 46.872 85.989  1.00 24.66 ? 155 LEU A CD1 1 
ATOM   512  C CD2 . LEU A 1 67  ? 105.664 46.104 86.604  1.00 24.22 ? 155 LEU A CD2 1 
ATOM   513  N N   . THR A 1 68  ? 106.955 41.853 83.595  1.00 25.67 ? 156 THR A N   1 
ATOM   514  C CA  . THR A 1 68  ? 106.638 41.230 82.315  1.00 26.71 ? 156 THR A CA  1 
ATOM   515  C C   . THR A 1 68  ? 105.457 40.258 82.511  1.00 26.49 ? 156 THR A C   1 
ATOM   516  O O   . THR A 1 68  ? 104.528 40.221 81.702  1.00 25.97 ? 156 THR A O   1 
ATOM   517  C CB  . THR A 1 68  ? 107.864 40.470 81.701  1.00 27.85 ? 156 THR A CB  1 
ATOM   518  O OG1 . THR A 1 68  ? 108.229 39.379 82.544  1.00 32.04 ? 156 THR A OG1 1 
ATOM   519  C CG2 . THR A 1 68  ? 109.076 41.368 81.586  1.00 27.53 ? 156 THR A CG2 1 
ATOM   520  N N   . ASN A 1 69  ? 105.473 39.493 83.597  1.00 26.85 ? 157 ASN A N   1 
ATOM   521  C CA  . ASN A 1 69  ? 104.382 38.561 83.860  1.00 27.73 ? 157 ASN A CA  1 
ATOM   522  C C   . ASN A 1 69  ? 103.079 39.256 84.247  1.00 28.22 ? 157 ASN A C   1 
ATOM   523  O O   . ASN A 1 69  ? 101.983 38.741 83.991  1.00 28.77 ? 157 ASN A O   1 
ATOM   524  C CB  . ASN A 1 69  ? 104.768 37.543 84.936  1.00 27.80 ? 157 ASN A CB  1 
ATOM   525  C CG  . ASN A 1 69  ? 105.864 36.616 84.476  1.00 28.41 ? 157 ASN A CG  1 
ATOM   526  O OD1 . ASN A 1 69  ? 106.085 36.448 83.277  1.00 28.53 ? 157 ASN A OD1 1 
ATOM   527  N ND2 . ASN A 1 69  ? 106.540 35.985 85.422  1.00 29.39 ? 157 ASN A ND2 1 
ATOM   528  N N   . ILE A 1 70  ? 103.174 40.418 84.880  1.00 28.41 ? 158 ILE A N   1 
ATOM   529  C CA  . ILE A 1 70  ? 101.951 41.125 85.211  1.00 28.53 ? 158 ILE A CA  1 
ATOM   530  C C   . ILE A 1 70  ? 101.356 41.563 83.875  1.00 28.24 ? 158 ILE A C   1 
ATOM   531  O O   . ILE A 1 70  ? 100.142 41.627 83.722  1.00 27.39 ? 158 ILE A O   1 
ATOM   532  C CB  . ILE A 1 70  ? 102.211 42.378 86.094  1.00 28.95 ? 158 ILE A CB  1 
ATOM   533  C CG1 . ILE A 1 70  ? 102.730 41.950 87.470  1.00 28.84 ? 158 ILE A CG1 1 
ATOM   534  C CG2 . ILE A 1 70  ? 100.925 43.208 86.228  1.00 27.75 ? 158 ILE A CG2 1 
ATOM   535  C CD1 . ILE A 1 70  ? 102.919 43.100 88.428  1.00 29.30 ? 158 ILE A CD1 1 
ATOM   536  N N   . ALA A 1 71  ? 102.230 41.840 82.907  1.00 28.37 ? 159 ALA A N   1 
ATOM   537  C CA  . ALA A 1 71  ? 101.804 42.278 81.577  1.00 28.68 ? 159 ALA A CA  1 
ATOM   538  C C   . ALA A 1 71  ? 101.396 41.138 80.654  1.00 28.47 ? 159 ALA A C   1 
ATOM   539  O O   . ALA A 1 71  ? 101.124 41.364 79.480  1.00 29.07 ? 159 ALA A O   1 
ATOM   540  C CB  . ALA A 1 71  ? 102.910 43.108 80.916  1.00 27.88 ? 159 ALA A CB  1 
ATOM   541  N N   . SER A 1 72  ? 101.358 39.920 81.178  1.00 28.54 ? 160 SER A N   1 
ATOM   542  C CA  . SER A 1 72  ? 100.973 38.765 80.375  1.00 28.94 ? 160 SER A CA  1 
ATOM   543  C C   . SER A 1 72  ? 99.537  38.366 80.678  1.00 29.11 ? 160 SER A C   1 
ATOM   544  O O   . SER A 1 72  ? 99.067  37.331 80.226  1.00 28.93 ? 160 SER A O   1 
ATOM   545  C CB  . SER A 1 72  ? 101.908 37.592 80.646  1.00 29.04 ? 160 SER A CB  1 
ATOM   546  O OG  . SER A 1 72  ? 101.880 37.226 82.013  1.00 29.29 ? 160 SER A OG  1 
ATOM   547  N N   . GLY A 1 73  ? 98.852  39.213 81.442  1.00 29.72 ? 161 GLY A N   1 
ATOM   548  C CA  . GLY A 1 73  ? 97.471  38.969 81.806  1.00 30.12 ? 161 GLY A CA  1 
ATOM   549  C C   . GLY A 1 73  ? 96.486  39.545 80.809  1.00 31.31 ? 161 GLY A C   1 
ATOM   550  O O   . GLY A 1 73  ? 96.672  39.435 79.593  1.00 31.65 ? 161 GLY A O   1 
ATOM   551  N N   . THR A 1 74  ? 95.431  40.161 81.327  1.00 31.53 ? 162 THR A N   1 
ATOM   552  C CA  . THR A 1 74  ? 94.394  40.747 80.493  1.00 32.43 ? 162 THR A CA  1 
ATOM   553  C C   . THR A 1 74  ? 94.793  42.145 80.051  1.00 33.34 ? 162 THR A C   1 
ATOM   554  O O   . THR A 1 74  ? 95.801  42.679 80.516  1.00 34.03 ? 162 THR A O   1 
ATOM   555  C CB  . THR A 1 74  ? 93.077  40.833 81.278  1.00 32.76 ? 162 THR A CB  1 
ATOM   556  O OG1 . THR A 1 74  ? 93.278  41.622 82.457  1.00 33.10 ? 162 THR A OG1 1 
ATOM   557  C CG2 . THR A 1 74  ? 92.619  39.457 81.698  1.00 32.09 ? 162 THR A CG2 1 
ATOM   558  N N   . SER A 1 75  ? 94.013  42.743 79.154  1.00 34.18 ? 163 SER A N   1 
ATOM   559  C CA  . SER A 1 75  ? 94.306  44.105 78.697  1.00 34.80 ? 163 SER A CA  1 
ATOM   560  C C   . SER A 1 75  ? 94.209  45.040 79.887  1.00 35.26 ? 163 SER A C   1 
ATOM   561  O O   . SER A 1 75  ? 94.905  46.051 79.956  1.00 36.41 ? 163 SER A O   1 
ATOM   562  C CB  . SER A 1 75  ? 93.315  44.583 77.627  1.00 34.33 ? 163 SER A CB  1 
ATOM   563  O OG  . SER A 1 75  ? 93.448  43.865 76.416  1.00 35.61 ? 163 SER A OG  1 
ATOM   564  N N   . ALA A 1 76  ? 93.332  44.712 80.823  1.00 35.39 ? 164 ALA A N   1 
ATOM   565  C CA  . ALA A 1 76  ? 93.171  45.552 82.001  1.00 35.76 ? 164 ALA A CA  1 
ATOM   566  C C   . ALA A 1 76  ? 94.460  45.503 82.829  1.00 35.68 ? 164 ALA A C   1 
ATOM   567  O O   . ALA A 1 76  ? 94.954  46.531 83.293  1.00 34.88 ? 164 ALA A O   1 
ATOM   568  C CB  . ALA A 1 76  ? 91.976  45.071 82.828  1.00 35.14 ? 164 ALA A CB  1 
ATOM   569  N N   . GLN A 1 77  ? 95.001  44.296 82.983  1.00 36.08 ? 165 GLN A N   1 
ATOM   570  C CA  . GLN A 1 77  ? 96.223  44.073 83.748  1.00 36.21 ? 165 GLN A CA  1 
ATOM   571  C C   . GLN A 1 77  ? 97.463  44.632 83.052  1.00 35.86 ? 165 GLN A C   1 
ATOM   572  O O   . GLN A 1 77  ? 98.396  45.082 83.715  1.00 36.57 ? 165 GLN A O   1 
ATOM   573  C CB  . GLN A 1 77  ? 96.387  42.579 84.025  1.00 35.58 ? 165 GLN A CB  1 
ATOM   574  C CG  . GLN A 1 77  ? 95.152  41.993 84.687  1.00 36.15 ? 165 GLN A CG  1 
ATOM   575  C CD  . GLN A 1 77  ? 95.301  40.541 85.089  1.00 36.34 ? 165 GLN A CD  1 
ATOM   576  O OE1 . GLN A 1 77  ? 95.624  39.672 84.270  1.00 36.74 ? 165 GLN A OE1 1 
ATOM   577  N NE2 . GLN A 1 77  ? 95.047  40.266 86.357  1.00 36.23 ? 165 GLN A NE2 1 
ATOM   578  N N   . THR A 1 78  ? 97.469  44.615 81.723  1.00 34.91 ? 166 THR A N   1 
ATOM   579  C CA  . THR A 1 78  ? 98.604  45.146 80.972  1.00 34.19 ? 166 THR A CA  1 
ATOM   580  C C   . THR A 1 78  ? 98.598  46.671 81.021  1.00 33.48 ? 166 THR A C   1 
ATOM   581  O O   . THR A 1 78  ? 99.648  47.306 80.928  1.00 33.84 ? 166 THR A O   1 
ATOM   582  C CB  . THR A 1 78  ? 98.567  44.691 79.491  1.00 34.56 ? 166 THR A CB  1 
ATOM   583  O OG1 . THR A 1 78  ? 98.592  43.258 79.427  1.00 35.35 ? 166 THR A OG1 1 
ATOM   584  C CG2 . THR A 1 78  ? 99.768  45.231 78.735  1.00 33.90 ? 166 THR A CG2 1 
ATOM   585  N N   . LYS A 1 79  ? 97.409  47.249 81.174  1.00 32.67 ? 167 LYS A N   1 
ATOM   586  C CA  . LYS A 1 79  ? 97.245  48.700 81.235  1.00 31.45 ? 167 LYS A CA  1 
ATOM   587  C C   . LYS A 1 79  ? 97.835  49.272 82.513  1.00 30.47 ? 167 LYS A C   1 
ATOM   588  O O   . LYS A 1 79  ? 98.347  50.388 82.514  1.00 30.81 ? 167 LYS A O   1 
ATOM   589  C CB  . LYS A 1 79  ? 95.758  49.076 81.142  1.00 32.63 ? 167 LYS A CB  1 
ATOM   590  C CG  . LYS A 1 79  ? 95.441  50.560 81.411  1.00 32.40 ? 167 LYS A CG  1 
ATOM   591  C CD  . LYS A 1 79  ? 93.946  50.838 81.275  1.00 32.92 ? 167 LYS A CD  1 
ATOM   592  C CE  . LYS A 1 79  ? 93.556  52.228 81.770  1.00 33.74 ? 167 LYS A CE  1 
ATOM   593  N NZ  . LYS A 1 79  ? 94.227  53.335 81.030  1.00 35.67 ? 167 LYS A NZ  1 
ATOM   594  N N   . VAL A 1 80  ? 97.765  48.517 83.600  1.00 28.85 ? 168 VAL A N   1 
ATOM   595  C CA  . VAL A 1 80  ? 98.325  48.990 84.853  1.00 28.00 ? 168 VAL A CA  1 
ATOM   596  C C   . VAL A 1 80  ? 99.824  49.235 84.671  1.00 27.94 ? 168 VAL A C   1 
ATOM   597  O O   . VAL A 1 80  ? 100.359 50.254 85.123  1.00 27.91 ? 168 VAL A O   1 
ATOM   598  C CB  . VAL A 1 80  ? 98.117  47.966 85.986  1.00 28.65 ? 168 VAL A CB  1 
ATOM   599  C CG1 . VAL A 1 80  ? 98.754  48.475 87.267  1.00 28.08 ? 168 VAL A CG1 1 
ATOM   600  C CG2 . VAL A 1 80  ? 96.634  47.713 86.206  1.00 27.64 ? 168 VAL A CG2 1 
ATOM   601  N N   . VAL A 1 81  ? 100.500 48.304 84.001  1.00 26.96 ? 169 VAL A N   1 
ATOM   602  C CA  . VAL A 1 81  ? 101.938 48.431 83.758  1.00 26.65 ? 169 VAL A CA  1 
ATOM   603  C C   . VAL A 1 81  ? 102.257 49.554 82.751  1.00 26.53 ? 169 VAL A C   1 
ATOM   604  O O   . VAL A 1 81  ? 103.224 50.291 82.919  1.00 25.58 ? 169 VAL A O   1 
ATOM   605  C CB  . VAL A 1 81  ? 102.538 47.068 83.264  1.00 26.05 ? 169 VAL A CB  1 
ATOM   606  C CG1 . VAL A 1 81  ? 103.998 47.219 82.909  1.00 24.65 ? 169 VAL A CG1 1 
ATOM   607  C CG2 . VAL A 1 81  ? 102.398 46.032 84.347  1.00 25.77 ? 169 VAL A CG2 1 
ATOM   608  N N   . VAL A 1 82  ? 101.447 49.678 81.706  1.00 26.84 ? 170 VAL A N   1 
ATOM   609  C CA  . VAL A 1 82  ? 101.671 50.715 80.712  1.00 28.14 ? 170 VAL A CA  1 
ATOM   610  C C   . VAL A 1 82  ? 101.387 52.104 81.273  1.00 29.29 ? 170 VAL A C   1 
ATOM   611  O O   . VAL A 1 82  ? 102.074 53.067 80.926  1.00 29.05 ? 170 VAL A O   1 
ATOM   612  C CB  . VAL A 1 82  ? 100.797 50.501 79.462  1.00 28.61 ? 170 VAL A CB  1 
ATOM   613  C CG1 . VAL A 1 82  ? 100.953 51.685 78.504  1.00 26.70 ? 170 VAL A CG1 1 
ATOM   614  C CG2 . VAL A 1 82  ? 101.196 49.188 78.771  1.00 27.64 ? 170 VAL A CG2 1 
ATOM   615  N N   . ASP A 1 83  ? 100.373 52.207 82.136  1.00 30.17 ? 171 ASP A N   1 
ATOM   616  C CA  . ASP A 1 83  ? 100.033 53.489 82.750  1.00 30.81 ? 171 ASP A CA  1 
ATOM   617  C C   . ASP A 1 83  ? 101.059 53.925 83.780  1.00 30.31 ? 171 ASP A C   1 
ATOM   618  O O   . ASP A 1 83  ? 101.033 55.068 84.229  1.00 30.37 ? 171 ASP A O   1 
ATOM   619  C CB  . ASP A 1 83  ? 98.669  53.454 83.449  1.00 32.38 ? 171 ASP A CB  1 
ATOM   620  C CG  . ASP A 1 83  ? 97.509  53.402 82.483  1.00 33.89 ? 171 ASP A CG  1 
ATOM   621  O OD1 . ASP A 1 83  ? 97.559  54.083 81.432  1.00 35.43 ? 171 ASP A OD1 1 
ATOM   622  O OD2 . ASP A 1 83  ? 96.525  52.705 82.796  1.00 35.05 ? 171 ASP A OD2 1 
ATOM   623  N N   . ALA A 1 84  ? 101.941 53.015 84.177  1.00 30.08 ? 172 ALA A N   1 
ATOM   624  C CA  . ALA A 1 84  ? 102.962 53.349 85.154  1.00 30.00 ? 172 ALA A CA  1 
ATOM   625  C C   . ALA A 1 84  ? 104.238 53.846 84.483  1.00 30.45 ? 172 ALA A C   1 
ATOM   626  O O   . ALA A 1 84  ? 105.237 54.057 85.150  1.00 30.47 ? 172 ALA A O   1 
ATOM   627  C CB  . ALA A 1 84  ? 103.256 52.151 86.031  1.00 29.46 ? 172 ALA A CB  1 
ATOM   628  N N   . ASP A 1 85  ? 104.188 54.042 83.167  1.00 31.41 ? 173 ASP A N   1 
ATOM   629  C CA  . ASP A 1 85  ? 105.328 54.525 82.384  1.00 32.41 ? 173 ASP A CA  1 
ATOM   630  C C   . ASP A 1 85  ? 106.486 53.543 82.287  1.00 32.79 ? 173 ASP A C   1 
ATOM   631  O O   . ASP A 1 85  ? 107.645 53.954 82.167  1.00 33.84 ? 173 ASP A O   1 
ATOM   632  C CB  . ASP A 1 85  ? 105.871 55.849 82.939  1.00 33.84 ? 173 ASP A CB  1 
ATOM   633  C CG  . ASP A 1 85  ? 104.986 57.042 82.613  1.00 35.11 ? 173 ASP A CG  1 
ATOM   634  O OD1 . ASP A 1 85  ? 104.631 57.229 81.429  1.00 36.88 ? 173 ASP A OD1 1 
ATOM   635  O OD2 . ASP A 1 85  ? 104.667 57.811 83.533  1.00 35.20 ? 173 ASP A OD2 1 
ATOM   636  N N   . ALA A 1 86  ? 106.180 52.251 82.319  1.00 31.91 ? 174 ALA A N   1 
ATOM   637  C CA  . ALA A 1 86  ? 107.211 51.232 82.229  1.00 30.44 ? 174 ALA A CA  1 
ATOM   638  C C   . ALA A 1 86  ? 107.820 51.110 80.835  1.00 29.66 ? 174 ALA A C   1 
ATOM   639  O O   . ALA A 1 86  ? 109.005 50.783 80.691  1.00 29.41 ? 174 ALA A O   1 
ATOM   640  C CB  . ALA A 1 86  ? 106.642 49.881 82.673  1.00 30.42 ? 174 ALA A CB  1 
ATOM   641  N N   . VAL A 1 87  ? 107.032 51.391 79.803  1.00 28.86 ? 175 VAL A N   1 
ATOM   642  C CA  . VAL A 1 87  ? 107.548 51.239 78.447  1.00 28.94 ? 175 VAL A CA  1 
ATOM   643  C C   . VAL A 1 87  ? 108.847 51.982 78.122  1.00 29.28 ? 175 VAL A C   1 
ATOM   644  O O   . VAL A 1 87  ? 109.805 51.378 77.631  1.00 29.78 ? 175 VAL A O   1 
ATOM   645  C CB  . VAL A 1 87  ? 106.467 51.568 77.408  1.00 28.52 ? 175 VAL A CB  1 
ATOM   646  C CG1 . VAL A 1 87  ? 107.040 51.464 76.001  1.00 28.06 ? 175 VAL A CG1 1 
ATOM   647  C CG2 . VAL A 1 87  ? 105.324 50.583 77.552  1.00 27.43 ? 175 VAL A CG2 1 
ATOM   648  N N   . PRO A 1 88  ? 108.905 53.295 78.369  1.00 29.46 ? 176 PRO A N   1 
ATOM   649  C CA  . PRO A 1 88  ? 110.150 54.007 78.066  1.00 29.20 ? 176 PRO A CA  1 
ATOM   650  C C   . PRO A 1 88  ? 111.376 53.439 78.808  1.00 28.53 ? 176 PRO A C   1 
ATOM   651  O O   . PRO A 1 88  ? 112.496 53.466 78.288  1.00 28.82 ? 176 PRO A O   1 
ATOM   652  C CB  . PRO A 1 88  ? 109.801 55.451 78.439  1.00 29.39 ? 176 PRO A CB  1 
ATOM   653  C CG  . PRO A 1 88  ? 108.754 55.254 79.537  1.00 30.44 ? 176 PRO A CG  1 
ATOM   654  C CD  . PRO A 1 88  ? 107.889 54.239 78.860  1.00 29.60 ? 176 PRO A CD  1 
ATOM   655  N N   . LEU A 1 89  ? 111.169 52.913 80.013  1.00 28.15 ? 177 LEU A N   1 
ATOM   656  C CA  . LEU A 1 89  ? 112.275 52.314 80.771  1.00 28.05 ? 177 LEU A CA  1 
ATOM   657  C C   . LEU A 1 89  ? 112.723 50.960 80.193  1.00 28.13 ? 177 LEU A C   1 
ATOM   658  O O   . LEU A 1 89  ? 113.926 50.682 80.124  1.00 28.84 ? 177 LEU A O   1 
ATOM   659  C CB  . LEU A 1 89  ? 111.899 52.169 82.248  1.00 27.39 ? 177 LEU A CB  1 
ATOM   660  C CG  . LEU A 1 89  ? 111.805 53.540 82.931  1.00 27.39 ? 177 LEU A CG  1 
ATOM   661  C CD1 . LEU A 1 89  ? 111.383 53.380 84.360  1.00 26.55 ? 177 LEU A CD1 1 
ATOM   662  C CD2 . LEU A 1 89  ? 113.153 54.244 82.863  1.00 27.01 ? 177 LEU A CD2 1 
ATOM   663  N N   . PHE A 1 90  ? 111.773 50.122 79.779  1.00 26.78 ? 178 PHE A N   1 
ATOM   664  C CA  . PHE A 1 90  ? 112.117 48.837 79.162  1.00 26.15 ? 178 PHE A CA  1 
ATOM   665  C C   . PHE A 1 90  ? 113.048 49.094 77.979  1.00 25.92 ? 178 PHE A C   1 
ATOM   666  O O   . PHE A 1 90  ? 114.008 48.353 77.741  1.00 25.68 ? 178 PHE A O   1 
ATOM   667  C CB  . PHE A 1 90  ? 110.859 48.134 78.629  1.00 26.29 ? 178 PHE A CB  1 
ATOM   668  C CG  . PHE A 1 90  ? 110.009 47.494 79.688  1.00 25.65 ? 178 PHE A CG  1 
ATOM   669  C CD1 . PHE A 1 90  ? 110.588 46.907 80.811  1.00 25.36 ? 178 PHE A CD1 1 
ATOM   670  C CD2 . PHE A 1 90  ? 108.627 47.435 79.539  1.00 25.15 ? 178 PHE A CD2 1 
ATOM   671  C CE1 . PHE A 1 90  ? 109.800 46.265 81.772  1.00 26.07 ? 178 PHE A CE1 1 
ATOM   672  C CE2 . PHE A 1 90  ? 107.827 46.799 80.494  1.00 25.48 ? 178 PHE A CE2 1 
ATOM   673  C CZ  . PHE A 1 90  ? 108.413 46.212 81.613  1.00 25.83 ? 178 PHE A CZ  1 
ATOM   674  N N   . ILE A 1 91  ? 112.744 50.153 77.233  1.00 26.02 ? 179 ILE A N   1 
ATOM   675  C CA  . ILE A 1 91  ? 113.521 50.511 76.057  1.00 26.25 ? 179 ILE A CA  1 
ATOM   676  C C   . ILE A 1 91  ? 114.939 50.955 76.393  1.00 27.15 ? 179 ILE A C   1 
ATOM   677  O O   . ILE A 1 91  ? 115.880 50.646 75.665  1.00 27.40 ? 179 ILE A O   1 
ATOM   678  C CB  . ILE A 1 91  ? 112.791 51.598 75.232  1.00 24.66 ? 179 ILE A CB  1 
ATOM   679  C CG1 . ILE A 1 91  ? 111.482 51.016 74.698  1.00 24.05 ? 179 ILE A CG1 1 
ATOM   680  C CG2 . ILE A 1 91  ? 113.657 52.079 74.081  1.00 22.27 ? 179 ILE A CG2 1 
ATOM   681  C CD1 . ILE A 1 91  ? 110.675 51.957 73.853  1.00 24.30 ? 179 ILE A CD1 1 
ATOM   682  N N   . GLN A 1 92  ? 115.120 51.662 77.495  1.00 28.36 ? 180 GLN A N   1 
ATOM   683  C CA  . GLN A 1 92  ? 116.477 52.081 77.813  1.00 29.76 ? 180 GLN A CA  1 
ATOM   684  C C   . GLN A 1 92  ? 117.286 50.900 78.322  1.00 29.11 ? 180 GLN A C   1 
ATOM   685  O O   . GLN A 1 92  ? 118.517 50.907 78.269  1.00 28.85 ? 180 GLN A O   1 
ATOM   686  C CB  . GLN A 1 92  ? 116.487 53.222 78.831  1.00 31.40 ? 180 GLN A CB  1 
ATOM   687  C CG  . GLN A 1 92  ? 115.925 52.873 80.171  1.00 34.99 ? 180 GLN A CG  1 
ATOM   688  C CD  . GLN A 1 92  ? 116.073 54.021 81.156  1.00 37.03 ? 180 GLN A CD  1 
ATOM   689  O OE1 . GLN A 1 92  ? 115.654 55.157 80.882  1.00 35.92 ? 180 GLN A OE1 1 
ATOM   690  N NE2 . GLN A 1 92  ? 116.667 53.728 82.319  1.00 38.31 ? 180 GLN A NE2 1 
ATOM   691  N N   . LEU A 1 93  ? 116.595 49.873 78.805  1.00 28.71 ? 181 LEU A N   1 
ATOM   692  C CA  . LEU A 1 93  ? 117.299 48.695 79.277  1.00 27.97 ? 181 LEU A CA  1 
ATOM   693  C C   . LEU A 1 93  ? 117.841 47.884 78.101  1.00 28.11 ? 181 LEU A C   1 
ATOM   694  O O   . LEU A 1 93  ? 118.792 47.110 78.265  1.00 28.13 ? 181 LEU A O   1 
ATOM   695  C CB  . LEU A 1 93  ? 116.389 47.828 80.150  1.00 27.06 ? 181 LEU A CB  1 
ATOM   696  C CG  . LEU A 1 93  ? 116.099 48.364 81.559  1.00 26.04 ? 181 LEU A CG  1 
ATOM   697  C CD1 . LEU A 1 93  ? 115.150 47.409 82.312  1.00 24.36 ? 181 LEU A CD1 1 
ATOM   698  C CD2 . LEU A 1 93  ? 117.418 48.540 82.306  1.00 23.61 ? 181 LEU A CD2 1 
ATOM   699  N N   . LEU A 1 94  ? 117.246 48.057 76.919  1.00 27.74 ? 182 LEU A N   1 
ATOM   700  C CA  . LEU A 1 94  ? 117.719 47.332 75.747  1.00 28.30 ? 182 LEU A CA  1 
ATOM   701  C C   . LEU A 1 94  ? 119.098 47.867 75.381  1.00 29.10 ? 182 LEU A C   1 
ATOM   702  O O   . LEU A 1 94  ? 119.930 47.146 74.822  1.00 29.87 ? 182 LEU A O   1 
ATOM   703  C CB  . LEU A 1 94  ? 116.751 47.491 74.567  1.00 28.08 ? 182 LEU A CB  1 
ATOM   704  C CG  . LEU A 1 94  ? 115.341 46.893 74.691  1.00 28.02 ? 182 LEU A CG  1 
ATOM   705  C CD1 . LEU A 1 94  ? 114.523 47.212 73.451  1.00 27.72 ? 182 LEU A CD1 1 
ATOM   706  C CD2 . LEU A 1 94  ? 115.436 45.401 74.880  1.00 26.62 ? 182 LEU A CD2 1 
ATOM   707  N N   . TYR A 1 95  ? 119.347 49.131 75.709  1.00 29.05 ? 183 TYR A N   1 
ATOM   708  C CA  . TYR A 1 95  ? 120.639 49.739 75.428  1.00 29.46 ? 183 TYR A CA  1 
ATOM   709  C C   . TYR A 1 95  ? 121.671 49.404 76.512  1.00 30.09 ? 183 TYR A C   1 
ATOM   710  O O   . TYR A 1 95  ? 122.669 48.726 76.253  1.00 30.51 ? 183 TYR A O   1 
ATOM   711  C CB  . TYR A 1 95  ? 120.540 51.273 75.340  1.00 29.09 ? 183 TYR A CB  1 
ATOM   712  C CG  . TYR A 1 95  ? 119.940 51.857 74.078  1.00 29.39 ? 183 TYR A CG  1 
ATOM   713  C CD1 . TYR A 1 95  ? 120.677 51.903 72.892  1.00 29.41 ? 183 TYR A CD1 1 
ATOM   714  C CD2 . TYR A 1 95  ? 118.655 52.404 74.075  1.00 29.58 ? 183 TYR A CD2 1 
ATOM   715  C CE1 . TYR A 1 95  ? 120.158 52.479 71.734  1.00 29.51 ? 183 TYR A CE1 1 
ATOM   716  C CE2 . TYR A 1 95  ? 118.121 52.989 72.917  1.00 30.22 ? 183 TYR A CE2 1 
ATOM   717  C CZ  . TYR A 1 95  ? 118.885 53.023 71.750  1.00 30.40 ? 183 TYR A CZ  1 
ATOM   718  O OH  . TYR A 1 95  ? 118.388 53.604 70.602  1.00 30.98 ? 183 TYR A OH  1 
ATOM   719  N N   . THR A 1 96  ? 121.405 49.879 77.727  1.00 30.19 ? 184 THR A N   1 
ATOM   720  C CA  . THR A 1 96  ? 122.304 49.727 78.878  1.00 30.51 ? 184 THR A CA  1 
ATOM   721  C C   . THR A 1 96  ? 122.438 48.366 79.581  1.00 30.28 ? 184 THR A C   1 
ATOM   722  O O   . THR A 1 96  ? 123.536 47.977 79.977  1.00 30.07 ? 184 THR A O   1 
ATOM   723  C CB  . THR A 1 96  ? 121.953 50.770 79.999  1.00 31.10 ? 184 THR A CB  1 
ATOM   724  O OG1 . THR A 1 96  ? 120.738 50.390 80.666  1.00 32.13 ? 184 THR A OG1 1 
ATOM   725  C CG2 . THR A 1 96  ? 121.753 52.149 79.402  1.00 30.56 ? 184 THR A CG2 1 
ATOM   726  N N   . GLY A 1 97  ? 121.336 47.649 79.744  1.00 29.78 ? 185 GLY A N   1 
ATOM   727  C CA  . GLY A 1 97  ? 121.398 46.389 80.455  1.00 29.83 ? 185 GLY A CA  1 
ATOM   728  C C   . GLY A 1 97  ? 122.272 45.285 79.905  1.00 29.83 ? 185 GLY A C   1 
ATOM   729  O O   . GLY A 1 97  ? 122.675 45.305 78.741  1.00 29.69 ? 185 GLY A O   1 
ATOM   730  N N   . SER A 1 98  ? 122.561 44.313 80.767  1.00 30.17 ? 186 SER A N   1 
ATOM   731  C CA  . SER A 1 98  ? 123.349 43.141 80.392  1.00 30.75 ? 186 SER A CA  1 
ATOM   732  C C   . SER A 1 98  ? 122.494 42.317 79.432  1.00 31.59 ? 186 SER A C   1 
ATOM   733  O O   . SER A 1 98  ? 121.420 42.753 79.007  1.00 31.99 ? 186 SER A O   1 
ATOM   734  C CB  . SER A 1 98  ? 123.657 42.285 81.616  1.00 29.96 ? 186 SER A CB  1 
ATOM   735  O OG  . SER A 1 98  ? 122.478 41.694 82.133  1.00 30.00 ? 186 SER A OG  1 
ATOM   736  N N   . VAL A 1 99  ? 122.945 41.115 79.107  1.00 32.13 ? 187 VAL A N   1 
ATOM   737  C CA  . VAL A 1 99  ? 122.175 40.295 78.195  1.00 33.16 ? 187 VAL A CA  1 
ATOM   738  C C   . VAL A 1 99  ? 120.956 39.705 78.876  1.00 33.50 ? 187 VAL A C   1 
ATOM   739  O O   . VAL A 1 99  ? 119.899 39.605 78.263  1.00 33.90 ? 187 VAL A O   1 
ATOM   740  C CB  . VAL A 1 99  ? 123.037 39.168 77.578  1.00 33.66 ? 187 VAL A CB  1 
ATOM   741  C CG1 . VAL A 1 99  ? 122.181 38.292 76.668  1.00 33.90 ? 187 VAL A CG1 1 
ATOM   742  C CG2 . VAL A 1 99  ? 124.170 39.788 76.763  1.00 34.08 ? 187 VAL A CG2 1 
ATOM   743  N N   . GLU A 1 100 ? 121.097 39.320 80.142  1.00 34.21 ? 188 GLU A N   1 
ATOM   744  C CA  . GLU A 1 100 ? 119.977 38.749 80.880  1.00 34.61 ? 188 GLU A CA  1 
ATOM   745  C C   . GLU A 1 100 ? 118.900 39.812 80.968  1.00 34.11 ? 188 GLU A C   1 
ATOM   746  O O   . GLU A 1 100 ? 117.728 39.531 80.728  1.00 34.99 ? 188 GLU A O   1 
ATOM   747  C CB  . GLU A 1 100 ? 120.393 38.352 82.293  1.00 36.51 ? 188 GLU A CB  1 
ATOM   748  C CG  . GLU A 1 100 ? 121.584 37.400 82.386  1.00 39.84 ? 188 GLU A CG  1 
ATOM   749  C CD  . GLU A 1 100 ? 121.976 37.100 83.840  1.00 41.91 ? 188 GLU A CD  1 
ATOM   750  O OE1 . GLU A 1 100 ? 121.165 36.459 84.556  1.00 42.69 ? 188 GLU A OE1 1 
ATOM   751  O OE2 . GLU A 1 100 ? 123.085 37.520 84.267  1.00 42.46 ? 188 GLU A OE2 1 
ATOM   752  N N   . VAL A 1 101 ? 119.305 41.031 81.319  1.00 33.13 ? 189 VAL A N   1 
ATOM   753  C CA  . VAL A 1 101 ? 118.388 42.157 81.433  1.00 31.91 ? 189 VAL A CA  1 
ATOM   754  C C   . VAL A 1 101 ? 117.661 42.431 80.121  1.00 32.14 ? 189 VAL A C   1 
ATOM   755  O O   . VAL A 1 101 ? 116.433 42.567 80.106  1.00 31.56 ? 189 VAL A O   1 
ATOM   756  C CB  . VAL A 1 101 ? 119.129 43.427 81.893  1.00 31.38 ? 189 VAL A CB  1 
ATOM   757  C CG1 . VAL A 1 101 ? 118.230 44.654 81.750  1.00 30.40 ? 189 VAL A CG1 1 
ATOM   758  C CG2 . VAL A 1 101 ? 119.548 43.266 83.343  1.00 30.38 ? 189 VAL A CG2 1 
ATOM   759  N N   . LYS A 1 102 ? 118.409 42.516 79.023  1.00 32.46 ? 190 LYS A N   1 
ATOM   760  C CA  . LYS A 1 102 ? 117.783 42.750 77.727  1.00 33.58 ? 190 LYS A CA  1 
ATOM   761  C C   . LYS A 1 102 ? 116.743 41.665 77.470  1.00 34.38 ? 190 LYS A C   1 
ATOM   762  O O   . LYS A 1 102 ? 115.625 41.950 77.043  1.00 35.23 ? 190 LYS A O   1 
ATOM   763  C CB  . LYS A 1 102 ? 118.826 42.748 76.612  1.00 33.37 ? 190 LYS A CB  1 
ATOM   764  C CG  . LYS A 1 102 ? 119.847 43.864 76.745  1.00 33.67 ? 190 LYS A CG  1 
ATOM   765  C CD  . LYS A 1 102 ? 120.804 43.872 75.567  1.00 34.24 ? 190 LYS A CD  1 
ATOM   766  C CE  . LYS A 1 102 ? 121.878 44.963 75.697  1.00 34.08 ? 190 LYS A CE  1 
ATOM   767  N NZ  . LYS A 1 102 ? 122.770 44.987 74.491  1.00 32.99 ? 190 LYS A NZ  1 
ATOM   768  N N   . GLU A 1 103 ? 117.115 40.421 77.742  1.00 34.79 ? 191 GLU A N   1 
ATOM   769  C CA  . GLU A 1 103 ? 116.214 39.286 77.566  1.00 35.65 ? 191 GLU A CA  1 
ATOM   770  C C   . GLU A 1 103 ? 114.851 39.583 78.196  1.00 34.51 ? 191 GLU A C   1 
ATOM   771  O O   . GLU A 1 103 ? 113.813 39.396 77.555  1.00 34.51 ? 191 GLU A O   1 
ATOM   772  C CB  . GLU A 1 103 ? 116.839 38.039 78.202  1.00 38.06 ? 191 GLU A CB  1 
ATOM   773  C CG  . GLU A 1 103 ? 117.076 36.882 77.241  1.00 41.79 ? 191 GLU A CG  1 
ATOM   774  C CD  . GLU A 1 103 ? 115.791 36.175 76.880  1.00 44.48 ? 191 GLU A CD  1 
ATOM   775  O OE1 . GLU A 1 103 ? 115.142 35.612 77.798  1.00 46.05 ? 191 GLU A OE1 1 
ATOM   776  O OE2 . GLU A 1 103 ? 115.429 36.188 75.686  1.00 46.23 ? 191 GLU A OE2 1 
ATOM   777  N N   . GLN A 1 104 ? 114.857 40.049 79.445  1.00 32.78 ? 192 GLN A N   1 
ATOM   778  C CA  . GLN A 1 104 ? 113.620 40.380 80.143  1.00 32.04 ? 192 GLN A CA  1 
ATOM   779  C C   . GLN A 1 104 ? 112.845 41.539 79.527  1.00 31.28 ? 192 GLN A C   1 
ATOM   780  O O   . GLN A 1 104 ? 111.616 41.477 79.387  1.00 30.99 ? 192 GLN A O   1 
ATOM   781  C CB  . GLN A 1 104 ? 113.899 40.729 81.600  1.00 32.10 ? 192 GLN A CB  1 
ATOM   782  C CG  . GLN A 1 104 ? 114.115 39.554 82.476  1.00 33.24 ? 192 GLN A CG  1 
ATOM   783  C CD  . GLN A 1 104 ? 112.975 38.570 82.371  1.00 34.22 ? 192 GLN A CD  1 
ATOM   784  O OE1 . GLN A 1 104 ? 113.110 37.397 82.742  1.00 35.50 ? 192 GLN A OE1 1 
ATOM   785  N NE2 . GLN A 1 104 ? 111.840 39.039 81.866  1.00 33.75 ? 192 GLN A NE2 1 
ATOM   786  N N   . ALA A 1 105 ? 113.572 42.596 79.176  1.00 29.90 ? 193 ALA A N   1 
ATOM   787  C CA  . ALA A 1 105 ? 112.974 43.799 78.603  1.00 28.73 ? 193 ALA A CA  1 
ATOM   788  C C   . ALA A 1 105 ? 112.268 43.581 77.278  1.00 27.92 ? 193 ALA A C   1 
ATOM   789  O O   . ALA A 1 105 ? 111.145 44.064 77.087  1.00 27.72 ? 193 ALA A O   1 
ATOM   790  C CB  . ALA A 1 105 ? 114.034 44.881 78.444  1.00 29.35 ? 193 ALA A CB  1 
ATOM   791  N N   . ILE A 1 106 ? 112.922 42.867 76.364  1.00 26.74 ? 194 ILE A N   1 
ATOM   792  C CA  . ILE A 1 106 ? 112.327 42.628 75.069  1.00 26.67 ? 194 ILE A CA  1 
ATOM   793  C C   . ILE A 1 106 ? 111.117 41.719 75.248  1.00 26.66 ? 194 ILE A C   1 
ATOM   794  O O   . ILE A 1 106 ? 110.159 41.792 74.473  1.00 26.72 ? 194 ILE A O   1 
ATOM   795  C CB  . ILE A 1 106 ? 113.344 42.014 74.066  1.00 26.60 ? 194 ILE A CB  1 
ATOM   796  C CG1 . ILE A 1 106 ? 112.776 42.079 72.646  1.00 26.44 ? 194 ILE A CG1 1 
ATOM   797  C CG2 . ILE A 1 106 ? 113.628 40.565 74.407  1.00 27.28 ? 194 ILE A CG2 1 
ATOM   798  C CD1 . ILE A 1 106 ? 112.503 43.488 72.157  1.00 25.17 ? 194 ILE A CD1 1 
ATOM   799  N N   . TRP A 1 107 ? 111.143 40.884 76.287  1.00 26.35 ? 195 TRP A N   1 
ATOM   800  C CA  . TRP A 1 107 ? 110.012 39.982 76.556  1.00 26.56 ? 195 TRP A CA  1 
ATOM   801  C C   . TRP A 1 107 ? 108.818 40.813 77.012  1.00 26.36 ? 195 TRP A C   1 
ATOM   802  O O   . TRP A 1 107 ? 107.713 40.641 76.517  1.00 26.50 ? 195 TRP A O   1 
ATOM   803  C CB  . TRP A 1 107 ? 110.342 38.963 77.657  1.00 25.76 ? 195 TRP A CB  1 
ATOM   804  C CG  . TRP A 1 107 ? 109.298 37.896 77.817  1.00 25.13 ? 195 TRP A CG  1 
ATOM   805  C CD1 . TRP A 1 107 ? 107.939 38.051 77.761  1.00 26.66 ? 195 TRP A CD1 1 
ATOM   806  C CD2 . TRP A 1 107 ? 109.526 36.508 78.061  1.00 25.83 ? 195 TRP A CD2 1 
ATOM   807  N NE1 . TRP A 1 107 ? 107.303 36.839 77.953  1.00 25.41 ? 195 TRP A NE1 1 
ATOM   808  C CE2 . TRP A 1 107 ? 108.258 35.878 78.141  1.00 25.99 ? 195 TRP A CE2 1 
ATOM   809  C CE3 . TRP A 1 107 ? 110.678 35.730 78.224  1.00 26.51 ? 195 TRP A CE3 1 
ATOM   810  C CZ2 . TRP A 1 107 ? 108.118 34.508 78.372  1.00 26.48 ? 195 TRP A CZ2 1 
ATOM   811  C CZ3 . TRP A 1 107 ? 110.536 34.370 78.454  1.00 27.28 ? 195 TRP A CZ3 1 
ATOM   812  C CH2 . TRP A 1 107 ? 109.264 33.772 78.524  1.00 26.84 ? 195 TRP A CH2 1 
ATOM   813  N N   . ALA A 1 108 ? 109.047 41.696 77.980  1.00 26.74 ? 196 ALA A N   1 
ATOM   814  C CA  . ALA A 1 108 ? 107.988 42.563 78.480  1.00 27.82 ? 196 ALA A CA  1 
ATOM   815  C C   . ALA A 1 108 ? 107.389 43.333 77.295  1.00 28.64 ? 196 ALA A C   1 
ATOM   816  O O   . ALA A 1 108 ? 106.167 43.321 77.101  1.00 28.62 ? 196 ALA A O   1 
ATOM   817  C CB  . ALA A 1 108 ? 108.549 43.538 79.515  1.00 27.22 ? 196 ALA A CB  1 
ATOM   818  N N   . LEU A 1 109 ? 108.247 43.989 76.505  1.00 28.35 ? 197 LEU A N   1 
ATOM   819  C CA  . LEU A 1 109 ? 107.784 44.739 75.344  1.00 28.36 ? 197 LEU A CA  1 
ATOM   820  C C   . LEU A 1 109 ? 106.946 43.876 74.415  1.00 28.21 ? 197 LEU A C   1 
ATOM   821  O O   . LEU A 1 109 ? 106.007 44.364 73.787  1.00 28.38 ? 197 LEU A O   1 
ATOM   822  C CB  . LEU A 1 109 ? 108.968 45.330 74.587  1.00 28.20 ? 197 LEU A CB  1 
ATOM   823  C CG  . LEU A 1 109 ? 109.666 46.463 75.351  1.00 28.46 ? 197 LEU A CG  1 
ATOM   824  C CD1 . LEU A 1 109 ? 110.973 46.823 74.669  1.00 27.18 ? 197 LEU A CD1 1 
ATOM   825  C CD2 . LEU A 1 109 ? 108.725 47.675 75.457  1.00 27.88 ? 197 LEU A CD2 1 
ATOM   826  N N   . GLY A 1 110 ? 107.287 42.593 74.341  1.00 28.57 ? 198 GLY A N   1 
ATOM   827  C CA  . GLY A 1 110 ? 106.545 41.656 73.501  1.00 28.18 ? 198 GLY A CA  1 
ATOM   828  C C   . GLY A 1 110 ? 105.092 41.555 73.926  1.00 28.24 ? 198 GLY A C   1 
ATOM   829  O O   . GLY A 1 110 ? 104.196 41.586 73.091  1.00 27.51 ? 198 GLY A O   1 
ATOM   830  N N   . ASN A 1 111 ? 104.862 41.428 75.230  1.00 28.90 ? 199 ASN A N   1 
ATOM   831  C CA  . ASN A 1 111 ? 103.514 41.356 75.776  1.00 29.64 ? 199 ASN A CA  1 
ATOM   832  C C   . ASN A 1 111 ? 102.732 42.661 75.590  1.00 30.18 ? 199 ASN A C   1 
ATOM   833  O O   . ASN A 1 111 ? 101.541 42.634 75.270  1.00 31.24 ? 199 ASN A O   1 
ATOM   834  C CB  . ASN A 1 111 ? 103.539 41.010 77.265  1.00 29.94 ? 199 ASN A CB  1 
ATOM   835  C CG  . ASN A 1 111 ? 103.957 39.581 77.529  1.00 30.58 ? 199 ASN A CG  1 
ATOM   836  O OD1 . ASN A 1 111 ? 103.533 38.653 76.833  1.00 30.38 ? 199 ASN A OD1 1 
ATOM   837  N ND2 . ASN A 1 111 ? 104.760 39.389 78.566  1.00 31.18 ? 199 ASN A ND2 1 
ATOM   838  N N   . VAL A 1 112 ? 103.378 43.803 75.800  1.00 29.62 ? 200 VAL A N   1 
ATOM   839  C CA  . VAL A 1 112 ? 102.682 45.074 75.621  1.00 29.30 ? 200 VAL A CA  1 
ATOM   840  C C   . VAL A 1 112 ? 102.296 45.274 74.163  1.00 29.70 ? 200 VAL A C   1 
ATOM   841  O O   . VAL A 1 112 ? 101.144 45.563 73.862  1.00 29.99 ? 200 VAL A O   1 
ATOM   842  C CB  . VAL A 1 112 ? 103.541 46.261 76.081  1.00 28.21 ? 200 VAL A CB  1 
ATOM   843  C CG1 . VAL A 1 112 ? 102.893 47.575 75.669  1.00 27.61 ? 200 VAL A CG1 1 
ATOM   844  C CG2 . VAL A 1 112 ? 103.705 46.203 77.575  1.00 26.30 ? 200 VAL A CG2 1 
ATOM   845  N N   . ALA A 1 113 ? 103.256 45.116 73.259  1.00 30.12 ? 201 ALA A N   1 
ATOM   846  C CA  . ALA A 1 113 ? 102.982 45.282 71.830  1.00 30.75 ? 201 ALA A CA  1 
ATOM   847  C C   . ALA A 1 113 ? 101.988 44.238 71.328  1.00 30.81 ? 201 ALA A C   1 
ATOM   848  O O   . ALA A 1 113 ? 101.421 44.390 70.245  1.00 30.99 ? 201 ALA A O   1 
ATOM   849  C CB  . ALA A 1 113 ? 104.275 45.188 71.031  1.00 30.69 ? 201 ALA A CB  1 
ATOM   850  N N   . GLY A 1 114 ? 101.782 43.182 72.114  1.00 30.91 ? 202 GLY A N   1 
ATOM   851  C CA  . GLY A 1 114 ? 100.857 42.130 71.722  1.00 31.08 ? 202 GLY A CA  1 
ATOM   852  C C   . GLY A 1 114 ? 99.451  42.314 72.263  1.00 31.80 ? 202 GLY A C   1 
ATOM   853  O O   . GLY A 1 114 ? 98.536  41.588 71.890  1.00 31.43 ? 202 GLY A O   1 
ATOM   854  N N   . ASP A 1 115 ? 99.267  43.298 73.140  1.00 32.66 ? 203 ASP A N   1 
ATOM   855  C CA  . ASP A 1 115 ? 97.954  43.544 73.715  1.00 32.54 ? 203 ASP A CA  1 
ATOM   856  C C   . ASP A 1 115 ? 96.997  44.157 72.712  1.00 32.98 ? 203 ASP A C   1 
ATOM   857  O O   . ASP A 1 115 ? 95.924  43.611 72.469  1.00 32.77 ? 203 ASP A O   1 
ATOM   858  C CB  . ASP A 1 115 ? 98.044  44.477 74.918  1.00 32.24 ? 203 ASP A CB  1 
ATOM   859  C CG  . ASP A 1 115 ? 96.719  44.587 75.659  1.00 32.71 ? 203 ASP A CG  1 
ATOM   860  O OD1 . ASP A 1 115 ? 96.377  43.639 76.405  1.00 32.03 ? 203 ASP A OD1 1 
ATOM   861  O OD2 . ASP A 1 115 ? 96.008  45.604 75.477  1.00 32.56 ? 203 ASP A OD2 1 
ATOM   862  N N   . SER A 1 116 ? 97.389  45.287 72.125  1.00 33.69 ? 204 SER A N   1 
ATOM   863  C CA  . SER A 1 116 ? 96.524  45.983 71.171  1.00 34.37 ? 204 SER A CA  1 
ATOM   864  C C   . SER A 1 116 ? 97.267  46.770 70.089  1.00 35.05 ? 204 SER A C   1 
ATOM   865  O O   . SER A 1 116 ? 98.460  47.043 70.218  1.00 35.56 ? 204 SER A O   1 
ATOM   866  C CB  . SER A 1 116 ? 95.628  46.935 71.942  1.00 34.02 ? 204 SER A CB  1 
ATOM   867  O OG  . SER A 1 116 ? 96.421  47.820 72.710  1.00 34.00 ? 204 SER A OG  1 
ATOM   868  N N   . THR A 1 117 ? 96.557  47.136 69.023  1.00 35.10 ? 205 THR A N   1 
ATOM   869  C CA  . THR A 1 117 ? 97.158  47.914 67.949  1.00 35.56 ? 205 THR A CA  1 
ATOM   870  C C   . THR A 1 117 ? 97.582  49.279 68.500  1.00 35.56 ? 205 THR A C   1 
ATOM   871  O O   . THR A 1 117 ? 98.435  49.950 67.927  1.00 35.10 ? 205 THR A O   1 
ATOM   872  C CB  . THR A 1 117 ? 96.172  48.142 66.774  1.00 36.02 ? 205 THR A CB  1 
ATOM   873  O OG1 . THR A 1 117 ? 95.025  48.866 67.235  1.00 37.17 ? 205 THR A OG1 1 
ATOM   874  C CG2 . THR A 1 117 ? 95.732  46.829 66.188  1.00 35.31 ? 205 THR A CG2 1 
ATOM   875  N N   . ASP A 1 118 ? 96.980  49.683 69.615  1.00 35.86 ? 206 ASP A N   1 
ATOM   876  C CA  . ASP A 1 118 ? 97.317  50.959 70.242  1.00 36.76 ? 206 ASP A CA  1 
ATOM   877  C C   . ASP A 1 118 ? 98.685  50.835 70.890  1.00 36.24 ? 206 ASP A C   1 
ATOM   878  O O   . ASP A 1 118 ? 99.601  51.626 70.628  1.00 36.11 ? 206 ASP A O   1 
ATOM   879  C CB  . ASP A 1 118 ? 96.285  51.313 71.309  1.00 38.55 ? 206 ASP A CB  1 
ATOM   880  C CG  . ASP A 1 118 ? 94.905  51.472 70.734  1.00 40.77 ? 206 ASP A CG  1 
ATOM   881  O OD1 . ASP A 1 118 ? 94.684  52.465 70.004  1.00 40.82 ? 206 ASP A OD1 1 
ATOM   882  O OD2 . ASP A 1 118 ? 94.051  50.588 70.993  1.00 43.01 ? 206 ASP A OD2 1 
ATOM   883  N N   . TYR A 1 119 ? 98.814  49.834 71.752  1.00 35.10 ? 207 TYR A N   1 
ATOM   884  C CA  . TYR A 1 119 ? 100.075 49.582 72.427  1.00 33.78 ? 207 TYR A CA  1 
ATOM   885  C C   . TYR A 1 119 ? 101.149 49.214 71.413  1.00 33.45 ? 207 TYR A C   1 
ATOM   886  O O   . TYR A 1 119 ? 102.305 49.593 71.574  1.00 33.80 ? 207 TYR A O   1 
ATOM   887  C CB  . TYR A 1 119 ? 99.907  48.474 73.465  1.00 32.78 ? 207 TYR A CB  1 
ATOM   888  C CG  . TYR A 1 119 ? 99.090  48.899 74.662  1.00 31.51 ? 207 TYR A CG  1 
ATOM   889  C CD1 . TYR A 1 119 ? 98.607  50.210 74.774  1.00 31.16 ? 207 TYR A CD1 1 
ATOM   890  C CD2 . TYR A 1 119 ? 98.814  48.004 75.693  1.00 30.94 ? 207 TYR A CD2 1 
ATOM   891  C CE1 . TYR A 1 119 ? 97.872  50.618 75.879  1.00 30.46 ? 207 TYR A CE1 1 
ATOM   892  C CE2 . TYR A 1 119 ? 98.080  48.399 76.802  1.00 30.83 ? 207 TYR A CE2 1 
ATOM   893  C CZ  . TYR A 1 119 ? 97.612  49.709 76.890  1.00 30.92 ? 207 TYR A CZ  1 
ATOM   894  O OH  . TYR A 1 119 ? 96.883  50.100 77.990  1.00 31.08 ? 207 TYR A OH  1 
ATOM   895  N N   . ARG A 1 120 ? 100.770 48.482 70.370  1.00 32.74 ? 208 ARG A N   1 
ATOM   896  C CA  . ARG A 1 120 ? 101.725 48.117 69.331  1.00 32.00 ? 208 ARG A CA  1 
ATOM   897  C C   . ARG A 1 120 ? 102.295 49.426 68.805  1.00 31.53 ? 208 ARG A C   1 
ATOM   898  O O   . ARG A 1 120 ? 103.509 49.603 68.726  1.00 31.28 ? 208 ARG A O   1 
ATOM   899  C CB  . ARG A 1 120 ? 101.036 47.382 68.185  1.00 31.58 ? 208 ARG A CB  1 
ATOM   900  C CG  . ARG A 1 120 ? 101.948 47.068 67.022  1.00 30.91 ? 208 ARG A CG  1 
ATOM   901  C CD  . ARG A 1 120 ? 101.138 46.886 65.762  1.00 31.29 ? 208 ARG A CD  1 
ATOM   902  N NE  . ARG A 1 120 ? 100.447 48.125 65.412  1.00 31.60 ? 208 ARG A NE  1 
ATOM   903  C CZ  . ARG A 1 120 ? 99.478  48.217 64.507  1.00 32.21 ? 208 ARG A CZ  1 
ATOM   904  N NH1 . ARG A 1 120 ? 99.077  47.137 63.847  1.00 32.41 ? 208 ARG A NH1 1 
ATOM   905  N NH2 . ARG A 1 120 ? 98.902  49.389 64.269  1.00 31.71 ? 208 ARG A NH2 1 
ATOM   906  N N   . ASP A 1 121 ? 101.413 50.354 68.458  1.00 31.23 ? 209 ASP A N   1 
ATOM   907  C CA  . ASP A 1 121 ? 101.867 51.647 67.950  1.00 31.21 ? 209 ASP A CA  1 
ATOM   908  C C   . ASP A 1 121 ? 102.602 52.494 68.982  1.00 30.66 ? 209 ASP A C   1 
ATOM   909  O O   . ASP A 1 121 ? 103.548 53.207 68.639  1.00 29.53 ? 209 ASP A O   1 
ATOM   910  C CB  . ASP A 1 121 ? 100.700 52.439 67.370  1.00 31.50 ? 209 ASP A CB  1 
ATOM   911  C CG  . ASP A 1 121 ? 100.084 51.752 66.185  1.00 32.18 ? 209 ASP A CG  1 
ATOM   912  O OD1 . ASP A 1 121 ? 100.864 51.234 65.352  1.00 32.09 ? 209 ASP A OD1 1 
ATOM   913  O OD2 . ASP A 1 121 ? 98.837  51.743 66.079  1.00 32.55 ? 209 ASP A OD2 1 
ATOM   914  N N   . TYR A 1 122 ? 102.171 52.412 70.239  1.00 30.60 ? 210 TYR A N   1 
ATOM   915  C CA  . TYR A 1 122 ? 102.806 53.172 71.307  1.00 30.70 ? 210 TYR A CA  1 
ATOM   916  C C   . TYR A 1 122 ? 104.269 52.770 71.427  1.00 31.00 ? 210 TYR A C   1 
ATOM   917  O O   . TYR A 1 122 ? 105.157 53.627 71.481  1.00 31.30 ? 210 TYR A O   1 
ATOM   918  C CB  . TYR A 1 122 ? 102.066 52.938 72.625  1.00 31.40 ? 210 TYR A CB  1 
ATOM   919  C CG  . TYR A 1 122 ? 102.726 53.528 73.853  1.00 32.00 ? 210 TYR A CG  1 
ATOM   920  C CD1 . TYR A 1 122 ? 103.197 54.845 73.859  1.00 32.98 ? 210 TYR A CD1 1 
ATOM   921  C CD2 . TYR A 1 122 ? 102.877 52.774 75.019  1.00 31.78 ? 210 TYR A CD2 1 
ATOM   922  C CE1 . TYR A 1 122 ? 103.813 55.393 75.002  1.00 32.86 ? 210 TYR A CE1 1 
ATOM   923  C CE2 . TYR A 1 122 ? 103.486 53.309 76.160  1.00 32.27 ? 210 TYR A CE2 1 
ATOM   924  C CZ  . TYR A 1 122 ? 103.953 54.615 76.144  1.00 32.71 ? 210 TYR A CZ  1 
ATOM   925  O OH  . TYR A 1 122 ? 104.581 55.127 77.256  1.00 32.31 ? 210 TYR A OH  1 
ATOM   926  N N   . VAL A 1 123 ? 104.527 51.467 71.446  1.00 31.24 ? 211 VAL A N   1 
ATOM   927  C CA  . VAL A 1 123 ? 105.898 50.976 71.553  1.00 31.09 ? 211 VAL A CA  1 
ATOM   928  C C   . VAL A 1 123 ? 106.721 51.452 70.365  1.00 31.65 ? 211 VAL A C   1 
ATOM   929  O O   . VAL A 1 123 ? 107.875 51.845 70.523  1.00 31.54 ? 211 VAL A O   1 
ATOM   930  C CB  . VAL A 1 123 ? 105.947 49.433 71.615  1.00 30.67 ? 211 VAL A CB  1 
ATOM   931  C CG1 . VAL A 1 123 ? 107.380 48.961 71.593  1.00 29.38 ? 211 VAL A CG1 1 
ATOM   932  C CG2 . VAL A 1 123 ? 105.264 48.940 72.876  1.00 29.50 ? 211 VAL A CG2 1 
ATOM   933  N N   . LEU A 1 124 ? 106.129 51.416 69.176  1.00 32.47 ? 212 LEU A N   1 
ATOM   934  C CA  . LEU A 1 124 ? 106.830 51.863 67.979  1.00 33.44 ? 212 LEU A CA  1 
ATOM   935  C C   . LEU A 1 124 ? 107.112 53.353 68.058  1.00 35.06 ? 212 LEU A C   1 
ATOM   936  O O   . LEU A 1 124 ? 108.187 53.800 67.672  1.00 35.36 ? 212 LEU A O   1 
ATOM   937  C CB  . LEU A 1 124 ? 106.016 51.557 66.717  1.00 33.14 ? 212 LEU A CB  1 
ATOM   938  C CG  . LEU A 1 124 ? 105.867 50.094 66.268  1.00 32.29 ? 212 LEU A CG  1 
ATOM   939  C CD1 . LEU A 1 124 ? 104.947 50.020 65.076  1.00 30.95 ? 212 LEU A CD1 1 
ATOM   940  C CD2 . LEU A 1 124 ? 107.235 49.510 65.912  1.00 31.71 ? 212 LEU A CD2 1 
ATOM   941  N N   . GLN A 1 125 ? 106.154 54.125 68.568  1.00 36.62 ? 213 GLN A N   1 
ATOM   942  C CA  . GLN A 1 125 ? 106.348 55.572 68.689  1.00 37.21 ? 213 GLN A CA  1 
ATOM   943  C C   . GLN A 1 125 ? 107.327 55.975 69.801  1.00 36.88 ? 213 GLN A C   1 
ATOM   944  O O   . GLN A 1 125 ? 107.732 57.133 69.872  1.00 37.04 ? 213 GLN A O   1 
ATOM   945  C CB  . GLN A 1 125 ? 104.994 56.281 68.859  1.00 38.31 ? 213 GLN A CB  1 
ATOM   946  C CG  . GLN A 1 125 ? 104.490 56.975 67.584  1.00 40.01 ? 213 GLN A CG  1 
ATOM   947  C CD  . GLN A 1 125 ? 104.430 56.056 66.379  1.00 40.71 ? 213 GLN A CD  1 
ATOM   948  O OE1 . GLN A 1 125 ? 103.667 55.085 66.349  1.00 42.09 ? 213 GLN A OE1 1 
ATOM   949  N NE2 . GLN A 1 125 ? 105.242 56.355 65.376  1.00 40.96 ? 213 GLN A NE2 1 
ATOM   950  N N   . CYS A 1 126 ? 107.712 55.034 70.665  1.00 36.12 ? 214 CYS A N   1 
ATOM   951  C CA  . CYS A 1 126 ? 108.685 55.342 71.712  1.00 35.56 ? 214 CYS A CA  1 
ATOM   952  C C   . CYS A 1 126 ? 110.071 55.054 71.170  1.00 35.58 ? 214 CYS A C   1 
ATOM   953  O O   . CYS A 1 126 ? 111.068 55.100 71.896  1.00 34.92 ? 214 CYS A O   1 
ATOM   954  C CB  . CYS A 1 126 ? 108.451 54.517 72.975  1.00 35.40 ? 214 CYS A CB  1 
ATOM   955  S SG  . CYS A 1 126 ? 107.076 55.074 73.996  1.00 34.72 ? 214 CYS A SG  1 
ATOM   956  N N   . ASN A 1 127 ? 110.110 54.749 69.878  1.00 35.77 ? 215 ASN A N   1 
ATOM   957  C CA  . ASN A 1 127 ? 111.351 54.476 69.157  1.00 36.15 ? 215 ASN A CA  1 
ATOM   958  C C   . ASN A 1 127 ? 112.089 53.241 69.642  1.00 36.20 ? 215 ASN A C   1 
ATOM   959  O O   . ASN A 1 127 ? 113.305 53.261 69.801  1.00 36.11 ? 215 ASN A O   1 
ATOM   960  C CB  . ASN A 1 127 ? 112.279 55.696 69.223  1.00 36.31 ? 215 ASN A CB  1 
ATOM   961  C CG  . ASN A 1 127 ? 113.552 55.507 68.410  1.00 37.63 ? 215 ASN A CG  1 
ATOM   962  N N   . ALA A 1 128 ? 111.348 52.158 69.853  1.00 36.58 ? 216 ALA A N   1 
ATOM   963  C CA  . ALA A 1 128 ? 111.930 50.910 70.320  1.00 36.35 ? 216 ALA A CA  1 
ATOM   964  C C   . ALA A 1 128 ? 112.616 50.119 69.206  1.00 36.47 ? 216 ALA A C   1 
ATOM   965  O O   . ALA A 1 128 ? 113.452 49.263 69.472  1.00 36.21 ? 216 ALA A O   1 
ATOM   966  C CB  . ALA A 1 128 ? 110.860 50.065 70.960  1.00 36.90 ? 216 ALA A CB  1 
ATOM   967  N N   . MET A 1 129 ? 112.276 50.414 67.959  1.00 36.28 ? 217 MET A N   1 
ATOM   968  C CA  . MET A 1 129 ? 112.857 49.703 66.821  1.00 36.22 ? 217 MET A CA  1 
ATOM   969  C C   . MET A 1 129 ? 114.391 49.827 66.698  1.00 37.01 ? 217 MET A C   1 
ATOM   970  O O   . MET A 1 129 ? 115.070 48.863 66.333  1.00 36.83 ? 217 MET A O   1 
ATOM   971  C CB  . MET A 1 129 ? 112.182 50.181 65.525  1.00 35.42 ? 217 MET A CB  1 
ATOM   972  C CG  . MET A 1 129 ? 112.610 49.446 64.279  1.00 34.19 ? 217 MET A CG  1 
ATOM   973  S SD  . MET A 1 129 ? 112.180 47.683 64.317  1.00 36.07 ? 217 MET A SD  1 
ATOM   974  C CE  . MET A 1 129 ? 110.352 47.687 64.232  1.00 31.98 ? 217 MET A CE  1 
ATOM   975  N N   . GLU A 1 130 ? 114.938 51.007 67.002  1.00 37.72 ? 218 GLU A N   1 
ATOM   976  C CA  . GLU A 1 130 ? 116.384 51.221 66.890  1.00 37.25 ? 218 GLU A CA  1 
ATOM   977  C C   . GLU A 1 130 ? 117.138 50.213 67.732  1.00 36.73 ? 218 GLU A C   1 
ATOM   978  O O   . GLU A 1 130 ? 117.868 49.379 67.197  1.00 37.55 ? 218 GLU A O   1 
ATOM   979  C CB  . GLU A 1 130 ? 116.778 52.653 67.295  1.00 37.32 ? 218 GLU A CB  1 
ATOM   980  N N   . PRO A 1 131 ? 116.980 50.272 69.065  1.00 35.80 ? 219 PRO A N   1 
ATOM   981  C CA  . PRO A 1 131 ? 117.695 49.309 69.900  1.00 35.08 ? 219 PRO A CA  1 
ATOM   982  C C   . PRO A 1 131 ? 117.315 47.853 69.596  1.00 34.96 ? 219 PRO A C   1 
ATOM   983  O O   . PRO A 1 131 ? 118.171 46.974 69.623  1.00 35.47 ? 219 PRO A O   1 
ATOM   984  C CB  . PRO A 1 131 ? 117.308 49.744 71.307  1.00 35.27 ? 219 PRO A CB  1 
ATOM   985  C CG  . PRO A 1 131 ? 115.902 50.275 71.092  1.00 35.93 ? 219 PRO A CG  1 
ATOM   986  C CD  . PRO A 1 131 ? 116.190 51.172 69.911  1.00 35.89 ? 219 PRO A CD  1 
ATOM   987  N N   . ILE A 1 132 ? 116.047 47.585 69.297  1.00 34.60 ? 220 ILE A N   1 
ATOM   988  C CA  . ILE A 1 132 ? 115.649 46.216 68.993  1.00 33.77 ? 220 ILE A CA  1 
ATOM   989  C C   . ILE A 1 132 ? 116.476 45.617 67.850  1.00 33.50 ? 220 ILE A C   1 
ATOM   990  O O   . ILE A 1 132 ? 116.942 44.483 67.951  1.00 33.21 ? 220 ILE A O   1 
ATOM   991  C CB  . ILE A 1 132 ? 114.154 46.118 68.631  1.00 33.81 ? 220 ILE A CB  1 
ATOM   992  C CG1 . ILE A 1 132 ? 113.301 46.460 69.855  1.00 33.40 ? 220 ILE A CG1 1 
ATOM   993  C CG2 . ILE A 1 132 ? 113.834 44.712 68.126  1.00 33.60 ? 220 ILE A CG2 1 
ATOM   994  C CD1 . ILE A 1 132 ? 111.810 46.516 69.568  1.00 34.55 ? 220 ILE A CD1 1 
ATOM   995  N N   . LEU A 1 133 ? 116.675 46.364 66.769  1.00 32.75 ? 221 LEU A N   1 
ATOM   996  C CA  . LEU A 1 133 ? 117.450 45.821 65.659  1.00 32.50 ? 221 LEU A CA  1 
ATOM   997  C C   . LEU A 1 133 ? 118.870 45.480 66.063  1.00 32.84 ? 221 LEU A C   1 
ATOM   998  O O   . LEU A 1 133 ? 119.506 44.617 65.447  1.00 32.67 ? 221 LEU A O   1 
ATOM   999  C CB  . LEU A 1 133 ? 117.465 46.787 64.473  1.00 31.53 ? 221 LEU A CB  1 
ATOM   1000 C CG  . LEU A 1 133 ? 116.152 46.837 63.692  1.00 31.42 ? 221 LEU A CG  1 
ATOM   1001 C CD1 . LEU A 1 133 ? 116.251 47.853 62.602  1.00 30.80 ? 221 LEU A CD1 1 
ATOM   1002 C CD2 . LEU A 1 133 ? 115.841 45.465 63.107  1.00 31.09 ? 221 LEU A CD2 1 
ATOM   1003 N N   . GLY A 1 134 ? 119.353 46.160 67.104  1.00 32.91 ? 222 GLY A N   1 
ATOM   1004 C CA  . GLY A 1 134 ? 120.698 45.940 67.603  1.00 32.55 ? 222 GLY A CA  1 
ATOM   1005 C C   . GLY A 1 134 ? 120.834 44.649 68.386  1.00 32.72 ? 222 GLY A C   1 
ATOM   1006 O O   . GLY A 1 134 ? 121.927 44.098 68.497  1.00 33.33 ? 222 GLY A O   1 
ATOM   1007 N N   . LEU A 1 135 ? 119.733 44.164 68.946  1.00 32.49 ? 223 LEU A N   1 
ATOM   1008 C CA  . LEU A 1 135 ? 119.762 42.912 69.694  1.00 32.59 ? 223 LEU A CA  1 
ATOM   1009 C C   . LEU A 1 135 ? 120.185 41.758 68.777  1.00 33.25 ? 223 LEU A C   1 
ATOM   1010 O O   . LEU A 1 135 ? 120.782 40.790 69.235  1.00 33.55 ? 223 LEU A O   1 
ATOM   1011 C CB  . LEU A 1 135 ? 118.377 42.600 70.272  1.00 31.85 ? 223 LEU A CB  1 
ATOM   1012 C CG  . LEU A 1 135 ? 117.761 43.592 71.265  1.00 31.04 ? 223 LEU A CG  1 
ATOM   1013 C CD1 . LEU A 1 135 ? 116.317 43.215 71.568  1.00 29.90 ? 223 LEU A CD1 1 
ATOM   1014 C CD2 . LEU A 1 135 ? 118.606 43.621 72.531  1.00 30.85 ? 223 LEU A CD2 1 
ATOM   1015 N N   . PHE A 1 136 ? 119.883 41.867 67.484  1.00 33.98 ? 224 PHE A N   1 
ATOM   1016 C CA  . PHE A 1 136 ? 120.205 40.805 66.535  1.00 34.77 ? 224 PHE A CA  1 
ATOM   1017 C C   . PHE A 1 136 ? 121.692 40.659 66.203  1.00 35.63 ? 224 PHE A C   1 
ATOM   1018 O O   . PHE A 1 136 ? 122.112 39.680 65.581  1.00 35.11 ? 224 PHE A O   1 
ATOM   1019 C CB  . PHE A 1 136 ? 119.365 40.956 65.245  1.00 33.97 ? 224 PHE A CB  1 
ATOM   1020 C CG  . PHE A 1 136 ? 117.875 40.814 65.474  1.00 34.29 ? 224 PHE A CG  1 
ATOM   1021 C CD1 . PHE A 1 136 ? 117.108 41.903 65.877  1.00 34.67 ? 224 PHE A CD1 1 
ATOM   1022 C CD2 . PHE A 1 136 ? 117.263 39.565 65.405  1.00 33.79 ? 224 PHE A CD2 1 
ATOM   1023 C CE1 . PHE A 1 136 ? 115.761 41.747 66.212  1.00 34.49 ? 224 PHE A CE1 1 
ATOM   1024 C CE2 . PHE A 1 136 ? 115.921 39.405 65.740  1.00 33.59 ? 224 PHE A CE2 1 
ATOM   1025 C CZ  . PHE A 1 136 ? 115.173 40.496 66.146  1.00 34.20 ? 224 PHE A CZ  1 
ATOM   1026 N N   . ASN A 1 137 ? 122.500 41.613 66.639  1.00 36.81 ? 225 ASN A N   1 
ATOM   1027 C CA  . ASN A 1 137 ? 123.928 41.533 66.363  1.00 38.24 ? 225 ASN A CA  1 
ATOM   1028 C C   . ASN A 1 137 ? 124.613 40.669 67.413  1.00 39.29 ? 225 ASN A C   1 
ATOM   1029 O O   . ASN A 1 137 ? 125.833 40.629 67.475  1.00 39.39 ? 225 ASN A O   1 
ATOM   1030 C CB  . ASN A 1 137 ? 124.562 42.932 66.348  1.00 37.88 ? 225 ASN A CB  1 
ATOM   1031 N N   . SER A 1 138 ? 123.832 39.988 68.249  1.00 40.86 ? 226 SER A N   1 
ATOM   1032 C CA  . SER A 1 138 ? 124.408 39.116 69.280  1.00 42.21 ? 226 SER A CA  1 
ATOM   1033 C C   . SER A 1 138 ? 124.419 37.661 68.804  1.00 43.18 ? 226 SER A C   1 
ATOM   1034 O O   . SER A 1 138 ? 123.812 37.319 67.786  1.00 43.37 ? 226 SER A O   1 
ATOM   1035 C CB  . SER A 1 138 ? 123.614 39.211 70.588  1.00 41.69 ? 226 SER A CB  1 
ATOM   1036 O OG  . SER A 1 138 ? 122.320 38.651 70.455  1.00 41.91 ? 226 SER A OG  1 
ATOM   1037 N N   . ASN A 1 139 ? 125.111 36.802 69.542  1.00 44.26 ? 227 ASN A N   1 
ATOM   1038 C CA  . ASN A 1 139 ? 125.177 35.397 69.161  1.00 45.98 ? 227 ASN A CA  1 
ATOM   1039 C C   . ASN A 1 139 ? 124.181 34.525 69.930  1.00 46.81 ? 227 ASN A C   1 
ATOM   1040 O O   . ASN A 1 139 ? 123.776 33.460 69.441  1.00 47.66 ? 227 ASN A O   1 
ATOM   1041 C CB  . ASN A 1 139 ? 126.600 34.852 69.358  1.00 45.30 ? 227 ASN A CB  1 
ATOM   1042 N N   . LYS A 1 140 ? 123.759 34.979 71.110  1.00 46.91 ? 228 LYS A N   1 
ATOM   1043 C CA  . LYS A 1 140 ? 122.842 34.177 71.906  1.00 46.87 ? 228 LYS A CA  1 
ATOM   1044 C C   . LYS A 1 140 ? 121.463 33.975 71.296  1.00 46.25 ? 228 LYS A C   1 
ATOM   1045 O O   . LYS A 1 140 ? 120.669 34.908 71.184  1.00 46.75 ? 228 LYS A O   1 
ATOM   1046 C CB  . LYS A 1 140 ? 122.702 34.747 73.313  1.00 47.54 ? 228 LYS A CB  1 
ATOM   1047 C CG  . LYS A 1 140 ? 121.931 33.806 74.234  1.00 48.53 ? 228 LYS A CG  1 
ATOM   1048 C CD  . LYS A 1 140 ? 122.097 34.191 75.696  1.00 49.11 ? 228 LYS A CD  1 
ATOM   1049 C CE  . LYS A 1 140 ? 121.451 33.160 76.605  1.00 49.90 ? 228 LYS A CE  1 
ATOM   1050 N NZ  . LYS A 1 140 ? 121.703 33.455 78.047  1.00 50.77 ? 228 LYS A NZ  1 
ATOM   1051 N N   . PRO A 1 141 ? 121.165 32.731 70.899  1.00 45.59 ? 229 PRO A N   1 
ATOM   1052 C CA  . PRO A 1 141 ? 119.908 32.299 70.290  1.00 44.90 ? 229 PRO A CA  1 
ATOM   1053 C C   . PRO A 1 141 ? 118.649 32.610 71.096  1.00 44.26 ? 229 PRO A C   1 
ATOM   1054 O O   . PRO A 1 141 ? 117.644 33.048 70.518  1.00 45.21 ? 229 PRO A O   1 
ATOM   1055 C CB  . PRO A 1 141 ? 120.132 30.793 70.099  1.00 44.66 ? 229 PRO A CB  1 
ATOM   1056 C CG  . PRO A 1 141 ? 121.085 30.464 71.215  1.00 44.92 ? 229 PRO A CG  1 
ATOM   1057 C CD  . PRO A 1 141 ? 122.072 31.578 71.007  1.00 45.19 ? 229 PRO A CD  1 
ATOM   1058 N N   . SER A 1 142 ? 118.693 32.391 72.414  1.00 42.51 ? 230 SER A N   1 
ATOM   1059 C CA  . SER A 1 142 ? 117.525 32.650 73.264  1.00 40.42 ? 230 SER A CA  1 
ATOM   1060 C C   . SER A 1 142 ? 117.074 34.098 73.120  1.00 38.92 ? 230 SER A C   1 
ATOM   1061 O O   . SER A 1 142 ? 115.910 34.350 72.821  1.00 39.04 ? 230 SER A O   1 
ATOM   1062 C CB  . SER A 1 142 ? 117.827 32.360 74.736  1.00 40.14 ? 230 SER A CB  1 
ATOM   1063 O OG  . SER A 1 142 ? 118.721 33.322 75.265  1.00 40.91 ? 230 SER A OG  1 
ATOM   1064 N N   . LEU A 1 143 ? 117.993 35.042 73.329  1.00 36.94 ? 231 LEU A N   1 
ATOM   1065 C CA  . LEU A 1 143 ? 117.671 36.456 73.197  1.00 35.22 ? 231 LEU A CA  1 
ATOM   1066 C C   . LEU A 1 143 ? 117.149 36.780 71.798  1.00 33.87 ? 231 LEU A C   1 
ATOM   1067 O O   . LEU A 1 143 ? 116.198 37.542 71.647  1.00 33.37 ? 231 LEU A O   1 
ATOM   1068 C CB  . LEU A 1 143 ? 118.901 37.321 73.490  1.00 35.30 ? 231 LEU A CB  1 
ATOM   1069 C CG  . LEU A 1 143 ? 118.748 38.832 73.236  1.00 35.45 ? 231 LEU A CG  1 
ATOM   1070 C CD1 . LEU A 1 143 ? 117.590 39.403 74.046  1.00 35.35 ? 231 LEU A CD1 1 
ATOM   1071 C CD2 . LEU A 1 143 ? 120.040 39.540 73.594  1.00 35.50 ? 231 LEU A CD2 1 
ATOM   1072 N N   . ILE A 1 144 ? 117.780 36.203 70.780  1.00 32.49 ? 232 ILE A N   1 
ATOM   1073 C CA  . ILE A 1 144 ? 117.377 36.440 69.398  1.00 31.02 ? 232 ILE A CA  1 
ATOM   1074 C C   . ILE A 1 144 ? 116.028 35.815 69.104  1.00 30.70 ? 232 ILE A C   1 
ATOM   1075 O O   . ILE A 1 144 ? 115.306 36.256 68.214  1.00 31.02 ? 232 ILE A O   1 
ATOM   1076 C CB  . ILE A 1 144 ? 118.429 35.886 68.426  1.00 30.20 ? 232 ILE A CB  1 
ATOM   1077 C CG1 . ILE A 1 144 ? 119.684 36.761 68.498  1.00 31.16 ? 232 ILE A CG1 1 
ATOM   1078 C CG2 . ILE A 1 144 ? 117.876 35.813 67.027  1.00 29.12 ? 232 ILE A CG2 1 
ATOM   1079 C CD1 . ILE A 1 144 ? 120.831 36.300 67.609  1.00 30.92 ? 232 ILE A CD1 1 
ATOM   1080 N N   . ARG A 1 145 ? 115.677 34.795 69.867  1.00 29.59 ? 233 ARG A N   1 
ATOM   1081 C CA  . ARG A 1 145 ? 114.415 34.135 69.654  1.00 29.36 ? 233 ARG A CA  1 
ATOM   1082 C C   . ARG A 1 145 ? 113.275 34.986 70.223  1.00 28.63 ? 233 ARG A C   1 
ATOM   1083 O O   . ARG A 1 145 ? 112.196 35.054 69.636  1.00 29.03 ? 233 ARG A O   1 
ATOM   1084 C CB  . ARG A 1 145 ? 114.439 32.754 70.313  1.00 30.57 ? 233 ARG A CB  1 
ATOM   1085 C CG  . ARG A 1 145 ? 113.248 31.894 69.955  1.00 32.66 ? 233 ARG A CG  1 
ATOM   1086 C CD  . ARG A 1 145 ? 113.234 30.615 70.753  1.00 35.19 ? 233 ARG A CD  1 
ATOM   1087 N NE  . ARG A 1 145 ? 114.412 29.782 70.515  1.00 36.48 ? 233 ARG A NE  1 
ATOM   1088 C CZ  . ARG A 1 145 ? 115.270 29.414 71.462  1.00 36.68 ? 233 ARG A CZ  1 
ATOM   1089 N NH1 . ARG A 1 145 ? 115.086 29.805 72.719  1.00 36.30 ? 233 ARG A NH1 1 
ATOM   1090 N NH2 . ARG A 1 145 ? 116.302 28.643 71.152  1.00 36.05 ? 233 ARG A NH2 1 
ATOM   1091 N N   . THR A 1 146 ? 113.509 35.637 71.360  1.00 27.53 ? 234 THR A N   1 
ATOM   1092 C CA  . THR A 1 146 ? 112.477 36.469 71.972  1.00 26.74 ? 234 THR A CA  1 
ATOM   1093 C C   . THR A 1 146 ? 112.319 37.755 71.169  1.00 25.96 ? 234 THR A C   1 
ATOM   1094 O O   . THR A 1 146 ? 111.218 38.257 70.989  1.00 26.02 ? 234 THR A O   1 
ATOM   1095 C CB  . THR A 1 146 ? 112.808 36.839 73.451  1.00 26.73 ? 234 THR A CB  1 
ATOM   1096 O OG1 . THR A 1 146 ? 112.975 35.653 74.234  1.00 26.83 ? 234 THR A OG1 1 
ATOM   1097 C CG2 . THR A 1 146 ? 111.671 37.636 74.063  1.00 25.92 ? 234 THR A CG2 1 
ATOM   1098 N N   . ALA A 1 147 ? 113.427 38.278 70.677  1.00 25.40 ? 235 ALA A N   1 
ATOM   1099 C CA  . ALA A 1 147 ? 113.391 39.501 69.899  1.00 25.86 ? 235 ALA A CA  1 
ATOM   1100 C C   . ALA A 1 147 ? 112.656 39.269 68.586  1.00 25.97 ? 235 ALA A C   1 
ATOM   1101 O O   . ALA A 1 147 ? 112.020 40.183 68.062  1.00 26.17 ? 235 ALA A O   1 
ATOM   1102 C CB  . ALA A 1 147 ? 114.810 39.995 69.631  1.00 25.43 ? 235 ALA A CB  1 
ATOM   1103 N N   . THR A 1 148 ? 112.744 38.052 68.052  1.00 25.71 ? 236 THR A N   1 
ATOM   1104 C CA  . THR A 1 148 ? 112.067 37.717 66.796  1.00 25.30 ? 236 THR A CA  1 
ATOM   1105 C C   . THR A 1 148 ? 110.559 37.659 67.027  1.00 25.33 ? 236 THR A C   1 
ATOM   1106 O O   . THR A 1 148 ? 109.770 38.177 66.238  1.00 24.78 ? 236 THR A O   1 
ATOM   1107 C CB  . THR A 1 148 ? 112.563 36.379 66.255  1.00 24.83 ? 236 THR A CB  1 
ATOM   1108 O OG1 . THR A 1 148 ? 113.981 36.463 66.059  1.00 25.17 ? 236 THR A OG1 1 
ATOM   1109 C CG2 . THR A 1 148 ? 111.899 36.053 64.929  1.00 24.24 ? 236 THR A CG2 1 
ATOM   1110 N N   . TRP A 1 149 ? 110.166 37.023 68.120  1.00 25.16 ? 237 TRP A N   1 
ATOM   1111 C CA  . TRP A 1 149 ? 108.764 36.950 68.481  1.00 25.81 ? 237 TRP A CA  1 
ATOM   1112 C C   . TRP A 1 149 ? 108.202 38.382 68.655  1.00 26.23 ? 237 TRP A C   1 
ATOM   1113 O O   . TRP A 1 149 ? 107.211 38.743 68.020  1.00 26.69 ? 237 TRP A O   1 
ATOM   1114 C CB  . TRP A 1 149 ? 108.613 36.147 69.780  1.00 25.27 ? 237 TRP A CB  1 
ATOM   1115 C CG  . TRP A 1 149 ? 107.270 36.265 70.405  1.00 24.53 ? 237 TRP A CG  1 
ATOM   1116 C CD1 . TRP A 1 149 ? 106.082 35.881 69.865  1.00 25.21 ? 237 TRP A CD1 1 
ATOM   1117 C CD2 . TRP A 1 149 ? 106.968 36.839 71.679  1.00 23.96 ? 237 TRP A CD2 1 
ATOM   1118 N NE1 . TRP A 1 149 ? 105.054 36.177 70.720  1.00 25.45 ? 237 TRP A NE1 1 
ATOM   1119 C CE2 . TRP A 1 149 ? 105.570 36.768 71.846  1.00 25.10 ? 237 TRP A CE2 1 
ATOM   1120 C CE3 . TRP A 1 149 ? 107.742 37.403 72.696  1.00 23.89 ? 237 TRP A CE3 1 
ATOM   1121 C CZ2 . TRP A 1 149 ? 104.925 37.249 72.996  1.00 23.90 ? 237 TRP A CZ2 1 
ATOM   1122 C CZ3 . TRP A 1 149 ? 107.104 37.877 73.835  1.00 23.44 ? 237 TRP A CZ3 1 
ATOM   1123 C CH2 . TRP A 1 149 ? 105.708 37.794 73.974  1.00 23.91 ? 237 TRP A CH2 1 
ATOM   1124 N N   . THR A 1 150 ? 108.838 39.187 69.510  1.00 26.05 ? 238 THR A N   1 
ATOM   1125 C CA  . THR A 1 150 ? 108.401 40.561 69.759  1.00 26.76 ? 238 THR A CA  1 
ATOM   1126 C C   . THR A 1 150 ? 108.265 41.359 68.455  1.00 27.66 ? 238 THR A C   1 
ATOM   1127 O O   . THR A 1 150 ? 107.320 42.120 68.265  1.00 27.41 ? 238 THR A O   1 
ATOM   1128 C CB  . THR A 1 150 ? 109.388 41.302 70.693  1.00 26.30 ? 238 THR A CB  1 
ATOM   1129 O OG1 . THR A 1 150 ? 109.410 40.659 71.970  1.00 26.19 ? 238 THR A OG1 1 
ATOM   1130 C CG2 . THR A 1 150 ? 108.977 42.755 70.875  1.00 25.61 ? 238 THR A CG2 1 
ATOM   1131 N N   . LEU A 1 151 ? 109.222 41.177 67.558  1.00 28.60 ? 239 LEU A N   1 
ATOM   1132 C CA  . LEU A 1 151 ? 109.214 41.859 66.271  1.00 29.10 ? 239 LEU A CA  1 
ATOM   1133 C C   . LEU A 1 151 ? 107.948 41.489 65.512  1.00 29.54 ? 239 LEU A C   1 
ATOM   1134 O O   . LEU A 1 151 ? 107.376 42.311 64.783  1.00 30.67 ? 239 LEU A O   1 
ATOM   1135 C CB  . LEU A 1 151 ? 110.420 41.417 65.457  1.00 29.61 ? 239 LEU A CB  1 
ATOM   1136 C CG  . LEU A 1 151 ? 110.755 42.204 64.197  1.00 30.28 ? 239 LEU A CG  1 
ATOM   1137 C CD1 . LEU A 1 151 ? 111.096 43.642 64.600  1.00 30.95 ? 239 LEU A CD1 1 
ATOM   1138 C CD2 . LEU A 1 151 ? 111.945 41.582 63.494  1.00 28.78 ? 239 LEU A CD2 1 
ATOM   1139 N N   . SER A 1 152 ? 107.520 40.240 65.691  1.00 28.84 ? 240 SER A N   1 
ATOM   1140 C CA  . SER A 1 152 ? 106.336 39.715 65.030  1.00 27.83 ? 240 SER A CA  1 
ATOM   1141 C C   . SER A 1 152 ? 105.112 40.509 65.503  1.00 27.31 ? 240 SER A C   1 
ATOM   1142 O O   . SER A 1 152 ? 104.306 40.964 64.688  1.00 26.89 ? 240 SER A O   1 
ATOM   1143 C CB  . SER A 1 152 ? 106.195 38.213 65.349  1.00 27.79 ? 240 SER A CB  1 
ATOM   1144 O OG  . SER A 1 152 ? 105.305 37.544 64.468  1.00 27.62 ? 240 SER A OG  1 
ATOM   1145 N N   . ASN A 1 153 ? 104.972 40.697 66.810  1.00 26.62 ? 241 ASN A N   1 
ATOM   1146 C CA  . ASN A 1 153 ? 103.823 41.457 67.292  1.00 27.10 ? 241 ASN A CA  1 
ATOM   1147 C C   . ASN A 1 153 ? 103.817 42.902 66.747  1.00 27.40 ? 241 ASN A C   1 
ATOM   1148 O O   . ASN A 1 153 ? 102.766 43.437 66.396  1.00 26.86 ? 241 ASN A O   1 
ATOM   1149 C CB  . ASN A 1 153 ? 103.749 41.448 68.831  1.00 26.07 ? 241 ASN A CB  1 
ATOM   1150 C CG  . ASN A 1 153 ? 103.388 40.076 69.395  1.00 26.53 ? 241 ASN A CG  1 
ATOM   1151 O OD1 . ASN A 1 153 ? 102.578 39.346 68.815  1.00 27.50 ? 241 ASN A OD1 1 
ATOM   1152 N ND2 . ASN A 1 153 ? 103.954 39.737 70.547  1.00 26.00 ? 241 ASN A ND2 1 
ATOM   1153 N N   . LEU A 1 154 ? 104.989 43.522 66.656  1.00 27.91 ? 242 LEU A N   1 
ATOM   1154 C CA  . LEU A 1 154 ? 105.097 44.885 66.140  1.00 29.26 ? 242 LEU A CA  1 
ATOM   1155 C C   . LEU A 1 154 ? 104.623 45.011 64.677  1.00 30.27 ? 242 LEU A C   1 
ATOM   1156 O O   . LEU A 1 154 ? 104.016 46.018 64.296  1.00 30.14 ? 242 LEU A O   1 
ATOM   1157 C CB  . LEU A 1 154 ? 106.541 45.371 66.273  1.00 28.63 ? 242 LEU A CB  1 
ATOM   1158 C CG  . LEU A 1 154 ? 107.038 45.542 67.711  1.00 27.85 ? 242 LEU A CG  1 
ATOM   1159 C CD1 . LEU A 1 154 ? 108.522 45.779 67.732  1.00 26.27 ? 242 LEU A CD1 1 
ATOM   1160 C CD2 . LEU A 1 154 ? 106.306 46.694 68.351  1.00 27.20 ? 242 LEU A CD2 1 
ATOM   1161 N N   . CYS A 1 155 ? 104.885 43.991 63.863  1.00 30.79 ? 243 CYS A N   1 
ATOM   1162 C CA  . CYS A 1 155 ? 104.451 44.012 62.467  1.00 31.58 ? 243 CYS A CA  1 
ATOM   1163 C C   . CYS A 1 155 ? 102.978 43.592 62.254  1.00 32.98 ? 243 CYS A C   1 
ATOM   1164 O O   . CYS A 1 155 ? 102.327 44.000 61.283  1.00 33.17 ? 243 CYS A O   1 
ATOM   1165 C CB  . CYS A 1 155 ? 105.356 43.104 61.641  1.00 30.12 ? 243 CYS A CB  1 
ATOM   1166 S SG  . CYS A 1 155 ? 107.071 43.625 61.618  1.00 28.97 ? 243 CYS A SG  1 
ATOM   1167 N N   . ARG A 1 156 ? 102.457 42.784 63.171  1.00 34.36 ? 244 ARG A N   1 
ATOM   1168 C CA  . ARG A 1 156 ? 101.095 42.284 63.073  1.00 35.71 ? 244 ARG A CA  1 
ATOM   1169 C C   . ARG A 1 156 ? 100.029 43.356 63.226  1.00 36.30 ? 244 ARG A C   1 
ATOM   1170 O O   . ARG A 1 156 ? 100.123 44.229 64.088  1.00 36.71 ? 244 ARG A O   1 
ATOM   1171 C CB  . ARG A 1 156 ? 100.877 41.188 64.117  1.00 36.29 ? 244 ARG A CB  1 
ATOM   1172 C CG  . ARG A 1 156 ? 99.578  40.434 63.965  1.00 37.80 ? 244 ARG A CG  1 
ATOM   1173 C CD  . ARG A 1 156 ? 99.551  39.217 64.875  1.00 39.18 ? 244 ARG A CD  1 
ATOM   1174 N NE  . ARG A 1 156 ? 98.400  38.361 64.587  1.00 41.60 ? 244 ARG A NE  1 
ATOM   1175 C CZ  . ARG A 1 156 ? 98.166  37.193 65.177  1.00 42.61 ? 244 ARG A CZ  1 
ATOM   1176 N NH1 . ARG A 1 156 ? 99.007  36.730 66.100  1.00 43.20 ? 244 ARG A NH1 1 
ATOM   1177 N NH2 . ARG A 1 156 ? 97.091  36.488 64.844  1.00 43.03 ? 244 ARG A NH2 1 
ATOM   1178 N N   . GLY A 1 157 ? 99.005  43.275 62.388  1.00 37.01 ? 245 GLY A N   1 
ATOM   1179 C CA  . GLY A 1 157 ? 97.926  44.239 62.452  1.00 38.03 ? 245 GLY A CA  1 
ATOM   1180 C C   . GLY A 1 157 ? 97.657  44.790 61.078  1.00 38.70 ? 245 GLY A C   1 
ATOM   1181 O O   . GLY A 1 157 ? 98.559  45.317 60.430  1.00 39.21 ? 245 GLY A O   1 
ATOM   1182 N N   . LYS A 1 158 ? 96.423  44.663 60.618  1.00 39.48 ? 246 LYS A N   1 
ATOM   1183 C CA  . LYS A 1 158 ? 96.087  45.164 59.298  1.00 40.50 ? 246 LYS A CA  1 
ATOM   1184 C C   . LYS A 1 158 ? 94.902  46.105 59.403  1.00 41.23 ? 246 LYS A C   1 
ATOM   1185 O O   . LYS A 1 158 ? 94.560  46.793 58.440  1.00 41.62 ? 246 LYS A O   1 
ATOM   1186 C CB  . LYS A 1 158 ? 95.797  44.007 58.338  1.00 40.93 ? 246 LYS A CB  1 
ATOM   1187 C CG  . LYS A 1 158 ? 95.768  44.417 56.880  1.00 40.64 ? 246 LYS A CG  1 
ATOM   1188 C CD  . LYS A 1 158 ? 95.695  43.212 55.958  1.00 40.25 ? 246 LYS A CD  1 
ATOM   1189 C CE  . LYS A 1 158 ? 94.435  42.413 56.187  1.00 40.23 ? 246 LYS A CE  1 
ATOM   1190 N NZ  . LYS A 1 158 ? 94.330  41.256 55.245  1.00 40.71 ? 246 LYS A NZ  1 
ATOM   1191 N N   . LYS A 1 159 ? 94.258  46.119 60.570  1.00 41.93 ? 247 LYS A N   1 
ATOM   1192 C CA  . LYS A 1 159 ? 93.168  47.061 60.812  1.00 42.52 ? 247 LYS A CA  1 
ATOM   1193 C C   . LYS A 1 159 ? 94.098  48.275 60.903  1.00 42.44 ? 247 LYS A C   1 
ATOM   1194 O O   . LYS A 1 159 ? 94.870  48.497 59.969  1.00 43.61 ? 247 LYS A O   1 
ATOM   1195 C CB  . LYS A 1 159 ? 92.471  46.758 62.142  1.00 42.32 ? 247 LYS A CB  1 
ATOM   1196 N N   . PRO A 1 160 ? 94.076  49.073 61.985  1.00 41.65 ? 248 PRO A N   1 
ATOM   1197 C CA  . PRO A 1 160 ? 95.079  50.133 61.794  1.00 41.45 ? 248 PRO A CA  1 
ATOM   1198 C C   . PRO A 1 160 ? 96.447  49.471 61.606  1.00 41.63 ? 248 PRO A C   1 
ATOM   1199 O O   . PRO A 1 160 ? 96.957  48.827 62.523  1.00 41.31 ? 248 PRO A O   1 
ATOM   1200 C CB  . PRO A 1 160 ? 94.984  50.923 63.095  1.00 41.06 ? 248 PRO A CB  1 
ATOM   1201 C CG  . PRO A 1 160 ? 94.495  49.855 64.088  1.00 41.43 ? 248 PRO A CG  1 
ATOM   1202 C CD  . PRO A 1 160 ? 93.393  49.239 63.274  1.00 41.03 ? 248 PRO A CD  1 
ATOM   1203 N N   . GLN A 1 161 ? 97.028  49.587 60.412  1.00 41.80 ? 249 GLN A N   1 
ATOM   1204 C CA  . GLN A 1 161 ? 98.328  48.966 60.186  1.00 42.42 ? 249 GLN A CA  1 
ATOM   1205 C C   . GLN A 1 161 ? 99.440  49.746 60.851  1.00 42.14 ? 249 GLN A C   1 
ATOM   1206 O O   . GLN A 1 161 ? 99.309  50.935 61.109  1.00 42.50 ? 249 GLN A O   1 
ATOM   1207 C CB  . GLN A 1 161 ? 98.646  48.807 58.692  1.00 43.03 ? 249 GLN A CB  1 
ATOM   1208 C CG  . GLN A 1 161 ? 97.805  47.752 57.985  1.00 44.84 ? 249 GLN A CG  1 
ATOM   1209 C CD  . GLN A 1 161 ? 98.588  46.982 56.922  1.00 45.40 ? 249 GLN A CD  1 
ATOM   1210 O OE1 . GLN A 1 161 ? 99.566  46.294 57.231  1.00 45.20 ? 249 GLN A OE1 1 
ATOM   1211 N NE2 . GLN A 1 161 ? 98.154  47.090 55.669  1.00 45.58 ? 249 GLN A NE2 1 
ATOM   1212 N N   . PRO A 1 162 ? 100.550 49.075 61.166  1.00 42.16 ? 250 PRO A N   1 
ATOM   1213 C CA  . PRO A 1 162 ? 101.688 49.729 61.811  1.00 41.87 ? 250 PRO A CA  1 
ATOM   1214 C C   . PRO A 1 162 ? 102.374 50.731 60.879  1.00 41.44 ? 250 PRO A C   1 
ATOM   1215 O O   . PRO A 1 162 ? 102.326 50.592 59.656  1.00 41.34 ? 250 PRO A O   1 
ATOM   1216 C CB  . PRO A 1 162 ? 102.587 48.546 62.163  1.00 41.88 ? 250 PRO A CB  1 
ATOM   1217 C CG  . PRO A 1 162 ? 102.331 47.613 60.981  1.00 41.62 ? 250 PRO A CG  1 
ATOM   1218 C CD  . PRO A 1 162 ? 100.826 47.633 61.001  1.00 42.04 ? 250 PRO A CD  1 
ATOM   1219 N N   . ASP A 1 163 ? 103.009 51.730 61.473  1.00 41.08 ? 251 ASP A N   1 
ATOM   1220 C CA  . ASP A 1 163 ? 103.740 52.766 60.745  1.00 41.79 ? 251 ASP A CA  1 
ATOM   1221 C C   . ASP A 1 163 ? 104.721 52.123 59.744  1.00 41.83 ? 251 ASP A C   1 
ATOM   1222 O O   . ASP A 1 163 ? 105.759 51.599 60.154  1.00 42.39 ? 251 ASP A O   1 
ATOM   1223 C CB  . ASP A 1 163 ? 104.522 53.591 61.762  1.00 42.97 ? 251 ASP A CB  1 
ATOM   1224 C CG  . ASP A 1 163 ? 105.040 54.882 61.198  1.00 44.00 ? 251 ASP A CG  1 
ATOM   1225 O OD1 . ASP A 1 163 ? 105.652 54.867 60.108  1.00 44.69 ? 251 ASP A OD1 1 
ATOM   1226 O OD2 . ASP A 1 163 ? 104.845 55.914 61.871  1.00 44.96 ? 251 ASP A OD2 1 
ATOM   1227 N N   . TRP A 1 164 ? 104.426 52.177 58.446  1.00 41.47 ? 252 TRP A N   1 
ATOM   1228 C CA  . TRP A 1 164 ? 105.303 51.539 57.455  1.00 41.06 ? 252 TRP A CA  1 
ATOM   1229 C C   . TRP A 1 164 ? 106.741 52.042 57.395  1.00 40.78 ? 252 TRP A C   1 
ATOM   1230 O O   . TRP A 1 164 ? 107.667 51.274 57.113  1.00 40.80 ? 252 TRP A O   1 
ATOM   1231 C CB  . TRP A 1 164 ? 104.682 51.599 56.049  1.00 40.99 ? 252 TRP A CB  1 
ATOM   1232 C CG  . TRP A 1 164 ? 105.574 50.989 54.995  1.00 41.14 ? 252 TRP A CG  1 
ATOM   1233 C CD1 . TRP A 1 164 ? 106.437 51.649 54.167  1.00 41.16 ? 252 TRP A CD1 1 
ATOM   1234 C CD2 . TRP A 1 164 ? 105.796 49.587 54.763  1.00 41.24 ? 252 TRP A CD2 1 
ATOM   1235 N NE1 . TRP A 1 164 ? 107.182 50.753 53.438  1.00 40.81 ? 252 TRP A NE1 1 
ATOM   1236 C CE2 . TRP A 1 164 ? 106.804 49.482 53.783  1.00 41.39 ? 252 TRP A CE2 1 
ATOM   1237 C CE3 . TRP A 1 164 ? 105.236 48.416 55.283  1.00 41.14 ? 252 TRP A CE3 1 
ATOM   1238 C CZ2 . TRP A 1 164 ? 107.274 48.245 53.322  1.00 41.15 ? 252 TRP A CZ2 1 
ATOM   1239 C CZ3 . TRP A 1 164 ? 105.705 47.185 54.821  1.00 40.74 ? 252 TRP A CZ3 1 
ATOM   1240 C CH2 . TRP A 1 164 ? 106.707 47.114 53.850  1.00 40.86 ? 252 TRP A CH2 1 
ATOM   1241 N N   . SER A 1 165 ? 106.944 53.325 57.649  1.00 40.33 ? 253 SER A N   1 
ATOM   1242 C CA  . SER A 1 165 ? 108.295 53.868 57.608  1.00 39.75 ? 253 SER A CA  1 
ATOM   1243 C C   . SER A 1 165 ? 109.157 53.290 58.735  1.00 38.97 ? 253 SER A C   1 
ATOM   1244 O O   . SER A 1 165 ? 110.379 53.288 58.650  1.00 39.00 ? 253 SER A O   1 
ATOM   1245 C CB  . SER A 1 165 ? 108.258 55.401 57.684  1.00 39.24 ? 253 SER A CB  1 
ATOM   1246 O OG  . SER A 1 165 ? 107.557 55.844 58.834  1.00 39.65 ? 253 SER A OG  1 
ATOM   1247 N N   . VAL A 1 166 ? 108.519 52.788 59.787  1.00 38.30 ? 254 VAL A N   1 
ATOM   1248 C CA  . VAL A 1 166 ? 109.259 52.215 60.896  1.00 37.60 ? 254 VAL A CA  1 
ATOM   1249 C C   . VAL A 1 166 ? 109.443 50.718 60.698  1.00 37.72 ? 254 VAL A C   1 
ATOM   1250 O O   . VAL A 1 166 ? 110.575 50.246 60.550  1.00 38.00 ? 254 VAL A O   1 
ATOM   1251 C CB  . VAL A 1 166 ? 108.555 52.468 62.236  1.00 37.82 ? 254 VAL A CB  1 
ATOM   1252 C CG1 . VAL A 1 166 ? 109.355 51.852 63.372  1.00 36.95 ? 254 VAL A CG1 1 
ATOM   1253 C CG2 . VAL A 1 166 ? 108.392 53.957 62.452  1.00 36.73 ? 254 VAL A CG2 1 
ATOM   1254 N N   . VAL A 1 167 ? 108.347 49.966 60.670  1.00 37.16 ? 255 VAL A N   1 
ATOM   1255 C CA  . VAL A 1 167 ? 108.460 48.519 60.490  1.00 37.64 ? 255 VAL A CA  1 
ATOM   1256 C C   . VAL A 1 167 ? 109.217 48.063 59.236  1.00 37.57 ? 255 VAL A C   1 
ATOM   1257 O O   . VAL A 1 167 ? 109.895 47.037 59.270  1.00 37.31 ? 255 VAL A O   1 
ATOM   1258 C CB  . VAL A 1 167 ? 107.075 47.830 60.510  1.00 37.27 ? 255 VAL A CB  1 
ATOM   1259 C CG1 . VAL A 1 167 ? 106.538 47.798 61.916  1.00 37.17 ? 255 VAL A CG1 1 
ATOM   1260 C CG2 . VAL A 1 167 ? 106.117 48.578 59.622  1.00 37.60 ? 255 VAL A CG2 1 
ATOM   1261 N N   . SER A 1 168 ? 109.122 48.817 58.141  1.00 37.84 ? 256 SER A N   1 
ATOM   1262 C CA  . SER A 1 168 ? 109.809 48.441 56.902  1.00 38.14 ? 256 SER A CA  1 
ATOM   1263 C C   . SER A 1 168 ? 111.315 48.251 57.119  1.00 38.22 ? 256 SER A C   1 
ATOM   1264 O O   . SER A 1 168 ? 111.970 47.484 56.411  1.00 38.82 ? 256 SER A O   1 
ATOM   1265 C CB  . SER A 1 168 ? 109.568 49.500 55.812  1.00 38.62 ? 256 SER A CB  1 
ATOM   1266 O OG  . SER A 1 168 ? 110.088 50.773 56.172  1.00 38.96 ? 256 SER A OG  1 
ATOM   1267 N N   . GLN A 1 169 ? 111.853 48.948 58.114  1.00 37.76 ? 257 GLN A N   1 
ATOM   1268 C CA  . GLN A 1 169 ? 113.272 48.877 58.441  1.00 37.30 ? 257 GLN A CA  1 
ATOM   1269 C C   . GLN A 1 169 ? 113.773 47.517 58.930  1.00 36.24 ? 257 GLN A C   1 
ATOM   1270 O O   . GLN A 1 169 ? 114.969 47.262 58.937  1.00 35.99 ? 257 GLN A O   1 
ATOM   1271 C CB  . GLN A 1 169 ? 113.606 49.945 59.491  1.00 38.46 ? 257 GLN A CB  1 
ATOM   1272 C CG  . GLN A 1 169 ? 113.642 51.349 58.934  1.00 40.88 ? 257 GLN A CG  1 
ATOM   1273 C CD  . GLN A 1 169 ? 113.937 52.399 59.989  1.00 42.73 ? 257 GLN A CD  1 
ATOM   1274 O OE1 . GLN A 1 169 ? 113.057 52.813 60.757  1.00 42.52 ? 257 GLN A OE1 1 
ATOM   1275 N NE2 . GLN A 1 169 ? 115.193 52.824 60.045  1.00 43.66 ? 257 GLN A NE2 1 
ATOM   1276 N N   . ALA A 1 170 ? 112.867 46.646 59.351  1.00 35.46 ? 258 ALA A N   1 
ATOM   1277 C CA  . ALA A 1 170 ? 113.282 45.344 59.848  1.00 34.71 ? 258 ALA A CA  1 
ATOM   1278 C C   . ALA A 1 170 ? 113.530 44.311 58.739  1.00 34.06 ? 258 ALA A C   1 
ATOM   1279 O O   . ALA A 1 170 ? 114.103 43.258 59.003  1.00 33.54 ? 258 ALA A O   1 
ATOM   1280 C CB  . ALA A 1 170 ? 112.244 44.814 60.855  1.00 34.08 ? 258 ALA A CB  1 
ATOM   1281 N N   . LEU A 1 171 ? 113.123 44.623 57.507  1.00 33.67 ? 259 LEU A N   1 
ATOM   1282 C CA  . LEU A 1 171 ? 113.284 43.698 56.379  1.00 33.74 ? 259 LEU A CA  1 
ATOM   1283 C C   . LEU A 1 171 ? 114.665 43.076 56.202  1.00 33.96 ? 259 LEU A C   1 
ATOM   1284 O O   . LEU A 1 171 ? 114.789 41.861 56.066  1.00 34.73 ? 259 LEU A O   1 
ATOM   1285 C CB  . LEU A 1 171 ? 112.855 44.369 55.067  1.00 32.63 ? 259 LEU A CB  1 
ATOM   1286 C CG  . LEU A 1 171 ? 111.352 44.580 54.887  1.00 30.97 ? 259 LEU A CG  1 
ATOM   1287 C CD1 . LEU A 1 171 ? 111.108 45.304 53.575  1.00 29.98 ? 259 LEU A CD1 1 
ATOM   1288 C CD2 . LEU A 1 171 ? 110.635 43.233 54.922  1.00 29.28 ? 259 LEU A CD2 1 
ATOM   1289 N N   . PRO A 1 172 ? 115.721 43.895 56.181  1.00 34.28 ? 260 PRO A N   1 
ATOM   1290 C CA  . PRO A 1 172 ? 117.055 43.323 56.019  1.00 33.85 ? 260 PRO A CA  1 
ATOM   1291 C C   . PRO A 1 172 ? 117.359 42.270 57.079  1.00 33.84 ? 260 PRO A C   1 
ATOM   1292 O O   . PRO A 1 172 ? 117.909 41.216 56.758  1.00 34.94 ? 260 PRO A O   1 
ATOM   1293 C CB  . PRO A 1 172 ? 117.958 44.553 56.119  1.00 33.36 ? 260 PRO A CB  1 
ATOM   1294 C CG  . PRO A 1 172 ? 117.096 45.615 55.496  1.00 32.81 ? 260 PRO A CG  1 
ATOM   1295 C CD  . PRO A 1 172 ? 115.824 45.362 56.285  1.00 34.15 ? 260 PRO A CD  1 
ATOM   1296 N N   . THR A 1 173 ? 117.003 42.541 58.334  1.00 33.59 ? 261 THR A N   1 
ATOM   1297 C CA  . THR A 1 173 ? 117.262 41.578 59.411  1.00 33.26 ? 261 THR A CA  1 
ATOM   1298 C C   . THR A 1 173 ? 116.454 40.317 59.169  1.00 33.39 ? 261 THR A C   1 
ATOM   1299 O O   . THR A 1 173 ? 116.974 39.207 59.230  1.00 33.95 ? 261 THR A O   1 
ATOM   1300 C CB  . THR A 1 173 ? 116.879 42.134 60.789  1.00 32.95 ? 261 THR A CB  1 
ATOM   1301 O OG1 . THR A 1 173 ? 117.650 43.313 61.060  1.00 33.89 ? 261 THR A OG1 1 
ATOM   1302 C CG2 . THR A 1 173 ? 117.151 41.097 61.870  1.00 32.48 ? 261 THR A CG2 1 
ATOM   1303 N N   . LEU A 1 174 ? 115.172 40.499 58.900  1.00 33.36 ? 262 LEU A N   1 
ATOM   1304 C CA  . LEU A 1 174 ? 114.303 39.375 58.626  1.00 33.55 ? 262 LEU A CA  1 
ATOM   1305 C C   . LEU A 1 174 ? 114.935 38.524 57.537  1.00 33.30 ? 262 LEU A C   1 
ATOM   1306 O O   . LEU A 1 174 ? 115.030 37.303 57.660  1.00 33.26 ? 262 LEU A O   1 
ATOM   1307 C CB  . LEU A 1 174 ? 112.919 39.872 58.182  1.00 34.26 ? 262 LEU A CB  1 
ATOM   1308 C CG  . LEU A 1 174 ? 111.878 40.250 59.245  1.00 34.52 ? 262 LEU A CG  1 
ATOM   1309 C CD1 . LEU A 1 174 ? 112.487 41.102 60.316  1.00 35.54 ? 262 LEU A CD1 1 
ATOM   1310 C CD2 . LEU A 1 174 ? 110.736 40.989 58.581  1.00 34.58 ? 262 LEU A CD2 1 
ATOM   1311 N N   . ALA A 1 175 ? 115.384 39.180 56.474  1.00 32.62 ? 263 ALA A N   1 
ATOM   1312 C CA  . ALA A 1 175 ? 115.989 38.474 55.363  1.00 32.56 ? 263 ALA A CA  1 
ATOM   1313 C C   . ALA A 1 175 ? 117.014 37.418 55.834  1.00 32.77 ? 263 ALA A C   1 
ATOM   1314 O O   . ALA A 1 175 ? 117.086 36.309 55.288  1.00 33.30 ? 263 ALA A O   1 
ATOM   1315 C CB  . ALA A 1 175 ? 116.629 39.477 54.414  1.00 31.48 ? 263 ALA A CB  1 
ATOM   1316 N N   . LYS A 1 176 ? 117.796 37.750 56.855  1.00 32.36 ? 264 LYS A N   1 
ATOM   1317 C CA  . LYS A 1 176 ? 118.786 36.810 57.363  1.00 31.69 ? 264 LYS A CA  1 
ATOM   1318 C C   . LYS A 1 176 ? 118.120 35.770 58.245  1.00 31.26 ? 264 LYS A C   1 
ATOM   1319 O O   . LYS A 1 176 ? 118.408 34.586 58.141  1.00 31.07 ? 264 LYS A O   1 
ATOM   1320 C CB  . LYS A 1 176 ? 119.848 37.539 58.176  1.00 31.61 ? 264 LYS A CB  1 
ATOM   1321 C CG  . LYS A 1 176 ? 120.589 38.610 57.400  1.00 32.85 ? 264 LYS A CG  1 
ATOM   1322 N N   . LEU A 1 177 ? 117.222 36.228 59.109  1.00 30.44 ? 265 LEU A N   1 
ATOM   1323 C CA  . LEU A 1 177 ? 116.526 35.348 60.035  1.00 29.50 ? 265 LEU A CA  1 
ATOM   1324 C C   . LEU A 1 177 ? 115.858 34.130 59.398  1.00 29.28 ? 265 LEU A C   1 
ATOM   1325 O O   . LEU A 1 177 ? 115.681 33.112 60.073  1.00 29.18 ? 265 LEU A O   1 
ATOM   1326 C CB  . LEU A 1 177 ? 115.489 36.147 60.833  1.00 28.57 ? 265 LEU A CB  1 
ATOM   1327 C CG  . LEU A 1 177 ? 116.026 37.247 61.751  1.00 27.30 ? 265 LEU A CG  1 
ATOM   1328 C CD1 . LEU A 1 177 ? 114.880 37.999 62.376  1.00 27.29 ? 265 LEU A CD1 1 
ATOM   1329 C CD2 . LEU A 1 177 ? 116.904 36.636 62.828  1.00 27.11 ? 265 LEU A CD2 1 
ATOM   1330 N N   . ILE A 1 178 ? 115.485 34.215 58.120  1.00 28.79 ? 266 ILE A N   1 
ATOM   1331 C CA  . ILE A 1 178 ? 114.837 33.075 57.485  1.00 29.09 ? 266 ILE A CA  1 
ATOM   1332 C C   . ILE A 1 178 ? 115.808 31.988 57.025  1.00 29.62 ? 266 ILE A C   1 
ATOM   1333 O O   . ILE A 1 178 ? 115.453 31.110 56.235  1.00 29.83 ? 266 ILE A O   1 
ATOM   1334 C CB  . ILE A 1 178 ? 113.908 33.490 56.316  1.00 28.70 ? 266 ILE A CB  1 
ATOM   1335 C CG1 . ILE A 1 178 ? 114.596 34.489 55.396  1.00 29.74 ? 266 ILE A CG1 1 
ATOM   1336 C CG2 . ILE A 1 178 ? 112.635 34.054 56.859  1.00 29.28 ? 266 ILE A CG2 1 
ATOM   1337 C CD1 . ILE A 1 178 ? 113.729 34.914 54.227  1.00 30.34 ? 266 ILE A CD1 1 
ATOM   1338 N N   . TYR A 1 179 ? 117.040 32.060 57.528  1.00 30.03 ? 267 TYR A N   1 
ATOM   1339 C CA  . TYR A 1 179 ? 118.068 31.053 57.262  1.00 29.82 ? 267 TYR A CA  1 
ATOM   1340 C C   . TYR A 1 179 ? 118.528 30.495 58.596  1.00 29.90 ? 267 TYR A C   1 
ATOM   1341 O O   . TYR A 1 179 ? 119.555 29.838 58.670  1.00 30.94 ? 267 TYR A O   1 
ATOM   1342 C CB  . TYR A 1 179 ? 119.298 31.615 56.544  1.00 29.04 ? 267 TYR A CB  1 
ATOM   1343 C CG  . TYR A 1 179 ? 119.065 32.026 55.119  1.00 29.45 ? 267 TYR A CG  1 
ATOM   1344 C CD1 . TYR A 1 179 ? 118.581 33.299 54.811  1.00 29.18 ? 267 TYR A CD1 1 
ATOM   1345 C CD2 . TYR A 1 179 ? 119.300 31.127 54.069  1.00 29.03 ? 267 TYR A CD2 1 
ATOM   1346 C CE1 . TYR A 1 179 ? 118.330 33.673 53.487  1.00 29.56 ? 267 TYR A CE1 1 
ATOM   1347 C CE2 . TYR A 1 179 ? 119.054 31.485 52.748  1.00 29.57 ? 267 TYR A CE2 1 
ATOM   1348 C CZ  . TYR A 1 179 ? 118.565 32.762 52.461  1.00 29.72 ? 267 TYR A CZ  1 
ATOM   1349 O OH  . TYR A 1 179 ? 118.276 33.112 51.164  1.00 28.97 ? 267 TYR A OH  1 
ATOM   1350 N N   . SER A 1 180 ? 117.772 30.766 59.652  1.00 30.41 ? 268 SER A N   1 
ATOM   1351 C CA  . SER A 1 180 ? 118.119 30.288 60.989  1.00 31.24 ? 268 SER A CA  1 
ATOM   1352 C C   . SER A 1 180 ? 117.903 28.775 61.141  1.00 31.76 ? 268 SER A C   1 
ATOM   1353 O O   . SER A 1 180 ? 117.096 28.173 60.432  1.00 31.29 ? 268 SER A O   1 
ATOM   1354 C CB  . SER A 1 180 ? 117.276 31.046 62.036  1.00 31.28 ? 268 SER A CB  1 
ATOM   1355 O OG  . SER A 1 180 ? 117.677 30.766 63.372  1.00 31.01 ? 268 SER A OG  1 
ATOM   1356 N N   . MET A 1 181 ? 118.642 28.170 62.062  1.00 33.01 ? 269 MET A N   1 
ATOM   1357 C CA  . MET A 1 181 ? 118.495 26.749 62.346  1.00 34.78 ? 269 MET A CA  1 
ATOM   1358 C C   . MET A 1 181 ? 117.395 26.563 63.397  1.00 35.12 ? 269 MET A C   1 
ATOM   1359 O O   . MET A 1 181 ? 116.799 25.494 63.490  1.00 35.99 ? 269 MET A O   1 
ATOM   1360 C CB  . MET A 1 181 ? 119.789 26.165 62.916  1.00 36.96 ? 269 MET A CB  1 
ATOM   1361 C CG  . MET A 1 181 ? 121.009 26.244 62.017  1.00 38.93 ? 269 MET A CG  1 
ATOM   1362 S SD  . MET A 1 181 ? 120.885 25.218 60.544  1.00 42.66 ? 269 MET A SD  1 
ATOM   1363 C CE  . MET A 1 181 ? 120.855 23.529 61.297  1.00 41.52 ? 269 MET A CE  1 
ATOM   1364 N N   . ASP A 1 182 ? 117.136 27.598 64.194  1.00 34.87 ? 270 ASP A N   1 
ATOM   1365 C CA  . ASP A 1 182 ? 116.128 27.524 65.246  1.00 34.83 ? 270 ASP A CA  1 
ATOM   1366 C C   . ASP A 1 182 ? 114.715 27.618 64.697  1.00 34.83 ? 270 ASP A C   1 
ATOM   1367 O O   . ASP A 1 182 ? 114.328 28.635 64.112  1.00 35.17 ? 270 ASP A O   1 
ATOM   1368 C CB  . ASP A 1 182 ? 116.357 28.635 66.253  1.00 35.50 ? 270 ASP A CB  1 
ATOM   1369 C CG  . ASP A 1 182 ? 115.365 28.600 67.377  1.00 36.96 ? 270 ASP A CG  1 
ATOM   1370 O OD1 . ASP A 1 182 ? 115.375 27.612 68.142  1.00 37.38 ? 270 ASP A OD1 1 
ATOM   1371 O OD2 . ASP A 1 182 ? 114.570 29.560 67.487  1.00 37.79 ? 270 ASP A OD2 1 
ATOM   1372 N N   . THR A 1 183 ? 113.940 26.557 64.901  1.00 34.70 ? 271 THR A N   1 
ATOM   1373 C CA  . THR A 1 183 ? 112.571 26.510 64.405  1.00 34.35 ? 271 THR A CA  1 
ATOM   1374 C C   . THR A 1 183 ? 111.669 27.601 64.971  1.00 34.26 ? 271 THR A C   1 
ATOM   1375 O O   . THR A 1 183 ? 110.957 28.260 64.212  1.00 34.41 ? 271 THR A O   1 
ATOM   1376 C CB  . THR A 1 183 ? 111.937 25.116 64.663  1.00 34.28 ? 271 THR A CB  1 
ATOM   1377 O OG1 . THR A 1 183 ? 112.679 24.127 63.936  1.00 32.88 ? 271 THR A OG1 1 
ATOM   1378 C CG2 . THR A 1 183 ? 110.457 25.084 64.207  1.00 34.03 ? 271 THR A CG2 1 
ATOM   1379 N N   . GLU A 1 184 ? 111.695 27.811 66.283  1.00 33.95 ? 272 GLU A N   1 
ATOM   1380 C CA  . GLU A 1 184 ? 110.851 28.844 66.857  1.00 34.29 ? 272 GLU A CA  1 
ATOM   1381 C C   . GLU A 1 184 ? 111.141 30.202 66.194  1.00 34.61 ? 272 GLU A C   1 
ATOM   1382 O O   . GLU A 1 184 ? 110.218 30.883 65.743  1.00 34.37 ? 272 GLU A O   1 
ATOM   1383 C CB  . GLU A 1 184 ? 111.060 28.900 68.359  1.00 35.02 ? 272 GLU A CB  1 
ATOM   1384 C CG  . GLU A 1 184 ? 109.756 28.848 69.131  1.00 38.19 ? 272 GLU A CG  1 
ATOM   1385 C CD  . GLU A 1 184 ? 109.969 28.589 70.615  1.00 39.75 ? 272 GLU A CD  1 
ATOM   1386 O OE1 . GLU A 1 184 ? 110.609 27.562 70.936  1.00 39.96 ? 272 GLU A OE1 1 
ATOM   1387 O OE2 . GLU A 1 184 ? 109.498 29.401 71.450  1.00 40.26 ? 272 GLU A OE2 1 
ATOM   1388 N N   . THR A 1 185 ? 112.420 30.575 66.110  1.00 34.64 ? 273 THR A N   1 
ATOM   1389 C CA  . THR A 1 185 ? 112.833 31.831 65.472  1.00 34.32 ? 273 THR A CA  1 
ATOM   1390 C C   . THR A 1 185 ? 112.361 31.864 64.024  1.00 34.43 ? 273 THR A C   1 
ATOM   1391 O O   . THR A 1 185 ? 111.694 32.805 63.582  1.00 35.00 ? 273 THR A O   1 
ATOM   1392 C CB  . THR A 1 185 ? 114.373 31.990 65.414  1.00 34.00 ? 273 THR A CB  1 
ATOM   1393 O OG1 . THR A 1 185 ? 114.909 32.181 66.727  1.00 33.71 ? 273 THR A OG1 1 
ATOM   1394 C CG2 . THR A 1 185 ? 114.737 33.186 64.546  1.00 33.83 ? 273 THR A CG2 1 
ATOM   1395 N N   . LEU A 1 186 ? 112.742 30.829 63.285  1.00 34.05 ? 274 LEU A N   1 
ATOM   1396 C CA  . LEU A 1 186 ? 112.391 30.700 61.880  1.00 32.98 ? 274 LEU A CA  1 
ATOM   1397 C C   . LEU A 1 186 ? 110.891 30.918 61.675  1.00 32.68 ? 274 LEU A C   1 
ATOM   1398 O O   . LEU A 1 186 ? 110.477 31.720 60.833  1.00 33.04 ? 274 LEU A O   1 
ATOM   1399 C CB  . LEU A 1 186 ? 112.765 29.310 61.403  1.00 32.82 ? 274 LEU A CB  1 
ATOM   1400 C CG  . LEU A 1 186 ? 112.961 29.059 59.910  1.00 33.55 ? 274 LEU A CG  1 
ATOM   1401 C CD1 . LEU A 1 186 ? 112.743 27.559 59.674  1.00 32.85 ? 274 LEU A CD1 1 
ATOM   1402 C CD2 . LEU A 1 186 ? 111.982 29.862 59.065  1.00 34.28 ? 274 LEU A CD2 1 
ATOM   1403 N N   . VAL A 1 187 ? 110.082 30.197 62.443  1.00 31.49 ? 275 VAL A N   1 
ATOM   1404 C CA  . VAL A 1 187 ? 108.641 30.326 62.337  1.00 30.87 ? 275 VAL A CA  1 
ATOM   1405 C C   . VAL A 1 187 ? 108.184 31.778 62.485  1.00 30.77 ? 275 VAL A C   1 
ATOM   1406 O O   . VAL A 1 187 ? 107.498 32.284 61.600  1.00 30.82 ? 275 VAL A O   1 
ATOM   1407 C CB  . VAL A 1 187 ? 107.914 29.421 63.382  1.00 30.91 ? 275 VAL A CB  1 
ATOM   1408 C CG1 . VAL A 1 187 ? 106.430 29.788 63.495  1.00 30.25 ? 275 VAL A CG1 1 
ATOM   1409 C CG2 . VAL A 1 187 ? 108.035 27.968 62.963  1.00 30.51 ? 275 VAL A CG2 1 
ATOM   1410 N N   . ASP A 1 188 ? 108.570 32.450 63.573  1.00 30.38 ? 276 ASP A N   1 
ATOM   1411 C CA  . ASP A 1 188 ? 108.140 33.832 63.786  1.00 30.25 ? 276 ASP A CA  1 
ATOM   1412 C C   . ASP A 1 188 ? 108.654 34.850 62.762  1.00 30.19 ? 276 ASP A C   1 
ATOM   1413 O O   . ASP A 1 188 ? 107.993 35.860 62.496  1.00 30.13 ? 276 ASP A O   1 
ATOM   1414 C CB  . ASP A 1 188 ? 108.468 34.308 65.210  1.00 29.60 ? 276 ASP A CB  1 
ATOM   1415 C CG  . ASP A 1 188 ? 107.510 33.740 66.259  1.00 30.56 ? 276 ASP A CG  1 
ATOM   1416 O OD1 . ASP A 1 188 ? 106.278 33.644 65.987  1.00 31.77 ? 276 ASP A OD1 1 
ATOM   1417 O OD2 . ASP A 1 188 ? 107.982 33.426 67.373  1.00 29.62 ? 276 ASP A OD2 1 
ATOM   1418 N N   . ALA A 1 189 ? 109.819 34.594 62.179  1.00 29.30 ? 277 ALA A N   1 
ATOM   1419 C CA  . ALA A 1 189 ? 110.340 35.507 61.180  1.00 28.78 ? 277 ALA A CA  1 
ATOM   1420 C C   . ALA A 1 189 ? 109.461 35.475 59.929  1.00 29.48 ? 277 ALA A C   1 
ATOM   1421 O O   . ALA A 1 189 ? 109.262 36.503 59.281  1.00 29.84 ? 277 ALA A O   1 
ATOM   1422 C CB  . ALA A 1 189 ? 111.753 35.142 60.827  1.00 28.36 ? 277 ALA A CB  1 
ATOM   1423 N N   . CYS A 1 190 ? 108.945 34.294 59.586  1.00 29.66 ? 278 CYS A N   1 
ATOM   1424 C CA  . CYS A 1 190 ? 108.082 34.144 58.420  1.00 29.81 ? 278 CYS A CA  1 
ATOM   1425 C C   . CYS A 1 190 ? 106.747 34.848 58.645  1.00 30.79 ? 278 CYS A C   1 
ATOM   1426 O O   . CYS A 1 190 ? 106.256 35.560 57.763  1.00 31.49 ? 278 CYS A O   1 
ATOM   1427 C CB  . CYS A 1 190 ? 107.860 32.657 58.101  1.00 30.38 ? 278 CYS A CB  1 
ATOM   1428 S SG  . CYS A 1 190 ? 109.295 31.832 57.356  1.00 27.91 ? 278 CYS A SG  1 
ATOM   1429 N N   . TRP A 1 191 ? 106.156 34.653 59.822  1.00 30.94 ? 279 TRP A N   1 
ATOM   1430 C CA  . TRP A 1 191 ? 104.900 35.317 60.135  1.00 30.47 ? 279 TRP A CA  1 
ATOM   1431 C C   . TRP A 1 191 ? 105.064 36.829 60.051  1.00 30.19 ? 279 TRP A C   1 
ATOM   1432 O O   . TRP A 1 191 ? 104.142 37.545 59.648  1.00 30.12 ? 279 TRP A O   1 
ATOM   1433 C CB  . TRP A 1 191 ? 104.419 34.950 61.541  1.00 30.47 ? 279 TRP A CB  1 
ATOM   1434 C CG  . TRP A 1 191 ? 103.650 33.699 61.592  1.00 29.07 ? 279 TRP A CG  1 
ATOM   1435 C CD1 . TRP A 1 191 ? 104.030 32.526 62.165  1.00 28.82 ? 279 TRP A CD1 1 
ATOM   1436 C CD2 . TRP A 1 191 ? 102.348 33.478 61.035  1.00 29.06 ? 279 TRP A CD2 1 
ATOM   1437 N NE1 . TRP A 1 191 ? 103.046 31.580 62.001  1.00 29.04 ? 279 TRP A NE1 1 
ATOM   1438 C CE2 . TRP A 1 191 ? 102.003 32.140 61.308  1.00 29.07 ? 279 TRP A CE2 1 
ATOM   1439 C CE3 . TRP A 1 191 ? 101.441 34.283 60.329  1.00 28.35 ? 279 TRP A CE3 1 
ATOM   1440 C CZ2 . TRP A 1 191 ? 100.792 31.587 60.900  1.00 29.29 ? 279 TRP A CZ2 1 
ATOM   1441 C CZ3 . TRP A 1 191 ? 100.240 33.734 59.925  1.00 28.58 ? 279 TRP A CZ3 1 
ATOM   1442 C CH2 . TRP A 1 191 ? 99.923  32.403 60.214  1.00 29.63 ? 279 TRP A CH2 1 
ATOM   1443 N N   . ALA A 1 192 ? 106.238 37.308 60.439  1.00 29.86 ? 280 ALA A N   1 
ATOM   1444 C CA  . ALA A 1 192 ? 106.495 38.736 60.418  1.00 31.12 ? 280 ALA A CA  1 
ATOM   1445 C C   . ALA A 1 192 ? 106.558 39.253 58.983  1.00 31.42 ? 280 ALA A C   1 
ATOM   1446 O O   . ALA A 1 192 ? 106.032 40.330 58.672  1.00 30.95 ? 280 ALA A O   1 
ATOM   1447 C CB  . ALA A 1 192 ? 107.792 39.051 61.166  1.00 30.59 ? 280 ALA A CB  1 
ATOM   1448 N N   . ILE A 1 193 ? 107.192 38.477 58.112  1.00 31.74 ? 281 ILE A N   1 
ATOM   1449 C CA  . ILE A 1 193 ? 107.311 38.867 56.717  1.00 32.41 ? 281 ILE A CA  1 
ATOM   1450 C C   . ILE A 1 193 ? 105.945 38.853 56.072  1.00 32.89 ? 281 ILE A C   1 
ATOM   1451 O O   . ILE A 1 193 ? 105.639 39.720 55.259  1.00 33.03 ? 281 ILE A O   1 
ATOM   1452 C CB  . ILE A 1 193 ? 108.284 37.934 55.945  1.00 32.47 ? 281 ILE A CB  1 
ATOM   1453 C CG1 . ILE A 1 193 ? 109.706 38.124 56.491  1.00 32.10 ? 281 ILE A CG1 1 
ATOM   1454 C CG2 . ILE A 1 193 ? 108.234 38.226 54.447  1.00 31.29 ? 281 ILE A CG2 1 
ATOM   1455 C CD1 . ILE A 1 193 ? 110.724 37.198 55.896  1.00 32.72 ? 281 ILE A CD1 1 
ATOM   1456 N N   . SER A 1 194 ? 105.112 37.888 56.452  1.00 33.88 ? 282 SER A N   1 
ATOM   1457 C CA  . SER A 1 194 ? 103.769 37.809 55.889  1.00 35.16 ? 282 SER A CA  1 
ATOM   1458 C C   . SER A 1 194 ? 102.917 39.002 56.329  1.00 35.24 ? 282 SER A C   1 
ATOM   1459 O O   . SER A 1 194 ? 102.038 39.427 55.597  1.00 35.81 ? 282 SER A O   1 
ATOM   1460 C CB  . SER A 1 194 ? 103.081 36.483 56.275  1.00 35.69 ? 282 SER A CB  1 
ATOM   1461 O OG  . SER A 1 194 ? 102.818 36.396 57.663  1.00 37.10 ? 282 SER A OG  1 
ATOM   1462 N N   . TYR A 1 195 ? 103.177 39.546 57.514  1.00 35.69 ? 283 TYR A N   1 
ATOM   1463 C CA  . TYR A 1 195 ? 102.423 40.703 58.000  1.00 36.67 ? 283 TYR A CA  1 
ATOM   1464 C C   . TYR A 1 195 ? 102.816 41.952 57.218  1.00 37.42 ? 283 TYR A C   1 
ATOM   1465 O O   . TYR A 1 195 ? 101.986 42.812 56.924  1.00 38.04 ? 283 TYR A O   1 
ATOM   1466 C CB  . TYR A 1 195 ? 102.698 40.934 59.485  1.00 36.52 ? 283 TYR A CB  1 
ATOM   1467 C CG  . TYR A 1 195 ? 102.204 39.830 60.391  1.00 37.07 ? 283 TYR A CG  1 
ATOM   1468 C CD1 . TYR A 1 195 ? 101.182 38.968 59.995  1.00 37.14 ? 283 TYR A CD1 1 
ATOM   1469 C CD2 . TYR A 1 195 ? 102.768 39.640 61.643  1.00 36.90 ? 283 TYR A CD2 1 
ATOM   1470 C CE1 . TYR A 1 195 ? 100.742 37.940 60.824  1.00 37.01 ? 283 TYR A CE1 1 
ATOM   1471 C CE2 . TYR A 1 195 ? 102.340 38.622 62.473  1.00 37.74 ? 283 TYR A CE2 1 
ATOM   1472 C CZ  . TYR A 1 195 ? 101.329 37.773 62.062  1.00 37.31 ? 283 TYR A CZ  1 
ATOM   1473 O OH  . TYR A 1 195 ? 100.922 36.763 62.910  1.00 37.54 ? 283 TYR A OH  1 
ATOM   1474 N N   . LEU A 1 196 ? 104.094 42.055 56.890  1.00 38.15 ? 284 LEU A N   1 
ATOM   1475 C CA  . LEU A 1 196 ? 104.576 43.195 56.132  1.00 39.19 ? 284 LEU A CA  1 
ATOM   1476 C C   . LEU A 1 196 ? 104.174 43.099 54.661  1.00 40.10 ? 284 LEU A C   1 
ATOM   1477 O O   . LEU A 1 196 ? 104.222 44.095 53.943  1.00 40.72 ? 284 LEU A O   1 
ATOM   1478 C CB  . LEU A 1 196 ? 106.097 43.303 56.241  1.00 38.46 ? 284 LEU A CB  1 
ATOM   1479 C CG  . LEU A 1 196 ? 106.688 43.623 57.609  1.00 37.89 ? 284 LEU A CG  1 
ATOM   1480 C CD1 . LEU A 1 196 ? 108.190 43.736 57.485  1.00 36.38 ? 284 LEU A CD1 1 
ATOM   1481 C CD2 . LEU A 1 196 ? 106.105 44.929 58.129  1.00 38.82 ? 284 LEU A CD2 1 
ATOM   1482 N N   . SER A 1 197 ? 103.770 41.905 54.226  1.00 40.70 ? 285 SER A N   1 
ATOM   1483 C CA  . SER A 1 197 ? 103.355 41.670 52.842  1.00 41.78 ? 285 SER A CA  1 
ATOM   1484 C C   . SER A 1 197 ? 101.873 41.900 52.564  1.00 42.37 ? 285 SER A C   1 
ATOM   1485 O O   . SER A 1 197 ? 101.479 42.034 51.415  1.00 42.35 ? 285 SER A O   1 
ATOM   1486 C CB  . SER A 1 197 ? 103.695 40.248 52.435  1.00 42.03 ? 285 SER A CB  1 
ATOM   1487 O OG  . SER A 1 197 ? 105.076 40.028 52.581  1.00 43.38 ? 285 SER A OG  1 
ATOM   1488 N N   . ASP A 1 198 ? 101.053 41.917 53.609  1.00 43.63 ? 286 ASP A N   1 
ATOM   1489 C CA  . ASP A 1 198 ? 99.621  42.138 53.447  1.00 45.19 ? 286 ASP A CA  1 
ATOM   1490 C C   . ASP A 1 198 ? 99.313  43.598 53.126  1.00 45.56 ? 286 ASP A C   1 
ATOM   1491 O O   . ASP A 1 198 ? 98.218  44.076 53.402  1.00 46.11 ? 286 ASP A O   1 
ATOM   1492 C CB  . ASP A 1 198 ? 98.849  41.749 54.725  1.00 46.10 ? 286 ASP A CB  1 
ATOM   1493 C CG  . ASP A 1 198 ? 99.350  42.486 55.984  1.00 46.79 ? 286 ASP A CG  1 
ATOM   1494 O OD1 . ASP A 1 198 ? 99.835  43.645 55.892  1.00 47.16 ? 286 ASP A OD1 1 
ATOM   1495 O OD2 . ASP A 1 198 ? 99.222  41.906 57.083  1.00 46.83 ? 286 ASP A OD2 1 
ATOM   1496 N N   . GLY A 1 199 ? 100.267 44.307 52.542  1.00 46.07 ? 287 GLY A N   1 
ATOM   1497 C CA  . GLY A 1 199 ? 100.030 45.707 52.234  1.00 46.91 ? 287 GLY A CA  1 
ATOM   1498 C C   . GLY A 1 199 ? 99.961  46.100 50.767  1.00 47.34 ? 287 GLY A C   1 
ATOM   1499 O O   . GLY A 1 199 ? 99.745  45.248 49.896  1.00 47.21 ? 287 GLY A O   1 
ATOM   1500 N N   . PRO A 1 200 ? 100.125 47.410 50.470  1.00 47.90 ? 288 PRO A N   1 
ATOM   1501 C CA  . PRO A 1 200 ? 100.100 48.030 49.136  1.00 47.56 ? 288 PRO A CA  1 
ATOM   1502 C C   . PRO A 1 200 ? 101.304 47.637 48.290  1.00 47.82 ? 288 PRO A C   1 
ATOM   1503 O O   . PRO A 1 200 ? 102.232 46.998 48.783  1.00 47.54 ? 288 PRO A O   1 
ATOM   1504 C CB  . PRO A 1 200 ? 100.091 49.515 49.467  1.00 47.11 ? 288 PRO A CB  1 
ATOM   1505 C CG  . PRO A 1 200 ? 100.977 49.554 50.695  1.00 47.15 ? 288 PRO A CG  1 
ATOM   1506 C CD  . PRO A 1 200 ? 100.313 48.459 51.496  1.00 47.50 ? 288 PRO A CD  1 
ATOM   1507 N N   . GLN A 1 201 ? 101.286 48.029 47.020  1.00 48.39 ? 289 GLN A N   1 
ATOM   1508 C CA  . GLN A 1 201 ? 102.382 47.719 46.105  1.00 48.57 ? 289 GLN A CA  1 
ATOM   1509 C C   . GLN A 1 201 ? 103.736 48.144 46.642  1.00 47.44 ? 289 GLN A C   1 
ATOM   1510 O O   . GLN A 1 201 ? 104.744 47.476 46.401  1.00 47.58 ? 289 GLN A O   1 
ATOM   1511 C CB  . GLN A 1 201 ? 102.140 48.370 44.743  1.00 50.10 ? 289 GLN A CB  1 
ATOM   1512 C CG  . GLN A 1 201 ? 100.964 47.756 44.007  1.00 53.40 ? 289 GLN A CG  1 
ATOM   1513 C CD  . GLN A 1 201 ? 100.796 48.309 42.610  1.00 55.14 ? 289 GLN A CD  1 
ATOM   1514 O OE1 . GLN A 1 201 ? 101.741 48.287 41.810  1.00 56.16 ? 289 GLN A OE1 1 
ATOM   1515 N NE2 . GLN A 1 201 ? 99.587  48.801 42.298  1.00 55.23 ? 289 GLN A NE2 1 
ATOM   1516 N N   . GLU A 1 202 ? 103.760 49.252 47.372  1.00 45.97 ? 290 GLU A N   1 
ATOM   1517 C CA  . GLU A 1 202 ? 105.009 49.731 47.941  1.00 44.80 ? 290 GLU A CA  1 
ATOM   1518 C C   . GLU A 1 202 ? 105.607 48.660 48.848  1.00 43.72 ? 290 GLU A C   1 
ATOM   1519 O O   . GLU A 1 202 ? 106.799 48.364 48.764  1.00 44.45 ? 290 GLU A O   1 
ATOM   1520 C CB  . GLU A 1 202 ? 104.780 51.018 48.738  1.00 44.66 ? 290 GLU A CB  1 
ATOM   1521 N N   . ALA A 1 203 ? 104.772 48.071 49.702  1.00 42.16 ? 291 ALA A N   1 
ATOM   1522 C CA  . ALA A 1 203 ? 105.221 47.041 50.629  1.00 40.40 ? 291 ALA A CA  1 
ATOM   1523 C C   . ALA A 1 203 ? 105.674 45.795 49.896  1.00 39.59 ? 291 ALA A C   1 
ATOM   1524 O O   . ALA A 1 203 ? 106.688 45.208 50.258  1.00 40.13 ? 291 ALA A O   1 
ATOM   1525 C CB  . ALA A 1 203 ? 104.108 46.691 51.615  1.00 40.60 ? 291 ALA A CB  1 
ATOM   1526 N N   . ILE A 1 204 ? 104.931 45.389 48.870  1.00 38.26 ? 292 ILE A N   1 
ATOM   1527 C CA  . ILE A 1 204 ? 105.293 44.200 48.113  1.00 37.45 ? 292 ILE A CA  1 
ATOM   1528 C C   . ILE A 1 204 ? 106.643 44.389 47.424  1.00 37.62 ? 292 ILE A C   1 
ATOM   1529 O O   . ILE A 1 204 ? 107.451 43.455 47.342  1.00 38.21 ? 292 ILE A O   1 
ATOM   1530 C CB  . ILE A 1 204 ? 104.233 43.857 47.041  1.00 37.07 ? 292 ILE A CB  1 
ATOM   1531 C CG1 . ILE A 1 204 ? 102.884 43.579 47.702  1.00 36.49 ? 292 ILE A CG1 1 
ATOM   1532 C CG2 . ILE A 1 204 ? 104.667 42.633 46.246  1.00 36.72 ? 292 ILE A CG2 1 
ATOM   1533 C CD1 . ILE A 1 204 ? 101.813 43.120 46.724  1.00 35.83 ? 292 ILE A CD1 1 
ATOM   1534 N N   . GLN A 1 205 ? 106.902 45.601 46.946  1.00 36.76 ? 293 GLN A N   1 
ATOM   1535 C CA  . GLN A 1 205 ? 108.156 45.857 46.259  1.00 36.08 ? 293 GLN A CA  1 
ATOM   1536 C C   . GLN A 1 205 ? 109.341 45.800 47.218  1.00 35.90 ? 293 GLN A C   1 
ATOM   1537 O O   . GLN A 1 205 ? 110.437 45.384 46.834  1.00 35.39 ? 293 GLN A O   1 
ATOM   1538 C CB  . GLN A 1 205 ? 108.124 47.216 45.566  1.00 35.82 ? 293 GLN A CB  1 
ATOM   1539 C CG  . GLN A 1 205 ? 109.215 47.376 44.526  1.00 34.43 ? 293 GLN A CG  1 
ATOM   1540 C CD  . GLN A 1 205 ? 109.103 46.326 43.440  1.00 34.15 ? 293 GLN A CD  1 
ATOM   1541 O OE1 . GLN A 1 205 ? 108.031 46.123 42.871  1.00 34.09 ? 293 GLN A OE1 1 
ATOM   1542 N NE2 . GLN A 1 205 ? 110.206 45.656 43.142  1.00 33.79 ? 293 GLN A NE2 1 
ATOM   1543 N N   . ALA A 1 206 ? 109.120 46.214 48.464  1.00 35.25 ? 294 ALA A N   1 
ATOM   1544 C CA  . ALA A 1 206 ? 110.186 46.194 49.455  1.00 34.46 ? 294 ALA A CA  1 
ATOM   1545 C C   . ALA A 1 206 ? 110.637 44.749 49.699  1.00 34.11 ? 294 ALA A C   1 
ATOM   1546 O O   . ALA A 1 206 ? 111.831 44.456 49.637  1.00 33.81 ? 294 ALA A O   1 
ATOM   1547 C CB  . ALA A 1 206 ? 109.710 46.844 50.750  1.00 34.10 ? 294 ALA A CB  1 
ATOM   1548 N N   . VAL A 1 207 ? 109.686 43.848 49.957  1.00 33.30 ? 295 VAL A N   1 
ATOM   1549 C CA  . VAL A 1 207 ? 110.020 42.446 50.185  1.00 32.80 ? 295 VAL A CA  1 
ATOM   1550 C C   . VAL A 1 207 ? 110.771 41.890 48.978  1.00 32.99 ? 295 VAL A C   1 
ATOM   1551 O O   . VAL A 1 207 ? 111.759 41.170 49.125  1.00 32.23 ? 295 VAL A O   1 
ATOM   1552 C CB  . VAL A 1 207 ? 108.764 41.574 50.403  1.00 32.26 ? 295 VAL A CB  1 
ATOM   1553 C CG1 . VAL A 1 207 ? 109.175 40.112 50.578  1.00 31.32 ? 295 VAL A CG1 1 
ATOM   1554 C CG2 . VAL A 1 207 ? 108.013 42.046 51.617  1.00 31.40 ? 295 VAL A CG2 1 
ATOM   1555 N N   . ILE A 1 208 ? 110.290 42.229 47.787  1.00 33.03 ? 296 ILE A N   1 
ATOM   1556 C CA  . ILE A 1 208 ? 110.921 41.767 46.562  1.00 33.68 ? 296 ILE A CA  1 
ATOM   1557 C C   . ILE A 1 208 ? 112.370 42.235 46.402  1.00 34.36 ? 296 ILE A C   1 
ATOM   1558 O O   . ILE A 1 208 ? 113.242 41.438 46.038  1.00 34.83 ? 296 ILE A O   1 
ATOM   1559 C CB  . ILE A 1 208 ? 110.104 42.203 45.333  1.00 33.47 ? 296 ILE A CB  1 
ATOM   1560 C CG1 . ILE A 1 208 ? 108.787 41.430 45.311  1.00 33.27 ? 296 ILE A CG1 1 
ATOM   1561 C CG2 . ILE A 1 208 ? 110.885 41.958 44.050  1.00 32.81 ? 296 ILE A CG2 1 
ATOM   1562 C CD1 . ILE A 1 208 ? 107.910 41.749 44.129  1.00 33.07 ? 296 ILE A CD1 1 
ATOM   1563 N N   . ASP A 1 209 ? 112.625 43.515 46.677  1.00 34.74 ? 297 ASP A N   1 
ATOM   1564 C CA  . ASP A 1 209 ? 113.971 44.082 46.555  1.00 34.65 ? 297 ASP A CA  1 
ATOM   1565 C C   . ASP A 1 209 ? 114.988 43.576 47.576  1.00 34.59 ? 297 ASP A C   1 
ATOM   1566 O O   . ASP A 1 209 ? 116.181 43.604 47.308  1.00 35.42 ? 297 ASP A O   1 
ATOM   1567 C CB  . ASP A 1 209 ? 113.941 45.616 46.629  1.00 35.02 ? 297 ASP A CB  1 
ATOM   1568 C CG  . ASP A 1 209 ? 113.139 46.251 45.494  1.00 35.76 ? 297 ASP A CG  1 
ATOM   1569 O OD1 . ASP A 1 209 ? 113.268 45.799 44.333  1.00 35.04 ? 297 ASP A OD1 1 
ATOM   1570 O OD2 . ASP A 1 209 ? 112.394 47.223 45.762  1.00 36.29 ? 297 ASP A OD2 1 
ATOM   1571 N N   . VAL A 1 210 ? 114.541 43.127 48.744  1.00 34.17 ? 298 VAL A N   1 
ATOM   1572 C CA  . VAL A 1 210 ? 115.484 42.622 49.730  1.00 33.81 ? 298 VAL A CA  1 
ATOM   1573 C C   . VAL A 1 210 ? 115.703 41.127 49.447  1.00 33.87 ? 298 VAL A C   1 
ATOM   1574 O O   . VAL A 1 210 ? 116.175 40.378 50.290  1.00 33.64 ? 298 VAL A O   1 
ATOM   1575 C CB  . VAL A 1 210 ? 114.962 42.863 51.177  1.00 33.34 ? 298 VAL A CB  1 
ATOM   1576 C CG1 . VAL A 1 210 ? 113.822 41.939 51.495  1.00 33.43 ? 298 VAL A CG1 1 
ATOM   1577 C CG2 . VAL A 1 210 ? 116.087 42.706 52.172  1.00 33.88 ? 298 VAL A CG2 1 
ATOM   1578 N N   . ARG A 1 211 ? 115.341 40.722 48.231  1.00 34.58 ? 299 ARG A N   1 
ATOM   1579 C CA  . ARG A 1 211 ? 115.472 39.352 47.721  1.00 35.72 ? 299 ARG A CA  1 
ATOM   1580 C C   . ARG A 1 211 ? 114.979 38.195 48.624  1.00 35.68 ? 299 ARG A C   1 
ATOM   1581 O O   . ARG A 1 211 ? 115.626 37.146 48.735  1.00 35.86 ? 299 ARG A O   1 
ATOM   1582 C CB  . ARG A 1 211 ? 116.931 39.124 47.277  1.00 36.96 ? 299 ARG A CB  1 
ATOM   1583 C CG  . ARG A 1 211 ? 117.420 40.166 46.239  1.00 38.75 ? 299 ARG A CG  1 
ATOM   1584 C CD  . ARG A 1 211 ? 118.830 39.894 45.686  1.00 40.58 ? 299 ARG A CD  1 
ATOM   1585 N NE  . ARG A 1 211 ? 119.896 40.003 46.687  1.00 42.33 ? 299 ARG A NE  1 
ATOM   1586 C CZ  . ARG A 1 211 ? 121.179 39.708 46.454  1.00 43.65 ? 299 ARG A CZ  1 
ATOM   1587 N NH1 . ARG A 1 211 ? 121.559 39.287 45.250  1.00 43.85 ? 299 ARG A NH1 1 
ATOM   1588 N NH2 . ARG A 1 211 ? 122.084 39.811 47.429  1.00 44.39 ? 299 ARG A NH2 1 
ATOM   1589 N N   . ILE A 1 212 ? 113.811 38.382 49.236  1.00 34.82 ? 300 ILE A N   1 
ATOM   1590 C CA  . ILE A 1 212 ? 113.219 37.378 50.113  1.00 34.17 ? 300 ILE A CA  1 
ATOM   1591 C C   . ILE A 1 212 ? 112.500 36.230 49.387  1.00 33.53 ? 300 ILE A C   1 
ATOM   1592 O O   . ILE A 1 212 ? 112.760 35.062 49.665  1.00 34.41 ? 300 ILE A O   1 
ATOM   1593 C CB  . ILE A 1 212 ? 112.218 38.035 51.115  1.00 34.70 ? 300 ILE A CB  1 
ATOM   1594 C CG1 . ILE A 1 212 ? 112.986 38.756 52.213  1.00 34.63 ? 300 ILE A CG1 1 
ATOM   1595 C CG2 . ILE A 1 212 ? 111.264 36.986 51.711  1.00 34.50 ? 300 ILE A CG2 1 
ATOM   1596 C CD1 . ILE A 1 212 ? 112.085 39.413 53.232  1.00 34.71 ? 300 ILE A CD1 1 
ATOM   1597 N N   . PRO A 1 213 ? 111.584 36.547 48.449  1.00 32.46 ? 301 PRO A N   1 
ATOM   1598 C CA  . PRO A 1 213 ? 110.827 35.531 47.699  1.00 31.73 ? 301 PRO A CA  1 
ATOM   1599 C C   . PRO A 1 213 ? 111.505 34.208 47.280  1.00 31.32 ? 301 PRO A C   1 
ATOM   1600 O O   . PRO A 1 213 ? 110.911 33.144 47.422  1.00 31.36 ? 301 PRO A O   1 
ATOM   1601 C CB  . PRO A 1 213 ? 110.259 36.339 46.517  1.00 30.95 ? 301 PRO A CB  1 
ATOM   1602 C CG  . PRO A 1 213 ? 111.084 37.652 46.536  1.00 31.14 ? 301 PRO A CG  1 
ATOM   1603 C CD  . PRO A 1 213 ? 111.187 37.886 47.995  1.00 31.16 ? 301 PRO A CD  1 
ATOM   1604 N N   . LYS A 1 214 ? 112.731 34.246 46.780  1.00 31.36 ? 302 LYS A N   1 
ATOM   1605 C CA  . LYS A 1 214 ? 113.373 32.997 46.395  1.00 31.99 ? 302 LYS A CA  1 
ATOM   1606 C C   . LYS A 1 214 ? 113.562 32.052 47.593  1.00 32.33 ? 302 LYS A C   1 
ATOM   1607 O O   . LYS A 1 214 ? 113.347 30.835 47.480  1.00 32.18 ? 302 LYS A O   1 
ATOM   1608 C CB  . LYS A 1 214 ? 114.723 33.259 45.720  1.00 31.69 ? 302 LYS A CB  1 
ATOM   1609 C CG  . LYS A 1 214 ? 115.517 31.983 45.448  1.00 32.03 ? 302 LYS A CG  1 
ATOM   1610 C CD  . LYS A 1 214 ? 114.709 31.002 44.622  1.00 32.59 ? 302 LYS A CD  1 
ATOM   1611 C CE  . LYS A 1 214 ? 115.439 29.704 44.408  1.00 32.03 ? 302 LYS A CE  1 
ATOM   1612 N NZ  . LYS A 1 214 ? 114.602 28.792 43.592  1.00 33.02 ? 302 LYS A NZ  1 
ATOM   1613 N N   . ARG A 1 215 ? 113.976 32.609 48.730  1.00 32.06 ? 303 ARG A N   1 
ATOM   1614 C CA  . ARG A 1 215 ? 114.177 31.819 49.939  1.00 32.58 ? 303 ARG A CA  1 
ATOM   1615 C C   . ARG A 1 215 ? 112.822 31.336 50.428  1.00 32.68 ? 303 ARG A C   1 
ATOM   1616 O O   . ARG A 1 215 ? 112.634 30.149 50.715  1.00 32.66 ? 303 ARG A O   1 
ATOM   1617 C CB  . ARG A 1 215 ? 114.847 32.668 51.017  1.00 33.06 ? 303 ARG A CB  1 
ATOM   1618 C CG  . ARG A 1 215 ? 114.973 31.988 52.361  1.00 33.83 ? 303 ARG A CG  1 
ATOM   1619 C CD  . ARG A 1 215 ? 115.634 30.635 52.214  1.00 34.84 ? 303 ARG A CD  1 
ATOM   1620 N NE  . ARG A 1 215 ? 116.013 30.063 53.505  1.00 36.94 ? 303 ARG A NE  1 
ATOM   1621 C CZ  . ARG A 1 215 ? 116.446 28.816 53.680  1.00 36.08 ? 303 ARG A CZ  1 
ATOM   1622 N NH1 . ARG A 1 215 ? 116.553 27.999 52.644  1.00 36.03 ? 303 ARG A NH1 1 
ATOM   1623 N NH2 . ARG A 1 215 ? 116.770 28.386 54.892  1.00 35.19 ? 303 ARG A NH2 1 
ATOM   1624 N N   . LEU A 1 216 ? 111.886 32.280 50.507  1.00 32.68 ? 304 LEU A N   1 
ATOM   1625 C CA  . LEU A 1 216 ? 110.519 32.033 50.937  1.00 32.91 ? 304 LEU A CA  1 
ATOM   1626 C C   . LEU A 1 216 ? 109.968 30.824 50.196  1.00 32.59 ? 304 LEU A C   1 
ATOM   1627 O O   . LEU A 1 216 ? 109.228 30.023 50.752  1.00 32.36 ? 304 LEU A O   1 
ATOM   1628 C CB  . LEU A 1 216 ? 109.672 33.269 50.639  1.00 33.75 ? 304 LEU A CB  1 
ATOM   1629 C CG  . LEU A 1 216 ? 108.786 33.793 51.768  1.00 33.97 ? 304 LEU A CG  1 
ATOM   1630 C CD1 . LEU A 1 216 ? 109.621 34.033 53.017  1.00 34.25 ? 304 LEU A CD1 1 
ATOM   1631 C CD2 . LEU A 1 216 ? 108.120 35.079 51.311  1.00 34.56 ? 304 LEU A CD2 1 
ATOM   1632 N N   . VAL A 1 217 ? 110.336 30.686 48.931  1.00 32.62 ? 305 VAL A N   1 
ATOM   1633 C CA  . VAL A 1 217 ? 109.885 29.526 48.171  1.00 32.70 ? 305 VAL A CA  1 
ATOM   1634 C C   . VAL A 1 217 ? 110.557 28.237 48.648  1.00 32.72 ? 305 VAL A C   1 
ATOM   1635 O O   . VAL A 1 217 ? 109.893 27.218 48.784  1.00 33.63 ? 305 VAL A O   1 
ATOM   1636 C CB  . VAL A 1 217 ? 110.161 29.688 46.665  1.00 32.39 ? 305 VAL A CB  1 
ATOM   1637 C CG1 . VAL A 1 217 ? 109.816 28.394 45.921  1.00 30.40 ? 305 VAL A CG1 1 
ATOM   1638 C CG2 . VAL A 1 217 ? 109.344 30.855 46.124  1.00 31.43 ? 305 VAL A CG2 1 
ATOM   1639 N N   . GLU A 1 218 ? 111.864 28.276 48.899  1.00 32.31 ? 306 GLU A N   1 
ATOM   1640 C CA  . GLU A 1 218 ? 112.576 27.082 49.346  1.00 31.95 ? 306 GLU A CA  1 
ATOM   1641 C C   . GLU A 1 218 ? 111.969 26.603 50.654  1.00 32.67 ? 306 GLU A C   1 
ATOM   1642 O O   . GLU A 1 218 ? 112.010 25.414 50.970  1.00 32.57 ? 306 GLU A O   1 
ATOM   1643 C CB  . GLU A 1 218 ? 114.054 27.383 49.577  1.00 31.45 ? 306 GLU A CB  1 
ATOM   1644 C CG  . GLU A 1 218 ? 114.722 28.164 48.467  1.00 30.57 ? 306 GLU A CG  1 
ATOM   1645 C CD  . GLU A 1 218 ? 116.188 28.432 48.749  1.00 30.58 ? 306 GLU A CD  1 
ATOM   1646 O OE1 . GLU A 1 218 ? 116.512 28.809 49.894  1.00 30.41 ? 306 GLU A OE1 1 
ATOM   1647 O OE2 . GLU A 1 218 ? 117.016 28.284 47.822  1.00 30.47 ? 306 GLU A OE2 1 
ATOM   1648 N N   . LEU A 1 219 ? 111.408 27.539 51.414  1.00 32.83 ? 307 LEU A N   1 
ATOM   1649 C CA  . LEU A 1 219 ? 110.797 27.204 52.690  1.00 33.40 ? 307 LEU A CA  1 
ATOM   1650 C C   . LEU A 1 219 ? 109.430 26.518 52.598  1.00 33.85 ? 307 LEU A C   1 
ATOM   1651 O O   . LEU A 1 219 ? 108.962 25.946 53.582  1.00 33.31 ? 307 LEU A O   1 
ATOM   1652 C CB  . LEU A 1 219 ? 110.709 28.456 53.563  1.00 33.40 ? 307 LEU A CB  1 
ATOM   1653 C CG  . LEU A 1 219 ? 112.040 28.907 54.158  1.00 32.93 ? 307 LEU A CG  1 
ATOM   1654 C CD1 . LEU A 1 219 ? 111.896 30.196 54.954  1.00 32.26 ? 307 LEU A CD1 1 
ATOM   1655 C CD2 . LEU A 1 219 ? 112.525 27.789 55.055  1.00 32.78 ? 307 LEU A CD2 1 
ATOM   1656 N N   . LEU A 1 220 ? 108.791 26.573 51.430  1.00 34.83 ? 308 LEU A N   1 
ATOM   1657 C CA  . LEU A 1 220 ? 107.494 25.916 51.261  1.00 36.13 ? 308 LEU A CA  1 
ATOM   1658 C C   . LEU A 1 220 ? 107.667 24.403 51.426  1.00 36.93 ? 308 LEU A C   1 
ATOM   1659 O O   . LEU A 1 220 ? 106.751 23.702 51.863  1.00 37.27 ? 308 LEU A O   1 
ATOM   1660 C CB  . LEU A 1 220 ? 106.901 26.208 49.877  1.00 35.76 ? 308 LEU A CB  1 
ATOM   1661 C CG  . LEU A 1 220 ? 106.576 27.656 49.505  1.00 36.03 ? 308 LEU A CG  1 
ATOM   1662 C CD1 . LEU A 1 220 ? 106.127 27.673 48.061  1.00 35.48 ? 308 LEU A CD1 1 
ATOM   1663 C CD2 . LEU A 1 220 ? 105.491 28.242 50.429  1.00 35.86 ? 308 LEU A CD2 1 
ATOM   1664 N N   . SER A 1 221 ? 108.853 23.905 51.097  1.00 37.68 ? 309 SER A N   1 
ATOM   1665 C CA  . SER A 1 221 ? 109.116 22.477 51.202  1.00 38.67 ? 309 SER A CA  1 
ATOM   1666 C C   . SER A 1 221 ? 109.785 22.032 52.487  1.00 39.29 ? 309 SER A C   1 
ATOM   1667 O O   . SER A 1 221 ? 110.448 21.002 52.505  1.00 39.92 ? 309 SER A O   1 
ATOM   1668 C CB  . SER A 1 221 ? 109.965 22.018 50.030  1.00 38.59 ? 309 SER A CB  1 
ATOM   1669 O OG  . SER A 1 221 ? 111.179 22.740 50.005  1.00 40.16 ? 309 SER A OG  1 
ATOM   1670 N N   . HIS A 1 222 ? 109.619 22.807 53.550  1.00 39.79 ? 310 HIS A N   1 
ATOM   1671 C CA  . HIS A 1 222 ? 110.169 22.479 54.864  1.00 40.49 ? 310 HIS A CA  1 
ATOM   1672 C C   . HIS A 1 222 ? 109.279 21.324 55.394  1.00 41.44 ? 310 HIS A C   1 
ATOM   1673 O O   . HIS A 1 222 ? 108.202 21.094 54.855  1.00 41.46 ? 310 HIS A O   1 
ATOM   1674 C CB  . HIS A 1 222 ? 110.074 23.744 55.712  1.00 40.06 ? 310 HIS A CB  1 
ATOM   1675 C CG  . HIS A 1 222 ? 110.621 23.612 57.094  1.00 40.43 ? 310 HIS A CG  1 
ATOM   1676 N ND1 . HIS A 1 222 ? 109.996 22.875 58.077  1.00 40.99 ? 310 HIS A ND1 1 
ATOM   1677 C CD2 . HIS A 1 222 ? 111.700 24.184 57.676  1.00 39.94 ? 310 HIS A CD2 1 
ATOM   1678 C CE1 . HIS A 1 222 ? 110.668 23.004 59.209  1.00 40.91 ? 310 HIS A CE1 1 
ATOM   1679 N NE2 . HIS A 1 222 ? 111.706 23.792 58.992  1.00 40.16 ? 310 HIS A NE2 1 
ATOM   1680 N N   . GLU A 1 223 ? 109.698 20.578 56.411  1.00 42.62 ? 311 GLU A N   1 
ATOM   1681 C CA  . GLU A 1 223 ? 108.833 19.486 56.860  1.00 44.17 ? 311 GLU A CA  1 
ATOM   1682 C C   . GLU A 1 223 ? 107.849 19.836 57.964  1.00 44.21 ? 311 GLU A C   1 
ATOM   1683 O O   . GLU A 1 223 ? 106.955 19.039 58.279  1.00 44.55 ? 311 GLU A O   1 
ATOM   1684 C CB  . GLU A 1 223 ? 109.646 18.247 57.258  1.00 46.24 ? 311 GLU A CB  1 
ATOM   1685 C CG  . GLU A 1 223 ? 111.136 18.462 57.365  1.00 50.71 ? 311 GLU A CG  1 
ATOM   1686 C CD  . GLU A 1 223 ? 111.509 19.416 58.477  1.00 53.17 ? 311 GLU A CD  1 
ATOM   1687 O OE1 . GLU A 1 223 ? 111.408 19.018 59.669  1.00 54.19 ? 311 GLU A OE1 1 
ATOM   1688 O OE2 . GLU A 1 223 ? 111.891 20.566 58.145  1.00 54.34 ? 311 GLU A OE2 1 
ATOM   1689 N N   . SER A 1 224 ? 107.998 21.021 58.549  1.00 43.41 ? 312 SER A N   1 
ATOM   1690 C CA  . SER A 1 224 ? 107.075 21.458 59.592  1.00 42.54 ? 312 SER A CA  1 
ATOM   1691 C C   . SER A 1 224 ? 106.038 22.379 58.952  1.00 42.07 ? 312 SER A C   1 
ATOM   1692 O O   . SER A 1 224 ? 106.387 23.356 58.281  1.00 41.56 ? 312 SER A O   1 
ATOM   1693 C CB  . SER A 1 224 ? 107.820 22.208 60.711  1.00 42.75 ? 312 SER A CB  1 
ATOM   1694 O OG  . SER A 1 224 ? 106.958 22.580 61.780  1.00 41.76 ? 312 SER A OG  1 
ATOM   1695 N N   . THR A 1 225 ? 104.763 22.050 59.134  1.00 41.33 ? 313 THR A N   1 
ATOM   1696 C CA  . THR A 1 225 ? 103.716 22.882 58.586  1.00 40.49 ? 313 THR A CA  1 
ATOM   1697 C C   . THR A 1 225 ? 103.697 24.204 59.340  1.00 39.69 ? 313 THR A C   1 
ATOM   1698 O O   . THR A 1 225 ? 102.973 25.121 58.965  1.00 40.48 ? 313 THR A O   1 
ATOM   1699 C CB  . THR A 1 225 ? 102.339 22.210 58.681  1.00 40.79 ? 313 THR A CB  1 
ATOM   1700 O OG1 . THR A 1 225 ? 102.108 21.772 60.027  1.00 41.73 ? 313 THR A OG1 1 
ATOM   1701 C CG2 . THR A 1 225 ? 102.256 21.041 57.711  1.00 40.35 ? 313 THR A CG2 1 
ATOM   1702 N N   . LEU A 1 226 ? 104.500 24.311 60.396  1.00 38.38 ? 314 LEU A N   1 
ATOM   1703 C CA  . LEU A 1 226 ? 104.562 25.556 61.156  1.00 37.70 ? 314 LEU A CA  1 
ATOM   1704 C C   . LEU A 1 226 ? 105.333 26.597 60.353  1.00 37.59 ? 314 LEU A C   1 
ATOM   1705 O O   . LEU A 1 226 ? 105.153 27.798 60.540  1.00 37.68 ? 314 LEU A O   1 
ATOM   1706 C CB  . LEU A 1 226 ? 105.236 25.343 62.516  1.00 36.22 ? 314 LEU A CB  1 
ATOM   1707 C CG  . LEU A 1 226 ? 104.498 24.362 63.434  1.00 35.72 ? 314 LEU A CG  1 
ATOM   1708 C CD1 . LEU A 1 226 ? 105.201 24.321 64.784  1.00 35.06 ? 314 LEU A CD1 1 
ATOM   1709 C CD2 . LEU A 1 226 ? 103.038 24.782 63.600  1.00 34.16 ? 314 LEU A CD2 1 
ATOM   1710 N N   . VAL A 1 227 ? 106.188 26.113 59.452  1.00 37.23 ? 315 VAL A N   1 
ATOM   1711 C CA  . VAL A 1 227 ? 107.000 26.961 58.584  1.00 36.45 ? 315 VAL A CA  1 
ATOM   1712 C C   . VAL A 1 227 ? 106.258 27.144 57.261  1.00 36.39 ? 315 VAL A C   1 
ATOM   1713 O O   . VAL A 1 227 ? 106.290 28.206 56.640  1.00 35.40 ? 315 VAL A O   1 
ATOM   1714 C CB  . VAL A 1 227 ? 108.382 26.306 58.296  1.00 36.41 ? 315 VAL A CB  1 
ATOM   1715 C CG1 . VAL A 1 227 ? 109.140 27.118 57.270  1.00 36.30 ? 315 VAL A CG1 1 
ATOM   1716 C CG2 . VAL A 1 227 ? 109.204 26.214 59.578  1.00 36.19 ? 315 VAL A CG2 1 
ATOM   1717 N N   . GLN A 1 228 ? 105.582 26.084 56.846  1.00 36.53 ? 316 GLN A N   1 
ATOM   1718 C CA  . GLN A 1 228 ? 104.829 26.092 55.609  1.00 36.71 ? 316 GLN A CA  1 
ATOM   1719 C C   . GLN A 1 228 ? 103.647 27.063 55.613  1.00 36.84 ? 316 GLN A C   1 
ATOM   1720 O O   . GLN A 1 228 ? 103.379 27.724 54.604  1.00 36.85 ? 316 GLN A O   1 
ATOM   1721 C CB  . GLN A 1 228 ? 104.343 24.676 55.306  1.00 37.23 ? 316 GLN A CB  1 
ATOM   1722 C CG  . GLN A 1 228 ? 105.461 23.705 54.961  1.00 37.40 ? 316 GLN A CG  1 
ATOM   1723 C CD  . GLN A 1 228 ? 104.941 22.332 54.624  1.00 37.42 ? 316 GLN A CD  1 
ATOM   1724 O OE1 . GLN A 1 228 ? 105.689 21.463 54.189  1.00 38.11 ? 316 GLN A OE1 1 
ATOM   1725 N NE2 . GLN A 1 228 ? 103.651 22.123 54.831  1.00 38.11 ? 316 GLN A NE2 1 
ATOM   1726 N N   . THR A 1 229 ? 102.946 27.158 56.742  1.00 36.38 ? 317 THR A N   1 
ATOM   1727 C CA  . THR A 1 229 ? 101.793 28.053 56.844  1.00 35.52 ? 317 THR A CA  1 
ATOM   1728 C C   . THR A 1 229 ? 102.102 29.553 56.626  1.00 34.86 ? 317 THR A C   1 
ATOM   1729 O O   . THR A 1 229 ? 101.495 30.186 55.765  1.00 33.90 ? 317 THR A O   1 
ATOM   1730 C CB  . THR A 1 229 ? 101.051 27.821 58.191  1.00 35.24 ? 317 THR A CB  1 
ATOM   1731 O OG1 . THR A 1 229 ? 100.391 26.554 58.135  1.00 35.76 ? 317 THR A OG1 1 
ATOM   1732 C CG2 . THR A 1 229 ? 100.020 28.897 58.447  1.00 35.33 ? 317 THR A CG2 1 
ATOM   1733 N N   . PRO A 1 230 ? 103.027 30.143 57.413  1.00 34.46 ? 318 PRO A N   1 
ATOM   1734 C CA  . PRO A 1 230 ? 103.366 31.567 57.247  1.00 33.88 ? 318 PRO A CA  1 
ATOM   1735 C C   . PRO A 1 230 ? 104.128 31.878 55.948  1.00 32.85 ? 318 PRO A C   1 
ATOM   1736 O O   . PRO A 1 230 ? 104.027 32.974 55.401  1.00 31.83 ? 318 PRO A O   1 
ATOM   1737 C CB  . PRO A 1 230 ? 104.203 31.858 58.492  1.00 34.06 ? 318 PRO A CB  1 
ATOM   1738 C CG  . PRO A 1 230 ? 104.940 30.566 58.657  1.00 34.86 ? 318 PRO A CG  1 
ATOM   1739 C CD  . PRO A 1 230 ? 103.769 29.590 58.558  1.00 34.55 ? 318 PRO A CD  1 
ATOM   1740 N N   . ALA A 1 231 ? 104.901 30.910 55.472  1.00 32.01 ? 319 ALA A N   1 
ATOM   1741 C CA  . ALA A 1 231 ? 105.660 31.084 54.243  1.00 31.15 ? 319 ALA A CA  1 
ATOM   1742 C C   . ALA A 1 231 ? 104.698 31.154 53.066  1.00 31.53 ? 319 ALA A C   1 
ATOM   1743 O O   . ALA A 1 231 ? 104.865 31.988 52.169  1.00 31.14 ? 319 ALA A O   1 
ATOM   1744 C CB  . ALA A 1 231 ? 106.623 29.934 54.059  1.00 30.70 ? 319 ALA A CB  1 
ATOM   1745 N N   . LEU A 1 232 ? 103.694 30.272 53.064  1.00 31.14 ? 320 LEU A N   1 
ATOM   1746 C CA  . LEU A 1 232 ? 102.704 30.266 51.996  1.00 30.63 ? 320 LEU A CA  1 
ATOM   1747 C C   . LEU A 1 232 ? 101.855 31.534 52.016  1.00 30.99 ? 320 LEU A C   1 
ATOM   1748 O O   . LEU A 1 232 ? 101.485 32.044 50.960  1.00 30.73 ? 320 LEU A O   1 
ATOM   1749 C CB  . LEU A 1 232 ? 101.781 29.056 52.107  1.00 29.98 ? 320 LEU A CB  1 
ATOM   1750 C CG  . LEU A 1 232 ? 100.672 29.029 51.040  1.00 30.25 ? 320 LEU A CG  1 
ATOM   1751 C CD1 . LEU A 1 232 ? 101.294 29.108 49.651  1.00 29.09 ? 320 LEU A CD1 1 
ATOM   1752 C CD2 . LEU A 1 232 ? 99.828  27.760 51.171  1.00 29.73 ? 320 LEU A CD2 1 
ATOM   1753 N N   . ARG A 1 233 ? 101.555 32.038 53.216  1.00 30.91 ? 321 ARG A N   1 
ATOM   1754 C CA  . ARG A 1 233 ? 100.735 33.235 53.375  1.00 31.22 ? 321 ARG A CA  1 
ATOM   1755 C C   . ARG A 1 233 ? 101.428 34.476 52.787  1.00 31.11 ? 321 ARG A C   1 
ATOM   1756 O O   . ARG A 1 233 ? 100.776 35.360 52.247  1.00 30.71 ? 321 ARG A O   1 
ATOM   1757 C CB  . ARG A 1 233 ? 100.405 33.447 54.863  1.00 31.88 ? 321 ARG A CB  1 
ATOM   1758 C CG  . ARG A 1 233 ? 99.527  34.666 55.175  1.00 33.69 ? 321 ARG A CG  1 
ATOM   1759 C CD  . ARG A 1 233 ? 98.052  34.487 54.799  1.00 35.06 ? 321 ARG A CD  1 
ATOM   1760 N NE  . ARG A 1 233 ? 97.201  34.160 55.952  1.00 36.79 ? 321 ARG A NE  1 
ATOM   1761 C CZ  . ARG A 1 233 ? 97.233  33.019 56.642  1.00 37.05 ? 321 ARG A CZ  1 
ATOM   1762 N NH1 . ARG A 1 233 ? 98.075  32.056 56.323  1.00 37.97 ? 321 ARG A NH1 1 
ATOM   1763 N NH2 . ARG A 1 233 ? 96.428  32.841 57.676  1.00 37.99 ? 321 ARG A NH2 1 
ATOM   1764 N N   . ALA A 1 234 ? 102.750 34.532 52.878  1.00 31.43 ? 322 ALA A N   1 
ATOM   1765 C CA  . ALA A 1 234 ? 103.496 35.668 52.339  1.00 31.95 ? 322 ALA A CA  1 
ATOM   1766 C C   . ALA A 1 234 ? 103.634 35.540 50.828  1.00 32.46 ? 322 ALA A C   1 
ATOM   1767 O O   . ALA A 1 234 ? 103.437 36.515 50.106  1.00 32.50 ? 322 ALA A O   1 
ATOM   1768 C CB  . ALA A 1 234 ? 104.875 35.761 52.996  1.00 31.04 ? 322 ALA A CB  1 
ATOM   1769 N N   . VAL A 1 235 ? 103.984 34.342 50.357  1.00 33.50 ? 323 VAL A N   1 
ATOM   1770 C CA  . VAL A 1 235 ? 104.110 34.071 48.925  1.00 33.79 ? 323 VAL A CA  1 
ATOM   1771 C C   . VAL A 1 235 ? 102.797 34.448 48.249  1.00 34.50 ? 323 VAL A C   1 
ATOM   1772 O O   . VAL A 1 235 ? 102.778 35.122 47.212  1.00 35.69 ? 323 VAL A O   1 
ATOM   1773 C CB  . VAL A 1 235 ? 104.381 32.575 48.659  1.00 33.33 ? 323 VAL A CB  1 
ATOM   1774 C CG1 . VAL A 1 235 ? 104.128 32.232 47.194  1.00 33.12 ? 323 VAL A CG1 1 
ATOM   1775 C CG2 . VAL A 1 235 ? 105.808 32.255 49.016  1.00 33.47 ? 323 VAL A CG2 1 
ATOM   1776 N N   . GLY A 1 236 ? 101.698 34.009 48.849  1.00 34.04 ? 324 GLY A N   1 
ATOM   1777 C CA  . GLY A 1 236 ? 100.403 34.309 48.294  1.00 33.81 ? 324 GLY A CA  1 
ATOM   1778 C C   . GLY A 1 236 ? 100.151 35.801 48.273  1.00 33.67 ? 324 GLY A C   1 
ATOM   1779 O O   . GLY A 1 236 ? 99.553  36.315 47.326  1.00 34.50 ? 324 GLY A O   1 
ATOM   1780 N N   . ASN A 1 237 ? 100.593 36.518 49.300  1.00 32.96 ? 325 ASN A N   1 
ATOM   1781 C CA  . ASN A 1 237 ? 100.349 37.960 49.312  1.00 32.73 ? 325 ASN A CA  1 
ATOM   1782 C C   . ASN A 1 237 ? 101.101 38.685 48.206  1.00 33.19 ? 325 ASN A C   1 
ATOM   1783 O O   . ASN A 1 237 ? 100.634 39.700 47.683  1.00 33.44 ? 325 ASN A O   1 
ATOM   1784 C CB  . ASN A 1 237 ? 100.699 38.590 50.669  1.00 30.85 ? 325 ASN A CB  1 
ATOM   1785 C CG  . ASN A 1 237 ? 99.700  38.235 51.756  1.00 29.48 ? 325 ASN A CG  1 
ATOM   1786 O OD1 . ASN A 1 237 ? 98.502  38.131 51.505  1.00 27.91 ? 325 ASN A OD1 1 
ATOM   1787 N ND2 . ASN A 1 237 ? 100.184 38.086 52.978  1.00 29.34 ? 325 ASN A ND2 1 
ATOM   1788 N N   . ILE A 1 238 ? 102.262 38.160 47.841  1.00 33.55 ? 326 ILE A N   1 
ATOM   1789 C CA  . ILE A 1 238 ? 103.052 38.777 46.797  1.00 33.87 ? 326 ILE A CA  1 
ATOM   1790 C C   . ILE A 1 238 ? 102.369 38.693 45.426  1.00 34.30 ? 326 ILE A C   1 
ATOM   1791 O O   . ILE A 1 238 ? 102.221 39.715 44.753  1.00 34.33 ? 326 ILE A O   1 
ATOM   1792 C CB  . ILE A 1 238 ? 104.458 38.148 46.739  1.00 33.87 ? 326 ILE A CB  1 
ATOM   1793 C CG1 . ILE A 1 238 ? 105.214 38.452 48.042  1.00 33.67 ? 326 ILE A CG1 1 
ATOM   1794 C CG2 . ILE A 1 238 ? 105.214 38.689 45.540  1.00 33.66 ? 326 ILE A CG2 1 
ATOM   1795 C CD1 . ILE A 1 238 ? 106.602 37.835 48.126  1.00 32.90 ? 326 ILE A CD1 1 
ATOM   1796 N N   . VAL A 1 239 ? 101.934 37.499 45.017  1.00 34.48 ? 327 VAL A N   1 
ATOM   1797 C CA  . VAL A 1 239 ? 101.284 37.344 43.714  1.00 34.81 ? 327 VAL A CA  1 
ATOM   1798 C C   . VAL A 1 239 ? 99.987  38.144 43.614  1.00 35.56 ? 327 VAL A C   1 
ATOM   1799 O O   . VAL A 1 239 ? 99.255  38.058 42.626  1.00 36.25 ? 327 VAL A O   1 
ATOM   1800 C CB  . VAL A 1 239 ? 101.026 35.853 43.370  1.00 34.19 ? 327 VAL A CB  1 
ATOM   1801 C CG1 . VAL A 1 239 ? 102.342 35.129 43.265  1.00 33.96 ? 327 VAL A CG1 1 
ATOM   1802 C CG2 . VAL A 1 239 ? 100.161 35.193 44.431  1.00 34.21 ? 327 VAL A CG2 1 
ATOM   1803 N N   . THR A 1 240 ? 99.714  38.928 44.648  1.00 35.86 ? 328 THR A N   1 
ATOM   1804 C CA  . THR A 1 240 ? 98.549  39.802 44.684  1.00 36.12 ? 328 THR A CA  1 
ATOM   1805 C C   . THR A 1 240 ? 98.868  41.035 43.834  1.00 37.11 ? 328 THR A C   1 
ATOM   1806 O O   . THR A 1 240 ? 97.980  41.643 43.249  1.00 37.88 ? 328 THR A O   1 
ATOM   1807 C CB  . THR A 1 240 ? 98.251  40.232 46.142  1.00 35.41 ? 328 THR A CB  1 
ATOM   1808 O OG1 . THR A 1 240 ? 97.324  39.313 46.725  1.00 34.87 ? 328 THR A OG1 1 
ATOM   1809 C CG2 . THR A 1 240 ? 97.715  41.644 46.218  1.00 35.26 ? 328 THR A CG2 1 
ATOM   1810 N N   . GLY A 1 241 ? 100.149 41.390 43.765  1.00 38.08 ? 329 GLY A N   1 
ATOM   1811 C CA  . GLY A 1 241 ? 100.569 42.556 43.005  1.00 38.87 ? 329 GLY A CA  1 
ATOM   1812 C C   . GLY A 1 241 ? 100.510 42.384 41.500  1.00 39.63 ? 329 GLY A C   1 
ATOM   1813 O O   . GLY A 1 241 ? 100.057 41.346 41.009  1.00 39.53 ? 329 GLY A O   1 
ATOM   1814 N N   . ASN A 1 242 ? 100.982 43.401 40.777  1.00 40.15 ? 330 ASN A N   1 
ATOM   1815 C CA  . ASN A 1 242 ? 100.977 43.406 39.316  1.00 41.26 ? 330 ASN A CA  1 
ATOM   1816 C C   . ASN A 1 242 ? 101.781 42.271 38.688  1.00 42.41 ? 330 ASN A C   1 
ATOM   1817 O O   . ASN A 1 242 ? 102.538 41.571 39.364  1.00 42.94 ? 330 ASN A O   1 
ATOM   1818 C CB  . ASN A 1 242 ? 101.506 44.732 38.797  1.00 40.91 ? 330 ASN A CB  1 
ATOM   1819 C CG  . ASN A 1 242 ? 102.938 44.960 39.181  1.00 42.14 ? 330 ASN A CG  1 
ATOM   1820 O OD1 . ASN A 1 242 ? 103.823 44.185 38.814  1.00 43.31 ? 330 ASN A OD1 1 
ATOM   1821 N ND2 . ASN A 1 242 ? 103.184 46.019 39.932  1.00 42.67 ? 330 ASN A ND2 1 
ATOM   1822 N N   . ASP A 1 243 ? 101.624 42.116 37.378  1.00 43.12 ? 331 ASP A N   1 
ATOM   1823 C CA  . ASP A 1 243 ? 102.290 41.056 36.627  1.00 44.21 ? 331 ASP A CA  1 
ATOM   1824 C C   . ASP A 1 243 ? 103.787 40.932 36.866  1.00 44.36 ? 331 ASP A C   1 
ATOM   1825 O O   . ASP A 1 243 ? 104.302 39.822 37.058  1.00 44.11 ? 331 ASP A O   1 
ATOM   1826 C CB  . ASP A 1 243 ? 102.020 41.244 35.134  1.00 44.98 ? 331 ASP A CB  1 
ATOM   1827 C CG  . ASP A 1 243 ? 100.534 41.246 34.806  1.00 45.62 ? 331 ASP A CG  1 
ATOM   1828 O OD1 . ASP A 1 243 ? 99.707  41.095 35.739  1.00 45.69 ? 331 ASP A OD1 1 
ATOM   1829 O OD2 . ASP A 1 243 ? 100.199 41.397 33.614  1.00 45.85 ? 331 ASP A OD2 1 
ATOM   1830 N N   . LEU A 1 244 ? 104.483 42.063 36.845  1.00 44.32 ? 332 LEU A N   1 
ATOM   1831 C CA  . LEU A 1 244 ? 105.922 42.055 37.060  1.00 44.53 ? 332 LEU A CA  1 
ATOM   1832 C C   . LEU A 1 244 ? 106.294 41.518 38.437  1.00 44.18 ? 332 LEU A C   1 
ATOM   1833 O O   . LEU A 1 244 ? 107.224 40.706 38.563  1.00 44.60 ? 332 LEU A O   1 
ATOM   1834 C CB  . LEU A 1 244 ? 106.508 43.460 36.870  1.00 45.21 ? 332 LEU A CB  1 
ATOM   1835 C CG  . LEU A 1 244 ? 106.667 43.935 35.423  1.00 45.53 ? 332 LEU A CG  1 
ATOM   1836 C CD1 . LEU A 1 244 ? 105.335 43.872 34.690  1.00 46.45 ? 332 LEU A CD1 1 
ATOM   1837 C CD2 . LEU A 1 244 ? 107.207 45.344 35.422  1.00 45.63 ? 332 LEU A CD2 1 
ATOM   1838 N N   . GLN A 1 245 ? 105.577 41.964 39.465  1.00 42.66 ? 333 GLN A N   1 
ATOM   1839 C CA  . GLN A 1 245 ? 105.856 41.496 40.812  1.00 41.56 ? 333 GLN A CA  1 
ATOM   1840 C C   . GLN A 1 245 ? 105.538 40.013 40.914  1.00 40.90 ? 333 GLN A C   1 
ATOM   1841 O O   . GLN A 1 245 ? 106.184 39.284 41.663  1.00 40.85 ? 333 GLN A O   1 
ATOM   1842 C CB  . GLN A 1 245 ? 105.039 42.282 41.833  1.00 41.57 ? 333 GLN A CB  1 
ATOM   1843 C CG  . GLN A 1 245 ? 105.385 43.753 41.888  1.00 41.55 ? 333 GLN A CG  1 
ATOM   1844 C CD  . GLN A 1 245 ? 104.519 44.504 42.867  1.00 42.07 ? 333 GLN A CD  1 
ATOM   1845 O OE1 . GLN A 1 245 ? 103.297 44.463 42.772  1.00 42.83 ? 333 GLN A OE1 1 
ATOM   1846 N NE2 . GLN A 1 245 ? 105.143 45.200 43.814  1.00 42.03 ? 333 GLN A NE2 1 
ATOM   1847 N N   . THR A 1 246 ? 104.552 39.562 40.143  1.00 40.41 ? 334 THR A N   1 
ATOM   1848 C CA  . THR A 1 246 ? 104.172 38.155 40.161  1.00 40.30 ? 334 THR A CA  1 
ATOM   1849 C C   . THR A 1 246 ? 105.166 37.277 39.394  1.00 40.42 ? 334 THR A C   1 
ATOM   1850 O O   . THR A 1 246 ? 105.326 36.096 39.726  1.00 40.43 ? 334 THR A O   1 
ATOM   1851 C CB  . THR A 1 246 ? 102.731 37.933 39.596  1.00 40.63 ? 334 THR A CB  1 
ATOM   1852 O OG1 . THR A 1 246 ? 101.762 38.532 40.473  1.00 40.19 ? 334 THR A OG1 1 
ATOM   1853 C CG2 . THR A 1 246 ? 102.431 36.447 39.475  1.00 40.05 ? 334 THR A CG2 1 
ATOM   1854 N N   . GLN A 1 247 ? 105.832 37.842 38.379  1.00 40.18 ? 335 GLN A N   1 
ATOM   1855 C CA  . GLN A 1 247 ? 106.814 37.077 37.608  1.00 39.73 ? 335 GLN A CA  1 
ATOM   1856 C C   . GLN A 1 247 ? 108.033 36.775 38.446  1.00 39.16 ? 335 GLN A C   1 
ATOM   1857 O O   . GLN A 1 247 ? 108.676 35.736 38.272  1.00 39.09 ? 335 GLN A O   1 
ATOM   1858 C CB  . GLN A 1 247 ? 107.239 37.811 36.333  1.00 40.25 ? 335 GLN A CB  1 
ATOM   1859 C CG  . GLN A 1 247 ? 106.452 37.398 35.106  1.00 41.35 ? 335 GLN A CG  1 
ATOM   1860 C CD  . GLN A 1 247 ? 106.663 35.930 34.738  1.00 42.63 ? 335 GLN A CD  1 
ATOM   1861 O OE1 . GLN A 1 247 ? 105.945 35.377 33.908  1.00 42.70 ? 335 GLN A OE1 1 
ATOM   1862 N NE2 . GLN A 1 247 ? 107.661 35.301 35.348  1.00 44.18 ? 335 GLN A NE2 1 
ATOM   1863 N N   . VAL A 1 248 ? 108.355 37.686 39.358  1.00 38.47 ? 336 VAL A N   1 
ATOM   1864 C CA  . VAL A 1 248 ? 109.495 37.473 40.241  1.00 37.99 ? 336 VAL A CA  1 
ATOM   1865 C C   . VAL A 1 248 ? 109.274 36.161 41.006  1.00 37.99 ? 336 VAL A C   1 
ATOM   1866 O O   . VAL A 1 248 ? 110.213 35.389 41.208  1.00 37.87 ? 336 VAL A O   1 
ATOM   1867 C CB  . VAL A 1 248 ? 109.660 38.641 41.259  1.00 36.97 ? 336 VAL A CB  1 
ATOM   1868 C CG1 . VAL A 1 248 ? 110.750 38.324 42.243  1.00 35.64 ? 336 VAL A CG1 1 
ATOM   1869 C CG2 . VAL A 1 248 ? 109.999 39.930 40.532  1.00 36.98 ? 336 VAL A CG2 1 
ATOM   1870 N N   . VAL A 1 249 ? 108.027 35.907 41.409  1.00 37.57 ? 337 VAL A N   1 
ATOM   1871 C CA  . VAL A 1 249 ? 107.705 34.698 42.169  1.00 37.67 ? 337 VAL A CA  1 
ATOM   1872 C C   . VAL A 1 249 ? 107.597 33.440 41.287  1.00 37.82 ? 337 VAL A C   1 
ATOM   1873 O O   . VAL A 1 249 ? 107.913 32.326 41.732  1.00 37.47 ? 337 VAL A O   1 
ATOM   1874 C CB  . VAL A 1 249 ? 106.400 34.885 42.997  1.00 37.25 ? 337 VAL A CB  1 
ATOM   1875 C CG1 . VAL A 1 249 ? 106.199 33.698 43.938  1.00 36.51 ? 337 VAL A CG1 1 
ATOM   1876 C CG2 . VAL A 1 249 ? 106.472 36.173 43.792  1.00 36.62 ? 337 VAL A CG2 1 
ATOM   1877 N N   . ILE A 1 250 ? 107.142 33.605 40.045  1.00 37.52 ? 338 ILE A N   1 
ATOM   1878 C CA  . ILE A 1 250 ? 107.061 32.463 39.139  1.00 36.56 ? 338 ILE A CA  1 
ATOM   1879 C C   . ILE A 1 250 ? 108.487 32.026 38.846  1.00 36.38 ? 338 ILE A C   1 
ATOM   1880 O O   . ILE A 1 250 ? 108.775 30.830 38.808  1.00 35.98 ? 338 ILE A O   1 
ATOM   1881 C CB  . ILE A 1 250 ? 106.374 32.822 37.801  1.00 36.19 ? 338 ILE A CB  1 
ATOM   1882 C CG1 . ILE A 1 250 ? 104.880 33.022 38.028  1.00 35.80 ? 338 ILE A CG1 1 
ATOM   1883 C CG2 . ILE A 1 250 ? 106.603 31.720 36.774  1.00 36.39 ? 338 ILE A CG2 1 
ATOM   1884 C CD1 . ILE A 1 250 ? 104.108 33.341 36.771  1.00 35.05 ? 338 ILE A CD1 1 
ATOM   1885 N N   . ASN A 1 251 ? 109.370 33.009 38.654  1.00 36.11 ? 339 ASN A N   1 
ATOM   1886 C CA  . ASN A 1 251 ? 110.774 32.746 38.363  1.00 35.83 ? 339 ASN A CA  1 
ATOM   1887 C C   . ASN A 1 251 ? 111.514 32.098 39.524  1.00 35.26 ? 339 ASN A C   1 
ATOM   1888 O O   . ASN A 1 251 ? 112.522 31.442 39.316  1.00 35.86 ? 339 ASN A O   1 
ATOM   1889 C CB  . ASN A 1 251 ? 111.506 34.030 37.953  1.00 35.99 ? 339 ASN A CB  1 
ATOM   1890 C CG  . ASN A 1 251 ? 110.933 34.659 36.699  1.00 36.04 ? 339 ASN A CG  1 
ATOM   1891 O OD1 . ASN A 1 251 ? 110.419 33.964 35.825  1.00 35.99 ? 339 ASN A OD1 1 
ATOM   1892 N ND2 . ASN A 1 251 ? 111.051 35.977 36.588  1.00 36.40 ? 339 ASN A ND2 1 
ATOM   1893 N N   . ALA A 1 252 ? 111.019 32.283 40.741  1.00 34.74 ? 340 ALA A N   1 
ATOM   1894 C CA  . ALA A 1 252 ? 111.655 31.689 41.906  1.00 34.72 ? 340 ALA A CA  1 
ATOM   1895 C C   . ALA A 1 252 ? 111.262 30.202 42.040  1.00 34.90 ? 340 ALA A C   1 
ATOM   1896 O O   . ALA A 1 252 ? 111.588 29.551 43.031  1.00 35.47 ? 340 ALA A O   1 
ATOM   1897 C CB  . ALA A 1 252 ? 111.272 32.479 43.171  1.00 33.83 ? 340 ALA A CB  1 
ATOM   1898 N N   . GLY A 1 253 ? 110.567 29.679 41.034  1.00 34.66 ? 341 GLY A N   1 
ATOM   1899 C CA  . GLY A 1 253 ? 110.151 28.285 41.044  1.00 35.28 ? 341 GLY A CA  1 
ATOM   1900 C C   . GLY A 1 253 ? 109.036 27.932 42.011  1.00 36.01 ? 341 GLY A C   1 
ATOM   1901 O O   . GLY A 1 253 ? 108.992 26.821 42.536  1.00 35.76 ? 341 GLY A O   1 
ATOM   1902 N N   . VAL A 1 254 ? 108.119 28.874 42.222  1.00 36.75 ? 342 VAL A N   1 
ATOM   1903 C CA  . VAL A 1 254 ? 106.996 28.695 43.142  1.00 36.66 ? 342 VAL A CA  1 
ATOM   1904 C C   . VAL A 1 254 ? 105.944 27.712 42.620  1.00 36.77 ? 342 VAL A C   1 
ATOM   1905 O O   . VAL A 1 254 ? 105.300 26.999 43.399  1.00 36.50 ? 342 VAL A O   1 
ATOM   1906 C CB  . VAL A 1 254 ? 106.320 30.072 43.447  1.00 36.49 ? 342 VAL A CB  1 
ATOM   1907 C CG1 . VAL A 1 254 ? 105.604 30.586 42.214  1.00 36.25 ? 342 VAL A CG1 1 
ATOM   1908 C CG2 . VAL A 1 254 ? 105.377 29.961 44.638  1.00 35.82 ? 342 VAL A CG2 1 
ATOM   1909 N N   . LEU A 1 255 ? 105.774 27.663 41.306  1.00 36.92 ? 343 LEU A N   1 
ATOM   1910 C CA  . LEU A 1 255 ? 104.776 26.767 40.733  1.00 37.43 ? 343 LEU A CA  1 
ATOM   1911 C C   . LEU A 1 255 ? 105.031 25.297 41.056  1.00 37.63 ? 343 LEU A C   1 
ATOM   1912 O O   . LEU A 1 255 ? 104.132 24.593 41.522  1.00 38.11 ? 343 LEU A O   1 
ATOM   1913 C CB  . LEU A 1 255 ? 104.676 26.975 39.219  1.00 37.08 ? 343 LEU A CB  1 
ATOM   1914 C CG  . LEU A 1 255 ? 104.206 28.380 38.804  1.00 37.41 ? 343 LEU A CG  1 
ATOM   1915 C CD1 . LEU A 1 255 ? 104.021 28.433 37.287  1.00 36.66 ? 343 LEU A CD1 1 
ATOM   1916 C CD2 . LEU A 1 255 ? 102.889 28.723 39.499  1.00 35.99 ? 343 LEU A CD2 1 
ATOM   1917 N N   . PRO A 1 256 ? 106.261 24.807 40.825  1.00 37.49 ? 344 PRO A N   1 
ATOM   1918 C CA  . PRO A 1 256 ? 106.499 23.397 41.140  1.00 37.04 ? 344 PRO A CA  1 
ATOM   1919 C C   . PRO A 1 256 ? 106.288 23.147 42.639  1.00 36.88 ? 344 PRO A C   1 
ATOM   1920 O O   . PRO A 1 256 ? 105.876 22.065 43.049  1.00 37.11 ? 344 PRO A O   1 
ATOM   1921 C CB  . PRO A 1 256 ? 107.946 23.200 40.695  1.00 36.89 ? 344 PRO A CB  1 
ATOM   1922 C CG  . PRO A 1 256 ? 108.092 24.260 39.574  1.00 36.23 ? 344 PRO A CG  1 
ATOM   1923 C CD  . PRO A 1 256 ? 107.491 25.423 40.297  1.00 37.09 ? 344 PRO A CD  1 
ATOM   1924 N N   . ALA A 1 257 ? 106.553 24.164 43.452  1.00 36.74 ? 345 ALA A N   1 
ATOM   1925 C CA  . ALA A 1 257 ? 106.380 24.040 44.896  1.00 36.62 ? 345 ALA A CA  1 
ATOM   1926 C C   . ALA A 1 257 ? 104.896 23.948 45.259  1.00 36.75 ? 345 ALA A C   1 
ATOM   1927 O O   . ALA A 1 257 ? 104.533 23.273 46.221  1.00 36.80 ? 345 ALA A O   1 
ATOM   1928 C CB  . ALA A 1 257 ? 107.026 25.228 45.613  1.00 36.11 ? 345 ALA A CB  1 
ATOM   1929 N N   . LEU A 1 258 ? 104.039 24.623 44.494  1.00 36.54 ? 346 LEU A N   1 
ATOM   1930 C CA  . LEU A 1 258 ? 102.605 24.593 44.767  1.00 36.68 ? 346 LEU A CA  1 
ATOM   1931 C C   . LEU A 1 258 ? 101.987 23.264 44.374  1.00 37.38 ? 346 LEU A C   1 
ATOM   1932 O O   . LEU A 1 258 ? 101.016 22.822 44.993  1.00 36.67 ? 346 LEU A O   1 
ATOM   1933 C CB  . LEU A 1 258 ? 101.889 25.738 44.039  1.00 35.48 ? 346 LEU A CB  1 
ATOM   1934 C CG  . LEU A 1 258 ? 102.119 27.138 44.610  1.00 35.19 ? 346 LEU A CG  1 
ATOM   1935 C CD1 . LEU A 1 258 ? 101.690 28.182 43.608  1.00 34.84 ? 346 LEU A CD1 1 
ATOM   1936 C CD2 . LEU A 1 258 ? 101.372 27.289 45.928  1.00 33.49 ? 346 LEU A CD2 1 
ATOM   1937 N N   . ARG A 1 259 ? 102.547 22.625 43.348  1.00 38.48 ? 347 ARG A N   1 
ATOM   1938 C CA  . ARG A 1 259 ? 102.017 21.344 42.913  1.00 39.62 ? 347 ARG A CA  1 
ATOM   1939 C C   . ARG A 1 259 ? 102.011 20.401 44.112  1.00 39.33 ? 347 ARG A C   1 
ATOM   1940 O O   . ARG A 1 259 ? 101.049 19.672 44.318  1.00 40.20 ? 347 ARG A O   1 
ATOM   1941 C CB  . ARG A 1 259 ? 102.865 20.729 41.802  1.00 40.92 ? 347 ARG A CB  1 
ATOM   1942 C CG  . ARG A 1 259 ? 102.159 19.577 41.092  1.00 43.19 ? 347 ARG A CG  1 
ATOM   1943 C CD  . ARG A 1 259 ? 103.093 18.736 40.222  1.00 46.16 ? 347 ARG A CD  1 
ATOM   1944 N NE  . ARG A 1 259 ? 104.028 19.556 39.447  1.00 48.63 ? 347 ARG A NE  1 
ATOM   1945 C CZ  . ARG A 1 259 ? 105.212 19.984 39.888  1.00 49.26 ? 347 ARG A CZ  1 
ATOM   1946 N NH1 . ARG A 1 259 ? 105.627 19.667 41.113  1.00 50.12 ? 347 ARG A NH1 1 
ATOM   1947 N NH2 . ARG A 1 259 ? 105.969 20.754 39.115  1.00 49.37 ? 347 ARG A NH2 1 
ATOM   1948 N N   . LEU A 1 260 ? 103.076 20.423 44.907  1.00 38.74 ? 348 LEU A N   1 
ATOM   1949 C CA  . LEU A 1 260 ? 103.148 19.559 46.075  1.00 38.72 ? 348 LEU A CA  1 
ATOM   1950 C C   . LEU A 1 260 ? 102.141 19.940 47.164  1.00 39.08 ? 348 LEU A C   1 
ATOM   1951 O O   . LEU A 1 260 ? 101.443 19.066 47.698  1.00 39.75 ? 348 LEU A O   1 
ATOM   1952 C CB  . LEU A 1 260 ? 104.567 19.555 46.660  1.00 38.79 ? 348 LEU A CB  1 
ATOM   1953 C CG  . LEU A 1 260 ? 105.674 18.950 45.791  1.00 38.28 ? 348 LEU A CG  1 
ATOM   1954 N N   . LEU A 1 261 ? 102.052 21.232 47.484  1.00 38.37 ? 349 LEU A N   1 
ATOM   1955 C CA  . LEU A 1 261 ? 101.138 21.710 48.528  1.00 37.69 ? 349 LEU A CA  1 
ATOM   1956 C C   . LEU A 1 261 ? 99.666  21.329 48.347  1.00 37.56 ? 349 LEU A C   1 
ATOM   1957 O O   . LEU A 1 261 ? 98.892  21.336 49.311  1.00 37.28 ? 349 LEU A O   1 
ATOM   1958 C CB  . LEU A 1 261 ? 101.253 23.231 48.670  1.00 37.69 ? 349 LEU A CB  1 
ATOM   1959 C CG  . LEU A 1 261 ? 102.597 23.789 49.167  1.00 37.64 ? 349 LEU A CG  1 
ATOM   1960 C CD1 . LEU A 1 261 ? 102.583 25.310 49.064  1.00 37.13 ? 349 LEU A CD1 1 
ATOM   1961 C CD2 . LEU A 1 261 ? 102.869 23.333 50.608  1.00 36.95 ? 349 LEU A CD2 1 
ATOM   1962 N N   . LEU A 1 262 ? 99.275  20.997 47.120  1.00 37.30 ? 350 LEU A N   1 
ATOM   1963 C CA  . LEU A 1 262 ? 97.894  20.619 46.853  1.00 36.90 ? 350 LEU A CA  1 
ATOM   1964 C C   . LEU A 1 262 ? 97.609  19.260 47.489  1.00 36.24 ? 350 LEU A C   1 
ATOM   1965 O O   . LEU A 1 262 ? 96.465  18.928 47.778  1.00 36.44 ? 350 LEU A O   1 
ATOM   1966 C CB  . LEU A 1 262 ? 97.630  20.584 45.336  1.00 36.74 ? 350 LEU A CB  1 
ATOM   1967 C CG  . LEU A 1 262 ? 97.883  21.913 44.600  1.00 36.82 ? 350 LEU A CG  1 
ATOM   1968 C CD1 . LEU A 1 262 ? 97.469  21.810 43.135  1.00 35.85 ? 350 LEU A CD1 1 
ATOM   1969 C CD2 . LEU A 1 262 ? 97.102  23.023 45.284  1.00 36.74 ? 350 LEU A CD2 1 
ATOM   1970 N N   . SER A 1 263 ? 98.657  18.486 47.730  1.00 35.68 ? 351 SER A N   1 
ATOM   1971 C CA  . SER A 1 263 ? 98.501  17.173 48.337  1.00 35.48 ? 351 SER A CA  1 
ATOM   1972 C C   . SER A 1 263 ? 98.609  17.254 49.859  1.00 35.70 ? 351 SER A C   1 
ATOM   1973 O O   . SER A 1 263 ? 98.392  16.269 50.566  1.00 36.00 ? 351 SER A O   1 
ATOM   1974 C CB  . SER A 1 263 ? 99.561  16.220 47.787  1.00 35.33 ? 351 SER A CB  1 
ATOM   1975 O OG  . SER A 1 263 ? 99.448  16.105 46.383  1.00 34.57 ? 351 SER A OG  1 
ATOM   1976 N N   . SER A 1 264 ? 98.949  18.435 50.359  1.00 35.35 ? 352 SER A N   1 
ATOM   1977 C CA  . SER A 1 264 ? 99.073  18.656 51.794  1.00 34.85 ? 352 SER A CA  1 
ATOM   1978 C C   . SER A 1 264 ? 97.943  18.050 52.609  1.00 34.89 ? 352 SER A C   1 
ATOM   1979 O O   . SER A 1 264 ? 96.773  18.207 52.278  1.00 35.05 ? 352 SER A O   1 
ATOM   1980 C CB  . SER A 1 264 ? 99.107  20.153 52.086  1.00 35.18 ? 352 SER A CB  1 
ATOM   1981 O OG  . SER A 1 264 ? 98.954  20.401 53.475  1.00 35.00 ? 352 SER A OG  1 
ATOM   1982 N N   . PRO A 1 265 ? 98.279  17.326 53.684  1.00 34.94 ? 353 PRO A N   1 
ATOM   1983 C CA  . PRO A 1 265 ? 97.223  16.737 54.511  1.00 34.72 ? 353 PRO A CA  1 
ATOM   1984 C C   . PRO A 1 265 ? 96.406  17.844 55.201  1.00 34.72 ? 353 PRO A C   1 
ATOM   1985 O O   . PRO A 1 265 ? 95.205  17.684 55.432  1.00 35.28 ? 353 PRO A O   1 
ATOM   1986 C CB  . PRO A 1 265 ? 98.018  15.892 55.500  1.00 34.57 ? 353 PRO A CB  1 
ATOM   1987 C CG  . PRO A 1 265 ? 99.287  16.721 55.647  1.00 34.94 ? 353 PRO A CG  1 
ATOM   1988 C CD  . PRO A 1 265 ? 99.600  16.931 54.191  1.00 34.31 ? 353 PRO A CD  1 
ATOM   1989 N N   . LYS A 1 266 ? 97.063  18.963 55.519  1.00 34.59 ? 354 LYS A N   1 
ATOM   1990 C CA  . LYS A 1 266 ? 96.419  20.114 56.177  1.00 33.57 ? 354 LYS A CA  1 
ATOM   1991 C C   . LYS A 1 266 ? 95.460  20.799 55.196  1.00 33.11 ? 354 LYS A C   1 
ATOM   1992 O O   . LYS A 1 266 ? 95.874  21.284 54.151  1.00 33.39 ? 354 LYS A O   1 
ATOM   1993 C CB  . LYS A 1 266 ? 97.492  21.103 56.652  1.00 32.99 ? 354 LYS A CB  1 
ATOM   1994 C CG  . LYS A 1 266 ? 97.010  22.157 57.626  1.00 33.18 ? 354 LYS A CG  1 
ATOM   1995 N N   . GLU A 1 267 ? 94.181  20.839 55.546  1.00 33.06 ? 355 GLU A N   1 
ATOM   1996 C CA  . GLU A 1 267 ? 93.157  21.434 54.690  1.00 33.17 ? 355 GLU A CA  1 
ATOM   1997 C C   . GLU A 1 267 ? 93.359  22.912 54.360  1.00 32.50 ? 355 GLU A C   1 
ATOM   1998 O O   . GLU A 1 267 ? 93.317  23.275 53.189  1.00 31.90 ? 355 GLU A O   1 
ATOM   1999 C CB  . GLU A 1 267 ? 91.771  21.228 55.315  1.00 33.53 ? 355 GLU A CB  1 
ATOM   2000 C CG  . GLU A 1 267 ? 90.584  21.550 54.413  1.00 34.88 ? 355 GLU A CG  1 
ATOM   2001 C CD  . GLU A 1 267 ? 90.456  20.605 53.217  1.00 35.76 ? 355 GLU A CD  1 
ATOM   2002 O OE1 . GLU A 1 267 ? 90.549  19.376 53.422  1.00 36.15 ? 355 GLU A OE1 1 
ATOM   2003 O OE2 . GLU A 1 267 ? 90.232  21.084 52.080  1.00 36.29 ? 355 GLU A OE2 1 
ATOM   2004 N N   . ASN A 1 268 ? 93.576  23.767 55.362  1.00 32.58 ? 356 ASN A N   1 
ATOM   2005 C CA  . ASN A 1 268 ? 93.755  25.189 55.062  1.00 33.20 ? 356 ASN A CA  1 
ATOM   2006 C C   . ASN A 1 268 ? 94.931  25.475 54.140  1.00 33.16 ? 356 ASN A C   1 
ATOM   2007 O O   . ASN A 1 268 ? 94.992  26.531 53.528  1.00 33.75 ? 356 ASN A O   1 
ATOM   2008 C CB  . ASN A 1 268 ? 93.884  26.040 56.331  1.00 34.19 ? 356 ASN A CB  1 
ATOM   2009 C CG  . ASN A 1 268 ? 92.545  26.266 57.030  1.00 35.22 ? 356 ASN A CG  1 
ATOM   2010 O OD1 . ASN A 1 268 ? 91.520  26.497 56.384  1.00 36.90 ? 356 ASN A OD1 1 
ATOM   2011 N ND2 . ASN A 1 268 ? 92.558  26.241 58.355  1.00 35.78 ? 356 ASN A ND2 1 
ATOM   2012 N N   . ILE A 1 269 ? 95.859  24.531 54.039  1.00 33.17 ? 357 ILE A N   1 
ATOM   2013 C CA  . ILE A 1 269 ? 97.021  24.681 53.168  1.00 32.21 ? 357 ILE A CA  1 
ATOM   2014 C C   . ILE A 1 269 ? 96.646  24.418 51.709  1.00 32.29 ? 357 ILE A C   1 
ATOM   2015 O O   . ILE A 1 269 ? 97.143  25.095 50.798  1.00 31.91 ? 357 ILE A O   1 
ATOM   2016 C CB  . ILE A 1 269 ? 98.166  23.730 53.599  1.00 31.83 ? 357 ILE A CB  1 
ATOM   2017 C CG1 . ILE A 1 269 ? 98.825  24.265 54.878  1.00 31.27 ? 357 ILE A CG1 1 
ATOM   2018 C CG2 . ILE A 1 269 ? 99.192  23.600 52.487  1.00 32.42 ? 357 ILE A CG2 1 
ATOM   2019 C CD1 . ILE A 1 269 ? 100.035 23.477 55.348  1.00 29.19 ? 357 ILE A CD1 1 
ATOM   2020 N N   . LYS A 1 270 ? 95.778  23.432 51.490  1.00 32.57 ? 358 LYS A N   1 
ATOM   2021 C CA  . LYS A 1 270 ? 95.315  23.109 50.144  1.00 32.96 ? 358 LYS A CA  1 
ATOM   2022 C C   . LYS A 1 270 ? 94.572  24.336 49.618  1.00 33.07 ? 358 LYS A C   1 
ATOM   2023 O O   . LYS A 1 270 ? 94.707  24.727 48.452  1.00 31.79 ? 358 LYS A O   1 
ATOM   2024 C CB  . LYS A 1 270 ? 94.355  21.915 50.171  1.00 33.09 ? 358 LYS A CB  1 
ATOM   2025 C CG  . LYS A 1 270 ? 94.977  20.578 50.555  1.00 33.63 ? 358 LYS A CG  1 
ATOM   2026 C CD  . LYS A 1 270 ? 93.910  19.483 50.565  1.00 34.21 ? 358 LYS A CD  1 
ATOM   2027 C CE  . LYS A 1 270 ? 94.509  18.117 50.871  1.00 35.06 ? 358 LYS A CE  1 
ATOM   2028 N NZ  . LYS A 1 270 ? 93.494  17.051 51.157  1.00 34.43 ? 358 LYS A NZ  1 
ATOM   2029 N N   . LYS A 1 271 ? 93.791  24.940 50.508  1.00 33.53 ? 359 LYS A N   1 
ATOM   2030 C CA  . LYS A 1 271 ? 93.014  26.119 50.174  1.00 34.19 ? 359 LYS A CA  1 
ATOM   2031 C C   . LYS A 1 271 ? 93.908  27.254 49.662  1.00 34.40 ? 359 LYS A C   1 
ATOM   2032 O O   . LYS A 1 271 ? 93.837  27.625 48.490  1.00 34.69 ? 359 LYS A O   1 
ATOM   2033 C CB  . LYS A 1 271 ? 92.239  26.592 51.399  1.00 34.68 ? 359 LYS A CB  1 
ATOM   2034 C CG  . LYS A 1 271 ? 91.322  27.761 51.109  1.00 35.13 ? 359 LYS A CG  1 
ATOM   2035 C CD  . LYS A 1 271 ? 90.634  28.270 52.359  1.00 35.58 ? 359 LYS A CD  1 
ATOM   2036 C CE  . LYS A 1 271 ? 91.631  28.873 53.326  1.00 36.46 ? 359 LYS A CE  1 
ATOM   2037 N NZ  . LYS A 1 271 ? 90.949  29.539 54.458  1.00 37.68 ? 359 LYS A NZ  1 
ATOM   2038 N N   . GLU A 1 272 ? 94.758  27.784 50.540  1.00 34.17 ? 360 GLU A N   1 
ATOM   2039 C CA  . GLU A 1 272 ? 95.657  28.884 50.199  1.00 34.06 ? 360 GLU A CA  1 
ATOM   2040 C C   . GLU A 1 272 ? 96.569  28.600 49.009  1.00 33.07 ? 360 GLU A C   1 
ATOM   2041 O O   . GLU A 1 272 ? 97.043  29.522 48.346  1.00 32.71 ? 360 GLU A O   1 
ATOM   2042 C CB  . GLU A 1 272 ? 96.504  29.290 51.418  1.00 35.00 ? 360 GLU A CB  1 
ATOM   2043 C CG  . GLU A 1 272 ? 95.685  29.628 52.671  1.00 37.31 ? 360 GLU A CG  1 
ATOM   2044 C CD  . GLU A 1 272 ? 96.395  30.597 53.626  1.00 39.18 ? 360 GLU A CD  1 
ATOM   2045 O OE1 . GLU A 1 272 ? 97.607  30.423 53.885  1.00 40.05 ? 360 GLU A OE1 1 
ATOM   2046 O OE2 . GLU A 1 272 ? 95.733  31.526 54.138  1.00 39.98 ? 360 GLU A OE2 1 
ATOM   2047 N N   . ALA A 1 273 ? 96.829  27.324 48.746  1.00 32.43 ? 361 ALA A N   1 
ATOM   2048 C CA  . ALA A 1 273 ? 97.659  26.948 47.611  1.00 31.04 ? 361 ALA A CA  1 
ATOM   2049 C C   . ALA A 1 273 ? 96.841  27.259 46.353  1.00 30.72 ? 361 ALA A C   1 
ATOM   2050 O O   . ALA A 1 273 ? 97.365  27.786 45.375  1.00 30.85 ? 361 ALA A O   1 
ATOM   2051 C CB  . ALA A 1 273 ? 97.993  25.474 47.683  1.00 30.47 ? 361 ALA A CB  1 
ATOM   2052 N N   . CYS A 1 274 ? 95.547  26.951 46.399  1.00 30.19 ? 362 CYS A N   1 
ATOM   2053 C CA  . CYS A 1 274 ? 94.646  27.215 45.277  1.00 30.12 ? 362 CYS A CA  1 
ATOM   2054 C C   . CYS A 1 274 ? 94.452  28.714 45.103  1.00 28.88 ? 362 CYS A C   1 
ATOM   2055 O O   . CYS A 1 274 ? 94.352  29.217 43.985  1.00 28.62 ? 362 CYS A O   1 
ATOM   2056 C CB  . CYS A 1 274 ? 93.275  26.565 45.510  1.00 31.54 ? 362 CYS A CB  1 
ATOM   2057 S SG  . CYS A 1 274 ? 93.269  24.759 45.527  1.00 33.20 ? 362 CYS A SG  1 
ATOM   2058 N N   . TRP A 1 275 ? 94.372  29.408 46.232  1.00 27.82 ? 363 TRP A N   1 
ATOM   2059 C CA  . TRP A 1 275 ? 94.204  30.851 46.279  1.00 26.15 ? 363 TRP A CA  1 
ATOM   2060 C C   . TRP A 1 275 ? 95.380  31.499 45.558  1.00 26.27 ? 363 TRP A C   1 
ATOM   2061 O O   . TRP A 1 275 ? 95.198  32.324 44.667  1.00 25.03 ? 363 TRP A O   1 
ATOM   2062 C CB  . TRP A 1 275 ? 94.172  31.273 47.736  1.00 26.10 ? 363 TRP A CB  1 
ATOM   2063 C CG  . TRP A 1 275 ? 94.238  32.738 47.961  1.00 26.50 ? 363 TRP A CG  1 
ATOM   2064 C CD1 . TRP A 1 275 ? 93.327  33.678 47.564  1.00 25.51 ? 363 TRP A CD1 1 
ATOM   2065 C CD2 . TRP A 1 275 ? 95.252  33.435 48.678  1.00 25.25 ? 363 TRP A CD2 1 
ATOM   2066 N NE1 . TRP A 1 275 ? 93.710  34.913 48.000  1.00 25.47 ? 363 TRP A NE1 1 
ATOM   2067 C CE2 . TRP A 1 275 ? 94.886  34.796 48.694  1.00 26.19 ? 363 TRP A CE2 1 
ATOM   2068 C CE3 . TRP A 1 275 ? 96.426  33.040 49.324  1.00 24.89 ? 363 TRP A CE3 1 
ATOM   2069 C CZ2 . TRP A 1 275 ? 95.670  35.776 49.324  1.00 26.11 ? 363 TRP A CZ2 1 
ATOM   2070 C CZ3 . TRP A 1 275 ? 97.199  34.004 49.951  1.00 25.52 ? 363 TRP A CZ3 1 
ATOM   2071 C CH2 . TRP A 1 275 ? 96.818  35.357 49.948  1.00 26.12 ? 363 TRP A CH2 1 
ATOM   2072 N N   . THR A 1 276 ? 96.590  31.114 45.955  1.00 26.83 ? 364 THR A N   1 
ATOM   2073 C CA  . THR A 1 276 ? 97.792  31.626 45.326  1.00 27.66 ? 364 THR A CA  1 
ATOM   2074 C C   . THR A 1 276 ? 97.712  31.321 43.832  1.00 28.10 ? 364 THR A C   1 
ATOM   2075 O O   . THR A 1 276 ? 97.770  32.231 43.008  1.00 29.34 ? 364 THR A O   1 
ATOM   2076 C CB  . THR A 1 276 ? 99.068  30.971 45.901  1.00 28.00 ? 364 THR A CB  1 
ATOM   2077 O OG1 . THR A 1 276 ? 99.137  31.211 47.310  1.00 28.62 ? 364 THR A OG1 1 
ATOM   2078 C CG2 . THR A 1 276 ? 100.321 31.568 45.242  1.00 28.34 ? 364 THR A CG2 1 
ATOM   2079 N N   . ILE A 1 277 ? 97.571  30.050 43.470  1.00 27.57 ? 365 ILE A N   1 
ATOM   2080 C CA  . ILE A 1 277 ? 97.477  29.717 42.056  1.00 27.00 ? 365 ILE A CA  1 
ATOM   2081 C C   . ILE A 1 277 ? 96.467  30.596 41.314  1.00 27.51 ? 365 ILE A C   1 
ATOM   2082 O O   . ILE A 1 277 ? 96.736  31.036 40.200  1.00 27.80 ? 365 ILE A O   1 
ATOM   2083 C CB  . ILE A 1 277 ? 97.106  28.253 41.859  1.00 25.99 ? 365 ILE A CB  1 
ATOM   2084 C CG1 . ILE A 1 277 ? 98.212  27.367 42.431  1.00 25.06 ? 365 ILE A CG1 1 
ATOM   2085 C CG2 . ILE A 1 277 ? 96.911  27.966 40.392  1.00 25.81 ? 365 ILE A CG2 1 
ATOM   2086 C CD1 . ILE A 1 277 ? 97.861  25.906 42.481  1.00 23.62 ? 365 ILE A CD1 1 
ATOM   2087 N N   . SER A 1 278 ? 95.324  30.883 41.928  1.00 27.81 ? 366 SER A N   1 
ATOM   2088 C CA  . SER A 1 278 ? 94.324  31.695 41.250  1.00 28.79 ? 366 SER A CA  1 
ATOM   2089 C C   . SER A 1 278 ? 94.756  33.148 40.993  1.00 29.67 ? 366 SER A C   1 
ATOM   2090 O O   . SER A 1 278 ? 94.311  33.755 40.023  1.00 29.85 ? 366 SER A O   1 
ATOM   2091 C CB  . SER A 1 278 ? 92.988  31.675 42.005  1.00 28.52 ? 366 SER A CB  1 
ATOM   2092 O OG  . SER A 1 278 ? 92.973  32.579 43.094  1.00 29.87 ? 366 SER A OG  1 
ATOM   2093 N N   . ASN A 1 279 ? 95.603  33.720 41.846  1.00 30.46 ? 367 ASN A N   1 
ATOM   2094 C CA  . ASN A 1 279 ? 96.049  35.093 41.599  1.00 31.01 ? 367 ASN A CA  1 
ATOM   2095 C C   . ASN A 1 279 ? 97.124  35.104 40.504  1.00 31.63 ? 367 ASN A C   1 
ATOM   2096 O O   . ASN A 1 279 ? 97.448  36.162 39.949  1.00 31.24 ? 367 ASN A O   1 
ATOM   2097 C CB  . ASN A 1 279 ? 96.585  35.766 42.876  1.00 30.55 ? 367 ASN A CB  1 
ATOM   2098 C CG  . ASN A 1 279 ? 95.471  36.256 43.799  1.00 31.04 ? 367 ASN A CG  1 
ATOM   2099 O OD1 . ASN A 1 279 ? 94.588  37.015 43.383  1.00 30.98 ? 367 ASN A OD1 1 
ATOM   2100 N ND2 . ASN A 1 279 ? 95.518  35.839 45.061  1.00 31.21 ? 367 ASN A ND2 1 
ATOM   2101 N N   . ILE A 1 280 ? 97.673  33.931 40.194  1.00 31.37 ? 368 ILE A N   1 
ATOM   2102 C CA  . ILE A 1 280 ? 98.675  33.846 39.147  1.00 32.09 ? 368 ILE A CA  1 
ATOM   2103 C C   . ILE A 1 280 ? 97.992  33.594 37.798  1.00 33.05 ? 368 ILE A C   1 
ATOM   2104 O O   . ILE A 1 280 ? 98.536  33.938 36.744  1.00 33.42 ? 368 ILE A O   1 
ATOM   2105 C CB  . ILE A 1 280 ? 99.684  32.724 39.409  1.00 31.65 ? 368 ILE A CB  1 
ATOM   2106 C CG1 . ILE A 1 280 ? 100.432 32.979 40.706  1.00 31.84 ? 368 ILE A CG1 1 
ATOM   2107 C CG2 . ILE A 1 280 ? 100.695 32.664 38.295  1.00 31.10 ? 368 ILE A CG2 1 
ATOM   2108 C CD1 . ILE A 1 280 ? 101.521 31.963 40.949  1.00 31.32 ? 368 ILE A CD1 1 
ATOM   2109 N N   . THR A 1 281 ? 96.809  32.984 37.823  1.00 33.44 ? 369 THR A N   1 
ATOM   2110 C CA  . THR A 1 281 ? 96.073  32.727 36.585  1.00 33.69 ? 369 THR A CA  1 
ATOM   2111 C C   . THR A 1 281 ? 95.241  33.950 36.282  1.00 33.90 ? 369 THR A C   1 
ATOM   2112 O O   . THR A 1 281 ? 94.485  33.975 35.316  1.00 34.21 ? 369 THR A O   1 
ATOM   2113 C CB  . THR A 1 281 ? 95.130  31.507 36.683  1.00 33.22 ? 369 THR A CB  1 
ATOM   2114 O OG1 . THR A 1 281 ? 94.195  31.699 37.751  1.00 33.66 ? 369 THR A OG1 1 
ATOM   2115 C CG2 . THR A 1 281 ? 95.914  30.258 36.926  1.00 32.46 ? 369 THR A CG2 1 
ATOM   2116 N N   . ALA A 1 282 ? 95.372  34.957 37.139  1.00 34.79 ? 370 ALA A N   1 
ATOM   2117 C CA  . ALA A 1 282 ? 94.668  36.225 36.965  1.00 35.79 ? 370 ALA A CA  1 
ATOM   2118 C C   . ALA A 1 282 ? 95.613  37.180 36.231  1.00 36.73 ? 370 ALA A C   1 
ATOM   2119 O O   . ALA A 1 282 ? 95.242  38.302 35.921  1.00 37.00 ? 370 ALA A O   1 
ATOM   2120 C CB  . ALA A 1 282 ? 94.276  36.808 38.316  1.00 35.04 ? 370 ALA A CB  1 
ATOM   2121 N N   . GLY A 1 283 ? 96.835  36.714 35.966  1.00 38.57 ? 371 GLY A N   1 
ATOM   2122 C CA  . GLY A 1 283 ? 97.833  37.508 35.261  1.00 39.80 ? 371 GLY A CA  1 
ATOM   2123 C C   . GLY A 1 283 ? 97.751  37.354 33.747  1.00 40.77 ? 371 GLY A C   1 
ATOM   2124 O O   . GLY A 1 283 ? 96.738  36.891 33.226  1.00 40.73 ? 371 GLY A O   1 
ATOM   2125 N N   . ASN A 1 284 ? 98.817  37.730 33.039  1.00 41.92 ? 372 ASN A N   1 
ATOM   2126 C CA  . ASN A 1 284 ? 98.844  37.645 31.579  1.00 42.10 ? 372 ASN A CA  1 
ATOM   2127 C C   . ASN A 1 284 ? 98.756  36.224 31.014  1.00 42.54 ? 372 ASN A C   1 
ATOM   2128 O O   . ASN A 1 284 ? 98.769  35.236 31.749  1.00 42.53 ? 372 ASN A O   1 
ATOM   2129 C CB  . ASN A 1 284 ? 100.094 38.350 31.026  1.00 42.18 ? 372 ASN A CB  1 
ATOM   2130 C CG  . ASN A 1 284 ? 101.392 37.740 31.530  1.00 41.95 ? 372 ASN A CG  1 
ATOM   2131 O OD1 . ASN A 1 284 ? 101.663 36.554 31.321  1.00 41.22 ? 372 ASN A OD1 1 
ATOM   2132 N ND2 . ASN A 1 284 ? 102.205 38.556 32.188  1.00 41.82 ? 372 ASN A ND2 1 
ATOM   2133 N N   . THR A 1 285 ? 98.664  36.148 29.690  1.00 42.90 ? 373 THR A N   1 
ATOM   2134 C CA  . THR A 1 285 ? 98.557  34.890 28.958  1.00 43.25 ? 373 THR A CA  1 
ATOM   2135 C C   . THR A 1 285 ? 99.709  33.930 29.227  1.00 43.05 ? 373 THR A C   1 
ATOM   2136 O O   . THR A 1 285 ? 99.498  32.724 29.405  1.00 42.45 ? 373 THR A O   1 
ATOM   2137 C CB  . THR A 1 285 ? 98.517  35.162 27.443  1.00 44.28 ? 373 THR A CB  1 
ATOM   2138 O OG1 . THR A 1 285 ? 97.442  36.066 27.148  1.00 45.06 ? 373 THR A OG1 1 
ATOM   2139 C CG2 . THR A 1 285 ? 98.325  33.864 26.671  1.00 44.77 ? 373 THR A CG2 1 
ATOM   2140 N N   . GLU A 1 286 ? 100.926 34.475 29.235  1.00 42.65 ? 374 GLU A N   1 
ATOM   2141 C CA  . GLU A 1 286 ? 102.122 33.679 29.461  1.00 42.27 ? 374 GLU A CA  1 
ATOM   2142 C C   . GLU A 1 286 ? 102.103 33.019 30.843  1.00 42.12 ? 374 GLU A C   1 
ATOM   2143 O O   . GLU A 1 286 ? 102.424 31.833 30.986  1.00 42.11 ? 374 GLU A O   1 
ATOM   2144 C CB  . GLU A 1 286 ? 103.366 34.558 29.296  1.00 41.84 ? 374 GLU A CB  1 
ATOM   2145 N N   . GLN A 1 287 ? 101.699 33.786 31.851  1.00 41.71 ? 375 GLN A N   1 
ATOM   2146 C CA  . GLN A 1 287 ? 101.650 33.288 33.216  1.00 40.90 ? 375 GLN A CA  1 
ATOM   2147 C C   . GLN A 1 287 ? 100.619 32.175 33.342  1.00 40.34 ? 375 GLN A C   1 
ATOM   2148 O O   . GLN A 1 287 ? 100.793 31.243 34.137  1.00 40.42 ? 375 GLN A O   1 
ATOM   2149 C CB  . GLN A 1 287 ? 101.351 34.441 34.169  1.00 41.12 ? 375 GLN A CB  1 
ATOM   2150 C CG  . GLN A 1 287 ? 102.342 35.580 34.001  1.00 41.53 ? 375 GLN A CG  1 
ATOM   2151 C CD  . GLN A 1 287 ? 102.149 36.701 34.998  1.00 42.00 ? 375 GLN A CD  1 
ATOM   2152 O OE1 . GLN A 1 287 ? 101.053 37.248 35.135  1.00 41.43 ? 375 GLN A OE1 1 
ATOM   2153 N NE2 . GLN A 1 287 ? 103.227 37.065 35.690  1.00 42.21 ? 375 GLN A NE2 1 
ATOM   2154 N N   . ILE A 1 288 ? 99.554  32.262 32.547  1.00 39.57 ? 376 ILE A N   1 
ATOM   2155 C CA  . ILE A 1 288 ? 98.524  31.222 32.561  1.00 38.88 ? 376 ILE A CA  1 
ATOM   2156 C C   . ILE A 1 288 ? 99.092  29.945 31.953  1.00 38.69 ? 376 ILE A C   1 
ATOM   2157 O O   . ILE A 1 288 ? 98.763  28.842 32.394  1.00 38.48 ? 376 ILE A O   1 
ATOM   2158 C CB  . ILE A 1 288 ? 97.276  31.609 31.745  1.00 38.26 ? 376 ILE A CB  1 
ATOM   2159 C CG1 . ILE A 1 288 ? 96.543  32.764 32.415  1.00 37.63 ? 376 ILE A CG1 1 
ATOM   2160 C CG2 . ILE A 1 288 ? 96.334  30.414 31.631  1.00 38.65 ? 376 ILE A CG2 1 
ATOM   2161 C CD1 . ILE A 1 288 ? 95.288  33.155 31.695  1.00 36.13 ? 376 ILE A CD1 1 
ATOM   2162 N N   . GLN A 1 289 ? 99.938  30.105 30.939  1.00 38.73 ? 377 GLN A N   1 
ATOM   2163 C CA  . GLN A 1 289 ? 100.557 28.966 30.280  1.00 38.68 ? 377 GLN A CA  1 
ATOM   2164 C C   . GLN A 1 289 ? 101.570 28.331 31.229  1.00 38.79 ? 377 GLN A C   1 
ATOM   2165 O O   . GLN A 1 289 ? 101.707 27.105 31.275  1.00 37.88 ? 377 GLN A O   1 
ATOM   2166 C CB  . GLN A 1 289 ? 101.262 29.405 28.997  1.00 38.33 ? 377 GLN A CB  1 
ATOM   2167 C CG  . GLN A 1 289 ? 101.788 28.238 28.180  1.00 38.64 ? 377 GLN A CG  1 
ATOM   2168 C CD  . GLN A 1 289 ? 100.671 27.365 27.610  1.00 39.08 ? 377 GLN A CD  1 
ATOM   2169 O OE1 . GLN A 1 289 ? 99.854  27.842 26.820  1.00 39.25 ? 377 GLN A OE1 1 
ATOM   2170 N NE2 . GLN A 1 289 ? 100.632 26.085 28.007  1.00 37.71 ? 377 GLN A NE2 1 
ATOM   2171 N N   . ALA A 1 290 ? 102.269 29.176 31.985  1.00 39.07 ? 378 ALA A N   1 
ATOM   2172 C CA  . ALA A 1 290 ? 103.263 28.706 32.939  1.00 39.68 ? 378 ALA A CA  1 
ATOM   2173 C C   . ALA A 1 290 ? 102.605 27.731 33.896  1.00 40.28 ? 378 ALA A C   1 
ATOM   2174 O O   . ALA A 1 290 ? 103.170 26.677 34.207  1.00 41.13 ? 378 ALA A O   1 
ATOM   2175 C CB  . ALA A 1 290 ? 103.842 29.870 33.708  1.00 39.07 ? 378 ALA A CB  1 
ATOM   2176 N N   . VAL A 1 291 ? 101.409 28.097 34.358  1.00 40.26 ? 379 VAL A N   1 
ATOM   2177 C CA  . VAL A 1 291 ? 100.646 27.267 35.281  1.00 40.77 ? 379 VAL A CA  1 
ATOM   2178 C C   . VAL A 1 291 ? 100.260 25.955 34.613  1.00 41.71 ? 379 VAL A C   1 
ATOM   2179 O O   . VAL A 1 291 ? 100.340 24.891 35.228  1.00 42.19 ? 379 VAL A O   1 
ATOM   2180 C CB  . VAL A 1 291 ? 99.374  27.989 35.754  1.00 40.62 ? 379 VAL A CB  1 
ATOM   2181 C CG1 . VAL A 1 291 ? 98.508  27.049 36.583  1.00 40.61 ? 379 VAL A CG1 1 
ATOM   2182 C CG2 . VAL A 1 291 ? 99.755  29.203 36.570  1.00 40.46 ? 379 VAL A CG2 1 
ATOM   2183 N N   . ILE A 1 292 ? 99.834  26.035 33.355  1.00 42.54 ? 380 ILE A N   1 
ATOM   2184 C CA  . ILE A 1 292 ? 99.456  24.848 32.589  1.00 42.68 ? 380 ILE A CA  1 
ATOM   2185 C C   . ILE A 1 292 ? 100.648 23.916 32.360  1.00 42.95 ? 380 ILE A C   1 
ATOM   2186 O O   . ILE A 1 292 ? 100.499 22.692 32.392  1.00 43.22 ? 380 ILE A O   1 
ATOM   2187 C CB  . ILE A 1 292 ? 98.887  25.225 31.217  1.00 42.77 ? 380 ILE A CB  1 
ATOM   2188 C CG1 . ILE A 1 292 ? 97.512  25.865 31.382  1.00 43.17 ? 380 ILE A CG1 1 
ATOM   2189 C CG2 . ILE A 1 292 ? 98.807  24.001 30.332  1.00 41.83 ? 380 ILE A CG2 1 
ATOM   2190 C CD1 . ILE A 1 292 ? 96.889  26.295 30.061  1.00 43.03 ? 380 ILE A CD1 1 
ATOM   2191 N N   . ASP A 1 293 ? 101.822 24.495 32.115  1.00 42.62 ? 381 ASP A N   1 
ATOM   2192 C CA  . ASP A 1 293 ? 103.018 23.696 31.890  1.00 42.59 ? 381 ASP A CA  1 
ATOM   2193 C C   . ASP A 1 293 ? 103.548 23.080 33.179  1.00 42.49 ? 381 ASP A C   1 
ATOM   2194 O O   . ASP A 1 293 ? 104.218 22.046 33.148  1.00 42.48 ? 381 ASP A O   1 
ATOM   2195 C CB  . ASP A 1 293 ? 104.128 24.525 31.235  1.00 43.03 ? 381 ASP A CB  1 
ATOM   2196 C CG  . ASP A 1 293 ? 103.781 24.952 29.820  1.00 43.79 ? 381 ASP A CG  1 
ATOM   2197 O OD1 . ASP A 1 293 ? 103.193 24.120 29.091  1.00 43.84 ? 381 ASP A OD1 1 
ATOM   2198 O OD2 . ASP A 1 293 ? 104.117 26.099 29.428  1.00 43.35 ? 381 ASP A OD2 1 
ATOM   2199 N N   . ALA A 1 294 ? 103.252 23.712 34.308  1.00 41.83 ? 382 ALA A N   1 
ATOM   2200 C CA  . ALA A 1 294 ? 103.711 23.199 35.585  1.00 41.07 ? 382 ALA A CA  1 
ATOM   2201 C C   . ALA A 1 294 ? 102.914 21.948 35.935  1.00 40.90 ? 382 ALA A C   1 
ATOM   2202 O O   . ALA A 1 294 ? 103.302 21.180 36.810  1.00 41.10 ? 382 ALA A O   1 
ATOM   2203 C CB  . ALA A 1 294 ? 103.543 24.258 36.658  1.00 40.45 ? 382 ALA A CB  1 
ATOM   2204 N N   . ASN A 1 295 ? 101.797 21.755 35.236  1.00 40.87 ? 383 ASN A N   1 
ATOM   2205 C CA  . ASN A 1 295 ? 100.918 20.608 35.444  1.00 40.66 ? 383 ASN A CA  1 
ATOM   2206 C C   . ASN A 1 295 ? 100.083 20.709 36.703  1.00 40.52 ? 383 ASN A C   1 
ATOM   2207 O O   . ASN A 1 295 ? 99.932  19.729 37.444  1.00 40.95 ? 383 ASN A O   1 
ATOM   2208 C CB  . ASN A 1 295 ? 101.729 19.321 35.479  1.00 41.65 ? 383 ASN A CB  1 
ATOM   2209 C CG  . ASN A 1 295 ? 101.429 18.432 34.312  1.00 42.25 ? 383 ASN A CG  1 
ATOM   2210 O OD1 . ASN A 1 295 ? 100.334 17.890 34.213  1.00 43.74 ? 383 ASN A OD1 1 
ATOM   2211 N ND2 . ASN A 1 295 ? 102.386 18.291 33.401  1.00 42.59 ? 383 ASN A ND2 1 
ATOM   2212 N N   . LEU A 1 296 ? 99.528  21.896 36.928  1.00 39.56 ? 384 LEU A N   1 
ATOM   2213 C CA  . LEU A 1 296 ? 98.698  22.166 38.093  1.00 38.38 ? 384 LEU A CA  1 
ATOM   2214 C C   . LEU A 1 296 ? 97.206  21.970 37.823  1.00 37.49 ? 384 LEU A C   1 
ATOM   2215 O O   . LEU A 1 296 ? 96.431  21.744 38.751  1.00 37.49 ? 384 LEU A O   1 
ATOM   2216 C CB  . LEU A 1 296 ? 98.969  23.600 38.588  1.00 38.57 ? 384 LEU A CB  1 
ATOM   2217 C CG  . LEU A 1 296 ? 100.190 23.912 39.477  1.00 37.99 ? 384 LEU A CG  1 
ATOM   2218 C CD1 . LEU A 1 296 ? 101.392 23.124 39.055  1.00 38.23 ? 384 LEU A CD1 1 
ATOM   2219 C CD2 . LEU A 1 296 ? 100.481 25.393 39.412  1.00 38.26 ? 384 LEU A CD2 1 
ATOM   2220 N N   . ILE A 1 297 ? 96.801  22.036 36.560  1.00 36.84 ? 385 ILE A N   1 
ATOM   2221 C CA  . ILE A 1 297 ? 95.388  21.890 36.220  1.00 36.98 ? 385 ILE A CA  1 
ATOM   2222 C C   . ILE A 1 297 ? 94.759  20.568 36.672  1.00 37.10 ? 385 ILE A C   1 
ATOM   2223 O O   . ILE A 1 297 ? 93.690  20.560 37.268  1.00 37.43 ? 385 ILE A O   1 
ATOM   2224 C CB  . ILE A 1 297 ? 95.135  22.056 34.700  1.00 36.69 ? 385 ILE A CB  1 
ATOM   2225 C CG1 . ILE A 1 297 ? 95.661  23.408 34.203  1.00 35.73 ? 385 ILE A CG1 1 
ATOM   2226 C CG2 . ILE A 1 297 ? 93.634  21.983 34.431  1.00 36.41 ? 385 ILE A CG2 1 
ATOM   2227 C CD1 . ILE A 1 297 ? 94.951  24.610 34.787  1.00 34.23 ? 385 ILE A CD1 1 
ATOM   2228 N N   . PRO A 1 298 ? 95.396  19.434 36.369  1.00 37.20 ? 386 PRO A N   1 
ATOM   2229 C CA  . PRO A 1 298 ? 94.815  18.157 36.799  1.00 37.17 ? 386 PRO A CA  1 
ATOM   2230 C C   . PRO A 1 298 ? 94.488  18.065 38.295  1.00 37.13 ? 386 PRO A C   1 
ATOM   2231 O O   . PRO A 1 298 ? 93.354  17.756 38.670  1.00 37.20 ? 386 PRO A O   1 
ATOM   2232 C CB  . PRO A 1 298 ? 95.865  17.141 36.345  1.00 37.56 ? 386 PRO A CB  1 
ATOM   2233 C CG  . PRO A 1 298 ? 96.394  17.812 35.047  1.00 37.64 ? 386 PRO A CG  1 
ATOM   2234 C CD  . PRO A 1 298 ? 96.635  19.206 35.602  1.00 37.47 ? 386 PRO A CD  1 
ATOM   2235 N N   . PRO A 1 299 ? 95.466  18.326 39.178  1.00 37.21 ? 387 PRO A N   1 
ATOM   2236 C CA  . PRO A 1 299 ? 95.133  18.231 40.607  1.00 37.66 ? 387 PRO A CA  1 
ATOM   2237 C C   . PRO A 1 299 ? 94.081  19.261 41.018  1.00 37.69 ? 387 PRO A C   1 
ATOM   2238 O O   . PRO A 1 299 ? 93.271  19.022 41.920  1.00 37.83 ? 387 PRO A O   1 
ATOM   2239 C CB  . PRO A 1 299 ? 96.477  18.476 41.279  1.00 37.14 ? 387 PRO A CB  1 
ATOM   2240 C CG  . PRO A 1 299 ? 97.116  19.445 40.320  1.00 38.02 ? 387 PRO A CG  1 
ATOM   2241 C CD  . PRO A 1 299 ? 96.876  18.696 39.022  1.00 37.29 ? 387 PRO A CD  1 
ATOM   2242 N N   . LEU A 1 300 ? 94.102  20.407 40.347  1.00 36.79 ? 388 LEU A N   1 
ATOM   2243 C CA  . LEU A 1 300 ? 93.141  21.464 40.624  1.00 36.13 ? 388 LEU A CA  1 
ATOM   2244 C C   . LEU A 1 300 ? 91.719  20.936 40.341  1.00 35.94 ? 388 LEU A C   1 
ATOM   2245 O O   . LEU A 1 300 ? 90.792  21.128 41.136  1.00 35.70 ? 388 LEU A O   1 
ATOM   2246 C CB  . LEU A 1 300 ? 93.480  22.673 39.742  1.00 35.41 ? 388 LEU A CB  1 
ATOM   2247 C CG  . LEU A 1 300 ? 93.699  24.046 40.388  1.00 34.39 ? 388 LEU A CG  1 
ATOM   2248 C CD1 . LEU A 1 300 ? 94.356  23.907 41.732  1.00 33.37 ? 388 LEU A CD1 1 
ATOM   2249 C CD2 . LEU A 1 300 ? 94.540  24.910 39.448  1.00 33.02 ? 388 LEU A CD2 1 
ATOM   2250 N N   . VAL A 1 301 ? 91.565  20.247 39.215  1.00 35.29 ? 389 VAL A N   1 
ATOM   2251 C CA  . VAL A 1 301 ? 90.278  19.691 38.825  1.00 35.36 ? 389 VAL A CA  1 
ATOM   2252 C C   . VAL A 1 301 ? 89.782  18.638 39.826  1.00 35.85 ? 389 VAL A C   1 
ATOM   2253 O O   . VAL A 1 301 ? 88.584  18.520 40.095  1.00 35.79 ? 389 VAL A O   1 
ATOM   2254 C CB  . VAL A 1 301 ? 90.376  19.076 37.408  1.00 34.69 ? 389 VAL A CB  1 
ATOM   2255 C CG1 . VAL A 1 301 ? 89.123  18.273 37.078  1.00 33.96 ? 389 VAL A CG1 1 
ATOM   2256 C CG2 . VAL A 1 301 ? 90.565  20.182 36.389  1.00 33.56 ? 389 VAL A CG2 1 
ATOM   2257 N N   . LYS A 1 302 ? 90.711  17.884 40.393  1.00 36.32 ? 390 LYS A N   1 
ATOM   2258 C CA  . LYS A 1 302 ? 90.350  16.855 41.350  1.00 36.38 ? 390 LYS A CA  1 
ATOM   2259 C C   . LYS A 1 302 ? 89.796  17.499 42.616  1.00 36.24 ? 390 LYS A C   1 
ATOM   2260 O O   . LYS A 1 302 ? 88.770  17.071 43.150  1.00 36.30 ? 390 LYS A O   1 
ATOM   2261 C CB  . LYS A 1 302 ? 91.581  16.008 41.675  1.00 37.22 ? 390 LYS A CB  1 
ATOM   2262 C CG  . LYS A 1 302 ? 91.289  14.768 42.478  1.00 37.81 ? 390 LYS A CG  1 
ATOM   2263 C CD  . LYS A 1 302 ? 90.384  13.824 41.710  1.00 39.27 ? 390 LYS A CD  1 
ATOM   2264 C CE  . LYS A 1 302 ? 90.030  12.599 42.551  1.00 40.04 ? 390 LYS A CE  1 
ATOM   2265 N NZ  . LYS A 1 302 ? 89.122  11.681 41.813  1.00 41.15 ? 390 LYS A NZ  1 
ATOM   2266 N N   . LEU A 1 303 ? 90.476  18.533 43.098  1.00 36.18 ? 391 LEU A N   1 
ATOM   2267 C CA  . LEU A 1 303 ? 90.023  19.231 44.293  1.00 36.40 ? 391 LEU A CA  1 
ATOM   2268 C C   . LEU A 1 303 ? 88.723  19.947 43.994  1.00 37.02 ? 391 LEU A C   1 
ATOM   2269 O O   . LEU A 1 303 ? 87.864  20.083 44.868  1.00 36.79 ? 391 LEU A O   1 
ATOM   2270 C CB  . LEU A 1 303 ? 91.069  20.246 44.774  1.00 35.71 ? 391 LEU A CB  1 
ATOM   2271 C CG  . LEU A 1 303 ? 92.288  19.717 45.542  1.00 35.06 ? 391 LEU A CG  1 
ATOM   2272 C CD1 . LEU A 1 303 ? 93.329  20.820 45.704  1.00 34.47 ? 391 LEU A CD1 1 
ATOM   2273 C CD2 . LEU A 1 303 ? 91.839  19.182 46.901  1.00 34.33 ? 391 LEU A CD2 1 
ATOM   2274 N N   . LEU A 1 304 ? 88.582  20.396 42.749  1.00 37.78 ? 392 LEU A N   1 
ATOM   2275 C CA  . LEU A 1 304 ? 87.384  21.108 42.329  1.00 38.41 ? 392 LEU A CA  1 
ATOM   2276 C C   . LEU A 1 304 ? 86.192  20.188 42.516  1.00 39.19 ? 392 LEU A C   1 
ATOM   2277 O O   . LEU A 1 304 ? 85.106  20.637 42.888  1.00 39.39 ? 392 LEU A O   1 
ATOM   2278 C CB  . LEU A 1 304 ? 87.518  21.556 40.863  1.00 38.53 ? 392 LEU A CB  1 
ATOM   2279 C CG  . LEU A 1 304 ? 86.530  22.542 40.202  1.00 38.55 ? 392 LEU A CG  1 
ATOM   2280 C CD1 . LEU A 1 304 ? 85.279  21.866 39.740  1.00 38.44 ? 392 LEU A CD1 1 
ATOM   2281 C CD2 . LEU A 1 304 ? 86.207  23.658 41.171  1.00 38.94 ? 392 LEU A CD2 1 
ATOM   2282 N N   . GLU A 1 305 ? 86.394  18.891 42.303  1.00 39.84 ? 393 GLU A N   1 
ATOM   2283 C CA  . GLU A 1 305 ? 85.281  17.966 42.456  1.00 40.95 ? 393 GLU A CA  1 
ATOM   2284 C C   . GLU A 1 305 ? 85.168  17.271 43.817  1.00 40.49 ? 393 GLU A C   1 
ATOM   2285 O O   . GLU A 1 305 ? 84.084  16.829 44.167  1.00 40.88 ? 393 GLU A O   1 
ATOM   2286 C CB  . GLU A 1 305 ? 85.304  16.890 41.363  1.00 42.17 ? 393 GLU A CB  1 
ATOM   2287 C CG  . GLU A 1 305 ? 86.333  15.808 41.594  1.00 44.92 ? 393 GLU A CG  1 
ATOM   2288 C CD  . GLU A 1 305 ? 86.321  14.732 40.522  1.00 46.14 ? 393 GLU A CD  1 
ATOM   2289 O OE1 . GLU A 1 305 ? 86.514  15.091 39.335  1.00 46.36 ? 393 GLU A OE1 1 
ATOM   2290 O OE2 . GLU A 1 305 ? 86.131  13.536 40.871  1.00 46.60 ? 393 GLU A OE2 1 
ATOM   2291 N N   . VAL A 1 306 ? 86.245  17.158 44.592  1.00 39.73 ? 394 VAL A N   1 
ATOM   2292 C CA  . VAL A 1 306 ? 86.100  16.465 45.874  1.00 38.78 ? 394 VAL A CA  1 
ATOM   2293 C C   . VAL A 1 306 ? 86.523  17.154 47.166  1.00 38.68 ? 394 VAL A C   1 
ATOM   2294 O O   . VAL A 1 306 ? 86.266  16.624 48.243  1.00 38.82 ? 394 VAL A O   1 
ATOM   2295 C CB  . VAL A 1 306 ? 86.794  15.083 45.854  1.00 38.19 ? 394 VAL A CB  1 
ATOM   2296 C CG1 . VAL A 1 306 ? 86.154  14.205 44.813  1.00 37.96 ? 394 VAL A CG1 1 
ATOM   2297 C CG2 . VAL A 1 306 ? 88.272  15.239 45.580  1.00 38.04 ? 394 VAL A CG2 1 
ATOM   2298 N N   . ALA A 1 307 ? 87.150  18.321 47.086  1.00 38.34 ? 395 ALA A N   1 
ATOM   2299 C CA  . ALA A 1 307 ? 87.594  19.008 48.300  1.00 38.24 ? 395 ALA A CA  1 
ATOM   2300 C C   . ALA A 1 307 ? 86.439  19.542 49.131  1.00 38.27 ? 395 ALA A C   1 
ATOM   2301 O O   . ALA A 1 307 ? 85.284  19.419 48.739  1.00 38.55 ? 395 ALA A O   1 
ATOM   2302 C CB  . ALA A 1 307 ? 88.530  20.149 47.929  1.00 38.53 ? 395 ALA A CB  1 
ATOM   2303 N N   . GLU A 1 308 ? 86.759  20.120 50.290  1.00 38.76 ? 396 GLU A N   1 
ATOM   2304 C CA  . GLU A 1 308 ? 85.754  20.733 51.167  1.00 38.72 ? 396 GLU A CA  1 
ATOM   2305 C C   . GLU A 1 308 ? 85.295  21.984 50.411  1.00 38.08 ? 396 GLU A C   1 
ATOM   2306 O O   . GLU A 1 308 ? 85.996  22.446 49.500  1.00 37.98 ? 396 GLU A O   1 
ATOM   2307 C CB  . GLU A 1 308 ? 86.383  21.157 52.497  1.00 40.34 ? 396 GLU A CB  1 
ATOM   2308 C CG  . GLU A 1 308 ? 86.934  20.025 53.341  1.00 42.17 ? 396 GLU A CG  1 
ATOM   2309 C CD  . GLU A 1 308 ? 85.842  19.154 53.936  1.00 43.82 ? 396 GLU A CD  1 
ATOM   2310 O OE1 . GLU A 1 308 ? 85.001  19.693 54.695  1.00 43.84 ? 396 GLU A OE1 1 
ATOM   2311 O OE2 . GLU A 1 308 ? 85.827  17.930 53.651  1.00 44.77 ? 396 GLU A OE2 1 
ATOM   2312 N N   . TYR A 1 309 ? 84.151  22.555 50.784  1.00 36.70 ? 397 TYR A N   1 
ATOM   2313 C CA  . TYR A 1 309 ? 83.664  23.729 50.059  1.00 35.28 ? 397 TYR A CA  1 
ATOM   2314 C C   . TYR A 1 309 ? 84.656  24.898 50.019  1.00 34.43 ? 397 TYR A C   1 
ATOM   2315 O O   . TYR A 1 309 ? 84.928  25.438 48.945  1.00 33.81 ? 397 TYR A O   1 
ATOM   2316 C CB  . TYR A 1 309 ? 82.322  24.218 50.616  1.00 34.67 ? 397 TYR A CB  1 
ATOM   2317 C CG  . TYR A 1 309 ? 81.742  25.326 49.768  1.00 34.37 ? 397 TYR A CG  1 
ATOM   2318 C CD1 . TYR A 1 309 ? 81.420  25.102 48.428  1.00 34.17 ? 397 TYR A CD1 1 
ATOM   2319 C CD2 . TYR A 1 309 ? 81.592  26.617 50.273  1.00 34.17 ? 397 TYR A CD2 1 
ATOM   2320 C CE1 . TYR A 1 309 ? 80.970  26.140 47.607  1.00 34.20 ? 397 TYR A CE1 1 
ATOM   2321 C CE2 . TYR A 1 309 ? 81.144  27.665 49.464  1.00 34.24 ? 397 TYR A CE2 1 
ATOM   2322 C CZ  . TYR A 1 309 ? 80.836  27.423 48.131  1.00 34.53 ? 397 TYR A CZ  1 
ATOM   2323 O OH  . TYR A 1 309 ? 80.411  28.464 47.326  1.00 33.67 ? 397 TYR A OH  1 
ATOM   2324 N N   . LYS A 1 310 ? 85.199  25.277 51.175  1.00 33.98 ? 398 LYS A N   1 
ATOM   2325 C CA  . LYS A 1 310 ? 86.153  26.387 51.250  1.00 33.55 ? 398 LYS A CA  1 
ATOM   2326 C C   . LYS A 1 310 ? 87.387  26.208 50.365  1.00 33.78 ? 398 LYS A C   1 
ATOM   2327 O O   . LYS A 1 310 ? 88.097  27.168 50.082  1.00 33.85 ? 398 LYS A O   1 
ATOM   2328 C CB  . LYS A 1 310 ? 86.592  26.626 52.697  1.00 32.71 ? 398 LYS A CB  1 
ATOM   2329 C CG  . LYS A 1 310 ? 87.364  25.492 53.335  1.00 32.08 ? 398 LYS A CG  1 
ATOM   2330 C CD  . LYS A 1 310 ? 87.775  25.873 54.747  1.00 31.77 ? 398 LYS A CD  1 
ATOM   2331 C CE  . LYS A 1 310 ? 88.697  24.835 55.355  1.00 31.56 ? 398 LYS A CE  1 
ATOM   2332 N NZ  . LYS A 1 310 ? 89.175  25.260 56.690  1.00 31.24 ? 398 LYS A NZ  1 
ATOM   2333 N N   . THR A 1 311 ? 87.645  24.979 49.932  1.00 34.25 ? 399 THR A N   1 
ATOM   2334 C CA  . THR A 1 311 ? 88.778  24.719 49.053  1.00 34.14 ? 399 THR A CA  1 
ATOM   2335 C C   . THR A 1 311 ? 88.319  24.694 47.588  1.00 34.51 ? 399 THR A C   1 
ATOM   2336 O O   . THR A 1 311 ? 88.982  25.270 46.730  1.00 34.42 ? 399 THR A O   1 
ATOM   2337 C CB  . THR A 1 311 ? 89.476  23.399 49.413  1.00 33.97 ? 399 THR A CB  1 
ATOM   2338 O OG1 . THR A 1 311 ? 90.045  23.502 50.723  1.00 32.72 ? 399 THR A OG1 1 
ATOM   2339 C CG2 . THR A 1 311 ? 90.575  23.100 48.418  1.00 33.93 ? 399 THR A CG2 1 
ATOM   2340 N N   . LYS A 1 312 ? 87.192  24.035 47.306  1.00 35.07 ? 400 LYS A N   1 
ATOM   2341 C CA  . LYS A 1 312 ? 86.647  23.993 45.942  1.00 35.69 ? 400 LYS A CA  1 
ATOM   2342 C C   . LYS A 1 312 ? 86.500  25.413 45.438  1.00 35.87 ? 400 LYS A C   1 
ATOM   2343 O O   . LYS A 1 312 ? 86.796  25.728 44.281  1.00 35.95 ? 400 LYS A O   1 
ATOM   2344 C CB  . LYS A 1 312 ? 85.251  23.375 45.917  1.00 35.85 ? 400 LYS A CB  1 
ATOM   2345 C CG  . LYS A 1 312 ? 85.192  21.909 46.179  1.00 35.88 ? 400 LYS A CG  1 
ATOM   2346 C CD  . LYS A 1 312 ? 83.806  21.403 45.885  1.00 36.15 ? 400 LYS A CD  1 
ATOM   2347 C CE  . LYS A 1 312 ? 83.688  19.915 46.182  1.00 35.76 ? 400 LYS A CE  1 
ATOM   2348 N NZ  . LYS A 1 312 ? 82.283  19.459 46.007  1.00 35.55 ? 400 LYS A NZ  1 
ATOM   2349 N N   . LYS A 1 313 ? 86.005  26.245 46.344  1.00 35.86 ? 401 LYS A N   1 
ATOM   2350 C CA  . LYS A 1 313 ? 85.764  27.664 46.126  1.00 36.26 ? 401 LYS A CA  1 
ATOM   2351 C C   . LYS A 1 313 ? 86.974  28.321 45.455  1.00 35.93 ? 401 LYS A C   1 
ATOM   2352 O O   . LYS A 1 313 ? 86.849  29.044 44.462  1.00 35.44 ? 401 LYS A O   1 
ATOM   2353 C CB  . LYS A 1 313 ? 85.484  28.295 47.493  1.00 36.81 ? 401 LYS A CB  1 
ATOM   2354 C CG  . LYS A 1 313 ? 84.754  29.604 47.480  1.00 37.82 ? 401 LYS A CG  1 
ATOM   2355 C CD  . LYS A 1 313 ? 84.226  29.898 48.882  1.00 38.30 ? 401 LYS A CD  1 
ATOM   2356 C CE  . LYS A 1 313 ? 83.409  31.190 48.922  1.00 39.01 ? 401 LYS A CE  1 
ATOM   2357 N NZ  . LYS A 1 313 ? 82.678  31.363 50.216  1.00 39.88 ? 401 LYS A NZ  1 
ATOM   2358 N N   . GLU A 1 314 ? 88.148  28.046 46.003  1.00 36.15 ? 402 GLU A N   1 
ATOM   2359 C CA  . GLU A 1 314 ? 89.387  28.599 45.489  1.00 35.97 ? 402 GLU A CA  1 
ATOM   2360 C C   . GLU A 1 314 ? 89.800  27.941 44.168  1.00 35.87 ? 402 GLU A C   1 
ATOM   2361 O O   . GLU A 1 314 ? 90.280  28.617 43.248  1.00 35.16 ? 402 GLU A O   1 
ATOM   2362 C CB  . GLU A 1 314 ? 90.469  28.421 46.543  1.00 36.47 ? 402 GLU A CB  1 
ATOM   2363 C CG  . GLU A 1 314 ? 91.077  29.714 47.014  1.00 38.33 ? 402 GLU A CG  1 
ATOM   2364 C CD  . GLU A 1 314 ? 90.062  30.695 47.556  1.00 38.95 ? 402 GLU A CD  1 
ATOM   2365 O OE1 . GLU A 1 314 ? 89.325  30.313 48.491  1.00 39.59 ? 402 GLU A OE1 1 
ATOM   2366 O OE2 . GLU A 1 314 ? 90.017  31.849 47.053  1.00 39.04 ? 402 GLU A OE2 1 
ATOM   2367 N N   . ALA A 1 315 ? 89.613  26.624 44.076  1.00 35.01 ? 403 ALA A N   1 
ATOM   2368 C CA  . ALA A 1 315 ? 89.955  25.894 42.858  1.00 34.72 ? 403 ALA A CA  1 
ATOM   2369 C C   . ALA A 1 315 ? 89.145  26.476 41.707  1.00 34.58 ? 403 ALA A C   1 
ATOM   2370 O O   . ALA A 1 315 ? 89.644  26.655 40.590  1.00 34.90 ? 403 ALA A O   1 
ATOM   2371 C CB  . ALA A 1 315 ? 89.644  24.416 43.025  1.00 34.61 ? 403 ALA A CB  1 
ATOM   2372 N N   . CYS A 1 316 ? 87.882  26.775 41.994  1.00 33.95 ? 404 CYS A N   1 
ATOM   2373 C CA  . CYS A 1 316 ? 86.990  27.364 41.010  1.00 33.52 ? 404 CYS A CA  1 
ATOM   2374 C C   . CYS A 1 316 ? 87.617  28.636 40.446  1.00 33.47 ? 404 CYS A C   1 
ATOM   2375 O O   . CYS A 1 316 ? 87.783  28.769 39.238  1.00 33.97 ? 404 CYS A O   1 
ATOM   2376 C CB  . CYS A 1 316 ? 85.646  27.697 41.655  1.00 33.87 ? 404 CYS A CB  1 
ATOM   2377 S SG  . CYS A 1 316 ? 84.414  28.428 40.550  1.00 33.11 ? 404 CYS A SG  1 
ATOM   2378 N N   . TRP A 1 317 ? 87.971  29.579 41.311  1.00 33.00 ? 405 TRP A N   1 
ATOM   2379 C CA  . TRP A 1 317 ? 88.582  30.799 40.809  1.00 32.83 ? 405 TRP A CA  1 
ATOM   2380 C C   . TRP A 1 317 ? 89.754  30.506 39.884  1.00 32.67 ? 405 TRP A C   1 
ATOM   2381 O O   . TRP A 1 317 ? 89.756  30.933 38.734  1.00 33.29 ? 405 TRP A O   1 
ATOM   2382 C CB  . TRP A 1 317 ? 89.062  31.712 41.944  1.00 32.14 ? 405 TRP A CB  1 
ATOM   2383 C CG  . TRP A 1 317 ? 87.980  32.461 42.633  1.00 31.44 ? 405 TRP A CG  1 
ATOM   2384 C CD1 . TRP A 1 317 ? 87.277  32.071 43.737  1.00 31.32 ? 405 TRP A CD1 1 
ATOM   2385 C CD2 . TRP A 1 317 ? 87.484  33.752 42.273  1.00 30.96 ? 405 TRP A CD2 1 
ATOM   2386 N NE1 . TRP A 1 317 ? 86.374  33.048 44.091  1.00 31.25 ? 405 TRP A NE1 1 
ATOM   2387 C CE2 . TRP A 1 317 ? 86.475  34.087 43.203  1.00 30.73 ? 405 TRP A CE2 1 
ATOM   2388 C CE3 . TRP A 1 317 ? 87.785  34.652 41.247  1.00 30.80 ? 405 TRP A CE3 1 
ATOM   2389 C CZ2 . TRP A 1 317 ? 85.778  35.292 43.150  1.00 30.55 ? 405 TRP A CZ2 1 
ATOM   2390 C CZ3 . TRP A 1 317 ? 87.090  35.853 41.190  1.00 31.43 ? 405 TRP A CZ3 1 
ATOM   2391 C CH2 . TRP A 1 317 ? 86.092  36.159 42.137  1.00 31.41 ? 405 TRP A CH2 1 
ATOM   2392 N N   . ALA A 1 318 ? 90.746  29.785 40.395  1.00 32.67 ? 406 ALA A N   1 
ATOM   2393 C CA  . ALA A 1 318 ? 91.930  29.428 39.626  1.00 32.80 ? 406 ALA A CA  1 
ATOM   2394 C C   . ALA A 1 318 ? 91.590  28.997 38.196  1.00 33.36 ? 406 ALA A C   1 
ATOM   2395 O O   . ALA A 1 318 ? 92.116  29.551 37.228  1.00 33.07 ? 406 ALA A O   1 
ATOM   2396 C CB  . ALA A 1 318 ? 92.683  28.311 40.338  1.00 32.38 ? 406 ALA A CB  1 
ATOM   2397 N N   . ILE A 1 319 ? 90.706  28.008 38.074  1.00 34.11 ? 407 ILE A N   1 
ATOM   2398 C CA  . ILE A 1 319 ? 90.286  27.480 36.774  1.00 34.89 ? 407 ILE A CA  1 
ATOM   2399 C C   . ILE A 1 319 ? 89.507  28.497 35.929  1.00 35.20 ? 407 ILE A C   1 
ATOM   2400 O O   . ILE A 1 319 ? 89.683  28.582 34.709  1.00 34.53 ? 407 ILE A O   1 
ATOM   2401 C CB  . ILE A 1 319 ? 89.431  26.210 36.982  1.00 35.03 ? 407 ILE A CB  1 
ATOM   2402 C CG1 . ILE A 1 319 ? 90.296  25.122 37.615  1.00 34.89 ? 407 ILE A CG1 1 
ATOM   2403 C CG2 . ILE A 1 319 ? 88.832  25.754 35.673  1.00 34.36 ? 407 ILE A CG2 1 
ATOM   2404 C CD1 . ILE A 1 319 ? 89.556  23.851 37.920  1.00 35.40 ? 407 ILE A CD1 1 
ATOM   2405 N N   . SER A 1 320 ? 88.652  29.262 36.600  1.00 35.90 ? 408 SER A N   1 
ATOM   2406 C CA  . SER A 1 320 ? 87.837  30.278 35.957  1.00 37.08 ? 408 SER A CA  1 
ATOM   2407 C C   . SER A 1 320 ? 88.712  31.400 35.412  1.00 38.01 ? 408 SER A C   1 
ATOM   2408 O O   . SER A 1 320 ? 88.545  31.812 34.266  1.00 37.87 ? 408 SER A O   1 
ATOM   2409 C CB  . SER A 1 320 ? 86.817  30.840 36.959  1.00 37.18 ? 408 SER A CB  1 
ATOM   2410 O OG  . SER A 1 320 ? 85.912  31.749 36.347  1.00 36.58 ? 408 SER A OG  1 
ATOM   2411 N N   . ASN A 1 321 ? 89.640  31.900 36.229  1.00 39.22 ? 409 ASN A N   1 
ATOM   2412 C CA  . ASN A 1 321 ? 90.529  32.972 35.778  1.00 40.92 ? 409 ASN A CA  1 
ATOM   2413 C C   . ASN A 1 321 ? 91.334  32.497 34.559  1.00 42.48 ? 409 ASN A C   1 
ATOM   2414 O O   . ASN A 1 321 ? 91.611  33.272 33.633  1.00 42.46 ? 409 ASN A O   1 
ATOM   2415 C CB  . ASN A 1 321 ? 91.477  33.416 36.908  1.00 40.11 ? 409 ASN A CB  1 
ATOM   2416 C CG  . ASN A 1 321 ? 90.738  34.038 38.089  1.00 39.29 ? 409 ASN A CG  1 
ATOM   2417 O OD1 . ASN A 1 321 ? 89.847  34.858 37.909  1.00 39.79 ? 409 ASN A OD1 1 
ATOM   2418 N ND2 . ASN A 1 321 ? 91.132  33.673 39.297  1.00 38.06 ? 409 ASN A ND2 1 
ATOM   2419 N N   . ALA A 1 322 ? 91.693  31.214 34.559  1.00 43.82 ? 410 ALA A N   1 
ATOM   2420 C CA  . ALA A 1 322 ? 92.446  30.634 33.455  1.00 45.32 ? 410 ALA A CA  1 
ATOM   2421 C C   . ALA A 1 322 ? 91.625  30.716 32.171  1.00 46.51 ? 410 ALA A C   1 
ATOM   2422 O O   . ALA A 1 322 ? 92.147  31.067 31.111  1.00 46.27 ? 410 ALA A O   1 
ATOM   2423 C CB  . ALA A 1 322 ? 92.796  29.179 33.761  1.00 44.72 ? 410 ALA A CB  1 
ATOM   2424 N N   . SER A 1 323 ? 90.337  30.402 32.267  1.00 48.19 ? 411 SER A N   1 
ATOM   2425 C CA  . SER A 1 323 ? 89.473  30.437 31.095  1.00 50.40 ? 411 SER A CA  1 
ATOM   2426 C C   . SER A 1 323 ? 89.446  31.803 30.419  1.00 52.19 ? 411 SER A C   1 
ATOM   2427 O O   . SER A 1 323 ? 89.133  31.896 29.234  1.00 52.72 ? 411 SER A O   1 
ATOM   2428 C CB  . SER A 1 323 ? 88.046  30.005 31.459  1.00 50.49 ? 411 SER A CB  1 
ATOM   2429 O OG  . SER A 1 323 ? 87.456  30.858 32.423  1.00 50.52 ? 411 SER A OG  1 
ATOM   2430 N N   . SER A 1 324 ? 89.769  32.858 31.163  1.00 54.05 ? 412 SER A N   1 
ATOM   2431 C CA  . SER A 1 324 ? 89.795  34.204 30.599  1.00 55.82 ? 412 SER A CA  1 
ATOM   2432 C C   . SER A 1 324 ? 90.785  34.248 29.456  1.00 57.22 ? 412 SER A C   1 
ATOM   2433 O O   . SER A 1 324 ? 90.438  34.639 28.340  1.00 57.94 ? 412 SER A O   1 
ATOM   2434 C CB  . SER A 1 324 ? 90.226  35.237 31.640  1.00 55.94 ? 412 SER A CB  1 
ATOM   2435 O OG  . SER A 1 324 ? 89.266  35.365 32.667  1.00 57.31 ? 412 SER A OG  1 
ATOM   2436 N N   . GLY A 1 325 ? 92.021  33.851 29.741  1.00 58.20 ? 413 GLY A N   1 
ATOM   2437 C CA  . GLY A 1 325 ? 93.052  33.856 28.721  1.00 59.59 ? 413 GLY A CA  1 
ATOM   2438 C C   . GLY A 1 325 ? 92.694  32.978 27.538  1.00 60.81 ? 413 GLY A C   1 
ATOM   2439 O O   . GLY A 1 325 ? 93.553  32.647 26.724  1.00 61.48 ? 413 GLY A O   1 
ATOM   2440 N N   . GLY A 1 326 ? 91.423  32.595 27.446  1.00 61.59 ? 414 GLY A N   1 
ATOM   2441 C CA  . GLY A 1 326 ? 90.966  31.757 26.351  1.00 62.17 ? 414 GLY A CA  1 
ATOM   2442 C C   . GLY A 1 326 ? 90.674  32.584 25.114  1.00 62.57 ? 414 GLY A C   1 
ATOM   2443 O O   . GLY A 1 326 ? 90.731  32.075 23.988  1.00 62.67 ? 414 GLY A O   1 
ATOM   2444 N N   . LEU A 1 327 ? 90.344  33.857 25.319  1.00 62.74 ? 415 LEU A N   1 
ATOM   2445 C CA  . LEU A 1 327 ? 90.075  34.748 24.197  1.00 63.07 ? 415 LEU A CA  1 
ATOM   2446 C C   . LEU A 1 327 ? 91.341  34.798 23.344  1.00 63.60 ? 415 LEU A C   1 
ATOM   2447 O O   . LEU A 1 327 ? 91.286  34.613 22.131  1.00 63.74 ? 415 LEU A O   1 
ATOM   2448 C CB  . LEU A 1 327 ? 89.732  36.153 24.696  1.00 62.77 ? 415 LEU A CB  1 
ATOM   2449 N N   . GLN A 1 328 ? 92.482  35.021 23.998  1.00 64.16 ? 416 GLN A N   1 
ATOM   2450 C CA  . GLN A 1 328 ? 93.780  35.098 23.322  1.00 64.64 ? 416 GLN A CA  1 
ATOM   2451 C C   . GLN A 1 328 ? 94.276  33.736 22.805  1.00 64.74 ? 416 GLN A C   1 
ATOM   2452 O O   . GLN A 1 328 ? 94.572  33.588 21.617  1.00 64.86 ? 416 GLN A O   1 
ATOM   2453 C CB  . GLN A 1 328 ? 94.823  35.718 24.262  1.00 64.72 ? 416 GLN A CB  1 
ATOM   2454 N N   . ARG A 1 329 ? 94.379  32.746 23.691  1.00 64.58 ? 417 ARG A N   1 
ATOM   2455 C CA  . ARG A 1 329 ? 94.811  31.415 23.275  1.00 64.56 ? 417 ARG A CA  1 
ATOM   2456 C C   . ARG A 1 329 ? 93.690  30.394 23.371  1.00 63.85 ? 417 ARG A C   1 
ATOM   2457 O O   . ARG A 1 329 ? 93.473  29.789 24.422  1.00 63.55 ? 417 ARG A O   1 
ATOM   2458 C CB  . ARG A 1 329 ? 95.987  30.924 24.115  1.00 65.80 ? 417 ARG A CB  1 
ATOM   2459 C CG  . ARG A 1 329 ? 97.280  31.667 23.878  1.00 67.88 ? 417 ARG A CG  1 
ATOM   2460 C CD  . ARG A 1 329 ? 98.423  31.013 24.639  1.00 69.23 ? 417 ARG A CD  1 
ATOM   2461 N NE  . ARG A 1 329 ? 99.663  31.775 24.512  1.00 70.80 ? 417 ARG A NE  1 
ATOM   2462 C CZ  . ARG A 1 329 ? 100.812 31.436 25.088  1.00 71.38 ? 417 ARG A CZ  1 
ATOM   2463 N NH1 . ARG A 1 329 ? 100.884 30.340 25.837  1.00 71.85 ? 417 ARG A NH1 1 
ATOM   2464 N NH2 . ARG A 1 329 ? 101.886 32.200 24.924  1.00 71.69 ? 417 ARG A NH2 1 
ATOM   2465 N N   . PRO A 1 330 ? 92.970  30.177 22.265  1.00 63.22 ? 418 PRO A N   1 
ATOM   2466 C CA  . PRO A 1 330 ? 91.869  29.217 22.240  1.00 62.92 ? 418 PRO A CA  1 
ATOM   2467 C C   . PRO A 1 330 ? 92.242  27.837 22.760  1.00 62.36 ? 418 PRO A C   1 
ATOM   2468 O O   . PRO A 1 330 ? 91.372  27.088 23.199  1.00 62.95 ? 418 PRO A O   1 
ATOM   2469 C CB  . PRO A 1 330 ? 91.475  29.193 20.759  1.00 62.80 ? 418 PRO A CB  1 
ATOM   2470 C CG  . PRO A 1 330 ? 92.765  29.592 20.066  1.00 63.20 ? 418 PRO A CG  1 
ATOM   2471 C CD  . PRO A 1 330 ? 93.124  30.775 20.933  1.00 63.20 ? 418 PRO A CD  1 
ATOM   2472 N N   . ASP A 1 331 ? 93.527  27.499 22.712  1.00 61.73 ? 419 ASP A N   1 
ATOM   2473 C CA  . ASP A 1 331 ? 93.975  26.188 23.176  1.00 60.73 ? 419 ASP A CA  1 
ATOM   2474 C C   . ASP A 1 331 ? 93.878  26.009 24.683  1.00 59.40 ? 419 ASP A C   1 
ATOM   2475 O O   . ASP A 1 331 ? 93.616  24.902 25.159  1.00 58.80 ? 419 ASP A O   1 
ATOM   2476 C CB  . ASP A 1 331 ? 95.403  25.906 22.699  1.00 62.17 ? 419 ASP A CB  1 
ATOM   2477 C CG  . ASP A 1 331 ? 95.480  25.686 21.194  1.00 63.33 ? 419 ASP A CG  1 
ATOM   2478 O OD1 . ASP A 1 331 ? 95.142  26.623 20.436  1.00 64.04 ? 419 ASP A OD1 1 
ATOM   2479 O OD2 . ASP A 1 331 ? 95.869  24.572 20.772  1.00 63.69 ? 419 ASP A OD2 1 
ATOM   2480 N N   . ILE A 1 332 ? 94.090  27.090 25.431  1.00 58.07 ? 420 ILE A N   1 
ATOM   2481 C CA  . ILE A 1 332 ? 93.990  27.026 26.886  1.00 56.51 ? 420 ILE A CA  1 
ATOM   2482 C C   . ILE A 1 332 ? 92.639  26.389 27.219  1.00 56.18 ? 420 ILE A C   1 
ATOM   2483 O O   . ILE A 1 332 ? 92.560  25.425 27.987  1.00 56.00 ? 420 ILE A O   1 
ATOM   2484 C CB  . ILE A 1 332 ? 94.069  28.434 27.515  1.00 55.77 ? 420 ILE A CB  1 
ATOM   2485 C CG1 . ILE A 1 332 ? 95.463  29.016 27.300  1.00 54.83 ? 420 ILE A CG1 1 
ATOM   2486 C CG2 . ILE A 1 332 ? 93.720  28.373 28.991  1.00 55.47 ? 420 ILE A CG2 1 
ATOM   2487 C CD1 . ILE A 1 332 ? 95.660  30.354 27.954  1.00 54.81 ? 420 ILE A CD1 1 
ATOM   2488 N N   . ILE A 1 333 ? 91.582  26.927 26.618  1.00 55.51 ? 421 ILE A N   1 
ATOM   2489 C CA  . ILE A 1 333 ? 90.238  26.406 26.825  1.00 54.94 ? 421 ILE A CA  1 
ATOM   2490 C C   . ILE A 1 333 ? 90.182  24.925 26.416  1.00 54.45 ? 421 ILE A C   1 
ATOM   2491 O O   . ILE A 1 333 ? 89.623  24.093 27.138  1.00 54.00 ? 421 ILE A O   1 
ATOM   2492 C CB  . ILE A 1 333 ? 89.204  27.200 26.002  1.00 55.07 ? 421 ILE A CB  1 
ATOM   2493 C CG1 . ILE A 1 333 ? 89.191  28.669 26.441  1.00 55.37 ? 421 ILE A CG1 1 
ATOM   2494 C CG2 . ILE A 1 333 ? 87.823  26.585 26.173  1.00 55.29 ? 421 ILE A CG2 1 
ATOM   2495 C CD1 . ILE A 1 333 ? 88.733  28.897 27.867  1.00 55.16 ? 421 ILE A CD1 1 
ATOM   2496 N N   . ARG A 1 334 ? 90.757  24.597 25.259  1.00 53.32 ? 422 ARG A N   1 
ATOM   2497 C CA  . ARG A 1 334 ? 90.761  23.211 24.810  1.00 52.36 ? 422 ARG A CA  1 
ATOM   2498 C C   . ARG A 1 334 ? 91.445  22.315 25.834  1.00 50.88 ? 422 ARG A C   1 
ATOM   2499 O O   . ARG A 1 334 ? 90.935  21.246 26.174  1.00 49.93 ? 422 ARG A O   1 
ATOM   2500 C CB  . ARG A 1 334 ? 91.448  23.075 23.443  1.00 53.66 ? 422 ARG A CB  1 
ATOM   2501 C CG  . ARG A 1 334 ? 90.538  23.401 22.261  1.00 54.75 ? 422 ARG A CG  1 
ATOM   2502 C CD  . ARG A 1 334 ? 91.176  23.035 20.922  1.00 55.40 ? 422 ARG A CD  1 
ATOM   2503 N NE  . ARG A 1 334 ? 92.118  24.038 20.429  1.00 56.79 ? 422 ARG A NE  1 
ATOM   2504 C CZ  . ARG A 1 334 ? 91.777  25.281 20.097  1.00 57.53 ? 422 ARG A CZ  1 
ATOM   2505 N NH1 . ARG A 1 334 ? 90.514  25.679 20.206  1.00 57.66 ? 422 ARG A NH1 1 
ATOM   2506 N NH2 . ARG A 1 334 ? 92.692  26.122 19.628  1.00 57.91 ? 422 ARG A NH2 1 
ATOM   2507 N N   . TYR A 1 335 ? 92.599  22.760 26.328  1.00 49.49 ? 423 TYR A N   1 
ATOM   2508 C CA  . TYR A 1 335 ? 93.333  21.993 27.319  1.00 47.94 ? 423 TYR A CA  1 
ATOM   2509 C C   . TYR A 1 335 ? 92.428  21.767 28.514  1.00 47.47 ? 423 TYR A C   1 
ATOM   2510 O O   . TYR A 1 335 ? 92.152  20.623 28.886  1.00 47.20 ? 423 TYR A O   1 
ATOM   2511 C CB  . TYR A 1 335 ? 94.588  22.736 27.766  1.00 47.58 ? 423 TYR A CB  1 
ATOM   2512 C CG  . TYR A 1 335 ? 95.348  22.002 28.842  1.00 47.39 ? 423 TYR A CG  1 
ATOM   2513 C CD1 . TYR A 1 335 ? 95.817  20.704 28.626  1.00 47.38 ? 423 TYR A CD1 1 
ATOM   2514 C CD2 . TYR A 1 335 ? 95.572  22.585 30.086  1.00 47.27 ? 423 TYR A CD2 1 
ATOM   2515 C CE1 . TYR A 1 335 ? 96.489  20.001 29.629  1.00 47.61 ? 423 TYR A CE1 1 
ATOM   2516 C CE2 . TYR A 1 335 ? 96.241  21.891 31.095  1.00 47.82 ? 423 TYR A CE2 1 
ATOM   2517 C CZ  . TYR A 1 335 ? 96.696  20.599 30.860  1.00 47.58 ? 423 TYR A CZ  1 
ATOM   2518 O OH  . TYR A 1 335 ? 97.353  19.908 31.853  1.00 47.57 ? 423 TYR A OH  1 
ATOM   2519 N N   . LEU A 1 336 ? 91.964  22.867 29.108  1.00 46.78 ? 424 LEU A N   1 
ATOM   2520 C CA  . LEU A 1 336 ? 91.080  22.803 30.271  1.00 45.74 ? 424 LEU A CA  1 
ATOM   2521 C C   . LEU A 1 336 ? 89.936  21.810 30.072  1.00 45.29 ? 424 LEU A C   1 
ATOM   2522 O O   . LEU A 1 336 ? 89.666  20.989 30.940  1.00 45.74 ? 424 LEU A O   1 
ATOM   2523 C CB  . LEU A 1 336 ? 90.526  24.199 30.596  1.00 45.18 ? 424 LEU A CB  1 
ATOM   2524 C CG  . LEU A 1 336 ? 91.302  25.135 31.536  1.00 44.45 ? 424 LEU A CG  1 
ATOM   2525 C CD1 . LEU A 1 336 ? 92.780  25.104 31.242  1.00 44.83 ? 424 LEU A CD1 1 
ATOM   2526 C CD2 . LEU A 1 336 ? 90.755  26.540 31.396  1.00 43.85 ? 424 LEU A CD2 1 
ATOM   2527 N N   . VAL A 1 337 ? 89.266  21.881 28.928  1.00 44.67 ? 425 VAL A N   1 
ATOM   2528 C CA  . VAL A 1 337 ? 88.168  20.973 28.639  1.00 43.46 ? 425 VAL A CA  1 
ATOM   2529 C C   . VAL A 1 337 ? 88.650  19.541 28.520  1.00 43.24 ? 425 VAL A C   1 
ATOM   2530 O O   . VAL A 1 337 ? 87.987  18.624 28.987  1.00 43.32 ? 425 VAL A O   1 
ATOM   2531 C CB  . VAL A 1 337 ? 87.464  21.360 27.337  1.00 43.38 ? 425 VAL A CB  1 
ATOM   2532 C CG1 . VAL A 1 337 ? 86.516  20.248 26.897  1.00 42.96 ? 425 VAL A CG1 1 
ATOM   2533 C CG2 . VAL A 1 337 ? 86.702  22.655 27.547  1.00 43.01 ? 425 VAL A CG2 1 
ATOM   2534 N N   . SER A 1 338 ? 89.807  19.351 27.899  1.00 43.31 ? 426 SER A N   1 
ATOM   2535 C CA  . SER A 1 338 ? 90.350  18.010 27.727  1.00 43.15 ? 426 SER A CA  1 
ATOM   2536 C C   . SER A 1 338 ? 90.648  17.366 29.083  1.00 43.13 ? 426 SER A C   1 
ATOM   2537 O O   . SER A 1 338 ? 90.596  16.139 29.216  1.00 42.81 ? 426 SER A O   1 
ATOM   2538 C CB  . SER A 1 338 ? 91.627  18.050 26.874  1.00 42.87 ? 426 SER A CB  1 
ATOM   2539 O OG  . SER A 1 338 ? 92.700  18.653 27.576  1.00 42.90 ? 426 SER A OG  1 
ATOM   2540 N N   . GLN A 1 339 ? 90.952  18.197 30.082  1.00 42.98 ? 427 GLN A N   1 
ATOM   2541 C CA  . GLN A 1 339 ? 91.256  17.714 31.423  1.00 43.14 ? 427 GLN A CA  1 
ATOM   2542 C C   . GLN A 1 339 ? 90.015  17.426 32.267  1.00 43.00 ? 427 GLN A C   1 
ATOM   2543 O O   . GLN A 1 339 ? 90.128  16.991 33.416  1.00 42.95 ? 427 GLN A O   1 
ATOM   2544 C CB  . GLN A 1 339 ? 92.160  18.707 32.148  1.00 43.72 ? 427 GLN A CB  1 
ATOM   2545 C CG  . GLN A 1 339 ? 93.526  18.842 31.504  1.00 45.98 ? 427 GLN A CG  1 
ATOM   2546 C CD  . GLN A 1 339 ? 94.201  17.487 31.306  1.00 47.61 ? 427 GLN A CD  1 
ATOM   2547 O OE1 . GLN A 1 339 ? 94.345  16.705 32.254  1.00 47.91 ? 427 GLN A OE1 1 
ATOM   2548 N NE2 . GLN A 1 339 ? 94.618  17.204 30.071  1.00 47.94 ? 427 GLN A NE2 1 
ATOM   2549 N N   . GLY A 1 340 ? 88.838  17.677 31.695  1.00 42.30 ? 428 GLY A N   1 
ATOM   2550 C CA  . GLY A 1 340 ? 87.590  17.408 32.392  1.00 42.36 ? 428 GLY A CA  1 
ATOM   2551 C C   . GLY A 1 340 ? 87.133  18.343 33.503  1.00 42.02 ? 428 GLY A C   1 
ATOM   2552 O O   . GLY A 1 340 ? 86.730  17.882 34.566  1.00 41.80 ? 428 GLY A O   1 
ATOM   2553 N N   . CYS A 1 341 ? 87.159  19.648 33.260  1.00 42.05 ? 429 CYS A N   1 
ATOM   2554 C CA  . CYS A 1 341 ? 86.740  20.606 34.275  1.00 42.22 ? 429 CYS A CA  1 
ATOM   2555 C C   . CYS A 1 341 ? 85.248  20.925 34.149  1.00 41.59 ? 429 CYS A C   1 
ATOM   2556 O O   . CYS A 1 341 ? 84.632  21.441 35.088  1.00 42.17 ? 429 CYS A O   1 
ATOM   2557 C CB  . CYS A 1 341 ? 87.546  21.896 34.139  1.00 42.79 ? 429 CYS A CB  1 
ATOM   2558 S SG  . CYS A 1 341 ? 87.194  22.750 32.600  1.00 44.40 ? 429 CYS A SG  1 
ATOM   2559 N N   . ILE A 1 342 ? 84.675  20.621 32.987  1.00 40.08 ? 430 ILE A N   1 
ATOM   2560 C CA  . ILE A 1 342 ? 83.255  20.877 32.732  1.00 38.49 ? 430 ILE A CA  1 
ATOM   2561 C C   . ILE A 1 342 ? 82.304  20.215 33.738  1.00 37.45 ? 430 ILE A C   1 
ATOM   2562 O O   . ILE A 1 342 ? 81.496  20.889 34.380  1.00 37.46 ? 430 ILE A O   1 
ATOM   2563 C CB  . ILE A 1 342 ? 82.860  20.426 31.301  1.00 38.54 ? 430 ILE A CB  1 
ATOM   2564 C CG1 . ILE A 1 342 ? 83.594  21.292 30.265  1.00 38.80 ? 430 ILE A CG1 1 
ATOM   2565 C CG2 . ILE A 1 342 ? 81.357  20.520 31.115  1.00 38.26 ? 430 ILE A CG2 1 
ATOM   2566 C CD1 . ILE A 1 342 ? 83.221  21.011 28.823  1.00 37.69 ? 430 ILE A CD1 1 
ATOM   2567 N N   . LYS A 1 343 ? 82.393  18.899 33.870  1.00 35.98 ? 431 LYS A N   1 
ATOM   2568 C CA  . LYS A 1 343 ? 81.536  18.176 34.799  1.00 34.64 ? 431 LYS A CA  1 
ATOM   2569 C C   . LYS A 1 343 ? 81.595  18.684 36.246  1.00 34.54 ? 431 LYS A C   1 
ATOM   2570 O O   . LYS A 1 343 ? 80.554  18.908 36.871  1.00 33.82 ? 431 LYS A O   1 
ATOM   2571 C CB  . LYS A 1 343 ? 81.885  16.691 34.780  1.00 34.04 ? 431 LYS A CB  1 
ATOM   2572 C CG  . LYS A 1 343 ? 81.101  15.839 35.780  1.00 32.81 ? 431 LYS A CG  1 
ATOM   2573 C CD  . LYS A 1 343 ? 79.640  15.761 35.445  1.00 31.52 ? 431 LYS A CD  1 
ATOM   2574 C CE  . LYS A 1 343 ? 78.918  14.838 36.399  1.00 31.81 ? 431 LYS A CE  1 
ATOM   2575 N NZ  . LYS A 1 343 ? 77.440  14.727 36.131  1.00 31.50 ? 431 LYS A NZ  1 
ATOM   2576 N N   . PRO A 1 344 ? 82.810  18.861 36.802  1.00 34.53 ? 432 PRO A N   1 
ATOM   2577 C CA  . PRO A 1 344 ? 82.973  19.338 38.180  1.00 34.50 ? 432 PRO A CA  1 
ATOM   2578 C C   . PRO A 1 344 ? 82.493  20.781 38.318  1.00 34.58 ? 432 PRO A C   1 
ATOM   2579 O O   . PRO A 1 344 ? 82.039  21.211 39.380  1.00 34.10 ? 432 PRO A O   1 
ATOM   2580 C CB  . PRO A 1 344 ? 84.481  19.207 38.409  1.00 34.31 ? 432 PRO A CB  1 
ATOM   2581 C CG  . PRO A 1 344 ? 84.898  18.154 37.410  1.00 34.78 ? 432 PRO A CG  1 
ATOM   2582 C CD  . PRO A 1 344 ? 84.138  18.645 36.209  1.00 34.59 ? 432 PRO A CD  1 
ATOM   2583 N N   . LEU A 1 345 ? 82.605  21.517 37.223  1.00 34.78 ? 433 LEU A N   1 
ATOM   2584 C CA  . LEU A 1 345 ? 82.186  22.907 37.179  1.00 35.37 ? 433 LEU A CA  1 
ATOM   2585 C C   . LEU A 1 345 ? 80.646  22.991 37.265  1.00 36.19 ? 433 LEU A C   1 
ATOM   2586 O O   . LEU A 1 345 ? 80.100  23.701 38.120  1.00 35.99 ? 433 LEU A O   1 
ATOM   2587 C CB  . LEU A 1 345 ? 82.729  23.532 35.888  1.00 34.31 ? 433 LEU A CB  1 
ATOM   2588 C CG  . LEU A 1 345 ? 83.571  24.820 35.954  1.00 33.58 ? 433 LEU A CG  1 
ATOM   2589 C CD1 . LEU A 1 345 ? 84.507  24.821 37.132  1.00 32.60 ? 433 LEU A CD1 1 
ATOM   2590 C CD2 . LEU A 1 345 ? 84.343  24.953 34.653  1.00 32.86 ? 433 LEU A CD2 1 
ATOM   2591 N N   . CYS A 1 346 ? 79.952  22.253 36.397  1.00 37.13 ? 434 CYS A N   1 
ATOM   2592 C CA  . CYS A 1 346 ? 78.484  22.227 36.386  1.00 38.15 ? 434 CYS A CA  1 
ATOM   2593 C C   . CYS A 1 346 ? 77.897  21.817 37.730  1.00 38.56 ? 434 CYS A C   1 
ATOM   2594 O O   . CYS A 1 346 ? 76.921  22.409 38.202  1.00 38.57 ? 434 CYS A O   1 
ATOM   2595 C CB  . CYS A 1 346 ? 77.961  21.249 35.328  1.00 38.73 ? 434 CYS A CB  1 
ATOM   2596 S SG  . CYS A 1 346 ? 78.140  21.777 33.620  1.00 41.48 ? 434 CYS A SG  1 
ATOM   2597 N N   . ASP A 1 347 ? 78.491  20.787 38.331  1.00 38.85 ? 435 ASP A N   1 
ATOM   2598 C CA  . ASP A 1 347 ? 78.026  20.269 39.614  1.00 38.95 ? 435 ASP A CA  1 
ATOM   2599 C C   . ASP A 1 347 ? 78.185  21.272 40.755  1.00 38.42 ? 435 ASP A C   1 
ATOM   2600 O O   . ASP A 1 347 ? 77.468  21.208 41.759  1.00 39.00 ? 435 ASP A O   1 
ATOM   2601 C CB  . ASP A 1 347 ? 78.765  18.959 39.952  1.00 39.48 ? 435 ASP A CB  1 
ATOM   2602 C CG  . ASP A 1 347 ? 78.433  17.833 38.982  1.00 40.24 ? 435 ASP A CG  1 
ATOM   2603 O OD1 . ASP A 1 347 ? 77.574  18.046 38.105  1.00 41.34 ? 435 ASP A OD1 1 
ATOM   2604 O OD2 . ASP A 1 347 ? 79.019  16.734 39.092  1.00 40.33 ? 435 ASP A OD2 1 
ATOM   2605 N N   . LEU A 1 348 ? 79.113  22.206 40.608  1.00 37.06 ? 436 LEU A N   1 
ATOM   2606 C CA  . LEU A 1 348 ? 79.322  23.175 41.663  1.00 36.13 ? 436 LEU A CA  1 
ATOM   2607 C C   . LEU A 1 348 ? 78.145  24.145 41.783  1.00 36.35 ? 436 LEU A C   1 
ATOM   2608 O O   . LEU A 1 348 ? 77.847  24.623 42.879  1.00 36.28 ? 436 LEU A O   1 
ATOM   2609 C CB  . LEU A 1 348 ? 80.629  23.934 41.425  1.00 35.15 ? 436 LEU A CB  1 
ATOM   2610 C CG  . LEU A 1 348 ? 81.081  24.932 42.488  1.00 33.75 ? 436 LEU A CG  1 
ATOM   2611 C CD1 . LEU A 1 348 ? 81.263  24.224 43.809  1.00 33.72 ? 436 LEU A CD1 1 
ATOM   2612 C CD2 . LEU A 1 348 ? 82.371  25.590 42.049  1.00 34.09 ? 436 LEU A CD2 1 
ATOM   2613 N N   . LEU A 1 349 ? 77.470  24.426 40.669  1.00 36.59 ? 437 LEU A N   1 
ATOM   2614 C CA  . LEU A 1 349 ? 76.332  25.349 40.675  1.00 36.32 ? 437 LEU A CA  1 
ATOM   2615 C C   . LEU A 1 349 ? 75.262  24.918 41.680  1.00 36.53 ? 437 LEU A C   1 
ATOM   2616 O O   . LEU A 1 349 ? 74.573  25.754 42.280  1.00 35.49 ? 437 LEU A O   1 
ATOM   2617 C CB  . LEU A 1 349 ? 75.711  25.435 39.278  1.00 35.72 ? 437 LEU A CB  1 
ATOM   2618 C CG  . LEU A 1 349 ? 76.538  26.055 38.151  1.00 36.09 ? 437 LEU A CG  1 
ATOM   2619 C CD1 . LEU A 1 349 ? 75.802  25.890 36.831  1.00 35.83 ? 437 LEU A CD1 1 
ATOM   2620 C CD2 . LEU A 1 349 ? 76.784  27.530 38.432  1.00 35.79 ? 437 LEU A CD2 1 
ATOM   2621 N N   . GLU A 1 350 ? 75.153  23.606 41.871  1.00 37.18 ? 438 GLU A N   1 
ATOM   2622 C CA  . GLU A 1 350 ? 74.162  23.019 42.769  1.00 37.92 ? 438 GLU A CA  1 
ATOM   2623 C C   . GLU A 1 350 ? 74.347  23.297 44.270  1.00 37.66 ? 438 GLU A C   1 
ATOM   2624 O O   . GLU A 1 350 ? 73.371  23.274 45.020  1.00 37.89 ? 438 GLU A O   1 
ATOM   2625 C CB  . GLU A 1 350 ? 74.108  21.508 42.534  1.00 38.99 ? 438 GLU A CB  1 
ATOM   2626 C CG  . GLU A 1 350 ? 72.880  20.807 43.109  1.00 40.93 ? 438 GLU A CG  1 
ATOM   2627 C CD  . GLU A 1 350 ? 71.575  21.315 42.500  1.00 42.53 ? 438 GLU A CD  1 
ATOM   2628 O OE1 . GLU A 1 350 ? 71.473  21.382 41.255  1.00 42.93 ? 438 GLU A OE1 1 
ATOM   2629 O OE2 . GLU A 1 350 ? 70.643  21.639 43.267  1.00 43.89 ? 438 GLU A OE2 1 
ATOM   2630 N N   . ILE A 1 351 ? 75.573  23.569 44.710  1.00 36.86 ? 439 ILE A N   1 
ATOM   2631 C CA  . ILE A 1 351 ? 75.823  23.815 46.136  1.00 36.58 ? 439 ILE A CA  1 
ATOM   2632 C C   . ILE A 1 351 ? 76.515  25.152 46.422  1.00 36.42 ? 439 ILE A C   1 
ATOM   2633 O O   . ILE A 1 351 ? 76.663  25.548 47.580  1.00 36.25 ? 439 ILE A O   1 
ATOM   2634 C CB  . ILE A 1 351 ? 76.718  22.699 46.755  1.00 37.00 ? 439 ILE A CB  1 
ATOM   2635 C CG1 . ILE A 1 351 ? 78.135  22.785 46.158  1.00 36.74 ? 439 ILE A CG1 1 
ATOM   2636 C CG2 . ILE A 1 351 ? 76.114  21.320 46.470  1.00 36.45 ? 439 ILE A CG2 1 
ATOM   2637 C CD1 . ILE A 1 351 ? 79.130  21.830 46.753  1.00 36.74 ? 439 ILE A CD1 1 
ATOM   2638 N N   . ALA A 1 352 ? 76.941  25.837 45.370  1.00 35.84 ? 440 ALA A N   1 
ATOM   2639 C CA  . ALA A 1 352 ? 77.634  27.104 45.531  1.00 36.04 ? 440 ALA A CA  1 
ATOM   2640 C C   . ALA A 1 352 ? 76.771  28.276 45.997  1.00 36.07 ? 440 ALA A C   1 
ATOM   2641 O O   . ALA A 1 352 ? 75.540  28.230 45.976  1.00 35.56 ? 440 ALA A O   1 
ATOM   2642 C CB  . ALA A 1 352 ? 78.329  27.471 44.232  1.00 36.36 ? 440 ALA A CB  1 
ATOM   2643 N N   . ASP A 1 353 ? 77.454  29.327 46.435  1.00 36.23 ? 441 ASP A N   1 
ATOM   2644 C CA  . ASP A 1 353 ? 76.804  30.544 46.889  1.00 36.84 ? 441 ASP A CA  1 
ATOM   2645 C C   . ASP A 1 353 ? 76.844  31.500 45.713  1.00 36.72 ? 441 ASP A C   1 
ATOM   2646 O O   . ASP A 1 353 ? 77.623  31.305 44.779  1.00 37.17 ? 441 ASP A O   1 
ATOM   2647 C CB  . ASP A 1 353 ? 77.532  31.145 48.100  1.00 36.91 ? 441 ASP A CB  1 
ATOM   2648 C CG  . ASP A 1 353 ? 78.995  31.386 47.839  1.00 37.70 ? 441 ASP A CG  1 
ATOM   2649 O OD1 . ASP A 1 353 ? 79.326  32.143 46.893  1.00 37.77 ? 441 ASP A OD1 1 
ATOM   2650 O OD2 . ASP A 1 353 ? 79.817  30.813 48.589  1.00 38.71 ? 441 ASP A OD2 1 
ATOM   2651 N N   . ASN A 1 354 ? 76.011  32.531 45.764  1.00 36.19 ? 442 ASN A N   1 
ATOM   2652 C CA  . ASN A 1 354 ? 75.914  33.494 44.679  1.00 35.74 ? 442 ASN A CA  1 
ATOM   2653 C C   . ASN A 1 354 ? 77.193  33.951 43.987  1.00 35.26 ? 442 ASN A C   1 
ATOM   2654 O O   . ASN A 1 354 ? 77.279  33.892 42.763  1.00 35.02 ? 442 ASN A O   1 
ATOM   2655 C CB  . ASN A 1 354 ? 75.114  34.693 45.167  1.00 36.05 ? 442 ASN A CB  1 
ATOM   2656 C CG  . ASN A 1 354 ? 73.653  34.378 45.308  1.00 35.87 ? 442 ASN A CG  1 
ATOM   2657 O OD1 . ASN A 1 354 ? 73.274  33.237 45.562  1.00 36.91 ? 442 ASN A OD1 1 
ATOM   2658 N ND2 . ASN A 1 354 ? 72.821  35.388 45.166  1.00 36.67 ? 442 ASN A ND2 1 
ATOM   2659 N N   . ARG A 1 355 ? 78.187  34.390 44.747  1.00 35.11 ? 443 ARG A N   1 
ATOM   2660 C CA  . ARG A 1 355 ? 79.427  34.858 44.137  1.00 35.28 ? 443 ARG A CA  1 
ATOM   2661 C C   . ARG A 1 355 ? 80.135  33.755 43.338  1.00 35.49 ? 443 ARG A C   1 
ATOM   2662 O O   . ARG A 1 355 ? 80.641  34.023 42.251  1.00 35.84 ? 443 ARG A O   1 
ATOM   2663 C CB  . ARG A 1 355 ? 80.362  35.432 45.203  1.00 35.11 ? 443 ARG A CB  1 
ATOM   2664 C CG  . ARG A 1 355 ? 81.375  36.427 44.668  1.00 35.03 ? 443 ARG A CG  1 
ATOM   2665 C CD  . ARG A 1 355 ? 80.682  37.651 44.086  0.00 35.01 ? 443 ARG A CD  1 
ATOM   2666 N NE  . ARG A 1 355 ? 81.631  38.631 43.566  0.00 34.99 ? 443 ARG A NE  1 
ATOM   2667 C CZ  . ARG A 1 355 ? 82.480  38.396 42.571  0.00 34.99 ? 443 ARG A CZ  1 
ATOM   2668 N NH1 . ARG A 1 355 ? 82.503  37.209 41.979  0.00 35.00 ? 443 ARG A NH1 1 
ATOM   2669 N NH2 . ARG A 1 355 ? 83.306  39.350 42.165  0.00 35.00 ? 443 ARG A NH2 1 
ATOM   2670 N N   . ILE A 1 356 ? 80.169  32.523 43.861  1.00 35.67 ? 444 ILE A N   1 
ATOM   2671 C CA  . ILE A 1 356 ? 80.803  31.395 43.150  1.00 35.67 ? 444 ILE A CA  1 
ATOM   2672 C C   . ILE A 1 356 ? 79.983  30.926 41.922  1.00 36.49 ? 444 ILE A C   1 
ATOM   2673 O O   . ILE A 1 356 ? 80.512  30.286 41.001  1.00 35.79 ? 444 ILE A O   1 
ATOM   2674 C CB  . ILE A 1 356 ? 81.047  30.198 44.100  1.00 34.78 ? 444 ILE A CB  1 
ATOM   2675 C CG1 . ILE A 1 356 ? 82.094  30.577 45.150  1.00 35.22 ? 444 ILE A CG1 1 
ATOM   2676 C CG2 . ILE A 1 356 ? 81.493  28.982 43.325  1.00 34.16 ? 444 ILE A CG2 1 
ATOM   2677 C CD1 . ILE A 1 356 ? 83.438  31.045 44.582  1.00 34.55 ? 444 ILE A CD1 1 
ATOM   2678 N N   . ILE A 1 357 ? 78.691  31.242 41.910  1.00 36.74 ? 445 ILE A N   1 
ATOM   2679 C CA  . ILE A 1 357 ? 77.859  30.899 40.769  1.00 37.57 ? 445 ILE A CA  1 
ATOM   2680 C C   . ILE A 1 357 ? 78.273  31.819 39.597  1.00 38.25 ? 445 ILE A C   1 
ATOM   2681 O O   . ILE A 1 357 ? 78.346  31.389 38.444  1.00 38.16 ? 445 ILE A O   1 
ATOM   2682 C CB  . ILE A 1 357 ? 76.339  31.056 41.120  1.00 37.36 ? 445 ILE A CB  1 
ATOM   2683 C CG1 . ILE A 1 357 ? 75.959  29.996 42.161  1.00 37.49 ? 445 ILE A CG1 1 
ATOM   2684 C CG2 . ILE A 1 357 ? 75.458  30.899 39.872  1.00 36.60 ? 445 ILE A CG2 1 
ATOM   2685 C CD1 . ILE A 1 357 ? 74.502  29.991 42.567  1.00 36.29 ? 445 ILE A CD1 1 
ATOM   2686 N N   . GLU A 1 358 ? 78.568  33.078 39.898  1.00 38.89 ? 446 GLU A N   1 
ATOM   2687 C CA  . GLU A 1 358 ? 78.984  34.017 38.863  1.00 40.09 ? 446 GLU A CA  1 
ATOM   2688 C C   . GLU A 1 358 ? 80.303  33.604 38.255  1.00 40.51 ? 446 GLU A C   1 
ATOM   2689 O O   . GLU A 1 358 ? 80.489  33.676 37.040  1.00 40.77 ? 446 GLU A O   1 
ATOM   2690 C CB  . GLU A 1 358 ? 79.157  35.413 39.431  1.00 41.20 ? 446 GLU A CB  1 
ATOM   2691 C CG  . GLU A 1 358 ? 77.889  36.112 39.772  1.00 43.13 ? 446 GLU A CG  1 
ATOM   2692 C CD  . GLU A 1 358 ? 78.175  37.491 40.286  1.00 44.97 ? 446 GLU A CD  1 
ATOM   2693 O OE1 . GLU A 1 358 ? 78.852  38.257 39.556  1.00 45.71 ? 446 GLU A OE1 1 
ATOM   2694 O OE2 . GLU A 1 358 ? 77.733  37.804 41.417  1.00 46.25 ? 446 GLU A OE2 1 
ATOM   2695 N N   . VAL A 1 359 ? 81.232  33.194 39.110  1.00 40.48 ? 447 VAL A N   1 
ATOM   2696 C CA  . VAL A 1 359 ? 82.535  32.769 38.638  1.00 40.24 ? 447 VAL A CA  1 
ATOM   2697 C C   . VAL A 1 359 ? 82.391  31.492 37.808  1.00 39.78 ? 447 VAL A C   1 
ATOM   2698 O O   . VAL A 1 359 ? 83.080  31.324 36.804  1.00 40.44 ? 447 VAL A O   1 
ATOM   2699 C CB  . VAL A 1 359 ? 83.496  32.513 39.815  1.00 40.77 ? 447 VAL A CB  1 
ATOM   2700 C CG1 . VAL A 1 359 ? 84.882  32.153 39.290  1.00 40.86 ? 447 VAL A CG1 1 
ATOM   2701 C CG2 . VAL A 1 359 ? 83.559  33.751 40.709  1.00 41.06 ? 447 VAL A CG2 1 
ATOM   2702 N N   . THR A 1 360 ? 81.488  30.603 38.213  1.00 38.48 ? 448 THR A N   1 
ATOM   2703 C CA  . THR A 1 360 ? 81.293  29.362 37.481  1.00 37.19 ? 448 THR A CA  1 
ATOM   2704 C C   . THR A 1 360 ? 80.614  29.622 36.135  1.00 37.27 ? 448 THR A C   1 
ATOM   2705 O O   . THR A 1 360 ? 80.988  29.029 35.117  1.00 37.63 ? 448 THR A O   1 
ATOM   2706 C CB  . THR A 1 360 ? 80.458  28.348 38.304  1.00 37.11 ? 448 THR A CB  1 
ATOM   2707 O OG1 . THR A 1 360 ? 81.147  28.041 39.523  1.00 36.15 ? 448 THR A OG1 1 
ATOM   2708 C CG2 . THR A 1 360 ? 80.241  27.046 37.515  1.00 36.49 ? 448 THR A CG2 1 
ATOM   2709 N N   . LEU A 1 361 ? 79.621  30.506 36.117  1.00 36.67 ? 449 LEU A N   1 
ATOM   2710 C CA  . LEU A 1 361 ? 78.936  30.809 34.867  1.00 36.09 ? 449 LEU A CA  1 
ATOM   2711 C C   . LEU A 1 361 ? 79.857  31.559 33.895  1.00 36.97 ? 449 LEU A C   1 
ATOM   2712 O O   . LEU A 1 361 ? 79.720  31.409 32.675  1.00 36.55 ? 449 LEU A O   1 
ATOM   2713 C CB  . LEU A 1 361 ? 77.658  31.614 35.124  1.00 34.69 ? 449 LEU A CB  1 
ATOM   2714 C CG  . LEU A 1 361 ? 76.510  30.936 35.893  1.00 33.91 ? 449 LEU A CG  1 
ATOM   2715 C CD1 . LEU A 1 361 ? 75.394  31.934 36.097  1.00 32.81 ? 449 LEU A CD1 1 
ATOM   2716 C CD2 . LEU A 1 361 ? 75.992  29.715 35.149  1.00 32.66 ? 449 LEU A CD2 1 
ATOM   2717 N N   . ASP A 1 362 ? 80.794  32.359 34.412  1.00 37.69 ? 450 ASP A N   1 
ATOM   2718 C CA  . ASP A 1 362 ? 81.706  33.062 33.517  1.00 38.93 ? 450 ASP A CA  1 
ATOM   2719 C C   . ASP A 1 362 ? 82.635  32.063 32.853  1.00 39.63 ? 450 ASP A C   1 
ATOM   2720 O O   . ASP A 1 362 ? 82.929  32.190 31.662  1.00 39.97 ? 450 ASP A O   1 
ATOM   2721 C CB  . ASP A 1 362 ? 82.536  34.126 34.245  1.00 39.49 ? 450 ASP A CB  1 
ATOM   2722 C CG  . ASP A 1 362 ? 81.726  35.354 34.599  1.00 40.69 ? 450 ASP A CG  1 
ATOM   2723 O OD1 . ASP A 1 362 ? 80.879  35.765 33.765  1.00 41.75 ? 450 ASP A OD1 1 
ATOM   2724 O OD2 . ASP A 1 362 ? 81.948  35.927 35.692  1.00 40.31 ? 450 ASP A OD2 1 
ATOM   2725 N N   . ALA A 1 363 ? 83.085  31.073 33.628  1.00 40.07 ? 451 ALA A N   1 
ATOM   2726 C CA  . ALA A 1 363 ? 83.963  30.018 33.123  1.00 40.82 ? 451 ALA A CA  1 
ATOM   2727 C C   . ALA A 1 363 ? 83.212  29.174 32.091  1.00 41.75 ? 451 ALA A C   1 
ATOM   2728 O O   . ALA A 1 363 ? 83.681  28.998 30.969  1.00 41.91 ? 451 ALA A O   1 
ATOM   2729 C CB  . ALA A 1 363 ? 84.444  29.141 34.268  1.00 40.09 ? 451 ALA A CB  1 
ATOM   2730 N N   . LEU A 1 364 ? 82.043  28.655 32.464  1.00 42.97 ? 452 LEU A N   1 
ATOM   2731 C CA  . LEU A 1 364 ? 81.248  27.855 31.530  1.00 44.25 ? 452 LEU A CA  1 
ATOM   2732 C C   . LEU A 1 364 ? 80.972  28.632 30.240  1.00 44.92 ? 452 LEU A C   1 
ATOM   2733 O O   . LEU A 1 364 ? 80.981  28.064 29.146  1.00 44.44 ? 452 LEU A O   1 
ATOM   2734 C CB  . LEU A 1 364 ? 79.929  27.431 32.184  1.00 44.22 ? 452 LEU A CB  1 
ATOM   2735 C CG  . LEU A 1 364 ? 80.019  26.260 33.169  1.00 45.36 ? 452 LEU A CG  1 
ATOM   2736 C CD1 . LEU A 1 364 ? 78.717  26.076 33.944  1.00 45.12 ? 452 LEU A CD1 1 
ATOM   2737 C CD2 . LEU A 1 364 ? 80.358  24.995 32.394  1.00 45.47 ? 452 LEU A CD2 1 
ATOM   2738 N N   . GLU A 1 365 ? 80.743  29.935 30.381  1.00 45.98 ? 453 GLU A N   1 
ATOM   2739 C CA  . GLU A 1 365 ? 80.472  30.813 29.247  1.00 47.09 ? 453 GLU A CA  1 
ATOM   2740 C C   . GLU A 1 365 ? 81.700  30.962 28.339  1.00 47.49 ? 453 GLU A C   1 
ATOM   2741 O O   . GLU A 1 365 ? 81.583  30.880 27.110  1.00 47.06 ? 453 GLU A O   1 
ATOM   2742 C CB  . GLU A 1 365 ? 80.032  32.188 29.746  1.00 47.56 ? 453 GLU A CB  1 
ATOM   2743 C CG  . GLU A 1 365 ? 79.686  33.152 28.637  1.00 48.93 ? 453 GLU A CG  1 
ATOM   2744 C CD  . GLU A 1 365 ? 79.350  34.538 29.157  1.00 49.98 ? 453 GLU A CD  1 
ATOM   2745 O OE1 . GLU A 1 365 ? 80.193  35.123 29.871  1.00 51.32 ? 453 GLU A OE1 1 
ATOM   2746 O OE2 . GLU A 1 365 ? 78.252  35.048 28.848  1.00 50.27 ? 453 GLU A OE2 1 
ATOM   2747 N N   . ASN A 1 366 ? 82.871  31.194 28.933  1.00 47.63 ? 454 ASN A N   1 
ATOM   2748 C CA  . ASN A 1 366 ? 84.078  31.319 28.134  1.00 48.05 ? 454 ASN A CA  1 
ATOM   2749 C C   . ASN A 1 366 ? 84.292  30.003 27.410  1.00 48.90 ? 454 ASN A C   1 
ATOM   2750 O O   . ASN A 1 366 ? 84.584  29.989 26.219  1.00 49.46 ? 454 ASN A O   1 
ATOM   2751 C CB  . ASN A 1 366 ? 85.308  31.623 28.990  1.00 47.47 ? 454 ASN A CB  1 
ATOM   2752 C CG  . ASN A 1 366 ? 85.232  32.972 29.680  1.00 47.97 ? 454 ASN A CG  1 
ATOM   2753 O OD1 . ASN A 1 366 ? 84.928  34.000 29.061  1.00 47.80 ? 454 ASN A OD1 1 
ATOM   2754 N ND2 . ASN A 1 366 ? 85.535  32.980 30.971  1.00 48.07 ? 454 ASN A ND2 1 
ATOM   2755 N N   . ILE A 1 367 ? 84.144  28.895 28.130  1.00 49.71 ? 455 ILE A N   1 
ATOM   2756 C CA  . ILE A 1 367 ? 84.322  27.573 27.541  1.00 50.76 ? 455 ILE A CA  1 
ATOM   2757 C C   . ILE A 1 367 ? 83.386  27.394 26.355  1.00 52.28 ? 455 ILE A C   1 
ATOM   2758 O O   . ILE A 1 367 ? 83.761  26.804 25.337  1.00 52.80 ? 455 ILE A O   1 
ATOM   2759 C CB  . ILE A 1 367 ? 84.025  26.443 28.554  1.00 50.21 ? 455 ILE A CB  1 
ATOM   2760 C CG1 . ILE A 1 367 ? 85.034  26.496 29.702  1.00 50.09 ? 455 ILE A CG1 1 
ATOM   2761 C CG2 . ILE A 1 367 ? 84.072  25.082 27.849  1.00 49.31 ? 455 ILE A CG2 1 
ATOM   2762 C CD1 . ILE A 1 367 ? 84.746  25.532 30.833  1.00 50.09 ? 455 ILE A CD1 1 
ATOM   2763 N N   . ILE A 1 368 ? 82.165  27.905 26.494  1.00 53.47 ? 456 ILE A N   1 
ATOM   2764 C CA  . ILE A 1 368 ? 81.153  27.797 25.441  1.00 54.38 ? 456 ILE A CA  1 
ATOM   2765 C C   . ILE A 1 368 ? 81.426  28.680 24.211  1.00 54.74 ? 456 ILE A C   1 
ATOM   2766 O O   . ILE A 1 368 ? 81.171  28.267 23.076  1.00 54.28 ? 456 ILE A O   1 
ATOM   2767 C CB  . ILE A 1 368 ? 79.739  28.119 26.002  1.00 54.54 ? 456 ILE A CB  1 
ATOM   2768 C CG1 . ILE A 1 368 ? 79.188  26.963 26.854  1.00 54.24 ? 456 ILE A CG1 1 
ATOM   2769 C CG2 . ILE A 1 368 ? 78.810  28.354 24.880  1.00 55.13 ? 456 ILE A CG2 1 
ATOM   2770 C CD1 . ILE A 1 368 ? 78.774  25.717 26.064  1.00 53.42 ? 456 ILE A CD1 1 
ATOM   2771 N N   . LYS A 1 369 ? 81.933  29.890 24.434  1.00 55.69 ? 457 LYS A N   1 
ATOM   2772 C CA  . LYS A 1 369 ? 82.243  30.797 23.330  1.00 57.01 ? 457 LYS A CA  1 
ATOM   2773 C C   . LYS A 1 369 ? 83.262  30.182 22.375  1.00 57.98 ? 457 LYS A C   1 
ATOM   2774 O O   . LYS A 1 369 ? 83.097  30.266 21.160  1.00 57.98 ? 457 LYS A O   1 
ATOM   2775 C CB  . LYS A 1 369 ? 82.789  32.127 23.860  1.00 57.06 ? 457 LYS A CB  1 
ATOM   2776 C CG  . LYS A 1 369 ? 81.826  32.876 24.767  1.00 58.36 ? 457 LYS A CG  1 
ATOM   2777 C CD  . LYS A 1 369 ? 82.443  34.158 25.321  1.00 59.17 ? 457 LYS A CD  1 
ATOM   2778 C CE  . LYS A 1 369 ? 81.460  34.884 26.235  1.00 59.86 ? 457 LYS A CE  1 
ATOM   2779 N NZ  . LYS A 1 369 ? 82.018  36.136 26.831  1.00 60.29 ? 457 LYS A NZ  1 
ATOM   2780 N N   . MET A 1 370 ? 84.312  29.573 22.932  1.00 59.24 ? 458 MET A N   1 
ATOM   2781 C CA  . MET A 1 370 ? 85.363  28.943 22.140  1.00 60.60 ? 458 MET A CA  1 
ATOM   2782 C C   . MET A 1 370 ? 84.806  27.762 21.349  1.00 61.78 ? 458 MET A C   1 
ATOM   2783 O O   . MET A 1 370 ? 84.991  27.676 20.136  1.00 61.81 ? 458 MET A O   1 
ATOM   2784 C CB  . MET A 1 370 ? 86.506  28.469 23.049  1.00 60.75 ? 458 MET A CB  1 
ATOM   2785 N N   . GLY A 1 371 ? 84.120  26.857 22.038  1.00 63.08 ? 459 GLY A N   1 
ATOM   2786 C CA  . GLY A 1 371 ? 83.544  25.703 21.373  1.00 65.02 ? 459 GLY A CA  1 
ATOM   2787 C C   . GLY A 1 371 ? 82.613  26.111 20.249  1.00 66.60 ? 459 GLY A C   1 
ATOM   2788 O O   . GLY A 1 371 ? 82.337  25.323 19.339  1.00 66.78 ? 459 GLY A O   1 
ATOM   2789 N N   . GLU A 1 372 ? 82.129  27.348 20.322  1.00 68.05 ? 460 GLU A N   1 
ATOM   2790 C CA  . GLU A 1 372 ? 81.227  27.904 19.317  1.00 69.65 ? 460 GLU A CA  1 
ATOM   2791 C C   . GLU A 1 372 ? 82.062  28.437 18.148  1.00 70.60 ? 460 GLU A C   1 
ATOM   2792 O O   . GLU A 1 372 ? 81.746  28.194 16.980  1.00 70.68 ? 460 GLU A O   1 
ATOM   2793 C CB  . GLU A 1 372 ? 80.405  29.038 19.937  1.00 70.17 ? 460 GLU A CB  1 
ATOM   2794 C CG  . GLU A 1 372 ? 79.243  29.557 19.080  1.00 70.77 ? 460 GLU A CG  1 
ATOM   2795 C CD  . GLU A 1 372 ? 78.173  28.501 18.825  1.00 70.95 ? 460 GLU A CD  1 
ATOM   2796 O OE1 . GLU A 1 372 ? 77.715  27.869 19.801  1.00 70.90 ? 460 GLU A OE1 1 
ATOM   2797 O OE2 . GLU A 1 372 ? 77.779  28.310 17.653  1.00 71.26 ? 460 GLU A OE2 1 
ATOM   2798 N N   . ALA A 1 373 ? 83.131  29.161 18.473  1.00 71.39 ? 461 ALA A N   1 
ATOM   2799 C CA  . ALA A 1 373 ? 84.026  29.714 17.466  1.00 72.00 ? 461 ALA A CA  1 
ATOM   2800 C C   . ALA A 1 373 ? 84.638  28.584 16.633  1.00 72.67 ? 461 ALA A C   1 
ATOM   2801 O O   . ALA A 1 373 ? 85.100  28.806 15.516  1.00 72.59 ? 461 ALA A O   1 
ATOM   2802 C CB  . ALA A 1 373 ? 85.122  30.525 18.137  1.00 71.77 ? 461 ALA A CB  1 
ATOM   2803 N N   . ASP A 1 374 ? 84.644  27.375 17.186  1.00 73.61 ? 462 ASP A N   1 
ATOM   2804 C CA  . ASP A 1 374 ? 85.181  26.211 16.486  1.00 74.56 ? 462 ASP A CA  1 
ATOM   2805 C C   . ASP A 1 374 ? 84.145  25.607 15.558  1.00 75.03 ? 462 ASP A C   1 
ATOM   2806 O O   . ASP A 1 374 ? 84.485  25.073 14.503  1.00 75.12 ? 462 ASP A O   1 
ATOM   2807 C CB  . ASP A 1 374 ? 85.650  25.149 17.479  1.00 74.98 ? 462 ASP A CB  1 
ATOM   2808 C CG  . ASP A 1 374 ? 87.030  25.431 18.017  1.00 75.85 ? 462 ASP A CG  1 
ATOM   2809 O OD1 . ASP A 1 374 ? 87.251  26.545 18.546  1.00 76.60 ? 462 ASP A OD1 1 
ATOM   2810 O OD2 . ASP A 1 374 ? 87.892  24.531 17.906  1.00 76.03 ? 462 ASP A OD2 1 
ATOM   2811 N N   . LYS A 1 375 ? 82.880  25.679 15.961  1.00 75.60 ? 463 LYS A N   1 
ATOM   2812 C CA  . LYS A 1 375 ? 81.797  25.154 15.138  1.00 76.11 ? 463 LYS A CA  1 
ATOM   2813 C C   . LYS A 1 375 ? 81.944  25.836 13.785  1.00 76.54 ? 463 LYS A C   1 
ATOM   2814 O O   . LYS A 1 375 ? 81.712  25.238 12.736  1.00 76.49 ? 463 LYS A O   1 
ATOM   2815 C CB  . LYS A 1 375 ? 80.440  25.495 15.763  1.00 75.82 ? 463 LYS A CB  1 
ATOM   2816 C CG  . LYS A 1 375 ? 79.245  24.929 15.017  1.00 75.22 ? 463 LYS A CG  1 
ATOM   2817 N N   . GLU A 1 376 ? 82.353  27.099 13.823  1.00 77.18 ? 464 GLU A N   1 
ATOM   2818 C CA  . GLU A 1 376 ? 82.559  27.875 12.611  1.00 77.89 ? 464 GLU A CA  1 
ATOM   2819 C C   . GLU A 1 376 ? 83.744  27.300 11.825  1.00 78.34 ? 464 GLU A C   1 
ATOM   2820 O O   . GLU A 1 376 ? 83.555  26.528 10.879  1.00 78.34 ? 464 GLU A O   1 
ATOM   2821 C CB  . GLU A 1 376 ? 82.818  29.345 12.972  1.00 77.72 ? 464 GLU A CB  1 
ATOM   2822 N N   . ALA A 1 377 ? 84.958  27.674 12.236  1.00 78.63 ? 465 ALA A N   1 
ATOM   2823 C CA  . ALA A 1 377 ? 86.199  27.226 11.600  1.00 78.94 ? 465 ALA A CA  1 
ATOM   2824 C C   . ALA A 1 377 ? 86.148  25.787 11.103  1.00 79.34 ? 465 ALA A C   1 
ATOM   2825 O O   . ALA A 1 377 ? 86.017  25.545 9.904   1.00 79.43 ? 465 ALA A O   1 
ATOM   2826 C CB  . ALA A 1 377 ? 87.368  27.392 12.568  1.00 78.65 ? 465 ALA A CB  1 
ATOM   2827 N N   . ARG A 1 378 ? 86.257  24.835 12.029  1.00 79.81 ? 466 ARG A N   1 
ATOM   2828 C CA  . ARG A 1 378 ? 86.234  23.412 11.690  1.00 80.11 ? 466 ARG A CA  1 
ATOM   2829 C C   . ARG A 1 378 ? 84.937  23.000 10.997  1.00 80.14 ? 466 ARG A C   1 
ATOM   2830 O O   . ARG A 1 378 ? 84.771  21.842 10.618  1.00 79.89 ? 466 ARG A O   1 
ATOM   2831 C CB  . ARG A 1 378 ? 86.436  22.558 12.949  1.00 80.33 ? 466 ARG A CB  1 
ATOM   2832 N N   . GLY A 1 379 ? 84.024  23.954 10.835  1.00 80.27 ? 467 GLY A N   1 
ATOM   2833 C CA  . GLY A 1 379 ? 82.757  23.673 10.179  1.00 80.50 ? 467 GLY A CA  1 
ATOM   2834 C C   . GLY A 1 379 ? 81.947  22.547 10.804  1.00 80.69 ? 467 GLY A C   1 
ATOM   2835 O O   . GLY A 1 379 ? 81.507  21.627 10.105  1.00 80.76 ? 467 GLY A O   1 
ATOM   2836 N N   . LEU A 1 380 ? 81.741  22.619 12.118  1.00 80.53 ? 468 LEU A N   1 
ATOM   2837 C CA  . LEU A 1 380 ? 80.981  21.602 12.840  1.00 79.93 ? 468 LEU A CA  1 
ATOM   2838 C C   . LEU A 1 380 ? 79.490  21.938 12.886  1.00 79.42 ? 468 LEU A C   1 
ATOM   2839 O O   . LEU A 1 380 ? 79.100  23.107 12.865  1.00 79.21 ? 468 LEU A O   1 
ATOM   2840 C CB  . LEU A 1 380 ? 81.518  21.458 14.266  1.00 80.36 ? 468 LEU A CB  1 
ATOM   2841 N N   . ASN A 1 381 ? 78.661  20.900 12.950  1.00 78.72 ? 469 ASN A N   1 
ATOM   2842 C CA  . ASN A 1 381 ? 77.214  21.073 13.000  1.00 77.77 ? 469 ASN A CA  1 
ATOM   2843 C C   . ASN A 1 381 ? 76.770  21.491 14.395  1.00 76.88 ? 469 ASN A C   1 
ATOM   2844 O O   . ASN A 1 381 ? 75.862  22.309 14.545  1.00 76.89 ? 469 ASN A O   1 
ATOM   2845 C CB  . ASN A 1 381 ? 76.510  19.767 12.610  1.00 78.08 ? 469 ASN A CB  1 
ATOM   2846 N N   . ILE A 1 382 ? 77.424  20.928 15.409  1.00 75.71 ? 470 ILE A N   1 
ATOM   2847 C CA  . ILE A 1 382 ? 77.104  21.217 16.806  1.00 74.19 ? 470 ILE A CA  1 
ATOM   2848 C C   . ILE A 1 382 ? 78.291  21.838 17.562  1.00 73.11 ? 470 ILE A C   1 
ATOM   2849 O O   . ILE A 1 382 ? 79.421  21.872 17.061  1.00 72.88 ? 470 ILE A O   1 
ATOM   2850 C CB  . ILE A 1 382 ? 76.672  19.924 17.540  1.00 74.24 ? 470 ILE A CB  1 
ATOM   2851 C CG1 . ILE A 1 382 ? 75.538  19.244 16.769  1.00 74.23 ? 470 ILE A CG1 1 
ATOM   2852 C CG2 . ILE A 1 382 ? 76.204  20.246 18.961  1.00 74.28 ? 470 ILE A CG2 1 
ATOM   2853 C CD1 . ILE A 1 382 ? 75.057  17.941 17.404  1.00 74.31 ? 470 ILE A CD1 1 
ATOM   2854 N N   . ASN A 1 383 ? 78.018  22.339 18.765  1.00 71.66 ? 471 ASN A N   1 
ATOM   2855 C CA  . ASN A 1 383 ? 79.039  22.942 19.621  1.00 70.08 ? 471 ASN A CA  1 
ATOM   2856 C C   . ASN A 1 383 ? 79.493  21.857 20.613  1.00 68.74 ? 471 ASN A C   1 
ATOM   2857 O O   . ASN A 1 383 ? 78.829  21.604 21.621  1.00 68.22 ? 471 ASN A O   1 
ATOM   2858 C CB  . ASN A 1 383 ? 78.449  24.147 20.369  1.00 69.77 ? 471 ASN A CB  1 
ATOM   2859 C CG  . ASN A 1 383 ? 79.482  24.891 21.194  1.00 69.80 ? 471 ASN A CG  1 
ATOM   2860 O OD1 . ASN A 1 383 ? 80.164  24.303 22.032  1.00 70.01 ? 471 ASN A OD1 1 
ATOM   2861 N ND2 . ASN A 1 383 ? 79.593  26.197 20.970  1.00 69.45 ? 471 ASN A ND2 1 
ATOM   2862 N N   . GLU A 1 384 ? 80.619  21.215 20.311  1.00 67.37 ? 472 GLU A N   1 
ATOM   2863 C CA  . GLU A 1 384 ? 81.151  20.140 21.151  1.00 65.97 ? 472 GLU A CA  1 
ATOM   2864 C C   . GLU A 1 384 ? 81.012  20.376 22.663  1.00 64.67 ? 472 GLU A C   1 
ATOM   2865 O O   . GLU A 1 384 ? 80.488  19.524 23.378  1.00 63.94 ? 472 GLU A O   1 
ATOM   2866 C CB  . GLU A 1 384 ? 82.624  19.876 20.798  1.00 66.22 ? 472 GLU A CB  1 
ATOM   2867 N N   . ASN A 1 385 ? 81.472  21.529 23.142  1.00 63.28 ? 473 ASN A N   1 
ATOM   2868 C CA  . ASN A 1 385 ? 81.404  21.838 24.567  1.00 61.84 ? 473 ASN A CA  1 
ATOM   2869 C C   . ASN A 1 385 ? 79.981  21.958 25.074  1.00 60.84 ? 473 ASN A C   1 
ATOM   2870 O O   . ASN A 1 385 ? 79.692  21.619 26.220  1.00 60.63 ? 473 ASN A O   1 
ATOM   2871 C CB  . ASN A 1 385 ? 82.164  23.128 24.880  1.00 62.04 ? 473 ASN A CB  1 
ATOM   2872 C CG  . ASN A 1 385 ? 83.621  23.057 24.477  1.00 62.04 ? 473 ASN A CG  1 
ATOM   2873 O OD1 . ASN A 1 385 ? 84.319  22.088 24.789  1.00 62.03 ? 473 ASN A OD1 1 
ATOM   2874 N ND2 . ASN A 1 385 ? 84.096  24.091 23.796  1.00 61.87 ? 473 ASN A ND2 1 
ATOM   2875 N N   . ALA A 1 386 ? 79.091  22.448 24.222  1.00 60.04 ? 474 ALA A N   1 
ATOM   2876 C CA  . ALA A 1 386 ? 77.692  22.597 24.596  1.00 58.68 ? 474 ALA A CA  1 
ATOM   2877 C C   . ALA A 1 386 ? 77.110  21.227 24.890  1.00 57.87 ? 474 ALA A C   1 
ATOM   2878 O O   . ALA A 1 386 ? 76.408  21.045 25.879  1.00 57.72 ? 474 ALA A O   1 
ATOM   2879 C CB  . ALA A 1 386 ? 76.926  23.250 23.480  1.00 58.64 ? 474 ALA A CB  1 
ATOM   2880 N N   . ASP A 1 387 ? 77.410  20.264 24.025  1.00 57.14 ? 475 ASP A N   1 
ATOM   2881 C CA  . ASP A 1 387 ? 76.916  18.906 24.203  1.00 56.28 ? 475 ASP A CA  1 
ATOM   2882 C C   . ASP A 1 387 ? 77.494  18.283 25.477  1.00 55.85 ? 475 ASP A C   1 
ATOM   2883 O O   . ASP A 1 387 ? 76.843  17.466 26.120  1.00 55.68 ? 475 ASP A O   1 
ATOM   2884 C CB  . ASP A 1 387 ? 77.272  18.050 22.981  1.00 56.46 ? 475 ASP A CB  1 
ATOM   2885 N N   . PHE A 1 388 ? 78.713  18.679 25.839  1.00 55.68 ? 476 PHE A N   1 
ATOM   2886 C CA  . PHE A 1 388 ? 79.382  18.176 27.046  1.00 55.18 ? 476 PHE A CA  1 
ATOM   2887 C C   . PHE A 1 388 ? 78.638  18.642 28.301  1.00 54.47 ? 476 PHE A C   1 
ATOM   2888 O O   . PHE A 1 388 ? 78.399  17.871 29.236  1.00 53.76 ? 476 PHE A O   1 
ATOM   2889 C CB  . PHE A 1 388 ? 80.836  18.685 27.082  1.00 55.75 ? 476 PHE A CB  1 
ATOM   2890 C CG  . PHE A 1 388 ? 81.779  17.955 26.149  1.00 55.96 ? 476 PHE A CG  1 
ATOM   2891 C CD1 . PHE A 1 388 ? 81.621  16.586 25.887  1.00 56.22 ? 476 PHE A CD1 1 
ATOM   2892 C CD2 . PHE A 1 388 ? 82.871  18.624 25.586  1.00 55.88 ? 476 PHE A CD2 1 
ATOM   2893 C CE1 . PHE A 1 388 ? 82.542  15.894 25.087  1.00 56.10 ? 476 PHE A CE1 1 
ATOM   2894 C CE2 . PHE A 1 388 ? 83.797  17.945 24.783  1.00 56.28 ? 476 PHE A CE2 1 
ATOM   2895 C CZ  . PHE A 1 388 ? 83.632  16.576 24.531  1.00 56.25 ? 476 PHE A CZ  1 
ATOM   2896 N N   . ILE A 1 389 ? 78.273  19.917 28.305  1.00 54.03 ? 477 ILE A N   1 
ATOM   2897 C CA  . ILE A 1 389 ? 77.553  20.514 29.421  1.00 53.95 ? 477 ILE A CA  1 
ATOM   2898 C C   . ILE A 1 389 ? 76.145  19.928 29.608  1.00 54.14 ? 477 ILE A C   1 
ATOM   2899 O O   . ILE A 1 389 ? 75.670  19.790 30.741  1.00 54.09 ? 477 ILE A O   1 
ATOM   2900 C CB  . ILE A 1 389 ? 77.492  22.053 29.251  1.00 53.23 ? 477 ILE A CB  1 
ATOM   2901 C CG1 . ILE A 1 389 ? 78.905  22.625 29.407  1.00 52.89 ? 477 ILE A CG1 1 
ATOM   2902 C CG2 . ILE A 1 389 ? 76.541  22.667 30.260  1.00 52.47 ? 477 ILE A CG2 1 
ATOM   2903 C CD1 . ILE A 1 389 ? 79.022  24.099 29.110  1.00 52.15 ? 477 ILE A CD1 1 
ATOM   2904 N N   . GLU A 1 390 ? 75.478  19.583 28.511  1.00 54.10 ? 478 GLU A N   1 
ATOM   2905 C CA  . GLU A 1 390 ? 74.153  18.986 28.614  1.00 54.36 ? 478 GLU A CA  1 
ATOM   2906 C C   . GLU A 1 390 ? 74.294  17.622 29.306  1.00 54.58 ? 478 GLU A C   1 
ATOM   2907 O O   . GLU A 1 390 ? 73.490  17.271 30.174  1.00 54.22 ? 478 GLU A O   1 
ATOM   2908 C CB  . GLU A 1 390 ? 73.533  18.813 27.225  1.00 54.39 ? 478 GLU A CB  1 
ATOM   2909 N N   . LYS A 1 391 ? 75.331  16.871 28.930  1.00 54.65 ? 479 LYS A N   1 
ATOM   2910 C CA  . LYS A 1 391 ? 75.598  15.550 29.504  1.00 55.21 ? 479 LYS A CA  1 
ATOM   2911 C C   . LYS A 1 391 ? 75.773  15.599 31.029  1.00 55.15 ? 479 LYS A C   1 
ATOM   2912 O O   . LYS A 1 391 ? 75.084  14.890 31.775  1.00 55.17 ? 479 LYS A O   1 
ATOM   2913 C CB  . LYS A 1 391 ? 76.877  14.969 28.910  1.00 55.96 ? 479 LYS A CB  1 
ATOM   2914 C CG  . LYS A 1 391 ? 76.933  14.916 27.394  1.00 57.18 ? 479 LYS A CG  1 
ATOM   2915 C CD  . LYS A 1 391 ? 75.967  13.909 26.787  1.00 57.69 ? 479 LYS A CD  1 
ATOM   2916 C CE  . LYS A 1 391 ? 76.216  13.806 25.282  1.00 57.97 ? 479 LYS A CE  1 
ATOM   2917 N NZ  . LYS A 1 391 ? 75.379  12.774 24.610  1.00 57.88 ? 479 LYS A NZ  1 
ATOM   2918 N N   . ALA A 1 392 ? 76.714  16.432 31.477  1.00 54.41 ? 480 ALA A N   1 
ATOM   2919 C CA  . ALA A 1 392 ? 77.023  16.587 32.900  1.00 53.23 ? 480 ALA A CA  1 
ATOM   2920 C C   . ALA A 1 392 ? 75.830  17.078 33.714  1.00 52.48 ? 480 ALA A C   1 
ATOM   2921 O O   . ALA A 1 392 ? 75.884  17.139 34.946  1.00 52.15 ? 480 ALA A O   1 
ATOM   2922 C CB  . ALA A 1 392 ? 78.202  17.544 33.070  1.00 53.00 ? 480 ALA A CB  1 
ATOM   2923 N N   . GLY A 1 393 ? 74.749  17.413 33.017  1.00 51.72 ? 481 GLY A N   1 
ATOM   2924 C CA  . GLY A 1 393 ? 73.560  17.908 33.681  1.00 50.56 ? 481 GLY A CA  1 
ATOM   2925 C C   . GLY A 1 393 ? 73.720  19.391 33.942  1.00 49.76 ? 481 GLY A C   1 
ATOM   2926 O O   . GLY A 1 393 ? 72.987  19.978 34.736  1.00 49.76 ? 481 GLY A O   1 
ATOM   2927 N N   . GLY A 1 394 ? 74.688  19.997 33.266  1.00 48.69 ? 482 GLY A N   1 
ATOM   2928 C CA  . GLY A 1 394 ? 74.932  21.413 33.450  1.00 48.22 ? 482 GLY A CA  1 
ATOM   2929 C C   . GLY A 1 394 ? 73.785  22.281 32.977  1.00 47.39 ? 482 GLY A C   1 
ATOM   2930 O O   . GLY A 1 394 ? 73.396  23.232 33.655  1.00 46.85 ? 482 GLY A O   1 
ATOM   2931 N N   . MET A 1 395 ? 73.243  21.939 31.810  1.00 47.16 ? 483 MET A N   1 
ATOM   2932 C CA  . MET A 1 395 ? 72.133  22.674 31.197  1.00 46.54 ? 483 MET A CA  1 
ATOM   2933 C C   . MET A 1 395 ? 70.953  22.887 32.131  1.00 45.65 ? 483 MET A C   1 
ATOM   2934 O O   . MET A 1 395 ? 70.409  23.989 32.214  1.00 45.37 ? 483 MET A O   1 
ATOM   2935 C CB  . MET A 1 395 ? 71.607  21.943 29.961  1.00 47.10 ? 483 MET A CB  1 
ATOM   2936 C CG  . MET A 1 395 ? 70.470  22.693 29.271  1.00 47.64 ? 483 MET A CG  1 
ATOM   2937 S SD  . MET A 1 395 ? 69.440  21.676 28.194  1.00 47.97 ? 483 MET A SD  1 
ATOM   2938 C CE  . MET A 1 395 ? 70.701  20.866 27.115  1.00 48.91 ? 483 MET A CE  1 
ATOM   2939 N N   . GLU A 1 396 ? 70.539  21.823 32.815  1.00 44.46 ? 484 GLU A N   1 
ATOM   2940 C CA  . GLU A 1 396 ? 69.408  21.925 33.729  1.00 42.97 ? 484 GLU A CA  1 
ATOM   2941 C C   . GLU A 1 396 ? 69.720  22.896 34.850  1.00 42.38 ? 484 GLU A C   1 
ATOM   2942 O O   . GLU A 1 396 ? 68.900  23.750 35.169  1.00 41.86 ? 484 GLU A O   1 
ATOM   2943 C CB  . GLU A 1 396 ? 69.053  20.559 34.319  1.00 42.73 ? 484 GLU A CB  1 
ATOM   2944 C CG  . GLU A 1 396 ? 67.830  20.585 35.226  1.00 41.77 ? 484 GLU A CG  1 
ATOM   2945 N N   . LYS A 1 397 ? 70.909  22.766 35.437  1.00 41.77 ? 485 LYS A N   1 
ATOM   2946 C CA  . LYS A 1 397 ? 71.326  23.641 36.534  1.00 40.85 ? 485 LYS A CA  1 
ATOM   2947 C C   . LYS A 1 397 ? 71.456  25.099 36.095  1.00 40.72 ? 485 LYS A C   1 
ATOM   2948 O O   . LYS A 1 397 ? 71.061  26.010 36.829  1.00 40.05 ? 485 LYS A O   1 
ATOM   2949 C CB  . LYS A 1 397 ? 72.646  23.147 37.153  1.00 40.21 ? 485 LYS A CB  1 
ATOM   2950 C CG  . LYS A 1 397 ? 72.518  21.799 37.853  1.00 39.34 ? 485 LYS A CG  1 
ATOM   2951 C CD  . LYS A 1 397 ? 73.815  21.341 38.505  1.00 38.31 ? 485 LYS A CD  1 
ATOM   2952 C CE  . LYS A 1 397 ? 73.650  19.977 39.172  1.00 36.85 ? 485 LYS A CE  1 
ATOM   2953 N NZ  . LYS A 1 397 ? 73.329  18.870 38.223  1.00 35.33 ? 485 LYS A NZ  1 
ATOM   2954 N N   . ILE A 1 398 ? 72.011  25.329 34.907  1.00 40.49 ? 486 ILE A N   1 
ATOM   2955 C CA  . ILE A 1 398 ? 72.144  26.695 34.410  1.00 40.29 ? 486 ILE A CA  1 
ATOM   2956 C C   . ILE A 1 398 ? 70.736  27.252 34.276  1.00 41.14 ? 486 ILE A C   1 
ATOM   2957 O O   . ILE A 1 398 ? 70.468  28.411 34.588  1.00 41.32 ? 486 ILE A O   1 
ATOM   2958 C CB  . ILE A 1 398 ? 72.828  26.740 33.025  1.00 39.33 ? 486 ILE A CB  1 
ATOM   2959 C CG1 . ILE A 1 398 ? 74.300  26.323 33.145  1.00 38.45 ? 486 ILE A CG1 1 
ATOM   2960 C CG2 . ILE A 1 398 ? 72.709  28.133 32.441  1.00 38.93 ? 486 ILE A CG2 1 
ATOM   2961 C CD1 . ILE A 1 398 ? 75.036  26.248 31.825  1.00 36.48 ? 486 ILE A CD1 1 
ATOM   2962 N N   . PHE A 1 399 ? 69.828  26.399 33.818  1.00 42.12 ? 487 PHE A N   1 
ATOM   2963 C CA  . PHE A 1 399 ? 68.441  26.790 33.633  1.00 42.61 ? 487 PHE A CA  1 
ATOM   2964 C C   . PHE A 1 399 ? 67.791  27.205 34.952  1.00 42.81 ? 487 PHE A C   1 
ATOM   2965 O O   . PHE A 1 399 ? 66.982  28.134 34.994  1.00 42.94 ? 487 PHE A O   1 
ATOM   2966 C CB  . PHE A 1 399 ? 67.648  25.638 33.030  1.00 42.97 ? 487 PHE A CB  1 
ATOM   2967 C CG  . PHE A 1 399 ? 66.252  26.007 32.677  1.00 43.27 ? 487 PHE A CG  1 
ATOM   2968 C CD1 . PHE A 1 399 ? 65.988  26.766 31.549  1.00 43.53 ? 487 PHE A CD1 1 
ATOM   2969 C CD2 . PHE A 1 399 ? 65.204  25.676 33.521  1.00 43.84 ? 487 PHE A CD2 1 
ATOM   2970 C CE1 . PHE A 1 399 ? 64.700  27.195 31.271  1.00 43.45 ? 487 PHE A CE1 1 
ATOM   2971 C CE2 . PHE A 1 399 ? 63.911  26.104 33.250  1.00 43.92 ? 487 PHE A CE2 1 
ATOM   2972 C CZ  . PHE A 1 399 ? 63.662  26.865 32.125  1.00 43.34 ? 487 PHE A CZ  1 
ATOM   2973 N N   . ASN A 1 400 ? 68.133  26.513 36.031  1.00 42.89 ? 488 ASN A N   1 
ATOM   2974 C CA  . ASN A 1 400 ? 67.564  26.841 37.333  1.00 43.14 ? 488 ASN A CA  1 
ATOM   2975 C C   . ASN A 1 400 ? 68.029  28.189 37.871  1.00 43.39 ? 488 ASN A C   1 
ATOM   2976 O O   . ASN A 1 400 ? 67.305  28.830 38.629  1.00 43.46 ? 488 ASN A O   1 
ATOM   2977 C CB  . ASN A 1 400 ? 67.895  25.752 38.347  1.00 43.21 ? 488 ASN A CB  1 
ATOM   2978 C CG  . ASN A 1 400 ? 67.193  24.454 38.044  1.00 43.71 ? 488 ASN A CG  1 
ATOM   2979 O OD1 . ASN A 1 400 ? 67.468  23.431 38.664  1.00 43.84 ? 488 ASN A OD1 1 
ATOM   2980 N ND2 . ASN A 1 400 ? 66.268  24.489 37.089  1.00 44.39 ? 488 ASN A ND2 1 
ATOM   2981 N N   . CYS A 1 401 ? 69.225  28.620 37.479  1.00 43.63 ? 489 CYS A N   1 
ATOM   2982 C CA  . CYS A 1 401 ? 69.765  29.898 37.942  1.00 43.62 ? 489 CYS A CA  1 
ATOM   2983 C C   . CYS A 1 401 ? 68.979  31.086 37.413  1.00 43.50 ? 489 CYS A C   1 
ATOM   2984 O O   . CYS A 1 401 ? 69.312  32.231 37.688  1.00 42.83 ? 489 CYS A O   1 
ATOM   2985 C CB  . CYS A 1 401 ? 71.242  30.044 37.546  1.00 43.90 ? 489 CYS A CB  1 
ATOM   2986 S SG  . CYS A 1 401 ? 72.365  28.900 38.396  1.00 43.85 ? 489 CYS A SG  1 
ATOM   2987 N N   . GLN A 1 402 ? 67.934  30.811 36.645  1.00 44.29 ? 490 GLN A N   1 
ATOM   2988 C CA  . GLN A 1 402 ? 67.102  31.880 36.109  1.00 45.27 ? 490 GLN A CA  1 
ATOM   2989 C C   . GLN A 1 402 ? 66.128  32.351 37.193  1.00 45.41 ? 490 GLN A C   1 
ATOM   2990 O O   . GLN A 1 402 ? 65.530  33.424 37.081  1.00 45.14 ? 490 GLN A O   1 
ATOM   2991 C CB  . GLN A 1 402 ? 66.334  31.390 34.874  1.00 45.61 ? 490 GLN A CB  1 
ATOM   2992 C CG  . GLN A 1 402 ? 67.238  30.852 33.768  1.00 47.75 ? 490 GLN A CG  1 
ATOM   2993 C CD  . GLN A 1 402 ? 66.489  30.488 32.500  1.00 48.45 ? 490 GLN A CD  1 
ATOM   2994 O OE1 . GLN A 1 402 ? 65.537  29.710 32.527  1.00 49.35 ? 490 GLN A OE1 1 
ATOM   2995 N NE2 . GLN A 1 402 ? 66.926  31.042 31.379  1.00 49.32 ? 490 GLN A NE2 1 
ATOM   2996 N N   . GLN A 1 403 ? 65.987  31.545 38.247  1.00 46.01 ? 491 GLN A N   1 
ATOM   2997 C CA  . GLN A 1 403 ? 65.097  31.858 39.361  1.00 46.22 ? 491 GLN A CA  1 
ATOM   2998 C C   . GLN A 1 403 ? 65.864  32.380 40.561  1.00 45.90 ? 491 GLN A C   1 
ATOM   2999 O O   . GLN A 1 403 ? 65.315  32.530 41.648  1.00 45.60 ? 491 GLN A O   1 
ATOM   3000 C CB  . GLN A 1 403 ? 64.289  30.629 39.779  1.00 47.63 ? 491 GLN A CB  1 
ATOM   3001 C CG  . GLN A 1 403 ? 63.424  30.043 38.676  1.00 49.44 ? 491 GLN A CG  1 
ATOM   3002 C CD  . GLN A 1 403 ? 62.134  29.447 39.214  1.00 50.54 ? 491 GLN A CD  1 
ATOM   3003 O OE1 . GLN A 1 403 ? 62.144  28.652 40.158  1.00 51.43 ? 491 GLN A OE1 1 
ATOM   3004 N NE2 . GLN A 1 403 ? 61.012  29.828 38.607  1.00 51.01 ? 491 GLN A NE2 1 
ATOM   3005 N N   . ASN A 1 404 ? 67.147  32.649 40.355  1.00 45.86 ? 492 ASN A N   1 
ATOM   3006 C CA  . ASN A 1 404 ? 68.008  33.184 41.400  1.00 45.43 ? 492 ASN A CA  1 
ATOM   3007 C C   . ASN A 1 404 ? 67.606  34.644 41.564  1.00 45.61 ? 492 ASN A C   1 
ATOM   3008 O O   . ASN A 1 404 ? 67.347  35.338 40.577  1.00 45.46 ? 492 ASN A O   1 
ATOM   3009 C CB  . ASN A 1 404 ? 69.474  33.075 40.959  1.00 45.19 ? 492 ASN A CB  1 
ATOM   3010 C CG  . ASN A 1 404 ? 70.459  33.517 42.033  1.00 44.48 ? 492 ASN A CG  1 
ATOM   3011 O OD1 . ASN A 1 404 ? 70.577  34.702 42.343  1.00 43.72 ? 492 ASN A OD1 1 
ATOM   3012 N ND2 . ASN A 1 404 ? 71.170  32.553 42.609  1.00 43.75 ? 492 ASN A ND2 1 
ATOM   3013 N N   . GLU A 1 405 ? 67.549  35.106 42.808  1.00 45.86 ? 493 GLU A N   1 
ATOM   3014 C CA  . GLU A 1 405 ? 67.160  36.486 43.099  1.00 45.79 ? 493 GLU A CA  1 
ATOM   3015 C C   . GLU A 1 405 ? 68.146  37.542 42.618  1.00 45.66 ? 493 GLU A C   1 
ATOM   3016 O O   . GLU A 1 405 ? 67.777  38.701 42.422  1.00 45.93 ? 493 GLU A O   1 
ATOM   3017 C CB  . GLU A 1 405 ? 66.918  36.674 44.605  1.00 46.10 ? 493 GLU A CB  1 
ATOM   3018 C CG  . GLU A 1 405 ? 68.113  36.413 45.532  1.00 46.92 ? 493 GLU A CG  1 
ATOM   3019 C CD  . GLU A 1 405 ? 68.589  34.957 45.528  1.00 47.83 ? 493 GLU A CD  1 
ATOM   3020 O OE1 . GLU A 1 405 ? 67.760  34.037 45.738  1.00 47.30 ? 493 GLU A OE1 1 
ATOM   3021 O OE2 . GLU A 1 405 ? 69.805  34.734 45.329  1.00 48.29 ? 493 GLU A OE2 1 
ATOM   3022 N N   . ASN A 1 406 ? 69.397  37.142 42.426  1.00 45.62 ? 494 ASN A N   1 
ATOM   3023 C CA  . ASN A 1 406 ? 70.430  38.064 41.979  1.00 44.93 ? 494 ASN A CA  1 
ATOM   3024 C C   . ASN A 1 406 ? 70.359  38.346 40.482  1.00 44.27 ? 494 ASN A C   1 
ATOM   3025 O O   . ASN A 1 406 ? 70.448  37.432 39.657  1.00 44.07 ? 494 ASN A O   1 
ATOM   3026 C CB  . ASN A 1 406 ? 71.808  37.512 42.357  1.00 46.00 ? 494 ASN A CB  1 
ATOM   3027 C CG  . ASN A 1 406 ? 72.952  38.382 41.851  1.00 47.35 ? 494 ASN A CG  1 
ATOM   3028 O OD1 . ASN A 1 406 ? 73.293  38.369 40.658  1.00 47.22 ? 494 ASN A OD1 1 
ATOM   3029 N ND2 . ASN A 1 406 ? 73.540  39.163 42.755  1.00 47.41 ? 494 ASN A ND2 1 
ATOM   3030 N N   . ASP A 1 407 ? 70.207  39.624 40.150  1.00 43.74 ? 495 ASP A N   1 
ATOM   3031 C CA  . ASP A 1 407 ? 70.113  40.084 38.763  1.00 43.54 ? 495 ASP A CA  1 
ATOM   3032 C C   . ASP A 1 407 ? 71.271  39.596 37.897  1.00 42.69 ? 495 ASP A C   1 
ATOM   3033 O O   . ASP A 1 407 ? 71.055  39.002 36.838  1.00 42.32 ? 495 ASP A O   1 
ATOM   3034 C CB  . ASP A 1 407 ? 70.051  41.619 38.714  1.00 45.13 ? 495 ASP A CB  1 
ATOM   3035 C CG  . ASP A 1 407 ? 68.792  42.192 39.394  1.00 46.91 ? 495 ASP A CG  1 
ATOM   3036 O OD1 . ASP A 1 407 ? 68.622  42.023 40.627  1.00 47.56 ? 495 ASP A OD1 1 
ATOM   3037 O OD2 . ASP A 1 407 ? 67.967  42.818 38.689  1.00 47.87 ? 495 ASP A OD2 1 
ATOM   3038 N N   . LYS A 1 408 ? 72.498  39.850 38.351  1.00 41.76 ? 496 LYS A N   1 
ATOM   3039 C CA  . LYS A 1 408 ? 73.697  39.434 37.623  1.00 40.37 ? 496 LYS A CA  1 
ATOM   3040 C C   . LYS A 1 408 ? 73.649  37.963 37.212  1.00 39.84 ? 496 LYS A C   1 
ATOM   3041 O O   . LYS A 1 408 ? 74.095  37.607 36.122  1.00 39.31 ? 496 LYS A O   1 
ATOM   3042 C CB  . LYS A 1 408 ? 74.943  39.680 38.475  1.00 39.58 ? 496 LYS A CB  1 
ATOM   3043 N N   . ILE A 1 409 ? 73.099  37.119 38.082  1.00 38.95 ? 497 ILE A N   1 
ATOM   3044 C CA  . ILE A 1 409 ? 73.011  35.698 37.795  1.00 38.55 ? 497 ILE A CA  1 
ATOM   3045 C C   . ILE A 1 409 ? 71.885  35.317 36.838  1.00 38.51 ? 497 ILE A C   1 
ATOM   3046 O O   . ILE A 1 409 ? 72.146  34.740 35.783  1.00 37.72 ? 497 ILE A O   1 
ATOM   3047 C CB  . ILE A 1 409 ? 72.849  34.860 39.090  1.00 38.62 ? 497 ILE A CB  1 
ATOM   3048 C CG1 . ILE A 1 409 ? 74.062  35.068 40.001  1.00 37.97 ? 497 ILE A CG1 1 
ATOM   3049 C CG2 . ILE A 1 409 ? 72.664  33.372 38.736  1.00 37.97 ? 497 ILE A CG2 1 
ATOM   3050 C CD1 . ILE A 1 409 ? 73.996  34.296 41.309  1.00 37.74 ? 497 ILE A CD1 1 
ATOM   3051 N N   . TYR A 1 410 ? 70.638  35.638 37.177  1.00 38.80 ? 498 TYR A N   1 
ATOM   3052 C CA  . TYR A 1 410 ? 69.560  35.227 36.294  1.00 38.96 ? 498 TYR A CA  1 
ATOM   3053 C C   . TYR A 1 410 ? 69.710  35.829 34.904  1.00 38.77 ? 498 TYR A C   1 
ATOM   3054 O O   . TYR A 1 410 ? 69.433  35.172 33.908  1.00 39.42 ? 498 TYR A O   1 
ATOM   3055 C CB  . TYR A 1 410 ? 68.179  35.498 36.917  1.00 39.35 ? 498 TYR A CB  1 
ATOM   3056 C CG  . TYR A 1 410 ? 67.676  36.918 36.929  1.00 40.65 ? 498 TYR A CG  1 
ATOM   3057 C CD1 . TYR A 1 410 ? 67.380  37.590 35.743  1.00 41.33 ? 498 TYR A CD1 1 
ATOM   3058 C CD2 . TYR A 1 410 ? 67.412  37.567 38.134  1.00 40.83 ? 498 TYR A CD2 1 
ATOM   3059 C CE1 . TYR A 1 410 ? 66.828  38.864 35.758  1.00 41.50 ? 498 TYR A CE1 1 
ATOM   3060 C CE2 . TYR A 1 410 ? 66.862  38.840 38.164  1.00 41.00 ? 498 TYR A CE2 1 
ATOM   3061 C CZ  . TYR A 1 410 ? 66.570  39.484 36.974  1.00 42.15 ? 498 TYR A CZ  1 
ATOM   3062 O OH  . TYR A 1 410 ? 66.006  40.746 37.010  1.00 43.16 ? 498 TYR A OH  1 
ATOM   3063 N N   . GLU A 1 411 ? 70.184  37.059 34.814  1.00 38.45 ? 499 GLU A N   1 
ATOM   3064 C CA  . GLU A 1 411 ? 70.382  37.643 33.496  1.00 38.67 ? 499 GLU A CA  1 
ATOM   3065 C C   . GLU A 1 411 ? 71.420  36.838 32.704  1.00 38.60 ? 499 GLU A C   1 
ATOM   3066 O O   . GLU A 1 411 ? 71.227  36.540 31.526  1.00 38.53 ? 499 GLU A O   1 
ATOM   3067 C CB  . GLU A 1 411 ? 70.823  39.106 33.614  1.00 38.14 ? 499 GLU A CB  1 
ATOM   3068 C CG  . GLU A 1 411 ? 69.719  40.046 34.065  1.00 37.63 ? 499 GLU A CG  1 
ATOM   3069 N N   . LYS A 1 412 ? 72.518  36.493 33.369  1.00 38.93 ? 500 LYS A N   1 
ATOM   3070 C CA  . LYS A 1 412 ? 73.606  35.715 32.772  1.00 38.78 ? 500 LYS A CA  1 
ATOM   3071 C C   . LYS A 1 412 ? 73.078  34.346 32.318  1.00 38.71 ? 500 LYS A C   1 
ATOM   3072 O O   . LYS A 1 412 ? 73.445  33.849 31.253  1.00 38.40 ? 500 LYS A O   1 
ATOM   3073 C CB  . LYS A 1 412 ? 74.718  35.531 33.818  1.00 38.44 ? 500 LYS A CB  1 
ATOM   3074 C CG  . LYS A 1 412 ? 75.958  34.799 33.365  1.00 38.37 ? 500 LYS A CG  1 
ATOM   3075 C CD  . LYS A 1 412 ? 76.785  35.630 32.425  1.00 38.92 ? 500 LYS A CD  1 
ATOM   3076 C CE  . LYS A 1 412 ? 78.079  34.908 32.070  1.00 39.20 ? 500 LYS A CE  1 
ATOM   3077 N N   . ALA A 1 413 ? 72.205  33.754 33.134  1.00 38.79 ? 501 ALA A N   1 
ATOM   3078 C CA  . ALA A 1 413 ? 71.628  32.447 32.848  1.00 39.12 ? 501 ALA A CA  1 
ATOM   3079 C C   . ALA A 1 413 ? 70.761  32.436 31.595  1.00 39.59 ? 501 ALA A C   1 
ATOM   3080 O O   . ALA A 1 413 ? 70.937  31.574 30.734  1.00 40.01 ? 501 ALA A O   1 
ATOM   3081 C CB  . ALA A 1 413 ? 70.826  31.949 34.047  1.00 38.15 ? 501 ALA A CB  1 
ATOM   3082 N N   . TYR A 1 414 ? 69.828  33.378 31.481  1.00 39.94 ? 502 TYR A N   1 
ATOM   3083 C CA  . TYR A 1 414 ? 68.975  33.416 30.297  1.00 40.82 ? 502 TYR A CA  1 
ATOM   3084 C C   . TYR A 1 414 ? 69.788  33.590 29.028  1.00 40.87 ? 502 TYR A C   1 
ATOM   3085 O O   . TYR A 1 414 ? 69.512  32.956 28.005  1.00 41.24 ? 502 TYR A O   1 
ATOM   3086 C CB  . TYR A 1 414 ? 67.947  34.549 30.352  1.00 41.92 ? 502 TYR A CB  1 
ATOM   3087 C CG  . TYR A 1 414 ? 66.810  34.370 31.337  1.00 43.03 ? 502 TYR A CG  1 
ATOM   3088 C CD1 . TYR A 1 414 ? 65.655  33.676 30.978  1.00 42.79 ? 502 TYR A CD1 1 
ATOM   3089 C CD2 . TYR A 1 414 ? 66.870  34.937 32.618  1.00 44.07 ? 502 TYR A CD2 1 
ATOM   3090 C CE1 . TYR A 1 414 ? 64.581  33.546 31.871  1.00 43.50 ? 502 TYR A CE1 1 
ATOM   3091 C CE2 . TYR A 1 414 ? 65.800  34.816 33.523  1.00 44.12 ? 502 TYR A CE2 1 
ATOM   3092 C CZ  . TYR A 1 414 ? 64.657  34.121 33.139  1.00 43.58 ? 502 TYR A CZ  1 
ATOM   3093 O OH  . TYR A 1 414 ? 63.608  33.997 34.023  1.00 43.08 ? 502 TYR A OH  1 
ATOM   3094 N N   . LYS A 1 415 ? 70.790  34.459 29.089  1.00 40.81 ? 503 LYS A N   1 
ATOM   3095 C CA  . LYS A 1 415 ? 71.626  34.711 27.930  1.00 40.54 ? 503 LYS A CA  1 
ATOM   3096 C C   . LYS A 1 415 ? 72.323  33.422 27.499  1.00 40.56 ? 503 LYS A C   1 
ATOM   3097 O O   . LYS A 1 415 ? 72.378  33.113 26.310  1.00 40.71 ? 503 LYS A O   1 
ATOM   3098 C CB  . LYS A 1 415 ? 72.643  35.813 28.244  1.00 39.89 ? 503 LYS A CB  1 
ATOM   3099 N N   . ILE A 1 416 ? 72.837  32.658 28.457  1.00 40.32 ? 504 ILE A N   1 
ATOM   3100 C CA  . ILE A 1 416 ? 73.509  31.412 28.111  1.00 41.08 ? 504 ILE A CA  1 
ATOM   3101 C C   . ILE A 1 416 ? 72.554  30.408 27.459  1.00 41.57 ? 504 ILE A C   1 
ATOM   3102 O O   . ILE A 1 416 ? 72.846  29.870 26.388  1.00 41.69 ? 504 ILE A O   1 
ATOM   3103 C CB  . ILE A 1 416 ? 74.204  30.779 29.353  1.00 40.90 ? 504 ILE A CB  1 
ATOM   3104 C CG1 . ILE A 1 416 ? 75.422  31.623 29.738  1.00 40.16 ? 504 ILE A CG1 1 
ATOM   3105 C CG2 . ILE A 1 416 ? 74.620  29.332 29.064  1.00 41.06 ? 504 ILE A CG2 1 
ATOM   3106 C CD1 . ILE A 1 416 ? 76.191  31.088 30.915  1.00 40.35 ? 504 ILE A CD1 1 
ATOM   3107 N N   . ILE A 1 417 ? 71.413  30.161 28.096  1.00 42.25 ? 505 ILE A N   1 
ATOM   3108 C CA  . ILE A 1 417 ? 70.434  29.230 27.546  1.00 43.19 ? 505 ILE A CA  1 
ATOM   3109 C C   . ILE A 1 417 ? 69.973  29.666 26.160  1.00 44.10 ? 505 ILE A C   1 
ATOM   3110 O O   . ILE A 1 417 ? 69.889  28.848 25.241  1.00 44.19 ? 505 ILE A O   1 
ATOM   3111 C CB  . ILE A 1 417 ? 69.171  29.115 28.432  1.00 42.89 ? 505 ILE A CB  1 
ATOM   3112 C CG1 . ILE A 1 417 ? 69.492  28.390 29.739  1.00 42.64 ? 505 ILE A CG1 1 
ATOM   3113 C CG2 . ILE A 1 417 ? 68.082  28.371 27.670  1.00 42.26 ? 505 ILE A CG2 1 
ATOM   3114 C CD1 . ILE A 1 417 ? 69.919  26.958 29.551  1.00 42.09 ? 505 ILE A CD1 1 
ATOM   3115 N N   . GLU A 1 418 ? 69.657  30.952 26.021  1.00 44.71 ? 506 GLU A N   1 
ATOM   3116 C CA  . GLU A 1 418 ? 69.198  31.491 24.746  1.00 45.63 ? 506 GLU A CA  1 
ATOM   3117 C C   . GLU A 1 418 ? 70.270  31.284 23.693  1.00 46.27 ? 506 GLU A C   1 
ATOM   3118 O O   . GLU A 1 418 ? 70.064  30.585 22.705  1.00 46.73 ? 506 GLU A O   1 
ATOM   3119 C CB  . GLU A 1 418 ? 68.900  32.996 24.863  1.00 45.56 ? 506 GLU A CB  1 
ATOM   3120 C CG  . GLU A 1 418 ? 68.362  33.632 23.563  1.00 45.22 ? 506 GLU A CG  1 
ATOM   3121 C CD  . GLU A 1 418 ? 68.184  35.154 23.640  1.00 44.54 ? 506 GLU A CD  1 
ATOM   3122 O OE1 . GLU A 1 418 ? 69.202  35.877 23.724  1.00 44.11 ? 506 GLU A OE1 1 
ATOM   3123 O OE2 . GLU A 1 418 ? 67.024  35.630 23.616  1.00 44.43 ? 506 GLU A OE2 1 
ATOM   3124 N N   . THR A 1 419 ? 71.422  31.892 23.935  1.00 47.01 ? 507 THR A N   1 
ATOM   3125 C CA  . THR A 1 419 ? 72.548  31.834 23.026  1.00 47.95 ? 507 THR A CA  1 
ATOM   3126 C C   . THR A 1 419 ? 73.073  30.443 22.682  1.00 48.63 ? 507 THR A C   1 
ATOM   3127 O O   . THR A 1 419 ? 73.446  30.202 21.530  1.00 48.77 ? 507 THR A O   1 
ATOM   3128 C CB  . THR A 1 419 ? 73.719  32.677 23.572  1.00 47.90 ? 507 THR A CB  1 
ATOM   3129 O OG1 . THR A 1 419 ? 73.278  34.025 23.773  1.00 48.13 ? 507 THR A OG1 1 
ATOM   3130 C CG2 . THR A 1 419 ? 74.890  32.667 22.600  1.00 47.88 ? 507 THR A CG2 1 
ATOM   3131 N N   . TYR A 1 420 ? 73.091  29.518 23.639  1.00 49.11 ? 508 TYR A N   1 
ATOM   3132 C CA  . TYR A 1 420 ? 73.653  28.211 23.324  1.00 49.95 ? 508 TYR A CA  1 
ATOM   3133 C C   . TYR A 1 420 ? 72.802  26.962 23.433  1.00 51.11 ? 508 TYR A C   1 
ATOM   3134 O O   . TYR A 1 420 ? 73.282  25.884 23.077  1.00 51.91 ? 508 TYR A O   1 
ATOM   3135 C CB  . TYR A 1 420 ? 74.939  27.995 24.124  1.00 48.79 ? 508 TYR A CB  1 
ATOM   3136 C CG  . TYR A 1 420 ? 75.937  29.118 23.959  1.00 47.98 ? 508 TYR A CG  1 
ATOM   3137 C CD1 . TYR A 1 420 ? 76.746  29.203 22.821  1.00 47.86 ? 508 TYR A CD1 1 
ATOM   3138 C CD2 . TYR A 1 420 ? 76.063  30.107 24.926  1.00 47.73 ? 508 TYR A CD2 1 
ATOM   3139 C CE1 . TYR A 1 420 ? 77.656  30.244 22.654  1.00 47.95 ? 508 TYR A CE1 1 
ATOM   3140 C CE2 . TYR A 1 420 ? 76.973  31.155 24.771  1.00 48.16 ? 508 TYR A CE2 1 
ATOM   3141 C CZ  . TYR A 1 420 ? 77.767  31.214 23.635  1.00 48.18 ? 508 TYR A CZ  1 
ATOM   3142 O OH  . TYR A 1 420 ? 78.686  32.227 23.489  1.00 48.54 ? 508 TYR A OH  1 
ATOM   3143 N N   . PHE A 1 421 ? 71.564  27.076 23.914  1.00 51.99 ? 509 PHE A N   1 
ATOM   3144 C CA  . PHE A 1 421 ? 70.706  25.892 24.035  1.00 52.76 ? 509 PHE A CA  1 
ATOM   3145 C C   . PHE A 1 421 ? 69.263  26.108 23.578  1.00 53.63 ? 509 PHE A C   1 
ATOM   3146 O O   . PHE A 1 421 ? 68.327  25.937 24.363  1.00 53.44 ? 509 PHE A O   1 
ATOM   3147 C CB  . PHE A 1 421 ? 70.692  25.356 25.477  1.00 52.59 ? 509 PHE A CB  1 
ATOM   3148 C CG  . PHE A 1 421 ? 72.049  24.992 26.013  1.00 52.72 ? 509 PHE A CG  1 
ATOM   3149 C CD1 . PHE A 1 421 ? 72.920  25.977 26.487  1.00 52.66 ? 509 PHE A CD1 1 
ATOM   3150 C CD2 . PHE A 1 421 ? 72.469  23.665 26.029  1.00 52.47 ? 509 PHE A CD2 1 
ATOM   3151 C CE1 . PHE A 1 421 ? 74.194  25.639 26.974  1.00 52.67 ? 509 PHE A CE1 1 
ATOM   3152 C CE2 . PHE A 1 421 ? 73.743  23.319 26.513  1.00 52.54 ? 509 PHE A CE2 1 
ATOM   3153 C CZ  . PHE A 1 421 ? 74.605  24.306 26.986  1.00 52.09 ? 509 PHE A CZ  1 
ATOM   3154 N N   . GLY A 1 422 ? 69.086  26.476 22.307  1.00 54.44 ? 510 GLY A N   1 
ATOM   3155 C CA  . GLY A 1 422 ? 67.752  26.692 21.771  1.00 54.76 ? 510 GLY A CA  1 
ATOM   3156 C C   . GLY A 1 422 ? 67.475  25.823 20.554  1.00 55.19 ? 510 GLY A C   1 
ATOM   3157 O O   . GLY A 1 422 ? 66.442  25.150 20.460  1.00 55.86 ? 510 GLY A O   1 
ATOM   3158 N N   . LYS B 2 1   ? 99.856  37.904 70.316  1.00 43.43 ? 127 LYS C N   1 
ATOM   3159 C CA  . LYS B 2 1   ? 99.736  37.016 71.462  1.00 42.98 ? 127 LYS C CA  1 
ATOM   3160 C C   . LYS B 2 1   ? 100.597 37.475 72.656  1.00 43.12 ? 127 LYS C C   1 
ATOM   3161 O O   . LYS B 2 1   ? 101.363 38.439 72.562  1.00 43.28 ? 127 LYS C O   1 
ATOM   3162 C CB  . LYS B 2 1   ? 100.129 35.594 71.048  1.00 42.67 ? 127 LYS C CB  1 
ATOM   3163 C CG  . LYS B 2 1   ? 101.590 35.440 70.739  1.00 42.69 ? 127 LYS C CG  1 
ATOM   3164 C CD  . LYS B 2 1   ? 101.962 34.044 70.237  1.00 43.49 ? 127 LYS C CD  1 
ATOM   3165 C CE  . LYS B 2 1   ? 101.778 33.918 68.727  1.00 43.56 ? 127 LYS C CE  1 
ATOM   3166 N NZ  . LYS B 2 1   ? 102.727 32.905 68.195  1.00 43.70 ? 127 LYS C NZ  1 
ATOM   3167 N N   . LYS B 2 2   ? 100.460 36.779 73.780  1.00 42.91 ? 128 LYS C N   1 
ATOM   3168 C CA  . LYS B 2 2   ? 101.217 37.087 74.983  1.00 42.41 ? 128 LYS C CA  1 
ATOM   3169 C C   . LYS B 2 2   ? 101.844 35.815 75.557  1.00 42.86 ? 128 LYS C C   1 
ATOM   3170 O O   . LYS B 2 2   ? 101.331 34.723 75.352  1.00 41.94 ? 128 LYS C O   1 
ATOM   3171 C CB  . LYS B 2 2   ? 100.308 37.741 76.023  1.00 41.23 ? 128 LYS C CB  1 
ATOM   3172 C CG  . LYS B 2 2   ? 99.670  39.048 75.563  1.00 41.17 ? 128 LYS C CG  1 
ATOM   3173 C CD  . LYS B 2 2   ? 98.864  39.699 76.686  1.00 39.95 ? 128 LYS C CD  1 
ATOM   3174 C CE  . LYS B 2 2   ? 98.320  41.046 76.259  1.00 39.25 ? 128 LYS C CE  1 
ATOM   3175 N NZ  . LYS B 2 2   ? 97.643  41.742 77.390  1.00 39.55 ? 128 LYS C NZ  1 
ATOM   3176 N N   . LYS B 2 3   ? 102.967 35.975 76.256  1.00 43.60 ? 129 LYS C N   1 
ATOM   3177 C CA  . LYS B 2 3   ? 103.676 34.858 76.881  1.00 44.74 ? 129 LYS C CA  1 
ATOM   3178 C C   . LYS B 2 3   ? 104.078 35.196 78.305  1.00 45.51 ? 129 LYS C C   1 
ATOM   3179 O O   . LYS B 2 3   ? 104.428 36.334 78.609  1.00 46.35 ? 129 LYS C O   1 
ATOM   3180 C CB  . LYS B 2 3   ? 104.954 34.489 76.106  1.00 44.84 ? 129 LYS C CB  1 
ATOM   3181 C CG  . LYS B 2 3   ? 104.748 33.996 74.682  1.00 44.92 ? 129 LYS C CG  1 
ATOM   3182 C CD  . LYS B 2 3   ? 106.065 33.517 74.075  1.00 44.61 ? 129 LYS C CD  1 
ATOM   3183 C CE  . LYS B 2 3   ? 105.954 33.353 72.564  1.00 45.04 ? 129 LYS C CE  1 
ATOM   3184 N NZ  . LYS B 2 3   ? 107.040 32.495 72.004  1.00 45.29 ? 129 LYS C NZ  1 
ATOM   3185 N N   . ARG B 2 4   ? 104.047 34.178 79.163  1.00 46.10 ? 130 ARG C N   1 
ATOM   3186 C CA  . ARG B 2 4   ? 104.407 34.316 80.571  1.00 46.63 ? 130 ARG C CA  1 
ATOM   3187 C C   . ARG B 2 4   ? 105.739 33.631 80.860  1.00 46.50 ? 130 ARG C C   1 
ATOM   3188 O O   . ARG B 2 4   ? 106.008 32.548 80.361  1.00 45.98 ? 130 ARG C O   1 
ATOM   3189 C CB  . ARG B 2 4   ? 103.297 33.717 81.442  1.00 47.41 ? 130 ARG C CB  1 
ATOM   3190 C CG  . ARG B 2 4   ? 103.514 33.851 82.952  1.00 48.48 ? 130 ARG C CG  1 
ATOM   3191 C CD  . ARG B 2 4   ? 102.173 33.800 83.710  1.00 50.25 ? 130 ARG C CD  1 
ATOM   3192 N NE  . ARG B 2 4   ? 102.241 33.128 85.008  1.00 51.17 ? 130 ARG C NE  1 
ATOM   3193 C CZ  . ARG B 2 4   ? 102.360 31.808 85.167  1.00 51.95 ? 130 ARG C CZ  1 
ATOM   3194 N NH1 . ARG B 2 4   ? 102.417 31.014 84.109  1.00 52.60 ? 130 ARG C NH1 1 
ATOM   3195 N NH2 . ARG B 2 4   ? 102.411 31.277 86.383  1.00 52.24 ? 130 ARG C NH2 1 
ATOM   3196 N N   . LYS B 2 5   ? 106.577 34.288 81.656  1.00 47.06 ? 131 LYS C N   1 
ATOM   3197 C CA  . LYS B 2 5   ? 107.879 33.747 82.021  1.00 47.37 ? 131 LYS C CA  1 
ATOM   3198 C C   . LYS B 2 5   ? 107.756 32.809 83.195  1.00 48.18 ? 131 LYS C C   1 
ATOM   3199 O O   . LYS B 2 5   ? 107.438 33.228 84.307  1.00 48.48 ? 131 LYS C O   1 
ATOM   3200 C CB  . LYS B 2 5   ? 108.843 34.853 82.415  1.00 47.10 ? 131 LYS C CB  1 
ATOM   3201 C CG  . LYS B 2 5   ? 110.136 34.290 82.979  1.00 47.14 ? 131 LYS C CG  1 
ATOM   3202 C CD  . LYS B 2 5   ? 111.101 35.383 83.331  1.00 46.70 ? 131 LYS C CD  1 
ATOM   3203 C CE  . LYS B 2 5   ? 112.487 34.859 83.672  1.00 46.55 ? 131 LYS C CE  1 
ATOM   3204 N NZ  . LYS B 2 5   ? 113.236 34.464 82.512  1.00 46.14 ? 131 LYS C NZ  1 
ATOM   3205 N N   . VAL B 2 6   ? 108.040 31.536 82.946  1.00 49.23 ? 132 VAL C N   1 
ATOM   3206 C CA  . VAL B 2 6   ? 107.950 30.515 83.980  1.00 49.83 ? 132 VAL C CA  1 
ATOM   3207 C C   . VAL B 2 6   ? 109.338 29.948 84.265  1.00 50.07 ? 132 VAL C C   1 
ATOM   3208 O O   . VAL B 2 6   ? 109.740 29.804 85.421  1.00 50.77 ? 132 VAL C O   1 
ATOM   3209 C CB  . VAL B 2 6   ? 107.002 29.374 83.553  1.00 49.76 ? 132 VAL C CB  1 
ATOM   3210 C CG1 . VAL B 2 6   ? 106.805 28.413 84.693  1.00 50.27 ? 132 VAL C CG1 1 
ATOM   3211 C CG2 . VAL B 2 6   ? 105.674 29.932 83.120  1.00 49.65 ? 132 VAL C CG2 1 
ATOM   3212 N N   . ALA C 3 1   ? 90.786  40.744 38.359  1.00 46.53 ? 127 ALA D N   1 
ATOM   3213 C CA  . ALA C 3 1   ? 90.479  39.437 38.935  1.00 46.10 ? 127 ALA D CA  1 
ATOM   3214 C C   . ALA C 3 1   ? 91.437  39.036 40.085  1.00 45.87 ? 127 ALA D C   1 
ATOM   3215 O O   . ALA C 3 1   ? 91.426  37.878 40.522  1.00 45.98 ? 127 ALA D O   1 
ATOM   3216 C CB  . ALA C 3 1   ? 90.487  38.363 37.818  1.00 45.60 ? 127 ALA D CB  1 
ATOM   3217 N N   . LYS C 3 2   ? 92.246  39.985 40.573  1.00 44.90 ? 128 LYS D N   1 
ATOM   3218 C CA  . LYS C 3 2   ? 93.202  39.742 41.666  1.00 44.04 ? 128 LYS D CA  1 
ATOM   3219 C C   . LYS C 3 2   ? 92.529  39.842 43.039  1.00 43.53 ? 128 LYS D C   1 
ATOM   3220 O O   . LYS C 3 2   ? 92.019  40.907 43.387  1.00 42.64 ? 128 LYS D O   1 
ATOM   3221 C CB  . LYS C 3 2   ? 94.347  40.758 41.628  1.00 43.56 ? 128 LYS D CB  1 
ATOM   3222 C CG  . LYS C 3 2   ? 95.318  40.641 40.468  1.00 43.26 ? 128 LYS D CG  1 
ATOM   3223 C CD  . LYS C 3 2   ? 96.329  39.530 40.676  1.00 43.34 ? 128 LYS D CD  1 
ATOM   3224 C CE  . LYS C 3 2   ? 97.397  39.555 39.590  1.00 42.02 ? 128 LYS D CE  1 
ATOM   3225 N NZ  . LYS C 3 2   ? 98.474  38.587 39.887  1.00 42.62 ? 128 LYS D NZ  1 
ATOM   3226 N N   . LYS C 3 3   ? 92.557  38.757 43.817  1.00 42.83 ? 129 LYS D N   1 
ATOM   3227 C CA  . LYS C 3 3   ? 91.929  38.730 45.140  1.00 42.32 ? 129 LYS D CA  1 
ATOM   3228 C C   . LYS C 3 3   ? 92.888  38.780 46.324  1.00 42.29 ? 129 LYS D C   1 
ATOM   3229 O O   . LYS C 3 3   ? 93.758  37.884 46.492  1.00 42.91 ? 129 LYS D O   1 
ATOM   3230 C CB  . LYS C 3 3   ? 91.033  37.480 45.306  1.00 41.69 ? 129 LYS D CB  1 
ATOM   3231 C CG  . LYS C 3 3   ? 89.870  37.281 44.300  1.00 40.34 ? 129 LYS D CG  1 
ATOM   3232 C CD  . LYS C 3 3   ? 89.159  35.971 44.625  1.00 38.80 ? 129 LYS D CD  1 
ATOM   3233 C CE  . LYS C 3 3   ? 90.149  34.820 44.592  1.00 38.03 ? 129 LYS D CE  1 
ATOM   3234 N NZ  . LYS C 3 3   ? 89.648  33.614 45.290  1.00 38.10 ? 129 LYS D NZ  1 
ATOM   3235 N N   . ALA C 3 4   ? 92.708  39.822 47.151  1.00 41.72 ? 130 ALA D N   1 
ATOM   3236 C CA  . ALA C 3 4   ? 93.445  40.115 48.374  1.00 40.75 ? 130 ALA D CA  1 
ATOM   3237 C C   . ALA C 3 4   ? 92.628  39.872 49.655  1.00 40.02 ? 130 ALA D C   1 
ATOM   3238 O O   . ALA C 3 4   ? 91.429  40.277 49.774  1.00 39.55 ? 130 ALA D O   1 
ATOM   3239 C CB  . ALA C 3 4   ? 93.983  41.561 48.414  1.00 40.52 ? 130 ALA D CB  1 
ATOM   3240 N N   . ALA C 3 5   ? 93.416  39.332 50.551  1.00 39.95 ? 131 ALA D N   1 
ATOM   3241 C CA  . ALA C 3 5   ? 93.272  38.919 51.984  1.00 39.96 ? 131 ALA D CA  1 
ATOM   3242 C C   . ALA C 3 5   ? 94.332  37.858 52.318  1.00 39.96 ? 131 ALA D C   1 
ATOM   3243 O O   . ALA C 3 5   ? 94.484  36.806 51.667  1.00 39.97 ? 131 ALA D O   1 
ATOM   3244 C CB  . ALA C 3 5   ? 91.880  38.388 52.280  1.00 39.96 ? 131 ALA D CB  1 
ATOM   3245 N N   . LEU D 1 1   ? 59.345  33.560 1.089   1.00 67.46 ? 89  LEU B N   1 
ATOM   3246 C CA  . LEU D 1 1   ? 59.213  33.794 -0.342  1.00 67.83 ? 89  LEU B CA  1 
ATOM   3247 C C   . LEU D 1 1   ? 59.075  35.284 -0.637  1.00 68.05 ? 89  LEU B C   1 
ATOM   3248 O O   . LEU D 1 1   ? 58.464  36.028 0.131   1.00 68.14 ? 89  LEU B O   1 
ATOM   3249 C CB  . LEU D 1 1   ? 57.991  33.050 -0.893  1.00 67.46 ? 89  LEU B CB  1 
ATOM   3250 N N   . PRO D 1 2   ? 59.672  35.746 -1.745  1.00 68.34 ? 90  PRO B N   1 
ATOM   3251 C CA  . PRO D 1 2   ? 59.617  37.152 -2.159  1.00 68.14 ? 90  PRO B CA  1 
ATOM   3252 C C   . PRO D 1 2   ? 58.198  37.534 -2.575  1.00 67.92 ? 90  PRO B C   1 
ATOM   3253 O O   . PRO D 1 2   ? 57.780  38.684 -2.422  1.00 67.64 ? 90  PRO B O   1 
ATOM   3254 C CB  . PRO D 1 2   ? 60.589  37.191 -3.337  1.00 68.44 ? 90  PRO B CB  1 
ATOM   3255 C CG  . PRO D 1 2   ? 61.542  36.031 -3.024  1.00 68.76 ? 90  PRO B CG  1 
ATOM   3256 C CD  . PRO D 1 2   ? 60.514  34.988 -2.683  1.00 68.40 ? 90  PRO B CD  1 
ATOM   3257 N N   . GLN D 1 3   ? 57.472  36.554 -3.108  1.00 67.61 ? 91  GLN B N   1 
ATOM   3258 C CA  . GLN D 1 3   ? 56.096  36.744 -3.544  1.00 67.57 ? 91  GLN B CA  1 
ATOM   3259 C C   . GLN D 1 3   ? 55.250  37.298 -2.398  1.00 67.76 ? 91  GLN B C   1 
ATOM   3260 O O   . GLN D 1 3   ? 54.382  38.151 -2.605  1.00 67.83 ? 91  GLN B O   1 
ATOM   3261 C CB  . GLN D 1 3   ? 55.515  35.413 -4.017  1.00 67.17 ? 91  GLN B CB  1 
ATOM   3262 N N   . MET D 1 4   ? 55.506  36.801 -1.191  1.00 67.88 ? 92  MET B N   1 
ATOM   3263 C CA  . MET D 1 4   ? 54.790  37.245 0.001   1.00 67.96 ? 92  MET B CA  1 
ATOM   3264 C C   . MET D 1 4   ? 55.004  38.721 0.267   1.00 67.90 ? 92  MET B C   1 
ATOM   3265 O O   . MET D 1 4   ? 54.060  39.463 0.517   1.00 68.08 ? 92  MET B O   1 
ATOM   3266 C CB  . MET D 1 4   ? 55.256  36.465 1.225   1.00 68.36 ? 92  MET B CB  1 
ATOM   3267 C CG  . MET D 1 4   ? 54.866  35.005 1.224   1.00 69.06 ? 92  MET B CG  1 
ATOM   3268 S SD  . MET D 1 4   ? 55.493  34.173 2.692   1.00 70.34 ? 92  MET B SD  1 
ATOM   3269 C CE  . MET D 1 4   ? 54.915  35.252 4.000   1.00 69.35 ? 92  MET B CE  1 
ATOM   3270 N N   . THR D 1 5   ? 56.256  39.146 0.231   1.00 68.03 ? 93  THR B N   1 
ATOM   3271 C CA  . THR D 1 5   ? 56.572  40.541 0.473   1.00 68.20 ? 93  THR B CA  1 
ATOM   3272 C C   . THR D 1 5   ? 55.830  41.433 -0.516  1.00 68.45 ? 93  THR B C   1 
ATOM   3273 O O   . THR D 1 5   ? 55.261  42.457 -0.139  1.00 68.46 ? 93  THR B O   1 
ATOM   3274 C CB  . THR D 1 5   ? 58.075  40.785 0.355   1.00 68.06 ? 93  THR B CB  1 
ATOM   3275 O OG1 . THR D 1 5   ? 58.765  39.917 1.266   1.00 68.09 ? 93  THR B OG1 1 
ATOM   3276 C CG2 . THR D 1 5   ? 58.405  42.237 0.685   1.00 67.66 ? 93  THR B CG2 1 
ATOM   3277 N N   . GLN D 1 6   ? 55.834  41.043 -1.785  1.00 68.89 ? 94  GLN B N   1 
ATOM   3278 C CA  . GLN D 1 6   ? 55.141  41.822 -2.803  1.00 69.40 ? 94  GLN B CA  1 
ATOM   3279 C C   . GLN D 1 6   ? 53.692  42.037 -2.386  1.00 69.07 ? 94  GLN B C   1 
ATOM   3280 O O   . GLN D 1 6   ? 53.204  43.171 -2.377  1.00 69.15 ? 94  GLN B O   1 
ATOM   3281 C CB  . GLN D 1 6   ? 55.194  41.108 -4.153  1.00 70.36 ? 94  GLN B CB  1 
ATOM   3282 C CG  . GLN D 1 6   ? 56.598  40.987 -4.733  1.00 71.43 ? 94  GLN B CG  1 
ATOM   3283 C CD  . GLN D 1 6   ? 56.594  40.316 -6.088  1.00 72.00 ? 94  GLN B CD  1 
ATOM   3284 O OE1 . GLN D 1 6   ? 55.915  40.769 -7.011  1.00 72.70 ? 94  GLN B OE1 1 
ATOM   3285 N NE2 . GLN D 1 6   ? 57.351  39.231 -6.218  1.00 72.05 ? 94  GLN B NE2 1 
ATOM   3286 N N   . GLN D 1 7   ? 53.008  40.949 -2.042  1.00 68.41 ? 95  GLN B N   1 
ATOM   3287 C CA  . GLN D 1 7   ? 51.620  41.039 -1.599  1.00 67.94 ? 95  GLN B CA  1 
ATOM   3288 C C   . GLN D 1 7   ? 51.464  41.986 -0.426  1.00 67.60 ? 95  GLN B C   1 
ATOM   3289 O O   . GLN D 1 7   ? 50.682  42.927 -0.482  1.00 67.72 ? 95  GLN B O   1 
ATOM   3290 C CB  . GLN D 1 7   ? 51.088  39.686 -1.150  1.00 67.97 ? 95  GLN B CB  1 
ATOM   3291 C CG  . GLN D 1 7   ? 50.619  38.766 -2.234  1.00 67.99 ? 95  GLN B CG  1 
ATOM   3292 C CD  . GLN D 1 7   ? 49.974  37.524 -1.646  1.00 68.29 ? 95  GLN B CD  1 
ATOM   3293 O OE1 . GLN D 1 7   ? 50.646  36.697 -1.021  1.00 68.48 ? 95  GLN B OE1 1 
ATOM   3294 N NE2 . GLN D 1 7   ? 48.663  37.397 -1.819  1.00 67.84 ? 95  GLN B NE2 1 
ATOM   3295 N N   . LEU D 1 8   ? 52.206  41.714 0.642   1.00 67.15 ? 96  LEU B N   1 
ATOM   3296 C CA  . LEU D 1 8   ? 52.140  42.513 1.854   1.00 66.67 ? 96  LEU B CA  1 
ATOM   3297 C C   . LEU D 1 8   ? 52.164  44.011 1.569   1.00 66.77 ? 96  LEU B C   1 
ATOM   3298 O O   . LEU D 1 8   ? 51.566  44.794 2.305   1.00 66.65 ? 96  LEU B O   1 
ATOM   3299 C CB  . LEU D 1 8   ? 53.292  42.149 2.792   1.00 66.22 ? 96  LEU B CB  1 
ATOM   3300 C CG  . LEU D 1 8   ? 53.105  42.669 4.218   1.00 65.84 ? 96  LEU B CG  1 
ATOM   3301 C CD1 . LEU D 1 8   ? 51.960  41.898 4.848   1.00 65.24 ? 96  LEU B CD1 1 
ATOM   3302 C CD2 . LEU D 1 8   ? 54.370  42.489 5.039   1.00 65.95 ? 96  LEU B CD2 1 
ATOM   3303 N N   . ASN D 1 9   ? 52.846  44.412 0.499   1.00 67.23 ? 97  ASN B N   1 
ATOM   3304 C CA  . ASN D 1 9   ? 52.928  45.827 0.146   1.00 67.53 ? 97  ASN B CA  1 
ATOM   3305 C C   . ASN D 1 9   ? 51.926  46.247 -0.929  1.00 67.69 ? 97  ASN B C   1 
ATOM   3306 O O   . ASN D 1 9   ? 52.035  47.328 -1.510  1.00 68.04 ? 97  ASN B O   1 
ATOM   3307 C CB  . ASN D 1 9   ? 54.348  46.164 -0.295  1.00 67.44 ? 97  ASN B CB  1 
ATOM   3308 C CG  . ASN D 1 9   ? 55.359  45.884 0.790   1.00 67.94 ? 97  ASN B CG  1 
ATOM   3309 O OD1 . ASN D 1 9   ? 55.234  46.387 1.909   1.00 67.85 ? 97  ASN B OD1 1 
ATOM   3310 N ND2 . ASN D 1 9   ? 56.371  45.079 0.470   1.00 68.35 ? 97  ASN B ND2 1 
ATOM   3311 N N   . SER D 1 10  ? 50.941  45.390 -1.173  1.00 67.66 ? 98  SER B N   1 
ATOM   3312 C CA  . SER D 1 10  ? 49.903  45.648 -2.168  1.00 67.79 ? 98  SER B CA  1 
ATOM   3313 C C   . SER D 1 10  ? 48.822  46.584 -1.609  1.00 67.87 ? 98  SER B C   1 
ATOM   3314 O O   . SER D 1 10  ? 48.587  46.613 -0.404  1.00 67.61 ? 98  SER B O   1 
ATOM   3315 C CB  . SER D 1 10  ? 49.275  44.315 -2.605  1.00 67.50 ? 98  SER B CB  1 
ATOM   3316 O OG  . SER D 1 10  ? 48.228  44.497 -3.543  1.00 67.09 ? 98  SER B OG  1 
ATOM   3317 N N   . ASP D 1 11  ? 48.183  47.358 -2.486  1.00 68.17 ? 99  ASP B N   1 
ATOM   3318 C CA  . ASP D 1 11  ? 47.115  48.272 -2.072  1.00 68.48 ? 99  ASP B CA  1 
ATOM   3319 C C   . ASP D 1 11  ? 45.846  47.475 -1.839  1.00 68.37 ? 99  ASP B C   1 
ATOM   3320 O O   . ASP D 1 11  ? 44.928  47.922 -1.152  1.00 67.92 ? 99  ASP B O   1 
ATOM   3321 C CB  . ASP D 1 11  ? 46.838  49.321 -3.149  1.00 69.23 ? 99  ASP B CB  1 
ATOM   3322 C CG  . ASP D 1 11  ? 47.939  50.346 -3.261  1.00 70.51 ? 99  ASP B CG  1 
ATOM   3323 O OD1 . ASP D 1 11  ? 48.222  51.017 -2.245  1.00 71.53 ? 99  ASP B OD1 1 
ATOM   3324 O OD2 . ASP D 1 11  ? 48.515  50.487 -4.363  1.00 71.26 ? 99  ASP B OD2 1 
ATOM   3325 N N   . ASP D 1 12  ? 45.807  46.285 -2.425  1.00 68.52 ? 100 ASP B N   1 
ATOM   3326 C CA  . ASP D 1 12  ? 44.658  45.401 -2.309  1.00 68.60 ? 100 ASP B CA  1 
ATOM   3327 C C   . ASP D 1 12  ? 44.536  44.804 -0.904  1.00 68.14 ? 100 ASP B C   1 
ATOM   3328 O O   . ASP D 1 12  ? 45.364  43.997 -0.477  1.00 67.89 ? 100 ASP B O   1 
ATOM   3329 C CB  . ASP D 1 12  ? 44.768  44.269 -3.338  1.00 69.57 ? 100 ASP B CB  1 
ATOM   3330 C CG  . ASP D 1 12  ? 43.503  43.440 -3.423  1.00 70.29 ? 100 ASP B CG  1 
ATOM   3331 O OD1 . ASP D 1 12  ? 43.058  42.931 -2.373  1.00 70.68 ? 100 ASP B OD1 1 
ATOM   3332 O OD2 . ASP D 1 12  ? 42.953  43.295 -4.539  1.00 70.75 ? 100 ASP B OD2 1 
ATOM   3333 N N   . MET D 1 13  ? 43.493  45.210 -0.195  1.00 67.49 ? 101 MET B N   1 
ATOM   3334 C CA  . MET D 1 13  ? 43.228  44.727 1.157   1.00 66.91 ? 101 MET B CA  1 
ATOM   3335 C C   . MET D 1 13  ? 43.398  43.216 1.304   1.00 65.98 ? 101 MET B C   1 
ATOM   3336 O O   . MET D 1 13  ? 44.208  42.730 2.092   1.00 66.03 ? 101 MET B O   1 
ATOM   3337 C CB  . MET D 1 13  ? 41.804  45.104 1.540   1.00 68.07 ? 101 MET B CB  1 
ATOM   3338 C CG  . MET D 1 13  ? 41.313  44.596 2.887   1.00 69.77 ? 101 MET B CG  1 
ATOM   3339 S SD  . MET D 1 13  ? 42.099  45.295 4.336   1.00 71.74 ? 101 MET B SD  1 
ATOM   3340 C CE  . MET D 1 13  ? 43.734  44.576 4.228   1.00 71.32 ? 101 MET B CE  1 
ATOM   3341 N N   . GLN D 1 14  ? 42.613  42.481 0.535   1.00 64.70 ? 102 GLN B N   1 
ATOM   3342 C CA  . GLN D 1 14  ? 42.628  41.029 0.558   1.00 63.29 ? 102 GLN B CA  1 
ATOM   3343 C C   . GLN D 1 14  ? 44.033  40.418 0.424   1.00 62.57 ? 102 GLN B C   1 
ATOM   3344 O O   . GLN D 1 14  ? 44.379  39.503 1.175   1.00 62.34 ? 102 GLN B O   1 
ATOM   3345 C CB  . GLN D 1 14  ? 41.678  40.527 -0.533  1.00 63.05 ? 102 GLN B CB  1 
ATOM   3346 C CG  . GLN D 1 14  ? 41.438  39.042 -0.560  1.00 62.93 ? 102 GLN B CG  1 
ATOM   3347 C CD  . GLN D 1 14  ? 40.247  38.688 -1.423  1.00 62.95 ? 102 GLN B CD  1 
ATOM   3348 O OE1 . GLN D 1 14  ? 39.949  37.511 -1.642  1.00 63.34 ? 102 GLN B OE1 1 
ATOM   3349 N NE2 . GLN D 1 14  ? 39.546  39.711 -1.912  1.00 62.31 ? 102 GLN B NE2 1 
ATOM   3350 N N   . GLU D 1 15  ? 44.844  40.914 -0.512  1.00 61.55 ? 103 GLU B N   1 
ATOM   3351 C CA  . GLU D 1 15  ? 46.199  40.382 -0.682  1.00 60.47 ? 103 GLU B CA  1 
ATOM   3352 C C   . GLU D 1 15  ? 47.078  40.651 0.547   1.00 59.65 ? 103 GLU B C   1 
ATOM   3353 O O   . GLU D 1 15  ? 48.030  39.906 0.802   1.00 59.77 ? 103 GLU B O   1 
ATOM   3354 C CB  . GLU D 1 15  ? 46.875  40.970 -1.938  1.00 60.42 ? 103 GLU B CB  1 
ATOM   3355 C CG  . GLU D 1 15  ? 46.344  40.449 -3.269  1.00 59.58 ? 103 GLU B CG  1 
ATOM   3356 N N   . GLN D 1 16  ? 46.746  41.704 1.302   1.00 58.32 ? 104 GLN B N   1 
ATOM   3357 C CA  . GLN D 1 16  ? 47.498  42.097 2.500   1.00 56.88 ? 104 GLN B CA  1 
ATOM   3358 C C   . GLN D 1 16  ? 47.227  41.142 3.646   1.00 56.24 ? 104 GLN B C   1 
ATOM   3359 O O   . GLN D 1 16  ? 48.143  40.744 4.376   1.00 56.62 ? 104 GLN B O   1 
ATOM   3360 C CB  . GLN D 1 16  ? 47.113  43.507 2.957   1.00 56.06 ? 104 GLN B CB  1 
ATOM   3361 C CG  . GLN D 1 16  ? 47.238  44.569 1.896   1.00 56.15 ? 104 GLN B CG  1 
ATOM   3362 C CD  . GLN D 1 16  ? 46.975  45.957 2.440   1.00 55.72 ? 104 GLN B CD  1 
ATOM   3363 O OE1 . GLN D 1 16  ? 45.989  46.184 3.130   1.00 55.02 ? 104 GLN B OE1 1 
ATOM   3364 N NE2 . GLN D 1 16  ? 47.853  46.899 2.116   1.00 56.21 ? 104 GLN B NE2 1 
ATOM   3365 N N   . LEU D 1 17  ? 45.956  40.793 3.809   1.00 54.71 ? 105 LEU B N   1 
ATOM   3366 C CA  . LEU D 1 17  ? 45.541  39.884 4.864   1.00 53.04 ? 105 LEU B CA  1 
ATOM   3367 C C   . LEU D 1 17  ? 46.087  38.484 4.611   1.00 52.03 ? 105 LEU B C   1 
ATOM   3368 O O   . LEU D 1 17  ? 46.393  37.745 5.545   1.00 51.71 ? 105 LEU B O   1 
ATOM   3369 C CB  . LEU D 1 17  ? 44.018  39.843 4.942   1.00 53.12 ? 105 LEU B CB  1 
ATOM   3370 C CG  . LEU D 1 17  ? 43.451  38.874 5.982   1.00 53.10 ? 105 LEU B CG  1 
ATOM   3371 C CD1 . LEU D 1 17  ? 43.898  39.294 7.368   1.00 53.35 ? 105 LEU B CD1 1 
ATOM   3372 C CD2 . LEU D 1 17  ? 41.943  38.861 5.895   1.00 53.27 ? 105 LEU B CD2 1 
ATOM   3373 N N   . SER D 1 18  ? 46.196  38.128 3.337   1.00 51.07 ? 106 SER B N   1 
ATOM   3374 C CA  . SER D 1 18  ? 46.715  36.833 2.934   1.00 50.15 ? 106 SER B CA  1 
ATOM   3375 C C   . SER D 1 18  ? 48.206  36.759 3.279   1.00 49.62 ? 106 SER B C   1 
ATOM   3376 O O   . SER D 1 18  ? 48.706  35.722 3.722   1.00 49.75 ? 106 SER B O   1 
ATOM   3377 C CB  . SER D 1 18  ? 46.512  36.654 1.428   1.00 50.39 ? 106 SER B CB  1 
ATOM   3378 O OG  . SER D 1 18  ? 47.087  35.445 0.968   1.00 52.09 ? 106 SER B OG  1 
ATOM   3379 N N   . ALA D 1 19  ? 48.910  37.867 3.083   1.00 48.30 ? 107 ALA B N   1 
ATOM   3380 C CA  . ALA D 1 19  ? 50.334  37.914 3.367   1.00 47.46 ? 107 ALA B CA  1 
ATOM   3381 C C   . ALA D 1 19  ? 50.615  37.941 4.870   1.00 46.69 ? 107 ALA B C   1 
ATOM   3382 O O   . ALA D 1 19  ? 51.519  37.255 5.350   1.00 46.35 ? 107 ALA B O   1 
ATOM   3383 C CB  . ALA D 1 19  ? 50.963  39.135 2.681   1.00 47.41 ? 107 ALA B CB  1 
ATOM   3384 N N   . THR D 1 20  ? 49.845  38.726 5.616   1.00 46.03 ? 108 THR B N   1 
ATOM   3385 C CA  . THR D 1 20  ? 50.058  38.815 7.057   1.00 45.48 ? 108 THR B CA  1 
ATOM   3386 C C   . THR D 1 20  ? 49.799  37.471 7.699   1.00 44.85 ? 108 THR B C   1 
ATOM   3387 O O   . THR D 1 20  ? 50.413  37.137 8.707   1.00 44.60 ? 108 THR B O   1 
ATOM   3388 C CB  . THR D 1 20  ? 49.137  39.856 7.731   1.00 45.45 ? 108 THR B CB  1 
ATOM   3389 O OG1 . THR D 1 20  ? 49.328  41.134 7.119   1.00 46.40 ? 108 THR B OG1 1 
ATOM   3390 C CG2 . THR D 1 20  ? 49.474  39.978 9.217   1.00 45.14 ? 108 THR B CG2 1 
ATOM   3391 N N   . VAL D 1 21  ? 48.877  36.711 7.118   1.00 44.37 ? 109 VAL B N   1 
ATOM   3392 C CA  . VAL D 1 21  ? 48.555  35.397 7.644   1.00 44.84 ? 109 VAL B CA  1 
ATOM   3393 C C   . VAL D 1 21  ? 49.696  34.440 7.353   1.00 45.71 ? 109 VAL B C   1 
ATOM   3394 O O   . VAL D 1 21  ? 50.133  33.702 8.242   1.00 46.15 ? 109 VAL B O   1 
ATOM   3395 C CB  . VAL D 1 21  ? 47.267  34.830 7.030   1.00 44.96 ? 109 VAL B CB  1 
ATOM   3396 C CG1 . VAL D 1 21  ? 47.095  33.373 7.449   1.00 44.45 ? 109 VAL B CG1 1 
ATOM   3397 C CG2 . VAL D 1 21  ? 46.071  35.641 7.501   1.00 44.46 ? 109 VAL B CG2 1 
ATOM   3398 N N   . LYS D 1 22  ? 50.174  34.450 6.110   1.00 45.88 ? 110 LYS B N   1 
ATOM   3399 C CA  . LYS D 1 22  ? 51.286  33.595 5.723   1.00 45.95 ? 110 LYS B CA  1 
ATOM   3400 C C   . LYS D 1 22  ? 52.501  33.942 6.591   1.00 46.12 ? 110 LYS B C   1 
ATOM   3401 O O   . LYS D 1 22  ? 53.151  33.051 7.137   1.00 45.83 ? 110 LYS B O   1 
ATOM   3402 C CB  . LYS D 1 22  ? 51.620  33.786 4.236   1.00 46.03 ? 110 LYS B CB  1 
ATOM   3403 C CG  . LYS D 1 22  ? 50.554  33.286 3.268   1.00 45.19 ? 110 LYS B CG  1 
ATOM   3404 N N   . PHE D 1 23  ? 52.800  35.234 6.727   1.00 46.27 ? 111 PHE B N   1 
ATOM   3405 C CA  . PHE D 1 23  ? 53.933  35.655 7.545   1.00 46.62 ? 111 PHE B CA  1 
ATOM   3406 C C   . PHE D 1 23  ? 53.805  35.174 8.981   1.00 46.82 ? 111 PHE B C   1 
ATOM   3407 O O   . PHE D 1 23  ? 54.767  34.675 9.571   1.00 46.77 ? 111 PHE B O   1 
ATOM   3408 C CB  . PHE D 1 23  ? 54.101  37.178 7.532   1.00 46.24 ? 111 PHE B CB  1 
ATOM   3409 C CG  . PHE D 1 23  ? 55.009  37.677 6.445   1.00 46.70 ? 111 PHE B CG  1 
ATOM   3410 C CD1 . PHE D 1 23  ? 56.383  37.477 6.539   1.00 46.97 ? 111 PHE B CD1 1 
ATOM   3411 C CD2 . PHE D 1 23  ? 54.504  38.328 5.324   1.00 46.27 ? 111 PHE B CD2 1 
ATOM   3412 C CE1 . PHE D 1 23  ? 57.246  37.926 5.533   1.00 47.59 ? 111 PHE B CE1 1 
ATOM   3413 C CE2 . PHE D 1 23  ? 55.360  38.780 4.312   1.00 46.44 ? 111 PHE B CE2 1 
ATOM   3414 C CZ  . PHE D 1 23  ? 56.734  38.578 4.417   1.00 46.67 ? 111 PHE B CZ  1 
ATOM   3415 N N   . ARG D 1 24  ? 52.612  35.309 9.542   1.00 46.95 ? 112 ARG B N   1 
ATOM   3416 C CA  . ARG D 1 24  ? 52.401  34.887 10.910  1.00 47.18 ? 112 ARG B CA  1 
ATOM   3417 C C   . ARG D 1 24  ? 52.497  33.369 11.049  1.00 47.91 ? 112 ARG B C   1 
ATOM   3418 O O   . ARG D 1 24  ? 52.928  32.857 12.077  1.00 48.02 ? 112 ARG B O   1 
ATOM   3419 C CB  . ARG D 1 24  ? 51.060  35.409 11.402  1.00 46.43 ? 112 ARG B CB  1 
ATOM   3420 C CG  . ARG D 1 24  ? 50.750  35.038 12.833  1.00 46.84 ? 112 ARG B CG  1 
ATOM   3421 C CD  . ARG D 1 24  ? 50.106  33.673 12.900  1.00 46.40 ? 112 ARG B CD  1 
ATOM   3422 N NE  . ARG D 1 24  ? 48.849  33.699 12.163  1.00 47.71 ? 112 ARG B NE  1 
ATOM   3423 C CZ  . ARG D 1 24  ? 48.034  32.658 12.003  1.00 47.70 ? 112 ARG B CZ  1 
ATOM   3424 N NH1 . ARG D 1 24  ? 48.332  31.482 12.532  1.00 47.67 ? 112 ARG B NH1 1 
ATOM   3425 N NH2 . ARG D 1 24  ? 46.913  32.794 11.307  1.00 47.38 ? 112 ARG B NH2 1 
ATOM   3426 N N   . GLN D 1 25  ? 52.109  32.647 10.010  1.00 48.47 ? 113 GLN B N   1 
ATOM   3427 C CA  . GLN D 1 25  ? 52.186  31.196 10.043  1.00 48.75 ? 113 GLN B CA  1 
ATOM   3428 C C   . GLN D 1 25  ? 53.613  30.670 10.204  1.00 49.12 ? 113 GLN B C   1 
ATOM   3429 O O   . GLN D 1 25  ? 53.855  29.794 11.035  1.00 49.53 ? 113 GLN B O   1 
ATOM   3430 C CB  . GLN D 1 25  ? 51.572  30.606 8.776   1.00 48.71 ? 113 GLN B CB  1 
ATOM   3431 C CG  . GLN D 1 25  ? 50.058  30.574 8.776   1.00 49.21 ? 113 GLN B CG  1 
ATOM   3432 C CD  . GLN D 1 25  ? 49.480  30.174 7.429   1.00 49.20 ? 113 GLN B CD  1 
ATOM   3433 O OE1 . GLN D 1 25  ? 48.283  29.948 7.304   1.00 49.97 ? 113 GLN B OE1 1 
ATOM   3434 N NE2 . GLN D 1 25  ? 50.328  30.102 6.412   1.00 49.82 ? 113 GLN B NE2 1 
ATOM   3435 N N   . ILE D 1 26  ? 54.556  31.195 9.421   1.00 49.04 ? 114 ILE B N   1 
ATOM   3436 C CA  . ILE D 1 26  ? 55.937  30.725 9.500   1.00 48.86 ? 114 ILE B CA  1 
ATOM   3437 C C   . ILE D 1 26  ? 56.690  31.205 10.732  1.00 49.48 ? 114 ILE B C   1 
ATOM   3438 O O   . ILE D 1 26  ? 57.837  30.817 10.953  1.00 50.19 ? 114 ILE B O   1 
ATOM   3439 C CB  . ILE D 1 26  ? 56.776  31.101 8.238   1.00 48.15 ? 114 ILE B CB  1 
ATOM   3440 C CG1 . ILE D 1 26  ? 56.963  32.615 8.139   1.00 47.33 ? 114 ILE B CG1 1 
ATOM   3441 C CG2 . ILE D 1 26  ? 56.101  30.558 6.993   1.00 47.98 ? 114 ILE B CG2 1 
ATOM   3442 C CD1 . ILE D 1 26  ? 57.860  33.037 6.993   1.00 46.20 ? 114 ILE B CD1 1 
ATOM   3443 N N   . LEU D 1 27  ? 56.070  32.061 11.534  1.00 49.97 ? 115 LEU B N   1 
ATOM   3444 C CA  . LEU D 1 27  ? 56.723  32.513 12.758  1.00 50.73 ? 115 LEU B CA  1 
ATOM   3445 C C   . LEU D 1 27  ? 56.099  31.724 13.902  1.00 51.92 ? 115 LEU B C   1 
ATOM   3446 O O   . LEU D 1 27  ? 56.514  31.832 15.053  1.00 51.36 ? 115 LEU B O   1 
ATOM   3447 C CB  . LEU D 1 27  ? 56.512  34.013 12.967  1.00 50.13 ? 115 LEU B CB  1 
ATOM   3448 C CG  . LEU D 1 27  ? 57.182  34.948 11.956  1.00 49.93 ? 115 LEU B CG  1 
ATOM   3449 C CD1 . LEU D 1 27  ? 56.802  36.364 12.292  1.00 49.85 ? 115 LEU B CD1 1 
ATOM   3450 C CD2 . LEU D 1 27  ? 58.701  34.784 11.982  1.00 49.78 ? 115 LEU B CD2 1 
ATOM   3451 N N   . SER D 1 28  ? 55.101  30.914 13.548  1.00 53.92 ? 116 SER B N   1 
ATOM   3452 C CA  . SER D 1 28  ? 54.364  30.082 14.491  1.00 56.24 ? 116 SER B CA  1 
ATOM   3453 C C   . SER D 1 28  ? 54.626  28.590 14.336  1.00 57.96 ? 116 SER B C   1 
ATOM   3454 O O   . SER D 1 28  ? 53.846  27.770 14.834  1.00 57.66 ? 116 SER B O   1 
ATOM   3455 C CB  . SER D 1 28  ? 52.866  30.327 14.348  1.00 56.04 ? 116 SER B CB  1 
ATOM   3456 O OG  . SER D 1 28  ? 52.537  31.646 14.727  1.00 57.50 ? 116 SER B OG  1 
ATOM   3457 N N   . ARG D 1 29  ? 55.705  28.240 13.634  1.00 60.36 ? 117 ARG B N   1 
ATOM   3458 C CA  . ARG D 1 29  ? 56.073  26.836 13.440  1.00 62.21 ? 117 ARG B CA  1 
ATOM   3459 C C   . ARG D 1 29  ? 56.295  26.241 14.819  1.00 62.53 ? 117 ARG B C   1 
ATOM   3460 O O   . ARG D 1 29  ? 56.191  26.934 15.833  1.00 63.10 ? 117 ARG B O   1 
ATOM   3461 C CB  . ARG D 1 29  ? 57.404  26.685 12.699  1.00 63.51 ? 117 ARG B CB  1 
ATOM   3462 C CG  . ARG D 1 29  ? 57.511  27.252 11.305  1.00 66.12 ? 117 ARG B CG  1 
ATOM   3463 C CD  . ARG D 1 29  ? 58.936  26.982 10.800  1.00 68.06 ? 117 ARG B CD  1 
ATOM   3464 N NE  . ARG D 1 29  ? 59.215  27.562 9.487   1.00 70.01 ? 117 ARG B NE  1 
ATOM   3465 C CZ  . ARG D 1 29  ? 60.384  27.451 8.858   1.00 71.28 ? 117 ARG B CZ  1 
ATOM   3466 N NH1 . ARG D 1 29  ? 61.380  26.782 9.425   1.00 72.18 ? 117 ARG B NH1 1 
ATOM   3467 N NH2 . ARG D 1 29  ? 60.559  27.998 7.659   1.00 71.55 ? 117 ARG B NH2 1 
ATOM   3468 N N   . GLU D 1 30  ? 56.623  24.956 14.848  1.00 62.57 ? 118 GLU B N   1 
ATOM   3469 C CA  . GLU D 1 30  ? 56.909  24.282 16.100  1.00 62.50 ? 118 GLU B CA  1 
ATOM   3470 C C   . GLU D 1 30  ? 58.424  24.333 16.244  1.00 62.45 ? 118 GLU B C   1 
ATOM   3471 O O   . GLU D 1 30  ? 58.950  24.358 17.353  1.00 62.88 ? 118 GLU B O   1 
ATOM   3472 C CB  . GLU D 1 30  ? 56.431  22.825 16.059  1.00 62.31 ? 118 GLU B CB  1 
ATOM   3473 N N   . HIS D 1 31  ? 59.113  24.381 15.105  1.00 62.23 ? 119 HIS B N   1 
ATOM   3474 C CA  . HIS D 1 31  ? 60.576  24.410 15.068  1.00 62.05 ? 119 HIS B CA  1 
ATOM   3475 C C   . HIS D 1 31  ? 61.229  25.805 15.145  1.00 61.67 ? 119 HIS B C   1 
ATOM   3476 O O   . HIS D 1 31  ? 60.697  26.721 15.776  1.00 61.99 ? 119 HIS B O   1 
ATOM   3477 C CB  . HIS D 1 31  ? 61.067  23.679 13.815  1.00 62.12 ? 119 HIS B CB  1 
ATOM   3478 N N   . ARG D 1 32  ? 62.388  25.949 14.505  1.00 60.63 ? 120 ARG B N   1 
ATOM   3479 C CA  . ARG D 1 32  ? 63.130  27.204 14.510  1.00 59.62 ? 120 ARG B CA  1 
ATOM   3480 C C   . ARG D 1 32  ? 62.519  28.246 13.585  1.00 58.94 ? 120 ARG B C   1 
ATOM   3481 O O   . ARG D 1 32  ? 62.644  28.157 12.361  1.00 59.34 ? 120 ARG B O   1 
ATOM   3482 C CB  . ARG D 1 32  ? 64.579  26.952 14.116  1.00 59.63 ? 120 ARG B CB  1 
ATOM   3483 N N   . PRO D 1 33  ? 61.850  29.257 14.161  1.00 57.71 ? 121 PRO B N   1 
ATOM   3484 C CA  . PRO D 1 33  ? 61.211  30.326 13.397  1.00 56.46 ? 121 PRO B CA  1 
ATOM   3485 C C   . PRO D 1 33  ? 62.241  31.208 12.709  1.00 55.43 ? 121 PRO B C   1 
ATOM   3486 O O   . PRO D 1 33  ? 63.113  31.786 13.352  1.00 55.72 ? 121 PRO B O   1 
ATOM   3487 C CB  . PRO D 1 33  ? 60.441  31.079 14.470  1.00 56.87 ? 121 PRO B CB  1 
ATOM   3488 C CG  . PRO D 1 33  ? 61.382  30.960 15.649  1.00 57.19 ? 121 PRO B CG  1 
ATOM   3489 C CD  . PRO D 1 33  ? 61.618  29.467 15.600  1.00 57.55 ? 121 PRO B CD  1 
ATOM   3490 N N   . PRO D 1 34  ? 62.158  31.310 11.381  1.00 54.45 ? 122 PRO B N   1 
ATOM   3491 C CA  . PRO D 1 34  ? 63.079  32.126 10.592  1.00 53.27 ? 122 PRO B CA  1 
ATOM   3492 C C   . PRO D 1 34  ? 62.878  33.605 10.875  1.00 52.06 ? 122 PRO B C   1 
ATOM   3493 O O   . PRO D 1 34  ? 62.419  34.337 10.006  1.00 51.80 ? 122 PRO B O   1 
ATOM   3494 C CB  . PRO D 1 34  ? 62.682  31.770 9.167   1.00 53.72 ? 122 PRO B CB  1 
ATOM   3495 C CG  . PRO D 1 34  ? 61.180  31.583 9.320   1.00 54.43 ? 122 PRO B CG  1 
ATOM   3496 C CD  . PRO D 1 34  ? 61.197  30.636 10.495  1.00 54.41 ? 122 PRO B CD  1 
ATOM   3497 N N   . ILE D 1 35  ? 63.225  34.047 12.080  1.00 51.21 ? 123 ILE B N   1 
ATOM   3498 C CA  . ILE D 1 35  ? 63.053  35.453 12.443  1.00 50.68 ? 123 ILE B CA  1 
ATOM   3499 C C   . ILE D 1 35  ? 63.909  36.414 11.627  1.00 51.25 ? 123 ILE B C   1 
ATOM   3500 O O   . ILE D 1 35  ? 63.392  37.377 11.055  1.00 50.57 ? 123 ILE B O   1 
ATOM   3501 C CB  . ILE D 1 35  ? 63.328  35.687 13.943  1.00 49.54 ? 123 ILE B CB  1 
ATOM   3502 C CG1 . ILE D 1 35  ? 62.315  34.888 14.765  1.00 48.83 ? 123 ILE B CG1 1 
ATOM   3503 C CG2 . ILE D 1 35  ? 63.255  37.182 14.269  1.00 48.55 ? 123 ILE B CG2 1 
ATOM   3504 C CD1 . ILE D 1 35  ? 62.449  35.051 16.252  1.00 48.84 ? 123 ILE B CD1 1 
ATOM   3505 N N   . ASP D 1 36  ? 65.215  36.161 11.566  1.00 52.18 ? 124 ASP B N   1 
ATOM   3506 C CA  . ASP D 1 36  ? 66.085  37.046 10.801  1.00 52.75 ? 124 ASP B CA  1 
ATOM   3507 C C   . ASP D 1 36  ? 65.659  37.181 9.346   1.00 52.76 ? 124 ASP B C   1 
ATOM   3508 O O   . ASP D 1 36  ? 65.609  38.291 8.813   1.00 52.58 ? 124 ASP B O   1 
ATOM   3509 C CB  . ASP D 1 36  ? 67.550  36.600 10.886  1.00 53.13 ? 124 ASP B CB  1 
ATOM   3510 C CG  . ASP D 1 36  ? 68.226  37.071 12.166  1.00 53.68 ? 124 ASP B CG  1 
ATOM   3511 O OD1 . ASP D 1 36  ? 68.132  38.286 12.476  1.00 53.35 ? 124 ASP B OD1 1 
ATOM   3512 O OD2 . ASP D 1 36  ? 68.862  36.241 12.852  1.00 53.70 ? 124 ASP B OD2 1 
ATOM   3513 N N   . VAL D 1 37  ? 65.339  36.066 8.702   1.00 52.48 ? 125 VAL B N   1 
ATOM   3514 C CA  . VAL D 1 37  ? 64.919  36.131 7.313   1.00 52.31 ? 125 VAL B CA  1 
ATOM   3515 C C   . VAL D 1 37  ? 63.799  37.158 7.145   1.00 52.14 ? 125 VAL B C   1 
ATOM   3516 O O   . VAL D 1 37  ? 63.881  38.048 6.300   1.00 51.69 ? 125 VAL B O   1 
ATOM   3517 C CB  . VAL D 1 37  ? 64.397  34.782 6.816   1.00 52.61 ? 125 VAL B CB  1 
ATOM   3518 C CG1 . VAL D 1 37  ? 64.080  34.883 5.333   1.00 52.53 ? 125 VAL B CG1 1 
ATOM   3519 C CG2 . VAL D 1 37  ? 65.420  33.687 7.080   1.00 53.21 ? 125 VAL B CG2 1 
ATOM   3520 N N   . VAL D 1 38  ? 62.757  37.027 7.965   1.00 52.06 ? 126 VAL B N   1 
ATOM   3521 C CA  . VAL D 1 38  ? 61.602  37.921 7.916   1.00 51.87 ? 126 VAL B CA  1 
ATOM   3522 C C   . VAL D 1 38  ? 61.995  39.370 8.145   1.00 52.14 ? 126 VAL B C   1 
ATOM   3523 O O   . VAL D 1 38  ? 61.519  40.271 7.453   1.00 52.36 ? 126 VAL B O   1 
ATOM   3524 C CB  . VAL D 1 38  ? 60.540  37.525 8.965   1.00 51.59 ? 126 VAL B CB  1 
ATOM   3525 C CG1 . VAL D 1 38  ? 59.375  38.494 8.928   1.00 51.35 ? 126 VAL B CG1 1 
ATOM   3526 C CG2 . VAL D 1 38  ? 60.040  36.123 8.689   1.00 51.22 ? 126 VAL B CG2 1 
ATOM   3527 N N   . ILE D 1 39  ? 62.853  39.602 9.127   1.00 52.54 ? 127 ILE B N   1 
ATOM   3528 C CA  . ILE D 1 39  ? 63.300  40.960 9.404   1.00 52.82 ? 127 ILE B CA  1 
ATOM   3529 C C   . ILE D 1 39  ? 63.994  41.508 8.158   1.00 53.05 ? 127 ILE B C   1 
ATOM   3530 O O   . ILE D 1 39  ? 63.748  42.644 7.750   1.00 52.94 ? 127 ILE B O   1 
ATOM   3531 C CB  . ILE D 1 39  ? 64.298  40.987 10.573  1.00 52.66 ? 127 ILE B CB  1 
ATOM   3532 C CG1 . ILE D 1 39  ? 63.638  40.405 11.828  1.00 52.45 ? 127 ILE B CG1 1 
ATOM   3533 C CG2 . ILE D 1 39  ? 64.795  42.410 10.785  1.00 52.70 ? 127 ILE B CG2 1 
ATOM   3534 C CD1 . ILE D 1 39  ? 64.548  40.320 13.037  1.00 52.17 ? 127 ILE B CD1 1 
ATOM   3535 N N   . GLN D 1 40  ? 64.855  40.679 7.563   1.00 53.50 ? 128 GLN B N   1 
ATOM   3536 C CA  . GLN D 1 40  ? 65.620  41.033 6.365   1.00 53.57 ? 128 GLN B CA  1 
ATOM   3537 C C   . GLN D 1 40  ? 64.768  41.402 5.150   1.00 52.87 ? 128 GLN B C   1 
ATOM   3538 O O   . GLN D 1 40  ? 65.203  42.183 4.301   1.00 53.07 ? 128 GLN B O   1 
ATOM   3539 C CB  . GLN D 1 40  ? 66.581  39.893 6.002   1.00 54.64 ? 128 GLN B CB  1 
ATOM   3540 C CG  . GLN D 1 40  ? 67.882  39.895 6.802   1.00 56.05 ? 128 GLN B CG  1 
ATOM   3541 C CD  . GLN D 1 40  ? 68.638  38.576 6.701   1.00 57.24 ? 128 GLN B CD  1 
ATOM   3542 O OE1 . GLN D 1 40  ? 68.769  37.993 5.620   1.00 57.38 ? 128 GLN B OE1 1 
ATOM   3543 N NE2 . GLN D 1 40  ? 69.155  38.107 7.835   1.00 57.86 ? 128 GLN B NE2 1 
ATOM   3544 N N   . ALA D 1 41  ? 63.564  40.843 5.058   1.00 51.38 ? 129 ALA B N   1 
ATOM   3545 C CA  . ALA D 1 41  ? 62.672  41.158 3.945   1.00 49.74 ? 129 ALA B CA  1 
ATOM   3546 C C   . ALA D 1 41  ? 62.244  42.616 4.074   1.00 48.78 ? 129 ALA B C   1 
ATOM   3547 O O   . ALA D 1 41  ? 61.679  43.194 3.147   1.00 48.52 ? 129 ALA B O   1 
ATOM   3548 C CB  . ALA D 1 41  ? 61.449  40.248 3.964   1.00 49.33 ? 129 ALA B CB  1 
ATOM   3549 N N   . GLY D 1 42  ? 62.518  43.194 5.242   1.00 47.92 ? 130 GLY B N   1 
ATOM   3550 C CA  . GLY D 1 42  ? 62.182  44.579 5.512   1.00 46.58 ? 130 GLY B CA  1 
ATOM   3551 C C   . GLY D 1 42  ? 60.696  44.833 5.618   1.00 45.97 ? 130 GLY B C   1 
ATOM   3552 O O   . GLY D 1 42  ? 60.207  45.857 5.143   1.00 46.38 ? 130 GLY B O   1 
ATOM   3553 N N   . VAL D 1 43  ? 59.976  43.918 6.260   1.00 45.43 ? 131 VAL B N   1 
ATOM   3554 C CA  . VAL D 1 43  ? 58.526  44.041 6.389   1.00 44.11 ? 131 VAL B CA  1 
ATOM   3555 C C   . VAL D 1 43  ? 57.992  44.479 7.757   1.00 43.60 ? 131 VAL B C   1 
ATOM   3556 O O   . VAL D 1 43  ? 56.846  44.886 7.858   1.00 44.07 ? 131 VAL B O   1 
ATOM   3557 C CB  . VAL D 1 43  ? 57.833  42.713 5.973   1.00 43.94 ? 131 VAL B CB  1 
ATOM   3558 C CG1 . VAL D 1 43  ? 58.140  42.399 4.521   1.00 43.27 ? 131 VAL B CG1 1 
ATOM   3559 C CG2 . VAL D 1 43  ? 58.310  41.570 6.848   1.00 44.48 ? 131 VAL B CG2 1 
ATOM   3560 N N   . VAL D 1 44  ? 58.808  44.410 8.802   1.00 43.45 ? 132 VAL B N   1 
ATOM   3561 C CA  . VAL D 1 44  ? 58.378  44.807 10.148  1.00 42.76 ? 132 VAL B CA  1 
ATOM   3562 C C   . VAL D 1 44  ? 57.624  46.133 10.224  1.00 42.89 ? 132 VAL B C   1 
ATOM   3563 O O   . VAL D 1 44  ? 56.549  46.201 10.803  1.00 42.95 ? 132 VAL B O   1 
ATOM   3564 C CB  . VAL D 1 44  ? 59.577  44.876 11.130  1.00 42.51 ? 132 VAL B CB  1 
ATOM   3565 C CG1 . VAL D 1 44  ? 59.122  45.383 12.484  1.00 42.28 ? 132 VAL B CG1 1 
ATOM   3566 C CG2 . VAL D 1 44  ? 60.210  43.498 11.279  1.00 42.56 ? 132 VAL B CG2 1 
ATOM   3567 N N   . PRO D 1 45  ? 58.174  47.212 9.649   1.00 43.52 ? 133 PRO B N   1 
ATOM   3568 C CA  . PRO D 1 45  ? 57.458  48.494 9.719   1.00 43.68 ? 133 PRO B CA  1 
ATOM   3569 C C   . PRO D 1 45  ? 56.091  48.446 9.029   1.00 43.65 ? 133 PRO B C   1 
ATOM   3570 O O   . PRO D 1 45  ? 55.155  49.156 9.416   1.00 43.50 ? 133 PRO B O   1 
ATOM   3571 C CB  . PRO D 1 45  ? 58.424  49.449 9.023   1.00 43.18 ? 133 PRO B CB  1 
ATOM   3572 C CG  . PRO D 1 45  ? 59.064  48.530 7.985   1.00 43.83 ? 133 PRO B CG  1 
ATOM   3573 C CD  . PRO D 1 45  ? 59.431  47.386 8.901   1.00 43.70 ? 133 PRO B CD  1 
ATOM   3574 N N   . ARG D 1 46  ? 55.995  47.603 8.001   1.00 43.62 ? 134 ARG B N   1 
ATOM   3575 C CA  . ARG D 1 46  ? 54.771  47.435 7.222   1.00 43.09 ? 134 ARG B CA  1 
ATOM   3576 C C   . ARG D 1 46  ? 53.715  46.735 8.054   1.00 43.30 ? 134 ARG B C   1 
ATOM   3577 O O   . ARG D 1 46  ? 52.525  47.015 7.924   1.00 43.31 ? 134 ARG B O   1 
ATOM   3578 C CB  . ARG D 1 46  ? 55.070  46.628 5.957   1.00 43.17 ? 134 ARG B CB  1 
ATOM   3579 C CG  . ARG D 1 46  ? 53.867  46.339 5.074   1.00 43.29 ? 134 ARG B CG  1 
ATOM   3580 C CD  . ARG D 1 46  ? 53.110  47.604 4.683   1.00 42.53 ? 134 ARG B CD  1 
ATOM   3581 N NE  . ARG D 1 46  ? 52.087  47.316 3.676   1.00 42.49 ? 134 ARG B NE  1 
ATOM   3582 C CZ  . ARG D 1 46  ? 51.242  48.214 3.176   1.00 42.83 ? 134 ARG B CZ  1 
ATOM   3583 N NH1 . ARG D 1 46  ? 51.283  49.478 3.592   1.00 42.68 ? 134 ARG B NH1 1 
ATOM   3584 N NH2 . ARG D 1 46  ? 50.371  47.852 2.238   1.00 41.78 ? 134 ARG B NH2 1 
ATOM   3585 N N   . LEU D 1 47  ? 54.159  45.813 8.907   1.00 43.32 ? 135 LEU B N   1 
ATOM   3586 C CA  . LEU D 1 47  ? 53.263  45.075 9.792   1.00 42.83 ? 135 LEU B CA  1 
ATOM   3587 C C   . LEU D 1 47  ? 52.822  45.954 10.954  1.00 43.38 ? 135 LEU B C   1 
ATOM   3588 O O   . LEU D 1 47  ? 51.777  45.715 11.539  1.00 43.50 ? 135 LEU B O   1 
ATOM   3589 C CB  . LEU D 1 47  ? 53.960  43.844 10.355  1.00 41.86 ? 135 LEU B CB  1 
ATOM   3590 C CG  . LEU D 1 47  ? 54.353  42.753 9.369   1.00 41.43 ? 135 LEU B CG  1 
ATOM   3591 C CD1 . LEU D 1 47  ? 55.183  41.709 10.093  1.00 40.71 ? 135 LEU B CD1 1 
ATOM   3592 C CD2 . LEU D 1 47  ? 53.106  42.137 8.758   1.00 40.92 ? 135 LEU B CD2 1 
ATOM   3593 N N   . VAL D 1 48  ? 53.635  46.953 11.291  1.00 44.48 ? 136 VAL B N   1 
ATOM   3594 C CA  . VAL D 1 48  ? 53.333  47.877 12.382  1.00 45.04 ? 136 VAL B CA  1 
ATOM   3595 C C   . VAL D 1 48  ? 52.223  48.817 11.947  1.00 45.74 ? 136 VAL B C   1 
ATOM   3596 O O   . VAL D 1 48  ? 51.499  49.358 12.778  1.00 45.82 ? 136 VAL B O   1 
ATOM   3597 C CB  . VAL D 1 48  ? 54.574  48.725 12.774  1.00 45.00 ? 136 VAL B CB  1 
ATOM   3598 C CG1 . VAL D 1 48  ? 54.229  49.692 13.903  1.00 44.33 ? 136 VAL B CG1 1 
ATOM   3599 C CG2 . VAL D 1 48  ? 55.704  47.818 13.190  1.00 45.11 ? 136 VAL B CG2 1 
ATOM   3600 N N   . GLU D 1 49  ? 52.090  49.016 10.641  1.00 46.48 ? 137 GLU B N   1 
ATOM   3601 C CA  . GLU D 1 49  ? 51.042  49.895 10.138  1.00 47.36 ? 137 GLU B CA  1 
ATOM   3602 C C   . GLU D 1 49  ? 49.696  49.247 10.359  1.00 47.27 ? 137 GLU B C   1 
ATOM   3603 O O   . GLU D 1 49  ? 48.744  49.909 10.761  1.00 47.74 ? 137 GLU B O   1 
ATOM   3604 C CB  . GLU D 1 49  ? 51.189  50.156 8.637   1.00 47.91 ? 137 GLU B CB  1 
ATOM   3605 C CG  . GLU D 1 49  ? 52.365  51.006 8.227   1.00 49.95 ? 137 GLU B CG  1 
ATOM   3606 C CD  . GLU D 1 49  ? 52.454  51.156 6.717   1.00 50.92 ? 137 GLU B CD  1 
ATOM   3607 O OE1 . GLU D 1 49  ? 51.457  51.594 6.100   1.00 51.45 ? 137 GLU B OE1 1 
ATOM   3608 O OE2 . GLU D 1 49  ? 53.523  50.837 6.147   1.00 51.70 ? 137 GLU B OE2 1 
ATOM   3609 N N   . PHE D 1 50  ? 49.625  47.944 10.095  1.00 47.13 ? 138 PHE B N   1 
ATOM   3610 C CA  . PHE D 1 50  ? 48.374  47.200 10.212  1.00 46.74 ? 138 PHE B CA  1 
ATOM   3611 C C   . PHE D 1 50  ? 47.731  47.174 11.596  1.00 47.04 ? 138 PHE B C   1 
ATOM   3612 O O   . PHE D 1 50  ? 46.656  46.604 11.769  1.00 46.57 ? 138 PHE B O   1 
ATOM   3613 C CB  . PHE D 1 50  ? 48.543  45.758 9.704   1.00 45.72 ? 138 PHE B CB  1 
ATOM   3614 C CG  . PHE D 1 50  ? 48.920  45.652 8.245   1.00 45.29 ? 138 PHE B CG  1 
ATOM   3615 C CD1 . PHE D 1 50  ? 48.633  46.679 7.348   1.00 44.82 ? 138 PHE B CD1 1 
ATOM   3616 C CD2 . PHE D 1 50  ? 49.527  44.496 7.759   1.00 45.63 ? 138 PHE B CD2 1 
ATOM   3617 C CE1 . PHE D 1 50  ? 48.942  46.559 5.989   1.00 44.58 ? 138 PHE B CE1 1 
ATOM   3618 C CE2 . PHE D 1 50  ? 49.838  44.363 6.395   1.00 45.57 ? 138 PHE B CE2 1 
ATOM   3619 C CZ  . PHE D 1 50  ? 49.545  45.403 5.511   1.00 45.32 ? 138 PHE B CZ  1 
ATOM   3620 N N   . MET D 1 51  ? 48.373  47.785 12.583  1.00 47.34 ? 139 MET B N   1 
ATOM   3621 C CA  . MET D 1 51  ? 47.801  47.814 13.923  1.00 47.86 ? 139 MET B CA  1 
ATOM   3622 C C   . MET D 1 51  ? 47.210  49.184 14.235  1.00 48.71 ? 139 MET B C   1 
ATOM   3623 O O   . MET D 1 51  ? 46.880  49.483 15.382  1.00 48.87 ? 139 MET B O   1 
ATOM   3624 C CB  . MET D 1 51  ? 48.858  47.468 14.974  1.00 47.63 ? 139 MET B CB  1 
ATOM   3625 C CG  . MET D 1 51  ? 49.394  46.049 14.904  1.00 47.02 ? 139 MET B CG  1 
ATOM   3626 S SD  . MET D 1 51  ? 50.383  45.703 16.372  1.00 47.16 ? 139 MET B SD  1 
ATOM   3627 C CE  . MET D 1 51  ? 51.674  46.988 16.239  1.00 47.17 ? 139 MET B CE  1 
ATOM   3628 N N   . ARG D 1 52  ? 47.084  50.017 13.212  1.00 49.82 ? 140 ARG B N   1 
ATOM   3629 C CA  . ARG D 1 52  ? 46.535  51.349 13.394  1.00 51.41 ? 140 ARG B CA  1 
ATOM   3630 C C   . ARG D 1 52  ? 45.005  51.322 13.557  1.00 51.71 ? 140 ARG B C   1 
ATOM   3631 O O   . ARG D 1 52  ? 44.338  50.344 13.206  1.00 51.33 ? 140 ARG B O   1 
ATOM   3632 C CB  . ARG D 1 52  ? 46.961  52.253 12.216  1.00 52.59 ? 140 ARG B CB  1 
ATOM   3633 C CG  . ARG D 1 52  ? 48.457  52.605 12.222  1.00 54.56 ? 140 ARG B CG  1 
ATOM   3634 C CD  . ARG D 1 52  ? 48.945  53.353 10.968  1.00 55.96 ? 140 ARG B CD  1 
ATOM   3635 N NE  . ARG D 1 52  ? 50.374  53.669 11.087  1.00 58.48 ? 140 ARG B NE  1 
ATOM   3636 C CZ  . ARG D 1 52  ? 51.143  54.173 10.118  1.00 59.22 ? 140 ARG B CZ  1 
ATOM   3637 N NH1 . ARG D 1 52  ? 50.639  54.434 8.914   1.00 58.73 ? 140 ARG B NH1 1 
ATOM   3638 N NH2 . ARG D 1 52  ? 52.428  54.419 10.361  1.00 59.52 ? 140 ARG B NH2 1 
ATOM   3639 N N   . GLU D 1 53  ? 44.468  52.400 14.113  1.00 52.18 ? 141 GLU B N   1 
ATOM   3640 C CA  . GLU D 1 53  ? 43.035  52.564 14.351  1.00 52.64 ? 141 GLU B CA  1 
ATOM   3641 C C   . GLU D 1 53  ? 42.084  52.104 13.222  1.00 52.93 ? 141 GLU B C   1 
ATOM   3642 O O   . GLU D 1 53  ? 41.277  51.194 13.410  1.00 52.20 ? 141 GLU B O   1 
ATOM   3643 C CB  . GLU D 1 53  ? 42.770  54.038 14.689  1.00 52.95 ? 141 GLU B CB  1 
ATOM   3644 C CG  . GLU D 1 53  ? 41.303  54.429 14.820  1.00 53.20 ? 141 GLU B CG  1 
ATOM   3645 N N   . ASN D 1 54  ? 42.180  52.745 12.058  1.00 53.85 ? 142 ASN B N   1 
ATOM   3646 C CA  . ASN D 1 54  ? 41.320  52.434 10.912  1.00 54.62 ? 142 ASN B CA  1 
ATOM   3647 C C   . ASN D 1 54  ? 41.427  51.035 10.291  1.00 54.19 ? 142 ASN B C   1 
ATOM   3648 O O   . ASN D 1 54  ? 40.540  50.619 9.545   1.00 53.86 ? 142 ASN B O   1 
ATOM   3649 C CB  . ASN D 1 54  ? 41.536  53.475 9.800   1.00 56.10 ? 142 ASN B CB  1 
ATOM   3650 C CG  . ASN D 1 54  ? 43.013  53.736 9.511   1.00 57.74 ? 142 ASN B CG  1 
ATOM   3651 O OD1 . ASN D 1 54  ? 43.836  52.812 9.481   1.00 57.89 ? 142 ASN B OD1 1 
ATOM   3652 N ND2 . ASN D 1 54  ? 43.348  55.008 9.271   1.00 59.53 ? 142 ASN B ND2 1 
ATOM   3653 N N   . GLN D 1 55  ? 42.505  50.314 10.586  1.00 54.03 ? 143 GLN B N   1 
ATOM   3654 C CA  . GLN D 1 55  ? 42.712  48.974 10.024  1.00 53.52 ? 143 GLN B CA  1 
ATOM   3655 C C   . GLN D 1 55  ? 41.668  47.925 10.452  1.00 52.85 ? 143 GLN B C   1 
ATOM   3656 O O   . GLN D 1 55  ? 41.167  47.958 11.579  1.00 52.62 ? 143 GLN B O   1 
ATOM   3657 C CB  . GLN D 1 55  ? 44.117  48.475 10.382  1.00 53.57 ? 143 GLN B CB  1 
ATOM   3658 C CG  . GLN D 1 55  ? 45.258  49.269 9.752   1.00 53.62 ? 143 GLN B CG  1 
ATOM   3659 C CD  . GLN D 1 55  ? 45.171  49.332 8.232   1.00 53.41 ? 143 GLN B CD  1 
ATOM   3660 O OE1 . GLN D 1 55  ? 45.042  48.309 7.559   1.00 52.95 ? 143 GLN B OE1 1 
ATOM   3661 N NE2 . GLN D 1 55  ? 45.258  50.541 7.685   1.00 53.70 ? 143 GLN B NE2 1 
ATOM   3662 N N   . PRO D 1 56  ? 41.317  46.985 9.548   1.00 52.27 ? 144 PRO B N   1 
ATOM   3663 C CA  . PRO D 1 56  ? 40.333  45.941 9.867   1.00 51.70 ? 144 PRO B CA  1 
ATOM   3664 C C   . PRO D 1 56  ? 40.852  45.151 11.059  1.00 51.57 ? 144 PRO B C   1 
ATOM   3665 O O   . PRO D 1 56  ? 42.063  44.970 11.218  1.00 51.97 ? 144 PRO B O   1 
ATOM   3666 C CB  . PRO D 1 56  ? 40.288  45.110 8.585   1.00 51.17 ? 144 PRO B CB  1 
ATOM   3667 C CG  . PRO D 1 56  ? 40.589  46.149 7.521   1.00 52.09 ? 144 PRO B CG  1 
ATOM   3668 C CD  . PRO D 1 56  ? 41.799  46.800 8.167   1.00 52.47 ? 144 PRO B CD  1 
ATOM   3669 N N   . GLU D 1 57  ? 39.951  44.666 11.896  1.00 50.99 ? 145 GLU B N   1 
ATOM   3670 C CA  . GLU D 1 57  ? 40.379  43.948 13.083  1.00 51.28 ? 145 GLU B CA  1 
ATOM   3671 C C   . GLU D 1 57  ? 41.166  42.663 12.867  1.00 50.70 ? 145 GLU B C   1 
ATOM   3672 O O   . GLU D 1 57  ? 42.043  42.322 13.663  1.00 51.02 ? 145 GLU B O   1 
ATOM   3673 C CB  . GLU D 1 57  ? 39.187  43.673 13.972  1.00 52.10 ? 145 GLU B CB  1 
ATOM   3674 C CG  . GLU D 1 57  ? 39.536  42.946 15.239  1.00 54.68 ? 145 GLU B CG  1 
ATOM   3675 C CD  . GLU D 1 57  ? 38.522  43.210 16.331  1.00 56.80 ? 145 GLU B CD  1 
ATOM   3676 O OE1 . GLU D 1 57  ? 38.519  44.342 16.885  1.00 57.80 ? 145 GLU B OE1 1 
ATOM   3677 O OE2 . GLU D 1 57  ? 37.714  42.294 16.616  1.00 57.77 ? 145 GLU B OE2 1 
ATOM   3678 N N   . MET D 1 58  ? 40.852  41.947 11.799  1.00 49.74 ? 146 MET B N   1 
ATOM   3679 C CA  . MET D 1 58  ? 41.557  40.710 11.489  1.00 48.23 ? 146 MET B CA  1 
ATOM   3680 C C   . MET D 1 58  ? 43.013  40.990 11.098  1.00 46.82 ? 146 MET B C   1 
ATOM   3681 O O   . MET D 1 58  ? 43.919  40.243 11.461  1.00 46.42 ? 146 MET B O   1 
ATOM   3682 C CB  . MET D 1 58  ? 40.869  39.996 10.331  1.00 49.63 ? 146 MET B CB  1 
ATOM   3683 C CG  . MET D 1 58  ? 41.477  38.656 10.006  1.00 50.79 ? 146 MET B CG  1 
ATOM   3684 S SD  . MET D 1 58  ? 40.906  37.351 11.118  1.00 53.77 ? 146 MET B SD  1 
ATOM   3685 C CE  . MET D 1 58  ? 41.245  38.002 12.775  1.00 53.06 ? 146 MET B CE  1 
ATOM   3686 N N   . LEU D 1 59  ? 43.220  42.069 10.347  1.00 44.93 ? 147 LEU B N   1 
ATOM   3687 C CA  . LEU D 1 59  ? 44.545  42.450 9.900   1.00 42.92 ? 147 LEU B CA  1 
ATOM   3688 C C   . LEU D 1 59  ? 45.364  42.862 11.121  1.00 41.92 ? 147 LEU B C   1 
ATOM   3689 O O   . LEU D 1 59  ? 46.582  42.658 11.154  1.00 42.47 ? 147 LEU B O   1 
ATOM   3690 C CB  . LEU D 1 59  ? 44.452  43.617 8.907   1.00 41.81 ? 147 LEU B CB  1 
ATOM   3691 C CG  . LEU D 1 59  ? 45.706  43.885 8.078   1.00 41.05 ? 147 LEU B CG  1 
ATOM   3692 C CD1 . LEU D 1 59  ? 45.918  42.704 7.144   1.00 40.15 ? 147 LEU B CD1 1 
ATOM   3693 C CD2 . LEU D 1 59  ? 45.565  45.180 7.281   1.00 41.06 ? 147 LEU B CD2 1 
ATOM   3694 N N   . GLN D 1 60  ? 44.690  43.428 12.126  1.00 40.11 ? 148 GLN B N   1 
ATOM   3695 C CA  . GLN D 1 60  ? 45.347  43.889 13.355  1.00 38.24 ? 148 GLN B CA  1 
ATOM   3696 C C   . GLN D 1 60  ? 45.880  42.754 14.184  1.00 37.50 ? 148 GLN B C   1 
ATOM   3697 O O   . GLN D 1 60  ? 47.039  42.757 14.603  1.00 37.23 ? 148 GLN B O   1 
ATOM   3698 C CB  . GLN D 1 60  ? 44.379  44.703 14.214  1.00 37.66 ? 148 GLN B CB  1 
ATOM   3699 C CG  . GLN D 1 60  ? 44.193  46.141 13.771  1.00 36.45 ? 148 GLN B CG  1 
ATOM   3700 C CD  . GLN D 1 60  ? 43.160  46.871 14.602  1.00 35.87 ? 148 GLN B CD  1 
ATOM   3701 O OE1 . GLN D 1 60  ? 43.029  48.087 14.503  1.00 37.35 ? 148 GLN B OE1 1 
ATOM   3702 N NE2 . GLN D 1 60  ? 42.406  46.133 15.411  1.00 34.39 ? 148 GLN B NE2 1 
ATOM   3703 N N   . LEU D 1 61  ? 45.003  41.789 14.422  1.00 36.97 ? 149 LEU B N   1 
ATOM   3704 C CA  . LEU D 1 61  ? 45.304  40.602 15.203  1.00 36.50 ? 149 LEU B CA  1 
ATOM   3705 C C   . LEU D 1 61  ? 46.473  39.828 14.594  1.00 36.61 ? 149 LEU B C   1 
ATOM   3706 O O   . LEU D 1 61  ? 47.471  39.542 15.260  1.00 36.37 ? 149 LEU B O   1 
ATOM   3707 C CB  . LEU D 1 61  ? 44.060  39.722 15.250  1.00 36.47 ? 149 LEU B CB  1 
ATOM   3708 C CG  . LEU D 1 61  ? 44.195  38.390 15.983  1.00 37.48 ? 149 LEU B CG  1 
ATOM   3709 C CD1 . LEU D 1 61  ? 44.468  38.619 17.459  1.00 37.00 ? 149 LEU B CD1 1 
ATOM   3710 C CD2 . LEU D 1 61  ? 42.922  37.600 15.797  1.00 36.85 ? 149 LEU B CD2 1 
ATOM   3711 N N   . GLU D 1 62  ? 46.328  39.484 13.321  1.00 36.54 ? 150 GLU B N   1 
ATOM   3712 C CA  . GLU D 1 62  ? 47.357  38.771 12.588  1.00 36.63 ? 150 GLU B CA  1 
ATOM   3713 C C   . GLU D 1 62  ? 48.703  39.492 12.668  1.00 37.01 ? 150 GLU B C   1 
ATOM   3714 O O   . GLU D 1 62  ? 49.714  38.886 13.023  1.00 36.69 ? 150 GLU B O   1 
ATOM   3715 C CB  . GLU D 1 62  ? 46.949  38.644 11.124  1.00 36.89 ? 150 GLU B CB  1 
ATOM   3716 C CG  . GLU D 1 62  ? 45.790  37.712 10.855  1.00 36.98 ? 150 GLU B CG  1 
ATOM   3717 C CD  . GLU D 1 62  ? 46.122  36.282 11.246  1.00 38.22 ? 150 GLU B CD  1 
ATOM   3718 O OE1 . GLU D 1 62  ? 47.259  35.855 10.963  1.00 38.15 ? 150 GLU B OE1 1 
ATOM   3719 O OE2 . GLU D 1 62  ? 45.258  35.579 11.817  1.00 38.28 ? 150 GLU B OE2 1 
ATOM   3720 N N   . ALA D 1 63  ? 48.712  40.784 12.328  1.00 37.24 ? 151 ALA B N   1 
ATOM   3721 C CA  . ALA D 1 63  ? 49.941  41.569 12.345  1.00 36.84 ? 151 ALA B CA  1 
ATOM   3722 C C   . ALA D 1 63  ? 50.580  41.494 13.717  1.00 36.44 ? 151 ALA B C   1 
ATOM   3723 O O   . ALA D 1 63  ? 51.744  41.123 13.846  1.00 37.42 ? 151 ALA B O   1 
ATOM   3724 C CB  . ALA D 1 63  ? 49.661  43.028 11.966  1.00 36.73 ? 151 ALA B CB  1 
ATOM   3725 N N   . ALA D 1 64  ? 49.816  41.836 14.745  1.00 35.68 ? 152 ALA B N   1 
ATOM   3726 C CA  . ALA D 1 64  ? 50.350  41.799 16.100  1.00 35.18 ? 152 ALA B CA  1 
ATOM   3727 C C   . ALA D 1 64  ? 50.946  40.417 16.427  1.00 34.46 ? 152 ALA B C   1 
ATOM   3728 O O   . ALA D 1 64  ? 52.013  40.315 17.025  1.00 34.24 ? 152 ALA B O   1 
ATOM   3729 C CB  . ALA D 1 64  ? 49.257  42.154 17.096  1.00 34.50 ? 152 ALA B CB  1 
ATOM   3730 N N   . TRP D 1 65  ? 50.260  39.358 16.011  1.00 33.41 ? 153 TRP B N   1 
ATOM   3731 C CA  . TRP D 1 65  ? 50.712  37.986 16.268  1.00 32.07 ? 153 TRP B CA  1 
ATOM   3732 C C   . TRP D 1 65  ? 52.121  37.738 15.728  1.00 31.36 ? 153 TRP B C   1 
ATOM   3733 O O   . TRP D 1 65  ? 52.996  37.255 16.442  1.00 30.69 ? 153 TRP B O   1 
ATOM   3734 C CB  . TRP D 1 65  ? 49.742  36.982 15.629  1.00 30.91 ? 153 TRP B CB  1 
ATOM   3735 C CG  . TRP D 1 65  ? 50.012  35.551 15.985  1.00 31.07 ? 153 TRP B CG  1 
ATOM   3736 C CD1 . TRP D 1 65  ? 51.206  35.008 16.410  1.00 32.01 ? 153 TRP B CD1 1 
ATOM   3737 C CD2 . TRP D 1 65  ? 49.113  34.445 15.827  1.00 30.79 ? 153 TRP B CD2 1 
ATOM   3738 N NE1 . TRP D 1 65  ? 51.103  33.638 16.518  1.00 30.29 ? 153 TRP B NE1 1 
ATOM   3739 C CE2 . TRP D 1 65  ? 49.835  33.263 16.162  1.00 30.33 ? 153 TRP B CE2 1 
ATOM   3740 C CE3 . TRP D 1 65  ? 47.776  34.330 15.431  1.00 29.80 ? 153 TRP B CE3 1 
ATOM   3741 C CZ2 . TRP D 1 65  ? 49.257  31.988 16.112  1.00 29.95 ? 153 TRP B CZ2 1 
ATOM   3742 C CZ3 . TRP D 1 65  ? 47.202  33.063 15.375  1.00 29.80 ? 153 TRP B CZ3 1 
ATOM   3743 C CH2 . TRP D 1 65  ? 47.944  31.905 15.723  1.00 29.80 ? 153 TRP B CH2 1 
ATOM   3744 N N   . ALA D 1 66  ? 52.323  38.046 14.452  1.00 31.53 ? 154 ALA B N   1 
ATOM   3745 C CA  . ALA D 1 66  ? 53.615  37.861 13.818  1.00 30.77 ? 154 ALA B CA  1 
ATOM   3746 C C   . ALA D 1 66  ? 54.619  38.703 14.572  1.00 31.24 ? 154 ALA B C   1 
ATOM   3747 O O   . ALA D 1 66  ? 55.708  38.224 14.886  1.00 32.12 ? 154 ALA B O   1 
ATOM   3748 C CB  . ALA D 1 66  ? 53.555  38.292 12.366  1.00 30.58 ? 154 ALA B CB  1 
ATOM   3749 N N   . LEU D 1 67  ? 54.246  39.949 14.880  1.00 30.59 ? 155 LEU B N   1 
ATOM   3750 C CA  . LEU D 1 67  ? 55.135  40.852 15.607  1.00 29.90 ? 155 LEU B CA  1 
ATOM   3751 C C   . LEU D 1 67  ? 55.497  40.383 17.010  1.00 29.24 ? 155 LEU B C   1 
ATOM   3752 O O   . LEU D 1 67  ? 56.618  40.591 17.469  1.00 29.51 ? 155 LEU B O   1 
ATOM   3753 C CB  . LEU D 1 67  ? 54.534  42.262 15.678  1.00 30.64 ? 155 LEU B CB  1 
ATOM   3754 C CG  . LEU D 1 67  ? 54.653  43.157 14.439  1.00 30.82 ? 155 LEU B CG  1 
ATOM   3755 C CD1 . LEU D 1 67  ? 53.907  44.463 14.668  1.00 30.75 ? 155 LEU B CD1 1 
ATOM   3756 C CD2 . LEU D 1 67  ? 56.129  43.438 14.162  1.00 31.28 ? 155 LEU B CD2 1 
ATOM   3757 N N   . THR D 1 68  ? 54.560  39.754 17.699  1.00 28.78 ? 156 THR B N   1 
ATOM   3758 C CA  . THR D 1 68  ? 54.842  39.281 19.039  1.00 29.36 ? 156 THR B CA  1 
ATOM   3759 C C   . THR D 1 68  ? 55.930  38.201 18.971  1.00 29.78 ? 156 THR B C   1 
ATOM   3760 O O   . THR D 1 68  ? 56.830  38.153 19.812  1.00 29.08 ? 156 THR B O   1 
ATOM   3761 C CB  . THR D 1 68  ? 53.565  38.712 19.712  1.00 30.10 ? 156 THR B CB  1 
ATOM   3762 O OG1 . THR D 1 68  ? 53.081  37.598 18.959  1.00 31.75 ? 156 THR B OG1 1 
ATOM   3763 C CG2 . THR D 1 68  ? 52.469  39.746 19.744  1.00 29.42 ? 156 THR B CG2 1 
ATOM   3764 N N   . ASN D 1 69  ? 55.860  37.339 17.960  1.00 30.20 ? 157 ASN B N   1 
ATOM   3765 C CA  . ASN D 1 69  ? 56.865  36.288 17.823  1.00 31.08 ? 157 ASN B CA  1 
ATOM   3766 C C   . ASN D 1 69  ? 58.230  36.811 17.367  1.00 32.02 ? 157 ASN B C   1 
ATOM   3767 O O   . ASN D 1 69  ? 59.267  36.234 17.690  1.00 32.34 ? 157 ASN B O   1 
ATOM   3768 C CB  . ASN D 1 69  ? 56.377  35.180 16.882  1.00 29.43 ? 157 ASN B CB  1 
ATOM   3769 C CG  . ASN D 1 69  ? 55.248  34.367 17.489  1.00 29.12 ? 157 ASN B CG  1 
ATOM   3770 O OD1 . ASN D 1 69  ? 55.058  34.361 18.708  1.00 27.20 ? 157 ASN B OD1 1 
ATOM   3771 N ND2 . ASN D 1 69  ? 54.513  33.652 16.647  1.00 29.20 ? 157 ASN B ND2 1 
ATOM   3772 N N   . ILE D 1 70  ? 58.242  37.896 16.611  1.00 33.02 ? 158 ILE B N   1 
ATOM   3773 C CA  . ILE D 1 70  ? 59.509  38.443 16.193  1.00 33.85 ? 158 ILE B CA  1 
ATOM   3774 C C   . ILE D 1 70  ? 60.136  38.995 17.461  1.00 34.95 ? 158 ILE B C   1 
ATOM   3775 O O   . ILE D 1 70  ? 61.356  38.964 17.638  1.00 34.98 ? 158 ILE B O   1 
ATOM   3776 C CB  . ILE D 1 70  ? 59.317  39.553 15.155  1.00 33.47 ? 158 ILE B CB  1 
ATOM   3777 C CG1 . ILE D 1 70  ? 58.842  38.931 13.841  1.00 33.86 ? 158 ILE B CG1 1 
ATOM   3778 C CG2 . ILE D 1 70  ? 60.603  40.317 14.956  1.00 32.77 ? 158 ILE B CG2 1 
ATOM   3779 C CD1 . ILE D 1 70  ? 58.587  39.939 12.740  1.00 35.25 ? 158 ILE B CD1 1 
ATOM   3780 N N   . ALA D 1 71  ? 59.289  39.467 18.370  1.00 35.97 ? 159 ALA B N   1 
ATOM   3781 C CA  . ALA D 1 71  ? 59.776  40.030 19.625  1.00 37.34 ? 159 ALA B CA  1 
ATOM   3782 C C   . ALA D 1 71  ? 60.061  38.981 20.707  1.00 37.87 ? 159 ALA B C   1 
ATOM   3783 O O   . ALA D 1 71  ? 60.305  39.325 21.862  1.00 38.14 ? 159 ALA B O   1 
ATOM   3784 C CB  . ALA D 1 71  ? 58.790  41.082 20.151  1.00 37.10 ? 159 ALA B CB  1 
ATOM   3785 N N   . SER D 1 72  ? 60.020  37.706 20.347  1.00 38.79 ? 160 SER B N   1 
ATOM   3786 C CA  . SER D 1 72  ? 60.316  36.661 21.317  1.00 40.10 ? 160 SER B CA  1 
ATOM   3787 C C   . SER D 1 72  ? 61.730  36.129 21.055  1.00 41.49 ? 160 SER B C   1 
ATOM   3788 O O   . SER D 1 72  ? 62.161  35.138 21.652  1.00 42.21 ? 160 SER B O   1 
ATOM   3789 C CB  . SER D 1 72  ? 59.281  35.528 21.235  1.00 39.30 ? 160 SER B CB  1 
ATOM   3790 O OG  . SER D 1 72  ? 59.236  34.928 19.954  1.00 38.24 ? 160 SER B OG  1 
ATOM   3791 N N   . GLY D 1 73  ? 62.453  36.810 20.168  1.00 42.49 ? 161 GLY B N   1 
ATOM   3792 C CA  . GLY D 1 73  ? 63.804  36.399 19.839  1.00 43.68 ? 161 GLY B CA  1 
ATOM   3793 C C   . GLY D 1 73  ? 64.856  36.990 20.760  1.00 44.68 ? 161 GLY B C   1 
ATOM   3794 O O   . GLY D 1 73  ? 64.691  37.019 21.983  1.00 45.58 ? 161 GLY B O   1 
ATOM   3795 N N   . THR D 1 74  ? 65.943  37.459 20.159  1.00 44.94 ? 162 THR B N   1 
ATOM   3796 C CA  . THR D 1 74  ? 67.062  38.055 20.886  1.00 45.05 ? 162 THR B CA  1 
ATOM   3797 C C   . THR D 1 74  ? 66.810  39.542 21.120  1.00 45.04 ? 162 THR B C   1 
ATOM   3798 O O   . THR D 1 74  ? 65.877  40.113 20.548  1.00 45.21 ? 162 THR B O   1 
ATOM   3799 C CB  . THR D 1 74  ? 68.371  37.891 20.082  1.00 45.46 ? 162 THR B CB  1 
ATOM   3800 O OG1 . THR D 1 74  ? 68.240  38.540 18.805  1.00 45.38 ? 162 THR B OG1 1 
ATOM   3801 C CG2 . THR D 1 74  ? 68.668  36.418 19.856  1.00 44.74 ? 162 THR B CG2 1 
ATOM   3802 N N   . SER D 1 75  ? 67.632  40.165 21.961  1.00 44.80 ? 163 SER B N   1 
ATOM   3803 C CA  . SER D 1 75  ? 67.477  41.590 22.240  1.00 44.96 ? 163 SER B CA  1 
ATOM   3804 C C   . SER D 1 75  ? 67.585  42.362 20.932  1.00 44.76 ? 163 SER B C   1 
ATOM   3805 O O   . SER D 1 75  ? 66.928  43.387 20.732  1.00 44.81 ? 163 SER B O   1 
ATOM   3806 C CB  . SER D 1 75  ? 68.553  42.075 23.219  1.00 44.76 ? 163 SER B CB  1 
ATOM   3807 O OG  . SER D 1 75  ? 68.384  41.489 24.499  1.00 45.93 ? 163 SER B OG  1 
ATOM   3808 N N   . ALA D 1 76  ? 68.415  41.851 20.034  1.00 44.59 ? 164 ALA B N   1 
ATOM   3809 C CA  . ALA D 1 76  ? 68.618  42.482 18.741  1.00 44.07 ? 164 ALA B CA  1 
ATOM   3810 C C   . ALA D 1 76  ? 67.324  42.440 17.945  1.00 43.47 ? 164 ALA B C   1 
ATOM   3811 O O   . ALA D 1 76  ? 66.894  43.447 17.374  1.00 43.28 ? 164 ALA B O   1 
ATOM   3812 C CB  . ALA D 1 76  ? 69.724  41.760 17.975  1.00 43.80 ? 164 ALA B CB  1 
ATOM   3813 N N   . GLN D 1 77  ? 66.702  41.266 17.922  1.00 42.40 ? 165 GLN B N   1 
ATOM   3814 C CA  . GLN D 1 77  ? 65.464  41.070 17.184  1.00 40.87 ? 165 GLN B CA  1 
ATOM   3815 C C   . GLN D 1 77  ? 64.284  41.803 17.824  1.00 40.48 ? 165 GLN B C   1 
ATOM   3816 O O   . GLN D 1 77  ? 63.354  42.208 17.131  1.00 40.78 ? 165 GLN B O   1 
ATOM   3817 C CB  . GLN D 1 77  ? 65.170  39.569 17.059  1.00 40.34 ? 165 GLN B CB  1 
ATOM   3818 C CG  . GLN D 1 77  ? 66.341  38.776 16.487  1.00 39.23 ? 165 GLN B CG  1 
ATOM   3819 C CD  . GLN D 1 77  ? 66.051  37.297 16.337  1.00 39.15 ? 165 GLN B CD  1 
ATOM   3820 O OE1 . GLN D 1 77  ? 65.662  36.624 17.291  1.00 38.85 ? 165 GLN B OE1 1 
ATOM   3821 N NE2 . GLN D 1 77  ? 66.256  36.780 15.133  1.00 38.79 ? 165 GLN B NE2 1 
ATOM   3822 N N   . THR D 1 78  ? 64.315  41.981 19.141  1.00 39.76 ? 166 THR B N   1 
ATOM   3823 C CA  . THR D 1 78  ? 63.228  42.679 19.821  1.00 39.10 ? 166 THR B CA  1 
ATOM   3824 C C   . THR D 1 78  ? 63.363  44.177 19.596  1.00 38.77 ? 166 THR B C   1 
ATOM   3825 O O   . THR D 1 78  ? 62.385  44.914 19.653  1.00 38.51 ? 166 THR B O   1 
ATOM   3826 C CB  . THR D 1 78  ? 63.243  42.406 21.336  1.00 38.85 ? 166 THR B CB  1 
ATOM   3827 O OG1 . THR D 1 78  ? 63.113  41.002 21.566  1.00 39.32 ? 166 THR B OG1 1 
ATOM   3828 C CG2 . THR D 1 78  ? 62.097  43.127 22.021  1.00 38.55 ? 166 THR B CG2 1 
ATOM   3829 N N   . LYS D 1 79  ? 64.588  44.621 19.355  1.00 38.69 ? 167 LYS B N   1 
ATOM   3830 C CA  . LYS D 1 79  ? 64.862  46.025 19.120  1.00 38.74 ? 167 LYS B CA  1 
ATOM   3831 C C   . LYS D 1 79  ? 64.235  46.466 17.793  1.00 39.23 ? 167 LYS B C   1 
ATOM   3832 O O   . LYS D 1 79  ? 63.703  47.573 17.678  1.00 38.70 ? 167 LYS B O   1 
ATOM   3833 C CB  . LYS D 1 79  ? 66.381  46.252 19.108  1.00 39.11 ? 167 LYS B CB  1 
ATOM   3834 C CG  . LYS D 1 79  ? 66.836  47.653 18.696  1.00 39.07 ? 167 LYS B CG  1 
ATOM   3835 C CD  . LYS D 1 79  ? 68.363  47.804 18.747  1.00 39.74 ? 167 LYS B CD  1 
ATOM   3836 C CE  . LYS D 1 79  ? 68.848  49.136 18.132  1.00 39.89 ? 167 LYS B CE  1 
ATOM   3837 N NZ  . LYS D 1 79  ? 68.242  50.362 18.735  1.00 39.27 ? 167 LYS B NZ  1 
ATOM   3838 N N   . VAL D 1 80  ? 64.289  45.593 16.792  1.00 39.82 ? 168 VAL B N   1 
ATOM   3839 C CA  . VAL D 1 80  ? 63.733  45.919 15.484  1.00 40.49 ? 168 VAL B CA  1 
ATOM   3840 C C   . VAL D 1 80  ? 62.267  46.334 15.633  1.00 41.19 ? 168 VAL B C   1 
ATOM   3841 O O   . VAL D 1 80  ? 61.830  47.351 15.079  1.00 41.69 ? 168 VAL B O   1 
ATOM   3842 C CB  . VAL D 1 80  ? 63.836  44.713 14.522  1.00 40.59 ? 168 VAL B CB  1 
ATOM   3843 C CG1 . VAL D 1 80  ? 63.241  45.065 13.168  1.00 40.26 ? 168 VAL B CG1 1 
ATOM   3844 C CG2 . VAL D 1 80  ? 65.289  44.296 14.371  1.00 41.19 ? 168 VAL B CG2 1 
ATOM   3845 N N   . VAL D 1 81  ? 61.518  45.550 16.398  1.00 40.87 ? 169 VAL B N   1 
ATOM   3846 C CA  . VAL D 1 81  ? 60.108  45.826 16.624  1.00 40.50 ? 169 VAL B CA  1 
ATOM   3847 C C   . VAL D 1 81  ? 59.892  47.066 17.485  1.00 40.75 ? 169 VAL B C   1 
ATOM   3848 O O   . VAL D 1 81  ? 58.934  47.812 17.265  1.00 40.36 ? 169 VAL B O   1 
ATOM   3849 C CB  . VAL D 1 81  ? 59.409  44.608 17.280  1.00 40.03 ? 169 VAL B CB  1 
ATOM   3850 C CG1 . VAL D 1 81  ? 57.956  44.930 17.597  1.00 39.33 ? 169 VAL B CG1 1 
ATOM   3851 C CG2 . VAL D 1 81  ? 59.489  43.418 16.344  1.00 39.26 ? 169 VAL B CG2 1 
ATOM   3852 N N   . VAL D 1 82  ? 60.772  47.284 18.463  1.00 41.33 ? 170 VAL B N   1 
ATOM   3853 C CA  . VAL D 1 82  ? 60.662  48.454 19.341  1.00 42.15 ? 170 VAL B CA  1 
ATOM   3854 C C   . VAL D 1 82  ? 61.040  49.728 18.599  1.00 42.18 ? 170 VAL B C   1 
ATOM   3855 O O   . VAL D 1 82  ? 60.418  50.766 18.792  1.00 41.52 ? 170 VAL B O   1 
ATOM   3856 C CB  . VAL D 1 82  ? 61.563  48.331 20.603  1.00 42.45 ? 170 VAL B CB  1 
ATOM   3857 C CG1 . VAL D 1 82  ? 61.527  49.632 21.409  1.00 42.37 ? 170 VAL B CG1 1 
ATOM   3858 C CG2 . VAL D 1 82  ? 61.082  47.187 21.470  1.00 42.47 ? 170 VAL B CG2 1 
ATOM   3859 N N   . ASP D 1 83  ? 62.065  49.646 17.752  1.00 43.24 ? 171 ASP B N   1 
ATOM   3860 C CA  . ASP D 1 83  ? 62.485  50.813 16.986  1.00 44.40 ? 171 ASP B CA  1 
ATOM   3861 C C   . ASP D 1 83  ? 61.441  51.213 15.942  1.00 44.78 ? 171 ASP B C   1 
ATOM   3862 O O   . ASP D 1 83  ? 61.451  52.349 15.456  1.00 45.30 ? 171 ASP B O   1 
ATOM   3863 C CB  . ASP D 1 83  ? 63.832  50.581 16.282  1.00 44.81 ? 171 ASP B CB  1 
ATOM   3864 C CG  . ASP D 1 83  ? 65.015  50.571 17.240  1.00 45.47 ? 171 ASP B CG  1 
ATOM   3865 O OD1 . ASP D 1 83  ? 65.023  51.363 18.212  1.00 45.10 ? 171 ASP B OD1 1 
ATOM   3866 O OD2 . ASP D 1 83  ? 65.961  49.791 16.994  1.00 46.04 ? 171 ASP B OD2 1 
ATOM   3867 N N   . ALA D 1 84  ? 60.544  50.287 15.603  1.00 44.91 ? 172 ALA B N   1 
ATOM   3868 C CA  . ALA D 1 84  ? 59.490  50.555 14.621  1.00 44.98 ? 172 ALA B CA  1 
ATOM   3869 C C   . ALA D 1 84  ? 58.249  51.215 15.245  1.00 44.94 ? 172 ALA B C   1 
ATOM   3870 O O   . ALA D 1 84  ? 57.209  51.324 14.603  1.00 45.34 ? 172 ALA B O   1 
ATOM   3871 C CB  . ALA D 1 84  ? 59.098  49.256 13.905  1.00 44.79 ? 172 ALA B CB  1 
ATOM   3872 N N   . ASP D 1 85  ? 58.370  51.655 16.494  1.00 44.80 ? 173 ASP B N   1 
ATOM   3873 C CA  . ASP D 1 85  ? 57.282  52.318 17.202  1.00 44.64 ? 173 ASP B CA  1 
ATOM   3874 C C   . ASP D 1 85  ? 56.053  51.465 17.440  1.00 43.48 ? 173 ASP B C   1 
ATOM   3875 O O   . ASP D 1 85  ? 54.949  51.993 17.553  1.00 43.50 ? 173 ASP B O   1 
ATOM   3876 C CB  . ASP D 1 85  ? 56.848  53.591 16.466  1.00 46.88 ? 173 ASP B CB  1 
ATOM   3877 C CG  . ASP D 1 85  ? 57.823  54.748 16.661  1.00 49.74 ? 173 ASP B CG  1 
ATOM   3878 O OD1 . ASP D 1 85  ? 58.077  55.111 17.841  1.00 50.89 ? 173 ASP B OD1 1 
ATOM   3879 O OD2 . ASP D 1 85  ? 58.320  55.304 15.642  1.00 50.95 ? 173 ASP B OD2 1 
ATOM   3880 N N   . ALA D 1 86  ? 56.236  50.156 17.538  1.00 42.13 ? 174 ALA B N   1 
ATOM   3881 C CA  . ALA D 1 86  ? 55.110  49.253 17.755  1.00 40.54 ? 174 ALA B CA  1 
ATOM   3882 C C   . ALA D 1 86  ? 54.486  49.343 19.162  1.00 39.46 ? 174 ALA B C   1 
ATOM   3883 O O   . ALA D 1 86  ? 53.286  49.105 19.337  1.00 38.06 ? 174 ALA B O   1 
ATOM   3884 C CB  . ALA D 1 86  ? 55.550  47.814 17.462  1.00 40.52 ? 174 ALA B CB  1 
ATOM   3885 N N   . VAL D 1 87  ? 55.300  49.692 20.156  1.00 38.78 ? 175 VAL B N   1 
ATOM   3886 C CA  . VAL D 1 87  ? 54.826  49.778 21.534  1.00 37.89 ? 175 VAL B CA  1 
ATOM   3887 C C   . VAL D 1 87  ? 53.610  50.675 21.726  1.00 37.80 ? 175 VAL B C   1 
ATOM   3888 O O   . VAL D 1 87  ? 52.590  50.227 22.244  1.00 38.42 ? 175 VAL B O   1 
ATOM   3889 C CB  . VAL D 1 87  ? 55.968  50.211 22.501  1.00 37.42 ? 175 VAL B CB  1 
ATOM   3890 C CG1 . VAL D 1 87  ? 55.424  50.443 23.910  1.00 36.82 ? 175 VAL B CG1 1 
ATOM   3891 C CG2 . VAL D 1 87  ? 57.031  49.123 22.545  1.00 37.25 ? 175 VAL B CG2 1 
ATOM   3892 N N   . PRO D 1 88  ? 53.691  51.952 21.335  1.00 37.80 ? 176 PRO B N   1 
ATOM   3893 C CA  . PRO D 1 88  ? 52.511  52.804 21.522  1.00 37.60 ? 176 PRO B CA  1 
ATOM   3894 C C   . PRO D 1 88  ? 51.209  52.273 20.872  1.00 37.13 ? 176 PRO B C   1 
ATOM   3895 O O   . PRO D 1 88  ? 50.112  52.519 21.372  1.00 36.94 ? 176 PRO B O   1 
ATOM   3896 C CB  . PRO D 1 88  ? 52.982  54.152 20.957  1.00 37.66 ? 176 PRO B CB  1 
ATOM   3897 C CG  . PRO D 1 88  ? 54.038  53.730 19.931  1.00 37.73 ? 176 PRO B CG  1 
ATOM   3898 C CD  . PRO D 1 88  ? 54.797  52.740 20.757  1.00 37.55 ? 176 PRO B CD  1 
ATOM   3899 N N   . LEU D 1 89  ? 51.332  51.548 19.765  1.00 37.10 ? 177 LEU B N   1 
ATOM   3900 C CA  . LEU D 1 89  ? 50.171  50.976 19.088  1.00 36.55 ? 177 LEU B CA  1 
ATOM   3901 C C   . LEU D 1 89  ? 49.618  49.756 19.822  1.00 36.43 ? 177 LEU B C   1 
ATOM   3902 O O   . LEU D 1 89  ? 48.401  49.560 19.868  1.00 35.89 ? 177 LEU B O   1 
ATOM   3903 C CB  . LEU D 1 89  ? 50.536  50.596 17.657  1.00 37.12 ? 177 LEU B CB  1 
ATOM   3904 C CG  . LEU D 1 89  ? 50.759  51.824 16.783  1.00 37.02 ? 177 LEU B CG  1 
ATOM   3905 C CD1 . LEU D 1 89  ? 51.243  51.424 15.403  1.00 37.39 ? 177 LEU B CD1 1 
ATOM   3906 C CD2 . LEU D 1 89  ? 49.439  52.584 16.701  1.00 37.24 ? 177 LEU B CD2 1 
ATOM   3907 N N   . PHE D 1 90  ? 50.513  48.930 20.370  1.00 36.60 ? 178 PHE B N   1 
ATOM   3908 C CA  . PHE D 1 90  ? 50.113  47.739 21.137  1.00 36.65 ? 178 PHE B CA  1 
ATOM   3909 C C   . PHE D 1 90  ? 49.227  48.198 22.286  1.00 37.13 ? 178 PHE B C   1 
ATOM   3910 O O   . PHE D 1 90  ? 48.238  47.549 22.625  1.00 36.85 ? 178 PHE B O   1 
ATOM   3911 C CB  . PHE D 1 90  ? 51.333  47.023 21.742  1.00 36.04 ? 178 PHE B CB  1 
ATOM   3912 C CG  . PHE D 1 90  ? 52.091  46.150 20.780  1.00 35.51 ? 178 PHE B CG  1 
ATOM   3913 C CD1 . PHE D 1 90  ? 51.439  45.447 19.772  1.00 35.13 ? 178 PHE B CD1 1 
ATOM   3914 C CD2 . PHE D 1 90  ? 53.471  46.005 20.913  1.00 34.93 ? 178 PHE B CD2 1 
ATOM   3915 C CE1 . PHE D 1 90  ? 52.153  44.614 18.914  1.00 35.68 ? 178 PHE B CE1 1 
ATOM   3916 C CE2 . PHE D 1 90  ? 54.193  45.177 20.060  1.00 35.00 ? 178 PHE B CE2 1 
ATOM   3917 C CZ  . PHE D 1 90  ? 53.537  44.478 19.057  1.00 35.04 ? 178 PHE B CZ  1 
ATOM   3918 N N   . ILE D 1 91  ? 49.606  49.321 22.887  1.00 37.72 ? 179 ILE B N   1 
ATOM   3919 C CA  . ILE D 1 91  ? 48.870  49.884 24.010  1.00 38.78 ? 179 ILE B CA  1 
ATOM   3920 C C   . ILE D 1 91  ? 47.473  50.398 23.651  1.00 39.52 ? 179 ILE B C   1 
ATOM   3921 O O   . ILE D 1 91  ? 46.551  50.268 24.456  1.00 39.33 ? 179 ILE B O   1 
ATOM   3922 C CB  . ILE D 1 91  ? 49.682  51.018 24.685  1.00 38.61 ? 179 ILE B CB  1 
ATOM   3923 C CG1 . ILE D 1 91  ? 50.965  50.440 25.289  1.00 38.33 ? 179 ILE B CG1 1 
ATOM   3924 C CG2 . ILE D 1 91  ? 48.844  51.707 25.753  1.00 38.09 ? 179 ILE B CG2 1 
ATOM   3925 C CD1 . ILE D 1 91  ? 51.820  51.460 25.995  1.00 38.33 ? 179 ILE B CD1 1 
ATOM   3926 N N   . GLN D 1 92  ? 47.302  50.974 22.460  1.00 40.68 ? 180 GLN B N   1 
ATOM   3927 C CA  . GLN D 1 92  ? 45.979  51.463 22.076  1.00 42.18 ? 180 GLN B CA  1 
ATOM   3928 C C   . GLN D 1 92  ? 45.087  50.286 21.736  1.00 42.22 ? 180 GLN B C   1 
ATOM   3929 O O   . GLN D 1 92  ? 43.868  50.395 21.812  1.00 42.65 ? 180 GLN B O   1 
ATOM   3930 C CB  . GLN D 1 92  ? 46.028  52.439 20.884  1.00 43.66 ? 180 GLN B CB  1 
ATOM   3931 C CG  . GLN D 1 92  ? 46.516  51.849 19.564  1.00 47.27 ? 180 GLN B CG  1 
ATOM   3932 C CD  . GLN D 1 92  ? 46.518  52.868 18.414  1.00 49.55 ? 180 GLN B CD  1 
ATOM   3933 O OE1 . GLN D 1 92  ? 47.097  53.965 18.525  1.00 50.12 ? 180 GLN B OE1 1 
ATOM   3934 N NE2 . GLN D 1 92  ? 45.879  52.501 17.295  1.00 50.09 ? 180 GLN B NE2 1 
ATOM   3935 N N   . LEU D 1 93  ? 45.681  49.156 21.356  1.00 42.21 ? 181 LEU B N   1 
ATOM   3936 C CA  . LEU D 1 93  ? 44.869  47.978 21.048  1.00 41.90 ? 181 LEU B CA  1 
ATOM   3937 C C   . LEU D 1 93  ? 44.301  47.403 22.344  1.00 41.89 ? 181 LEU B C   1 
ATOM   3938 O O   . LEU D 1 93  ? 43.263  46.731 22.333  1.00 42.08 ? 181 LEU B O   1 
ATOM   3939 C CB  . LEU D 1 93  ? 45.680  46.906 20.301  1.00 41.69 ? 181 LEU B CB  1 
ATOM   3940 C CG  . LEU D 1 93  ? 46.032  47.182 18.835  1.00 41.47 ? 181 LEU B CG  1 
ATOM   3941 C CD1 . LEU D 1 93  ? 46.898  46.054 18.291  1.00 40.82 ? 181 LEU B CD1 1 
ATOM   3942 C CD2 . LEU D 1 93  ? 44.748  47.319 18.021  1.00 40.76 ? 181 LEU B CD2 1 
ATOM   3943 N N   . LEU D 1 94  ? 44.970  47.671 23.465  1.00 41.23 ? 182 LEU B N   1 
ATOM   3944 C CA  . LEU D 1 94  ? 44.477  47.187 24.745  1.00 40.81 ? 182 LEU B CA  1 
ATOM   3945 C C   . LEU D 1 94  ? 43.129  47.837 25.044  1.00 41.31 ? 182 LEU B C   1 
ATOM   3946 O O   . LEU D 1 94  ? 42.282  47.229 25.701  1.00 41.22 ? 182 LEU B O   1 
ATOM   3947 C CB  . LEU D 1 94  ? 45.466  47.496 25.864  1.00 39.86 ? 182 LEU B CB  1 
ATOM   3948 C CG  . LEU D 1 94  ? 46.813  46.776 25.813  1.00 38.84 ? 182 LEU B CG  1 
ATOM   3949 C CD1 . LEU D 1 94  ? 47.632  47.190 27.014  1.00 38.23 ? 182 LEU B CD1 1 
ATOM   3950 C CD2 . LEU D 1 94  ? 46.610  45.278 25.816  1.00 38.74 ? 182 LEU B CD2 1 
ATOM   3951 N N   . TYR D 1 95  ? 42.946  49.069 24.554  1.00 41.29 ? 183 TYR B N   1 
ATOM   3952 C CA  . TYR D 1 95  ? 41.703  49.835 24.727  1.00 40.89 ? 183 TYR B CA  1 
ATOM   3953 C C   . TYR D 1 95  ? 40.640  49.495 23.682  1.00 40.96 ? 183 TYR B C   1 
ATOM   3954 O O   . TYR D 1 95  ? 39.542  49.062 24.001  1.00 41.05 ? 183 TYR B O   1 
ATOM   3955 C CB  . TYR D 1 95  ? 41.945  51.351 24.614  1.00 41.05 ? 183 TYR B CB  1 
ATOM   3956 C CG  . TYR D 1 95  ? 42.602  52.049 25.786  1.00 41.25 ? 183 TYR B CG  1 
ATOM   3957 C CD1 . TYR D 1 95  ? 41.901  52.276 26.970  1.00 41.40 ? 183 TYR B CD1 1 
ATOM   3958 C CD2 . TYR D 1 95  ? 43.911  52.519 25.697  1.00 41.43 ? 183 TYR B CD2 1 
ATOM   3959 C CE1 . TYR D 1 95  ? 42.488  52.955 28.035  1.00 41.46 ? 183 TYR B CE1 1 
ATOM   3960 C CE2 . TYR D 1 95  ? 44.508  53.197 26.750  1.00 41.44 ? 183 TYR B CE2 1 
ATOM   3961 C CZ  . TYR D 1 95  ? 43.792  53.415 27.920  1.00 41.95 ? 183 TYR B CZ  1 
ATOM   3962 O OH  . TYR D 1 95  ? 44.384  54.085 28.975  1.00 41.77 ? 183 TYR B OH  1 
ATOM   3963 N N   . THR D 1 96  ? 40.978  49.712 22.422  1.00 41.38 ? 184 THR B N   1 
ATOM   3964 C CA  . THR D 1 96  ? 40.048  49.500 21.323  1.00 41.68 ? 184 THR B CA  1 
ATOM   3965 C C   . THR D 1 96  ? 39.757  48.072 20.851  1.00 41.31 ? 184 THR B C   1 
ATOM   3966 O O   . THR D 1 96  ? 38.604  47.720 20.626  1.00 41.49 ? 184 THR B O   1 
ATOM   3967 C CB  . THR D 1 96  ? 40.507  50.315 20.114  1.00 41.92 ? 184 THR B CB  1 
ATOM   3968 O OG1 . THR D 1 96  ? 41.739  49.776 19.610  1.00 42.62 ? 184 THR B OG1 1 
ATOM   3969 C CG2 . THR D 1 96  ? 40.745  51.759 20.539  1.00 42.05 ? 184 THR B CG2 1 
ATOM   3970 N N   . GLY D 1 97  ? 40.797  47.262 20.701  1.00 41.15 ? 185 GLY B N   1 
ATOM   3971 C CA  . GLY D 1 97  ? 40.630  45.904 20.210  1.00 40.62 ? 185 GLY B CA  1 
ATOM   3972 C C   . GLY D 1 97  ? 39.674  44.957 20.913  1.00 40.50 ? 185 GLY B C   1 
ATOM   3973 O O   . GLY D 1 97  ? 39.315  45.142 22.074  1.00 39.90 ? 185 GLY B O   1 
ATOM   3974 N N   . SER D 1 98  ? 39.258  43.930 20.175  1.00 40.60 ? 186 SER B N   1 
ATOM   3975 C CA  . SER D 1 98  ? 38.374  42.890 20.688  1.00 40.37 ? 186 SER B CA  1 
ATOM   3976 C C   . SER D 1 98  ? 39.183  42.174 21.754  1.00 40.94 ? 186 SER B C   1 
ATOM   3977 O O   . SER D 1 98  ? 40.263  42.623 22.116  1.00 41.62 ? 186 SER B O   1 
ATOM   3978 C CB  . SER D 1 98  ? 38.021  41.881 19.587  1.00 39.91 ? 186 SER B CB  1 
ATOM   3979 O OG  . SER D 1 98  ? 39.141  41.081 19.227  1.00 37.29 ? 186 SER B OG  1 
ATOM   3980 N N   . VAL D 1 99  ? 38.681  41.051 22.241  1.00 41.42 ? 187 VAL B N   1 
ATOM   3981 C CA  . VAL D 1 99  ? 39.398  40.300 23.260  1.00 42.09 ? 187 VAL B CA  1 
ATOM   3982 C C   . VAL D 1 99  ? 40.552  39.496 22.663  1.00 42.44 ? 187 VAL B C   1 
ATOM   3983 O O   . VAL D 1 99  ? 41.612  39.376 23.276  1.00 42.21 ? 187 VAL B O   1 
ATOM   3984 C CB  . VAL D 1 99  ? 38.452  39.347 24.021  1.00 42.70 ? 187 VAL B CB  1 
ATOM   3985 C CG1 . VAL D 1 99  ? 39.237  38.523 25.026  1.00 43.29 ? 187 VAL B CG1 1 
ATOM   3986 C CG2 . VAL D 1 99  ? 37.381  40.150 24.742  1.00 42.93 ? 187 VAL B CG2 1 
ATOM   3987 N N   . GLU D 1 100 ? 40.350  38.939 21.472  1.00 43.17 ? 188 GLU B N   1 
ATOM   3988 C CA  . GLU D 1 100 ? 41.412  38.175 20.826  1.00 43.19 ? 188 GLU B CA  1 
ATOM   3989 C C   . GLU D 1 100 ? 42.578  39.133 20.592  1.00 42.01 ? 188 GLU B C   1 
ATOM   3990 O O   . GLU D 1 100 ? 43.722  38.803 20.887  1.00 41.98 ? 188 GLU B O   1 
ATOM   3991 C CB  . GLU D 1 100 ? 40.953  37.610 19.473  1.00 45.03 ? 188 GLU B CB  1 
ATOM   3992 C CG  . GLU D 1 100 ? 39.708  36.726 19.496  1.00 48.05 ? 188 GLU B CG  1 
ATOM   3993 C CD  . GLU D 1 100 ? 39.255  36.322 18.076  1.00 50.27 ? 188 GLU B CD  1 
ATOM   3994 O OE1 . GLU D 1 100 ? 39.980  35.536 17.404  1.00 49.92 ? 188 GLU B OE1 1 
ATOM   3995 O OE2 . GLU D 1 100 ? 38.178  36.810 17.634  1.00 51.21 ? 188 GLU B OE2 1 
ATOM   3996 N N   . VAL D 1 101 ? 42.273  40.316 20.056  1.00 40.74 ? 189 VAL B N   1 
ATOM   3997 C CA  . VAL D 1 101 ? 43.283  41.332 19.774  1.00 39.52 ? 189 VAL B CA  1 
ATOM   3998 C C   . VAL D 1 101 ? 44.020  41.728 21.038  1.00 39.01 ? 189 VAL B C   1 
ATOM   3999 O O   . VAL D 1 101 ? 45.244  41.766 21.049  1.00 38.71 ? 189 VAL B O   1 
ATOM   4000 C CB  . VAL D 1 101 ? 42.660  42.594 19.110  1.00 39.37 ? 189 VAL B CB  1 
ATOM   4001 C CG1 . VAL D 1 101 ? 43.661  43.740 19.089  1.00 39.21 ? 189 VAL B CG1 1 
ATOM   4002 C CG2 . VAL D 1 101 ? 42.253  42.267 17.680  1.00 38.54 ? 189 VAL B CG2 1 
ATOM   4003 N N   . LYS D 1 102 ? 43.291  42.018 22.107  1.00 38.77 ? 190 LYS B N   1 
ATOM   4004 C CA  . LYS D 1 102 ? 43.956  42.383 23.351  1.00 39.03 ? 190 LYS B CA  1 
ATOM   4005 C C   . LYS D 1 102 ? 44.919  41.270 23.787  1.00 39.00 ? 190 LYS B C   1 
ATOM   4006 O O   . LYS D 1 102 ? 46.040  41.538 24.212  1.00 39.20 ? 190 LYS B O   1 
ATOM   4007 C CB  . LYS D 1 102 ? 42.928  42.639 24.449  1.00 38.59 ? 190 LYS B CB  1 
ATOM   4008 C CG  . LYS D 1 102 ? 42.010  43.804 24.180  1.00 38.20 ? 190 LYS B CG  1 
ATOM   4009 C CD  . LYS D 1 102 ? 41.094  44.032 25.362  1.00 38.12 ? 190 LYS B CD  1 
ATOM   4010 C CE  . LYS D 1 102 ? 40.135  45.173 25.107  1.00 38.34 ? 190 LYS B CE  1 
ATOM   4011 N NZ  . LYS D 1 102 ? 39.282  45.384 26.303  1.00 38.63 ? 190 LYS B NZ  1 
ATOM   4012 N N   . GLU D 1 103 ? 44.463  40.025 23.674  1.00 38.80 ? 191 GLU B N   1 
ATOM   4013 C CA  . GLU D 1 103 ? 45.248  38.837 24.025  1.00 38.28 ? 191 GLU B CA  1 
ATOM   4014 C C   . GLU D 1 103 ? 46.636  38.911 23.368  1.00 37.10 ? 191 GLU B C   1 
ATOM   4015 O O   . GLU D 1 103 ? 47.641  38.693 24.027  1.00 36.77 ? 191 GLU B O   1 
ATOM   4016 C CB  . GLU D 1 103 ? 44.492  37.583 23.553  1.00 40.48 ? 191 GLU B CB  1 
ATOM   4017 C CG  . GLU D 1 103 ? 44.149  36.523 24.632  1.00 43.02 ? 191 GLU B CG  1 
ATOM   4018 C CD  . GLU D 1 103 ? 45.358  35.725 25.105  1.00 44.65 ? 191 GLU B CD  1 
ATOM   4019 O OE1 . GLU D 1 103 ? 45.962  34.991 24.299  1.00 45.42 ? 191 GLU B OE1 1 
ATOM   4020 O OE2 . GLU D 1 103 ? 45.713  35.831 26.292  1.00 46.18 ? 191 GLU B OE2 1 
ATOM   4021 N N   . GLN D 1 104 ? 46.679  39.217 22.070  1.00 36.04 ? 192 GLN B N   1 
ATOM   4022 C CA  . GLN D 1 104 ? 47.941  39.345 21.342  1.00 34.92 ? 192 GLN B CA  1 
ATOM   4023 C C   . GLN D 1 104 ? 48.763  40.534 21.804  1.00 34.72 ? 192 GLN B C   1 
ATOM   4024 O O   . GLN D 1 104 ? 49.968  40.417 21.998  1.00 34.94 ? 192 GLN B O   1 
ATOM   4025 C CB  . GLN D 1 104 ? 47.725  39.509 19.832  1.00 34.25 ? 192 GLN B CB  1 
ATOM   4026 C CG  . GLN D 1 104 ? 47.389  38.251 19.076  1.00 34.07 ? 192 GLN B CG  1 
ATOM   4027 C CD  . GLN D 1 104 ? 48.380  37.139 19.343  1.00 33.59 ? 192 GLN B CD  1 
ATOM   4028 O OE1 . GLN D 1 104 ? 48.016  35.977 19.519  1.00 33.11 ? 192 GLN B OE1 1 
ATOM   4029 N NE2 . GLN D 1 104 ? 49.646  37.498 19.373  1.00 33.57 ? 192 GLN B NE2 1 
ATOM   4030 N N   . ALA D 1 105 ? 48.114  41.683 21.963  1.00 34.27 ? 193 ALA B N   1 
ATOM   4031 C CA  . ALA D 1 105 ? 48.802  42.910 22.373  1.00 34.03 ? 193 ALA B CA  1 
ATOM   4032 C C   . ALA D 1 105 ? 49.527  42.814 23.716  1.00 33.88 ? 193 ALA B C   1 
ATOM   4033 O O   . ALA D 1 105 ? 50.694  43.191 23.833  1.00 33.90 ? 193 ALA B O   1 
ATOM   4034 C CB  . ALA D 1 105 ? 47.815  44.068 22.400  1.00 32.98 ? 193 ALA B CB  1 
ATOM   4035 N N   . ILE D 1 106 ? 48.834  42.320 24.732  1.00 33.78 ? 194 ILE B N   1 
ATOM   4036 C CA  . ILE D 1 106 ? 49.442  42.195 26.044  1.00 33.93 ? 194 ILE B CA  1 
ATOM   4037 C C   . ILE D 1 106 ? 50.596  41.180 25.983  1.00 33.92 ? 194 ILE B C   1 
ATOM   4038 O O   . ILE D 1 106 ? 51.586  41.308 26.713  1.00 33.52 ? 194 ILE B O   1 
ATOM   4039 C CB  . ILE D 1 106 ? 48.382  41.761 27.113  1.00 34.47 ? 194 ILE B CB  1 
ATOM   4040 C CG1 . ILE D 1 106 ? 48.953  41.970 28.517  1.00 34.48 ? 194 ILE B CG1 1 
ATOM   4041 C CG2 . ILE D 1 106 ? 47.961  40.299 26.908  1.00 33.89 ? 194 ILE B CG2 1 
ATOM   4042 C CD1 . ILE D 1 106 ? 49.327  43.429 28.802  1.00 33.47 ? 194 ILE B CD1 1 
ATOM   4043 N N   . TRP D 1 107 ? 50.470  40.186 25.100  1.00 33.62 ? 195 TRP B N   1 
ATOM   4044 C CA  . TRP D 1 107 ? 51.501  39.160 24.939  1.00 32.47 ? 195 TRP B CA  1 
ATOM   4045 C C   . TRP D 1 107 ? 52.748  39.820 24.373  1.00 31.47 ? 195 TRP B C   1 
ATOM   4046 O O   . TRP D 1 107 ? 53.836  39.656 24.906  1.00 31.24 ? 195 TRP B O   1 
ATOM   4047 C CB  . TRP D 1 107 ? 51.047  38.045 23.984  1.00 32.61 ? 195 TRP B CB  1 
ATOM   4048 C CG  . TRP D 1 107 ? 51.974  36.855 23.989  1.00 32.66 ? 195 TRP B CG  1 
ATOM   4049 C CD1 . TRP D 1 107 ? 53.337  36.887 24.038  1.00 33.28 ? 195 TRP B CD1 1 
ATOM   4050 C CD2 . TRP D 1 107 ? 51.613  35.470 23.907  1.00 32.51 ? 195 TRP B CD2 1 
ATOM   4051 N NE1 . TRP D 1 107 ? 53.848  35.618 23.992  1.00 33.21 ? 195 TRP B NE1 1 
ATOM   4052 C CE2 . TRP D 1 107 ? 52.814  34.726 23.911  1.00 33.14 ? 195 TRP B CE2 1 
ATOM   4053 C CE3 . TRP D 1 107 ? 50.393  34.782 23.832  1.00 32.74 ? 195 TRP B CE3 1 
ATOM   4054 C CZ2 . TRP D 1 107 ? 52.833  33.330 23.839  1.00 33.64 ? 195 TRP B CZ2 1 
ATOM   4055 C CZ3 . TRP D 1 107 ? 50.410  33.393 23.763  1.00 32.76 ? 195 TRP B CZ3 1 
ATOM   4056 C CH2 . TRP D 1 107 ? 51.624  32.683 23.767  1.00 33.65 ? 195 TRP B CH2 1 
ATOM   4057 N N   . ALA D 1 108 ? 52.583  40.562 23.289  1.00 31.23 ? 196 ALA B N   1 
ATOM   4058 C CA  . ALA D 1 108 ? 53.707  41.249 22.667  1.00 31.08 ? 196 ALA B CA  1 
ATOM   4059 C C   . ALA D 1 108 ? 54.370  42.122 23.712  1.00 31.54 ? 196 ALA B C   1 
ATOM   4060 O O   . ALA D 1 108 ? 55.585  42.052 23.907  1.00 31.72 ? 196 ALA B O   1 
ATOM   4061 C CB  . ALA D 1 108 ? 53.236  42.097 21.509  1.00 30.52 ? 196 ALA B CB  1 
ATOM   4062 N N   . LEU D 1 109 ? 53.577  42.945 24.394  1.00 31.83 ? 197 LEU B N   1 
ATOM   4063 C CA  . LEU D 1 109 ? 54.129  43.813 25.430  1.00 32.28 ? 197 LEU B CA  1 
ATOM   4064 C C   . LEU D 1 109 ? 54.900  43.008 26.479  1.00 33.20 ? 197 LEU B C   1 
ATOM   4065 O O   . LEU D 1 109 ? 55.891  43.481 27.039  1.00 32.76 ? 197 LEU B O   1 
ATOM   4066 C CB  . LEU D 1 109 ? 53.016  44.614 26.090  1.00 31.38 ? 197 LEU B CB  1 
ATOM   4067 C CG  . LEU D 1 109 ? 52.416  45.690 25.191  1.00 30.64 ? 197 LEU B CG  1 
ATOM   4068 C CD1 . LEU D 1 109 ? 51.179  46.251 25.841  1.00 29.75 ? 197 LEU B CD1 1 
ATOM   4069 C CD2 . LEU D 1 109 ? 53.448  46.775 24.930  1.00 29.55 ? 197 LEU B CD2 1 
ATOM   4070 N N   . GLY D 1 110 ? 54.442  41.788 26.738  1.00 34.15 ? 198 GLY B N   1 
ATOM   4071 C CA  . GLY D 1 110 ? 55.123  40.949 27.701  1.00 35.03 ? 198 GLY B CA  1 
ATOM   4072 C C   . GLY D 1 110 ? 56.546  40.664 27.254  1.00 35.62 ? 198 GLY B C   1 
ATOM   4073 O O   . GLY D 1 110 ? 57.474  40.726 28.057  1.00 35.31 ? 198 GLY B O   1 
ATOM   4074 N N   . ASN D 1 111 ? 56.729  40.358 25.972  1.00 36.03 ? 199 ASN B N   1 
ATOM   4075 C CA  . ASN D 1 111 ? 58.063  40.065 25.464  1.00 36.95 ? 199 ASN B CA  1 
ATOM   4076 C C   . ASN D 1 111 ? 58.984  41.280 25.495  1.00 37.71 ? 199 ASN B C   1 
ATOM   4077 O O   . ASN D 1 111 ? 60.166  41.163 25.830  1.00 37.97 ? 199 ASN B O   1 
ATOM   4078 C CB  . ASN D 1 111 ? 58.007  39.488 24.040  1.00 36.23 ? 199 ASN B CB  1 
ATOM   4079 C CG  . ASN D 1 111 ? 57.468  38.066 24.008  1.00 36.48 ? 199 ASN B CG  1 
ATOM   4080 O OD1 . ASN D 1 111 ? 57.850  37.233 24.827  1.00 35.87 ? 199 ASN B OD1 1 
ATOM   4081 N ND2 . ASN D 1 111 ? 56.600  37.773 23.045  1.00 37.13 ? 199 ASN B ND2 1 
ATOM   4082 N N   . VAL D 1 112 ? 58.447  42.443 25.142  1.00 38.59 ? 200 VAL B N   1 
ATOM   4083 C CA  . VAL D 1 112 ? 59.242  43.663 25.152  1.00 39.34 ? 200 VAL B CA  1 
ATOM   4084 C C   . VAL D 1 112 ? 59.663  43.984 26.585  1.00 39.56 ? 200 VAL B C   1 
ATOM   4085 O O   . VAL D 1 112 ? 60.844  44.137 26.866  1.00 38.86 ? 200 VAL B O   1 
ATOM   4086 C CB  . VAL D 1 112 ? 58.444  44.857 24.538  1.00 39.67 ? 200 VAL B CB  1 
ATOM   4087 C CG1 . VAL D 1 112 ? 59.182  46.174 24.769  1.00 39.24 ? 200 VAL B CG1 1 
ATOM   4088 C CG2 . VAL D 1 112 ? 58.264  44.634 23.039  1.00 39.26 ? 200 VAL B CG2 1 
ATOM   4089 N N   . ALA D 1 113 ? 58.691  44.061 27.491  1.00 40.57 ? 201 ALA B N   1 
ATOM   4090 C CA  . ALA D 1 113 ? 58.971  44.364 28.893  1.00 41.34 ? 201 ALA B CA  1 
ATOM   4091 C C   . ALA D 1 113 ? 59.905  43.325 29.473  1.00 41.84 ? 201 ALA B C   1 
ATOM   4092 O O   . ALA D 1 113 ? 60.604  43.586 30.458  1.00 42.96 ? 201 ALA B O   1 
ATOM   4093 C CB  . ALA D 1 113 ? 57.675  44.400 29.707  1.00 41.33 ? 201 ALA B CB  1 
ATOM   4094 N N   . GLY D 1 114 ? 59.925  42.148 28.862  1.00 41.48 ? 202 GLY B N   1 
ATOM   4095 C CA  . GLY D 1 114 ? 60.786  41.099 29.367  1.00 41.79 ? 202 GLY B CA  1 
ATOM   4096 C C   . GLY D 1 114 ? 62.219  41.132 28.860  1.00 42.10 ? 202 GLY B C   1 
ATOM   4097 O O   . GLY D 1 114 ? 63.079  40.435 29.400  1.00 43.04 ? 202 GLY B O   1 
ATOM   4098 N N   . ASP D 1 115 ? 62.494  41.949 27.848  1.00 41.69 ? 203 ASP B N   1 
ATOM   4099 C CA  . ASP D 1 115 ? 63.830  42.022 27.260  1.00 40.92 ? 203 ASP B CA  1 
ATOM   4100 C C   . ASP D 1 115 ? 64.884  42.710 28.122  1.00 40.75 ? 203 ASP B C   1 
ATOM   4101 O O   . ASP D 1 115 ? 65.977  42.183 28.313  1.00 40.45 ? 203 ASP B O   1 
ATOM   4102 C CB  . ASP D 1 115 ? 63.773  42.751 25.920  1.00 40.98 ? 203 ASP B CB  1 
ATOM   4103 C CG  . ASP D 1 115 ? 65.071  42.659 25.160  1.00 40.83 ? 203 ASP B CG  1 
ATOM   4104 O OD1 . ASP D 1 115 ? 65.282  41.631 24.491  1.00 40.76 ? 203 ASP B OD1 1 
ATOM   4105 O OD2 . ASP D 1 115 ? 65.889  43.600 25.246  1.00 41.28 ? 203 ASP B OD2 1 
ATOM   4106 N N   . SER D 1 116 ? 64.562  43.895 28.628  1.00 40.54 ? 204 SER B N   1 
ATOM   4107 C CA  . SER D 1 116 ? 65.513  44.655 29.435  1.00 40.18 ? 204 SER B CA  1 
ATOM   4108 C C   . SER D 1 116 ? 64.850  45.664 30.373  1.00 40.17 ? 204 SER B C   1 
ATOM   4109 O O   . SER D 1 116 ? 63.705  46.070 30.153  1.00 40.18 ? 204 SER B O   1 
ATOM   4110 C CB  . SER D 1 116 ? 66.467  45.397 28.507  1.00 39.97 ? 204 SER B CB  1 
ATOM   4111 O OG  . SER D 1 116 ? 65.739  46.256 27.648  1.00 39.53 ? 204 SER B OG  1 
ATOM   4112 N N   . THR D 1 117 ? 65.577  46.076 31.412  1.00 40.15 ? 205 THR B N   1 
ATOM   4113 C CA  . THR D 1 117 ? 65.061  47.048 32.381  1.00 40.70 ? 205 THR B CA  1 
ATOM   4114 C C   . THR D 1 117 ? 64.732  48.370 31.693  1.00 41.16 ? 205 THR B C   1 
ATOM   4115 O O   . THR D 1 117 ? 63.939  49.166 32.196  1.00 40.41 ? 205 THR B O   1 
ATOM   4116 C CB  . THR D 1 117 ? 66.071  47.320 33.516  1.00 40.63 ? 205 THR B CB  1 
ATOM   4117 O OG1 . THR D 1 117 ? 67.288  47.834 32.965  1.00 39.48 ? 205 THR B OG1 1 
ATOM   4118 C CG2 . THR D 1 117 ? 66.359  46.040 34.291  1.00 40.88 ? 205 THR B CG2 1 
ATOM   4119 N N   . ASP D 1 118 ? 65.358  48.589 30.540  1.00 42.12 ? 206 ASP B N   1 
ATOM   4120 C CA  . ASP D 1 118 ? 65.137  49.780 29.734  1.00 42.68 ? 206 ASP B CA  1 
ATOM   4121 C C   . ASP D 1 118 ? 63.745  49.654 29.118  1.00 42.66 ? 206 ASP B C   1 
ATOM   4122 O O   . ASP D 1 118 ? 62.870  50.506 29.321  1.00 42.42 ? 206 ASP B O   1 
ATOM   4123 C CB  . ASP D 1 118 ? 66.185  49.843 28.626  1.00 44.44 ? 206 ASP B CB  1 
ATOM   4124 C CG  . ASP D 1 118 ? 67.599  49.927 29.167  1.00 46.34 ? 206 ASP B CG  1 
ATOM   4125 O OD1 . ASP D 1 118 ? 67.943  50.958 29.794  1.00 46.93 ? 206 ASP B OD1 1 
ATOM   4126 O OD2 . ASP D 1 118 ? 68.363  48.956 28.973  1.00 47.37 ? 206 ASP B OD2 1 
ATOM   4127 N N   . TYR D 1 119 ? 63.551  48.575 28.363  1.00 42.23 ? 207 TYR B N   1 
ATOM   4128 C CA  . TYR D 1 119 ? 62.274  48.317 27.730  1.00 41.66 ? 207 TYR B CA  1 
ATOM   4129 C C   . TYR D 1 119 ? 61.187  48.213 28.781  1.00 41.63 ? 207 TYR B C   1 
ATOM   4130 O O   . TYR D 1 119 ? 60.093  48.751 28.600  1.00 41.78 ? 207 TYR B O   1 
ATOM   4131 C CB  . TYR D 1 119 ? 62.357  47.048 26.890  1.00 41.11 ? 207 TYR B CB  1 
ATOM   4132 C CG  . TYR D 1 119 ? 63.194  47.230 25.643  1.00 41.02 ? 207 TYR B CG  1 
ATOM   4133 C CD1 . TYR D 1 119 ? 63.786  48.460 25.364  1.00 40.41 ? 207 TYR B CD1 1 
ATOM   4134 C CD2 . TYR D 1 119 ? 63.351  46.195 24.718  1.00 40.71 ? 207 TYR B CD2 1 
ATOM   4135 C CE1 . TYR D 1 119 ? 64.506  48.664 24.206  1.00 40.60 ? 207 TYR B CE1 1 
ATOM   4136 C CE2 . TYR D 1 119 ? 64.074  46.391 23.544  1.00 41.11 ? 207 TYR B CE2 1 
ATOM   4137 C CZ  . TYR D 1 119 ? 64.647  47.638 23.295  1.00 41.32 ? 207 TYR B CZ  1 
ATOM   4138 O OH  . TYR D 1 119 ? 65.345  47.881 22.131  1.00 42.31 ? 207 TYR B OH  1 
ATOM   4139 N N   . ARG D 1 120 ? 61.488  47.538 29.887  1.00 41.41 ? 208 ARG B N   1 
ATOM   4140 C CA  . ARG D 1 120 ? 60.519  47.412 30.973  1.00 41.48 ? 208 ARG B CA  1 
ATOM   4141 C C   . ARG D 1 120 ? 60.065  48.820 31.353  1.00 41.30 ? 208 ARG B C   1 
ATOM   4142 O O   . ARG D 1 120 ? 58.872  49.088 31.512  1.00 41.51 ? 208 ARG B O   1 
ATOM   4143 C CB  . ARG D 1 120 ? 61.157  46.754 32.198  1.00 40.96 ? 208 ARG B CB  1 
ATOM   4144 C CG  . ARG D 1 120 ? 60.238  46.664 33.412  1.00 40.48 ? 208 ARG B CG  1 
ATOM   4145 C CD  . ARG D 1 120 ? 61.071  46.582 34.676  1.00 40.36 ? 208 ARG B CD  1 
ATOM   4146 N NE  . ARG D 1 120 ? 61.872  47.793 34.833  1.00 40.64 ? 208 ARG B NE  1 
ATOM   4147 C CZ  . ARG D 1 120 ? 62.865  47.948 35.703  1.00 40.74 ? 208 ARG B CZ  1 
ATOM   4148 N NH1 . ARG D 1 120 ? 63.205  46.965 36.522  1.00 41.30 ? 208 ARG B NH1 1 
ATOM   4149 N NH2 . ARG D 1 120 ? 63.525  49.093 35.747  1.00 40.16 ? 208 ARG B NH2 1 
ATOM   4150 N N   . ASP D 1 121 ? 61.028  49.723 31.496  1.00 41.13 ? 209 ASP B N   1 
ATOM   4151 C CA  . ASP D 1 121 ? 60.699  51.087 31.864  1.00 41.53 ? 209 ASP B CA  1 
ATOM   4152 C C   . ASP D 1 121 ? 60.037  51.855 30.727  1.00 41.44 ? 209 ASP B C   1 
ATOM   4153 O O   . ASP D 1 121 ? 59.151  52.687 30.967  1.00 41.19 ? 209 ASP B O   1 
ATOM   4154 C CB  . ASP D 1 121 ? 61.943  51.824 32.360  1.00 41.20 ? 209 ASP B CB  1 
ATOM   4155 C CG  . ASP D 1 121 ? 62.501  51.225 33.642  1.00 40.79 ? 209 ASP B CG  1 
ATOM   4156 O OD1 . ASP D 1 121 ? 61.705  50.918 34.561  1.00 39.33 ? 209 ASP B OD1 1 
ATOM   4157 O OD2 . ASP D 1 121 ? 63.739  51.087 33.741  1.00 42.11 ? 209 ASP B OD2 1 
ATOM   4158 N N   . TYR D 1 122 ? 60.454  51.571 29.495  1.00 41.36 ? 210 TYR B N   1 
ATOM   4159 C CA  . TYR D 1 122 ? 59.868  52.234 28.332  1.00 41.73 ? 210 TYR B CA  1 
ATOM   4160 C C   . TYR D 1 122 ? 58.362  51.966 28.295  1.00 41.53 ? 210 TYR B C   1 
ATOM   4161 O O   . TYR D 1 122 ? 57.564  52.901 28.185  1.00 41.28 ? 210 TYR B O   1 
ATOM   4162 C CB  . TYR D 1 122 ? 60.549  51.742 27.044  1.00 42.82 ? 210 TYR B CB  1 
ATOM   4163 C CG  . TYR D 1 122 ? 59.918  52.233 25.756  1.00 43.70 ? 210 TYR B CG  1 
ATOM   4164 C CD1 . TYR D 1 122 ? 59.577  53.570 25.584  1.00 44.74 ? 210 TYR B CD1 1 
ATOM   4165 C CD2 . TYR D 1 122 ? 59.690  51.360 24.700  1.00 44.45 ? 210 TYR B CD2 1 
ATOM   4166 C CE1 . TYR D 1 122 ? 59.025  54.028 24.392  1.00 45.84 ? 210 TYR B CE1 1 
ATOM   4167 C CE2 . TYR D 1 122 ? 59.139  51.804 23.500  1.00 45.70 ? 210 TYR B CE2 1 
ATOM   4168 C CZ  . TYR D 1 122 ? 58.809  53.141 23.352  1.00 46.31 ? 210 TYR B CZ  1 
ATOM   4169 O OH  . TYR D 1 122 ? 58.264  53.591 22.168  1.00 46.93 ? 210 TYR B OH  1 
ATOM   4170 N N   . VAL D 1 123 ? 57.985  50.691 28.412  1.00 41.01 ? 211 VAL B N   1 
ATOM   4171 C CA  . VAL D 1 123 ? 56.581  50.301 28.410  1.00 40.74 ? 211 VAL B CA  1 
ATOM   4172 C C   . VAL D 1 123 ? 55.840  51.023 29.539  1.00 41.50 ? 211 VAL B C   1 
ATOM   4173 O O   . VAL D 1 123 ? 54.733  51.528 29.339  1.00 41.01 ? 211 VAL B O   1 
ATOM   4174 C CB  . VAL D 1 123 ? 56.415  48.753 28.568  1.00 39.62 ? 211 VAL B CB  1 
ATOM   4175 C CG1 . VAL D 1 123 ? 54.938  48.382 28.684  1.00 38.37 ? 211 VAL B CG1 1 
ATOM   4176 C CG2 . VAL D 1 123 ? 57.024  48.044 27.373  1.00 38.68 ? 211 VAL B CG2 1 
ATOM   4177 N N   . LEU D 1 124 ? 56.442  51.081 30.722  1.00 42.33 ? 212 LEU B N   1 
ATOM   4178 C CA  . LEU D 1 124 ? 55.786  51.767 31.825  1.00 44.07 ? 212 LEU B CA  1 
ATOM   4179 C C   . LEU D 1 124 ? 55.631  53.263 31.537  1.00 45.50 ? 212 LEU B C   1 
ATOM   4180 O O   . LEU D 1 124 ? 54.615  53.873 31.898  1.00 45.76 ? 212 LEU B O   1 
ATOM   4181 C CB  . LEU D 1 124 ? 56.555  51.565 33.129  1.00 43.72 ? 212 LEU B CB  1 
ATOM   4182 C CG  . LEU D 1 124 ? 56.524  50.167 33.748  1.00 43.84 ? 212 LEU B CG  1 
ATOM   4183 C CD1 . LEU D 1 124 ? 57.435  50.155 34.955  1.00 44.18 ? 212 LEU B CD1 1 
ATOM   4184 C CD2 . LEU D 1 124 ? 55.101  49.789 34.154  1.00 43.28 ? 212 LEU B CD2 1 
ATOM   4185 N N   . GLN D 1 125 ? 56.625  53.849 30.870  1.00 46.25 ? 213 GLN B N   1 
ATOM   4186 C CA  . GLN D 1 125 ? 56.567  55.268 30.551  1.00 47.42 ? 213 GLN B CA  1 
ATOM   4187 C C   . GLN D 1 125 ? 55.636  55.645 29.395  1.00 46.95 ? 213 GLN B C   1 
ATOM   4188 O O   . GLN D 1 125 ? 55.391  56.830 29.141  1.00 46.71 ? 213 GLN B O   1 
ATOM   4189 C CB  . GLN D 1 125 ? 57.978  55.812 30.319  1.00 49.94 ? 213 GLN B CB  1 
ATOM   4190 C CG  . GLN D 1 125 ? 58.544  56.588 31.537  1.00 53.11 ? 213 GLN B CG  1 
ATOM   4191 C CD  . GLN D 1 125 ? 58.530  55.789 32.860  1.00 55.08 ? 213 GLN B CD  1 
ATOM   4192 O OE1 . GLN D 1 125 ? 59.228  54.772 32.996  1.00 55.81 ? 213 GLN B OE1 1 
ATOM   4193 N NE2 . GLN D 1 125 ? 57.733  56.255 33.839  1.00 54.95 ? 213 GLN B NE2 1 
ATOM   4194 N N   . CYS D 1 126 ? 55.115  54.643 28.693  1.00 45.88 ? 214 CYS B N   1 
ATOM   4195 C CA  . CYS D 1 126 ? 54.165  54.896 27.614  1.00 44.48 ? 214 CYS B CA  1 
ATOM   4196 C C   . CYS D 1 126 ? 52.759  54.757 28.214  1.00 44.21 ? 214 CYS B C   1 
ATOM   4197 O O   . CYS D 1 126 ? 51.760  54.692 27.495  1.00 43.61 ? 214 CYS B O   1 
ATOM   4198 C CB  . CYS D 1 126 ? 54.352  53.903 26.458  1.00 44.09 ? 214 CYS B CB  1 
ATOM   4199 S SG  . CYS D 1 126 ? 55.806  54.167 25.404  1.00 43.64 ? 214 CYS B SG  1 
ATOM   4200 N N   . ASN D 1 127 ? 52.706  54.698 29.544  1.00 43.79 ? 215 ASN B N   1 
ATOM   4201 C CA  . ASN D 1 127 ? 51.455  54.587 30.289  1.00 43.50 ? 215 ASN B CA  1 
ATOM   4202 C C   . ASN D 1 127 ? 50.616  53.346 29.962  1.00 43.31 ? 215 ASN B C   1 
ATOM   4203 O O   . ASN D 1 127 ? 49.394  53.430 29.793  1.00 43.63 ? 215 ASN B O   1 
ATOM   4204 C CB  . ASN D 1 127 ? 50.628  55.857 30.077  1.00 43.33 ? 215 ASN B CB  1 
ATOM   4205 C CG  . ASN D 1 127 ? 49.351  55.861 30.885  1.00 44.02 ? 215 ASN B CG  1 
ATOM   4206 N N   . ALA D 1 128 ? 51.270  52.190 29.900  1.00 42.77 ? 216 ALA B N   1 
ATOM   4207 C CA  . ALA D 1 128 ? 50.583  50.939 29.605  1.00 41.76 ? 216 ALA B CA  1 
ATOM   4208 C C   . ALA D 1 128 ? 49.826  50.384 30.817  1.00 41.21 ? 216 ALA B C   1 
ATOM   4209 O O   . ALA D 1 128 ? 48.891  49.599 30.664  1.00 40.83 ? 216 ALA B O   1 
ATOM   4210 C CB  . ALA D 1 128 ? 51.585  49.918 29.106  1.00 42.18 ? 216 ALA B CB  1 
ATOM   4211 N N   . MET D 1 129 ? 50.216  50.820 32.013  1.00 40.81 ? 217 MET B N   1 
ATOM   4212 C CA  . MET D 1 129 ? 49.605  50.349 33.256  1.00 40.53 ? 217 MET B CA  1 
ATOM   4213 C C   . MET D 1 129 ? 48.106  50.624 33.392  1.00 41.07 ? 217 MET B C   1 
ATOM   4214 O O   . MET D 1 129 ? 47.368  49.800 33.960  1.00 41.39 ? 217 MET B O   1 
ATOM   4215 C CB  . MET D 1 129 ? 50.351  50.936 34.460  1.00 39.48 ? 217 MET B CB  1 
ATOM   4216 C CG  . MET D 1 129 ? 49.905  50.389 35.810  1.00 39.51 ? 217 MET B CG  1 
ATOM   4217 S SD  . MET D 1 129 ? 50.217  48.619 36.085  1.00 40.13 ? 217 MET B SD  1 
ATOM   4218 C CE  . MET D 1 129 ? 51.930  48.550 36.033  1.00 39.08 ? 217 MET B CE  1 
ATOM   4219 N N   . GLU D 1 130 ? 47.644  51.768 32.885  1.00 41.14 ? 218 GLU B N   1 
ATOM   4220 C CA  . GLU D 1 130 ? 46.218  52.092 32.979  1.00 40.96 ? 218 GLU B CA  1 
ATOM   4221 C C   . GLU D 1 130 ? 45.359  51.039 32.265  1.00 40.54 ? 218 GLU B C   1 
ATOM   4222 O O   . GLU D 1 130 ? 44.544  50.359 32.891  1.00 39.75 ? 218 GLU B O   1 
ATOM   4223 C CB  . GLU D 1 130 ? 45.934  53.486 32.399  1.00 41.28 ? 218 GLU B CB  1 
ATOM   4224 N N   . PRO D 1 131 ? 45.522  50.901 30.939  1.00 40.65 ? 219 PRO B N   1 
ATOM   4225 C CA  . PRO D 1 131 ? 44.715  49.900 30.239  1.00 40.79 ? 219 PRO B CA  1 
ATOM   4226 C C   . PRO D 1 131 ? 44.968  48.475 30.731  1.00 40.62 ? 219 PRO B C   1 
ATOM   4227 O O   . PRO D 1 131 ? 44.043  47.658 30.770  1.00 40.68 ? 219 PRO B O   1 
ATOM   4228 C CB  . PRO D 1 131 ? 45.120  50.108 28.778  1.00 40.72 ? 219 PRO B CB  1 
ATOM   4229 C CG  . PRO D 1 131 ? 46.549  50.563 28.911  1.00 41.20 ? 219 PRO B CG  1 
ATOM   4230 C CD  . PRO D 1 131 ? 46.374  51.616 29.978  1.00 40.65 ? 219 PRO B CD  1 
ATOM   4231 N N   . ILE D 1 132 ? 46.204  48.172 31.119  1.00 40.06 ? 220 ILE B N   1 
ATOM   4232 C CA  . ILE D 1 132 ? 46.498  46.822 31.591  1.00 39.47 ? 220 ILE B CA  1 
ATOM   4233 C C   . ILE D 1 132 ? 45.658  46.436 32.797  1.00 39.46 ? 220 ILE B C   1 
ATOM   4234 O O   . ILE D 1 132 ? 45.165  45.312 32.861  1.00 40.39 ? 220 ILE B O   1 
ATOM   4235 C CB  . ILE D 1 132 ? 47.983  46.629 31.945  1.00 38.89 ? 220 ILE B CB  1 
ATOM   4236 C CG1 . ILE D 1 132 ? 48.836  46.667 30.678  1.00 38.41 ? 220 ILE B CG1 1 
ATOM   4237 C CG2 . ILE D 1 132 ? 48.177  45.289 32.620  1.00 38.88 ? 220 ILE B CG2 1 
ATOM   4238 C CD1 . ILE D 1 132 ? 50.321  46.653 30.952  1.00 37.37 ? 220 ILE B CD1 1 
ATOM   4239 N N   . LEU D 1 133 ? 45.481  47.347 33.748  1.00 38.80 ? 221 LEU B N   1 
ATOM   4240 C CA  . LEU D 1 133 ? 44.680  47.017 34.916  1.00 38.83 ? 221 LEU B CA  1 
ATOM   4241 C C   . LEU D 1 133 ? 43.231  46.728 34.551  1.00 39.00 ? 221 LEU B C   1 
ATOM   4242 O O   . LEU D 1 133 ? 42.549  45.963 35.243  1.00 39.19 ? 221 LEU B O   1 
ATOM   4243 C CB  . LEU D 1 133 ? 44.759  48.134 35.959  1.00 38.49 ? 221 LEU B CB  1 
ATOM   4244 C CG  . LEU D 1 133 ? 46.099  48.155 36.701  1.00 39.42 ? 221 LEU B CG  1 
ATOM   4245 C CD1 . LEU D 1 133 ? 46.148  49.310 37.683  1.00 38.90 ? 221 LEU B CD1 1 
ATOM   4246 C CD2 . LEU D 1 133 ? 46.280  46.820 37.441  1.00 39.10 ? 221 LEU B CD2 1 
ATOM   4247 N N   . GLY D 1 134 ? 42.771  47.327 33.454  1.00 38.81 ? 222 GLY B N   1 
ATOM   4248 C CA  . GLY D 1 134 ? 41.405  47.122 33.003  1.00 38.76 ? 222 GLY B CA  1 
ATOM   4249 C C   . GLY D 1 134 ? 41.174  45.740 32.415  1.00 38.89 ? 222 GLY B C   1 
ATOM   4250 O O   . GLY D 1 134 ? 40.051  45.225 32.421  1.00 38.76 ? 222 GLY B O   1 
ATOM   4251 N N   . LEU D 1 135 ? 42.231  45.133 31.898  1.00 38.62 ? 223 LEU B N   1 
ATOM   4252 C CA  . LEU D 1 135 ? 42.101  43.805 31.329  1.00 39.16 ? 223 LEU B CA  1 
ATOM   4253 C C   . LEU D 1 135 ? 41.581  42.835 32.391  1.00 39.86 ? 223 LEU B C   1 
ATOM   4254 O O   . LEU D 1 135 ? 40.846  41.886 32.087  1.00 40.13 ? 223 LEU B O   1 
ATOM   4255 C CB  . LEU D 1 135 ? 43.453  43.319 30.807  1.00 38.50 ? 223 LEU B CB  1 
ATOM   4256 C CG  . LEU D 1 135 ? 44.092  44.092 29.655  1.00 37.98 ? 223 LEU B CG  1 
ATOM   4257 C CD1 . LEU D 1 135 ? 45.496  43.563 29.419  1.00 36.93 ? 223 LEU B CD1 1 
ATOM   4258 C CD2 . LEU D 1 135 ? 43.229  43.974 28.407  1.00 36.98 ? 223 LEU B CD2 1 
ATOM   4259 N N   . PHE D 1 136 ? 41.941  43.084 33.645  1.00 40.14 ? 224 PHE B N   1 
ATOM   4260 C CA  . PHE D 1 136 ? 41.524  42.189 34.708  1.00 41.17 ? 224 PHE B CA  1 
ATOM   4261 C C   . PHE D 1 136 ? 40.045  42.220 35.058  1.00 42.38 ? 224 PHE B C   1 
ATOM   4262 O O   . PHE D 1 136 ? 39.572  41.363 35.810  1.00 42.72 ? 224 PHE B O   1 
ATOM   4263 C CB  . PHE D 1 136 ? 42.386  42.407 35.960  1.00 40.41 ? 224 PHE B CB  1 
ATOM   4264 C CG  . PHE D 1 136 ? 43.843  42.120 35.736  1.00 39.42 ? 224 PHE B CG  1 
ATOM   4265 C CD1 . PHE D 1 136 ? 44.677  43.074 35.171  1.00 39.77 ? 224 PHE B CD1 1 
ATOM   4266 C CD2 . PHE D 1 136 ? 44.358  40.859 35.991  1.00 39.64 ? 224 PHE B CD2 1 
ATOM   4267 C CE1 . PHE D 1 136 ? 46.008  42.774 34.855  1.00 38.94 ? 224 PHE B CE1 1 
ATOM   4268 C CE2 . PHE D 1 136 ? 45.687  40.549 35.677  1.00 39.92 ? 224 PHE B CE2 1 
ATOM   4269 C CZ  . PHE D 1 136 ? 46.509  41.511 35.106  1.00 39.06 ? 224 PHE B CZ  1 
ATOM   4270 N N   . ASN D 1 137 ? 39.305  43.182 34.512  1.00 43.30 ? 225 ASN B N   1 
ATOM   4271 C CA  . ASN D 1 137 ? 37.873  43.239 34.789  1.00 44.56 ? 225 ASN B CA  1 
ATOM   4272 C C   . ASN D 1 137 ? 37.116  42.257 33.890  1.00 45.56 ? 225 ASN B C   1 
ATOM   4273 O O   . ASN D 1 137 ? 35.886  42.252 33.870  1.00 46.66 ? 225 ASN B O   1 
ATOM   4274 C CB  . ASN D 1 137 ? 37.332  44.654 34.575  1.00 44.19 ? 225 ASN B CB  1 
ATOM   4275 N N   . SER D 1 138 ? 37.836  41.426 33.144  1.00 46.12 ? 226 SER B N   1 
ATOM   4276 C CA  . SER D 1 138 ? 37.165  40.472 32.274  1.00 47.14 ? 226 SER B CA  1 
ATOM   4277 C C   . SER D 1 138 ? 37.038  39.107 32.957  1.00 47.84 ? 226 SER B C   1 
ATOM   4278 O O   . SER D 1 138 ? 37.603  38.873 34.034  1.00 48.03 ? 226 SER B O   1 
ATOM   4279 C CB  . SER D 1 138 ? 37.916  40.314 30.955  1.00 47.06 ? 226 SER B CB  1 
ATOM   4280 O OG  . SER D 1 138 ? 39.147  39.659 31.165  1.00 47.96 ? 226 SER B OG  1 
ATOM   4281 N N   . ASN D 1 139 ? 36.290  38.210 32.324  1.00 47.95 ? 227 ASN B N   1 
ATOM   4282 C CA  . ASN D 1 139 ? 36.074  36.879 32.864  1.00 47.53 ? 227 ASN B CA  1 
ATOM   4283 C C   . ASN D 1 139 ? 36.989  35.852 32.215  1.00 47.32 ? 227 ASN B C   1 
ATOM   4284 O O   . ASN D 1 139 ? 37.304  34.832 32.837  1.00 47.46 ? 227 ASN B O   1 
ATOM   4285 C CB  . ASN D 1 139 ? 34.617  36.453 32.656  1.00 46.95 ? 227 ASN B CB  1 
ATOM   4286 N N   . LYS D 1 140 ? 37.436  36.121 30.985  1.00 46.49 ? 228 LYS B N   1 
ATOM   4287 C CA  . LYS D 1 140 ? 38.272  35.152 30.274  1.00 45.50 ? 228 LYS B CA  1 
ATOM   4288 C C   . LYS D 1 140 ? 39.636  34.890 30.890  1.00 43.75 ? 228 LYS B C   1 
ATOM   4289 O O   . LYS D 1 140 ? 40.523  35.735 30.850  1.00 43.07 ? 228 LYS B O   1 
ATOM   4290 C CB  . LYS D 1 140 ? 38.437  35.530 28.795  1.00 46.74 ? 228 LYS B CB  1 
ATOM   4291 C CG  . LYS D 1 140 ? 39.091  34.397 27.989  1.00 48.19 ? 228 LYS B CG  1 
ATOM   4292 C CD  . LYS D 1 140 ? 38.966  34.583 26.486  1.00 49.63 ? 228 LYS B CD  1 
ATOM   4293 C CE  . LYS D 1 140 ? 39.532  33.367 25.735  1.00 50.56 ? 228 LYS B CE  1 
ATOM   4294 N NZ  . LYS D 1 140 ? 39.353  33.484 24.250  1.00 51.72 ? 228 LYS B NZ  1 
ATOM   4295 N N   . PRO D 1 141 ? 39.817  33.683 31.460  1.00 42.69 ? 229 PRO B N   1 
ATOM   4296 C CA  . PRO D 1 141 ? 41.040  33.216 32.116  1.00 41.63 ? 229 PRO B CA  1 
ATOM   4297 C C   . PRO D 1 141 ? 42.322  33.298 31.288  1.00 40.56 ? 229 PRO B C   1 
ATOM   4298 O O   . PRO D 1 141 ? 43.376  33.665 31.813  1.00 40.76 ? 229 PRO B O   1 
ATOM   4299 C CB  . PRO D 1 141 ? 40.678  31.780 32.506  1.00 41.70 ? 229 PRO B CB  1 
ATOM   4300 C CG  . PRO D 1 141 ? 39.656  31.394 31.449  1.00 41.22 ? 229 PRO B CG  1 
ATOM   4301 C CD  . PRO D 1 141 ? 38.797  32.620 31.521  1.00 42.14 ? 229 PRO B CD  1 
ATOM   4302 N N   . SER D 1 142 ? 42.235  32.956 30.005  1.00 39.20 ? 230 SER B N   1 
ATOM   4303 C CA  . SER D 1 142 ? 43.406  32.999 29.137  1.00 37.87 ? 230 SER B CA  1 
ATOM   4304 C C   . SER D 1 142 ? 43.998  34.403 29.065  1.00 37.02 ? 230 SER B C   1 
ATOM   4305 O O   . SER D 1 142 ? 45.205  34.569 29.244  1.00 36.88 ? 230 SER B O   1 
ATOM   4306 C CB  . SER D 1 142 ? 43.064  32.513 27.723  1.00 37.78 ? 230 SER B CB  1 
ATOM   4307 O OG  . SER D 1 142 ? 42.195  33.404 27.054  1.00 38.23 ? 230 SER B OG  1 
ATOM   4308 N N   . LEU D 1 143 ? 43.160  35.408 28.804  1.00 35.90 ? 231 LEU B N   1 
ATOM   4309 C CA  . LEU D 1 143 ? 43.629  36.784 28.725  1.00 35.38 ? 231 LEU B CA  1 
ATOM   4310 C C   . LEU D 1 143 ? 44.175  37.237 30.078  1.00 35.63 ? 231 LEU B C   1 
ATOM   4311 O O   . LEU D 1 143 ? 45.207  37.920 30.162  1.00 35.17 ? 231 LEU B O   1 
ATOM   4312 C CB  . LEU D 1 143 ? 42.494  37.710 28.295  1.00 35.65 ? 231 LEU B CB  1 
ATOM   4313 C CG  . LEU D 1 143 ? 42.743  39.224 28.331  1.00 34.68 ? 231 LEU B CG  1 
ATOM   4314 C CD1 . LEU D 1 143 ? 43.894  39.578 27.427  1.00 34.37 ? 231 LEU B CD1 1 
ATOM   4315 C CD2 . LEU D 1 143 ? 41.489  39.957 27.896  1.00 34.18 ? 231 LEU B CD2 1 
ATOM   4316 N N   . ILE D 1 144 ? 43.489  36.844 31.143  1.00 35.36 ? 232 ILE B N   1 
ATOM   4317 C CA  . ILE D 1 144 ? 43.920  37.216 32.481  1.00 35.33 ? 232 ILE B CA  1 
ATOM   4318 C C   . ILE D 1 144 ? 45.223  36.535 32.863  1.00 35.14 ? 232 ILE B C   1 
ATOM   4319 O O   . ILE D 1 144 ? 45.981  37.050 33.683  1.00 35.25 ? 232 ILE B O   1 
ATOM   4320 C CB  . ILE D 1 144 ? 42.841  36.888 33.523  1.00 35.66 ? 232 ILE B CB  1 
ATOM   4321 C CG1 . ILE D 1 144 ? 41.652  37.828 33.322  1.00 36.40 ? 232 ILE B CG1 1 
ATOM   4322 C CG2 . ILE D 1 144 ? 43.414  36.991 34.928  1.00 35.24 ? 232 ILE B CG2 1 
ATOM   4323 C CD1 . ILE D 1 144 ? 40.513  37.616 34.294  1.00 37.75 ? 232 ILE B CD1 1 
ATOM   4324 N N   . ARG D 1 145 ? 45.484  35.377 32.268  1.00 34.73 ? 233 ARG B N   1 
ATOM   4325 C CA  . ARG D 1 145 ? 46.711  34.644 32.552  1.00 34.23 ? 233 ARG B CA  1 
ATOM   4326 C C   . ARG D 1 145 ? 47.910  35.310 31.849  1.00 33.37 ? 233 ARG B C   1 
ATOM   4327 O O   . ARG D 1 145 ? 48.996  35.377 32.406  1.00 32.94 ? 233 ARG B O   1 
ATOM   4328 C CB  . ARG D 1 145 ? 46.569  33.189 32.097  1.00 34.74 ? 233 ARG B CB  1 
ATOM   4329 C CG  . ARG D 1 145 ? 47.728  32.291 32.499  1.00 35.63 ? 233 ARG B CG  1 
ATOM   4330 C CD  . ARG D 1 145 ? 47.620  30.910 31.864  1.00 36.84 ? 233 ARG B CD  1 
ATOM   4331 N NE  . ARG D 1 145 ? 46.387  30.203 32.210  1.00 38.45 ? 233 ARG B NE  1 
ATOM   4332 C CZ  . ARG D 1 145 ? 45.460  29.833 31.328  1.00 38.94 ? 233 ARG B CZ  1 
ATOM   4333 N NH1 . ARG D 1 145 ? 45.624  30.103 30.037  1.00 39.24 ? 233 ARG B NH1 1 
ATOM   4334 N NH2 . ARG D 1 145 ? 44.373  29.186 31.734  1.00 39.24 ? 233 ARG B NH2 1 
ATOM   4335 N N   . THR D 1 146 ? 47.713  35.803 30.629  1.00 32.86 ? 234 THR B N   1 
ATOM   4336 C CA  . THR D 1 146 ? 48.795  36.470 29.907  1.00 32.12 ? 234 THR B CA  1 
ATOM   4337 C C   . THR D 1 146 ? 49.044  37.848 30.515  1.00 32.35 ? 234 THR B C   1 
ATOM   4338 O O   . THR D 1 146 ? 50.177  38.310 30.580  1.00 32.04 ? 234 THR B O   1 
ATOM   4339 C CB  . THR D 1 146 ? 48.465  36.657 28.411  1.00 31.79 ? 234 THR B CB  1 
ATOM   4340 O OG1 . THR D 1 146 ? 48.155  35.393 27.819  1.00 31.69 ? 234 THR B OG1 1 
ATOM   4341 C CG2 . THR D 1 146 ? 49.656  37.243 27.677  1.00 31.46 ? 234 THR B CG2 1 
ATOM   4342 N N   . ALA D 1 147 ? 47.984  38.510 30.965  1.00 32.52 ? 235 ALA B N   1 
ATOM   4343 C CA  . ALA D 1 147 ? 48.153  39.826 31.561  1.00 32.33 ? 235 ALA B CA  1 
ATOM   4344 C C   . ALA D 1 147 ? 48.894  39.711 32.880  1.00 32.33 ? 235 ALA B C   1 
ATOM   4345 O O   . ALA D 1 147 ? 49.630  40.625 33.268  1.00 32.80 ? 235 ALA B O   1 
ATOM   4346 C CB  . ALA D 1 147 ? 46.811  40.487 31.784  1.00 32.13 ? 235 ALA B CB  1 
ATOM   4347 N N   . THR D 1 148 ? 48.705  38.592 33.573  1.00 31.73 ? 236 THR B N   1 
ATOM   4348 C CA  . THR D 1 148 ? 49.360  38.404 34.862  1.00 31.55 ? 236 THR B CA  1 
ATOM   4349 C C   . THR D 1 148 ? 50.838  38.152 34.646  1.00 31.75 ? 236 THR B C   1 
ATOM   4350 O O   . THR D 1 148 ? 51.680  38.622 35.401  1.00 32.15 ? 236 THR B O   1 
ATOM   4351 C CB  . THR D 1 148 ? 48.741  37.241 35.649  1.00 31.32 ? 236 THR B CB  1 
ATOM   4352 O OG1 . THR D 1 148 ? 47.341  37.483 35.840  1.00 30.50 ? 236 THR B OG1 1 
ATOM   4353 C CG2 . THR D 1 148 ? 49.386  37.128 37.001  1.00 30.54 ? 236 THR B CG2 1 
ATOM   4354 N N   . TRP D 1 149 ? 51.160  37.410 33.599  1.00 32.36 ? 237 TRP B N   1 
ATOM   4355 C CA  . TRP D 1 149 ? 52.553  37.140 33.283  1.00 32.30 ? 237 TRP B CA  1 
ATOM   4356 C C   . TRP D 1 149 ? 53.217  38.474 32.930  1.00 32.30 ? 237 TRP B C   1 
ATOM   4357 O O   . TRP D 1 149 ? 54.156  38.887 33.586  1.00 33.27 ? 237 TRP B O   1 
ATOM   4358 C CB  . TRP D 1 149 ? 52.632  36.156 32.119  1.00 32.28 ? 237 TRP B CB  1 
ATOM   4359 C CG  . TRP D 1 149 ? 53.971  36.066 31.496  1.00 32.57 ? 237 TRP B CG  1 
ATOM   4360 C CD1 . TRP D 1 149 ? 55.131  35.663 32.088  1.00 32.30 ? 237 TRP B CD1 1 
ATOM   4361 C CD2 . TRP D 1 149 ? 54.305  36.429 30.160  1.00 32.94 ? 237 TRP B CD2 1 
ATOM   4362 N NE1 . TRP D 1 149 ? 56.171  35.753 31.196  1.00 32.34 ? 237 TRP B NE1 1 
ATOM   4363 C CE2 . TRP D 1 149 ? 55.693  36.216 30.002  1.00 32.73 ? 237 TRP B CE2 1 
ATOM   4364 C CE3 . TRP D 1 149 ? 53.561  36.908 29.071  1.00 33.20 ? 237 TRP B CE3 1 
ATOM   4365 C CZ2 . TRP D 1 149 ? 56.358  36.478 28.803  1.00 32.98 ? 237 TRP B CZ2 1 
ATOM   4366 C CZ3 . TRP D 1 149 ? 54.221  37.167 27.881  1.00 33.71 ? 237 TRP B CZ3 1 
ATOM   4367 C CH2 . TRP D 1 149 ? 55.609  36.950 27.755  1.00 33.37 ? 237 TRP B CH2 1 
ATOM   4368 N N   . THR D 1 150 ? 52.721  39.147 31.898  1.00 32.24 ? 238 THR B N   1 
ATOM   4369 C CA  . THR D 1 150 ? 53.247  40.451 31.495  1.00 31.40 ? 238 THR B CA  1 
ATOM   4370 C C   . THR D 1 150 ? 53.449  41.408 32.680  1.00 31.66 ? 238 THR B C   1 
ATOM   4371 O O   . THR D 1 150 ? 54.446  42.125 32.733  1.00 31.51 ? 238 THR B O   1 
ATOM   4372 C CB  . THR D 1 150 ? 52.293  41.139 30.527  1.00 30.26 ? 238 THR B CB  1 
ATOM   4373 O OG1 . THR D 1 150 ? 52.191  40.368 29.331  1.00 29.76 ? 238 THR B OG1 1 
ATOM   4374 C CG2 . THR D 1 150 ? 52.782  42.523 30.202  1.00 29.79 ? 238 THR B CG2 1 
ATOM   4375 N N   . LEU D 1 151 ? 52.497  41.432 33.613  1.00 31.75 ? 239 LEU B N   1 
ATOM   4376 C CA  . LEU D 1 151 ? 52.577  42.305 34.788  1.00 31.73 ? 239 LEU B CA  1 
ATOM   4377 C C   . LEU D 1 151 ? 53.821  41.943 35.601  1.00 32.26 ? 239 LEU B C   1 
ATOM   4378 O O   . LEU D 1 151 ? 54.507  42.811 36.161  1.00 32.29 ? 239 LEU B O   1 
ATOM   4379 C CB  . LEU D 1 151 ? 51.331  42.115 35.656  1.00 31.76 ? 239 LEU B CB  1 
ATOM   4380 C CG  . LEU D 1 151 ? 51.071  43.089 36.807  1.00 31.01 ? 239 LEU B CG  1 
ATOM   4381 C CD1 . LEU D 1 151 ? 50.831  44.483 36.250  1.00 29.62 ? 239 LEU B CD1 1 
ATOM   4382 C CD2 . LEU D 1 151 ? 49.852  42.626 37.587  1.00 30.35 ? 239 LEU B CD2 1 
ATOM   4383 N N   . SER D 1 152 ? 54.100  40.641 35.652  1.00 32.32 ? 240 SER B N   1 
ATOM   4384 C CA  . SER D 1 152 ? 55.244  40.109 36.376  1.00 32.25 ? 240 SER B CA  1 
ATOM   4385 C C   . SER D 1 152 ? 56.526  40.732 35.840  1.00 32.60 ? 240 SER B C   1 
ATOM   4386 O O   . SER D 1 152 ? 57.334  41.249 36.608  1.00 32.59 ? 240 SER B O   1 
ATOM   4387 C CB  . SER D 1 152 ? 55.288  38.592 36.215  1.00 32.63 ? 240 SER B CB  1 
ATOM   4388 O OG  . SER D 1 152 ? 56.152  38.010 37.163  1.00 33.71 ? 240 SER B OG  1 
ATOM   4389 N N   . ASN D 1 153 ? 56.717  40.688 34.523  1.00 32.99 ? 241 ASN B N   1 
ATOM   4390 C CA  . ASN D 1 153 ? 57.908  41.275 33.928  1.00 33.42 ? 241 ASN B CA  1 
ATOM   4391 C C   . ASN D 1 153 ? 58.011  42.778 34.226  1.00 35.04 ? 241 ASN B C   1 
ATOM   4392 O O   . ASN D 1 153 ? 59.114  43.297 34.446  1.00 35.27 ? 241 ASN B O   1 
ATOM   4393 C CB  . ASN D 1 153 ? 57.956  41.043 32.407  1.00 32.67 ? 241 ASN B CB  1 
ATOM   4394 C CG  . ASN D 1 153 ? 58.211  39.570 32.033  1.00 32.40 ? 241 ASN B CG  1 
ATOM   4395 O OD1 . ASN D 1 153 ? 58.958  38.862 32.711  1.00 32.24 ? 241 ASN B OD1 1 
ATOM   4396 N ND2 . ASN D 1 153 ? 57.619  39.125 30.928  1.00 31.80 ? 241 ASN B ND2 1 
ATOM   4397 N N   . LEU D 1 154 ? 56.880  43.485 34.248  1.00 35.28 ? 242 LEU B N   1 
ATOM   4398 C CA  . LEU D 1 154 ? 56.928  44.912 34.530  1.00 35.92 ? 242 LEU B CA  1 
ATOM   4399 C C   . LEU D 1 154 ? 57.471  45.188 35.932  1.00 37.53 ? 242 LEU B C   1 
ATOM   4400 O O   . LEU D 1 154 ? 58.240  46.131 36.131  1.00 37.62 ? 242 LEU B O   1 
ATOM   4401 C CB  . LEU D 1 154 ? 55.541  45.532 34.366  1.00 34.83 ? 242 LEU B CB  1 
ATOM   4402 C CG  . LEU D 1 154 ? 55.022  45.556 32.927  1.00 33.87 ? 242 LEU B CG  1 
ATOM   4403 C CD1 . LEU D 1 154 ? 53.559  45.910 32.912  1.00 32.38 ? 242 LEU B CD1 1 
ATOM   4404 C CD2 . LEU D 1 154 ? 55.832  46.532 32.104  1.00 32.89 ? 242 LEU B CD2 1 
ATOM   4405 N N   . CYS D 1 155 ? 57.084  44.358 36.898  1.00 39.09 ? 243 CYS B N   1 
ATOM   4406 C CA  . CYS D 1 155 ? 57.529  44.523 38.286  1.00 39.94 ? 243 CYS B CA  1 
ATOM   4407 C C   . CYS D 1 155 ? 58.946  44.019 38.559  1.00 40.83 ? 243 CYS B C   1 
ATOM   4408 O O   . CYS D 1 155 ? 59.625  44.527 39.456  1.00 40.80 ? 243 CYS B O   1 
ATOM   4409 C CB  . CYS D 1 155 ? 56.568  43.806 39.237  1.00 39.68 ? 243 CYS B CB  1 
ATOM   4410 S SG  . CYS D 1 155 ? 54.904  44.462 39.252  1.00 39.13 ? 243 CYS B SG  1 
ATOM   4411 N N   . ARG D 1 156 ? 59.384  43.025 37.790  1.00 41.71 ? 244 ARG B N   1 
ATOM   4412 C CA  . ARG D 1 156 ? 60.711  42.428 37.961  1.00 42.73 ? 244 ARG B CA  1 
ATOM   4413 C C   . ARG D 1 156 ? 61.862  43.372 37.627  1.00 43.82 ? 244 ARG B C   1 
ATOM   4414 O O   . ARG D 1 156 ? 61.822  44.101 36.636  1.00 43.55 ? 244 ARG B O   1 
ATOM   4415 C CB  . ARG D 1 156 ? 60.830  41.169 37.105  1.00 42.32 ? 244 ARG B CB  1 
ATOM   4416 C CG  . ARG D 1 156 ? 62.086  40.364 37.342  1.00 41.72 ? 244 ARG B CG  1 
ATOM   4417 C CD  . ARG D 1 156 ? 62.013  39.065 36.577  1.00 42.25 ? 244 ARG B CD  1 
ATOM   4418 N NE  . ARG D 1 156 ? 63.081  38.141 36.940  1.00 42.84 ? 244 ARG B NE  1 
ATOM   4419 C CZ  . ARG D 1 156 ? 63.153  36.882 36.514  1.00 43.26 ? 244 ARG B CZ  1 
ATOM   4420 N NH1 . ARG D 1 156 ? 62.212  36.403 35.705  1.00 43.25 ? 244 ARG B NH1 1 
ATOM   4421 N NH2 . ARG D 1 156 ? 64.155  36.099 36.909  1.00 43.48 ? 244 ARG B NH2 1 
ATOM   4422 N N   . GLY D 1 157 ? 62.897  43.335 38.460  1.00 45.53 ? 245 GLY B N   1 
ATOM   4423 C CA  . GLY D 1 157 ? 64.054  44.192 38.266  1.00 47.14 ? 245 GLY B CA  1 
ATOM   4424 C C   . GLY D 1 157 ? 64.378  44.899 39.564  1.00 48.29 ? 245 GLY B C   1 
ATOM   4425 O O   . GLY D 1 157 ? 63.538  45.594 40.134  1.00 48.87 ? 245 GLY B O   1 
ATOM   4426 N N   . LYS D 1 158 ? 65.596  44.721 40.050  1.00 49.65 ? 246 LYS B N   1 
ATOM   4427 C CA  . LYS D 1 158 ? 65.975  45.348 41.300  1.00 50.73 ? 246 LYS B CA  1 
ATOM   4428 C C   . LYS D 1 158 ? 67.225  46.159 41.076  1.00 51.26 ? 246 LYS B C   1 
ATOM   4429 O O   . LYS D 1 158 ? 67.631  46.929 41.943  1.00 51.89 ? 246 LYS B O   1 
ATOM   4430 C CB  . LYS D 1 158 ? 66.193  44.296 42.389  1.00 51.65 ? 246 LYS B CB  1 
ATOM   4431 C CG  . LYS D 1 158 ? 66.240  44.880 43.785  1.00 52.85 ? 246 LYS B CG  1 
ATOM   4432 C CD  . LYS D 1 158 ? 66.250  43.799 44.853  1.00 53.65 ? 246 LYS B CD  1 
ATOM   4433 C CE  . LYS D 1 158 ? 67.489  42.935 44.773  1.00 53.88 ? 246 LYS B CE  1 
ATOM   4434 N NZ  . LYS D 1 158 ? 67.440  41.885 45.825  1.00 55.68 ? 246 LYS B NZ  1 
ATOM   4435 N N   . LYS D 1 159 ? 67.859  45.972 39.920  1.00 51.68 ? 247 LYS B N   1 
ATOM   4436 C CA  . LYS D 1 159 ? 69.023  46.786 39.582  1.00 52.08 ? 247 LYS B CA  1 
ATOM   4437 C C   . LYS D 1 159 ? 68.215  48.058 39.331  1.00 52.22 ? 247 LYS B C   1 
ATOM   4438 O O   . LYS D 1 159 ? 67.491  48.494 40.226  1.00 53.26 ? 247 LYS B O   1 
ATOM   4439 C CB  . LYS D 1 159 ? 69.697  46.267 38.307  1.00 52.17 ? 247 LYS B CB  1 
ATOM   4440 N N   . PRO D 1 160 ? 68.302  48.689 38.149  1.00 51.72 ? 248 PRO B N   1 
ATOM   4441 C CA  . PRO D 1 160 ? 67.406  49.846 38.204  1.00 51.44 ? 248 PRO B CA  1 
ATOM   4442 C C   . PRO D 1 160 ? 65.976  49.326 38.443  1.00 51.48 ? 248 PRO B C   1 
ATOM   4443 O O   . PRO D 1 160 ? 65.400  48.673 37.571  1.00 51.51 ? 248 PRO B O   1 
ATOM   4444 C CB  . PRO D 1 160 ? 67.589  50.465 36.826  1.00 51.21 ? 248 PRO B CB  1 
ATOM   4445 C CG  . PRO D 1 160 ? 67.946  49.244 35.968  1.00 51.30 ? 248 PRO B CG  1 
ATOM   4446 C CD  . PRO D 1 160 ? 68.985  48.633 36.847  1.00 51.06 ? 248 PRO B CD  1 
ATOM   4447 N N   . GLN D 1 161 ? 65.422  49.575 39.630  1.00 51.26 ? 249 GLN B N   1 
ATOM   4448 C CA  . GLN D 1 161 ? 64.070  49.113 39.925  1.00 51.74 ? 249 GLN B CA  1 
ATOM   4449 C C   . GLN D 1 161 ? 63.016  49.927 39.183  1.00 51.31 ? 249 GLN B C   1 
ATOM   4450 O O   . GLN D 1 161 ? 63.232  51.096 38.867  1.00 51.92 ? 249 GLN B O   1 
ATOM   4451 C CB  . GLN D 1 161 ? 63.774  49.171 41.424  1.00 52.66 ? 249 GLN B CB  1 
ATOM   4452 C CG  . GLN D 1 161 ? 64.531  48.165 42.260  1.00 54.18 ? 249 GLN B CG  1 
ATOM   4453 C CD  . GLN D 1 161 ? 63.693  47.659 43.416  1.00 55.25 ? 249 GLN B CD  1 
ATOM   4454 O OE1 . GLN D 1 161 ? 62.670  47.018 43.211  1.00 56.61 ? 249 GLN B OE1 1 
ATOM   4455 N NE2 . GLN D 1 161 ? 64.117  47.952 44.632  1.00 55.88 ? 249 GLN B NE2 1 
ATOM   4456 N N   . PRO D 1 162 ? 61.852  49.320 38.910  1.00 50.46 ? 250 PRO B N   1 
ATOM   4457 C CA  . PRO D 1 162 ? 60.758  49.989 38.200  1.00 49.87 ? 250 PRO B CA  1 
ATOM   4458 C C   . PRO D 1 162 ? 60.203  51.158 38.998  1.00 49.63 ? 250 PRO B C   1 
ATOM   4459 O O   . PRO D 1 162 ? 60.305  51.170 40.224  1.00 49.83 ? 250 PRO B O   1 
ATOM   4460 C CB  . PRO D 1 162 ? 59.734  48.871 38.059  1.00 49.88 ? 250 PRO B CB  1 
ATOM   4461 C CG  . PRO D 1 162 ? 59.945  48.107 39.360  1.00 49.55 ? 250 PRO B CG  1 
ATOM   4462 C CD  . PRO D 1 162 ? 61.446  47.951 39.266  1.00 49.87 ? 250 PRO B CD  1 
ATOM   4463 N N   . ASP D 1 163 ? 59.605  52.119 38.293  1.00 49.37 ? 251 ASP B N   1 
ATOM   4464 C CA  . ASP D 1 163 ? 58.984  53.316 38.882  1.00 49.11 ? 251 ASP B CA  1 
ATOM   4465 C C   . ASP D 1 163 ? 57.942  52.909 39.947  1.00 48.44 ? 251 ASP B C   1 
ATOM   4466 O O   . ASP D 1 163 ? 56.845  52.455 39.609  1.00 48.41 ? 251 ASP B O   1 
ATOM   4467 C CB  . ASP D 1 163 ? 58.293  54.106 37.766  1.00 50.32 ? 251 ASP B CB  1 
ATOM   4468 C CG  . ASP D 1 163 ? 57.925  55.523 38.175  1.00 51.48 ? 251 ASP B CG  1 
ATOM   4469 O OD1 . ASP D 1 163 ? 57.350  55.728 39.269  1.00 52.23 ? 251 ASP B OD1 1 
ATOM   4470 O OD2 . ASP D 1 163 ? 58.198  56.437 37.371  1.00 52.39 ? 251 ASP B OD2 1 
ATOM   4471 N N   . TRP D 1 164 ? 58.266  53.095 41.225  1.00 47.86 ? 252 TRP B N   1 
ATOM   4472 C CA  . TRP D 1 164 ? 57.348  52.686 42.289  1.00 47.47 ? 252 TRP B CA  1 
ATOM   4473 C C   . TRP D 1 164 ? 55.956  53.307 42.266  1.00 47.22 ? 252 TRP B C   1 
ATOM   4474 O O   . TRP D 1 164 ? 54.980  52.635 42.607  1.00 47.04 ? 252 TRP B O   1 
ATOM   4475 C CB  . TRP D 1 164 ? 57.985  52.887 43.678  1.00 47.01 ? 252 TRP B CB  1 
ATOM   4476 C CG  . TRP D 1 164 ? 57.064  52.501 44.814  1.00 46.53 ? 252 TRP B CG  1 
ATOM   4477 C CD1 . TRP D 1 164 ? 56.290  53.339 45.556  1.00 46.70 ? 252 TRP B CD1 1 
ATOM   4478 C CD2 . TRP D 1 164 ? 56.721  51.168 45.232  1.00 46.72 ? 252 TRP B CD2 1 
ATOM   4479 N NE1 . TRP D 1 164 ? 55.479  52.620 46.406  1.00 46.56 ? 252 TRP B NE1 1 
ATOM   4480 C CE2 . TRP D 1 164 ? 55.721  51.285 46.226  1.00 46.60 ? 252 TRP B CE2 1 
ATOM   4481 C CE3 . TRP D 1 164 ? 57.156  49.888 44.859  1.00 46.49 ? 252 TRP B CE3 1 
ATOM   4482 C CZ2 . TRP D 1 164 ? 55.149  50.171 46.852  1.00 46.58 ? 252 TRP B CZ2 1 
ATOM   4483 C CZ3 . TRP D 1 164 ? 56.585  48.779 45.479  1.00 46.21 ? 252 TRP B CZ3 1 
ATOM   4484 C CH2 . TRP D 1 164 ? 55.593  48.930 46.467  1.00 46.64 ? 252 TRP B CH2 1 
ATOM   4485 N N   . SER D 1 165 ? 55.856  54.569 41.861  1.00 46.70 ? 253 SER B N   1 
ATOM   4486 C CA  . SER D 1 165 ? 54.561  55.242 41.815  1.00 46.29 ? 253 SER B CA  1 
ATOM   4487 C C   . SER D 1 165 ? 53.645  54.612 40.771  1.00 45.99 ? 253 SER B C   1 
ATOM   4488 O O   . SER D 1 165 ? 52.420  54.772 40.824  1.00 45.21 ? 253 SER B O   1 
ATOM   4489 C CB  . SER D 1 165 ? 54.741  56.746 41.538  1.00 46.72 ? 253 SER B CB  1 
ATOM   4490 O OG  . SER D 1 165 ? 55.464  56.999 40.340  1.00 47.58 ? 253 SER B OG  1 
ATOM   4491 N N   . VAL D 1 166 ? 54.239  53.886 39.826  1.00 45.71 ? 254 VAL B N   1 
ATOM   4492 C CA  . VAL D 1 166 ? 53.456  53.224 38.789  1.00 45.10 ? 254 VAL B CA  1 
ATOM   4493 C C   . VAL D 1 166 ? 53.115  51.789 39.187  1.00 45.06 ? 254 VAL B C   1 
ATOM   4494 O O   . VAL D 1 166 ? 51.938  51.446 39.355  1.00 45.14 ? 254 VAL B O   1 
ATOM   4495 C CB  . VAL D 1 166 ? 54.207  53.192 37.431  1.00 44.77 ? 254 VAL B CB  1 
ATOM   4496 C CG1 . VAL D 1 166 ? 53.345  52.507 36.376  1.00 44.25 ? 254 VAL B CG1 1 
ATOM   4497 C CG2 . VAL D 1 166 ? 54.561  54.603 36.991  1.00 43.76 ? 254 VAL B CG2 1 
ATOM   4498 N N   . VAL D 1 167 ? 54.141  50.956 39.356  1.00 44.73 ? 255 VAL B N   1 
ATOM   4499 C CA  . VAL D 1 167 ? 53.915  49.552 39.699  1.00 44.47 ? 255 VAL B CA  1 
ATOM   4500 C C   . VAL D 1 167 ? 53.139  49.321 40.989  1.00 44.93 ? 255 VAL B C   1 
ATOM   4501 O O   . VAL D 1 167 ? 52.402  48.343 41.089  1.00 45.18 ? 255 VAL B O   1 
ATOM   4502 C CB  . VAL D 1 167 ? 55.237  48.749 39.770  1.00 43.33 ? 255 VAL B CB  1 
ATOM   4503 C CG1 . VAL D 1 167 ? 55.784  48.524 38.383  1.00 42.94 ? 255 VAL B CG1 1 
ATOM   4504 C CG2 . VAL D 1 167 ? 56.246  49.489 40.605  1.00 42.81 ? 255 VAL B CG2 1 
ATOM   4505 N N   . SER D 1 168 ? 53.290  50.213 41.967  1.00 45.12 ? 256 SER B N   1 
ATOM   4506 C CA  . SER D 1 168 ? 52.584  50.068 43.247  1.00 44.61 ? 256 SER B CA  1 
ATOM   4507 C C   . SER D 1 168 ? 51.072  49.975 43.050  1.00 44.13 ? 256 SER B C   1 
ATOM   4508 O O   . SER D 1 168 ? 50.368  49.348 43.841  1.00 43.98 ? 256 SER B O   1 
ATOM   4509 C CB  . SER D 1 168 ? 52.902  51.247 44.184  1.00 44.85 ? 256 SER B CB  1 
ATOM   4510 O OG  . SER D 1 168 ? 52.482  52.492 43.634  1.00 44.39 ? 256 SER B OG  1 
ATOM   4511 N N   . GLN D 1 169 ? 50.584  50.603 41.988  1.00 43.63 ? 257 GLN B N   1 
ATOM   4512 C CA  . GLN D 1 169 ? 49.160  50.606 41.683  1.00 43.38 ? 257 GLN B CA  1 
ATOM   4513 C C   . GLN D 1 169 ? 48.550  49.231 41.416  1.00 42.79 ? 257 GLN B C   1 
ATOM   4514 O O   . GLN D 1 169 ? 47.339  49.063 41.515  1.00 43.48 ? 257 GLN B O   1 
ATOM   4515 C CB  . GLN D 1 169 ? 48.900  51.534 40.492  1.00 43.55 ? 257 GLN B CB  1 
ATOM   4516 C CG  . GLN D 1 169 ? 49.018  53.010 40.856  1.00 45.29 ? 257 GLN B CG  1 
ATOM   4517 C CD  . GLN D 1 169 ? 48.825  53.950 39.676  1.00 45.83 ? 257 GLN B CD  1 
ATOM   4518 O OE1 . GLN D 1 169 ? 49.740  54.175 38.883  1.00 45.96 ? 257 GLN B OE1 1 
ATOM   4519 N NE2 . GLN D 1 169 ? 47.615  54.491 39.545  1.00 46.76 ? 257 GLN B NE2 1 
ATOM   4520 N N   . ALA D 1 170 ? 49.379  48.246 41.095  1.00 41.73 ? 258 ALA B N   1 
ATOM   4521 C CA  . ALA D 1 170 ? 48.876  46.915 40.790  1.00 41.24 ? 258 ALA B CA  1 
ATOM   4522 C C   . ALA D 1 170 ? 48.547  46.061 42.009  1.00 40.98 ? 258 ALA B C   1 
ATOM   4523 O O   . ALA D 1 170 ? 47.881  45.029 41.886  1.00 40.85 ? 258 ALA B O   1 
ATOM   4524 C CB  . ALA D 1 170 ? 49.871  46.185 39.896  1.00 40.81 ? 258 ALA B CB  1 
ATOM   4525 N N   . LEU D 1 171 ? 48.992  46.493 43.183  1.00 40.69 ? 259 LEU B N   1 
ATOM   4526 C CA  . LEU D 1 171 ? 48.754  45.738 44.410  1.00 40.65 ? 259 LEU B CA  1 
ATOM   4527 C C   . LEU D 1 171 ? 47.322  45.288 44.640  1.00 40.81 ? 259 LEU B C   1 
ATOM   4528 O O   . LEU D 1 171 ? 47.073  44.118 44.924  1.00 40.98 ? 259 LEU B O   1 
ATOM   4529 C CB  . LEU D 1 171 ? 49.241  46.523 45.629  1.00 40.64 ? 259 LEU B CB  1 
ATOM   4530 C CG  . LEU D 1 171 ? 50.761  46.679 45.740  1.00 41.06 ? 259 LEU B CG  1 
ATOM   4531 C CD1 . LEU D 1 171 ? 51.124  47.534 46.942  1.00 40.59 ? 259 LEU B CD1 1 
ATOM   4532 C CD2 . LEU D 1 171 ? 51.386  45.299 45.864  1.00 41.42 ? 259 LEU B CD2 1 
ATOM   4533 N N   . PRO D 1 172 ? 46.352  46.206 44.529  1.00 40.90 ? 260 PRO B N   1 
ATOM   4534 C CA  . PRO D 1 172 ? 44.974  45.760 44.757  1.00 41.11 ? 260 PRO B CA  1 
ATOM   4535 C C   . PRO D 1 172 ? 44.536  44.595 43.851  1.00 41.12 ? 260 PRO B C   1 
ATOM   4536 O O   . PRO D 1 172 ? 43.873  43.650 44.310  1.00 41.15 ? 260 PRO B O   1 
ATOM   4537 C CB  . PRO D 1 172 ? 44.177  47.046 44.529  1.00 40.83 ? 260 PRO B CB  1 
ATOM   4538 C CG  . PRO D 1 172 ? 45.166  48.109 45.003  1.00 40.38 ? 260 PRO B CG  1 
ATOM   4539 C CD  . PRO D 1 172 ? 46.373  47.644 44.227  1.00 40.39 ? 260 PRO B CD  1 
ATOM   4540 N N   . THR D 1 173 ? 44.905  44.667 42.572  1.00 40.74 ? 261 THR B N   1 
ATOM   4541 C CA  . THR D 1 173 ? 44.560  43.619 41.613  1.00 39.90 ? 261 THR B CA  1 
ATOM   4542 C C   . THR D 1 173 ? 45.244  42.322 42.026  1.00 39.92 ? 261 THR B C   1 
ATOM   4543 O O   . THR D 1 173 ? 44.604  41.269 42.090  1.00 39.41 ? 261 THR B O   1 
ATOM   4544 C CB  . THR D 1 173 ? 45.010  43.988 40.195  1.00 39.42 ? 261 THR B CB  1 
ATOM   4545 O OG1 . THR D 1 173 ? 44.351  45.190 39.786  1.00 38.69 ? 261 THR B OG1 1 
ATOM   4546 C CG2 . THR D 1 173 ? 44.675  42.869 39.226  1.00 38.87 ? 261 THR B CG2 1 
ATOM   4547 N N   . LEU D 1 174 ? 46.548  42.414 42.299  1.00 39.66 ? 262 LEU B N   1 
ATOM   4548 C CA  . LEU D 1 174 ? 47.347  41.274 42.744  1.00 39.77 ? 262 LEU B CA  1 
ATOM   4549 C C   . LEU D 1 174 ? 46.705  40.599 43.952  1.00 39.62 ? 262 LEU B C   1 
ATOM   4550 O O   . LEU D 1 174 ? 46.594  39.373 44.005  1.00 39.97 ? 262 LEU B O   1 
ATOM   4551 C CB  . LEU D 1 174 ? 48.766  41.730 43.109  1.00 40.39 ? 262 LEU B CB  1 
ATOM   4552 C CG  . LEU D 1 174 ? 49.833  41.835 42.006  1.00 41.23 ? 262 LEU B CG  1 
ATOM   4553 C CD1 . LEU D 1 174 ? 49.280  42.544 40.792  1.00 42.40 ? 262 LEU B CD1 1 
ATOM   4554 C CD2 . LEU D 1 174 ? 51.052  42.563 42.545  1.00 40.46 ? 262 LEU B CD2 1 
ATOM   4555 N N   . ALA D 1 175 ? 46.289  41.412 44.921  1.00 38.89 ? 263 ALA B N   1 
ATOM   4556 C CA  . ALA D 1 175 ? 45.648  40.920 46.127  1.00 38.01 ? 263 ALA B CA  1 
ATOM   4557 C C   . ALA D 1 175 ? 44.537  39.934 45.783  1.00 38.02 ? 263 ALA B C   1 
ATOM   4558 O O   . ALA D 1 175 ? 44.371  38.922 46.462  1.00 38.77 ? 263 ALA B O   1 
ATOM   4559 C CB  . ALA D 1 175 ? 45.090  42.075 46.911  1.00 38.09 ? 263 ALA B CB  1 
ATOM   4560 N N   . LYS D 1 176 ? 43.778  40.219 44.727  1.00 37.41 ? 264 LYS B N   1 
ATOM   4561 C CA  . LYS D 1 176 ? 42.693  39.332 44.315  1.00 36.95 ? 264 LYS B CA  1 
ATOM   4562 C C   . LYS D 1 176 ? 43.271  38.108 43.592  1.00 36.66 ? 264 LYS B C   1 
ATOM   4563 O O   . LYS D 1 176 ? 42.909  36.962 43.879  1.00 36.94 ? 264 LYS B O   1 
ATOM   4564 C CB  . LYS D 1 176 ? 41.723  40.072 43.381  1.00 36.76 ? 264 LYS B CB  1 
ATOM   4565 C CG  . LYS D 1 176 ? 41.062  41.315 43.980  1.00 36.57 ? 264 LYS B CG  1 
ATOM   4566 N N   . LEU D 1 177 ? 44.181  38.375 42.661  1.00 36.00 ? 265 LEU B N   1 
ATOM   4567 C CA  . LEU D 1 177 ? 44.829  37.348 41.860  1.00 35.15 ? 265 LEU B CA  1 
ATOM   4568 C C   . LEU D 1 177 ? 45.389  36.167 42.641  1.00 35.05 ? 265 LEU B C   1 
ATOM   4569 O O   . LEU D 1 177 ? 45.443  35.050 42.116  1.00 35.12 ? 265 LEU B O   1 
ATOM   4570 C CB  . LEU D 1 177 ? 45.935  37.973 41.005  1.00 34.31 ? 265 LEU B CB  1 
ATOM   4571 C CG  . LEU D 1 177 ? 45.463  38.954 39.928  1.00 34.17 ? 265 LEU B CG  1 
ATOM   4572 C CD1 . LEU D 1 177 ? 46.660  39.484 39.153  1.00 33.18 ? 265 LEU B CD1 1 
ATOM   4573 C CD2 . LEU D 1 177 ? 44.484  38.260 38.981  1.00 34.06 ? 265 LEU B CD2 1 
ATOM   4574 N N   . ILE D 1 178 ? 45.809  36.391 43.881  1.00 34.63 ? 266 ILE B N   1 
ATOM   4575 C CA  . ILE D 1 178 ? 46.335  35.279 44.664  1.00 34.69 ? 266 ILE B CA  1 
ATOM   4576 C C   . ILE D 1 178 ? 45.272  34.324 45.237  1.00 34.95 ? 266 ILE B C   1 
ATOM   4577 O O   . ILE D 1 178 ? 45.585  33.504 46.096  1.00 34.76 ? 266 ILE B O   1 
ATOM   4578 C CB  . ILE D 1 178 ? 47.286  35.765 45.801  1.00 34.54 ? 266 ILE B CB  1 
ATOM   4579 C CG1 . ILE D 1 178 ? 46.676  36.941 46.559  1.00 34.34 ? 266 ILE B CG1 1 
ATOM   4580 C CG2 . ILE D 1 178 ? 48.643  36.123 45.222  1.00 33.49 ? 266 ILE B CG2 1 
ATOM   4581 C CD1 . ILE D 1 178 ? 47.566  37.441 47.692  1.00 35.63 ? 266 ILE B CD1 1 
ATOM   4582 N N   . TYR D 1 179 ? 44.021  34.447 44.770  1.00 35.43 ? 267 TYR B N   1 
ATOM   4583 C CA  . TYR D 1 179 ? 42.923  33.556 45.178  1.00 36.01 ? 267 TYR B CA  1 
ATOM   4584 C C   . TYR D 1 179 ? 42.399  32.889 43.920  1.00 37.20 ? 267 TYR B C   1 
ATOM   4585 O O   . TYR D 1 179 ? 41.283  32.374 43.905  1.00 36.96 ? 267 TYR B O   1 
ATOM   4586 C CB  . TYR D 1 179 ? 41.741  34.290 45.828  1.00 34.59 ? 267 TYR B CB  1 
ATOM   4587 C CG  . TYR D 1 179 ? 42.013  34.856 47.194  1.00 34.12 ? 267 TYR B CG  1 
ATOM   4588 C CD1 . TYR D 1 179 ? 42.651  36.083 47.338  1.00 33.19 ? 267 TYR B CD1 1 
ATOM   4589 C CD2 . TYR D 1 179 ? 41.681  34.138 48.351  1.00 33.11 ? 267 TYR B CD2 1 
ATOM   4590 C CE1 . TYR D 1 179 ? 42.962  36.583 48.592  1.00 33.43 ? 267 TYR B CE1 1 
ATOM   4591 C CE2 . TYR D 1 179 ? 41.993  34.636 49.621  1.00 33.01 ? 267 TYR B CE2 1 
ATOM   4592 C CZ  . TYR D 1 179 ? 42.637  35.862 49.730  1.00 32.92 ? 267 TYR B CZ  1 
ATOM   4593 O OH  . TYR D 1 179 ? 42.991  36.370 50.960  1.00 32.01 ? 267 TYR B OH  1 
ATOM   4594 N N   . SER D 1 180 ? 43.208  32.911 42.865  1.00 38.13 ? 268 SER B N   1 
ATOM   4595 C CA  . SER D 1 180 ? 42.814  32.333 41.589  1.00 39.55 ? 268 SER B CA  1 
ATOM   4596 C C   . SER D 1 180 ? 42.900  30.810 41.568  1.00 40.61 ? 268 SER B C   1 
ATOM   4597 O O   . SER D 1 180 ? 43.709  30.219 42.267  1.00 41.37 ? 268 SER B O   1 
ATOM   4598 C CB  . SER D 1 180 ? 43.683  32.920 40.481  1.00 39.16 ? 268 SER B CB  1 
ATOM   4599 O OG  . SER D 1 180 ? 43.296  32.413 39.222  1.00 38.72 ? 268 SER B OG  1 
ATOM   4600 N N   . MET D 1 181 ? 42.058  30.173 40.766  1.00 41.75 ? 269 MET B N   1 
ATOM   4601 C CA  . MET D 1 181 ? 42.069  28.716 40.666  1.00 42.80 ? 269 MET B CA  1 
ATOM   4602 C C   . MET D 1 181 ? 43.158  28.281 39.687  1.00 41.49 ? 269 MET B C   1 
ATOM   4603 O O   . MET D 1 181 ? 43.688  27.179 39.785  1.00 41.73 ? 269 MET B O   1 
ATOM   4604 C CB  . MET D 1 181 ? 40.710  28.188 40.160  1.00 45.67 ? 269 MET B CB  1 
ATOM   4605 C CG  . MET D 1 181 ? 39.493  28.461 41.064  1.00 49.45 ? 269 MET B CG  1 
ATOM   4606 S SD  . MET D 1 181 ? 39.482  27.577 42.670  1.00 54.04 ? 269 MET B SD  1 
ATOM   4607 C CE  . MET D 1 181 ? 39.388  25.844 42.161  1.00 53.46 ? 269 MET B CE  1 
ATOM   4608 N N   . ASP D 1 182 ? 43.476  29.158 38.740  1.00 40.01 ? 270 ASP B N   1 
ATOM   4609 C CA  . ASP D 1 182 ? 44.471  28.890 37.696  1.00 38.33 ? 270 ASP B CA  1 
ATOM   4610 C C   . ASP D 1 182 ? 45.904  28.906 38.238  1.00 37.80 ? 270 ASP B C   1 
ATOM   4611 O O   . ASP D 1 182 ? 46.405  29.952 38.661  1.00 38.30 ? 270 ASP B O   1 
ATOM   4612 C CB  . ASP D 1 182 ? 44.323  29.934 36.583  1.00 37.65 ? 270 ASP B CB  1 
ATOM   4613 C CG  . ASP D 1 182 ? 45.239  29.675 35.401  1.00 37.45 ? 270 ASP B CG  1 
ATOM   4614 O OD1 . ASP D 1 182 ? 45.053  28.642 34.723  1.00 38.30 ? 270 ASP B OD1 1 
ATOM   4615 O OD2 . ASP D 1 182 ? 46.143  30.497 35.142  1.00 35.76 ? 270 ASP B OD2 1 
ATOM   4616 N N   . THR D 1 183 ? 46.572  27.757 38.203  1.00 36.38 ? 271 THR B N   1 
ATOM   4617 C CA  . THR D 1 183 ? 47.932  27.666 38.728  1.00 35.08 ? 271 THR B CA  1 
ATOM   4618 C C   . THR D 1 183 ? 48.932  28.590 38.045  1.00 34.65 ? 271 THR B C   1 
ATOM   4619 O O   . THR D 1 183 ? 49.739  29.237 38.713  1.00 33.94 ? 271 THR B O   1 
ATOM   4620 C CB  . THR D 1 183 ? 48.474  26.217 38.659  1.00 34.93 ? 271 THR B CB  1 
ATOM   4621 O OG1 . THR D 1 183 ? 47.678  25.365 39.489  1.00 34.48 ? 271 THR B OG1 1 
ATOM   4622 C CG2 . THR D 1 183 ? 49.924  26.164 39.145  1.00 34.64 ? 271 THR B CG2 1 
ATOM   4623 N N   . GLU D 1 184 ? 48.891  28.656 36.719  1.00 33.98 ? 272 GLU B N   1 
ATOM   4624 C CA  . GLU D 1 184 ? 49.827  29.519 36.009  1.00 33.03 ? 272 GLU B CA  1 
ATOM   4625 C C   . GLU D 1 184 ? 49.632  30.973 36.436  1.00 31.65 ? 272 GLU B C   1 
ATOM   4626 O O   . GLU D 1 184 ? 50.600  31.664 36.715  1.00 31.05 ? 272 GLU B O   1 
ATOM   4627 C CB  . GLU D 1 184 ? 49.655  29.357 34.496  1.00 34.12 ? 272 GLU B CB  1 
ATOM   4628 C CG  . GLU D 1 184 ? 50.952  29.070 33.762  1.00 34.77 ? 272 GLU B CG  1 
ATOM   4629 C CD  . GLU D 1 184 ? 50.719  28.645 32.329  1.00 37.53 ? 272 GLU B CD  1 
ATOM   4630 O OE1 . GLU D 1 184 ? 49.939  27.686 32.120  1.00 38.76 ? 272 GLU B OE1 1 
ATOM   4631 O OE2 . GLU D 1 184 ? 51.315  29.254 31.405  1.00 39.15 ? 272 GLU B OE2 1 
ATOM   4632 N N   . THR D 1 185 ? 48.386  31.432 36.503  1.00 31.05 ? 273 THR B N   1 
ATOM   4633 C CA  . THR D 1 185 ? 48.110  32.806 36.936  1.00 30.66 ? 273 THR B CA  1 
ATOM   4634 C C   . THR D 1 185 ? 48.618  33.006 38.357  1.00 30.67 ? 273 THR B C   1 
ATOM   4635 O O   . THR D 1 185 ? 49.399  33.912 38.638  1.00 29.95 ? 273 THR B O   1 
ATOM   4636 C CB  . THR D 1 185 ? 46.603  33.121 36.938  1.00 30.28 ? 273 THR B CB  1 
ATOM   4637 O OG1 . THR D 1 185 ? 46.113  33.181 35.591  1.00 30.95 ? 273 THR B OG1 1 
ATOM   4638 C CG2 . THR D 1 185 ? 46.344  34.444 37.641  1.00 30.48 ? 273 THR B CG2 1 
ATOM   4639 N N   . LEU D 1 186 ? 48.152  32.139 39.245  1.00 31.01 ? 274 LEU B N   1 
ATOM   4640 C CA  . LEU D 1 186 ? 48.519  32.164 40.652  1.00 31.24 ? 274 LEU B CA  1 
ATOM   4641 C C   . LEU D 1 186 ? 50.046  32.281 40.815  1.00 31.65 ? 274 LEU B C   1 
ATOM   4642 O O   . LEU D 1 186 ? 50.550  33.136 41.558  1.00 31.67 ? 274 LEU B O   1 
ATOM   4643 C CB  . LEU D 1 186 ? 48.035  30.872 41.325  1.00 31.19 ? 274 LEU B CB  1 
ATOM   4644 C CG  . LEU D 1 186 ? 47.854  30.826 42.842  1.00 31.15 ? 274 LEU B CG  1 
ATOM   4645 C CD1 . LEU D 1 186 ? 47.923  29.377 43.295  1.00 31.23 ? 274 LEU B CD1 1 
ATOM   4646 C CD2 . LEU D 1 186 ? 48.942  31.614 43.531  1.00 31.74 ? 274 LEU B CD2 1 
ATOM   4647 N N   . VAL D 1 187 ? 50.778  31.412 40.125  1.00 31.38 ? 275 VAL B N   1 
ATOM   4648 C CA  . VAL D 1 187 ? 52.235  31.416 40.220  1.00 30.98 ? 275 VAL B CA  1 
ATOM   4649 C C   . VAL D 1 187 ? 52.853  32.759 39.878  1.00 30.77 ? 275 VAL B C   1 
ATOM   4650 O O   . VAL D 1 187 ? 53.642  33.297 40.666  1.00 30.72 ? 275 VAL B O   1 
ATOM   4651 C CB  . VAL D 1 187 ? 52.861  30.309 39.332  1.00 31.42 ? 275 VAL B CB  1 
ATOM   4652 C CG1 . VAL D 1 187 ? 54.365  30.515 39.207  1.00 29.98 ? 275 VAL B CG1 1 
ATOM   4653 C CG2 . VAL D 1 187 ? 52.559  28.933 39.952  1.00 30.78 ? 275 VAL B CG2 1 
ATOM   4654 N N   . ASP D 1 188 ? 52.506  33.310 38.717  1.00 30.25 ? 276 ASP B N   1 
ATOM   4655 C CA  . ASP D 1 188 ? 53.053  34.609 38.345  1.00 29.61 ? 276 ASP B CA  1 
ATOM   4656 C C   . ASP D 1 188 ? 52.599  35.784 39.217  1.00 29.68 ? 276 ASP B C   1 
ATOM   4657 O O   . ASP D 1 188 ? 53.292  36.791 39.277  1.00 30.10 ? 276 ASP B O   1 
ATOM   4658 C CB  . ASP D 1 188 ? 52.767  34.938 36.884  1.00 29.38 ? 276 ASP B CB  1 
ATOM   4659 C CG  . ASP D 1 188 ? 53.626  34.137 35.925  1.00 29.40 ? 276 ASP B CG  1 
ATOM   4660 O OD1 . ASP D 1 188 ? 54.820  33.932 36.230  1.00 28.61 ? 276 ASP B OD1 1 
ATOM   4661 O OD2 . ASP D 1 188 ? 53.117  33.742 34.853  1.00 29.43 ? 276 ASP B OD2 1 
ATOM   4662 N N   . ALA D 1 189 ? 51.444  35.681 39.874  1.00 29.53 ? 277 ALA B N   1 
ATOM   4663 C CA  . ALA D 1 189 ? 50.983  36.762 40.744  1.00 29.15 ? 277 ALA B CA  1 
ATOM   4664 C C   . ALA D 1 189 ? 51.891  36.812 41.980  1.00 29.50 ? 277 ALA B C   1 
ATOM   4665 O O   . ALA D 1 189 ? 52.273  37.890 42.439  1.00 28.96 ? 277 ALA B O   1 
ATOM   4666 C CB  . ALA D 1 189 ? 49.531  36.538 41.160  1.00 28.79 ? 277 ALA B CB  1 
ATOM   4667 N N   . CYS D 1 190 ? 52.236  35.644 42.520  1.00 29.75 ? 278 CYS B N   1 
ATOM   4668 C CA  . CYS D 1 190 ? 53.120  35.586 43.681  1.00 29.79 ? 278 CYS B CA  1 
ATOM   4669 C C   . CYS D 1 190 ? 54.523  36.160 43.340  1.00 30.82 ? 278 CYS B C   1 
ATOM   4670 O O   . CYS D 1 190 ? 55.093  36.934 44.132  1.00 31.41 ? 278 CYS B O   1 
ATOM   4671 C CB  . CYS D 1 190 ? 53.243  34.146 44.190  1.00 28.89 ? 278 CYS B CB  1 
ATOM   4672 S SG  . CYS D 1 190 ? 51.731  33.414 44.876  1.00 28.32 ? 278 CYS B SG  1 
ATOM   4673 N N   . TRP D 1 191 ? 55.086  35.787 42.187  1.00 30.02 ? 279 TRP B N   1 
ATOM   4674 C CA  . TRP D 1 191 ? 56.386  36.321 41.787  1.00 29.60 ? 279 TRP B CA  1 
ATOM   4675 C C   . TRP D 1 191 ? 56.352  37.845 41.671  1.00 30.13 ? 279 TRP B C   1 
ATOM   4676 O O   . TRP D 1 191 ? 57.317  38.533 42.009  1.00 30.86 ? 279 TRP B O   1 
ATOM   4677 C CB  . TRP D 1 191 ? 56.845  35.750 40.440  1.00 29.41 ? 279 TRP B CB  1 
ATOM   4678 C CG  . TRP D 1 191 ? 57.514  34.410 40.528  1.00 28.61 ? 279 TRP B CG  1 
ATOM   4679 C CD1 . TRP D 1 191 ? 57.023  33.210 40.092  1.00 28.60 ? 279 TRP B CD1 1 
ATOM   4680 C CD2 . TRP D 1 191 ? 58.781  34.131 41.125  1.00 27.64 ? 279 TRP B CD2 1 
ATOM   4681 N NE1 . TRP D 1 191 ? 57.911  32.204 40.387  1.00 28.79 ? 279 TRP B NE1 1 
ATOM   4682 C CE2 . TRP D 1 191 ? 58.996  32.739 41.026  1.00 27.22 ? 279 TRP B CE2 1 
ATOM   4683 C CE3 . TRP D 1 191 ? 59.756  34.925 41.747  1.00 27.25 ? 279 TRP B CE3 1 
ATOM   4684 C CZ2 . TRP D 1 191 ? 60.148  32.123 41.512  1.00 26.91 ? 279 TRP B CZ2 1 
ATOM   4685 C CZ3 . TRP D 1 191 ? 60.903  34.311 42.231  1.00 27.05 ? 279 TRP B CZ3 1 
ATOM   4686 C CH2 . TRP D 1 191 ? 61.089  32.919 42.115  1.00 27.01 ? 279 TRP B CH2 1 
ATOM   4687 N N   . ALA D 1 192 ? 55.248  38.377 41.168  1.00 30.07 ? 280 ALA B N   1 
ATOM   4688 C CA  . ALA D 1 192 ? 55.109  39.821 41.027  1.00 29.47 ? 280 ALA B CA  1 
ATOM   4689 C C   . ALA D 1 192 ? 55.129  40.475 42.406  1.00 29.61 ? 280 ALA B C   1 
ATOM   4690 O O   . ALA D 1 192 ? 55.849  41.448 42.624  1.00 29.37 ? 280 ALA B O   1 
ATOM   4691 C CB  . ALA D 1 192 ? 53.806  40.154 40.299  1.00 28.97 ? 280 ALA B CB  1 
ATOM   4692 N N   . ILE D 1 193 ? 54.334  39.943 43.335  1.00 29.85 ? 281 ILE B N   1 
ATOM   4693 C CA  . ILE D 1 193 ? 54.286  40.475 44.695  1.00 30.12 ? 281 ILE B CA  1 
ATOM   4694 C C   . ILE D 1 193 ? 55.667  40.386 45.359  1.00 31.79 ? 281 ILE B C   1 
ATOM   4695 O O   . ILE D 1 193 ? 56.036  41.271 46.122  1.00 32.03 ? 281 ILE B O   1 
ATOM   4696 C CB  . ILE D 1 193 ? 53.245  39.712 45.576  1.00 29.06 ? 281 ILE B CB  1 
ATOM   4697 C CG1 . ILE D 1 193 ? 51.843  39.898 44.995  1.00 26.71 ? 281 ILE B CG1 1 
ATOM   4698 C CG2 . ILE D 1 193 ? 53.338  40.177 47.044  1.00 27.48 ? 281 ILE B CG2 1 
ATOM   4699 C CD1 . ILE D 1 193 ? 50.781  39.160 45.723  1.00 25.50 ? 281 ILE B CD1 1 
ATOM   4700 N N   . SER D 1 194 ? 56.425  39.325 45.072  1.00 33.32 ? 282 SER B N   1 
ATOM   4701 C CA  . SER D 1 194 ? 57.756  39.168 45.655  1.00 34.88 ? 282 SER B CA  1 
ATOM   4702 C C   . SER D 1 194 ? 58.730  40.185 45.082  1.00 35.97 ? 282 SER B C   1 
ATOM   4703 O O   . SER D 1 194 ? 59.696  40.550 45.738  1.00 36.47 ? 282 SER B O   1 
ATOM   4704 C CB  . SER D 1 194 ? 58.309  37.748 45.436  1.00 35.18 ? 282 SER B CB  1 
ATOM   4705 O OG  . SER D 1 194 ? 58.612  37.471 44.077  1.00 35.28 ? 282 SER B OG  1 
ATOM   4706 N N   . TYR D 1 195 ? 58.484  40.634 43.857  1.00 37.71 ? 283 TYR B N   1 
ATOM   4707 C CA  . TYR D 1 195 ? 59.342  41.635 43.222  1.00 39.53 ? 283 TYR B CA  1 
ATOM   4708 C C   . TYR D 1 195 ? 59.067  43.014 43.818  1.00 40.61 ? 283 TYR B C   1 
ATOM   4709 O O   . TYR D 1 195 ? 59.976  43.822 43.972  1.00 41.01 ? 283 TYR B O   1 
ATOM   4710 C CB  . TYR D 1 195 ? 59.078  41.689 41.715  1.00 39.39 ? 283 TYR B CB  1 
ATOM   4711 C CG  . TYR D 1 195 ? 59.449  40.431 40.968  1.00 39.29 ? 283 TYR B CG  1 
ATOM   4712 C CD1 . TYR D 1 195 ? 60.396  39.544 41.475  1.00 39.21 ? 283 TYR B CD1 1 
ATOM   4713 C CD2 . TYR D 1 195 ? 58.867  40.136 39.737  1.00 39.04 ? 283 TYR B CD2 1 
ATOM   4714 C CE1 . TYR D 1 195 ? 60.754  38.392 40.774  1.00 38.26 ? 283 TYR B CE1 1 
ATOM   4715 C CE2 . TYR D 1 195 ? 59.216  38.989 39.031  1.00 38.46 ? 283 TYR B CE2 1 
ATOM   4716 C CZ  . TYR D 1 195 ? 60.159  38.123 39.553  1.00 38.26 ? 283 TYR B CZ  1 
ATOM   4717 O OH  . TYR D 1 195 ? 60.510  36.996 38.848  1.00 37.51 ? 283 TYR B OH  1 
ATOM   4718 N N   . LEU D 1 196 ? 57.805  43.288 44.133  1.00 41.82 ? 284 LEU B N   1 
ATOM   4719 C CA  . LEU D 1 196 ? 57.441  44.580 44.709  1.00 43.48 ? 284 LEU B CA  1 
ATOM   4720 C C   . LEU D 1 196 ? 57.856  44.635 46.172  1.00 44.40 ? 284 LEU B C   1 
ATOM   4721 O O   . LEU D 1 196 ? 57.958  45.710 46.757  1.00 44.44 ? 284 LEU B O   1 
ATOM   4722 C CB  . LEU D 1 196 ? 55.923  44.834 44.589  1.00 43.71 ? 284 LEU B CB  1 
ATOM   4723 C CG  . LEU D 1 196 ? 55.305  45.012 43.191  1.00 43.65 ? 284 LEU B CG  1 
ATOM   4724 C CD1 . LEU D 1 196 ? 53.794  45.235 43.303  1.00 44.09 ? 284 LEU B CD1 1 
ATOM   4725 C CD2 . LEU D 1 196 ? 55.967  46.193 42.495  1.00 43.14 ? 284 LEU B CD2 1 
ATOM   4726 N N   . SER D 1 197 ? 58.114  43.467 46.750  1.00 45.63 ? 285 SER B N   1 
ATOM   4727 C CA  . SER D 1 197 ? 58.506  43.377 48.146  1.00 46.63 ? 285 SER B CA  1 
ATOM   4728 C C   . SER D 1 197 ? 59.998  43.525 48.362  1.00 47.78 ? 285 SER B C   1 
ATOM   4729 O O   . SER D 1 197 ? 60.435  43.791 49.476  1.00 48.06 ? 285 SER B O   1 
ATOM   4730 C CB  . SER D 1 197 ? 58.056  42.044 48.719  1.00 46.22 ? 285 SER B CB  1 
ATOM   4731 O OG  . SER D 1 197 ? 56.657  41.940 48.630  1.00 47.33 ? 285 SER B OG  1 
ATOM   4732 N N   . ASP D 1 198 ? 60.788  43.338 47.313  1.00 49.17 ? 286 ASP B N   1 
ATOM   4733 C CA  . ASP D 1 198 ? 62.229  43.452 47.469  1.00 51.36 ? 286 ASP B CA  1 
ATOM   4734 C C   . ASP D 1 198 ? 62.675  44.897 47.627  1.00 52.05 ? 286 ASP B C   1 
ATOM   4735 O O   . ASP D 1 198 ? 63.811  45.232 47.303  1.00 52.39 ? 286 ASP B O   1 
ATOM   4736 C CB  . ASP D 1 198 ? 62.965  42.839 46.275  1.00 52.81 ? 286 ASP B CB  1 
ATOM   4737 C CG  . ASP D 1 198 ? 62.527  43.434 44.942  1.00 55.19 ? 286 ASP B CG  1 
ATOM   4738 O OD1 . ASP D 1 198 ? 62.215  44.653 44.871  1.00 55.98 ? 286 ASP B OD1 1 
ATOM   4739 O OD2 . ASP D 1 198 ? 62.523  42.678 43.946  1.00 56.47 ? 286 ASP B OD2 1 
ATOM   4740 N N   . GLY D 1 199 ? 61.798  45.753 48.138  1.00 52.62 ? 287 GLY B N   1 
ATOM   4741 C CA  . GLY D 1 199 ? 62.170  47.148 48.284  1.00 52.98 ? 287 GLY B CA  1 
ATOM   4742 C C   . GLY D 1 199 ? 62.264  47.718 49.689  1.00 53.24 ? 287 GLY B C   1 
ATOM   4743 O O   . GLY D 1 199 ? 62.407  46.985 50.677  1.00 52.91 ? 287 GLY B O   1 
ATOM   4744 N N   . PRO D 1 200 ? 62.213  49.057 49.791  1.00 53.33 ? 288 PRO B N   1 
ATOM   4745 C CA  . PRO D 1 200 ? 62.282  49.845 51.025  1.00 53.31 ? 288 PRO B CA  1 
ATOM   4746 C C   . PRO D 1 200 ? 61.052  49.681 51.915  1.00 53.19 ? 288 PRO B C   1 
ATOM   4747 O O   . PRO D 1 200 ? 60.050  49.086 51.511  1.00 52.92 ? 288 PRO B O   1 
ATOM   4748 C CB  . PRO D 1 200 ? 62.417  51.269 50.492  1.00 53.35 ? 288 PRO B CB  1 
ATOM   4749 C CG  . PRO D 1 200 ? 61.540  51.211 49.260  1.00 53.36 ? 288 PRO B CG  1 
ATOM   4750 C CD  . PRO D 1 200 ? 62.134  49.965 48.633  1.00 53.61 ? 288 PRO B CD  1 
ATOM   4751 N N   . GLN D 1 201 ? 61.133  50.226 53.124  1.00 52.79 ? 289 GLN B N   1 
ATOM   4752 C CA  . GLN D 1 201 ? 60.027  50.142 54.059  1.00 52.82 ? 289 GLN B CA  1 
ATOM   4753 C C   . GLN D 1 201 ? 58.713  50.612 53.452  1.00 51.81 ? 289 GLN B C   1 
ATOM   4754 O O   . GLN D 1 201 ? 57.653  50.065 53.760  1.00 51.52 ? 289 GLN B O   1 
ATOM   4755 C CB  . GLN D 1 201 ? 60.336  50.945 55.323  1.00 54.43 ? 289 GLN B CB  1 
ATOM   4756 C CG  . GLN D 1 201 ? 61.455  50.335 56.153  1.00 57.80 ? 289 GLN B CG  1 
ATOM   4757 C CD  . GLN D 1 201 ? 61.703  51.066 57.459  1.00 59.46 ? 289 GLN B CD  1 
ATOM   4758 O OE1 . GLN D 1 201 ? 60.797  51.208 58.290  1.00 60.99 ? 289 GLN B OE1 1 
ATOM   4759 N NE2 . GLN D 1 201 ? 62.939  51.530 57.653  1.00 59.62 ? 289 GLN B NE2 1 
ATOM   4760 N N   . GLU D 1 202 ? 58.776  51.622 52.589  1.00 50.57 ? 290 GLU B N   1 
ATOM   4761 C CA  . GLU D 1 202 ? 57.562  52.127 51.955  1.00 49.24 ? 290 GLU B CA  1 
ATOM   4762 C C   . GLU D 1 202 ? 56.870  50.992 51.195  1.00 47.78 ? 290 GLU B C   1 
ATOM   4763 O O   . GLU D 1 202 ? 55.661  50.803 51.312  1.00 47.68 ? 290 GLU B O   1 
ATOM   4764 C CB  . GLU D 1 202 ? 57.893  53.281 50.998  1.00 49.55 ? 290 GLU B CB  1 
ATOM   4765 N N   . ALA D 1 203 ? 57.651  50.229 50.436  1.00 46.41 ? 291 ALA B N   1 
ATOM   4766 C CA  . ALA D 1 203 ? 57.122  49.117 49.659  1.00 44.40 ? 291 ALA B CA  1 
ATOM   4767 C C   . ALA D 1 203 ? 56.563  48.028 50.561  1.00 43.53 ? 291 ALA B C   1 
ATOM   4768 O O   . ALA D 1 203 ? 55.481  47.491 50.299  1.00 43.96 ? 291 ALA B O   1 
ATOM   4769 C CB  . ALA D 1 203 ? 58.201  48.551 48.765  1.00 44.20 ? 291 ALA B CB  1 
ATOM   4770 N N   . ILE D 1 204 ? 57.290  47.699 51.624  1.00 41.92 ? 292 ILE B N   1 
ATOM   4771 C CA  . ILE D 1 204 ? 56.821  46.671 52.542  1.00 40.20 ? 292 ILE B CA  1 
ATOM   4772 C C   . ILE D 1 204 ? 55.498  47.069 53.183  1.00 39.64 ? 292 ILE B C   1 
ATOM   4773 O O   . ILE D 1 204 ? 54.624  46.226 53.387  1.00 39.87 ? 292 ILE B O   1 
ATOM   4774 C CB  . ILE D 1 204 ? 57.856  46.393 53.653  1.00 40.19 ? 292 ILE B CB  1 
ATOM   4775 C CG1 . ILE D 1 204 ? 59.150  45.882 53.026  1.00 40.04 ? 292 ILE B CG1 1 
ATOM   4776 C CG2 . ILE D 1 204 ? 57.328  45.350 54.639  1.00 39.94 ? 292 ILE B CG2 1 
ATOM   4777 C CD1 . ILE D 1 204 ? 60.193  45.504 54.034  1.00 40.41 ? 292 ILE B CD1 1 
ATOM   4778 N N   . GLN D 1 205 ? 55.332  48.357 53.479  1.00 39.28 ? 293 GLN B N   1 
ATOM   4779 C CA  . GLN D 1 205 ? 54.102  48.830 54.124  1.00 38.50 ? 293 GLN B CA  1 
ATOM   4780 C C   . GLN D 1 205 ? 52.900  48.726 53.208  1.00 37.58 ? 293 GLN B C   1 
ATOM   4781 O O   . GLN D 1 205 ? 51.781  48.473 53.664  1.00 36.50 ? 293 GLN B O   1 
ATOM   4782 C CB  . GLN D 1 205 ? 54.246  50.281 54.599  1.00 38.94 ? 293 GLN B CB  1 
ATOM   4783 C CG  . GLN D 1 205 ? 53.198  50.671 55.631  1.00 40.21 ? 293 GLN B CG  1 
ATOM   4784 C CD  . GLN D 1 205 ? 53.230  49.759 56.865  1.00 41.72 ? 293 GLN B CD  1 
ATOM   4785 O OE1 . GLN D 1 205 ? 54.263  49.638 57.536  1.00 42.69 ? 293 GLN B OE1 1 
ATOM   4786 N NE2 . GLN D 1 205 ? 52.100  49.116 57.165  1.00 41.20 ? 293 GLN B NE2 1 
ATOM   4787 N N   . ALA D 1 206 ? 53.144  48.918 51.914  1.00 36.95 ? 294 ALA B N   1 
ATOM   4788 C CA  . ALA D 1 206 ? 52.086  48.843 50.917  1.00 37.04 ? 294 ALA B CA  1 
ATOM   4789 C C   . ALA D 1 206 ? 51.499  47.434 50.842  1.00 36.92 ? 294 ALA B C   1 
ATOM   4790 O O   . ALA D 1 206 ? 50.283  47.258 50.863  1.00 36.42 ? 294 ALA B O   1 
ATOM   4791 C CB  . ALA D 1 206 ? 52.625  49.267 49.553  1.00 37.03 ? 294 ALA B CB  1 
ATOM   4792 N N   . VAL D 1 207 ? 52.369  46.434 50.758  1.00 37.53 ? 295 VAL B N   1 
ATOM   4793 C CA  . VAL D 1 207 ? 51.919  45.049 50.691  1.00 38.11 ? 295 VAL B CA  1 
ATOM   4794 C C   . VAL D 1 207 ? 51.144  44.725 51.951  1.00 38.84 ? 295 VAL B C   1 
ATOM   4795 O O   . VAL D 1 207 ? 50.113  44.049 51.912  1.00 38.34 ? 295 VAL B O   1 
ATOM   4796 C CB  . VAL D 1 207 ? 53.105  44.050 50.601  1.00 37.90 ? 295 VAL B CB  1 
ATOM   4797 C CG1 . VAL D 1 207 ? 52.579  42.627 50.581  1.00 37.29 ? 295 VAL B CG1 1 
ATOM   4798 C CG2 . VAL D 1 207 ? 53.932  44.316 49.358  1.00 37.72 ? 295 VAL B CG2 1 
ATOM   4799 N N   . ILE D 1 208 ? 51.651  45.209 53.078  1.00 40.03 ? 296 ILE B N   1 
ATOM   4800 C CA  . ILE D 1 208 ? 50.998  44.940 54.346  1.00 41.79 ? 296 ILE B CA  1 
ATOM   4801 C C   . ILE D 1 208 ? 49.610  45.543 54.427  1.00 42.32 ? 296 ILE B C   1 
ATOM   4802 O O   . ILE D 1 208 ? 48.671  44.880 54.870  1.00 42.83 ? 296 ILE B O   1 
ATOM   4803 C CB  . ILE D 1 208 ? 51.845  45.443 55.538  1.00 42.35 ? 296 ILE B CB  1 
ATOM   4804 C CG1 . ILE D 1 208 ? 53.110  44.584 55.681  1.00 42.94 ? 296 ILE B CG1 1 
ATOM   4805 C CG2 . ILE D 1 208 ? 51.025  45.386 56.817  1.00 42.49 ? 296 ILE B CG2 1 
ATOM   4806 C CD1 . ILE D 1 208 ? 54.045  45.009 56.807  1.00 42.74 ? 296 ILE B CD1 1 
ATOM   4807 N N   . ASP D 1 209 ? 49.474  46.788 53.983  1.00 42.97 ? 297 ASP B N   1 
ATOM   4808 C CA  . ASP D 1 209 ? 48.191  47.474 54.042  1.00 43.64 ? 297 ASP B CA  1 
ATOM   4809 C C   . ASP D 1 209 ? 47.110  46.924 53.133  1.00 43.69 ? 297 ASP B C   1 
ATOM   4810 O O   . ASP D 1 209 ? 45.920  47.073 53.420  1.00 43.71 ? 297 ASP B O   1 
ATOM   4811 C CB  . ASP D 1 209 ? 48.372  48.962 53.765  1.00 44.80 ? 297 ASP B CB  1 
ATOM   4812 C CG  . ASP D 1 209 ? 49.243  49.636 54.797  1.00 45.93 ? 297 ASP B CG  1 
ATOM   4813 O OD1 . ASP D 1 209 ? 49.014  49.385 56.005  1.00 46.45 ? 297 ASP B OD1 1 
ATOM   4814 O OD2 . ASP D 1 209 ? 50.135  50.423 54.403  1.00 45.93 ? 297 ASP B OD2 1 
ATOM   4815 N N   . VAL D 1 210 ? 47.508  46.298 52.032  1.00 43.70 ? 298 VAL B N   1 
ATOM   4816 C CA  . VAL D 1 210 ? 46.524  45.737 51.123  1.00 43.29 ? 298 VAL B CA  1 
ATOM   4817 C C   . VAL D 1 210 ? 46.172  44.318 51.612  1.00 43.33 ? 298 VAL B C   1 
ATOM   4818 O O   . VAL D 1 210 ? 45.601  43.501 50.896  1.00 43.26 ? 298 VAL B O   1 
ATOM   4819 C CB  . VAL D 1 210 ? 47.056  45.753 49.659  1.00 42.90 ? 298 VAL B CB  1 
ATOM   4820 C CG1 . VAL D 1 210 ? 48.132  44.704 49.461  1.00 43.00 ? 298 VAL B CG1 1 
ATOM   4821 C CG2 . VAL D 1 210 ? 45.903  45.582 48.689  1.00 43.25 ? 298 VAL B CG2 1 
ATOM   4822 N N   . ARG D 1 211 ? 46.517  44.054 52.864  1.00 43.81 ? 299 ARG B N   1 
ATOM   4823 C CA  . ARG D 1 211 ? 46.235  42.785 53.525  1.00 45.19 ? 299 ARG B CA  1 
ATOM   4824 C C   . ARG D 1 211 ? 46.589  41.488 52.781  1.00 44.94 ? 299 ARG B C   1 
ATOM   4825 O O   . ARG D 1 211 ? 45.818  40.526 52.795  1.00 44.26 ? 299 ARG B O   1 
ATOM   4826 C CB  . ARG D 1 211 ? 44.762  42.762 53.953  1.00 47.06 ? 299 ARG B CB  1 
ATOM   4827 C CG  . ARG D 1 211 ? 44.399  43.923 54.892  1.00 50.42 ? 299 ARG B CG  1 
ATOM   4828 C CD  . ARG D 1 211 ? 42.998  43.805 55.495  1.00 52.31 ? 299 ARG B CD  1 
ATOM   4829 N NE  . ARG D 1 211 ? 41.929  43.860 54.497  1.00 55.30 ? 299 ARG B NE  1 
ATOM   4830 C CZ  . ARG D 1 211 ? 40.630  43.735 54.783  1.00 56.58 ? 299 ARG B CZ  1 
ATOM   4831 N NH1 . ARG D 1 211 ? 40.239  43.546 56.040  1.00 57.20 ? 299 ARG B NH1 1 
ATOM   4832 N NH2 . ARG D 1 211 ? 39.718  43.805 53.818  1.00 56.62 ? 299 ARG B NH2 1 
ATOM   4833 N N   . ILE D 1 212 ? 47.773  41.467 52.164  1.00 44.79 ? 300 ILE B N   1 
ATOM   4834 C CA  . ILE D 1 212 ? 48.283  40.313 51.423  1.00 44.07 ? 300 ILE B CA  1 
ATOM   4835 C C   . ILE D 1 212 ? 48.907  39.224 52.320  1.00 43.92 ? 300 ILE B C   1 
ATOM   4836 O O   . ILE D 1 212 ? 48.524  38.057 52.258  1.00 43.29 ? 300 ILE B O   1 
ATOM   4837 C CB  . ILE D 1 212 ? 49.349  40.763 50.366  1.00 43.91 ? 300 ILE B CB  1 
ATOM   4838 C CG1 . ILE D 1 212 ? 48.662  41.396 49.162  1.00 43.63 ? 300 ILE B CG1 1 
ATOM   4839 C CG2 . ILE D 1 212 ? 50.202  39.588 49.914  1.00 44.23 ? 300 ILE B CG2 1 
ATOM   4840 C CD1 . ILE D 1 212 ? 49.623  41.803 48.069  1.00 42.69 ? 300 ILE B CD1 1 
ATOM   4841 N N   . PRO D 1 213 ? 49.864  39.601 53.179  1.00 43.93 ? 301 PRO B N   1 
ATOM   4842 C CA  . PRO D 1 213 ? 50.528  38.642 54.066  1.00 43.78 ? 301 PRO B CA  1 
ATOM   4843 C C   . PRO D 1 213 ? 49.750  37.454 54.644  1.00 43.30 ? 301 PRO B C   1 
ATOM   4844 O O   . PRO D 1 213 ? 50.262  36.332 54.663  1.00 43.29 ? 301 PRO B O   1 
ATOM   4845 C CB  . PRO D 1 213 ? 51.154  39.550 55.146  1.00 43.90 ? 301 PRO B CB  1 
ATOM   4846 C CG  . PRO D 1 213 ? 50.465  40.922 54.932  1.00 44.47 ? 301 PRO B CG  1 
ATOM   4847 C CD  . PRO D 1 213 ? 50.389  40.950 53.438  1.00 44.22 ? 301 PRO B CD  1 
ATOM   4848 N N   . LYS D 1 214 ? 48.529  37.670 55.107  1.00 43.18 ? 302 LYS B N   1 
ATOM   4849 C CA  . LYS D 1 214 ? 47.782  36.556 55.671  1.00 43.33 ? 302 LYS B CA  1 
ATOM   4850 C C   . LYS D 1 214 ? 47.520  35.462 54.640  1.00 42.80 ? 302 LYS B C   1 
ATOM   4851 O O   . LYS D 1 214 ? 47.616  34.266 54.937  1.00 43.08 ? 302 LYS B O   1 
ATOM   4852 C CB  . LYS D 1 214 ? 46.459  37.031 56.269  1.00 44.54 ? 302 LYS B CB  1 
ATOM   4853 C CG  . LYS D 1 214 ? 45.593  35.870 56.758  1.00 46.44 ? 302 LYS B CG  1 
ATOM   4854 C CD  . LYS D 1 214 ? 46.388  34.932 57.661  1.00 47.20 ? 302 LYS B CD  1 
ATOM   4855 C CE  . LYS D 1 214 ? 45.551  33.743 58.120  1.00 48.22 ? 302 LYS B CE  1 
ATOM   4856 N NZ  . LYS D 1 214 ? 46.318  32.846 59.042  1.00 48.93 ? 302 LYS B NZ  1 
ATOM   4857 N N   . ARG D 1 215 ? 47.170  35.882 53.429  1.00 41.57 ? 303 ARG B N   1 
ATOM   4858 C CA  . ARG D 1 215 ? 46.913  34.956 52.338  1.00 39.78 ? 303 ARG B CA  1 
ATOM   4859 C C   . ARG D 1 215 ? 48.225  34.305 51.955  1.00 39.53 ? 303 ARG B C   1 
ATOM   4860 O O   . ARG D 1 215 ? 48.336  33.078 51.881  1.00 40.46 ? 303 ARG B O   1 
ATOM   4861 C CB  . ARG D 1 215 ? 46.375  35.710 51.127  1.00 39.06 ? 303 ARG B CB  1 
ATOM   4862 C CG  . ARG D 1 215 ? 46.218  34.853 49.886  1.00 37.53 ? 303 ARG B CG  1 
ATOM   4863 C CD  . ARG D 1 215 ? 45.440  33.598 50.212  1.00 36.12 ? 303 ARG B CD  1 
ATOM   4864 N NE  . ARG D 1 215 ? 45.080  32.872 49.009  1.00 34.50 ? 303 ARG B NE  1 
ATOM   4865 C CZ  . ARG D 1 215 ? 44.499  31.682 49.011  1.00 33.69 ? 303 ARG B CZ  1 
ATOM   4866 N NH1 . ARG D 1 215 ? 44.222  31.097 50.167  1.00 33.40 ? 303 ARG B NH1 1 
ATOM   4867 N NH2 . ARG D 1 215 ? 44.190  31.090 47.862  1.00 32.49 ? 303 ARG B NH2 1 
ATOM   4868 N N   . LEU D 1 216 ? 49.212  35.155 51.701  1.00 37.88 ? 304 LEU B N   1 
ATOM   4869 C CA  . LEU D 1 216 ? 50.543  34.722 51.321  1.00 36.10 ? 304 LEU B CA  1 
ATOM   4870 C C   . LEU D 1 216 ? 50.986  33.561 52.221  1.00 35.81 ? 304 LEU B C   1 
ATOM   4871 O O   . LEU D 1 216 ? 51.668  32.631 51.774  1.00 35.27 ? 304 LEU B O   1 
ATOM   4872 C CB  . LEU D 1 216 ? 51.501  35.908 51.443  1.00 35.15 ? 304 LEU B CB  1 
ATOM   4873 C CG  . LEU D 1 216 ? 52.389  36.235 50.244  1.00 34.35 ? 304 LEU B CG  1 
ATOM   4874 C CD1 . LEU D 1 216 ? 51.543  36.444 49.009  1.00 33.60 ? 304 LEU B CD1 1 
ATOM   4875 C CD2 . LEU D 1 216 ? 53.193  37.472 50.542  1.00 33.70 ? 304 LEU B CD2 1 
ATOM   4876 N N   . VAL D 1 217 ? 50.583  33.605 53.489  1.00 35.06 ? 305 VAL B N   1 
ATOM   4877 C CA  . VAL D 1 217 ? 50.955  32.545 54.413  1.00 34.28 ? 305 VAL B CA  1 
ATOM   4878 C C   . VAL D 1 217 ? 50.199  31.271 54.112  1.00 33.99 ? 305 VAL B C   1 
ATOM   4879 O O   . VAL D 1 217 ? 50.781  30.192 54.108  1.00 34.21 ? 305 VAL B O   1 
ATOM   4880 C CB  . VAL D 1 217 ? 50.698  32.946 55.881  1.00 34.23 ? 305 VAL B CB  1 
ATOM   4881 C CG1 . VAL D 1 217 ? 50.953  31.750 56.810  1.00 32.95 ? 305 VAL B CG1 1 
ATOM   4882 C CG2 . VAL D 1 217 ? 51.608  34.117 56.252  1.00 33.15 ? 305 VAL B CG2 1 
ATOM   4883 N N   . GLU D 1 218 ? 48.903  31.383 53.856  1.00 33.77 ? 306 GLU B N   1 
ATOM   4884 C CA  . GLU D 1 218 ? 48.117  30.192 53.555  1.00 33.45 ? 306 GLU B CA  1 
ATOM   4885 C C   . GLU D 1 218 ? 48.727  29.505 52.342  1.00 33.40 ? 306 GLU B C   1 
ATOM   4886 O O   . GLU D 1 218 ? 48.701  28.282 52.227  1.00 33.33 ? 306 GLU B O   1 
ATOM   4887 C CB  . GLU D 1 218 ? 46.671  30.554 53.240  1.00 33.45 ? 306 GLU B CB  1 
ATOM   4888 C CG  . GLU D 1 218 ? 46.008  31.467 54.239  1.00 33.92 ? 306 GLU B CG  1 
ATOM   4889 C CD  . GLU D 1 218 ? 44.575  31.717 53.864  1.00 34.06 ? 306 GLU B CD  1 
ATOM   4890 O OE1 . GLU D 1 218 ? 44.330  31.999 52.674  1.00 34.25 ? 306 GLU B OE1 1 
ATOM   4891 O OE2 . GLU D 1 218 ? 43.699  31.646 54.745  1.00 34.52 ? 306 GLU B OE2 1 
ATOM   4892 N N   . LEU D 1 219 ? 49.289  30.304 51.438  1.00 33.20 ? 307 LEU B N   1 
ATOM   4893 C CA  . LEU D 1 219 ? 49.895  29.768 50.227  1.00 32.55 ? 307 LEU B CA  1 
ATOM   4894 C C   . LEU D 1 219 ? 51.202  28.993 50.420  1.00 32.18 ? 307 LEU B C   1 
ATOM   4895 O O   . LEU D 1 219 ? 51.628  28.276 49.517  1.00 32.30 ? 307 LEU B O   1 
ATOM   4896 C CB  . LEU D 1 219 ? 50.094  30.890 49.205  1.00 32.74 ? 307 LEU B CB  1 
ATOM   4897 C CG  . LEU D 1 219 ? 48.802  31.405 48.570  1.00 33.79 ? 307 LEU B CG  1 
ATOM   4898 C CD1 . LEU D 1 219 ? 49.104  32.522 47.591  1.00 33.40 ? 307 LEU B CD1 1 
ATOM   4899 C CD2 . LEU D 1 219 ? 48.111  30.253 47.847  1.00 34.52 ? 307 LEU B CD2 1 
ATOM   4900 N N   . LEU D 1 220 ? 51.847  29.122 51.576  1.00 31.39 ? 308 LEU B N   1 
ATOM   4901 C CA  . LEU D 1 220 ? 53.088  28.378 51.811  1.00 30.96 ? 308 LEU B CA  1 
ATOM   4902 C C   . LEU D 1 220 ? 52.802  26.861 51.868  1.00 31.87 ? 308 LEU B C   1 
ATOM   4903 O O   . LEU D 1 220 ? 53.668  26.042 51.566  1.00 31.96 ? 308 LEU B O   1 
ATOM   4904 C CB  . LEU D 1 220 ? 53.766  28.824 53.122  1.00 28.91 ? 308 LEU B CB  1 
ATOM   4905 C CG  . LEU D 1 220 ? 54.277  30.263 53.331  1.00 27.10 ? 308 LEU B CG  1 
ATOM   4906 C CD1 . LEU D 1 220 ? 54.808  30.421 54.733  1.00 25.16 ? 308 LEU B CD1 1 
ATOM   4907 C CD2 . LEU D 1 220 ? 55.360  30.607 52.343  1.00 25.37 ? 308 LEU B CD2 1 
ATOM   4908 N N   . SER D 1 221 ? 51.578  26.496 52.241  1.00 33.10 ? 309 SER B N   1 
ATOM   4909 C CA  . SER D 1 221 ? 51.185  25.091 52.340  1.00 33.95 ? 309 SER B CA  1 
ATOM   4910 C C   . SER D 1 221 ? 50.442  24.575 51.100  1.00 33.90 ? 309 SER B C   1 
ATOM   4911 O O   . SER D 1 221 ? 49.608  23.669 51.191  1.00 34.47 ? 309 SER B O   1 
ATOM   4912 C CB  . SER D 1 221 ? 50.327  24.881 53.600  1.00 34.58 ? 309 SER B CB  1 
ATOM   4913 O OG  . SER D 1 221 ? 49.215  25.761 53.631  1.00 36.01 ? 309 SER B OG  1 
ATOM   4914 N N   . HIS D 1 222 ? 50.736  25.168 49.949  1.00 33.25 ? 310 HIS B N   1 
ATOM   4915 C CA  . HIS D 1 222 ? 50.138  24.765 48.680  1.00 33.72 ? 310 HIS B CA  1 
ATOM   4916 C C   . HIS D 1 222 ? 50.895  23.479 48.323  1.00 34.27 ? 310 HIS B C   1 
ATOM   4917 O O   . HIS D 1 222 ? 51.959  23.238 48.875  1.00 35.01 ? 310 HIS B O   1 
ATOM   4918 C CB  . HIS D 1 222 ? 50.379  25.893 47.659  1.00 33.80 ? 310 HIS B CB  1 
ATOM   4919 C CG  . HIS D 1 222 ? 49.790  25.651 46.300  1.00 33.86 ? 310 HIS B CG  1 
ATOM   4920 N ND1 . HIS D 1 222 ? 50.322  24.750 45.403  1.00 34.06 ? 310 HIS B ND1 1 
ATOM   4921 C CD2 . HIS D 1 222 ? 48.731  26.221 45.676  1.00 33.93 ? 310 HIS B CD2 1 
ATOM   4922 C CE1 . HIS D 1 222 ? 49.615  24.774 44.286  1.00 33.71 ? 310 HIS B CE1 1 
ATOM   4923 N NE2 . HIS D 1 222 ? 48.644  25.657 44.425  1.00 33.73 ? 310 HIS B NE2 1 
ATOM   4924 N N   . GLU D 1 223 ? 50.377  22.632 47.439  1.00 35.01 ? 311 GLU B N   1 
ATOM   4925 C CA  . GLU D 1 223 ? 51.113  21.405 47.141  1.00 35.66 ? 311 GLU B CA  1 
ATOM   4926 C C   . GLU D 1 223 ? 52.111  21.501 46.021  1.00 35.01 ? 311 GLU B C   1 
ATOM   4927 O O   . GLU D 1 223 ? 52.914  20.578 45.834  1.00 35.08 ? 311 GLU B O   1 
ATOM   4928 C CB  . GLU D 1 223 ? 50.181  20.216 46.877  1.00 37.66 ? 311 GLU B CB  1 
ATOM   4929 C CG  . GLU D 1 223 ? 48.715  20.551 46.731  1.00 41.09 ? 311 GLU B CG  1 
ATOM   4930 C CD  . GLU D 1 223 ? 48.416  21.369 45.503  1.00 41.88 ? 311 GLU B CD  1 
ATOM   4931 O OE1 . GLU D 1 223 ? 48.450  20.812 44.386  1.00 42.62 ? 311 GLU B OE1 1 
ATOM   4932 O OE2 . GLU D 1 223 ? 48.155  22.574 45.666  1.00 42.90 ? 311 GLU B OE2 1 
ATOM   4933 N N   . SER D 1 224 ? 52.076  22.607 45.279  1.00 33.84 ? 312 SER B N   1 
ATOM   4934 C CA  . SER D 1 224 ? 53.027  22.802 44.187  1.00 32.26 ? 312 SER B CA  1 
ATOM   4935 C C   . SER D 1 224 ? 54.146  23.701 44.683  1.00 31.76 ? 312 SER B C   1 
ATOM   4936 O O   . SER D 1 224 ? 53.895  24.779 45.211  1.00 31.69 ? 312 SER B O   1 
ATOM   4937 C CB  . SER D 1 224 ? 52.356  23.454 42.975  1.00 32.48 ? 312 SER B CB  1 
ATOM   4938 O OG  . SER D 1 224 ? 53.247  23.522 41.864  1.00 31.61 ? 312 SER B OG  1 
ATOM   4939 N N   . THR D 1 225 ? 55.384  23.252 44.530  1.00 31.04 ? 313 THR B N   1 
ATOM   4940 C CA  . THR D 1 225 ? 56.519  24.058 44.955  1.00 30.40 ? 313 THR B CA  1 
ATOM   4941 C C   . THR D 1 225 ? 56.672  25.281 44.029  1.00 30.12 ? 313 THR B C   1 
ATOM   4942 O O   . THR D 1 225 ? 57.514  26.149 44.256  1.00 28.91 ? 313 THR B O   1 
ATOM   4943 C CB  . THR D 1 225 ? 57.845  23.211 44.997  1.00 29.93 ? 313 THR B CB  1 
ATOM   4944 O OG1 . THR D 1 225 ? 58.034  22.515 43.758  1.00 29.37 ? 313 THR B OG1 1 
ATOM   4945 C CG2 . THR D 1 225 ? 57.801  22.210 46.131  1.00 29.25 ? 313 THR B CG2 1 
ATOM   4946 N N   . LEU D 1 226 ? 55.844  25.341 42.987  1.00 30.37 ? 314 LEU B N   1 
ATOM   4947 C CA  . LEU D 1 226 ? 55.868  26.469 42.063  1.00 30.83 ? 314 LEU B CA  1 
ATOM   4948 C C   . LEU D 1 226 ? 55.182  27.657 42.739  1.00 30.86 ? 314 LEU B C   1 
ATOM   4949 O O   . LEU D 1 226 ? 55.480  28.817 42.448  1.00 31.20 ? 314 LEU B O   1 
ATOM   4950 C CB  . LEU D 1 226 ? 55.163  26.112 40.746  1.00 31.00 ? 314 LEU B CB  1 
ATOM   4951 C CG  . LEU D 1 226 ? 55.814  24.976 39.933  1.00 32.13 ? 314 LEU B CG  1 
ATOM   4952 C CD1 . LEU D 1 226 ? 55.115  24.831 38.591  1.00 31.58 ? 314 LEU B CD1 1 
ATOM   4953 C CD2 . LEU D 1 226 ? 57.288  25.276 39.699  1.00 31.37 ? 314 LEU B CD2 1 
ATOM   4954 N N   . VAL D 1 227 ? 54.271  27.352 43.657  1.00 30.52 ? 315 VAL B N   1 
ATOM   4955 C CA  . VAL D 1 227 ? 53.558  28.371 44.409  1.00 30.82 ? 315 VAL B CA  1 
ATOM   4956 C C   . VAL D 1 227 ? 54.333  28.664 45.691  1.00 30.61 ? 315 VAL B C   1 
ATOM   4957 O O   . VAL D 1 227 ? 54.378  29.804 46.163  1.00 30.49 ? 315 VAL B O   1 
ATOM   4958 C CB  . VAL D 1 227 ? 52.140  27.892 44.784  1.00 30.91 ? 315 VAL B CB  1 
ATOM   4959 C CG1 . VAL D 1 227 ? 51.454  28.920 45.661  1.00 31.12 ? 315 VAL B CG1 1 
ATOM   4960 C CG2 . VAL D 1 227 ? 51.339  27.653 43.526  1.00 31.70 ? 315 VAL B CG2 1 
ATOM   4961 N N   . GLN D 1 228 ? 54.944  27.619 46.240  1.00 30.20 ? 316 GLN B N   1 
ATOM   4962 C CA  . GLN D 1 228 ? 55.711  27.733 47.467  1.00 30.10 ? 316 GLN B CA  1 
ATOM   4963 C C   . GLN D 1 228 ? 56.963  28.583 47.315  1.00 30.31 ? 316 GLN B C   1 
ATOM   4964 O O   . GLN D 1 228 ? 57.307  29.349 48.212  1.00 30.91 ? 316 GLN B O   1 
ATOM   4965 C CB  . GLN D 1 228 ? 56.088  26.341 47.988  1.00 29.83 ? 316 GLN B CB  1 
ATOM   4966 C CG  . GLN D 1 228 ? 54.912  25.557 48.578  1.00 29.44 ? 316 GLN B CG  1 
ATOM   4967 C CD  . GLN D 1 228 ? 55.275  24.130 49.019  1.00 29.39 ? 316 GLN B CD  1 
ATOM   4968 O OE1 . GLN D 1 228 ? 54.437  23.421 49.553  1.00 29.89 ? 316 GLN B OE1 1 
ATOM   4969 N NE2 . GLN D 1 228 ? 56.519  23.711 48.786  1.00 29.32 ? 316 GLN B NE2 1 
ATOM   4970 N N   . THR D 1 229 ? 57.638  28.473 46.178  1.00 29.88 ? 317 THR B N   1 
ATOM   4971 C CA  . THR D 1 229 ? 58.852  29.245 45.984  1.00 29.59 ? 317 THR B CA  1 
ATOM   4972 C C   . THR D 1 229 ? 58.670  30.770 46.017  1.00 29.36 ? 317 THR B C   1 
ATOM   4973 O O   . THR D 1 229 ? 59.283  31.443 46.837  1.00 28.83 ? 317 THR B O   1 
ATOM   4974 C CB  . THR D 1 229 ? 59.575  28.780 44.696  1.00 29.80 ? 317 THR B CB  1 
ATOM   4975 O OG1 . THR D 1 229 ? 60.112  27.465 44.926  1.00 30.13 ? 317 THR B OG1 1 
ATOM   4976 C CG2 . THR D 1 229 ? 60.710  29.743 44.303  1.00 28.56 ? 317 THR B CG2 1 
ATOM   4977 N N   . PRO D 1 230 ? 57.832  31.331 45.135  1.00 29.50 ? 318 PRO B N   1 
ATOM   4978 C CA  . PRO D 1 230 ? 57.609  32.778 45.108  1.00 29.96 ? 318 PRO B CA  1 
ATOM   4979 C C   . PRO D 1 230 ? 56.869  33.329 46.350  1.00 29.87 ? 318 PRO B C   1 
ATOM   4980 O O   . PRO D 1 230 ? 57.053  34.497 46.728  1.00 29.27 ? 318 PRO B O   1 
ATOM   4981 C CB  . PRO D 1 230 ? 56.813  32.955 43.822  1.00 30.27 ? 318 PRO B CB  1 
ATOM   4982 C CG  . PRO D 1 230 ? 55.958  31.706 43.848  1.00 30.41 ? 318 PRO B CG  1 
ATOM   4983 C CD  . PRO D 1 230 ? 57.054  30.693 44.062  1.00 30.03 ? 318 PRO B CD  1 
ATOM   4984 N N   . ALA D 1 231 ? 56.027  32.501 46.969  1.00 29.09 ? 319 ALA B N   1 
ATOM   4985 C CA  . ALA D 1 231 ? 55.303  32.921 48.167  1.00 28.94 ? 319 ALA B CA  1 
ATOM   4986 C C   . ALA D 1 231 ? 56.292  33.073 49.331  1.00 29.22 ? 319 ALA B C   1 
ATOM   4987 O O   . ALA D 1 231 ? 56.223  34.026 50.113  1.00 28.65 ? 319 ALA B O   1 
ATOM   4988 C CB  . ALA D 1 231 ? 54.244  31.900 48.517  1.00 29.30 ? 319 ALA B CB  1 
ATOM   4989 N N   . LEU D 1 232 ? 57.228  32.130 49.431  1.00 29.33 ? 320 LEU B N   1 
ATOM   4990 C CA  . LEU D 1 232 ? 58.228  32.176 50.489  1.00 29.36 ? 320 LEU B CA  1 
ATOM   4991 C C   . LEU D 1 232 ? 59.193  33.339 50.294  1.00 29.36 ? 320 LEU B C   1 
ATOM   4992 O O   . LEU D 1 232 ? 59.649  33.942 51.263  1.00 29.68 ? 320 LEU B O   1 
ATOM   4993 C CB  . LEU D 1 232 ? 59.016  30.872 50.559  1.00 27.88 ? 320 LEU B CB  1 
ATOM   4994 C CG  . LEU D 1 232 ? 60.094  30.918 51.638  1.00 27.64 ? 320 LEU B CG  1 
ATOM   4995 C CD1 . LEU D 1 232 ? 59.463  31.183 52.978  1.00 26.64 ? 320 LEU B CD1 1 
ATOM   4996 C CD2 . LEU D 1 232 ? 60.859  29.611 51.666  1.00 29.16 ? 320 LEU B CD2 1 
ATOM   4997 N N   . ARG D 1 233 ? 59.499  33.656 49.043  1.00 29.29 ? 321 ARG B N   1 
ATOM   4998 C CA  . ARG D 1 233 ? 60.412  34.746 48.741  1.00 30.17 ? 321 ARG B CA  1 
ATOM   4999 C C   . ARG D 1 233 ? 59.843  36.121 49.176  1.00 30.29 ? 321 ARG B C   1 
ATOM   5000 O O   . ARG D 1 233 ? 60.591  37.016 49.587  1.00 28.79 ? 321 ARG B O   1 
ATOM   5001 C CB  . ARG D 1 233 ? 60.721  34.741 47.247  1.00 31.30 ? 321 ARG B CB  1 
ATOM   5002 C CG  . ARG D 1 233 ? 61.666  35.836 46.803  1.00 34.05 ? 321 ARG B CG  1 
ATOM   5003 C CD  . ARG D 1 233 ? 63.136  35.580 47.169  1.00 35.68 ? 321 ARG B CD  1 
ATOM   5004 N NE  . ARG D 1 233 ? 63.932  35.098 46.033  1.00 35.93 ? 321 ARG B NE  1 
ATOM   5005 C CZ  . ARG D 1 233 ? 63.845  33.885 45.503  1.00 36.90 ? 321 ARG B CZ  1 
ATOM   5006 N NH1 . ARG D 1 233 ? 62.992  33.003 46.000  1.00 38.02 ? 321 ARG B NH1 1 
ATOM   5007 N NH2 . ARG D 1 233 ? 64.616  33.554 44.477  1.00 37.03 ? 321 ARG B NH2 1 
ATOM   5008 N N   . ALA D 1 234 ? 58.522  36.270 49.110  1.00 30.42 ? 322 ALA B N   1 
ATOM   5009 C CA  . ALA D 1 234 ? 57.872  37.520 49.492  1.00 30.79 ? 322 ALA B CA  1 
ATOM   5010 C C   . ALA D 1 234 ? 57.710  37.596 51.010  1.00 31.27 ? 322 ALA B C   1 
ATOM   5011 O O   . ALA D 1 234 ? 57.954  38.645 51.611  1.00 31.81 ? 322 ALA B O   1 
ATOM   5012 C CB  . ALA D 1 234 ? 56.518  37.643 48.796  1.00 29.46 ? 322 ALA B CB  1 
ATOM   5013 N N   . VAL D 1 235 ? 57.280  36.495 51.620  1.00 31.20 ? 323 VAL B N   1 
ATOM   5014 C CA  . VAL D 1 235 ? 57.126  36.439 53.067  1.00 31.72 ? 323 VAL B CA  1 
ATOM   5015 C C   . VAL D 1 235 ? 58.480  36.802 53.668  1.00 32.45 ? 323 VAL B C   1 
ATOM   5016 O O   . VAL D 1 235 ? 58.585  37.642 54.570  1.00 32.61 ? 323 VAL B O   1 
ATOM   5017 C CB  . VAL D 1 235 ? 56.734  35.005 53.540  1.00 31.81 ? 323 VAL B CB  1 
ATOM   5018 C CG1 . VAL D 1 235 ? 56.991  34.841 55.024  1.00 32.12 ? 323 VAL B CG1 1 
ATOM   5019 C CG2 . VAL D 1 235 ? 55.272  34.757 53.275  1.00 31.23 ? 323 VAL B CG2 1 
ATOM   5020 N N   . GLY D 1 236 ? 59.516  36.157 53.147  1.00 32.94 ? 324 GLY B N   1 
ATOM   5021 C CA  . GLY D 1 236 ? 60.859  36.408 53.614  1.00 33.81 ? 324 GLY B CA  1 
ATOM   5022 C C   . GLY D 1 236 ? 61.240  37.869 53.507  1.00 34.33 ? 324 GLY B C   1 
ATOM   5023 O O   . GLY D 1 236 ? 61.826  38.417 54.442  1.00 35.25 ? 324 GLY B O   1 
ATOM   5024 N N   . ASN D 1 237 ? 60.916  38.507 52.381  1.00 34.80 ? 325 ASN B N   1 
ATOM   5025 C CA  . ASN D 1 237 ? 61.252  39.922 52.192  1.00 34.80 ? 325 ASN B CA  1 
ATOM   5026 C C   . ASN D 1 237 ? 60.580  40.835 53.190  1.00 35.08 ? 325 ASN B C   1 
ATOM   5027 O O   . ASN D 1 237 ? 61.150  41.853 53.578  1.00 35.06 ? 325 ASN B O   1 
ATOM   5028 C CB  . ASN D 1 237 ? 60.884  40.423 50.797  1.00 34.10 ? 325 ASN B CB  1 
ATOM   5029 C CG  . ASN D 1 237 ? 61.797  39.901 49.734  1.00 33.91 ? 325 ASN B CG  1 
ATOM   5030 O OD1 . ASN D 1 237 ? 62.986  39.695 49.971  1.00 34.39 ? 325 ASN B OD1 1 
ATOM   5031 N ND2 . ASN D 1 237 ? 61.264  39.723 48.534  1.00 34.07 ? 325 ASN B ND2 1 
ATOM   5032 N N   . ILE D 1 238 ? 59.365  40.479 53.592  1.00 35.86 ? 326 ILE B N   1 
ATOM   5033 C CA  . ILE D 1 238 ? 58.611  41.295 54.537  1.00 36.89 ? 326 ILE B CA  1 
ATOM   5034 C C   . ILE D 1 238 ? 59.244  41.364 55.920  1.00 37.29 ? 326 ILE B C   1 
ATOM   5035 O O   . ILE D 1 238 ? 59.372  42.464 56.473  1.00 37.19 ? 326 ILE B O   1 
ATOM   5036 C CB  . ILE D 1 238 ? 57.153  40.796 54.669  1.00 36.76 ? 326 ILE B CB  1 
ATOM   5037 C CG1 . ILE D 1 238 ? 56.408  41.032 53.352  1.00 36.32 ? 326 ILE B CG1 1 
ATOM   5038 C CG2 . ILE D 1 238 ? 56.459  41.511 55.820  1.00 37.42 ? 326 ILE B CG2 1 
ATOM   5039 C CD1 . ILE D 1 238 ? 55.013  40.447 53.319  1.00 36.51 ? 326 ILE B CD1 1 
ATOM   5040 N N   . VAL D 1 239 ? 59.639  40.209 56.472  1.00 37.19 ? 327 VAL B N   1 
ATOM   5041 C CA  . VAL D 1 239 ? 60.256  40.161 57.799  1.00 36.72 ? 327 VAL B CA  1 
ATOM   5042 C C   . VAL D 1 239 ? 61.611  40.863 57.823  1.00 36.93 ? 327 VAL B C   1 
ATOM   5043 O O   . VAL D 1 239 ? 62.314  40.878 58.837  1.00 36.96 ? 327 VAL B O   1 
ATOM   5044 C CB  . VAL D 1 239 ? 60.407  38.706 58.306  1.00 36.75 ? 327 VAL B CB  1 
ATOM   5045 C CG1 . VAL D 1 239 ? 59.037  38.104 58.537  1.00 36.36 ? 327 VAL B CG1 1 
ATOM   5046 C CG2 . VAL D 1 239 ? 61.198  37.871 57.308  1.00 35.94 ? 327 VAL B CG2 1 
ATOM   5047 N N   . THR D 1 240 ? 61.969  41.434 56.680  1.00 37.03 ? 328 THR B N   1 
ATOM   5048 C CA  . THR D 1 240 ? 63.199  42.193 56.518  1.00 37.38 ? 328 THR B CA  1 
ATOM   5049 C C   . THR D 1 240 ? 63.001  43.557 57.158  1.00 37.53 ? 328 THR B C   1 
ATOM   5050 O O   . THR D 1 240 ? 63.953  44.186 57.589  1.00 37.74 ? 328 THR B O   1 
ATOM   5051 C CB  . THR D 1 240 ? 63.523  42.381 55.020  1.00 37.90 ? 328 THR B CB  1 
ATOM   5052 O OG1 . THR D 1 240 ? 64.323  41.286 54.572  1.00 37.29 ? 328 THR B OG1 1 
ATOM   5053 C CG2 . THR D 1 240 ? 64.213  43.719 54.757  1.00 38.13 ? 328 THR B CG2 1 
ATOM   5054 N N   . GLY D 1 241 ? 61.749  44.005 57.205  1.00 38.11 ? 329 GLY B N   1 
ATOM   5055 C CA  . GLY D 1 241 ? 61.426  45.294 57.796  1.00 38.73 ? 329 GLY B CA  1 
ATOM   5056 C C   . GLY D 1 241 ? 61.479  45.338 59.314  1.00 38.96 ? 329 GLY B C   1 
ATOM   5057 O O   . GLY D 1 241 ? 61.858  44.367 59.971  1.00 38.66 ? 329 GLY B O   1 
ATOM   5058 N N   . ASN D 1 242 ? 61.080  46.472 59.878  1.00 39.16 ? 330 ASN B N   1 
ATOM   5059 C CA  . ASN D 1 242 ? 61.096  46.658 61.321  1.00 39.61 ? 330 ASN B CA  1 
ATOM   5060 C C   . ASN D 1 242 ? 60.217  45.666 62.115  1.00 39.90 ? 330 ASN B C   1 
ATOM   5061 O O   . ASN D 1 242 ? 59.412  44.927 61.550  1.00 39.71 ? 330 ASN B O   1 
ATOM   5062 C CB  . ASN D 1 242 ? 60.707  48.106 61.652  1.00 39.35 ? 330 ASN B CB  1 
ATOM   5063 C CG  . ASN D 1 242 ? 59.279  48.437 61.263  1.00 39.49 ? 330 ASN B CG  1 
ATOM   5064 O OD1 . ASN D 1 242 ? 58.329  47.855 61.794  1.00 39.05 ? 330 ASN B OD1 1 
ATOM   5065 N ND2 . ASN D 1 242 ? 59.119  49.378 60.338  1.00 39.07 ? 330 ASN B ND2 1 
ATOM   5066 N N   . ASP D 1 243 ? 60.392  45.666 63.433  1.00 40.25 ? 331 ASP B N   1 
ATOM   5067 C CA  . ASP D 1 243 ? 59.656  44.780 64.328  1.00 40.66 ? 331 ASP B CA  1 
ATOM   5068 C C   . ASP D 1 243 ? 58.139  44.782 64.117  1.00 41.17 ? 331 ASP B C   1 
ATOM   5069 O O   . ASP D 1 243 ? 57.518  43.715 64.088  1.00 40.62 ? 331 ASP B O   1 
ATOM   5070 C CB  . ASP D 1 243 ? 59.967  45.137 65.785  1.00 41.19 ? 331 ASP B CB  1 
ATOM   5071 C CG  . ASP D 1 243 ? 61.454  45.064 66.104  1.00 41.62 ? 331 ASP B CG  1 
ATOM   5072 O OD1 . ASP D 1 243 ? 62.254  44.726 65.203  1.00 41.57 ? 331 ASP B OD1 1 
ATOM   5073 O OD2 . ASP D 1 243 ? 61.823  45.349 67.261  1.00 41.71 ? 331 ASP B OD2 1 
ATOM   5074 N N   . LEU D 1 244 ? 57.542  45.969 63.978  1.00 41.27 ? 332 LEU B N   1 
ATOM   5075 C CA  . LEU D 1 244 ? 56.096  46.066 63.771  1.00 41.07 ? 332 LEU B CA  1 
ATOM   5076 C C   . LEU D 1 244 ? 55.646  45.397 62.481  1.00 40.80 ? 332 LEU B C   1 
ATOM   5077 O O   . LEU D 1 244 ? 54.635  44.693 62.469  1.00 41.04 ? 332 LEU B O   1 
ATOM   5078 C CB  . LEU D 1 244 ? 55.628  47.527 63.773  1.00 41.71 ? 332 LEU B CB  1 
ATOM   5079 C CG  . LEU D 1 244 ? 55.535  48.229 65.130  1.00 42.75 ? 332 LEU B CG  1 
ATOM   5080 C CD1 . LEU D 1 244 ? 56.892  48.191 65.854  1.00 43.57 ? 332 LEU B CD1 1 
ATOM   5081 C CD2 . LEU D 1 244 ? 55.087  49.660 64.915  1.00 42.50 ? 332 LEU B CD2 1 
ATOM   5082 N N   . GLN D 1 245 ? 56.384  45.620 61.396  1.00 40.18 ? 333 GLN B N   1 
ATOM   5083 C CA  . GLN D 1 245 ? 56.039  45.012 60.123  1.00 39.33 ? 333 GLN B CA  1 
ATOM   5084 C C   . GLN D 1 245 ? 56.231  43.506 60.236  1.00 39.72 ? 333 GLN B C   1 
ATOM   5085 O O   . GLN D 1 245 ? 55.482  42.740 59.631  1.00 40.03 ? 333 GLN B O   1 
ATOM   5086 C CB  . GLN D 1 245 ? 56.908  45.574 58.994  1.00 39.26 ? 333 GLN B CB  1 
ATOM   5087 C CG  . GLN D 1 245 ? 56.726  47.067 58.747  1.00 38.50 ? 333 GLN B CG  1 
ATOM   5088 C CD  . GLN D 1 245 ? 57.649  47.588 57.666  1.00 38.72 ? 333 GLN B CD  1 
ATOM   5089 O OE1 . GLN D 1 245 ? 58.864  47.389 57.727  1.00 39.46 ? 333 GLN B OE1 1 
ATOM   5090 N NE2 . GLN D 1 245 ? 57.083  48.268 56.676  1.00 37.92 ? 333 GLN B NE2 1 
ATOM   5091 N N   . THR D 1 246 ? 57.217  43.078 61.025  1.00 39.48 ? 334 THR B N   1 
ATOM   5092 C CA  . THR D 1 246 ? 57.468  41.654 61.202  1.00 39.42 ? 334 THR B CA  1 
ATOM   5093 C C   . THR D 1 246 ? 56.411  40.973 62.085  1.00 40.25 ? 334 THR B C   1 
ATOM   5094 O O   . THR D 1 246 ? 56.138  39.776 61.919  1.00 40.17 ? 334 THR B O   1 
ATOM   5095 C CB  . THR D 1 246 ? 58.871  41.406 61.780  1.00 39.14 ? 334 THR B CB  1 
ATOM   5096 O OG1 . THR D 1 246 ? 59.856  41.830 60.831  1.00 39.35 ? 334 THR B OG1 1 
ATOM   5097 C CG2 . THR D 1 246 ? 59.079  39.937 62.061  1.00 38.63 ? 334 THR B CG2 1 
ATOM   5098 N N   . GLN D 1 247 ? 55.812  41.722 63.014  1.00 40.41 ? 335 GLN B N   1 
ATOM   5099 C CA  . GLN D 1 247 ? 54.771  41.153 63.880  1.00 40.07 ? 335 GLN B CA  1 
ATOM   5100 C C   . GLN D 1 247 ? 53.519  40.852 63.087  1.00 39.74 ? 335 GLN B C   1 
ATOM   5101 O O   . GLN D 1 247 ? 52.774  39.929 63.425  1.00 39.08 ? 335 GLN B O   1 
ATOM   5102 C CB  . GLN D 1 247 ? 54.403  42.089 65.041  1.00 40.35 ? 335 GLN B CB  1 
ATOM   5103 C CG  . GLN D 1 247 ? 55.166  41.806 66.321  1.00 41.41 ? 335 GLN B CG  1 
ATOM   5104 C CD  . GLN D 1 247 ? 54.851  40.431 66.900  1.00 42.07 ? 335 GLN B CD  1 
ATOM   5105 O OE1 . GLN D 1 247 ? 55.518  39.965 67.835  1.00 42.13 ? 335 GLN B OE1 1 
ATOM   5106 N NE2 . GLN D 1 247 ? 53.822  39.780 66.357  1.00 41.94 ? 335 GLN B NE2 1 
ATOM   5107 N N   . VAL D 1 248 ? 53.283  41.641 62.041  1.00 39.43 ? 336 VAL B N   1 
ATOM   5108 C CA  . VAL D 1 248 ? 52.115  41.429 61.192  1.00 39.28 ? 336 VAL B CA  1 
ATOM   5109 C C   . VAL D 1 248 ? 52.189  40.017 60.601  1.00 39.00 ? 336 VAL B C   1 
ATOM   5110 O O   . VAL D 1 248 ? 51.193  39.296 60.551  1.00 38.64 ? 336 VAL B O   1 
ATOM   5111 C CB  . VAL D 1 248 ? 52.056  42.464 60.045  1.00 39.22 ? 336 VAL B CB  1 
ATOM   5112 C CG1 . VAL D 1 248 ? 50.936  42.109 59.077  1.00 39.03 ? 336 VAL B CG1 1 
ATOM   5113 C CG2 . VAL D 1 248 ? 51.824  43.848 60.614  1.00 38.59 ? 336 VAL B CG2 1 
ATOM   5114 N N   . VAL D 1 249 ? 53.386  39.627 60.178  1.00 38.80 ? 337 VAL B N   1 
ATOM   5115 C CA  . VAL D 1 249 ? 53.603  38.306 59.610  1.00 38.75 ? 337 VAL B CA  1 
ATOM   5116 C C   . VAL D 1 249 ? 53.591  37.201 60.684  1.00 38.71 ? 337 VAL B C   1 
ATOM   5117 O O   . VAL D 1 249 ? 53.128  36.095 60.413  1.00 38.24 ? 337 VAL B O   1 
ATOM   5118 C CB  . VAL D 1 249 ? 54.931  38.263 58.815  1.00 38.57 ? 337 VAL B CB  1 
ATOM   5119 C CG1 . VAL D 1 249 ? 55.090  36.914 58.129  1.00 38.00 ? 337 VAL B CG1 1 
ATOM   5120 C CG2 . VAL D 1 249 ? 54.950  39.389 57.792  1.00 37.33 ? 337 VAL B CG2 1 
ATOM   5121 N N   . ILE D 1 250 ? 54.099  37.481 61.886  1.00 38.84 ? 338 ILE B N   1 
ATOM   5122 C CA  . ILE D 1 250 ? 54.061  36.463 62.948  1.00 38.91 ? 338 ILE B CA  1 
ATOM   5123 C C   . ILE D 1 250 ? 52.581  36.212 63.295  1.00 39.31 ? 338 ILE B C   1 
ATOM   5124 O O   . ILE D 1 250 ? 52.155  35.066 63.485  1.00 39.35 ? 338 ILE B O   1 
ATOM   5125 C CB  . ILE D 1 250 ? 54.829  36.902 64.257  1.00 38.01 ? 338 ILE B CB  1 
ATOM   5126 C CG1 . ILE D 1 250 ? 56.341  36.942 64.014  1.00 37.50 ? 338 ILE B CG1 1 
ATOM   5127 C CG2 . ILE D 1 250 ? 54.538  35.931 65.393  1.00 36.91 ? 338 ILE B CG2 1 
ATOM   5128 C CD1 . ILE D 1 250 ? 57.145  37.328 65.249  1.00 36.70 ? 338 ILE B CD1 1 
ATOM   5129 N N   . ASN D 1 251 ? 51.793  37.288 63.353  1.00 39.45 ? 339 ASN B N   1 
ATOM   5130 C CA  . ASN D 1 251 ? 50.374  37.168 63.680  1.00 39.20 ? 339 ASN B CA  1 
ATOM   5131 C C   . ASN D 1 251 ? 49.578  36.445 62.596  1.00 38.79 ? 339 ASN B C   1 
ATOM   5132 O O   . ASN D 1 251 ? 48.468  35.978 62.838  1.00 37.99 ? 339 ASN B O   1 
ATOM   5133 C CB  . ASN D 1 251 ? 49.744  38.544 63.933  1.00 39.99 ? 339 ASN B CB  1 
ATOM   5134 C CG  . ASN D 1 251 ? 50.394  39.285 65.093  1.00 41.22 ? 339 ASN B CG  1 
ATOM   5135 O OD1 . ASN D 1 251 ? 50.807  38.674 66.079  1.00 42.85 ? 339 ASN B OD1 1 
ATOM   5136 N ND2 . ASN D 1 251 ? 50.456  40.610 64.993  1.00 40.53 ? 339 ASN B ND2 1 
ATOM   5137 N N   . ALA D 1 252 ? 50.140  36.356 61.397  1.00 38.75 ? 340 ALA B N   1 
ATOM   5138 C CA  . ALA D 1 252 ? 49.469  35.666 60.298  1.00 38.11 ? 340 ALA B CA  1 
ATOM   5139 C C   . ALA D 1 252 ? 49.754  34.153 60.337  1.00 37.90 ? 340 ALA B C   1 
ATOM   5140 O O   . ALA D 1 252 ? 49.435  33.428 59.401  1.00 37.60 ? 340 ALA B O   1 
ATOM   5141 C CB  . ALA D 1 252 ? 49.910  36.256 58.966  1.00 37.37 ? 340 ALA B CB  1 
ATOM   5142 N N   . GLY D 1 253 ? 50.358  33.695 61.430  1.00 37.74 ? 341 GLY B N   1 
ATOM   5143 C CA  . GLY D 1 253 ? 50.664  32.287 61.586  1.00 37.50 ? 341 GLY B CA  1 
ATOM   5144 C C   . GLY D 1 253 ? 51.780  31.767 60.702  1.00 37.77 ? 341 GLY B C   1 
ATOM   5145 O O   . GLY D 1 253 ? 51.785  30.592 60.350  1.00 38.41 ? 341 GLY B O   1 
ATOM   5146 N N   . VAL D 1 254 ? 52.744  32.618 60.358  1.00 37.40 ? 342 VAL B N   1 
ATOM   5147 C CA  . VAL D 1 254 ? 53.849  32.203 59.492  1.00 37.00 ? 342 VAL B CA  1 
ATOM   5148 C C   . VAL D 1 254 ? 54.809  31.197 60.140  1.00 37.14 ? 342 VAL B C   1 
ATOM   5149 O O   . VAL D 1 254 ? 55.360  30.339 59.458  1.00 37.58 ? 342 VAL B O   1 
ATOM   5150 C CB  . VAL D 1 254 ? 54.676  33.432 58.998  1.00 36.44 ? 342 VAL B CB  1 
ATOM   5151 C CG1 . VAL D 1 254 ? 55.484  34.025 60.137  1.00 35.51 ? 342 VAL B CG1 1 
ATOM   5152 C CG2 . VAL D 1 254 ? 55.576  33.032 57.853  1.00 35.13 ? 342 VAL B CG2 1 
ATOM   5153 N N   . LEU D 1 255 ? 55.010  31.299 61.448  1.00 37.25 ? 343 LEU B N   1 
ATOM   5154 C CA  . LEU D 1 255 ? 55.918  30.392 62.138  1.00 37.50 ? 343 LEU B CA  1 
ATOM   5155 C C   . LEU D 1 255 ? 55.517  28.926 62.008  1.00 37.99 ? 343 LEU B C   1 
ATOM   5156 O O   . LEU D 1 255 ? 56.341  28.080 61.649  1.00 38.56 ? 343 LEU B O   1 
ATOM   5157 C CB  . LEU D 1 255 ? 56.035  30.779 63.613  1.00 37.73 ? 343 LEU B CB  1 
ATOM   5158 C CG  . LEU D 1 255 ? 56.634  32.168 63.842  1.00 37.92 ? 343 LEU B CG  1 
ATOM   5159 C CD1 . LEU D 1 255 ? 56.791  32.410 65.329  1.00 37.55 ? 343 LEU B CD1 1 
ATOM   5160 C CD2 . LEU D 1 255 ? 57.991  32.273 63.128  1.00 37.52 ? 343 LEU B CD2 1 
ATOM   5161 N N   . PRO D 1 256 ? 54.255  28.591 62.306  1.00 38.17 ? 344 PRO B N   1 
ATOM   5162 C CA  . PRO D 1 256 ? 53.872  27.182 62.173  1.00 38.05 ? 344 PRO B CA  1 
ATOM   5163 C C   . PRO D 1 256 ? 54.057  26.706 60.732  1.00 38.10 ? 344 PRO B C   1 
ATOM   5164 O O   . PRO D 1 256 ? 54.362  25.536 60.477  1.00 38.06 ? 344 PRO B O   1 
ATOM   5165 C CB  . PRO D 1 256 ? 52.413  27.190 62.614  1.00 37.69 ? 344 PRO B CB  1 
ATOM   5166 C CG  . PRO D 1 256 ? 52.390  28.353 63.620  1.00 37.93 ? 344 PRO B CG  1 
ATOM   5167 C CD  . PRO D 1 256 ? 53.109  29.381 62.786  1.00 38.29 ? 344 PRO B CD  1 
ATOM   5168 N N   . ALA D 1 257 ? 53.884  27.632 59.794  1.00 38.16 ? 345 ALA B N   1 
ATOM   5169 C CA  . ALA D 1 257 ? 54.037  27.327 58.377  1.00 38.49 ? 345 ALA B CA  1 
ATOM   5170 C C   . ALA D 1 257 ? 55.494  27.073 58.013  1.00 38.87 ? 345 ALA B C   1 
ATOM   5171 O O   . ALA D 1 257 ? 55.782  26.314 57.091  1.00 39.04 ? 345 ALA B O   1 
ATOM   5172 C CB  . ALA D 1 257 ? 53.487  28.465 57.539  1.00 37.84 ? 345 ALA B CB  1 
ATOM   5173 N N   . LEU D 1 258 ? 56.412  27.716 58.727  1.00 39.61 ? 346 LEU B N   1 
ATOM   5174 C CA  . LEU D 1 258 ? 57.840  27.531 58.465  1.00 40.46 ? 346 LEU B CA  1 
ATOM   5175 C C   . LEU D 1 258 ? 58.354  26.216 59.027  1.00 40.58 ? 346 LEU B C   1 
ATOM   5176 O O   . LEU D 1 258 ? 59.312  25.649 58.501  1.00 40.29 ? 346 LEU B O   1 
ATOM   5177 C CB  . LEU D 1 258 ? 58.654  28.694 59.051  1.00 40.09 ? 346 LEU B CB  1 
ATOM   5178 C CG  . LEU D 1 258 ? 58.557  30.014 58.284  1.00 40.30 ? 346 LEU B CG  1 
ATOM   5179 C CD1 . LEU D 1 258 ? 59.105  31.152 59.122  1.00 39.38 ? 346 LEU B CD1 1 
ATOM   5180 C CD2 . LEU D 1 258 ? 59.311  29.876 56.947  1.00 39.89 ? 346 LEU B CD2 1 
ATOM   5181 N N   . ARG D 1 259 ? 57.721  25.733 60.093  1.00 41.09 ? 347 ARG B N   1 
ATOM   5182 C CA  . ARG D 1 259 ? 58.148  24.482 60.702  1.00 42.12 ? 347 ARG B CA  1 
ATOM   5183 C C   . ARG D 1 259 ? 58.070  23.369 59.663  1.00 41.80 ? 347 ARG B C   1 
ATOM   5184 O O   . ARG D 1 259 ? 58.927  22.483 59.612  1.00 42.13 ? 347 ARG B O   1 
ATOM   5185 C CB  . ARG D 1 259 ? 57.266  24.119 61.891  1.00 43.77 ? 347 ARG B CB  1 
ATOM   5186 C CG  . ARG D 1 259 ? 57.891  23.048 62.770  1.00 46.56 ? 347 ARG B CG  1 
ATOM   5187 C CD  . ARG D 1 259 ? 56.888  22.395 63.738  1.00 49.90 ? 347 ARG B CD  1 
ATOM   5188 N NE  . ARG D 1 259 ? 55.993  23.343 64.412  1.00 51.69 ? 347 ARG B NE  1 
ATOM   5189 C CZ  . ARG D 1 259 ? 54.855  23.817 63.899  1.00 52.29 ? 347 ARG B CZ  1 
ATOM   5190 N NH1 . ARG D 1 259 ? 54.440  23.439 62.691  1.00 51.60 ? 347 ARG B NH1 1 
ATOM   5191 N NH2 . ARG D 1 259 ? 54.126  24.677 64.604  1.00 52.52 ? 347 ARG B NH2 1 
ATOM   5192 N N   . LEU D 1 260 ? 57.038  23.424 58.830  1.00 41.05 ? 348 LEU B N   1 
ATOM   5193 C CA  . LEU D 1 260 ? 56.855  22.428 57.784  1.00 40.28 ? 348 LEU B CA  1 
ATOM   5194 C C   . LEU D 1 260 ? 57.871  22.572 56.653  1.00 39.67 ? 348 LEU B C   1 
ATOM   5195 O O   . LEU D 1 260 ? 58.478  21.582 56.239  1.00 40.57 ? 348 LEU B O   1 
ATOM   5196 C CB  . LEU D 1 260 ? 55.432  22.506 57.231  1.00 40.91 ? 348 LEU B CB  1 
ATOM   5197 C CG  . LEU D 1 260 ? 54.325  22.171 58.244  1.00 41.16 ? 348 LEU B CG  1 
ATOM   5198 N N   . LEU D 1 261 ? 58.067  23.796 56.161  1.00 38.32 ? 349 LEU B N   1 
ATOM   5199 C CA  . LEU D 1 261 ? 59.032  24.058 55.082  1.00 36.88 ? 349 LEU B CA  1 
ATOM   5200 C C   . LEU D 1 261 ? 60.470  23.589 55.350  1.00 36.08 ? 349 LEU B C   1 
ATOM   5201 O O   . LEU D 1 261 ? 61.253  23.424 54.410  1.00 35.40 ? 349 LEU B O   1 
ATOM   5202 C CB  . LEU D 1 261 ? 59.064  25.552 54.744  1.00 36.70 ? 349 LEU B CB  1 
ATOM   5203 C CG  . LEU D 1 261 ? 57.788  26.168 54.157  1.00 37.30 ? 349 LEU B CG  1 
ATOM   5204 C CD1 . LEU D 1 261 ? 57.939  27.683 54.036  1.00 36.93 ? 349 LEU B CD1 1 
ATOM   5205 C CD2 . LEU D 1 261 ? 57.500  25.543 52.800  1.00 36.74 ? 349 LEU B CD2 1 
ATOM   5206 N N   . LEU D 1 262 ? 60.832  23.381 56.614  1.00 35.26 ? 350 LEU B N   1 
ATOM   5207 C CA  . LEU D 1 262 ? 62.188  22.930 56.916  1.00 34.87 ? 350 LEU B CA  1 
ATOM   5208 C C   . LEU D 1 262 ? 62.373  21.477 56.490  1.00 35.11 ? 350 LEU B C   1 
ATOM   5209 O O   . LEU D 1 262 ? 63.501  21.024 56.304  1.00 35.04 ? 350 LEU B O   1 
ATOM   5210 C CB  . LEU D 1 262 ? 62.498  23.096 58.411  1.00 34.10 ? 350 LEU B CB  1 
ATOM   5211 C CG  . LEU D 1 262 ? 62.354  24.524 58.972  1.00 32.88 ? 350 LEU B CG  1 
ATOM   5212 C CD1 . LEU D 1 262 ? 62.750  24.539 60.421  1.00 31.80 ? 350 LEU B CD1 1 
ATOM   5213 C CD2 . LEU D 1 262 ? 63.233  25.488 58.199  1.00 32.74 ? 350 LEU B CD2 1 
ATOM   5214 N N   . SER D 1 263 ? 61.259  20.762 56.311  1.00 35.06 ? 351 SER B N   1 
ATOM   5215 C CA  . SER D 1 263 ? 61.282  19.360 55.897  1.00 35.13 ? 351 SER B CA  1 
ATOM   5216 C C   . SER D 1 263 ? 61.153  19.243 54.383  1.00 35.04 ? 351 SER B C   1 
ATOM   5217 O O   . SER D 1 263 ? 61.200  18.145 53.814  1.00 35.01 ? 351 SER B O   1 
ATOM   5218 C CB  . SER D 1 263 ? 60.137  18.596 56.565  1.00 36.17 ? 351 SER B CB  1 
ATOM   5219 O OG  . SER D 1 263 ? 60.250  18.660 57.978  1.00 38.05 ? 351 SER B OG  1 
ATOM   5220 N N   . SER D 1 264 ? 60.989  20.389 53.737  1.00 34.63 ? 352 SER B N   1 
ATOM   5221 C CA  . SER D 1 264 ? 60.846  20.443 52.289  1.00 34.35 ? 352 SER B CA  1 
ATOM   5222 C C   . SER D 1 264 ? 61.897  19.643 51.561  1.00 34.30 ? 352 SER B C   1 
ATOM   5223 O O   . SER D 1 264 ? 63.072  19.731 51.876  1.00 34.67 ? 352 SER B O   1 
ATOM   5224 C CB  . SER D 1 264 ? 60.922  21.892 51.800  1.00 34.20 ? 352 SER B CB  1 
ATOM   5225 O OG  . SER D 1 264 ? 61.097  21.939 50.392  1.00 32.96 ? 352 SER B OG  1 
ATOM   5226 N N   . PRO D 1 265 ? 61.484  18.829 50.582  1.00 34.38 ? 353 PRO B N   1 
ATOM   5227 C CA  . PRO D 1 265 ? 62.472  18.048 49.840  1.00 33.54 ? 353 PRO B CA  1 
ATOM   5228 C C   . PRO D 1 265 ? 63.355  18.990 49.010  1.00 32.93 ? 353 PRO B C   1 
ATOM   5229 O O   . PRO D 1 265 ? 64.523  18.710 48.783  1.00 33.07 ? 353 PRO B O   1 
ATOM   5230 C CB  . PRO D 1 265 ? 61.599  17.144 48.981  1.00 33.62 ? 353 PRO B CB  1 
ATOM   5231 C CG  . PRO D 1 265 ? 60.411  18.030 48.703  1.00 34.23 ? 353 PRO B CG  1 
ATOM   5232 C CD  . PRO D 1 265 ? 60.127  18.502 50.113  1.00 34.63 ? 353 PRO B CD  1 
ATOM   5233 N N   . LYS D 1 266 ? 62.799  20.116 48.576  1.00 32.49 ? 354 LYS B N   1 
ATOM   5234 C CA  . LYS D 1 266 ? 63.552  21.096 47.776  1.00 32.58 ? 354 LYS B CA  1 
ATOM   5235 C C   . LYS D 1 266 ? 64.587  21.839 48.655  1.00 32.15 ? 354 LYS B C   1 
ATOM   5236 O O   . LYS D 1 266 ? 64.233  22.472 49.656  1.00 31.67 ? 354 LYS B O   1 
ATOM   5237 C CB  . LYS D 1 266 ? 62.576  22.087 47.132  1.00 32.63 ? 354 LYS B CB  1 
ATOM   5238 C CG  . LYS D 1 266 ? 63.165  22.930 46.029  1.00 32.77 ? 354 LYS B CG  1 
ATOM   5239 N N   . GLU D 1 267 ? 65.861  21.755 48.269  1.00 31.97 ? 355 GLU B N   1 
ATOM   5240 C CA  . GLU D 1 267 ? 66.970  22.348 49.033  1.00 31.88 ? 355 GLU B CA  1 
ATOM   5241 C C   . GLU D 1 267 ? 66.957  23.870 49.176  1.00 31.64 ? 355 GLU B C   1 
ATOM   5242 O O   . GLU D 1 267 ? 67.153  24.388 50.274  1.00 31.04 ? 355 GLU B O   1 
ATOM   5243 C CB  . GLU D 1 267 ? 68.315  21.894 48.442  1.00 32.79 ? 355 GLU B CB  1 
ATOM   5244 C CG  . GLU D 1 267 ? 69.574  22.217 49.273  1.00 32.45 ? 355 GLU B CG  1 
ATOM   5245 C CD  . GLU D 1 267 ? 69.624  21.495 50.622  1.00 33.44 ? 355 GLU B CD  1 
ATOM   5246 O OE1 . GLU D 1 267 ? 69.501  20.252 50.651  1.00 34.79 ? 355 GLU B OE1 1 
ATOM   5247 O OE2 . GLU D 1 267 ? 69.806  22.166 51.658  1.00 32.64 ? 355 GLU B OE2 1 
ATOM   5248 N N   . ASN D 1 268 ? 66.752  24.602 48.086  1.00 31.56 ? 356 ASN B N   1 
ATOM   5249 C CA  . ASN D 1 268 ? 66.698  26.048 48.225  1.00 31.25 ? 356 ASN B CA  1 
ATOM   5250 C C   . ASN D 1 268 ? 65.517  26.484 49.091  1.00 31.60 ? 356 ASN B C   1 
ATOM   5251 O O   . ASN D 1 268 ? 65.507  27.613 49.598  1.00 32.71 ? 356 ASN B O   1 
ATOM   5252 C CB  . ASN D 1 268 ? 66.608  26.757 46.872  1.00 31.74 ? 356 ASN B CB  1 
ATOM   5253 C CG  . ASN D 1 268 ? 67.917  26.741 46.110  1.00 32.51 ? 356 ASN B CG  1 
ATOM   5254 O OD1 . ASN D 1 268 ? 68.995  26.950 46.682  1.00 33.42 ? 356 ASN B OD1 1 
ATOM   5255 N ND2 . ASN D 1 268 ? 67.829  26.531 44.807  1.00 32.54 ? 356 ASN B ND2 1 
ATOM   5256 N N   . ILE D 1 269 ? 64.511  25.625 49.258  1.00 30.75 ? 357 ILE B N   1 
ATOM   5257 C CA  . ILE D 1 269 ? 63.379  25.995 50.106  1.00 30.16 ? 357 ILE B CA  1 
ATOM   5258 C C   . ILE D 1 269 ? 63.751  25.880 51.585  1.00 30.62 ? 357 ILE B C   1 
ATOM   5259 O O   . ILE D 1 269 ? 63.348  26.719 52.383  1.00 31.29 ? 357 ILE B O   1 
ATOM   5260 C CB  . ILE D 1 269 ? 62.129  25.150 49.820  1.00 29.28 ? 357 ILE B CB  1 
ATOM   5261 C CG1 . ILE D 1 269 ? 61.507  25.604 48.506  1.00 28.21 ? 357 ILE B CG1 1 
ATOM   5262 C CG2 . ILE D 1 269 ? 61.132  25.274 50.970  1.00 28.72 ? 357 ILE B CG2 1 
ATOM   5263 C CD1 . ILE D 1 269 ? 60.314  24.789 48.091  1.00 28.14 ? 357 ILE B CD1 1 
ATOM   5264 N N   . LYS D 1 270 ? 64.515  24.852 51.954  1.00 30.50 ? 358 LYS B N   1 
ATOM   5265 C CA  . LYS D 1 270 ? 64.937  24.713 53.349  1.00 29.82 ? 358 LYS B CA  1 
ATOM   5266 C C   . LYS D 1 270 ? 65.779  25.939 53.690  1.00 29.55 ? 358 LYS B C   1 
ATOM   5267 O O   . LYS D 1 270 ? 65.676  26.497 54.781  1.00 28.85 ? 358 LYS B O   1 
ATOM   5268 C CB  . LYS D 1 270 ? 65.787  23.459 53.546  1.00 29.35 ? 358 LYS B CB  1 
ATOM   5269 C CG  . LYS D 1 270 ? 65.061  22.154 53.341  1.00 30.52 ? 358 LYS B CG  1 
ATOM   5270 C CD  . LYS D 1 270 ? 66.028  20.983 53.448  1.00 31.25 ? 358 LYS B CD  1 
ATOM   5271 C CE  . LYS D 1 270 ? 65.282  19.686 53.315  1.00 33.16 ? 358 LYS B CE  1 
ATOM   5272 N NZ  . LYS D 1 270 ? 66.176  18.516 53.184  1.00 35.32 ? 358 LYS B NZ  1 
ATOM   5273 N N   . LYS D 1 271 ? 66.611  26.347 52.735  1.00 29.21 ? 359 LYS B N   1 
ATOM   5274 C CA  . LYS D 1 271 ? 67.476  27.498 52.895  1.00 29.17 ? 359 LYS B CA  1 
ATOM   5275 C C   . LYS D 1 271 ? 66.712  28.789 53.226  1.00 30.00 ? 359 LYS B C   1 
ATOM   5276 O O   . LYS D 1 271 ? 66.868  29.355 54.316  1.00 30.12 ? 359 LYS B O   1 
ATOM   5277 C CB  . LYS D 1 271 ? 68.291  27.722 51.625  1.00 28.77 ? 359 LYS B CB  1 
ATOM   5278 C CG  . LYS D 1 271 ? 69.291  28.862 51.753  1.00 28.87 ? 359 LYS B CG  1 
ATOM   5279 C CD  . LYS D 1 271 ? 70.033  29.158 50.458  1.00 28.50 ? 359 LYS B CD  1 
ATOM   5280 C CE  . LYS D 1 271 ? 69.087  29.651 49.389  1.00 28.87 ? 359 LYS B CE  1 
ATOM   5281 N NZ  . LYS D 1 271 ? 69.800  30.112 48.175  1.00 28.87 ? 359 LYS B NZ  1 
ATOM   5282 N N   . GLU D 1 272 ? 65.881  29.254 52.296  1.00 29.66 ? 360 GLU B N   1 
ATOM   5283 C CA  . GLU D 1 272 ? 65.150  30.493 52.525  1.00 29.44 ? 360 GLU B CA  1 
ATOM   5284 C C   . GLU D 1 272 ? 64.226  30.439 53.738  1.00 29.03 ? 360 GLU B C   1 
ATOM   5285 O O   . GLU D 1 272 ? 63.863  31.480 54.292  1.00 29.13 ? 360 GLU B O   1 
ATOM   5286 C CB  . GLU D 1 272 ? 64.359  30.901 51.281  1.00 30.59 ? 360 GLU B CB  1 
ATOM   5287 C CG  . GLU D 1 272 ? 65.168  30.892 49.988  1.00 32.08 ? 360 GLU B CG  1 
ATOM   5288 C CD  . GLU D 1 272 ? 64.543  31.768 48.920  1.00 34.33 ? 360 GLU B CD  1 
ATOM   5289 O OE1 . GLU D 1 272 ? 63.301  31.761 48.780  1.00 37.00 ? 360 GLU B OE1 1 
ATOM   5290 O OE2 . GLU D 1 272 ? 65.285  32.463 48.205  1.00 34.96 ? 360 GLU B OE2 1 
ATOM   5291 N N   . ALA D 1 273 ? 63.837  29.238 54.152  1.00 28.37 ? 361 ALA B N   1 
ATOM   5292 C CA  . ALA D 1 273 ? 62.986  29.106 55.324  1.00 28.30 ? 361 ALA B CA  1 
ATOM   5293 C C   . ALA D 1 273 ? 63.832  29.514 56.528  1.00 28.29 ? 361 ALA B C   1 
ATOM   5294 O O   . ALA D 1 273 ? 63.354  30.202 57.422  1.00 27.79 ? 361 ALA B O   1 
ATOM   5295 C CB  . ALA D 1 273 ? 62.505  27.665 55.483  1.00 28.34 ? 361 ALA B CB  1 
ATOM   5296 N N   . CYS D 1 274 ? 65.095  29.082 56.528  1.00 28.62 ? 362 CYS B N   1 
ATOM   5297 C CA  . CYS D 1 274 ? 66.044  29.382 57.604  1.00 29.05 ? 362 CYS B CA  1 
ATOM   5298 C C   . CYS D 1 274 ? 66.371  30.861 57.583  1.00 29.43 ? 362 CYS B C   1 
ATOM   5299 O O   . CYS D 1 274 ? 66.506  31.505 58.623  1.00 29.15 ? 362 CYS B O   1 
ATOM   5300 C CB  . CYS D 1 274 ? 67.331  28.567 57.429  1.00 29.43 ? 362 CYS B CB  1 
ATOM   5301 S SG  . CYS D 1 274 ? 67.174  26.795 57.798  1.00 29.00 ? 362 CYS B SG  1 
ATOM   5302 N N   . TRP D 1 275 ? 66.508  31.378 56.370  1.00 30.08 ? 363 TRP B N   1 
ATOM   5303 C CA  . TRP D 1 275 ? 66.768  32.783 56.120  1.00 29.49 ? 363 TRP B CA  1 
ATOM   5304 C C   . TRP D 1 275 ? 65.644  33.616 56.744  1.00 29.78 ? 363 TRP B C   1 
ATOM   5305 O O   . TRP D 1 275 ? 65.908  34.568 57.486  1.00 30.22 ? 363 TRP B O   1 
ATOM   5306 C CB  . TRP D 1 275 ? 66.815  33.018 54.616  1.00 29.45 ? 363 TRP B CB  1 
ATOM   5307 C CG  . TRP D 1 275 ? 66.852  34.453 54.213  1.00 30.91 ? 363 TRP B CG  1 
ATOM   5308 C CD1 . TRP D 1 275 ? 67.831  35.367 54.503  1.00 30.62 ? 363 TRP B CD1 1 
ATOM   5309 C CD2 . TRP D 1 275 ? 65.905  35.132 53.384  1.00 30.75 ? 363 TRP B CD2 1 
ATOM   5310 N NE1 . TRP D 1 275 ? 67.549  36.568 53.896  1.00 30.61 ? 363 TRP B NE1 1 
ATOM   5311 C CE2 . TRP D 1 275 ? 66.375  36.452 53.201  1.00 30.98 ? 363 TRP B CE2 1 
ATOM   5312 C CE3 . TRP D 1 275 ? 64.704  34.751 52.770  1.00 31.37 ? 363 TRP B CE3 1 
ATOM   5313 C CZ2 . TRP D 1 275 ? 65.685  37.394 52.430  1.00 30.76 ? 363 TRP B CZ2 1 
ATOM   5314 C CZ3 . TRP D 1 275 ? 64.018  35.688 51.999  1.00 31.63 ? 363 TRP B CZ3 1 
ATOM   5315 C CH2 . TRP D 1 275 ? 64.512  36.994 51.835  1.00 30.81 ? 363 TRP B CH2 1 
ATOM   5316 N N   . THR D 1 276 ? 64.393  33.265 56.438  1.00 29.05 ? 364 THR B N   1 
ATOM   5317 C CA  . THR D 1 276 ? 63.250  33.992 56.995  1.00 28.45 ? 364 THR B CA  1 
ATOM   5318 C C   . THR D 1 276 ? 63.296  33.913 58.523  1.00 28.54 ? 364 THR B C   1 
ATOM   5319 O O   . THR D 1 276 ? 63.285  34.932 59.221  1.00 28.48 ? 364 THR B O   1 
ATOM   5320 C CB  . THR D 1 276 ? 61.887  33.415 56.487  1.00 27.81 ? 364 THR B CB  1 
ATOM   5321 O OG1 . THR D 1 276 ? 61.834  33.512 55.060  1.00 26.10 ? 364 THR B OG1 1 
ATOM   5322 C CG2 . THR D 1 276 ? 60.704  34.195 57.072  1.00 26.03 ? 364 THR B CG2 1 
ATOM   5323 N N   . ILE D 1 277 ? 63.355  32.699 59.047  1.00 28.88 ? 365 ILE B N   1 
ATOM   5324 C CA  . ILE D 1 277 ? 63.416  32.535 60.485  1.00 29.41 ? 365 ILE B CA  1 
ATOM   5325 C C   . ILE D 1 277 ? 64.501  33.421 61.102  1.00 29.54 ? 365 ILE B C   1 
ATOM   5326 O O   . ILE D 1 277 ? 64.277  34.035 62.135  1.00 29.40 ? 365 ILE B O   1 
ATOM   5327 C CB  . ILE D 1 277 ? 63.687  31.069 60.856  1.00 29.59 ? 365 ILE B CB  1 
ATOM   5328 C CG1 . ILE D 1 277 ? 62.511  30.197 60.393  1.00 29.65 ? 365 ILE B CG1 1 
ATOM   5329 C CG2 . ILE D 1 277 ? 63.907  30.947 62.359  1.00 29.74 ? 365 ILE B CG2 1 
ATOM   5330 C CD1 . ILE D 1 277 ? 62.732  28.697 60.567  1.00 28.69 ? 365 ILE B CD1 1 
ATOM   5331 N N   . SER D 1 278 ? 65.660  33.512 60.457  1.00 30.02 ? 366 SER B N   1 
ATOM   5332 C CA  . SER D 1 278 ? 66.755  34.317 61.000  1.00 30.91 ? 366 SER B CA  1 
ATOM   5333 C C   . SER D 1 278 ? 66.445  35.816 61.088  1.00 32.02 ? 366 SER B C   1 
ATOM   5334 O O   . SER D 1 278 ? 66.932  36.486 62.009  1.00 32.42 ? 366 SER B O   1 
ATOM   5335 C CB  . SER D 1 278 ? 68.061  34.111 60.205  1.00 29.84 ? 366 SER B CB  1 
ATOM   5336 O OG  . SER D 1 278 ? 68.101  34.893 59.027  1.00 28.67 ? 366 SER B OG  1 
ATOM   5337 N N   . ASN D 1 279 ? 65.664  36.353 60.141  1.00 31.95 ? 367 ASN B N   1 
ATOM   5338 C CA  . ASN D 1 279 ? 65.311  37.774 60.193  1.00 32.23 ? 367 ASN B CA  1 
ATOM   5339 C C   . ASN D 1 279 ? 64.232  38.014 61.245  1.00 32.85 ? 367 ASN B C   1 
ATOM   5340 O O   . ASN D 1 279 ? 63.928  39.162 61.580  1.00 32.52 ? 367 ASN B O   1 
ATOM   5341 C CB  . ASN D 1 279 ? 64.804  38.304 58.841  1.00 31.63 ? 367 ASN B CB  1 
ATOM   5342 C CG  . ASN D 1 279 ? 65.919  38.603 57.867  1.00 30.79 ? 367 ASN B CG  1 
ATOM   5343 O OD1 . ASN D 1 279 ? 66.858  39.330 58.182  1.00 30.38 ? 367 ASN B OD1 1 
ATOM   5344 N ND2 . ASN D 1 279 ? 65.810  38.060 56.669  1.00 31.16 ? 367 ASN B ND2 1 
ATOM   5345 N N   . ILE D 1 280 ? 63.630  36.935 61.742  1.00 33.01 ? 368 ILE B N   1 
ATOM   5346 C CA  . ILE D 1 280 ? 62.617  37.067 62.782  1.00 33.07 ? 368 ILE B CA  1 
ATOM   5347 C C   . ILE D 1 280 ? 63.303  36.954 64.144  1.00 34.05 ? 368 ILE B C   1 
ATOM   5348 O O   . ILE D 1 280 ? 62.841  37.535 65.126  1.00 34.82 ? 368 ILE B O   1 
ATOM   5349 C CB  . ILE D 1 280 ? 61.519  35.995 62.657  1.00 32.01 ? 368 ILE B CB  1 
ATOM   5350 C CG1 . ILE D 1 280 ? 60.809  36.166 61.310  1.00 32.00 ? 368 ILE B CG1 1 
ATOM   5351 C CG2 . ILE D 1 280 ? 60.542  36.106 63.821  1.00 30.18 ? 368 ILE B CG2 1 
ATOM   5352 C CD1 . ILE D 1 280 ? 59.638  35.242 61.086  1.00 31.41 ? 368 ILE B CD1 1 
ATOM   5353 N N   . THR D 1 281 ? 64.412  36.220 64.206  1.00 34.28 ? 369 THR B N   1 
ATOM   5354 C CA  . THR D 1 281 ? 65.136  36.089 65.462  1.00 34.96 ? 369 THR B CA  1 
ATOM   5355 C C   . THR D 1 281 ? 66.060  37.282 65.601  1.00 35.09 ? 369 THR B C   1 
ATOM   5356 O O   . THR D 1 281 ? 66.818  37.386 66.556  1.00 35.61 ? 369 THR B O   1 
ATOM   5357 C CB  . THR D 1 281 ? 65.979  34.807 65.518  1.00 35.02 ? 369 THR B CB  1 
ATOM   5358 O OG1 . THR D 1 281 ? 66.897  34.798 64.417  1.00 35.96 ? 369 THR B OG1 1 
ATOM   5359 C CG2 . THR D 1 281 ? 65.083  33.574 65.467  1.00 34.08 ? 369 THR B CG2 1 
ATOM   5360 N N   . ALA D 1 282 ? 65.995  38.181 64.629  1.00 35.70 ? 370 ALA B N   1 
ATOM   5361 C CA  . ALA D 1 282 ? 66.805  39.389 64.645  1.00 36.26 ? 370 ALA B CA  1 
ATOM   5362 C C   . ALA D 1 282 ? 65.957  40.498 65.253  1.00 37.36 ? 370 ALA B C   1 
ATOM   5363 O O   . ALA D 1 282 ? 66.408  41.633 65.401  1.00 37.28 ? 370 ALA B O   1 
ATOM   5364 C CB  . ALA D 1 282 ? 67.202  39.764 63.244  1.00 36.01 ? 370 ALA B CB  1 
ATOM   5365 N N   . GLY D 1 283 ? 64.720  40.149 65.599  1.00 38.19 ? 371 GLY B N   1 
ATOM   5366 C CA  . GLY D 1 283 ? 63.798  41.107 66.181  1.00 39.28 ? 371 GLY B CA  1 
ATOM   5367 C C   . GLY D 1 283 ? 63.891  41.174 67.691  1.00 40.29 ? 371 GLY B C   1 
ATOM   5368 O O   . GLY D 1 283 ? 64.903  40.765 68.264  1.00 40.29 ? 371 GLY B O   1 
ATOM   5369 N N   . ASN D 1 284 ? 62.837  41.678 68.336  1.00 41.07 ? 372 ASN B N   1 
ATOM   5370 C CA  . ASN D 1 284 ? 62.821  41.809 69.789  1.00 41.70 ? 372 ASN B CA  1 
ATOM   5371 C C   . ASN D 1 284 ? 62.784  40.489 70.537  1.00 42.25 ? 372 ASN B C   1 
ATOM   5372 O O   . ASN D 1 284 ? 62.671  39.423 69.940  1.00 42.65 ? 372 ASN B O   1 
ATOM   5373 C CB  . ASN D 1 284 ? 61.662  42.698 70.259  1.00 41.87 ? 372 ASN B CB  1 
ATOM   5374 C CG  . ASN D 1 284 ? 60.306  42.178 69.840  1.00 42.47 ? 372 ASN B CG  1 
ATOM   5375 O OD1 . ASN D 1 284 ? 59.906  41.055 70.190  1.00 42.55 ? 372 ASN B OD1 1 
ATOM   5376 N ND2 . ASN D 1 284 ? 59.575  43.001 69.090  1.00 42.08 ? 372 ASN B ND2 1 
ATOM   5377 N N   . THR D 1 285 ? 62.893  40.588 71.856  1.00 42.87 ? 373 THR B N   1 
ATOM   5378 C CA  . THR D 1 285 ? 62.914  39.438 72.751  1.00 43.08 ? 373 THR B CA  1 
ATOM   5379 C C   . THR D 1 285 ? 61.670  38.574 72.619  1.00 43.30 ? 373 THR B C   1 
ATOM   5380 O O   . THR D 1 285 ? 61.756  37.338 72.645  1.00 43.70 ? 373 THR B O   1 
ATOM   5381 C CB  . THR D 1 285 ? 63.032  39.889 74.238  1.00 43.21 ? 373 THR B CB  1 
ATOM   5382 O OG1 . THR D 1 285 ? 64.207  40.691 74.419  1.00 42.71 ? 373 THR B OG1 1 
ATOM   5383 C CG2 . THR D 1 285 ? 63.101  38.674 75.158  1.00 42.98 ? 373 THR B CG2 1 
ATOM   5384 N N   . GLU D 1 286 ? 60.516  39.221 72.490  1.00 42.81 ? 374 GLU B N   1 
ATOM   5385 C CA  . GLU D 1 286 ? 59.255  38.500 72.374  1.00 42.76 ? 374 GLU B CA  1 
ATOM   5386 C C   . GLU D 1 286 ? 59.196  37.664 71.100  1.00 42.62 ? 374 GLU B C   1 
ATOM   5387 O O   . GLU D 1 286 ? 58.762  36.504 71.114  1.00 42.65 ? 374 GLU B O   1 
ATOM   5388 C CB  . GLU D 1 286 ? 58.081  39.480 72.397  1.00 42.42 ? 374 GLU B CB  1 
ATOM   5389 N N   . GLN D 1 287 ? 59.642  38.250 69.995  1.00 41.83 ? 375 GLN B N   1 
ATOM   5390 C CA  . GLN D 1 287 ? 59.611  37.542 68.727  1.00 41.09 ? 375 GLN B CA  1 
ATOM   5391 C C   . GLN D 1 287 ? 60.550  36.333 68.747  1.00 40.74 ? 375 GLN B C   1 
ATOM   5392 O O   . GLN D 1 287 ? 60.300  35.334 68.066  1.00 40.72 ? 375 GLN B O   1 
ATOM   5393 C CB  . GLN D 1 287 ? 59.961  38.510 67.596  1.00 40.88 ? 375 GLN B CB  1 
ATOM   5394 C CG  . GLN D 1 287 ? 59.096  39.761 67.626  1.00 40.33 ? 375 GLN B CG  1 
ATOM   5395 C CD  . GLN D 1 287 ? 59.365  40.699 66.469  1.00 40.53 ? 375 GLN B CD  1 
ATOM   5396 O OE1 . GLN D 1 287 ? 60.511  41.069 66.197  1.00 41.01 ? 375 GLN B OE1 1 
ATOM   5397 N NE2 . GLN D 1 287 ? 58.305  41.107 65.790  1.00 39.64 ? 375 GLN B NE2 1 
ATOM   5398 N N   . ILE D 1 288 ? 61.623  36.424 69.531  1.00 39.90 ? 376 ILE B N   1 
ATOM   5399 C CA  . ILE D 1 288 ? 62.576  35.327 69.656  1.00 39.13 ? 376 ILE B CA  1 
ATOM   5400 C C   . ILE D 1 288 ? 61.888  34.186 70.414  1.00 38.97 ? 376 ILE B C   1 
ATOM   5401 O O   . ILE D 1 288 ? 62.075  33.004 70.105  1.00 38.13 ? 376 ILE B O   1 
ATOM   5402 C CB  . ILE D 1 288 ? 63.854  35.761 70.438  1.00 38.77 ? 376 ILE B CB  1 
ATOM   5403 C CG1 . ILE D 1 288 ? 64.645  36.786 69.625  1.00 38.44 ? 376 ILE B CG1 1 
ATOM   5404 C CG2 . ILE D 1 288 ? 64.722  34.541 70.769  1.00 38.97 ? 376 ILE B CG2 1 
ATOM   5405 C CD1 . ILE D 1 288 ? 65.999  37.145 70.228  1.00 38.00 ? 376 ILE B CD1 1 
ATOM   5406 N N   . GLN D 1 289 ? 61.085  34.559 71.406  1.00 38.76 ? 377 GLN B N   1 
ATOM   5407 C CA  . GLN D 1 289 ? 60.366  33.583 72.214  1.00 38.76 ? 377 GLN B CA  1 
ATOM   5408 C C   . GLN D 1 289 ? 59.296  32.902 71.366  1.00 37.89 ? 377 GLN B C   1 
ATOM   5409 O O   . GLN D 1 289 ? 59.055  31.700 71.496  1.00 36.48 ? 377 GLN B O   1 
ATOM   5410 C CB  . GLN D 1 289 ? 59.713  34.269 73.421  1.00 39.79 ? 377 GLN B CB  1 
ATOM   5411 C CG  . GLN D 1 289 ? 59.108  33.301 74.429  1.00 39.90 ? 377 GLN B CG  1 
ATOM   5412 C CD  . GLN D 1 289 ? 60.160  32.415 75.078  1.00 40.72 ? 377 GLN B CD  1 
ATOM   5413 O OE1 . GLN D 1 289 ? 61.080  32.912 75.746  1.00 40.36 ? 377 GLN B OE1 1 
ATOM   5414 N NE2 . GLN D 1 289 ? 60.033  31.098 74.887  1.00 40.83 ? 377 GLN B NE2 1 
ATOM   5415 N N   . ALA D 1 290 ? 58.663  33.685 70.497  1.00 37.78 ? 378 ALA B N   1 
ATOM   5416 C CA  . ALA D 1 290 ? 57.627  33.171 69.607  1.00 38.13 ? 378 ALA B CA  1 
ATOM   5417 C C   . ALA D 1 290 ? 58.214  32.033 68.788  1.00 38.59 ? 378 ALA B C   1 
ATOM   5418 O O   . ALA D 1 290 ? 57.607  30.975 68.637  1.00 38.50 ? 378 ALA B O   1 
ATOM   5419 C CB  . ALA D 1 290 ? 57.137  34.277 68.682  1.00 37.98 ? 378 ALA B CB  1 
ATOM   5420 N N   . VAL D 1 291 ? 59.409  32.267 68.256  1.00 39.15 ? 379 VAL B N   1 
ATOM   5421 C CA  . VAL D 1 291 ? 60.096  31.264 67.461  1.00 39.56 ? 379 VAL B CA  1 
ATOM   5422 C C   . VAL D 1 291 ? 60.382  30.036 68.306  1.00 40.14 ? 379 VAL B C   1 
ATOM   5423 O O   . VAL D 1 291 ? 60.230  28.910 67.836  1.00 40.20 ? 379 VAL B O   1 
ATOM   5424 C CB  . VAL D 1 291 ? 61.423  31.808 66.914  1.00 39.13 ? 379 VAL B CB  1 
ATOM   5425 C CG1 . VAL D 1 291 ? 62.197  30.699 66.223  1.00 38.77 ? 379 VAL B CG1 1 
ATOM   5426 C CG2 . VAL D 1 291 ? 61.146  32.939 65.952  1.00 38.51 ? 379 VAL B CG2 1 
ATOM   5427 N N   . ILE D 1 292 ? 60.810  30.262 69.547  1.00 40.57 ? 380 ILE B N   1 
ATOM   5428 C CA  . ILE D 1 292 ? 61.110  29.169 70.462  1.00 41.19 ? 380 ILE B CA  1 
ATOM   5429 C C   . ILE D 1 292 ? 59.857  28.356 70.773  1.00 41.90 ? 380 ILE B C   1 
ATOM   5430 O O   . ILE D 1 292 ? 59.906  27.121 70.801  1.00 42.26 ? 380 ILE B O   1 
ATOM   5431 C CB  . ILE D 1 292 ? 61.719  29.693 71.785  1.00 40.68 ? 380 ILE B CB  1 
ATOM   5432 C CG1 . ILE D 1 292 ? 63.166  30.134 71.542  1.00 40.65 ? 380 ILE B CG1 1 
ATOM   5433 C CG2 . ILE D 1 292 ? 61.623  28.631 72.869  1.00 40.33 ? 380 ILE B CG2 1 
ATOM   5434 C CD1 . ILE D 1 292 ? 63.879  30.650 72.780  1.00 40.68 ? 380 ILE B CD1 1 
ATOM   5435 N N   . ASP D 1 293 ? 58.738  29.053 70.990  1.00 42.16 ? 381 ASP B N   1 
ATOM   5436 C CA  . ASP D 1 293 ? 57.468  28.398 71.315  1.00 41.85 ? 381 ASP B CA  1 
ATOM   5437 C C   . ASP D 1 293 ? 56.858  27.633 70.143  1.00 42.00 ? 381 ASP B C   1 
ATOM   5438 O O   . ASP D 1 293 ? 56.119  26.662 70.345  1.00 41.84 ? 381 ASP B O   1 
ATOM   5439 C CB  . ASP D 1 293 ? 56.433  29.409 71.844  1.00 41.83 ? 381 ASP B CB  1 
ATOM   5440 C CG  . ASP D 1 293 ? 56.801  29.988 73.205  1.00 41.80 ? 381 ASP B CG  1 
ATOM   5441 O OD1 . ASP D 1 293 ? 57.300  29.243 74.074  1.00 42.08 ? 381 ASP B OD1 1 
ATOM   5442 O OD2 . ASP D 1 293 ? 56.556  31.188 73.425  1.00 41.79 ? 381 ASP B OD2 1 
ATOM   5443 N N   . ALA D 1 294 ? 57.154  28.075 68.920  1.00 41.32 ? 382 ALA B N   1 
ATOM   5444 C CA  . ALA D 1 294 ? 56.636  27.409 67.733  1.00 40.10 ? 382 ALA B CA  1 
ATOM   5445 C C   . ALA D 1 294 ? 57.358  26.085 67.560  1.00 40.11 ? 382 ALA B C   1 
ATOM   5446 O O   . ALA D 1 294 ? 56.920  25.233 66.798  1.00 40.43 ? 382 ALA B O   1 
ATOM   5447 C CB  . ALA D 1 294 ? 56.846  28.280 66.507  1.00 39.23 ? 382 ALA B CB  1 
ATOM   5448 N N   . ASN D 1 295 ? 58.469  25.917 68.266  1.00 40.27 ? 383 ASN B N   1 
ATOM   5449 C CA  . ASN D 1 295 ? 59.253  24.691 68.177  1.00 41.61 ? 383 ASN B CA  1 
ATOM   5450 C C   . ASN D 1 295 ? 60.090  24.576 66.901  1.00 41.10 ? 383 ASN B C   1 
ATOM   5451 O O   . ASN D 1 295 ? 60.111  23.533 66.252  1.00 41.84 ? 383 ASN B O   1 
ATOM   5452 C CB  . ASN D 1 295 ? 58.328  23.477 68.301  1.00 43.21 ? 383 ASN B CB  1 
ATOM   5453 C CG  . ASN D 1 295 ? 58.588  22.675 69.567  1.00 44.91 ? 383 ASN B CG  1 
ATOM   5454 O OD1 . ASN D 1 295 ? 59.613  21.988 69.676  1.00 45.42 ? 383 ASN B OD1 1 
ATOM   5455 N ND2 . ASN D 1 295 ? 57.667  22.770 70.541  1.00 44.85 ? 383 ASN B ND2 1 
ATOM   5456 N N   . LEU D 1 296 ? 60.789  25.653 66.557  1.00 40.39 ? 384 LEU B N   1 
ATOM   5457 C CA  . LEU D 1 296 ? 61.635  25.697 65.370  1.00 39.29 ? 384 LEU B CA  1 
ATOM   5458 C C   . LEU D 1 296 ? 63.101  25.418 65.671  1.00 38.78 ? 384 LEU B C   1 
ATOM   5459 O O   . LEU D 1 296 ? 63.859  25.033 64.780  1.00 38.72 ? 384 LEU B O   1 
ATOM   5460 C CB  . LEU D 1 296 ? 61.512  27.060 64.701  1.00 39.24 ? 384 LEU B CB  1 
ATOM   5461 C CG  . LEU D 1 296 ? 60.316  27.340 63.788  1.00 39.79 ? 384 LEU B CG  1 
ATOM   5462 C CD1 . LEU D 1 296 ? 59.062  26.689 64.316  1.00 40.05 ? 384 LEU B CD1 1 
ATOM   5463 C CD2 . LEU D 1 296 ? 60.147  28.858 63.654  1.00 39.71 ? 384 LEU B CD2 1 
ATOM   5464 N N   . ILE D 1 297 ? 63.504  25.596 66.923  1.00 37.75 ? 385 ILE B N   1 
ATOM   5465 C CA  . ILE D 1 297 ? 64.894  25.372 67.290  1.00 36.56 ? 385 ILE B CA  1 
ATOM   5466 C C   . ILE D 1 297 ? 65.369  23.950 66.993  1.00 36.11 ? 385 ILE B C   1 
ATOM   5467 O O   . ILE D 1 297 ? 66.389  23.749 66.332  1.00 36.84 ? 385 ILE B O   1 
ATOM   5468 C CB  . ILE D 1 297 ? 65.138  25.709 68.779  1.00 35.79 ? 385 ILE B CB  1 
ATOM   5469 C CG1 . ILE D 1 297 ? 64.751  27.167 69.043  1.00 35.53 ? 385 ILE B CG1 1 
ATOM   5470 C CG2 . ILE D 1 297 ? 66.613  25.538 69.127  1.00 36.13 ? 385 ILE B CG2 1 
ATOM   5471 C CD1 . ILE D 1 297 ? 65.535  28.173 68.236  1.00 34.40 ? 385 ILE B CD1 1 
ATOM   5472 N N   . PRO D 1 298 ? 64.630  22.943 67.458  1.00 35.60 ? 386 PRO B N   1 
ATOM   5473 C CA  . PRO D 1 298 ? 65.069  21.573 67.184  1.00 35.24 ? 386 PRO B CA  1 
ATOM   5474 C C   . PRO D 1 298 ? 65.414  21.248 65.723  1.00 34.58 ? 386 PRO B C   1 
ATOM   5475 O O   . PRO D 1 298 ? 66.522  20.808 65.424  1.00 35.26 ? 386 PRO B O   1 
ATOM   5476 C CB  . PRO D 1 298 ? 63.919  20.748 67.755  1.00 34.69 ? 386 PRO B CB  1 
ATOM   5477 C CG  . PRO D 1 298 ? 63.526  21.603 68.968  1.00 34.83 ? 386 PRO B CG  1 
ATOM   5478 C CD  . PRO D 1 298 ? 63.388  22.921 68.249  1.00 35.76 ? 386 PRO B CD  1 
ATOM   5479 N N   . PRO D 1 299 ? 64.483  21.474 64.790  1.00 34.03 ? 387 PRO B N   1 
ATOM   5480 C CA  . PRO D 1 299 ? 64.802  21.163 63.396  1.00 33.53 ? 387 PRO B CA  1 
ATOM   5481 C C   . PRO D 1 299 ? 65.953  22.031 62.883  1.00 33.73 ? 387 PRO B C   1 
ATOM   5482 O O   . PRO D 1 299 ? 66.762  21.594 62.057  1.00 34.24 ? 387 PRO B O   1 
ATOM   5483 C CB  . PRO D 1 299 ? 63.480  21.446 62.685  1.00 32.48 ? 387 PRO B CB  1 
ATOM   5484 C CG  . PRO D 1 299 ? 62.939  22.590 63.488  1.00 32.70 ? 387 PRO B CG  1 
ATOM   5485 C CD  . PRO D 1 299 ? 63.116  22.014 64.876  1.00 34.09 ? 387 PRO B CD  1 
ATOM   5486 N N   . LEU D 1 300 ? 66.021  23.262 63.381  1.00 33.14 ? 388 LEU B N   1 
ATOM   5487 C CA  . LEU D 1 300 ? 67.066  24.197 62.981  1.00 32.40 ? 388 LEU B CA  1 
ATOM   5488 C C   . LEU D 1 300 ? 68.440  23.620 63.336  1.00 32.65 ? 388 LEU B C   1 
ATOM   5489 O O   . LEU D 1 300 ? 69.372  23.645 62.526  1.00 32.29 ? 388 LEU B O   1 
ATOM   5490 C CB  . LEU D 1 300 ? 66.830  25.532 63.683  1.00 31.18 ? 388 LEU B CB  1 
ATOM   5491 C CG  . LEU D 1 300 ? 66.771  26.824 62.862  1.00 29.62 ? 388 LEU B CG  1 
ATOM   5492 C CD1 . LEU D 1 300 ? 66.096  26.598 61.544  1.00 29.78 ? 388 LEU B CD1 1 
ATOM   5493 C CD2 . LEU D 1 300 ? 66.026  27.885 63.674  1.00 28.56 ? 388 LEU B CD2 1 
ATOM   5494 N N   . VAL D 1 301 ? 68.550  23.089 64.549  1.00 32.96 ? 389 VAL B N   1 
ATOM   5495 C CA  . VAL D 1 301 ? 69.790  22.473 65.017  1.00 33.12 ? 389 VAL B CA  1 
ATOM   5496 C C   . VAL D 1 301 ? 70.166  21.261 64.137  1.00 33.17 ? 389 VAL B C   1 
ATOM   5497 O O   . VAL D 1 301 ? 71.341  21.055 63.802  1.00 32.16 ? 389 VAL B O   1 
ATOM   5498 C CB  . VAL D 1 301 ? 69.627  22.038 66.499  1.00 33.40 ? 389 VAL B CB  1 
ATOM   5499 C CG1 . VAL D 1 301 ? 70.803  21.167 66.951  1.00 32.78 ? 389 VAL B CG1 1 
ATOM   5500 C CG2 . VAL D 1 301 ? 69.518  23.282 67.377  1.00 32.40 ? 389 VAL B CG2 1 
ATOM   5501 N N   . LYS D 1 302 ? 69.163  20.475 63.752  1.00 33.18 ? 390 LYS B N   1 
ATOM   5502 C CA  . LYS D 1 302 ? 69.401  19.306 62.919  1.00 33.96 ? 390 LYS B CA  1 
ATOM   5503 C C   . LYS D 1 302 ? 69.999  19.728 61.582  1.00 33.87 ? 390 LYS B C   1 
ATOM   5504 O O   . LYS D 1 302 ? 70.990  19.156 61.122  1.00 33.70 ? 390 LYS B O   1 
ATOM   5505 C CB  . LYS D 1 302 ? 68.098  18.538 62.688  1.00 34.74 ? 390 LYS B CB  1 
ATOM   5506 C CG  . LYS D 1 302 ? 68.291  17.179 62.022  1.00 36.42 ? 390 LYS B CG  1 
ATOM   5507 C CD  . LYS D 1 302 ? 69.125  16.254 62.915  1.00 38.28 ? 390 LYS B CD  1 
ATOM   5508 C CE  . LYS D 1 302 ? 69.327  14.866 62.304  1.00 38.68 ? 390 LYS B CE  1 
ATOM   5509 N NZ  . LYS D 1 302 ? 70.139  13.999 63.213  1.00 38.33 ? 390 LYS B NZ  1 
ATOM   5510 N N   . LEU D 1 303 ? 69.394  20.730 60.953  1.00 33.50 ? 391 LEU B N   1 
ATOM   5511 C CA  . LEU D 1 303 ? 69.905  21.211 59.678  1.00 33.47 ? 391 LEU B CA  1 
ATOM   5512 C C   . LEU D 1 303 ? 71.269  21.866 59.866  1.00 33.88 ? 391 LEU B C   1 
ATOM   5513 O O   . LEU D 1 303 ? 72.110  21.838 58.963  1.00 33.76 ? 391 LEU B O   1 
ATOM   5514 C CB  . LEU D 1 303 ? 68.939  22.214 59.053  1.00 32.76 ? 391 LEU B CB  1 
ATOM   5515 C CG  . LEU D 1 303 ? 67.675  21.698 58.366  1.00 31.94 ? 391 LEU B CG  1 
ATOM   5516 C CD1 . LEU D 1 303 ? 66.772  22.867 58.057  1.00 32.10 ? 391 LEU B CD1 1 
ATOM   5517 C CD2 . LEU D 1 303 ? 68.034  20.964 57.090  1.00 31.10 ? 391 LEU B CD2 1 
ATOM   5518 N N   . LEU D 1 304 ? 71.483  22.446 61.045  1.00 34.09 ? 392 LEU B N   1 
ATOM   5519 C CA  . LEU D 1 304 ? 72.740  23.117 61.355  1.00 34.52 ? 392 LEU B CA  1 
ATOM   5520 C C   . LEU D 1 304 ? 73.863  22.092 61.342  1.00 35.37 ? 392 LEU B C   1 
ATOM   5521 O O   . LEU D 1 304 ? 75.000  22.427 61.009  1.00 34.98 ? 392 LEU B O   1 
ATOM   5522 C CB  . LEU D 1 304 ? 72.634  23.823 62.722  1.00 33.96 ? 392 LEU B CB  1 
ATOM   5523 C CG  . LEU D 1 304 ? 73.695  24.782 63.298  1.00 32.69 ? 392 LEU B CG  1 
ATOM   5524 C CD1 . LEU D 1 304 ? 74.859  24.024 63.843  1.00 33.77 ? 392 LEU B CD1 1 
ATOM   5525 C CD2 . LEU D 1 304 ? 74.132  25.775 62.248  1.00 32.56 ? 392 LEU B CD2 1 
ATOM   5526 N N   . GLU D 1 305 ? 73.546  20.836 61.665  1.00 36.35 ? 393 GLU B N   1 
ATOM   5527 C CA  . GLU D 1 305 ? 74.586  19.811 61.655  1.00 37.71 ? 393 GLU B CA  1 
ATOM   5528 C C   . GLU D 1 305 ? 74.656  18.954 60.387  1.00 37.05 ? 393 GLU B C   1 
ATOM   5529 O O   . GLU D 1 305 ? 75.728  18.429 60.075  1.00 37.24 ? 393 GLU B O   1 
ATOM   5530 C CB  . GLU D 1 305 ? 74.477  18.877 62.867  1.00 39.22 ? 393 GLU B CB  1 
ATOM   5531 C CG  . GLU D 1 305 ? 73.403  17.829 62.759  1.00 42.90 ? 393 GLU B CG  1 
ATOM   5532 C CD  . GLU D 1 305 ? 73.363  16.932 63.980  1.00 45.30 ? 393 GLU B CD  1 
ATOM   5533 O OE1 . GLU D 1 305 ? 73.265  17.486 65.100  1.00 46.75 ? 393 GLU B OE1 1 
ATOM   5534 O OE2 . GLU D 1 305 ? 73.422  15.686 63.828  1.00 45.89 ? 393 GLU B OE2 1 
ATOM   5535 N N   . VAL D 1 306 ? 73.557  18.807 59.645  1.00 36.15 ? 394 VAL B N   1 
ATOM   5536 C CA  . VAL D 1 306 ? 73.630  17.957 58.449  1.00 34.84 ? 394 VAL B CA  1 
ATOM   5537 C C   . VAL D 1 306 ? 73.228  18.504 57.084  1.00 33.74 ? 394 VAL B C   1 
ATOM   5538 O O   . VAL D 1 306 ? 73.417  17.819 56.081  1.00 33.80 ? 394 VAL B O   1 
ATOM   5539 C CB  . VAL D 1 306 ? 72.854  16.638 58.651  1.00 34.75 ? 394 VAL B CB  1 
ATOM   5540 C CG1 . VAL D 1 306 ? 73.443  15.878 59.814  1.00 34.72 ? 394 VAL B CG1 1 
ATOM   5541 C CG2 . VAL D 1 306 ? 71.381  16.922 58.875  1.00 35.06 ? 394 VAL B CG2 1 
ATOM   5542 N N   . ALA D 1 307 ? 72.702  19.720 57.015  1.00 32.26 ? 395 ALA B N   1 
ATOM   5543 C CA  . ALA D 1 307 ? 72.293  20.253 55.716  1.00 31.31 ? 395 ALA B CA  1 
ATOM   5544 C C   . ALA D 1 307 ? 73.476  20.546 54.809  1.00 30.50 ? 395 ALA B C   1 
ATOM   5545 O O   . ALA D 1 307 ? 74.619  20.325 55.187  1.00 30.70 ? 395 ALA B O   1 
ATOM   5546 C CB  . ALA D 1 307 ? 71.472  21.507 55.906  1.00 31.45 ? 395 ALA B CB  1 
ATOM   5547 N N   . GLU D 1 308 ? 73.195  21.023 53.602  1.00 29.78 ? 396 GLU B N   1 
ATOM   5548 C CA  . GLU D 1 308 ? 74.251  21.399 52.665  1.00 29.43 ? 396 GLU B CA  1 
ATOM   5549 C C   . GLU D 1 308 ? 74.836  22.684 53.255  1.00 28.57 ? 396 GLU B C   1 
ATOM   5550 O O   . GLU D 1 308 ? 74.228  23.282 54.141  1.00 27.83 ? 396 GLU B O   1 
ATOM   5551 C CB  . GLU D 1 308 ? 73.655  21.695 51.291  1.00 30.52 ? 396 GLU B CB  1 
ATOM   5552 C CG  . GLU D 1 308 ? 73.009  20.504 50.609  1.00 32.45 ? 396 GLU B CG  1 
ATOM   5553 C CD  . GLU D 1 308 ? 74.023  19.493 50.108  1.00 33.93 ? 396 GLU B CD  1 
ATOM   5554 O OE1 . GLU D 1 308 ? 74.840  19.875 49.249  1.00 34.65 ? 396 GLU B OE1 1 
ATOM   5555 O OE2 . GLU D 1 308 ? 74.010  18.320 50.565  1.00 35.64 ? 396 GLU B OE2 1 
ATOM   5556 N N   . TYR D 1 309 ? 75.991  23.131 52.771  1.00 27.83 ? 397 TYR B N   1 
ATOM   5557 C CA  . TYR D 1 309 ? 76.575  24.347 53.342  1.00 27.74 ? 397 TYR B CA  1 
ATOM   5558 C C   . TYR D 1 309 ? 75.695  25.587 53.196  1.00 27.17 ? 397 TYR B C   1 
ATOM   5559 O O   . TYR D 1 309 ? 75.457  26.300 54.173  1.00 26.39 ? 397 TYR B O   1 
ATOM   5560 C CB  . TYR D 1 309 ? 77.953  24.656 52.746  1.00 27.99 ? 397 TYR B CB  1 
ATOM   5561 C CG  . TYR D 1 309 ? 78.631  25.817 53.443  1.00 28.68 ? 397 TYR B CG  1 
ATOM   5562 C CD1 . TYR D 1 309 ? 78.933  25.748 54.806  1.00 29.05 ? 397 TYR B CD1 1 
ATOM   5563 C CD2 . TYR D 1 309 ? 78.920  27.007 52.764  1.00 28.66 ? 397 TYR B CD2 1 
ATOM   5564 C CE1 . TYR D 1 309 ? 79.505  26.839 55.487  1.00 29.13 ? 397 TYR B CE1 1 
ATOM   5565 C CE2 . TYR D 1 309 ? 79.493  28.105 53.433  1.00 28.51 ? 397 TYR B CE2 1 
ATOM   5566 C CZ  . TYR D 1 309 ? 79.780  28.015 54.795  1.00 29.25 ? 397 TYR B CZ  1 
ATOM   5567 O OH  . TYR D 1 309 ? 80.330  29.093 55.473  1.00 28.93 ? 397 TYR B OH  1 
ATOM   5568 N N   . LYS D 1 310 ? 75.207  25.845 51.989  1.00 26.65 ? 398 LYS B N   1 
ATOM   5569 C CA  . LYS D 1 310 ? 74.380  27.014 51.783  1.00 26.49 ? 398 LYS B CA  1 
ATOM   5570 C C   . LYS D 1 310 ? 73.172  27.074 52.716  1.00 27.11 ? 398 LYS B C   1 
ATOM   5571 O O   . LYS D 1 310 ? 72.604  28.142 52.901  1.00 27.65 ? 398 LYS B O   1 
ATOM   5572 C CB  . LYS D 1 310 ? 73.927  27.101 50.328  1.00 25.47 ? 398 LYS B CB  1 
ATOM   5573 C CG  . LYS D 1 310 ? 73.043  25.986 49.861  1.00 24.66 ? 398 LYS B CG  1 
ATOM   5574 C CD  . LYS D 1 310 ? 72.660  26.222 48.409  1.00 24.29 ? 398 LYS B CD  1 
ATOM   5575 C CE  . LYS D 1 310 ? 71.690  25.168 47.914  1.00 23.94 ? 398 LYS B CE  1 
ATOM   5576 N NZ  . LYS D 1 310 ? 71.143  25.482 46.569  1.00 22.90 ? 398 LYS B NZ  1 
ATOM   5577 N N   . THR D 1 311 ? 72.781  25.944 53.301  1.00 27.57 ? 399 THR B N   1 
ATOM   5578 C CA  . THR D 1 311 ? 71.644  25.915 54.230  1.00 28.63 ? 399 THR B CA  1 
ATOM   5579 C C   . THR D 1 311 ? 72.116  26.076 55.698  1.00 29.47 ? 399 THR B C   1 
ATOM   5580 O O   . THR D 1 311 ? 71.550  26.870 56.450  1.00 28.96 ? 399 THR B O   1 
ATOM   5581 C CB  . THR D 1 311 ? 70.815  24.597 54.065  1.00 28.75 ? 399 THR B CB  1 
ATOM   5582 O OG1 . THR D 1 311 ? 70.261  24.545 52.743  1.00 29.65 ? 399 THR B OG1 1 
ATOM   5583 C CG2 . THR D 1 311 ? 69.670  24.525 55.082  1.00 27.91 ? 399 THR B CG2 1 
ATOM   5584 N N   . LYS D 1 312 ? 73.149  25.334 56.100  1.00 30.20 ? 400 LYS B N   1 
ATOM   5585 C CA  . LYS D 1 312 ? 73.682  25.445 57.462  1.00 30.93 ? 400 LYS B CA  1 
ATOM   5586 C C   . LYS D 1 312 ? 73.980  26.905 57.735  1.00 31.72 ? 400 LYS B C   1 
ATOM   5587 O O   . LYS D 1 312 ? 73.759  27.420 58.830  1.00 31.70 ? 400 LYS B O   1 
ATOM   5588 C CB  . LYS D 1 312 ? 75.003  24.690 57.616  1.00 30.59 ? 400 LYS B CB  1 
ATOM   5589 C CG  . LYS D 1 312 ? 74.948  23.202 57.461  1.00 30.71 ? 400 LYS B CG  1 
ATOM   5590 C CD  . LYS D 1 312 ? 76.314  22.622 57.744  1.00 30.70 ? 400 LYS B CD  1 
ATOM   5591 C CE  . LYS D 1 312 ? 76.311  21.108 57.665  1.00 31.47 ? 400 LYS B CE  1 
ATOM   5592 N NZ  . LYS D 1 312 ? 77.666  20.545 57.926  1.00 31.39 ? 400 LYS B NZ  1 
ATOM   5593 N N   . LYS D 1 313 ? 74.521  27.550 56.709  1.00 32.75 ? 401 LYS B N   1 
ATOM   5594 C CA  . LYS D 1 313 ? 74.899  28.960 56.730  1.00 33.53 ? 401 LYS B CA  1 
ATOM   5595 C C   . LYS D 1 313 ? 73.766  29.803 57.305  1.00 34.10 ? 401 LYS B C   1 
ATOM   5596 O O   . LYS D 1 313 ? 73.974  30.640 58.183  1.00 34.21 ? 401 LYS B O   1 
ATOM   5597 C CB  . LYS D 1 313 ? 75.205  29.392 55.297  1.00 33.48 ? 401 LYS B CB  1 
ATOM   5598 C CG  . LYS D 1 313 ? 75.997  30.650 55.135  1.00 33.77 ? 401 LYS B CG  1 
ATOM   5599 C CD  . LYS D 1 313 ? 76.554  30.683 53.719  1.00 34.79 ? 401 LYS B CD  1 
ATOM   5600 C CE  . LYS D 1 313 ? 77.563  31.802 53.520  1.00 35.45 ? 401 LYS B CE  1 
ATOM   5601 N NZ  . LYS D 1 313 ? 78.243  31.695 52.205  1.00 35.51 ? 401 LYS B NZ  1 
ATOM   5602 N N   . GLU D 1 314 ? 72.563  29.560 56.796  1.00 34.44 ? 402 GLU B N   1 
ATOM   5603 C CA  . GLU D 1 314 ? 71.372  30.269 57.220  1.00 34.38 ? 402 GLU B CA  1 
ATOM   5604 C C   . GLU D 1 314 ? 70.931  29.847 58.621  1.00 34.13 ? 402 GLU B C   1 
ATOM   5605 O O   . GLU D 1 314 ? 70.589  30.695 59.449  1.00 34.19 ? 402 GLU B O   1 
ATOM   5606 C CB  . GLU D 1 314 ? 70.260  30.015 56.207  1.00 34.90 ? 402 GLU B CB  1 
ATOM   5607 C CG  . GLU D 1 314 ? 69.762  31.270 55.546  1.00 35.94 ? 402 GLU B CG  1 
ATOM   5608 C CD  . GLU D 1 314 ? 70.872  32.059 54.892  1.00 35.87 ? 402 GLU B CD  1 
ATOM   5609 O OE1 . GLU D 1 314 ? 71.550  31.509 54.012  1.00 36.21 ? 402 GLU B OE1 1 
ATOM   5610 O OE2 . GLU D 1 314 ? 71.065  33.234 55.258  1.00 36.92 ? 402 GLU B OE2 1 
ATOM   5611 N N   . ALA D 1 315 ? 70.938  28.538 58.877  1.00 33.70 ? 403 ALA B N   1 
ATOM   5612 C CA  . ALA D 1 315 ? 70.549  27.996 60.186  1.00 32.90 ? 403 ALA B CA  1 
ATOM   5613 C C   . ALA D 1 315 ? 71.407  28.663 61.248  1.00 32.71 ? 403 ALA B C   1 
ATOM   5614 O O   . ALA D 1 315 ? 70.920  29.036 62.321  1.00 31.65 ? 403 ALA B O   1 
ATOM   5615 C CB  . ALA D 1 315 ? 70.757  26.470 60.221  1.00 32.03 ? 403 ALA B CB  1 
ATOM   5616 N N   . CYS D 1 316 ? 72.691  28.807 60.921  1.00 32.65 ? 404 CYS B N   1 
ATOM   5617 C CA  . CYS D 1 316 ? 73.654  29.433 61.805  1.00 32.54 ? 404 CYS B CA  1 
ATOM   5618 C C   . CYS D 1 316 ? 73.182  30.817 62.235  1.00 32.74 ? 404 CYS B C   1 
ATOM   5619 O O   . CYS D 1 316 ? 73.094  31.114 63.434  1.00 32.56 ? 404 CYS B O   1 
ATOM   5620 C CB  . CYS D 1 316 ? 74.989  29.561 61.105  1.00 32.59 ? 404 CYS B CB  1 
ATOM   5621 S SG  . CYS D 1 316 ? 76.224  30.309 62.142  1.00 32.92 ? 404 CYS B SG  1 
ATOM   5622 N N   . TRP D 1 317 ? 72.885  31.670 61.256  1.00 32.57 ? 405 TRP B N   1 
ATOM   5623 C CA  . TRP D 1 317 ? 72.412  33.011 61.579  1.00 32.75 ? 405 TRP B CA  1 
ATOM   5624 C C   . TRP D 1 317 ? 71.229  32.959 62.527  1.00 32.97 ? 405 TRP B C   1 
ATOM   5625 O O   . TRP D 1 317 ? 71.255  33.565 63.593  1.00 33.35 ? 405 TRP B O   1 
ATOM   5626 C CB  . TRP D 1 317 ? 71.995  33.780 60.329  1.00 32.73 ? 405 TRP B CB  1 
ATOM   5627 C CG  . TRP D 1 317 ? 73.119  34.337 59.555  1.00 32.95 ? 405 TRP B CG  1 
ATOM   5628 C CD1 . TRP D 1 317 ? 73.791  33.738 58.531  1.00 33.72 ? 405 TRP B CD1 1 
ATOM   5629 C CD2 . TRP D 1 317 ? 73.738  35.611 59.751  1.00 32.99 ? 405 TRP B CD2 1 
ATOM   5630 N NE1 . TRP D 1 317 ? 74.795  34.568 58.077  1.00 33.48 ? 405 TRP B NE1 1 
ATOM   5631 C CE2 . TRP D 1 317 ? 74.792  35.717 58.815  1.00 32.34 ? 405 TRP B CE2 1 
ATOM   5632 C CE3 . TRP D 1 317 ? 73.519  36.673 60.646  1.00 33.16 ? 405 TRP B CE3 1 
ATOM   5633 C CZ2 . TRP D 1 317 ? 75.601  36.845 58.726  1.00 31.95 ? 405 TRP B CZ2 1 
ATOM   5634 C CZ3 . TRP D 1 317 ? 74.333  37.800 60.560  1.00 32.27 ? 405 TRP B CZ3 1 
ATOM   5635 C CH2 . TRP D 1 317 ? 75.367  37.871 59.609  1.00 31.95 ? 405 TRP B CH2 1 
ATOM   5636 N N   . ALA D 1 318 ? 70.188  32.241 62.124  1.00 32.77 ? 406 ALA B N   1 
ATOM   5637 C CA  . ALA D 1 318 ? 68.988  32.106 62.934  1.00 32.91 ? 406 ALA B CA  1 
ATOM   5638 C C   . ALA D 1 318 ? 69.315  31.878 64.412  1.00 33.15 ? 406 ALA B C   1 
ATOM   5639 O O   . ALA D 1 318 ? 68.901  32.647 65.290  1.00 31.95 ? 406 ALA B O   1 
ATOM   5640 C CB  . ALA D 1 318 ? 68.146  30.940 62.402  1.00 33.48 ? 406 ALA B CB  1 
ATOM   5641 N N   . ILE D 1 319 ? 70.059  30.803 64.665  1.00 33.50 ? 407 ILE B N   1 
ATOM   5642 C CA  . ILE D 1 319 ? 70.452  30.414 66.007  1.00 33.94 ? 407 ILE B CA  1 
ATOM   5643 C C   . ILE D 1 319 ? 71.313  31.480 66.662  1.00 34.88 ? 407 ILE B C   1 
ATOM   5644 O O   . ILE D 1 319 ? 71.140  31.796 67.845  1.00 35.44 ? 407 ILE B O   1 
ATOM   5645 C CB  . ILE D 1 319 ? 71.205  29.070 65.971  1.00 34.06 ? 407 ILE B CB  1 
ATOM   5646 C CG1 . ILE D 1 319 ? 70.247  27.977 65.467  1.00 34.05 ? 407 ILE B CG1 1 
ATOM   5647 C CG2 . ILE D 1 319 ? 71.792  28.749 67.343  1.00 33.29 ? 407 ILE B CG2 1 
ATOM   5648 C CD1 . ILE D 1 319 ? 70.870  26.605 65.293  1.00 33.82 ? 407 ILE B CD1 1 
ATOM   5649 N N   . SER D 1 320 ? 72.231  32.047 65.887  1.00 35.23 ? 408 SER B N   1 
ATOM   5650 C CA  . SER D 1 320 ? 73.119  33.077 66.403  1.00 35.76 ? 408 SER B CA  1 
ATOM   5651 C C   . SER D 1 320 ? 72.344  34.338 66.806  1.00 36.46 ? 408 SER B C   1 
ATOM   5652 O O   . SER D 1 320 ? 72.531  34.875 67.899  1.00 36.18 ? 408 SER B O   1 
ATOM   5653 C CB  . SER D 1 320 ? 74.170  33.417 65.354  1.00 35.50 ? 408 SER B CB  1 
ATOM   5654 O OG  . SER D 1 320 ? 75.137  34.291 65.891  1.00 34.63 ? 408 SER B OG  1 
ATOM   5655 N N   . ASN D 1 321 ? 71.467  34.814 65.931  1.00 37.40 ? 409 ASN B N   1 
ATOM   5656 C CA  . ASN D 1 321 ? 70.691  36.001 66.262  1.00 38.56 ? 409 ASN B CA  1 
ATOM   5657 C C   . ASN D 1 321 ? 69.852  35.740 67.513  1.00 39.62 ? 409 ASN B C   1 
ATOM   5658 O O   . ASN D 1 321 ? 69.585  36.652 68.294  1.00 38.83 ? 409 ASN B O   1 
ATOM   5659 C CB  . ASN D 1 321 ? 69.775  36.407 65.104  1.00 38.16 ? 409 ASN B CB  1 
ATOM   5660 C CG  . ASN D 1 321 ? 70.541  36.794 63.860  1.00 38.12 ? 409 ASN B CG  1 
ATOM   5661 O OD1 . ASN D 1 321 ? 71.495  37.554 63.919  1.00 38.26 ? 409 ASN B OD1 1 
ATOM   5662 N ND2 . ASN D 1 321 ? 70.106  36.293 62.720  1.00 39.31 ? 409 ASN B ND2 1 
ATOM   5663 N N   . ALA D 1 322 ? 69.441  34.488 67.700  1.00 41.29 ? 410 ALA B N   1 
ATOM   5664 C CA  . ALA D 1 322 ? 68.635  34.122 68.860  1.00 42.72 ? 410 ALA B CA  1 
ATOM   5665 C C   . ALA D 1 322 ? 69.452  34.283 70.139  1.00 43.97 ? 410 ALA B C   1 
ATOM   5666 O O   . ALA D 1 322 ? 68.951  34.772 71.150  1.00 44.17 ? 410 ALA B O   1 
ATOM   5667 C CB  . ALA D 1 322 ? 68.152  32.692 68.723  1.00 42.21 ? 410 ALA B CB  1 
ATOM   5668 N N   . SER D 1 323 ? 70.718  33.889 70.085  1.00 45.09 ? 411 SER B N   1 
ATOM   5669 C CA  . SER D 1 323 ? 71.573  33.990 71.250  1.00 46.76 ? 411 SER B CA  1 
ATOM   5670 C C   . SER D 1 323 ? 71.743  35.432 71.732  1.00 47.97 ? 411 SER B C   1 
ATOM   5671 O O   . SER D 1 323 ? 72.094  35.665 72.885  1.00 48.19 ? 411 SER B O   1 
ATOM   5672 C CB  . SER D 1 323 ? 72.937  33.346 70.965  1.00 46.73 ? 411 SER B CB  1 
ATOM   5673 O OG  . SER D 1 323 ? 73.587  33.944 69.864  1.00 46.87 ? 411 SER B OG  1 
ATOM   5674 N N   . SER D 1 324 ? 71.494  36.399 70.859  1.00 49.58 ? 412 SER B N   1 
ATOM   5675 C CA  . SER D 1 324 ? 71.615  37.803 71.254  1.00 51.38 ? 412 SER B CA  1 
ATOM   5676 C C   . SER D 1 324 ? 70.642  38.104 72.372  1.00 52.46 ? 412 SER B C   1 
ATOM   5677 O O   . SER D 1 324 ? 71.015  38.666 73.397  1.00 52.48 ? 412 SER B O   1 
ATOM   5678 C CB  . SER D 1 324 ? 71.299  38.735 70.089  1.00 51.59 ? 412 SER B CB  1 
ATOM   5679 O OG  . SER D 1 324 ? 72.254  38.594 69.056  1.00 53.06 ? 412 SER B OG  1 
ATOM   5680 N N   . GLY D 1 325 ? 69.386  37.732 72.151  1.00 54.10 ? 413 GLY B N   1 
ATOM   5681 C CA  . GLY D 1 325 ? 68.346  37.962 73.135  1.00 55.69 ? 413 GLY B CA  1 
ATOM   5682 C C   . GLY D 1 325 ? 68.629  37.215 74.420  1.00 56.73 ? 413 GLY B C   1 
ATOM   5683 O O   . GLY D 1 325 ? 67.742  37.038 75.253  1.00 57.16 ? 413 GLY B O   1 
ATOM   5684 N N   . GLY D 1 326 ? 69.873  36.770 74.569  1.00 57.35 ? 414 GLY B N   1 
ATOM   5685 C CA  . GLY D 1 326 ? 70.280  36.056 75.763  1.00 57.90 ? 414 GLY B CA  1 
ATOM   5686 C C   . GLY D 1 326 ? 70.630  37.023 76.878  1.00 58.38 ? 414 GLY B C   1 
ATOM   5687 O O   . GLY D 1 326 ? 70.506  36.691 78.058  1.00 58.65 ? 414 GLY B O   1 
ATOM   5688 N N   . LEU D 1 327 ? 71.081  38.219 76.509  1.00 58.56 ? 415 LEU B N   1 
ATOM   5689 C CA  . LEU D 1 327 ? 71.423  39.227 77.498  1.00 58.60 ? 415 LEU B CA  1 
ATOM   5690 C C   . LEU D 1 327 ? 70.167  39.512 78.326  1.00 59.14 ? 415 LEU B C   1 
ATOM   5691 O O   . LEU D 1 327 ? 70.212  39.503 79.562  1.00 59.51 ? 415 LEU B O   1 
ATOM   5692 C CB  . LEU D 1 327 ? 71.903  40.505 76.810  1.00 58.40 ? 415 LEU B CB  1 
ATOM   5693 N N   . GLN D 1 328 ? 69.045  39.739 77.639  1.00 58.89 ? 416 GLN B N   1 
ATOM   5694 C CA  . GLN D 1 328 ? 67.768  40.023 78.297  1.00 58.51 ? 416 GLN B CA  1 
ATOM   5695 C C   . GLN D 1 328 ? 67.157  38.792 78.994  1.00 58.33 ? 416 GLN B C   1 
ATOM   5696 O O   . GLN D 1 328 ? 66.855  38.851 80.187  1.00 58.55 ? 416 GLN B O   1 
ATOM   5697 C CB  . GLN D 1 328 ? 66.779  40.610 77.284  1.00 58.55 ? 416 GLN B CB  1 
ATOM   5698 N N   . ARG D 1 329 ? 66.965  37.691 78.266  1.00 57.81 ? 417 ARG B N   1 
ATOM   5699 C CA  . ARG D 1 329 ? 66.419  36.471 78.868  1.00 57.15 ? 417 ARG B CA  1 
ATOM   5700 C C   . ARG D 1 329 ? 67.445  35.356 78.889  1.00 56.83 ? 417 ARG B C   1 
ATOM   5701 O O   . ARG D 1 329 ? 67.589  34.614 77.925  1.00 56.72 ? 417 ARG B O   1 
ATOM   5702 C CB  . ARG D 1 329 ? 65.188  35.969 78.122  1.00 56.90 ? 417 ARG B CB  1 
ATOM   5703 C CG  . ARG D 1 329 ? 63.986  36.857 78.228  1.00 56.88 ? 417 ARG B CG  1 
ATOM   5704 C CD  . ARG D 1 329 ? 62.803  36.201 77.560  1.00 56.38 ? 417 ARG B CD  1 
ATOM   5705 N NE  . ARG D 1 329 ? 61.644  37.079 77.566  1.00 56.22 ? 417 ARG B NE  1 
ATOM   5706 C CZ  . ARG D 1 329 ? 60.472  36.765 77.033  1.00 56.28 ? 417 ARG B CZ  1 
ATOM   5707 N NH1 . ARG D 1 329 ? 60.301  35.584 76.450  1.00 56.23 ? 417 ARG B NH1 1 
ATOM   5708 N NH2 . ARG D 1 329 ? 59.472  37.632 77.084  1.00 56.57 ? 417 ARG B NH2 1 
ATOM   5709 N N   . PRO D 1 330 ? 68.153  35.204 80.009  1.00 56.71 ? 418 PRO B N   1 
ATOM   5710 C CA  . PRO D 1 330 ? 69.171  34.164 80.150  1.00 56.58 ? 418 PRO B CA  1 
ATOM   5711 C C   . PRO D 1 330 ? 68.656  32.766 79.818  1.00 56.42 ? 418 PRO B C   1 
ATOM   5712 O O   . PRO D 1 330 ? 69.432  31.890 79.435  1.00 56.35 ? 418 PRO B O   1 
ATOM   5713 C CB  . PRO D 1 330 ? 69.598  34.313 81.613  1.00 56.71 ? 418 PRO B CB  1 
ATOM   5714 C CG  . PRO D 1 330 ? 68.344  34.887 82.269  1.00 57.24 ? 418 PRO B CG  1 
ATOM   5715 C CD  . PRO D 1 330 ? 68.044  35.966 81.261  1.00 56.95 ? 418 PRO B CD  1 
ATOM   5716 N N   . ASP D 1 331 ? 67.350  32.555 79.946  1.00 56.21 ? 419 ASP B N   1 
ATOM   5717 C CA  . ASP D 1 331 ? 66.797  31.240 79.653  1.00 56.34 ? 419 ASP B CA  1 
ATOM   5718 C C   . ASP D 1 331 ? 66.845  30.867 78.182  1.00 55.66 ? 419 ASP B C   1 
ATOM   5719 O O   . ASP D 1 331 ? 66.950  29.691 77.851  1.00 55.40 ? 419 ASP B O   1 
ATOM   5720 C CB  . ASP D 1 331 ? 65.369  31.127 80.170  1.00 57.75 ? 419 ASP B CB  1 
ATOM   5721 C CG  . ASP D 1 331 ? 65.304  31.112 81.682  1.00 59.10 ? 419 ASP B CG  1 
ATOM   5722 O OD1 . ASP D 1 331 ? 65.683  32.134 82.302  1.00 60.12 ? 419 ASP B OD1 1 
ATOM   5723 O OD2 . ASP D 1 331 ? 64.882  30.074 82.244  1.00 59.08 ? 419 ASP B OD2 1 
ATOM   5724 N N   . ILE D 1 332 ? 66.758  31.857 77.302  1.00 55.19 ? 420 ILE B N   1 
ATOM   5725 C CA  . ILE D 1 332 ? 66.828  31.581 75.869  1.00 54.85 ? 420 ILE B CA  1 
ATOM   5726 C C   . ILE D 1 332 ? 68.102  30.784 75.615  1.00 54.54 ? 420 ILE B C   1 
ATOM   5727 O O   . ILE D 1 332 ? 68.072  29.751 74.949  1.00 54.56 ? 420 ILE B O   1 
ATOM   5728 C CB  . ILE D 1 332 ? 66.871  32.885 75.024  1.00 54.91 ? 420 ILE B CB  1 
ATOM   5729 C CG1 . ILE D 1 332 ? 65.532  33.618 75.140  1.00 54.89 ? 420 ILE B CG1 1 
ATOM   5730 C CG2 . ILE D 1 332 ? 67.185  32.565 73.562  1.00 54.22 ? 420 ILE B CG2 1 
ATOM   5731 C CD1 . ILE D 1 332 ? 65.448  34.884 74.314  1.00 54.81 ? 420 ILE B CD1 1 
ATOM   5732 N N   . ILE D 1 333 ? 69.213  31.273 76.162  1.00 54.13 ? 421 ILE B N   1 
ATOM   5733 C CA  . ILE D 1 333 ? 70.509  30.616 76.024  1.00 53.60 ? 421 ILE B CA  1 
ATOM   5734 C C   . ILE D 1 333 ? 70.428  29.203 76.632  1.00 53.78 ? 421 ILE B C   1 
ATOM   5735 O O   . ILE D 1 333 ? 70.901  28.230 76.029  1.00 53.47 ? 421 ILE B O   1 
ATOM   5736 C CB  . ILE D 1 333 ? 71.625  31.445 76.736  1.00 53.22 ? 421 ILE B CB  1 
ATOM   5737 C CG1 . ILE D 1 333 ? 71.748  32.828 76.084  1.00 52.90 ? 421 ILE B CG1 1 
ATOM   5738 C CG2 . ILE D 1 333 ? 72.959  30.707 76.683  1.00 52.33 ? 421 ILE B CG2 1 
ATOM   5739 C CD1 . ILE D 1 333 ? 72.186  32.807 74.629  1.00 52.56 ? 421 ILE B CD1 1 
ATOM   5740 N N   . ARG D 1 334 ? 69.824  29.085 77.818  1.00 53.69 ? 422 ARG B N   1 
ATOM   5741 C CA  . ARG D 1 334 ? 69.691  27.775 78.459  1.00 53.54 ? 422 ARG B CA  1 
ATOM   5742 C C   . ARG D 1 334 ? 68.930  26.806 77.576  1.00 52.35 ? 422 ARG B C   1 
ATOM   5743 O O   . ARG D 1 334 ? 69.334  25.653 77.427  1.00 51.94 ? 422 ARG B O   1 
ATOM   5744 C CB  . ARG D 1 334 ? 69.007  27.882 79.830  1.00 54.60 ? 422 ARG B CB  1 
ATOM   5745 C CG  . ARG D 1 334 ? 69.974  28.259 80.955  1.00 56.85 ? 422 ARG B CG  1 
ATOM   5746 C CD  . ARG D 1 334 ? 69.344  28.163 82.346  1.00 58.02 ? 422 ARG B CD  1 
ATOM   5747 N NE  . ARG D 1 334 ? 68.493  29.302 82.700  1.00 59.44 ? 422 ARG B NE  1 
ATOM   5748 C CZ  . ARG D 1 334 ? 68.940  30.542 82.893  1.00 60.12 ? 422 ARG B CZ  1 
ATOM   5749 N NH1 . ARG D 1 334 ? 70.235  30.817 82.766  1.00 61.09 ? 422 ARG B NH1 1 
ATOM   5750 N NH2 . ARG D 1 334 ? 68.098  31.509 83.232  1.00 60.36 ? 422 ARG B NH2 1 
ATOM   5751 N N   . TYR D 1 335 ? 67.835  27.285 76.990  1.00 51.19 ? 423 TYR B N   1 
ATOM   5752 C CA  . TYR D 1 335 ? 67.025  26.475 76.099  1.00 50.21 ? 423 TYR B CA  1 
ATOM   5753 C C   . TYR D 1 335 ? 67.893  26.030 74.929  1.00 49.57 ? 423 TYR B C   1 
ATOM   5754 O O   . TYR D 1 335 ? 68.080  24.835 74.711  1.00 49.60 ? 423 TYR B O   1 
ATOM   5755 C CB  . TYR D 1 335 ? 65.825  27.270 75.582  1.00 51.02 ? 423 TYR B CB  1 
ATOM   5756 C CG  . TYR D 1 335 ? 64.984  26.476 74.611  1.00 51.75 ? 423 TYR B CG  1 
ATOM   5757 C CD1 . TYR D 1 335 ? 64.455  25.234 74.979  1.00 51.77 ? 423 TYR B CD1 1 
ATOM   5758 C CD2 . TYR D 1 335 ? 64.767  26.927 73.304  1.00 51.53 ? 423 TYR B CD2 1 
ATOM   5759 C CE1 . TYR D 1 335 ? 63.738  24.456 74.072  1.00 51.77 ? 423 TYR B CE1 1 
ATOM   5760 C CE2 . TYR D 1 335 ? 64.048  26.155 72.387  1.00 51.47 ? 423 TYR B CE2 1 
ATOM   5761 C CZ  . TYR D 1 335 ? 63.542  24.917 72.780  1.00 51.95 ? 423 TYR B CZ  1 
ATOM   5762 O OH  . TYR D 1 335 ? 62.872  24.121 71.878  1.00 52.12 ? 423 TYR B OH  1 
ATOM   5763 N N   . LEU D 1 336 ? 68.416  26.993 74.174  1.00 48.45 ? 424 LEU B N   1 
ATOM   5764 C CA  . LEU D 1 336 ? 69.297  26.693 73.048  1.00 47.58 ? 424 LEU B CA  1 
ATOM   5765 C C   . LEU D 1 336 ? 70.379  25.657 73.402  1.00 47.66 ? 424 LEU B C   1 
ATOM   5766 O O   . LEU D 1 336 ? 70.622  24.719 72.635  1.00 47.26 ? 424 LEU B O   1 
ATOM   5767 C CB  . LEU D 1 336 ? 69.958  27.979 72.552  1.00 46.62 ? 424 LEU B CB  1 
ATOM   5768 C CG  . LEU D 1 336 ? 69.244  28.846 71.509  1.00 45.78 ? 424 LEU B CG  1 
ATOM   5769 C CD1 . LEU D 1 336 ? 67.787  28.967 71.817  1.00 45.25 ? 424 LEU B CD1 1 
ATOM   5770 C CD2 . LEU D 1 336 ? 69.912  30.212 71.449  1.00 45.41 ? 424 LEU B CD2 1 
ATOM   5771 N N   . VAL D 1 337 ? 71.031  25.821 74.553  1.00 47.39 ? 425 VAL B N   1 
ATOM   5772 C CA  . VAL D 1 337 ? 72.067  24.874 74.953  1.00 47.59 ? 425 VAL B CA  1 
ATOM   5773 C C   . VAL D 1 337 ? 71.484  23.499 75.253  1.00 47.16 ? 425 VAL B C   1 
ATOM   5774 O O   . VAL D 1 337 ? 72.080  22.485 74.903  1.00 46.72 ? 425 VAL B O   1 
ATOM   5775 C CB  . VAL D 1 337 ? 72.871  25.369 76.191  1.00 48.07 ? 425 VAL B CB  1 
ATOM   5776 C CG1 . VAL D 1 337 ? 73.748  24.242 76.727  1.00 48.05 ? 425 VAL B CG1 1 
ATOM   5777 C CG2 . VAL D 1 337 ? 73.770  26.543 75.799  1.00 47.60 ? 425 VAL B CG2 1 
ATOM   5778 N N   . SER D 1 338 ? 70.315  23.472 75.888  1.00 47.28 ? 426 SER B N   1 
ATOM   5779 C CA  . SER D 1 338 ? 69.645  22.211 76.232  1.00 47.08 ? 426 SER B CA  1 
ATOM   5780 C C   . SER D 1 338 ? 69.225  21.439 74.978  1.00 47.09 ? 426 SER B C   1 
ATOM   5781 O O   . SER D 1 338 ? 69.021  20.227 75.033  1.00 47.51 ? 426 SER B O   1 
ATOM   5782 C CB  . SER D 1 338 ? 68.396  22.463 77.094  1.00 46.42 ? 426 SER B CB  1 
ATOM   5783 O OG  . SER D 1 338 ? 67.329  22.993 76.325  1.00 45.76 ? 426 SER B OG  1 
ATOM   5784 N N   . GLN D 1 339 ? 69.077  22.145 73.856  1.00 46.58 ? 427 GLN B N   1 
ATOM   5785 C CA  . GLN D 1 339 ? 68.700  21.508 72.598  1.00 45.79 ? 427 GLN B CA  1 
ATOM   5786 C C   . GLN D 1 339 ? 69.911  21.025 71.800  1.00 45.60 ? 427 GLN B C   1 
ATOM   5787 O O   . GLN D 1 339 ? 69.752  20.464 70.715  1.00 45.76 ? 427 GLN B O   1 
ATOM   5788 C CB  . GLN D 1 339 ? 67.872  22.457 71.733  1.00 45.88 ? 427 GLN B CB  1 
ATOM   5789 C CG  . GLN D 1 339 ? 66.539  22.815 72.342  1.00 47.12 ? 427 GLN B CG  1 
ATOM   5790 C CD  . GLN D 1 339 ? 65.749  21.583 72.732  1.00 47.73 ? 427 GLN B CD  1 
ATOM   5791 O OE1 . GLN D 1 339 ? 65.494  20.703 71.903  1.00 47.54 ? 427 GLN B OE1 1 
ATOM   5792 N NE2 . GLN D 1 339 ? 65.358  21.512 74.000  1.00 47.75 ? 427 GLN B NE2 1 
ATOM   5793 N N   . GLY D 1 340 ? 71.114  21.263 72.325  1.00 45.14 ? 428 GLY B N   1 
ATOM   5794 C CA  . GLY D 1 340 ? 72.333  20.811 71.666  1.00 44.35 ? 428 GLY B CA  1 
ATOM   5795 C C   . GLY D 1 340 ? 72.837  21.545 70.434  1.00 43.97 ? 428 GLY B C   1 
ATOM   5796 O O   . GLY D 1 340 ? 73.155  20.916 69.421  1.00 44.13 ? 428 GLY B O   1 
ATOM   5797 N N   . CYS D 1 341 ? 72.933  22.868 70.510  1.00 43.24 ? 429 CYS B N   1 
ATOM   5798 C CA  . CYS D 1 341 ? 73.417  23.647 69.379  1.00 42.42 ? 429 CYS B CA  1 
ATOM   5799 C C   . CYS D 1 341 ? 74.933  23.829 69.461  1.00 41.72 ? 429 CYS B C   1 
ATOM   5800 O O   . CYS D 1 341 ? 75.588  24.112 68.452  1.00 41.72 ? 429 CYS B O   1 
ATOM   5801 C CB  . CYS D 1 341 ? 72.752  25.020 69.358  1.00 42.85 ? 429 CYS B CB  1 
ATOM   5802 S SG  . CYS D 1 341 ? 73.242  26.091 70.736  1.00 44.14 ? 429 CYS B SG  1 
ATOM   5803 N N   . ILE D 1 342 ? 75.478  23.663 70.665  1.00 40.33 ? 430 ILE B N   1 
ATOM   5804 C CA  . ILE D 1 342 ? 76.911  23.818 70.899  1.00 38.66 ? 430 ILE B CA  1 
ATOM   5805 C C   . ILE D 1 342 ? 77.795  22.956 69.991  1.00 38.50 ? 430 ILE B C   1 
ATOM   5806 O O   . ILE D 1 342 ? 78.645  23.480 69.266  1.00 38.85 ? 430 ILE B O   1 
ATOM   5807 C CB  . ILE D 1 342 ? 77.261  23.519 72.382  1.00 37.67 ? 430 ILE B CB  1 
ATOM   5808 C CG1 . ILE D 1 342 ? 76.596  24.558 73.285  1.00 36.55 ? 430 ILE B CG1 1 
ATOM   5809 C CG2 . ILE D 1 342 ? 78.770  23.520 72.584  1.00 37.37 ? 430 ILE B CG2 1 
ATOM   5810 C CD1 . ILE D 1 342 ? 76.927  24.422 74.752  1.00 35.21 ? 430 ILE B CD1 1 
ATOM   5811 N N   . LYS D 1 343 ? 77.592  21.643 70.024  1.00 37.33 ? 431 LYS B N   1 
ATOM   5812 C CA  . LYS D 1 343 ? 78.398  20.725 69.226  1.00 36.69 ? 431 LYS B CA  1 
ATOM   5813 C C   . LYS D 1 343 ? 78.388  21.041 67.729  1.00 35.99 ? 431 LYS B C   1 
ATOM   5814 O O   . LYS D 1 343 ? 79.445  21.133 67.099  1.00 35.07 ? 431 LYS B O   1 
ATOM   5815 C CB  . LYS D 1 343 ? 77.918  19.286 69.478  1.00 37.69 ? 431 LYS B CB  1 
ATOM   5816 C CG  . LYS D 1 343 ? 78.610  18.193 68.670  1.00 38.11 ? 431 LYS B CG  1 
ATOM   5817 C CD  . LYS D 1 343 ? 80.074  18.033 69.013  1.00 38.76 ? 431 LYS B CD  1 
ATOM   5818 C CE  . LYS D 1 343 ? 80.714  16.965 68.137  1.00 39.58 ? 431 LYS B CE  1 
ATOM   5819 N NZ  . LYS D 1 343 ? 82.158  16.785 68.439  1.00 40.12 ? 431 LYS B NZ  1 
ATOM   5820 N N   . PRO D 1 344 ? 77.194  21.223 67.142  1.00 35.73 ? 432 PRO B N   1 
ATOM   5821 C CA  . PRO D 1 344 ? 77.053  21.527 65.713  1.00 35.51 ? 432 PRO B CA  1 
ATOM   5822 C C   . PRO D 1 344 ? 77.620  22.904 65.374  1.00 35.71 ? 432 PRO B C   1 
ATOM   5823 O O   . PRO D 1 344 ? 78.027  23.164 64.241  1.00 35.48 ? 432 PRO B O   1 
ATOM   5824 C CB  . PRO D 1 344 ? 75.543  21.463 65.504  1.00 35.15 ? 432 PRO B CB  1 
ATOM   5825 C CG  . PRO D 1 344 ? 75.075  20.564 66.645  1.00 36.04 ? 432 PRO B CG  1 
ATOM   5826 C CD  . PRO D 1 344 ? 75.863  21.163 67.764  1.00 35.74 ? 432 PRO B CD  1 
ATOM   5827 N N   . LEU D 1 345 ? 77.628  23.785 66.369  1.00 35.84 ? 433 LEU B N   1 
ATOM   5828 C CA  . LEU D 1 345 ? 78.149  25.132 66.204  1.00 36.16 ? 433 LEU B CA  1 
ATOM   5829 C C   . LEU D 1 345 ? 79.673  25.052 66.109  1.00 37.37 ? 433 LEU B C   1 
ATOM   5830 O O   . LEU D 1 345 ? 80.275  25.581 65.172  1.00 38.49 ? 433 LEU B O   1 
ATOM   5831 C CB  . LEU D 1 345 ? 77.720  25.993 67.397  1.00 35.20 ? 433 LEU B CB  1 
ATOM   5832 C CG  . LEU D 1 345 ? 76.952  27.305 67.171  1.00 34.26 ? 433 LEU B CG  1 
ATOM   5833 C CD1 . LEU D 1 345 ? 75.984  27.187 65.994  1.00 33.32 ? 433 LEU B CD1 1 
ATOM   5834 C CD2 . LEU D 1 345 ? 76.207  27.663 68.455  1.00 33.03 ? 433 LEU B CD2 1 
ATOM   5835 N N   . CYS D 1 346 ? 80.298  24.366 67.062  1.00 37.62 ? 434 CYS B N   1 
ATOM   5836 C CA  . CYS D 1 346 ? 81.749  24.233 67.070  1.00 37.70 ? 434 CYS B CA  1 
ATOM   5837 C C   . CYS D 1 346 ? 82.288  23.576 65.807  1.00 37.62 ? 434 CYS B C   1 
ATOM   5838 O O   . CYS D 1 346 ? 83.309  23.997 65.260  1.00 37.97 ? 434 CYS B O   1 
ATOM   5839 C CB  . CYS D 1 346 ? 82.208  23.435 68.300  1.00 38.13 ? 434 CYS B CB  1 
ATOM   5840 S SG  . CYS D 1 346 ? 81.972  24.284 69.891  1.00 39.56 ? 434 CYS B SG  1 
ATOM   5841 N N   . ASP D 1 347 ? 81.606  22.541 65.344  1.00 37.46 ? 435 ASP B N   1 
ATOM   5842 C CA  . ASP D 1 347 ? 82.047  21.828 64.161  1.00 36.96 ? 435 ASP B CA  1 
ATOM   5843 C C   . ASP D 1 347 ? 81.973  22.688 62.902  1.00 36.06 ? 435 ASP B C   1 
ATOM   5844 O O   . ASP D 1 347 ? 82.690  22.444 61.929  1.00 35.54 ? 435 ASP B O   1 
ATOM   5845 C CB  . ASP D 1 347 ? 81.212  20.559 64.007  1.00 38.03 ? 435 ASP B CB  1 
ATOM   5846 C CG  . ASP D 1 347 ? 81.400  19.609 65.174  1.00 39.92 ? 435 ASP B CG  1 
ATOM   5847 O OD1 . ASP D 1 347 ? 82.268  19.902 66.032  1.00 40.74 ? 435 ASP B OD1 1 
ATOM   5848 O OD2 . ASP D 1 347 ? 80.696  18.573 65.233  1.00 40.79 ? 435 ASP B OD2 1 
ATOM   5849 N N   . LEU D 1 348 ? 81.118  23.705 62.927  1.00 35.13 ? 436 LEU B N   1 
ATOM   5850 C CA  . LEU D 1 348 ? 80.963  24.578 61.766  1.00 34.46 ? 436 LEU B CA  1 
ATOM   5851 C C   . LEU D 1 348 ? 82.204  25.439 61.524  1.00 34.09 ? 436 LEU B C   1 
ATOM   5852 O O   . LEU D 1 348 ? 82.496  25.812 60.392  1.00 34.20 ? 436 LEU B O   1 
ATOM   5853 C CB  . LEU D 1 348 ? 79.721  25.470 61.927  1.00 33.58 ? 436 LEU B CB  1 
ATOM   5854 C CG  . LEU D 1 348 ? 79.324  26.337 60.721  1.00 32.78 ? 436 LEU B CG  1 
ATOM   5855 C CD1 . LEU D 1 348 ? 79.118  25.468 59.496  1.00 32.35 ? 436 LEU B CD1 1 
ATOM   5856 C CD2 . LEU D 1 348 ? 78.061  27.108 61.038  1.00 31.71 ? 436 LEU B CD2 1 
ATOM   5857 N N   . LEU D 1 349 ? 82.938  25.753 62.583  1.00 33.81 ? 437 LEU B N   1 
ATOM   5858 C CA  . LEU D 1 349 ? 84.137  26.561 62.437  1.00 34.58 ? 437 LEU B CA  1 
ATOM   5859 C C   . LEU D 1 349 ? 85.146  25.892 61.499  1.00 35.23 ? 437 LEU B C   1 
ATOM   5860 O O   . LEU D 1 349 ? 85.918  26.558 60.803  1.00 35.71 ? 437 LEU B O   1 
ATOM   5861 C CB  . LEU D 1 349 ? 84.787  26.789 63.809  1.00 33.65 ? 437 LEU B CB  1 
ATOM   5862 C CG  . LEU D 1 349 ? 84.013  27.618 64.842  1.00 33.48 ? 437 LEU B CG  1 
ATOM   5863 C CD1 . LEU D 1 349 ? 84.713  27.573 66.198  1.00 31.93 ? 437 LEU B CD1 1 
ATOM   5864 C CD2 . LEU D 1 349 ? 83.888  29.057 64.340  1.00 33.01 ? 437 LEU B CD2 1 
ATOM   5865 N N   . GLU D 1 350 ? 85.110  24.571 61.459  1.00 35.94 ? 438 GLU B N   1 
ATOM   5866 C CA  . GLU D 1 350 ? 86.052  23.808 60.666  1.00 36.84 ? 438 GLU B CA  1 
ATOM   5867 C C   . GLU D 1 350 ? 85.875  23.896 59.155  1.00 36.30 ? 438 GLU B C   1 
ATOM   5868 O O   . GLU D 1 350 ? 86.826  23.668 58.403  1.00 36.14 ? 438 GLU B O   1 
ATOM   5869 C CB  . GLU D 1 350 ? 85.995  22.346 61.119  1.00 39.76 ? 438 GLU B CB  1 
ATOM   5870 C CG  . GLU D 1 350 ? 87.144  21.471 60.632  1.00 43.55 ? 438 GLU B CG  1 
ATOM   5871 C CD  . GLU D 1 350 ? 88.479  21.950 61.162  1.00 45.75 ? 438 GLU B CD  1 
ATOM   5872 O OE1 . GLU D 1 350 ? 88.569  22.148 62.393  1.00 47.49 ? 438 GLU B OE1 1 
ATOM   5873 O OE2 . GLU D 1 350 ? 89.430  22.121 60.361  1.00 46.88 ? 438 GLU B OE2 1 
ATOM   5874 N N   . ILE D 1 351 ? 84.676  24.232 58.697  1.00 35.27 ? 439 ILE B N   1 
ATOM   5875 C CA  . ILE D 1 351 ? 84.441  24.292 57.261  1.00 34.68 ? 439 ILE B CA  1 
ATOM   5876 C C   . ILE D 1 351 ? 83.870  25.615 56.785  1.00 34.84 ? 439 ILE B C   1 
ATOM   5877 O O   . ILE D 1 351 ? 83.772  25.850 55.581  1.00 34.75 ? 439 ILE B O   1 
ATOM   5878 C CB  . ILE D 1 351 ? 83.465  23.186 56.814  1.00 34.55 ? 439 ILE B CB  1 
ATOM   5879 C CG1 . ILE D 1 351 ? 82.080  23.439 57.422  1.00 33.88 ? 439 ILE B CG1 1 
ATOM   5880 C CG2 . ILE D 1 351 ? 83.983  21.832 57.261  1.00 33.94 ? 439 ILE B CG2 1 
ATOM   5881 C CD1 . ILE D 1 351 ? 81.009  22.541 56.891  1.00 33.23 ? 439 ILE B CD1 1 
ATOM   5882 N N   . ALA D 1 352 ? 83.491  26.470 57.725  1.00 34.72 ? 440 ALA B N   1 
ATOM   5883 C CA  . ALA D 1 352 ? 82.905  27.763 57.395  1.00 35.43 ? 440 ALA B CA  1 
ATOM   5884 C C   . ALA D 1 352 ? 83.860  28.763 56.754  1.00 36.23 ? 440 ALA B C   1 
ATOM   5885 O O   . ALA D 1 352 ? 85.082  28.590 56.779  1.00 36.89 ? 440 ALA B O   1 
ATOM   5886 C CB  . ALA D 1 352 ? 82.309  28.376 58.640  1.00 34.69 ? 440 ALA B CB  1 
ATOM   5887 N N   . ASP D 1 353 ? 83.284  29.813 56.173  1.00 37.12 ? 441 ASP B N   1 
ATOM   5888 C CA  . ASP D 1 353 ? 84.058  30.895 55.559  1.00 37.38 ? 441 ASP B CA  1 
ATOM   5889 C C   . ASP D 1 353 ? 84.115  32.018 56.597  1.00 37.06 ? 441 ASP B C   1 
ATOM   5890 O O   . ASP D 1 353 ? 83.320  32.043 57.533  1.00 37.22 ? 441 ASP B O   1 
ATOM   5891 C CB  . ASP D 1 353 ? 83.387  31.383 54.273  1.00 38.09 ? 441 ASP B CB  1 
ATOM   5892 C CG  . ASP D 1 353 ? 81.959  31.810 54.492  1.00 39.15 ? 441 ASP B CG  1 
ATOM   5893 O OD1 . ASP D 1 353 ? 81.734  32.732 55.303  1.00 39.86 ? 441 ASP B OD1 1 
ATOM   5894 O OD2 . ASP D 1 353 ? 81.061  31.217 53.856  1.00 40.37 ? 441 ASP B OD2 1 
ATOM   5895 N N   . ASN D 1 354 ? 85.048  32.944 56.433  1.00 36.57 ? 442 ASN B N   1 
ATOM   5896 C CA  . ASN D 1 354 ? 85.232  34.029 57.392  1.00 35.88 ? 442 ASN B CA  1 
ATOM   5897 C C   . ASN D 1 354 ? 84.009  34.681 58.008  1.00 35.83 ? 442 ASN B C   1 
ATOM   5898 O O   . ASN D 1 354 ? 83.934  34.800 59.229  1.00 36.09 ? 442 ASN B O   1 
ATOM   5899 C CB  . ASN D 1 354 ? 86.121  35.100 56.780  1.00 35.81 ? 442 ASN B CB  1 
ATOM   5900 C CG  . ASN D 1 354 ? 87.555  34.645 56.645  1.00 35.54 ? 442 ASN B CG  1 
ATOM   5901 O OD1 . ASN D 1 354 ? 87.834  33.449 56.553  1.00 34.85 ? 442 ASN B OD1 1 
ATOM   5902 N ND2 . ASN D 1 354 ? 88.474  35.599 56.609  1.00 35.16 ? 442 ASN B ND2 1 
ATOM   5903 N N   . ARG D 1 355 ? 83.048  35.098 57.193  1.00 35.69 ? 443 ARG B N   1 
ATOM   5904 C CA  . ARG D 1 355 ? 81.872  35.762 57.742  1.00 35.39 ? 443 ARG B CA  1 
ATOM   5905 C C   . ARG D 1 355 ? 81.104  34.853 58.707  1.00 35.07 ? 443 ARG B C   1 
ATOM   5906 O O   . ARG D 1 355 ? 80.695  35.298 59.784  1.00 34.97 ? 443 ARG B O   1 
ATOM   5907 C CB  . ARG D 1 355 ? 80.955  36.251 56.611  1.00 35.55 ? 443 ARG B CB  1 
ATOM   5908 C CG  . ARG D 1 355 ? 80.032  37.402 57.012  1.00 35.64 ? 443 ARG B CG  1 
ATOM   5909 C CD  . ARG D 1 355 ? 80.829  38.633 57.413  0.00 35.77 ? 443 ARG B CD  1 
ATOM   5910 N NE  . ARG D 1 355 ? 79.968  39.749 57.798  0.00 35.94 ? 443 ARG B NE  1 
ATOM   5911 C CZ  . ARG D 1 355 ? 79.112  39.720 58.814  0.00 36.03 ? 443 ARG B CZ  1 
ATOM   5912 N NH1 . ARG D 1 355 ? 78.994  38.628 59.557  0.00 36.11 ? 443 ARG B NH1 1 
ATOM   5913 N NH2 . ARG D 1 355 ? 78.372  40.786 59.089  0.00 36.11 ? 443 ARG B NH2 1 
ATOM   5914 N N   . ILE D 1 356 ? 80.922  33.585 58.334  1.00 34.71 ? 444 ILE B N   1 
ATOM   5915 C CA  . ILE D 1 356 ? 80.196  32.634 59.187  1.00 34.42 ? 444 ILE B CA  1 
ATOM   5916 C C   . ILE D 1 356 ? 80.971  32.261 60.458  1.00 34.06 ? 444 ILE B C   1 
ATOM   5917 O O   . ILE D 1 356 ? 80.380  31.807 61.440  1.00 34.70 ? 444 ILE B O   1 
ATOM   5918 C CB  . ILE D 1 356 ? 79.814  31.341 58.399  1.00 34.26 ? 444 ILE B CB  1 
ATOM   5919 C CG1 . ILE D 1 356 ? 78.805  31.685 57.290  1.00 33.99 ? 444 ILE B CG1 1 
ATOM   5920 C CG2 . ILE D 1 356 ? 79.248  30.280 59.341  1.00 34.31 ? 444 ILE B CG2 1 
ATOM   5921 C CD1 . ILE D 1 356 ? 77.499  32.288 57.778  1.00 32.86 ? 444 ILE B CD1 1 
ATOM   5922 N N   . ILE D 1 357 ? 82.286  32.462 60.442  1.00 33.06 ? 445 ILE B N   1 
ATOM   5923 C CA  . ILE D 1 357 ? 83.102  32.171 61.606  1.00 32.36 ? 445 ILE B CA  1 
ATOM   5924 C C   . ILE D 1 357 ? 82.821  33.248 62.641  1.00 32.66 ? 445 ILE B C   1 
ATOM   5925 O O   . ILE D 1 357 ? 82.828  32.992 63.845  1.00 32.16 ? 445 ILE B O   1 
ATOM   5926 C CB  . ILE D 1 357 ? 84.600  32.151 61.242  1.00 32.63 ? 445 ILE B CB  1 
ATOM   5927 C CG1 . ILE D 1 357 ? 84.872  30.982 60.284  1.00 32.99 ? 445 ILE B CG1 1 
ATOM   5928 C CG2 . ILE D 1 357 ? 85.451  32.031 62.503  1.00 31.52 ? 445 ILE B CG2 1 
ATOM   5929 C CD1 . ILE D 1 357 ? 86.317  30.806 59.902  1.00 33.30 ? 445 ILE B CD1 1 
ATOM   5930 N N   . GLU D 1 358 ? 82.560  34.460 62.167  1.00 32.91 ? 446 GLU B N   1 
ATOM   5931 C CA  . GLU D 1 358 ? 82.249  35.556 63.067  1.00 33.30 ? 446 GLU B CA  1 
ATOM   5932 C C   . GLU D 1 358 ? 80.910  35.341 63.732  1.00 33.31 ? 446 GLU B C   1 
ATOM   5933 O O   . GLU D 1 358 ? 80.759  35.602 64.920  1.00 33.28 ? 446 GLU B O   1 
ATOM   5934 C CB  . GLU D 1 358 ? 82.188  36.886 62.325  1.00 34.57 ? 446 GLU B CB  1 
ATOM   5935 C CG  . GLU D 1 358 ? 83.530  37.462 61.952  1.00 36.56 ? 446 GLU B CG  1 
ATOM   5936 C CD  . GLU D 1 358 ? 83.395  38.778 61.221  1.00 37.47 ? 446 GLU B CD  1 
ATOM   5937 O OE1 . GLU D 1 358 ? 82.843  39.736 61.818  1.00 37.81 ? 446 GLU B OE1 1 
ATOM   5938 O OE2 . GLU D 1 358 ? 83.838  38.839 60.050  1.00 37.93 ? 446 GLU B OE2 1 
ATOM   5939 N N   . VAL D 1 359 ? 79.936  34.879 62.955  1.00 33.29 ? 447 VAL B N   1 
ATOM   5940 C CA  . VAL D 1 359 ? 78.596  34.655 63.472  1.00 33.11 ? 447 VAL B CA  1 
ATOM   5941 C C   . VAL D 1 359 ? 78.594  33.484 64.438  1.00 33.57 ? 447 VAL B C   1 
ATOM   5942 O O   . VAL D 1 359 ? 77.826  33.456 65.402  1.00 33.09 ? 447 VAL B O   1 
ATOM   5943 C CB  . VAL D 1 359 ? 77.605  34.368 62.338  1.00 33.12 ? 447 VAL B CB  1 
ATOM   5944 C CG1 . VAL D 1 359 ? 76.209  34.190 62.904  1.00 32.43 ? 447 VAL B CG1 1 
ATOM   5945 C CG2 . VAL D 1 359 ? 77.631  35.499 61.334  1.00 32.82 ? 447 VAL B CG2 1 
ATOM   5946 N N   . THR D 1 360 ? 79.450  32.510 64.175  1.00 33.02 ? 448 THR B N   1 
ATOM   5947 C CA  . THR D 1 360 ? 79.526  31.369 65.059  1.00 33.27 ? 448 THR B CA  1 
ATOM   5948 C C   . THR D 1 360 ? 80.241  31.762 66.348  1.00 33.61 ? 448 THR B C   1 
ATOM   5949 O O   . THR D 1 360 ? 79.831  31.343 67.429  1.00 34.11 ? 448 THR B O   1 
ATOM   5950 C CB  . THR D 1 360 ? 80.270  30.194 64.395  1.00 33.14 ? 448 THR B CB  1 
ATOM   5951 O OG1 . THR D 1 360 ? 79.543  29.773 63.236  1.00 32.51 ? 448 THR B OG1 1 
ATOM   5952 C CG2 . THR D 1 360 ? 80.417  29.029 65.364  1.00 32.00 ? 448 THR B CG2 1 
ATOM   5953 N N   . LEU D 1 361 ? 81.300  32.565 66.243  1.00 33.68 ? 449 LEU B N   1 
ATOM   5954 C CA  . LEU D 1 361 ? 82.032  32.969 67.436  1.00 34.05 ? 449 LEU B CA  1 
ATOM   5955 C C   . LEU D 1 361 ? 81.204  33.905 68.312  1.00 35.00 ? 449 LEU B C   1 
ATOM   5956 O O   . LEU D 1 361 ? 81.355  33.901 69.538  1.00 35.54 ? 449 LEU B O   1 
ATOM   5957 C CB  . LEU D 1 361 ? 83.382  33.605 67.076  1.00 33.16 ? 449 LEU B CB  1 
ATOM   5958 C CG  . LEU D 1 361 ? 84.462  32.691 66.472  1.00 32.43 ? 449 LEU B CG  1 
ATOM   5959 C CD1 . LEU D 1 361 ? 85.712  33.500 66.199  1.00 32.41 ? 449 LEU B CD1 1 
ATOM   5960 C CD2 . LEU D 1 361 ? 84.787  31.559 67.412  1.00 31.38 ? 449 LEU B CD2 1 
ATOM   5961 N N   . ASP D 1 362 ? 80.327  34.699 67.705  1.00 35.78 ? 450 ASP B N   1 
ATOM   5962 C CA  . ASP D 1 362 ? 79.480  35.577 68.501  1.00 36.66 ? 450 ASP B CA  1 
ATOM   5963 C C   . ASP D 1 362 ? 78.482  34.753 69.294  1.00 36.73 ? 450 ASP B C   1 
ATOM   5964 O O   . ASP D 1 362 ? 78.215  35.045 70.453  1.00 36.79 ? 450 ASP B O   1 
ATOM   5965 C CB  . ASP D 1 362 ? 78.731  36.589 67.637  1.00 37.87 ? 450 ASP B CB  1 
ATOM   5966 C CG  . ASP D 1 362 ? 79.628  37.706 67.158  1.00 40.41 ? 450 ASP B CG  1 
ATOM   5967 O OD1 . ASP D 1 362 ? 80.554  38.074 67.925  1.00 41.74 ? 450 ASP B OD1 1 
ATOM   5968 O OD2 . ASP D 1 362 ? 79.399  38.234 66.043  1.00 40.94 ? 450 ASP B OD2 1 
ATOM   5969 N N   . ALA D 1 363 ? 77.933  33.720 68.668  1.00 36.98 ? 451 ALA B N   1 
ATOM   5970 C CA  . ALA D 1 363 ? 76.975  32.848 69.335  1.00 37.79 ? 451 ALA B CA  1 
ATOM   5971 C C   . ALA D 1 363 ? 77.651  32.072 70.468  1.00 38.45 ? 451 ALA B C   1 
ATOM   5972 O O   . ALA D 1 363 ? 77.145  32.040 71.596  1.00 38.03 ? 451 ALA B O   1 
ATOM   5973 C CB  . ALA D 1 363 ? 76.367  31.874 68.335  1.00 38.20 ? 451 ALA B CB  1 
ATOM   5974 N N   . LEU D 1 364 ? 78.785  31.437 70.159  1.00 39.04 ? 452 LEU B N   1 
ATOM   5975 C CA  . LEU D 1 364 ? 79.538  30.675 71.151  1.00 39.24 ? 452 LEU B CA  1 
ATOM   5976 C C   . LEU D 1 364 ? 79.924  31.587 72.309  1.00 39.95 ? 452 LEU B C   1 
ATOM   5977 O O   . LEU D 1 364 ? 79.924  31.165 73.461  1.00 39.81 ? 452 LEU B O   1 
ATOM   5978 C CB  . LEU D 1 364 ? 80.782  30.056 70.514  1.00 38.32 ? 452 LEU B CB  1 
ATOM   5979 C CG  . LEU D 1 364 ? 80.524  28.803 69.681  1.00 38.03 ? 452 LEU B CG  1 
ATOM   5980 C CD1 . LEU D 1 364 ? 81.771  28.396 68.918  1.00 37.80 ? 452 LEU B CD1 1 
ATOM   5981 C CD2 . LEU D 1 364 ? 80.071  27.682 70.613  1.00 38.04 ? 452 LEU B CD2 1 
ATOM   5982 N N   . GLU D 1 365 ? 80.230  32.843 71.994  1.00 40.73 ? 453 GLU B N   1 
ATOM   5983 C CA  . GLU D 1 365 ? 80.598  33.818 73.007  1.00 41.99 ? 453 GLU B CA  1 
ATOM   5984 C C   . GLU D 1 365 ? 79.396  34.191 73.883  1.00 42.55 ? 453 GLU B C   1 
ATOM   5985 O O   . GLU D 1 365 ? 79.517  34.250 75.109  1.00 42.94 ? 453 GLU B O   1 
ATOM   5986 C CB  . GLU D 1 365 ? 81.161  35.073 72.343  1.00 42.92 ? 453 GLU B CB  1 
ATOM   5987 C CG  . GLU D 1 365 ? 81.578  36.146 73.321  1.00 44.99 ? 453 GLU B CG  1 
ATOM   5988 C CD  . GLU D 1 365 ? 82.018  37.411 72.620  1.00 46.60 ? 453 GLU B CD  1 
ATOM   5989 O OE1 . GLU D 1 365 ? 81.218  37.977 71.843  1.00 48.20 ? 453 GLU B OE1 1 
ATOM   5990 O OE2 . GLU D 1 365 ? 83.161  37.844 72.846  1.00 47.22 ? 453 GLU B OE2 1 
ATOM   5991 N N   . ASN D 1 366 ? 78.241  34.449 73.267  1.00 42.59 ? 454 ASN B N   1 
ATOM   5992 C CA  . ASN D 1 366 ? 77.051  34.799 74.046  1.00 42.65 ? 454 ASN B CA  1 
ATOM   5993 C C   . ASN D 1 366 ? 76.705  33.619 74.951  1.00 43.84 ? 454 ASN B C   1 
ATOM   5994 O O   . ASN D 1 366 ? 76.385  33.804 76.125  1.00 45.05 ? 454 ASN B O   1 
ATOM   5995 C CB  . ASN D 1 366 ? 75.842  35.125 73.147  1.00 40.87 ? 454 ASN B CB  1 
ATOM   5996 C CG  . ASN D 1 366 ? 76.040  36.386 72.307  1.00 39.27 ? 454 ASN B CG  1 
ATOM   5997 O OD1 . ASN D 1 366 ? 76.423  37.437 72.809  1.00 37.61 ? 454 ASN B OD1 1 
ATOM   5998 N ND2 . ASN D 1 366 ? 75.747  36.283 71.022  1.00 39.10 ? 454 ASN B ND2 1 
ATOM   5999 N N   . ILE D 1 367 ? 76.767  32.409 74.397  1.00 44.37 ? 455 ILE B N   1 
ATOM   6000 C CA  . ILE D 1 367 ? 76.491  31.186 75.150  1.00 44.28 ? 455 ILE B CA  1 
ATOM   6001 C C   . ILE D 1 367 ? 77.419  31.112 76.365  1.00 45.05 ? 455 ILE B C   1 
ATOM   6002 O O   . ILE D 1 367 ? 76.996  30.773 77.472  1.00 44.86 ? 455 ILE B O   1 
ATOM   6003 C CB  . ILE D 1 367 ? 76.725  29.932 74.267  1.00 43.45 ? 455 ILE B CB  1 
ATOM   6004 C CG1 . ILE D 1 367 ? 75.745  29.932 73.101  1.00 42.73 ? 455 ILE B CG1 1 
ATOM   6005 C CG2 . ILE D 1 367 ? 76.590  28.663 75.092  1.00 43.06 ? 455 ILE B CG2 1 
ATOM   6006 C CD1 . ILE D 1 367 ? 75.940  28.779 72.153  1.00 42.10 ? 455 ILE B CD1 1 
ATOM   6007 N N   . ILE D 1 368 ? 78.687  31.438 76.146  1.00 46.13 ? 456 ILE B N   1 
ATOM   6008 C CA  . ILE D 1 368 ? 79.680  31.405 77.211  1.00 47.70 ? 456 ILE B CA  1 
ATOM   6009 C C   . ILE D 1 368 ? 79.473  32.469 78.301  1.00 48.74 ? 456 ILE B C   1 
ATOM   6010 O O   . ILE D 1 368 ? 79.684  32.195 79.484  1.00 48.39 ? 456 ILE B O   1 
ATOM   6011 C CB  . ILE D 1 368 ? 81.105  31.550 76.633  1.00 47.74 ? 456 ILE B CB  1 
ATOM   6012 C CG1 . ILE D 1 368 ? 81.576  30.253 75.972  1.00 47.89 ? 456 ILE B CG1 1 
ATOM   6013 C CG2 . ILE D 1 368 ? 82.048  31.828 77.727  1.00 48.98 ? 456 ILE B CG2 1 
ATOM   6014 C CD1 . ILE D 1 368 ? 81.872  29.137 76.958  1.00 47.02 ? 456 ILE B CD1 1 
ATOM   6015 N N   . LYS D 1 369 ? 79.067  33.676 77.910  1.00 50.16 ? 457 LYS B N   1 
ATOM   6016 C CA  . LYS D 1 369 ? 78.843  34.756 78.875  1.00 51.71 ? 457 LYS B CA  1 
ATOM   6017 C C   . LYS D 1 369 ? 77.780  34.378 79.901  1.00 52.94 ? 457 LYS B C   1 
ATOM   6018 O O   . LYS D 1 369 ? 77.928  34.652 81.097  1.00 52.96 ? 457 LYS B O   1 
ATOM   6019 C CB  . LYS D 1 369 ? 78.418  36.042 78.161  1.00 51.30 ? 457 LYS B CB  1 
ATOM   6020 C CG  . LYS D 1 369 ? 79.452  36.585 77.198  1.00 51.94 ? 457 LYS B CG  1 
ATOM   6021 C CD  . LYS D 1 369 ? 78.970  37.856 76.512  1.00 51.93 ? 457 LYS B CD  1 
ATOM   6022 C CE  . LYS D 1 369 ? 79.999  38.351 75.505  1.00 52.49 ? 457 LYS B CE  1 
ATOM   6023 N NZ  . LYS D 1 369 ? 79.569  39.567 74.759  1.00 52.05 ? 457 LYS B NZ  1 
ATOM   6024 N N   . MET D 1 370 ? 76.707  33.751 79.425  1.00 54.15 ? 458 MET B N   1 
ATOM   6025 C CA  . MET D 1 370 ? 75.620  33.334 80.295  1.00 55.70 ? 458 MET B CA  1 
ATOM   6026 C C   . MET D 1 370 ? 76.088  32.236 81.242  1.00 56.85 ? 458 MET B C   1 
ATOM   6027 O O   . MET D 1 370 ? 75.882  32.323 82.452  1.00 57.21 ? 458 MET B O   1 
ATOM   6028 C CB  . MET D 1 370 ? 74.440  32.828 79.463  1.00 55.87 ? 458 MET B CB  1 
ATOM   6029 N N   . GLY D 1 371 ? 76.716  31.204 80.688  1.00 57.95 ? 459 GLY B N   1 
ATOM   6030 C CA  . GLY D 1 371 ? 77.198  30.110 81.516  1.00 59.61 ? 459 GLY B CA  1 
ATOM   6031 C C   . GLY D 1 371 ? 78.159  30.591 82.587  1.00 60.66 ? 459 GLY B C   1 
ATOM   6032 O O   . GLY D 1 371 ? 78.364  29.927 83.609  1.00 60.86 ? 459 GLY B O   1 
ATOM   6033 N N   . GLU D 1 372 ? 78.748  31.756 82.343  1.00 61.35 ? 460 GLU B N   1 
ATOM   6034 C CA  . GLU D 1 372 ? 79.696  32.357 83.264  1.00 62.19 ? 460 GLU B CA  1 
ATOM   6035 C C   . GLU D 1 372 ? 78.911  33.086 84.342  1.00 62.85 ? 460 GLU B C   1 
ATOM   6036 O O   . GLU D 1 372 ? 79.205  32.959 85.528  1.00 62.52 ? 460 GLU B O   1 
ATOM   6037 C CB  . GLU D 1 372 ? 80.593  33.337 82.503  1.00 62.34 ? 460 GLU B CB  1 
ATOM   6038 C CG  . GLU D 1 372 ? 81.800  33.857 83.268  1.00 62.38 ? 460 GLU B CG  1 
ATOM   6039 C CD  . GLU D 1 372 ? 82.765  32.753 83.664  1.00 62.83 ? 460 GLU B CD  1 
ATOM   6040 O OE1 . GLU D 1 372 ? 83.166  31.958 82.788  1.00 62.72 ? 460 GLU B OE1 1 
ATOM   6041 O OE2 . GLU D 1 372 ? 83.136  32.688 84.854  1.00 63.47 ? 460 GLU B OE2 1 
ATOM   6042 N N   . ALA D 1 373 ? 77.903  33.840 83.914  1.00 64.19 ? 461 ALA B N   1 
ATOM   6043 C CA  . ALA D 1 373 ? 77.055  34.601 84.827  1.00 65.60 ? 461 ALA B CA  1 
ATOM   6044 C C   . ALA D 1 373 ? 76.343  33.674 85.804  1.00 67.00 ? 461 ALA B C   1 
ATOM   6045 O O   . ALA D 1 373 ? 75.878  34.108 86.857  1.00 67.06 ? 461 ALA B O   1 
ATOM   6046 C CB  . ALA D 1 373 ? 76.043  35.403 84.041  1.00 65.05 ? 461 ALA B CB  1 
ATOM   6047 N N   . ASP D 1 374 ? 76.250  32.399 85.438  1.00 68.82 ? 462 ASP B N   1 
ATOM   6048 C CA  . ASP D 1 374 ? 75.624  31.390 86.288  1.00 70.62 ? 462 ASP B CA  1 
ATOM   6049 C C   . ASP D 1 374 ? 76.619  30.821 87.292  1.00 71.44 ? 462 ASP B C   1 
ATOM   6050 O O   . ASP D 1 374 ? 76.244  30.469 88.413  1.00 71.68 ? 462 ASP B O   1 
ATOM   6051 C CB  . ASP D 1 374 ? 75.054  30.253 85.446  1.00 71.21 ? 462 ASP B CB  1 
ATOM   6052 C CG  . ASP D 1 374 ? 73.716  30.597 84.850  1.00 72.20 ? 462 ASP B CG  1 
ATOM   6053 O OD1 . ASP D 1 374 ? 73.616  31.638 84.164  1.00 73.06 ? 462 ASP B OD1 1 
ATOM   6054 O OD2 . ASP D 1 374 ? 72.764  29.820 85.071  1.00 72.62 ? 462 ASP B OD2 1 
ATOM   6055 N N   . LYS D 1 375 ? 77.882  30.715 86.882  1.00 72.03 ? 463 LYS B N   1 
ATOM   6056 C CA  . LYS D 1 375 ? 78.926  30.210 87.765  1.00 72.39 ? 463 LYS B CA  1 
ATOM   6057 C C   . LYS D 1 375 ? 78.856  31.088 89.020  1.00 72.96 ? 463 LYS B C   1 
ATOM   6058 O O   . LYS D 1 375 ? 79.043  30.609 90.139  1.00 72.87 ? 463 LYS B O   1 
ATOM   6059 C CB  . LYS D 1 375 ? 80.300  30.329 87.080  1.00 71.90 ? 463 LYS B CB  1 
ATOM   6060 C CG  . LYS D 1 375 ? 81.473  29.772 87.876  1.00 71.00 ? 463 LYS B CG  1 
ATOM   6061 N N   . GLU D 1 376 ? 78.562  32.373 88.813  1.00 73.44 ? 464 GLU B N   1 
ATOM   6062 C CA  . GLU D 1 376 ? 78.440  33.333 89.903  1.00 74.22 ? 464 GLU B CA  1 
ATOM   6063 C C   . GLU D 1 376 ? 77.218  32.987 90.746  1.00 74.94 ? 464 GLU B C   1 
ATOM   6064 O O   . GLU D 1 376 ? 77.345  32.361 91.797  1.00 75.19 ? 464 GLU B O   1 
ATOM   6065 C CB  . GLU D 1 376 ? 78.297  34.754 89.353  1.00 73.81 ? 464 GLU B CB  1 
ATOM   6066 N N   . ALA D 1 377 ? 76.038  33.387 90.276  1.00 75.64 ? 465 ALA B N   1 
ATOM   6067 C CA  . ALA D 1 377 ? 74.776  33.128 90.982  1.00 76.26 ? 465 ALA B CA  1 
ATOM   6068 C C   . ALA D 1 377 ? 74.694  31.757 91.662  1.00 76.78 ? 465 ALA B C   1 
ATOM   6069 O O   . ALA D 1 377 ? 74.806  31.656 92.883  1.00 77.05 ? 465 ALA B O   1 
ATOM   6070 C CB  . ALA D 1 377 ? 73.606  33.292 90.023  1.00 76.16 ? 465 ALA B CB  1 
ATOM   6071 N N   . ARG D 1 378 ? 74.494  30.706 90.869  1.00 77.29 ? 466 ARG B N   1 
ATOM   6072 C CA  . ARG D 1 378 ? 74.387  29.348 91.396  1.00 77.61 ? 466 ARG B CA  1 
ATOM   6073 C C   . ARG D 1 378 ? 75.645  28.911 92.136  1.00 78.13 ? 466 ARG B C   1 
ATOM   6074 O O   . ARG D 1 378 ? 75.709  27.800 92.659  1.00 78.38 ? 466 ARG B O   1 
ATOM   6075 C CB  . ARG D 1 378 ? 74.093  28.362 90.261  1.00 77.35 ? 466 ARG B CB  1 
ATOM   6076 N N   . GLY D 1 379 ? 76.646  29.788 92.170  1.00 78.60 ? 467 GLY B N   1 
ATOM   6077 C CA  . GLY D 1 379 ? 77.893  29.487 92.856  1.00 78.88 ? 467 GLY B CA  1 
ATOM   6078 C C   . GLY D 1 379 ? 78.606  28.231 92.385  1.00 79.07 ? 467 GLY B C   1 
ATOM   6079 O O   . GLY D 1 379 ? 79.005  27.392 93.198  1.00 79.16 ? 467 GLY B O   1 
ATOM   6080 N N   . LEU D 1 380 ? 78.777  28.099 91.073  1.00 79.11 ? 468 LEU B N   1 
ATOM   6081 C CA  . LEU D 1 380 ? 79.450  26.933 90.510  1.00 78.83 ? 468 LEU B CA  1 
ATOM   6082 C C   . LEU D 1 380 ? 80.969  27.131 90.443  1.00 78.46 ? 468 LEU B C   1 
ATOM   6083 O O   . LEU D 1 380 ? 81.459  28.259 90.341  1.00 78.73 ? 468 LEU B O   1 
ATOM   6084 C CB  . LEU D 1 380 ? 78.895  26.638 89.113  1.00 78.67 ? 468 LEU B CB  1 
ATOM   6085 N N   . ASN D 1 381 ? 81.708  26.028 90.509  1.00 77.89 ? 469 ASN B N   1 
ATOM   6086 C CA  . ASN D 1 381 ? 83.167  26.078 90.452  1.00 77.00 ? 469 ASN B CA  1 
ATOM   6087 C C   . ASN D 1 381 ? 83.646  26.277 89.015  1.00 76.29 ? 469 ASN B C   1 
ATOM   6088 O O   . ASN D 1 381 ? 84.618  26.995 88.776  1.00 76.37 ? 469 ASN B O   1 
ATOM   6089 C CB  . ASN D 1 381 ? 83.763  24.786 91.023  1.00 76.74 ? 469 ASN B CB  1 
ATOM   6090 N N   . ILE D 1 382 ? 82.944  25.649 88.070  1.00 75.21 ? 470 ILE B N   1 
ATOM   6091 C CA  . ILE D 1 382 ? 83.280  25.722 86.645  1.00 73.89 ? 470 ILE B CA  1 
ATOM   6092 C C   . ILE D 1 382 ? 82.145  26.338 85.821  1.00 72.49 ? 470 ILE B C   1 
ATOM   6093 O O   . ILE D 1 382 ? 81.041  26.527 86.326  1.00 72.67 ? 470 ILE B O   1 
ATOM   6094 C CB  . ILE D 1 382 ? 83.578  24.304 86.091  1.00 74.46 ? 470 ILE B CB  1 
ATOM   6095 C CG1 . ILE D 1 382 ? 84.671  23.649 86.942  1.00 74.94 ? 470 ILE B CG1 1 
ATOM   6096 C CG2 . ILE D 1 382 ? 84.027  24.378 84.624  1.00 74.68 ? 470 ILE B CG2 1 
ATOM   6097 C CD1 . ILE D 1 382 ? 85.044  22.246 86.505  1.00 75.21 ? 470 ILE B CD1 1 
ATOM   6098 N N   . ASN D 1 383 ? 82.431  26.656 84.557  1.00 70.64 ? 471 ASN B N   1 
ATOM   6099 C CA  . ASN D 1 383 ? 81.448  27.231 83.632  1.00 68.33 ? 471 ASN B CA  1 
ATOM   6100 C C   . ASN D 1 383 ? 80.880  26.081 82.794  1.00 66.81 ? 471 ASN B C   1 
ATOM   6101 O O   . ASN D 1 383 ? 81.509  25.644 81.832  1.00 66.81 ? 471 ASN B O   1 
ATOM   6102 C CB  . ASN D 1 383 ? 82.127  28.252 82.714  1.00 67.96 ? 471 ASN B CB  1 
ATOM   6103 C CG  . ASN D 1 383 ? 81.156  28.948 81.783  1.00 67.43 ? 471 ASN B CG  1 
ATOM   6104 O OD1 . ASN D 1 383 ? 80.425  28.304 81.034  1.00 67.36 ? 471 ASN B OD1 1 
ATOM   6105 N ND2 . ASN D 1 383 ? 81.154  30.273 81.815  1.00 66.68 ? 471 ASN B ND2 1 
ATOM   6106 N N   . GLU D 1 384 ? 79.697  25.598 83.170  1.00 65.03 ? 472 GLU B N   1 
ATOM   6107 C CA  . GLU D 1 384 ? 79.042  24.484 82.488  1.00 63.11 ? 472 GLU B CA  1 
ATOM   6108 C C   . GLU D 1 384 ? 79.181  24.497 80.972  1.00 62.06 ? 472 GLU B C   1 
ATOM   6109 O O   . GLU D 1 384 ? 79.619  23.509 80.381  1.00 62.02 ? 472 GLU B O   1 
ATOM   6110 C CB  . GLU D 1 384 ? 77.563  24.435 82.867  1.00 62.76 ? 472 GLU B CB  1 
ATOM   6111 N N   . ASN D 1 385 ? 78.815  25.607 80.340  1.00 60.88 ? 473 ASN B N   1 
ATOM   6112 C CA  . ASN D 1 385 ? 78.922  25.706 78.885  1.00 60.08 ? 473 ASN B CA  1 
ATOM   6113 C C   . ASN D 1 385 ? 80.367  25.633 78.369  1.00 59.09 ? 473 ASN B C   1 
ATOM   6114 O O   . ASN D 1 385 ? 80.616  25.108 77.278  1.00 59.19 ? 473 ASN B O   1 
ATOM   6115 C CB  . ASN D 1 385 ? 78.258  26.987 78.389  1.00 60.06 ? 473 ASN B CB  1 
ATOM   6116 C CG  . ASN D 1 385 ? 76.811  27.081 78.806  1.00 60.05 ? 473 ASN B CG  1 
ATOM   6117 O OD1 . ASN D 1 385 ? 76.040  26.147 78.612  1.00 60.45 ? 473 ASN B OD1 1 
ATOM   6118 N ND2 . ASN D 1 385 ? 76.428  28.215 79.370  1.00 60.17 ? 473 ASN B ND2 1 
ATOM   6119 N N   . ALA D 1 386 ? 81.314  26.157 79.144  1.00 57.59 ? 474 ALA B N   1 
ATOM   6120 C CA  . ALA D 1 386 ? 82.720  26.107 78.749  1.00 56.08 ? 474 ALA B CA  1 
ATOM   6121 C C   . ALA D 1 386 ? 83.158  24.645 78.640  1.00 55.18 ? 474 ALA B C   1 
ATOM   6122 O O   . ALA D 1 386 ? 83.826  24.255 77.680  1.00 54.81 ? 474 ALA B O   1 
ATOM   6123 C CB  . ALA D 1 386 ? 83.574  26.836 79.769  1.00 55.83 ? 474 ALA B CB  1 
ATOM   6124 N N   . ASP D 1 387 ? 82.764  23.842 79.628  1.00 54.52 ? 475 ASP B N   1 
ATOM   6125 C CA  . ASP D 1 387 ? 83.098  22.417 79.655  1.00 54.03 ? 475 ASP B CA  1 
ATOM   6126 C C   . ASP D 1 387 ? 82.470  21.672 78.473  1.00 53.57 ? 475 ASP B C   1 
ATOM   6127 O O   . ASP D 1 387 ? 83.041  20.707 77.968  1.00 53.26 ? 475 ASP B O   1 
ATOM   6128 C CB  . ASP D 1 387 ? 82.633  21.784 80.974  1.00 53.52 ? 475 ASP B CB  1 
ATOM   6129 N N   . PHE D 1 388 ? 81.294  22.126 78.044  1.00 53.24 ? 476 PHE B N   1 
ATOM   6130 C CA  . PHE D 1 388 ? 80.579  21.535 76.911  1.00 52.99 ? 476 PHE B CA  1 
ATOM   6131 C C   . PHE D 1 388 ? 81.333  21.765 75.606  1.00 53.20 ? 476 PHE B C   1 
ATOM   6132 O O   . PHE D 1 388 ? 81.426  20.871 74.766  1.00 52.87 ? 476 PHE B O   1 
ATOM   6133 C CB  . PHE D 1 388 ? 79.189  22.156 76.793  1.00 53.22 ? 476 PHE B CB  1 
ATOM   6134 C CG  . PHE D 1 388 ? 78.198  21.653 77.808  1.00 52.99 ? 476 PHE B CG  1 
ATOM   6135 C CD1 . PHE D 1 388 ? 78.242  20.337 78.257  1.00 53.12 ? 476 PHE B CD1 1 
ATOM   6136 C CD2 . PHE D 1 388 ? 77.181  22.484 78.275  1.00 52.81 ? 476 PHE B CD2 1 
ATOM   6137 C CE1 . PHE D 1 388 ? 77.286  19.855 79.150  1.00 53.02 ? 476 PHE B CE1 1 
ATOM   6138 C CE2 . PHE D 1 388 ? 76.220  22.014 79.170  1.00 52.52 ? 476 PHE B CE2 1 
ATOM   6139 C CZ  . PHE D 1 388 ? 76.274  20.699 79.609  1.00 52.72 ? 476 PHE B CZ  1 
ATOM   6140 N N   . ILE D 1 389 ? 81.860  22.977 75.446  1.00 53.57 ? 477 ILE B N   1 
ATOM   6141 C CA  . ILE D 1 389 ? 82.617  23.359 74.257  1.00 54.04 ? 477 ILE B CA  1 
ATOM   6142 C C   . ILE D 1 389 ? 83.958  22.625 74.151  1.00 54.18 ? 477 ILE B C   1 
ATOM   6143 O O   . ILE D 1 389 ? 84.392  22.270 73.050  1.00 54.39 ? 477 ILE B O   1 
ATOM   6144 C CB  . ILE D 1 389 ? 82.820  24.905 74.225  1.00 54.15 ? 477 ILE B CB  1 
ATOM   6145 C CG1 . ILE D 1 389 ? 81.460  25.577 73.993  1.00 54.44 ? 477 ILE B CG1 1 
ATOM   6146 C CG2 . ILE D 1 389 ? 83.811  25.305 73.144  1.00 53.78 ? 477 ILE B CG2 1 
ATOM   6147 C CD1 . ILE D 1 389 ? 81.481  27.077 74.035  1.00 54.26 ? 477 ILE B CD1 1 
ATOM   6148 N N   . GLU D 1 390 ? 84.612  22.381 75.283  1.00 54.23 ? 478 GLU B N   1 
ATOM   6149 C CA  . GLU D 1 390 ? 85.881  21.662 75.247  1.00 54.88 ? 478 GLU B CA  1 
ATOM   6150 C C   . GLU D 1 390 ? 85.619  20.248 74.722  1.00 55.44 ? 478 GLU B C   1 
ATOM   6151 O O   . GLU D 1 390 ? 86.385  19.729 73.905  1.00 55.32 ? 478 GLU B O   1 
ATOM   6152 C CB  . GLU D 1 390 ? 86.515  21.597 76.642  1.00 54.04 ? 478 GLU B CB  1 
ATOM   6153 N N   . LYS D 1 391 ? 84.519  19.647 75.180  1.00 56.21 ? 479 LYS B N   1 
ATOM   6154 C CA  . LYS D 1 391 ? 84.120  18.285 74.788  1.00 57.03 ? 479 LYS B CA  1 
ATOM   6155 C C   . LYS D 1 391 ? 83.935  18.134 73.277  1.00 57.01 ? 479 LYS B C   1 
ATOM   6156 O O   . LYS D 1 391 ? 84.537  17.269 72.640  1.00 56.62 ? 479 LYS B O   1 
ATOM   6157 C CB  . LYS D 1 391 ? 82.794  17.906 75.455  1.00 57.50 ? 479 LYS B CB  1 
ATOM   6158 C CG  . LYS D 1 391 ? 82.734  18.063 76.969  1.00 58.82 ? 479 LYS B CG  1 
ATOM   6159 C CD  . LYS D 1 391 ? 83.631  17.099 77.724  1.00 60.19 ? 479 LYS B CD  1 
ATOM   6160 C CE  . LYS D 1 391 ? 83.351  17.203 79.225  1.00 61.16 ? 479 LYS B CE  1 
ATOM   6161 N NZ  . LYS D 1 391 ? 84.122  16.219 80.048  1.00 62.58 ? 479 LYS B NZ  1 
ATOM   6162 N N   . ALA D 1 392 ? 83.076  18.978 72.721  1.00 56.99 ? 480 ALA B N   1 
ATOM   6163 C CA  . ALA D 1 392 ? 82.775  18.963 71.296  1.00 57.11 ? 480 ALA B CA  1 
ATOM   6164 C C   . ALA D 1 392 ? 83.998  19.254 70.450  1.00 57.29 ? 480 ALA B C   1 
ATOM   6165 O O   . ALA D 1 392 ? 83.939  19.189 69.221  1.00 57.67 ? 480 ALA B O   1 
ATOM   6166 C CB  . ALA D 1 392 ? 81.694  19.987 70.991  1.00 57.29 ? 480 ALA B CB  1 
ATOM   6167 N N   . GLY D 1 393 ? 85.102  19.587 71.106  1.00 57.15 ? 481 GLY B N   1 
ATOM   6168 C CA  . GLY D 1 393 ? 86.319  19.899 70.383  1.00 56.63 ? 481 GLY B CA  1 
ATOM   6169 C C   . GLY D 1 393 ? 86.291  21.342 69.921  1.00 56.09 ? 481 GLY B C   1 
ATOM   6170 O O   . GLY D 1 393 ? 87.081  21.746 69.068  1.00 56.23 ? 481 GLY B O   1 
ATOM   6171 N N   . GLY D 1 394 ? 85.377  22.120 70.491  1.00 55.49 ? 482 GLY B N   1 
ATOM   6172 C CA  . GLY D 1 394 ? 85.258  23.518 70.121  1.00 55.00 ? 482 GLY B CA  1 
ATOM   6173 C C   . GLY D 1 394 ? 86.472  24.337 70.503  1.00 54.56 ? 482 GLY B C   1 
ATOM   6174 O O   . GLY D 1 394 ? 86.938  25.170 69.724  1.00 54.71 ? 482 GLY B O   1 
ATOM   6175 N N   . MET D 1 395 ? 86.986  24.089 71.702  1.00 54.15 ? 483 MET B N   1 
ATOM   6176 C CA  . MET D 1 395 ? 88.146  24.803 72.211  1.00 53.54 ? 483 MET B CA  1 
ATOM   6177 C C   . MET D 1 395 ? 89.317  24.781 71.249  1.00 52.71 ? 483 MET B C   1 
ATOM   6178 O O   . MET D 1 395 ? 89.922  25.813 70.982  1.00 53.12 ? 483 MET B O   1 
ATOM   6179 C CB  . MET D 1 395 ? 88.611  24.200 73.525  1.00 54.35 ? 483 MET B CB  1 
ATOM   6180 C CG  . MET D 1 395 ? 89.775  24.948 74.134  1.00 55.59 ? 483 MET B CG  1 
ATOM   6181 S SD  . MET D 1 395 ? 90.728  23.919 75.251  1.00 57.50 ? 483 MET B SD  1 
ATOM   6182 C CE  . MET D 1 395 ? 89.499  23.468 76.488  1.00 56.95 ? 483 MET B CE  1 
ATOM   6183 N N   . GLU D 1 396 ? 89.650  23.604 70.737  1.00 51.96 ? 484 GLU B N   1 
ATOM   6184 C CA  . GLU D 1 396 ? 90.779  23.498 69.822  1.00 51.28 ? 484 GLU B CA  1 
ATOM   6185 C C   . GLU D 1 396 ? 90.529  24.341 68.575  1.00 50.27 ? 484 GLU B C   1 
ATOM   6186 O O   . GLU D 1 396 ? 91.405  25.092 68.134  1.00 50.21 ? 484 GLU B O   1 
ATOM   6187 C CB  . GLU D 1 396 ? 91.031  22.027 69.447  1.00 51.73 ? 484 GLU B CB  1 
ATOM   6188 C CG  . GLU D 1 396 ? 92.280  21.789 68.583  1.00 52.16 ? 484 GLU B CG  1 
ATOM   6189 N N   . LYS D 1 397 ? 89.322  24.231 68.023  1.00 49.26 ? 485 LYS B N   1 
ATOM   6190 C CA  . LYS D 1 397 ? 88.959  24.975 66.822  1.00 48.24 ? 485 LYS B CA  1 
ATOM   6191 C C   . LYS D 1 397 ? 88.966  26.477 67.037  1.00 47.40 ? 485 LYS B C   1 
ATOM   6192 O O   . LYS D 1 397 ? 89.428  27.226 66.177  1.00 47.70 ? 485 LYS B O   1 
ATOM   6193 C CB  . LYS D 1 397 ? 87.598  24.509 66.301  1.00 48.31 ? 485 LYS B CB  1 
ATOM   6194 C CG  . LYS D 1 397 ? 87.628  23.072 65.794  1.00 47.41 ? 485 LYS B CG  1 
ATOM   6195 C CD  . LYS D 1 397 ? 86.327  22.667 65.145  1.00 46.82 ? 485 LYS B CD  1 
ATOM   6196 C CE  . LYS D 1 397 ? 86.408  21.236 64.658  1.00 46.26 ? 485 LYS B CE  1 
ATOM   6197 N NZ  . LYS D 1 397 ? 86.674  20.314 65.792  1.00 45.33 ? 485 LYS B NZ  1 
ATOM   6198 N N   . ILE D 1 398 ? 88.452  26.916 68.179  1.00 46.22 ? 486 ILE B N   1 
ATOM   6199 C CA  . ILE D 1 398 ? 88.462  28.333 68.500  1.00 45.18 ? 486 ILE B CA  1 
ATOM   6200 C C   . ILE D 1 398 ? 89.920  28.768 68.545  1.00 44.62 ? 486 ILE B C   1 
ATOM   6201 O O   . ILE D 1 398 ? 90.285  29.825 68.030  1.00 44.51 ? 486 ILE B O   1 
ATOM   6202 C CB  . ILE D 1 398 ? 87.825  28.595 69.871  1.00 45.14 ? 486 ILE B CB  1 
ATOM   6203 C CG1 . ILE D 1 398 ? 86.331  28.269 69.796  1.00 45.42 ? 486 ILE B CG1 1 
ATOM   6204 C CG2 . ILE D 1 398 ? 88.074  30.045 70.308  1.00 44.78 ? 486 ILE B CG2 1 
ATOM   6205 C CD1 . ILE D 1 398 ? 85.584  28.441 71.101  1.00 45.28 ? 486 ILE B CD1 1 
ATOM   6206 N N   . PHE D 1 399 ? 90.755  27.930 69.148  1.00 44.00 ? 487 PHE B N   1 
ATOM   6207 C CA  . PHE D 1 399 ? 92.178  28.221 69.263  1.00 43.51 ? 487 PHE B CA  1 
ATOM   6208 C C   . PHE D 1 399 ? 92.850  28.409 67.892  1.00 43.14 ? 487 PHE B C   1 
ATOM   6209 O O   . PHE D 1 399 ? 93.755  29.241 67.737  1.00 42.19 ? 487 PHE B O   1 
ATOM   6210 C CB  . PHE D 1 399 ? 92.887  27.098 70.018  1.00 43.15 ? 487 PHE B CB  1 
ATOM   6211 C CG  . PHE D 1 399 ? 94.322  27.391 70.299  1.00 43.54 ? 487 PHE B CG  1 
ATOM   6212 C CD1 . PHE D 1 399 ? 94.674  28.261 71.324  1.00 44.33 ? 487 PHE B CD1 1 
ATOM   6213 C CD2 . PHE D 1 399 ? 95.327  26.866 69.484  1.00 43.94 ? 487 PHE B CD2 1 
ATOM   6214 C CE1 . PHE D 1 399 ? 96.007  28.614 71.537  1.00 44.33 ? 487 PHE B CE1 1 
ATOM   6215 C CE2 . PHE D 1 399 ? 96.660  27.210 69.682  1.00 43.97 ? 487 PHE B CE2 1 
ATOM   6216 C CZ  . PHE D 1 399 ? 97.002  28.089 70.714  1.00 44.23 ? 487 PHE B CZ  1 
ATOM   6217 N N   . ASN D 1 400 ? 92.402  27.636 66.906  1.00 42.60 ? 488 ASN B N   1 
ATOM   6218 C CA  . ASN D 1 400 ? 92.967  27.709 65.566  1.00 42.45 ? 488 ASN B CA  1 
ATOM   6219 C C   . ASN D 1 400 ? 92.582  28.986 64.834  1.00 42.14 ? 488 ASN B C   1 
ATOM   6220 O O   . ASN D 1 400 ? 93.287  29.420 63.921  1.00 42.49 ? 488 ASN B O   1 
ATOM   6221 C CB  . ASN D 1 400 ? 92.543  26.489 64.747  1.00 42.98 ? 488 ASN B CB  1 
ATOM   6222 C CG  . ASN D 1 400 ? 93.152  25.189 65.268  1.00 43.93 ? 488 ASN B CG  1 
ATOM   6223 O OD1 . ASN D 1 400 ? 92.757  24.093 64.858  1.00 44.05 ? 488 ASN B OD1 1 
ATOM   6224 N ND2 . ASN D 1 400 ? 94.127  25.308 66.165  1.00 44.38 ? 488 ASN B ND2 1 
ATOM   6225 N N   . CYS D 1 401 ? 91.476  29.597 65.232  1.00 41.37 ? 489 CYS B N   1 
ATOM   6226 C CA  . CYS D 1 401 ? 91.056  30.821 64.579  1.00 41.57 ? 489 CYS B CA  1 
ATOM   6227 C C   . CYS D 1 401 ? 91.983  31.989 64.925  1.00 42.44 ? 489 CYS B C   1 
ATOM   6228 O O   . CYS D 1 401 ? 91.800  33.107 64.439  1.00 42.71 ? 489 CYS B O   1 
ATOM   6229 C CB  . CYS D 1 401 ? 89.615  31.157 64.956  1.00 41.45 ? 489 CYS B CB  1 
ATOM   6230 S SG  . CYS D 1 401 ? 88.380  29.965 64.374  1.00 39.96 ? 489 CYS B SG  1 
ATOM   6231 N N   . GLN D 1 402 ? 92.985  31.733 65.759  1.00 43.02 ? 490 GLN B N   1 
ATOM   6232 C CA  . GLN D 1 402 ? 93.928  32.780 66.124  1.00 43.73 ? 490 GLN B CA  1 
ATOM   6233 C C   . GLN D 1 402 ? 94.947  32.972 65.009  1.00 43.72 ? 490 GLN B C   1 
ATOM   6234 O O   . GLN D 1 402 ? 95.698  33.940 65.007  1.00 44.19 ? 490 GLN B O   1 
ATOM   6235 C CB  . GLN D 1 402 ? 94.638  32.434 67.430  1.00 44.45 ? 490 GLN B CB  1 
ATOM   6236 C CG  . GLN D 1 402 ? 93.686  32.211 68.589  1.00 45.15 ? 490 GLN B CG  1 
ATOM   6237 C CD  . GLN D 1 402 ? 94.401  31.881 69.879  1.00 45.42 ? 490 GLN B CD  1 
ATOM   6238 O OE1 . GLN D 1 402 ? 95.245  30.995 69.921  1.00 46.06 ? 490 GLN B OE1 1 
ATOM   6239 N NE2 . GLN D 1 402 ? 94.052  32.581 70.945  1.00 45.69 ? 490 GLN B NE2 1 
ATOM   6240 N N   . GLN D 1 403 ? 94.966  32.043 64.061  1.00 44.06 ? 491 GLN B N   1 
ATOM   6241 C CA  . GLN D 1 403 ? 95.878  32.138 62.929  1.00 44.20 ? 491 GLN B CA  1 
ATOM   6242 C C   . GLN D 1 403 ? 95.143  32.557 61.672  1.00 43.25 ? 491 GLN B C   1 
ATOM   6243 O O   . GLN D 1 403 ? 95.688  32.461 60.572  1.00 42.74 ? 491 GLN B O   1 
ATOM   6244 C CB  . GLN D 1 403 ? 96.574  30.810 62.663  1.00 45.88 ? 491 GLN B CB  1 
ATOM   6245 C CG  . GLN D 1 403 ? 97.402  30.317 63.813  1.00 48.06 ? 491 GLN B CG  1 
ATOM   6246 C CD  . GLN D 1 403 ? 98.659  29.608 63.347  1.00 50.05 ? 491 GLN B CD  1 
ATOM   6247 O OE1 . GLN D 1 403 ? 98.609  28.692 62.510  1.00 50.78 ? 491 GLN B OE1 1 
ATOM   6248 N NE2 . GLN D 1 403 ? 99.803  30.024 63.893  1.00 50.67 ? 491 GLN B NE2 1 
ATOM   6249 N N   . ASN D 1 404 ? 93.902  33.003 61.842  1.00 42.36 ? 492 ASN B N   1 
ATOM   6250 C CA  . ASN D 1 404 ? 93.089  33.463 60.723  1.00 41.91 ? 492 ASN B CA  1 
ATOM   6251 C C   . ASN D 1 404 ? 93.622  34.848 60.322  1.00 41.77 ? 492 ASN B C   1 
ATOM   6252 O O   . ASN D 1 404 ? 93.962  35.657 61.184  1.00 41.60 ? 492 ASN B O   1 
ATOM   6253 C CB  . ASN D 1 404 ? 91.619  33.530 61.153  1.00 41.33 ? 492 ASN B CB  1 
ATOM   6254 C CG  . ASN D 1 404 ? 90.687  33.882 60.012  1.00 40.99 ? 492 ASN B CG  1 
ATOM   6255 O OD1 . ASN D 1 404 ? 90.681  35.008 59.521  1.00 41.25 ? 492 ASN B OD1 1 
ATOM   6256 N ND2 . ASN D 1 404 ? 89.898  32.914 59.578  1.00 40.12 ? 492 ASN B ND2 1 
ATOM   6257 N N   . GLU D 1 405 ? 93.717  35.114 59.023  1.00 41.51 ? 493 GLU B N   1 
ATOM   6258 C CA  . GLU D 1 405 ? 94.240  36.399 58.559  1.00 41.62 ? 493 GLU B CA  1 
ATOM   6259 C C   . GLU D 1 405 ? 93.355  37.602 58.899  1.00 41.70 ? 493 GLU B C   1 
ATOM   6260 O O   . GLU D 1 405 ? 93.834  38.738 58.943  1.00 41.55 ? 493 GLU B O   1 
ATOM   6261 C CB  . GLU D 1 405 ? 94.505  36.359 57.044  1.00 41.10 ? 493 GLU B CB  1 
ATOM   6262 C CG  . GLU D 1 405 ? 93.291  36.082 56.150  1.00 41.28 ? 493 GLU B CG  1 
ATOM   6263 C CD  . GLU D 1 405 ? 92.666  34.705 56.372  1.00 40.88 ? 493 GLU B CD  1 
ATOM   6264 O OE1 . GLU D 1 405 ? 93.398  33.696 56.319  1.00 39.86 ? 493 GLU B OE1 1 
ATOM   6265 O OE2 . GLU D 1 405 ? 91.436  34.635 56.582  1.00 40.91 ? 493 GLU B OE2 1 
ATOM   6266 N N   . ASN D 1 406 ? 92.072  37.346 59.147  1.00 41.67 ? 494 ASN B N   1 
ATOM   6267 C CA  . ASN D 1 406 ? 91.126  38.401 59.473  1.00 41.25 ? 494 ASN B CA  1 
ATOM   6268 C C   . ASN D 1 406 ? 91.236  38.872 60.929  1.00 40.89 ? 494 ASN B C   1 
ATOM   6269 O O   . ASN D 1 406 ? 91.091  38.079 61.861  1.00 40.77 ? 494 ASN B O   1 
ATOM   6270 C CB  . ASN D 1 406 ? 89.713  37.916 59.165  1.00 41.46 ? 494 ASN B CB  1 
ATOM   6271 C CG  . ASN D 1 406 ? 88.667  38.932 59.522  1.00 42.45 ? 494 ASN B CG  1 
ATOM   6272 O OD1 . ASN D 1 406 ? 88.321  39.112 60.696  1.00 42.78 ? 494 ASN B OD1 1 
ATOM   6273 N ND2 . ASN D 1 406 ? 88.172  39.638 58.509  1.00 43.36 ? 494 ASN B ND2 1 
ATOM   6274 N N   . ASP D 1 407 ? 91.497  40.169 61.106  1.00 40.82 ? 495 ASP B N   1 
ATOM   6275 C CA  . ASP D 1 407 ? 91.643  40.794 62.430  1.00 40.90 ? 495 ASP B CA  1 
ATOM   6276 C C   . ASP D 1 407 ? 90.447  40.531 63.338  1.00 40.14 ? 495 ASP B C   1 
ATOM   6277 O O   . ASP D 1 407 ? 90.613  40.059 64.465  1.00 39.69 ? 495 ASP B O   1 
ATOM   6278 C CB  . ASP D 1 407 ? 91.846  42.317 62.297  1.00 42.41 ? 495 ASP B CB  1 
ATOM   6279 C CG  . ASP D 1 407 ? 93.123  42.685 61.531  1.00 44.65 ? 495 ASP B CG  1 
ATOM   6280 O OD1 . ASP D 1 407 ? 93.262  42.301 60.342  1.00 45.86 ? 495 ASP B OD1 1 
ATOM   6281 O OD2 . ASP D 1 407 ? 93.996  43.364 62.118  1.00 45.64 ? 495 ASP B OD2 1 
ATOM   6282 N N   . LYS D 1 408 ? 89.247  40.835 62.841  1.00 39.17 ? 496 LYS B N   1 
ATOM   6283 C CA  . LYS D 1 408 ? 88.025  40.638 63.610  1.00 38.45 ? 496 LYS B CA  1 
ATOM   6284 C C   . LYS D 1 408 ? 87.953  39.213 64.183  1.00 38.00 ? 496 LYS B C   1 
ATOM   6285 O O   . LYS D 1 408 ? 87.510  39.014 65.317  1.00 38.48 ? 496 LYS B O   1 
ATOM   6286 C CB  . LYS D 1 408 ? 86.796  40.935 62.739  1.00 37.98 ? 496 LYS B CB  1 
ATOM   6287 N N   . ILE D 1 409 ? 88.404  38.222 63.420  1.00 36.85 ? 497 ILE B N   1 
ATOM   6288 C CA  . ILE D 1 409 ? 88.367  36.850 63.906  1.00 35.81 ? 497 ILE B CA  1 
ATOM   6289 C C   . ILE D 1 409 ? 89.449  36.488 64.920  1.00 35.60 ? 497 ILE B C   1 
ATOM   6290 O O   . ILE D 1 409 ? 89.131  36.069 66.028  1.00 35.20 ? 497 ILE B O   1 
ATOM   6291 C CB  . ILE D 1 409 ? 88.449  35.825 62.758  1.00 35.30 ? 497 ILE B CB  1 
ATOM   6292 C CG1 . ILE D 1 409 ? 87.245  35.971 61.832  1.00 34.31 ? 497 ILE B CG1 1 
ATOM   6293 C CG2 . ILE D 1 409 ? 88.486  34.411 63.329  1.00 34.40 ? 497 ILE B CG2 1 
ATOM   6294 C CD1 . ILE D 1 409 ? 87.279  35.010 60.669  1.00 33.58 ? 497 ILE B CD1 1 
ATOM   6295 N N   . TYR D 1 410 ? 90.721  36.642 64.564  1.00 35.88 ? 498 TYR B N   1 
ATOM   6296 C CA  . TYR D 1 410 ? 91.770  36.252 65.504  1.00 35.74 ? 498 TYR B CA  1 
ATOM   6297 C C   . TYR D 1 410 ? 91.695  37.032 66.811  1.00 35.49 ? 498 TYR B C   1 
ATOM   6298 O O   . TYR D 1 410 ? 91.948  36.474 67.875  1.00 34.04 ? 498 TYR B O   1 
ATOM   6299 C CB  . TYR D 1 410 ? 93.184  36.313 64.855  1.00 36.13 ? 498 TYR B CB  1 
ATOM   6300 C CG  . TYR D 1 410 ? 93.857  37.662 64.655  1.00 36.95 ? 498 TYR B CG  1 
ATOM   6301 C CD1 . TYR D 1 410 ? 94.233  38.453 65.741  1.00 37.88 ? 498 TYR B CD1 1 
ATOM   6302 C CD2 . TYR D 1 410 ? 94.177  38.118 63.371  1.00 37.73 ? 498 TYR B CD2 1 
ATOM   6303 C CE1 . TYR D 1 410 ? 94.917  39.670 65.558  1.00 38.89 ? 498 TYR B CE1 1 
ATOM   6304 C CE2 . TYR D 1 410 ? 94.862  39.333 63.171  1.00 38.34 ? 498 TYR B CE2 1 
ATOM   6305 C CZ  . TYR D 1 410 ? 95.226  40.107 64.270  1.00 39.05 ? 498 TYR B CZ  1 
ATOM   6306 O OH  . TYR D 1 410 ? 95.882  41.317 64.091  1.00 38.53 ? 498 TYR B OH  1 
ATOM   6307 N N   . GLU D 1 411 ? 91.319  38.309 66.743  1.00 36.09 ? 499 GLU B N   1 
ATOM   6308 C CA  . GLU D 1 411 ? 91.196  39.101 67.963  1.00 36.46 ? 499 GLU B CA  1 
ATOM   6309 C C   . GLU D 1 411 ? 90.066  38.522 68.801  1.00 36.99 ? 499 GLU B C   1 
ATOM   6310 O O   . GLU D 1 411 ? 90.187  38.373 70.013  1.00 37.57 ? 499 GLU B O   1 
ATOM   6311 C CB  . GLU D 1 411 ? 90.912  40.573 67.648  1.00 35.95 ? 499 GLU B CB  1 
ATOM   6312 C CG  . GLU D 1 411 ? 92.079  41.307 67.007  1.00 36.01 ? 499 GLU B CG  1 
ATOM   6313 N N   . LYS D 1 412 ? 88.963  38.184 68.150  1.00 37.80 ? 500 LYS B N   1 
ATOM   6314 C CA  . LYS D 1 412 ? 87.823  37.602 68.853  1.00 38.62 ? 500 LYS B CA  1 
ATOM   6315 C C   . LYS D 1 412 ? 88.251  36.290 69.518  1.00 38.44 ? 500 LYS B C   1 
ATOM   6316 O O   . LYS D 1 412 ? 87.909  36.022 70.667  1.00 38.77 ? 500 LYS B O   1 
ATOM   6317 C CB  . LYS D 1 412 ? 86.692  37.324 67.860  1.00 39.56 ? 500 LYS B CB  1 
ATOM   6318 C CG  . LYS D 1 412 ? 85.411  36.778 68.463  1.00 39.95 ? 500 LYS B CG  1 
ATOM   6319 C CD  . LYS D 1 412 ? 84.652  37.846 69.220  1.00 41.03 ? 500 LYS B CD  1 
ATOM   6320 C CE  . LYS D 1 412 ? 83.319  37.301 69.730  1.00 42.20 ? 500 LYS B CE  1 
ATOM   6321 N N   . ALA D 1 413 ? 89.009  35.482 68.788  1.00 37.96 ? 501 ALA B N   1 
ATOM   6322 C CA  . ALA D 1 413 ? 89.463  34.196 69.289  1.00 38.14 ? 501 ALA B CA  1 
ATOM   6323 C C   . ALA D 1 413 ? 90.345  34.273 70.540  1.00 38.61 ? 501 ALA B C   1 
ATOM   6324 O O   . ALA D 1 413 ? 90.095  33.553 71.513  1.00 38.18 ? 501 ALA B O   1 
ATOM   6325 C CB  . ALA D 1 413 ? 90.183  33.436 68.176  1.00 38.12 ? 501 ALA B CB  1 
ATOM   6326 N N   . TYR D 1 414 ? 91.373  35.127 70.525  1.00 39.19 ? 502 TYR B N   1 
ATOM   6327 C CA  . TYR D 1 414 ? 92.256  35.251 71.689  1.00 39.67 ? 502 TYR B CA  1 
ATOM   6328 C C   . TYR D 1 414 ? 91.469  35.676 72.920  1.00 39.27 ? 502 TYR B C   1 
ATOM   6329 O O   . TYR D 1 414 ? 91.713  35.175 74.018  1.00 39.13 ? 502 TYR B O   1 
ATOM   6330 C CB  . TYR D 1 414 ? 93.393  36.275 71.477  1.00 41.15 ? 502 TYR B CB  1 
ATOM   6331 C CG  . TYR D 1 414 ? 94.518  35.884 70.518  1.00 42.73 ? 502 TYR B CG  1 
ATOM   6332 C CD1 . TYR D 1 414 ? 95.622  35.138 70.964  1.00 42.81 ? 502 TYR B CD1 1 
ATOM   6333 C CD2 . TYR D 1 414 ? 94.494  36.281 69.170  1.00 43.82 ? 502 TYR B CD2 1 
ATOM   6334 C CE1 . TYR D 1 414 ? 96.675  34.793 70.088  1.00 43.30 ? 502 TYR B CE1 1 
ATOM   6335 C CE2 . TYR D 1 414 ? 95.544  35.944 68.285  1.00 43.90 ? 502 TYR B CE2 1 
ATOM   6336 C CZ  . TYR D 1 414 ? 96.630  35.204 68.752  1.00 44.00 ? 502 TYR B CZ  1 
ATOM   6337 O OH  . TYR D 1 414 ? 97.667  34.895 67.891  1.00 44.00 ? 502 TYR B OH  1 
ATOM   6338 N N   . LYS D 1 415 ? 90.529  36.602 72.747  1.00 38.92 ? 503 LYS B N   1 
ATOM   6339 C CA  . LYS D 1 415 ? 89.734  37.065 73.877  1.00 38.59 ? 503 LYS B CA  1 
ATOM   6340 C C   . LYS D 1 415 ? 88.936  35.904 74.448  1.00 38.89 ? 503 LYS B C   1 
ATOM   6341 O O   . LYS D 1 415 ? 88.879  35.715 75.660  1.00 39.32 ? 503 LYS B O   1 
ATOM   6342 C CB  . LYS D 1 415 ? 88.801  38.200 73.460  1.00 37.28 ? 503 LYS B CB  1 
ATOM   6343 N N   . ILE D 1 416 ? 88.332  35.102 73.586  1.00 39.40 ? 504 ILE B N   1 
ATOM   6344 C CA  . ILE D 1 416 ? 87.568  33.986 74.102  1.00 40.29 ? 504 ILE B CA  1 
ATOM   6345 C C   . ILE D 1 416 ? 88.470  33.023 74.858  1.00 41.19 ? 504 ILE B C   1 
ATOM   6346 O O   . ILE D 1 416 ? 88.181  32.678 76.007  1.00 41.86 ? 504 ILE B O   1 
ATOM   6347 C CB  . ILE D 1 416 ? 86.805  33.245 72.984  1.00 40.32 ? 504 ILE B CB  1 
ATOM   6348 C CG1 . ILE D 1 416 ? 85.649  34.126 72.490  1.00 39.88 ? 504 ILE B CG1 1 
ATOM   6349 C CG2 . ILE D 1 416 ? 86.280  31.899 73.496  1.00 39.98 ? 504 ILE B CG2 1 
ATOM   6350 C CD1 . ILE D 1 416 ? 84.832  33.521 71.368  1.00 39.06 ? 504 ILE B CD1 1 
ATOM   6351 N N   . ILE D 1 417 ? 89.568  32.594 74.239  1.00 41.59 ? 505 ILE B N   1 
ATOM   6352 C CA  . ILE D 1 417 ? 90.468  31.671 74.923  1.00 41.88 ? 505 ILE B CA  1 
ATOM   6353 C C   . ILE D 1 417 ? 90.959  32.226 76.253  1.00 42.32 ? 505 ILE B C   1 
ATOM   6354 O O   . ILE D 1 417 ? 90.937  31.527 77.267  1.00 42.40 ? 505 ILE B O   1 
ATOM   6355 C CB  . ILE D 1 417 ? 91.697  31.322 74.074  1.00 41.44 ? 505 ILE B CB  1 
ATOM   6356 C CG1 . ILE D 1 417 ? 91.281  30.448 72.885  1.00 41.12 ? 505 ILE B CG1 1 
ATOM   6357 C CG2 . ILE D 1 417 ? 92.735  30.614 74.945  1.00 40.81 ? 505 ILE B CG2 1 
ATOM   6358 C CD1 . ILE D 1 417 ? 90.737  29.094 73.274  1.00 39.88 ? 505 ILE B CD1 1 
ATOM   6359 N N   . GLU D 1 418 ? 91.396  33.482 76.247  1.00 42.54 ? 506 GLU B N   1 
ATOM   6360 C CA  . GLU D 1 418 ? 91.907  34.117 77.457  1.00 42.76 ? 506 GLU B CA  1 
ATOM   6361 C C   . GLU D 1 418 ? 90.814  34.148 78.514  1.00 43.18 ? 506 GLU B C   1 
ATOM   6362 O O   . GLU D 1 418 ? 90.944  33.577 79.598  1.00 43.07 ? 506 GLU B O   1 
ATOM   6363 C CB  . GLU D 1 418 ? 92.363  35.547 77.150  1.00 42.18 ? 506 GLU B CB  1 
ATOM   6364 C CG  . GLU D 1 418 ? 93.011  36.281 78.316  1.00 41.54 ? 506 GLU B CG  1 
ATOM   6365 C CD  . GLU D 1 418 ? 93.268  37.763 78.018  1.00 42.27 ? 506 GLU B CD  1 
ATOM   6366 O OE1 . GLU D 1 418 ? 92.274  38.519 77.873  1.00 42.38 ? 506 GLU B OE1 1 
ATOM   6367 O OE2 . GLU D 1 418 ? 94.455  38.170 77.922  1.00 41.13 ? 506 GLU B OE2 1 
ATOM   6368 N N   . THR D 1 419 ? 89.719  34.808 78.170  1.00 43.82 ? 507 THR B N   1 
ATOM   6369 C CA  . THR D 1 419 ? 88.600  34.961 79.077  1.00 44.11 ? 507 THR B CA  1 
ATOM   6370 C C   . THR D 1 419 ? 87.950  33.683 79.595  1.00 44.44 ? 507 THR B C   1 
ATOM   6371 O O   . THR D 1 419 ? 87.527  33.636 80.747  1.00 43.94 ? 507 THR B O   1 
ATOM   6372 C CB  . THR D 1 419 ? 87.519  35.830 78.432  1.00 43.61 ? 507 THR B CB  1 
ATOM   6373 O OG1 . THR D 1 419 ? 88.087  37.092 78.071  1.00 43.67 ? 507 THR B OG1 1 
ATOM   6374 C CG2 . THR D 1 419 ? 86.383  36.063 79.399  1.00 43.33 ? 507 THR B CG2 1 
ATOM   6375 N N   . TYR D 1 420 ? 87.870  32.639 78.777  1.00 45.39 ? 508 TYR B N   1 
ATOM   6376 C CA  . TYR D 1 420 ? 87.201  31.435 79.260  1.00 46.46 ? 508 TYR B CA  1 
ATOM   6377 C C   . TYR D 1 420 ? 87.956  30.117 79.314  1.00 47.25 ? 508 TYR B C   1 
ATOM   6378 O O   . TYR D 1 420 ? 87.413  29.134 79.819  1.00 46.93 ? 508 TYR B O   1 
ATOM   6379 C CB  . TYR D 1 420 ? 85.889  31.224 78.494  1.00 46.21 ? 508 TYR B CB  1 
ATOM   6380 C CG  . TYR D 1 420 ? 84.980  32.439 78.499  1.00 45.71 ? 508 TYR B CG  1 
ATOM   6381 C CD1 . TYR D 1 420 ? 84.172  32.733 79.601  1.00 45.56 ? 508 TYR B CD1 1 
ATOM   6382 C CD2 . TYR D 1 420 ? 84.946  33.308 77.412  1.00 45.23 ? 508 TYR B CD2 1 
ATOM   6383 C CE1 . TYR D 1 420 ? 83.351  33.868 79.615  1.00 45.18 ? 508 TYR B CE1 1 
ATOM   6384 C CE2 . TYR D 1 420 ? 84.132  34.441 77.416  1.00 45.03 ? 508 TYR B CE2 1 
ATOM   6385 C CZ  . TYR D 1 420 ? 83.341  34.715 78.514  1.00 45.07 ? 508 TYR B CZ  1 
ATOM   6386 O OH  . TYR D 1 420 ? 82.552  35.841 78.504  1.00 45.32 ? 508 TYR B OH  1 
ATOM   6387 N N   . PHE D 1 421 ? 89.191  30.073 78.815  1.00 49.02 ? 509 PHE B N   1 
ATOM   6388 C CA  . PHE D 1 421 ? 89.959  28.821 78.850  1.00 50.43 ? 509 PHE B CA  1 
ATOM   6389 C C   . PHE D 1 421 ? 91.425  28.954 79.285  1.00 51.38 ? 509 PHE B C   1 
ATOM   6390 O O   . PHE D 1 421 ? 92.340  28.562 78.559  1.00 51.23 ? 509 PHE B O   1 
ATOM   6391 C CB  . PHE D 1 421 ? 89.901  28.103 77.488  1.00 50.08 ? 509 PHE B CB  1 
ATOM   6392 C CG  . PHE D 1 421 ? 88.502  27.788 77.018  1.00 49.72 ? 509 PHE B CG  1 
ATOM   6393 C CD1 . PHE D 1 421 ? 87.710  28.770 76.426  1.00 49.51 ? 509 PHE B CD1 1 
ATOM   6394 C CD2 . PHE D 1 421 ? 87.973  26.514 77.171  1.00 49.45 ? 509 PHE B CD2 1 
ATOM   6395 C CE1 . PHE D 1 421 ? 86.418  28.482 75.993  1.00 48.76 ? 509 PHE B CE1 1 
ATOM   6396 C CE2 . PHE D 1 421 ? 86.678  26.222 76.740  1.00 48.94 ? 509 PHE B CE2 1 
ATOM   6397 C CZ  . PHE D 1 421 ? 85.905  27.205 76.150  1.00 48.66 ? 509 PHE B CZ  1 
ATOM   6398 N N   . GLY D 1 422 ? 91.641  29.490 80.482  1.00 52.67 ? 510 GLY B N   1 
ATOM   6399 C CA  . GLY D 1 422 ? 92.997  29.642 80.981  1.00 53.99 ? 510 GLY B CA  1 
ATOM   6400 C C   . GLY D 1 422 ? 93.218  28.888 82.280  1.00 54.58 ? 510 GLY B C   1 
ATOM   6401 O O   . GLY D 1 422 ? 94.190  28.143 82.411  1.00 55.50 ? 510 GLY B O   1 
ATOM   6402 N N   . LYS E 2 1   ? 61.300  36.951 31.337  1.00 46.66 ? 127 LYS E N   1 
ATOM   6403 C CA  . LYS E 2 1   ? 61.400  35.899 30.338  1.00 46.20 ? 127 LYS E CA  1 
ATOM   6404 C C   . LYS E 2 1   ? 60.573  36.275 29.096  1.00 46.12 ? 127 LYS E C   1 
ATOM   6405 O O   . LYS E 2 1   ? 59.927  37.326 29.064  1.00 45.96 ? 127 LYS E O   1 
ATOM   6406 C CB  . LYS E 2 1   ? 60.908  34.569 30.940  1.00 46.06 ? 127 LYS E CB  1 
ATOM   6407 C CG  . LYS E 2 1   ? 59.443  34.562 31.307  1.00 46.55 ? 127 LYS E CG  1 
ATOM   6408 C CD  . LYS E 2 1   ? 58.984  33.271 31.973  1.00 46.87 ? 127 LYS E CD  1 
ATOM   6409 C CE  . LYS E 2 1   ? 59.117  33.348 33.480  1.00 47.55 ? 127 LYS E CE  1 
ATOM   6410 N NZ  . LYS E 2 1   ? 58.066  32.505 34.130  1.00 48.32 ? 127 LYS E NZ  1 
ATOM   6411 N N   . LYS E 2 2   ? 60.605  35.421 28.077  1.00 45.15 ? 128 LYS E N   1 
ATOM   6412 C CA  . LYS E 2 2   ? 59.849  35.661 26.851  1.00 44.76 ? 128 LYS E CA  1 
ATOM   6413 C C   . LYS E 2 2   ? 59.114  34.394 26.448  1.00 44.44 ? 128 LYS E C   1 
ATOM   6414 O O   . LYS E 2 2   ? 59.544  33.302 26.803  1.00 44.61 ? 128 LYS E O   1 
ATOM   6415 C CB  . LYS E 2 2   ? 60.773  36.088 25.714  1.00 44.53 ? 128 LYS E CB  1 
ATOM   6416 C CG  . LYS E 2 2   ? 61.518  37.370 25.987  1.00 44.32 ? 128 LYS E CG  1 
ATOM   6417 C CD  . LYS E 2 2   ? 62.331  37.785 24.785  1.00 44.21 ? 128 LYS E CD  1 
ATOM   6418 C CE  . LYS E 2 2   ? 63.037  39.114 25.029  1.00 44.30 ? 128 LYS E CE  1 
ATOM   6419 N NZ  . LYS E 2 2   ? 63.801  39.557 23.831  1.00 42.62 ? 128 LYS E NZ  1 
ATOM   6420 N N   . LYS E 2 3   ? 58.007  34.537 25.724  1.00 43.89 ? 129 LYS E N   1 
ATOM   6421 C CA  . LYS E 2 3   ? 57.227  33.383 25.281  1.00 43.08 ? 129 LYS E CA  1 
ATOM   6422 C C   . LYS E 2 3   ? 56.824  33.547 23.813  1.00 43.29 ? 129 LYS E C   1 
ATOM   6423 O O   . LYS E 2 3   ? 56.551  34.659 23.353  1.00 42.76 ? 129 LYS E O   1 
ATOM   6424 C CB  . LYS E 2 3   ? 55.973  33.219 26.149  1.00 42.59 ? 129 LYS E CB  1 
ATOM   6425 C CG  . LYS E 2 3   ? 56.234  33.003 27.631  1.00 41.89 ? 129 LYS E CG  1 
ATOM   6426 C CD  . LYS E 2 3   ? 54.926  32.829 28.377  1.00 41.90 ? 129 LYS E CD  1 
ATOM   6427 C CE  . LYS E 2 3   ? 55.131  32.797 29.875  1.00 41.87 ? 129 LYS E CE  1 
ATOM   6428 N NZ  . LYS E 2 3   ? 53.813  32.799 30.565  1.00 41.75 ? 129 LYS E NZ  1 
ATOM   6429 N N   . ARG E 2 4   ? 56.796  32.443 23.076  1.00 43.62 ? 130 ARG E N   1 
ATOM   6430 C CA  . ARG E 2 4   ? 56.420  32.478 21.666  1.00 44.23 ? 130 ARG E CA  1 
ATOM   6431 C C   . ARG E 2 4   ? 55.036  31.855 21.443  1.00 44.57 ? 130 ARG E C   1 
ATOM   6432 O O   . ARG E 2 4   ? 54.699  30.848 22.062  1.00 45.02 ? 130 ARG E O   1 
ATOM   6433 C CB  . ARG E 2 4   ? 57.504  31.772 20.858  1.00 44.34 ? 130 ARG E CB  1 
ATOM   6434 C CG  . ARG E 2 4   ? 57.241  31.577 19.385  1.00 45.39 ? 130 ARG E CG  1 
ATOM   6435 C CD  . ARG E 2 4   ? 58.573  31.316 18.704  1.00 46.67 ? 130 ARG E CD  1 
ATOM   6436 N NE  . ARG E 2 4   ? 58.459  30.539 17.474  1.00 48.01 ? 130 ARG E NE  1 
ATOM   6437 C CZ  . ARG E 2 4   ? 58.230  29.231 17.448  1.00 48.37 ? 130 ARG E CZ  1 
ATOM   6438 N NH1 . ARG E 2 4   ? 58.093  28.562 18.586  1.00 48.49 ? 130 ARG E NH1 1 
ATOM   6439 N NH2 . ARG E 2 4   ? 58.131  28.590 16.289  1.00 48.65 ? 130 ARG E NH2 1 
ATOM   6440 N N   . LYS E 2 5   ? 54.225  32.474 20.584  1.00 45.19 ? 131 LYS E N   1 
ATOM   6441 C CA  . LYS E 2 5   ? 52.876  31.981 20.309  1.00 45.43 ? 131 LYS E CA  1 
ATOM   6442 C C   . LYS E 2 5   ? 52.915  30.891 19.277  1.00 45.31 ? 131 LYS E C   1 
ATOM   6443 O O   . LYS E 2 5   ? 53.295  31.101 18.131  1.00 44.90 ? 131 LYS E O   1 
ATOM   6444 C CB  . LYS E 2 5   ? 51.970  33.097 19.822  1.00 46.41 ? 131 LYS E CB  1 
ATOM   6445 C CG  . LYS E 2 5   ? 50.539  32.641 19.602  1.00 47.68 ? 131 LYS E CG  1 
ATOM   6446 C CD  . LYS E 2 5   ? 49.653  33.792 19.172  1.00 47.77 ? 131 LYS E CD  1 
ATOM   6447 C CE  . LYS E 2 5   ? 48.220  33.333 18.975  1.00 47.50 ? 131 LYS E CE  1 
ATOM   6448 N NZ  . LYS E 2 5   ? 47.581  33.155 20.285  1.00 47.52 ? 131 LYS E NZ  1 
ATOM   6449 N N   . VAL E 2 6   ? 52.457  29.725 19.687  1.00 45.87 ? 132 VAL E N   1 
ATOM   6450 C CA  . VAL E 2 6   ? 52.497  28.567 18.821  1.00 45.92 ? 132 VAL E CA  1 
ATOM   6451 C C   . VAL E 2 6   ? 51.107  27.956 18.632  1.00 45.23 ? 132 VAL E C   1 
ATOM   6452 O O   . VAL E 2 6   ? 50.653  27.719 17.499  1.00 44.71 ? 132 VAL E O   1 
ATOM   6453 C CB  . VAL E 2 6   ? 53.506  27.650 19.484  1.00 46.59 ? 132 VAL E CB  1 
ATOM   6454 C CG1 . VAL E 2 6   ? 54.855  28.411 19.592  1.00 46.83 ? 132 VAL E CG1 1 
ATOM   6455 C CG2 . VAL E 2 6   ? 53.046  27.334 20.921  1.00 46.71 ? 132 VAL E CG2 1 
ATOM   6456 N N   . ALA F 3 1   ? 70.812  43.368 62.646  1.00 48.35 ? 127 ALA F N   1 
ATOM   6457 C CA  . ALA F 3 1   ? 71.048  41.986 62.241  1.00 48.00 ? 127 ALA F CA  1 
ATOM   6458 C C   . ALA F 3 1   ? 70.047  41.506 61.175  1.00 47.62 ? 127 ALA F C   1 
ATOM   6459 O O   . ALA F 3 1   ? 69.913  40.301 60.936  1.00 48.19 ? 127 ALA F O   1 
ATOM   6460 C CB  . ALA F 3 1   ? 71.015  41.060 63.480  1.00 47.45 ? 127 ALA F CB  1 
ATOM   6461 N N   . LYS F 3 2   ? 69.354  42.450 60.535  1.00 46.83 ? 128 LYS F N   1 
ATOM   6462 C CA  . LYS F 3 2   ? 68.380  42.137 59.481  1.00 46.24 ? 128 LYS F CA  1 
ATOM   6463 C C   . LYS F 3 2   ? 69.083  41.992 58.139  1.00 45.44 ? 128 LYS F C   1 
ATOM   6464 O O   . LYS F 3 2   ? 69.726  42.936 57.673  1.00 45.28 ? 128 LYS F O   1 
ATOM   6465 C CB  . LYS F 3 2   ? 67.323  43.241 59.389  1.00 46.09 ? 128 LYS F CB  1 
ATOM   6466 C CG  . LYS F 3 2   ? 66.346  43.323 60.560  1.00 45.11 ? 128 LYS F CG  1 
ATOM   6467 C CD  . LYS F 3 2   ? 65.213  42.320 60.434  1.00 44.51 ? 128 LYS F CD  1 
ATOM   6468 C CE  . LYS F 3 2   ? 64.187  42.489 61.555  1.00 44.15 ? 128 LYS F CE  1 
ATOM   6469 N NZ  . LYS F 3 2   ? 63.040  41.540 61.430  1.00 43.50 ? 128 LYS F NZ  1 
ATOM   6470 N N   . LYS F 3 3   ? 68.952  40.817 57.536  1.00 44.90 ? 129 LYS F N   1 
ATOM   6471 C CA  . LYS F 3 3   ? 69.595  40.569 56.247  1.00 44.37 ? 129 LYS F CA  1 
ATOM   6472 C C   . LYS F 3 3   ? 68.659  40.563 55.082  1.00 44.48 ? 129 LYS F C   1 
ATOM   6473 O O   . LYS F 3 3   ? 67.660  39.853 54.980  1.00 45.15 ? 129 LYS F O   1 
ATOM   6474 C CB  . LYS F 3 3   ? 70.357  39.240 56.215  1.00 43.48 ? 129 LYS F CB  1 
ATOM   6475 C CG  . LYS F 3 3   ? 71.506  39.095 57.188  1.00 41.90 ? 129 LYS F CG  1 
ATOM   6476 C CD  . LYS F 3 3   ? 72.105  37.695 57.037  1.00 40.91 ? 129 LYS F CD  1 
ATOM   6477 C CE  . LYS F 3 3   ? 71.037  36.625 57.238  1.00 40.16 ? 129 LYS F CE  1 
ATOM   6478 N NZ  . LYS F 3 3   ? 71.466  35.311 56.746  1.00 39.79 ? 129 LYS F NZ  1 
ATOM   6479 N N   . ALA F 3 4   ? 69.096  41.400 54.157  1.00 44.06 ? 130 ALA F N   1 
ATOM   6480 C CA  . ALA F 3 4   ? 68.397  41.588 52.945  1.00 44.26 ? 130 ALA F CA  1 
ATOM   6481 C C   . ALA F 3 4   ? 69.319  41.229 51.800  1.00 44.11 ? 130 ALA F C   1 
ATOM   6482 O O   . ALA F 3 4   ? 70.558  41.085 51.942  1.00 43.66 ? 130 ALA F O   1 
ATOM   6483 C CB  . ALA F 3 4   ? 67.983  43.032 52.842  1.00 43.90 ? 130 ALA F CB  1 
ATOM   6484 N N   . ALA F 3 5   ? 68.640  41.105 50.663  1.00 43.96 ? 131 ALA F N   1 
ATOM   6485 C CA  . ALA F 3 5   ? 69.186  40.773 49.368  1.00 43.96 ? 131 ALA F CA  1 
ATOM   6486 C C   . ALA F 3 5   ? 68.269  39.695 48.831  1.00 43.96 ? 131 ALA F C   1 
ATOM   6487 O O   . ALA F 3 5   ? 68.268  38.566 49.326  1.00 43.97 ? 131 ALA F O   1 
ATOM   6488 C CB  . ALA F 3 5   ? 70.616  40.255 49.470  1.00 43.96 ? 131 ALA F CB  1 
HETATM 6489 O O   . HOH G 4 .   ? 101.425 45.034 57.422  1.00 10.24 ? 1   HOH A O   1 
HETATM 6490 O O   . HOH G 4 .   ? 110.364 33.136 68.690  1.00 14.89 ? 2   HOH A O   1 
HETATM 6491 O O   . HOH G 4 .   ? 106.746 30.097 68.326  1.00 47.52 ? 3   HOH A O   1 
HETATM 6492 O O   . HOH G 4 .   ? 108.508 30.705 73.700  1.00 72.06 ? 4   HOH A O   1 
HETATM 6493 O O   . HOH G 4 .   ? 106.460 32.560 69.320  1.00 50.08 ? 5   HOH A O   1 
HETATM 6494 O O   . HOH G 4 .   ? 97.578  35.317 46.193  1.00 38.65 ? 6   HOH A O   1 
HETATM 6495 O O   . HOH H 4 .   ? 60.831  45.968 43.174  1.00 15.42 ? 1   HOH B O   1 
HETATM 6496 O O   . HOH H 4 .   ? 50.344  33.893 34.418  1.00 41.08 ? 2   HOH B O   1 
HETATM 6497 O O   . HOH H 4 .   ? 55.013  31.207 34.242  1.00 40.64 ? 3   HOH B O   1 
HETATM 6498 O O   . HOH H 4 .   ? 46.541  34.172 22.399  1.00 78.80 ? 4   HOH B O   1 
HETATM 6499 O O   . HOH H 4 .   ? 63.812  37.493 55.578  1.00 45.96 ? 5   HOH B O   1 
HETATM 6500 O O   . HOH H 4 .   ? 38.954  48.751 17.276  1.00 49.95 ? 6   HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LEU 1   89  89  LEU LEU A . n 
A 1 2   PRO 2   90  90  PRO PRO A . n 
A 1 3   GLN 3   91  91  GLN GLN A . n 
A 1 4   MET 4   92  92  MET MET A . n 
A 1 5   THR 5   93  93  THR THR A . n 
A 1 6   GLN 6   94  94  GLN GLN A . n 
A 1 7   GLN 7   95  95  GLN GLN A . n 
A 1 8   LEU 8   96  96  LEU LEU A . n 
A 1 9   ASN 9   97  97  ASN ASN A . n 
A 1 10  SER 10  98  98  SER SER A . n 
A 1 11  ASP 11  99  99  ASP ASP A . n 
A 1 12  ASP 12  100 100 ASP ASP A . n 
A 1 13  MET 13  101 101 MET MET A . n 
A 1 14  GLN 14  102 102 GLN GLN A . n 
A 1 15  GLU 15  103 103 GLU GLU A . n 
A 1 16  GLN 16  104 104 GLN GLN A . n 
A 1 17  LEU 17  105 105 LEU LEU A . n 
A 1 18  SER 18  106 106 SER SER A . n 
A 1 19  ALA 19  107 107 ALA ALA A . n 
A 1 20  THR 20  108 108 THR THR A . n 
A 1 21  VAL 21  109 109 VAL VAL A . n 
A 1 22  LYS 22  110 110 LYS LYS A . n 
A 1 23  PHE 23  111 111 PHE PHE A . n 
A 1 24  ARG 24  112 112 ARG ARG A . n 
A 1 25  GLN 25  113 113 GLN GLN A . n 
A 1 26  ILE 26  114 114 ILE ILE A . n 
A 1 27  LEU 27  115 115 LEU LEU A . n 
A 1 28  SER 28  116 116 SER SER A . n 
A 1 29  ARG 29  117 117 ARG ARG A . n 
A 1 30  GLU 30  118 118 GLU GLU A . n 
A 1 31  HIS 31  119 119 HIS HIS A . n 
A 1 32  ARG 32  120 120 ARG ARG A . n 
A 1 33  PRO 33  121 121 PRO PRO A . n 
A 1 34  PRO 34  122 122 PRO PRO A . n 
A 1 35  ILE 35  123 123 ILE ILE A . n 
A 1 36  ASP 36  124 124 ASP ASP A . n 
A 1 37  VAL 37  125 125 VAL VAL A . n 
A 1 38  VAL 38  126 126 VAL VAL A . n 
A 1 39  ILE 39  127 127 ILE ILE A . n 
A 1 40  GLN 40  128 128 GLN GLN A . n 
A 1 41  ALA 41  129 129 ALA ALA A . n 
A 1 42  GLY 42  130 130 GLY GLY A . n 
A 1 43  VAL 43  131 131 VAL VAL A . n 
A 1 44  VAL 44  132 132 VAL VAL A . n 
A 1 45  PRO 45  133 133 PRO PRO A . n 
A 1 46  ARG 46  134 134 ARG ARG A . n 
A 1 47  LEU 47  135 135 LEU LEU A . n 
A 1 48  VAL 48  136 136 VAL VAL A . n 
A 1 49  GLU 49  137 137 GLU GLU A . n 
A 1 50  PHE 50  138 138 PHE PHE A . n 
A 1 51  MET 51  139 139 MET MET A . n 
A 1 52  ARG 52  140 140 ARG ARG A . n 
A 1 53  GLU 53  141 141 GLU GLU A . n 
A 1 54  ASN 54  142 142 ASN ASN A . n 
A 1 55  GLN 55  143 143 GLN GLN A . n 
A 1 56  PRO 56  144 144 PRO PRO A . n 
A 1 57  GLU 57  145 145 GLU GLU A . n 
A 1 58  MET 58  146 146 MET MET A . n 
A 1 59  LEU 59  147 147 LEU LEU A . n 
A 1 60  GLN 60  148 148 GLN GLN A . n 
A 1 61  LEU 61  149 149 LEU LEU A . n 
A 1 62  GLU 62  150 150 GLU GLU A . n 
A 1 63  ALA 63  151 151 ALA ALA A . n 
A 1 64  ALA 64  152 152 ALA ALA A . n 
A 1 65  TRP 65  153 153 TRP TRP A . n 
A 1 66  ALA 66  154 154 ALA ALA A . n 
A 1 67  LEU 67  155 155 LEU LEU A . n 
A 1 68  THR 68  156 156 THR THR A . n 
A 1 69  ASN 69  157 157 ASN ASN A . n 
A 1 70  ILE 70  158 158 ILE ILE A . n 
A 1 71  ALA 71  159 159 ALA ALA A . n 
A 1 72  SER 72  160 160 SER SER A . n 
A 1 73  GLY 73  161 161 GLY GLY A . n 
A 1 74  THR 74  162 162 THR THR A . n 
A 1 75  SER 75  163 163 SER SER A . n 
A 1 76  ALA 76  164 164 ALA ALA A . n 
A 1 77  GLN 77  165 165 GLN GLN A . n 
A 1 78  THR 78  166 166 THR THR A . n 
A 1 79  LYS 79  167 167 LYS LYS A . n 
A 1 80  VAL 80  168 168 VAL VAL A . n 
A 1 81  VAL 81  169 169 VAL VAL A . n 
A 1 82  VAL 82  170 170 VAL VAL A . n 
A 1 83  ASP 83  171 171 ASP ASP A . n 
A 1 84  ALA 84  172 172 ALA ALA A . n 
A 1 85  ASP 85  173 173 ASP ASP A . n 
A 1 86  ALA 86  174 174 ALA ALA A . n 
A 1 87  VAL 87  175 175 VAL VAL A . n 
A 1 88  PRO 88  176 176 PRO PRO A . n 
A 1 89  LEU 89  177 177 LEU LEU A . n 
A 1 90  PHE 90  178 178 PHE PHE A . n 
A 1 91  ILE 91  179 179 ILE ILE A . n 
A 1 92  GLN 92  180 180 GLN GLN A . n 
A 1 93  LEU 93  181 181 LEU LEU A . n 
A 1 94  LEU 94  182 182 LEU LEU A . n 
A 1 95  TYR 95  183 183 TYR TYR A . n 
A 1 96  THR 96  184 184 THR THR A . n 
A 1 97  GLY 97  185 185 GLY GLY A . n 
A 1 98  SER 98  186 186 SER SER A . n 
A 1 99  VAL 99  187 187 VAL VAL A . n 
A 1 100 GLU 100 188 188 GLU GLU A . n 
A 1 101 VAL 101 189 189 VAL VAL A . n 
A 1 102 LYS 102 190 190 LYS LYS A . n 
A 1 103 GLU 103 191 191 GLU GLU A . n 
A 1 104 GLN 104 192 192 GLN GLN A . n 
A 1 105 ALA 105 193 193 ALA ALA A . n 
A 1 106 ILE 106 194 194 ILE ILE A . n 
A 1 107 TRP 107 195 195 TRP TRP A . n 
A 1 108 ALA 108 196 196 ALA ALA A . n 
A 1 109 LEU 109 197 197 LEU LEU A . n 
A 1 110 GLY 110 198 198 GLY GLY A . n 
A 1 111 ASN 111 199 199 ASN ASN A . n 
A 1 112 VAL 112 200 200 VAL VAL A . n 
A 1 113 ALA 113 201 201 ALA ALA A . n 
A 1 114 GLY 114 202 202 GLY GLY A . n 
A 1 115 ASP 115 203 203 ASP ASP A . n 
A 1 116 SER 116 204 204 SER SER A . n 
A 1 117 THR 117 205 205 THR THR A . n 
A 1 118 ASP 118 206 206 ASP ASP A . n 
A 1 119 TYR 119 207 207 TYR TYR A . n 
A 1 120 ARG 120 208 208 ARG ARG A . n 
A 1 121 ASP 121 209 209 ASP ASP A . n 
A 1 122 TYR 122 210 210 TYR TYR A . n 
A 1 123 VAL 123 211 211 VAL VAL A . n 
A 1 124 LEU 124 212 212 LEU LEU A . n 
A 1 125 GLN 125 213 213 GLN GLN A . n 
A 1 126 CYS 126 214 214 CYS CYS A . n 
A 1 127 ASN 127 215 215 ASN ASN A . n 
A 1 128 ALA 128 216 216 ALA ALA A . n 
A 1 129 MET 129 217 217 MET MET A . n 
A 1 130 GLU 130 218 218 GLU GLU A . n 
A 1 131 PRO 131 219 219 PRO PRO A . n 
A 1 132 ILE 132 220 220 ILE ILE A . n 
A 1 133 LEU 133 221 221 LEU LEU A . n 
A 1 134 GLY 134 222 222 GLY GLY A . n 
A 1 135 LEU 135 223 223 LEU LEU A . n 
A 1 136 PHE 136 224 224 PHE PHE A . n 
A 1 137 ASN 137 225 225 ASN ASN A . n 
A 1 138 SER 138 226 226 SER SER A . n 
A 1 139 ASN 139 227 227 ASN ASN A . n 
A 1 140 LYS 140 228 228 LYS LYS A . n 
A 1 141 PRO 141 229 229 PRO PRO A . n 
A 1 142 SER 142 230 230 SER SER A . n 
A 1 143 LEU 143 231 231 LEU LEU A . n 
A 1 144 ILE 144 232 232 ILE ILE A . n 
A 1 145 ARG 145 233 233 ARG ARG A . n 
A 1 146 THR 146 234 234 THR THR A . n 
A 1 147 ALA 147 235 235 ALA ALA A . n 
A 1 148 THR 148 236 236 THR THR A . n 
A 1 149 TRP 149 237 237 TRP TRP A . n 
A 1 150 THR 150 238 238 THR THR A . n 
A 1 151 LEU 151 239 239 LEU LEU A . n 
A 1 152 SER 152 240 240 SER SER A . n 
A 1 153 ASN 153 241 241 ASN ASN A . n 
A 1 154 LEU 154 242 242 LEU LEU A . n 
A 1 155 CYS 155 243 243 CYS CYS A . n 
A 1 156 ARG 156 244 244 ARG ARG A . n 
A 1 157 GLY 157 245 245 GLY GLY A . n 
A 1 158 LYS 158 246 246 LYS LYS A . n 
A 1 159 LYS 159 247 247 LYS LYS A . n 
A 1 160 PRO 160 248 248 PRO PRO A . n 
A 1 161 GLN 161 249 249 GLN GLN A . n 
A 1 162 PRO 162 250 250 PRO PRO A . n 
A 1 163 ASP 163 251 251 ASP ASP A . n 
A 1 164 TRP 164 252 252 TRP TRP A . n 
A 1 165 SER 165 253 253 SER SER A . n 
A 1 166 VAL 166 254 254 VAL VAL A . n 
A 1 167 VAL 167 255 255 VAL VAL A . n 
A 1 168 SER 168 256 256 SER SER A . n 
A 1 169 GLN 169 257 257 GLN GLN A . n 
A 1 170 ALA 170 258 258 ALA ALA A . n 
A 1 171 LEU 171 259 259 LEU LEU A . n 
A 1 172 PRO 172 260 260 PRO PRO A . n 
A 1 173 THR 173 261 261 THR THR A . n 
A 1 174 LEU 174 262 262 LEU LEU A . n 
A 1 175 ALA 175 263 263 ALA ALA A . n 
A 1 176 LYS 176 264 264 LYS LYS A . n 
A 1 177 LEU 177 265 265 LEU LEU A . n 
A 1 178 ILE 178 266 266 ILE ILE A . n 
A 1 179 TYR 179 267 267 TYR TYR A . n 
A 1 180 SER 180 268 268 SER SER A . n 
A 1 181 MET 181 269 269 MET MET A . n 
A 1 182 ASP 182 270 270 ASP ASP A . n 
A 1 183 THR 183 271 271 THR THR A . n 
A 1 184 GLU 184 272 272 GLU GLU A . n 
A 1 185 THR 185 273 273 THR THR A . n 
A 1 186 LEU 186 274 274 LEU LEU A . n 
A 1 187 VAL 187 275 275 VAL VAL A . n 
A 1 188 ASP 188 276 276 ASP ASP A . n 
A 1 189 ALA 189 277 277 ALA ALA A . n 
A 1 190 CYS 190 278 278 CYS CYS A . n 
A 1 191 TRP 191 279 279 TRP TRP A . n 
A 1 192 ALA 192 280 280 ALA ALA A . n 
A 1 193 ILE 193 281 281 ILE ILE A . n 
A 1 194 SER 194 282 282 SER SER A . n 
A 1 195 TYR 195 283 283 TYR TYR A . n 
A 1 196 LEU 196 284 284 LEU LEU A . n 
A 1 197 SER 197 285 285 SER SER A . n 
A 1 198 ASP 198 286 286 ASP ASP A . n 
A 1 199 GLY 199 287 287 GLY GLY A . n 
A 1 200 PRO 200 288 288 PRO PRO A . n 
A 1 201 GLN 201 289 289 GLN GLN A . n 
A 1 202 GLU 202 290 290 GLU GLU A . n 
A 1 203 ALA 203 291 291 ALA ALA A . n 
A 1 204 ILE 204 292 292 ILE ILE A . n 
A 1 205 GLN 205 293 293 GLN GLN A . n 
A 1 206 ALA 206 294 294 ALA ALA A . n 
A 1 207 VAL 207 295 295 VAL VAL A . n 
A 1 208 ILE 208 296 296 ILE ILE A . n 
A 1 209 ASP 209 297 297 ASP ASP A . n 
A 1 210 VAL 210 298 298 VAL VAL A . n 
A 1 211 ARG 211 299 299 ARG ARG A . n 
A 1 212 ILE 212 300 300 ILE ILE A . n 
A 1 213 PRO 213 301 301 PRO PRO A . n 
A 1 214 LYS 214 302 302 LYS LYS A . n 
A 1 215 ARG 215 303 303 ARG ARG A . n 
A 1 216 LEU 216 304 304 LEU LEU A . n 
A 1 217 VAL 217 305 305 VAL VAL A . n 
A 1 218 GLU 218 306 306 GLU GLU A . n 
A 1 219 LEU 219 307 307 LEU LEU A . n 
A 1 220 LEU 220 308 308 LEU LEU A . n 
A 1 221 SER 221 309 309 SER SER A . n 
A 1 222 HIS 222 310 310 HIS HIS A . n 
A 1 223 GLU 223 311 311 GLU GLU A . n 
A 1 224 SER 224 312 312 SER SER A . n 
A 1 225 THR 225 313 313 THR THR A . n 
A 1 226 LEU 226 314 314 LEU LEU A . n 
A 1 227 VAL 227 315 315 VAL VAL A . n 
A 1 228 GLN 228 316 316 GLN GLN A . n 
A 1 229 THR 229 317 317 THR THR A . n 
A 1 230 PRO 230 318 318 PRO PRO A . n 
A 1 231 ALA 231 319 319 ALA ALA A . n 
A 1 232 LEU 232 320 320 LEU LEU A . n 
A 1 233 ARG 233 321 321 ARG ARG A . n 
A 1 234 ALA 234 322 322 ALA ALA A . n 
A 1 235 VAL 235 323 323 VAL VAL A . n 
A 1 236 GLY 236 324 324 GLY GLY A . n 
A 1 237 ASN 237 325 325 ASN ASN A . n 
A 1 238 ILE 238 326 326 ILE ILE A . n 
A 1 239 VAL 239 327 327 VAL VAL A . n 
A 1 240 THR 240 328 328 THR THR A . n 
A 1 241 GLY 241 329 329 GLY GLY A . n 
A 1 242 ASN 242 330 330 ASN ASN A . n 
A 1 243 ASP 243 331 331 ASP ASP A . n 
A 1 244 LEU 244 332 332 LEU LEU A . n 
A 1 245 GLN 245 333 333 GLN GLN A . n 
A 1 246 THR 246 334 334 THR THR A . n 
A 1 247 GLN 247 335 335 GLN GLN A . n 
A 1 248 VAL 248 336 336 VAL VAL A . n 
A 1 249 VAL 249 337 337 VAL VAL A . n 
A 1 250 ILE 250 338 338 ILE ILE A . n 
A 1 251 ASN 251 339 339 ASN ASN A . n 
A 1 252 ALA 252 340 340 ALA ALA A . n 
A 1 253 GLY 253 341 341 GLY GLY A . n 
A 1 254 VAL 254 342 342 VAL VAL A . n 
A 1 255 LEU 255 343 343 LEU LEU A . n 
A 1 256 PRO 256 344 344 PRO PRO A . n 
A 1 257 ALA 257 345 345 ALA ALA A . n 
A 1 258 LEU 258 346 346 LEU LEU A . n 
A 1 259 ARG 259 347 347 ARG ARG A . n 
A 1 260 LEU 260 348 348 LEU LEU A . n 
A 1 261 LEU 261 349 349 LEU LEU A . n 
A 1 262 LEU 262 350 350 LEU LEU A . n 
A 1 263 SER 263 351 351 SER SER A . n 
A 1 264 SER 264 352 352 SER SER A . n 
A 1 265 PRO 265 353 353 PRO PRO A . n 
A 1 266 LYS 266 354 354 LYS LYS A . n 
A 1 267 GLU 267 355 355 GLU GLU A . n 
A 1 268 ASN 268 356 356 ASN ASN A . n 
A 1 269 ILE 269 357 357 ILE ILE A . n 
A 1 270 LYS 270 358 358 LYS LYS A . n 
A 1 271 LYS 271 359 359 LYS LYS A . n 
A 1 272 GLU 272 360 360 GLU GLU A . n 
A 1 273 ALA 273 361 361 ALA ALA A . n 
A 1 274 CYS 274 362 362 CYS CYS A . n 
A 1 275 TRP 275 363 363 TRP TRP A . n 
A 1 276 THR 276 364 364 THR THR A . n 
A 1 277 ILE 277 365 365 ILE ILE A . n 
A 1 278 SER 278 366 366 SER SER A . n 
A 1 279 ASN 279 367 367 ASN ASN A . n 
A 1 280 ILE 280 368 368 ILE ILE A . n 
A 1 281 THR 281 369 369 THR THR A . n 
A 1 282 ALA 282 370 370 ALA ALA A . n 
A 1 283 GLY 283 371 371 GLY GLY A . n 
A 1 284 ASN 284 372 372 ASN ASN A . n 
A 1 285 THR 285 373 373 THR THR A . n 
A 1 286 GLU 286 374 374 GLU GLU A . n 
A 1 287 GLN 287 375 375 GLN GLN A . n 
A 1 288 ILE 288 376 376 ILE ILE A . n 
A 1 289 GLN 289 377 377 GLN GLN A . n 
A 1 290 ALA 290 378 378 ALA ALA A . n 
A 1 291 VAL 291 379 379 VAL VAL A . n 
A 1 292 ILE 292 380 380 ILE ILE A . n 
A 1 293 ASP 293 381 381 ASP ASP A . n 
A 1 294 ALA 294 382 382 ALA ALA A . n 
A 1 295 ASN 295 383 383 ASN ASN A . n 
A 1 296 LEU 296 384 384 LEU LEU A . n 
A 1 297 ILE 297 385 385 ILE ILE A . n 
A 1 298 PRO 298 386 386 PRO PRO A . n 
A 1 299 PRO 299 387 387 PRO PRO A . n 
A 1 300 LEU 300 388 388 LEU LEU A . n 
A 1 301 VAL 301 389 389 VAL VAL A . n 
A 1 302 LYS 302 390 390 LYS LYS A . n 
A 1 303 LEU 303 391 391 LEU LEU A . n 
A 1 304 LEU 304 392 392 LEU LEU A . n 
A 1 305 GLU 305 393 393 GLU GLU A . n 
A 1 306 VAL 306 394 394 VAL VAL A . n 
A 1 307 ALA 307 395 395 ALA ALA A . n 
A 1 308 GLU 308 396 396 GLU GLU A . n 
A 1 309 TYR 309 397 397 TYR TYR A . n 
A 1 310 LYS 310 398 398 LYS LYS A . n 
A 1 311 THR 311 399 399 THR THR A . n 
A 1 312 LYS 312 400 400 LYS LYS A . n 
A 1 313 LYS 313 401 401 LYS LYS A . n 
A 1 314 GLU 314 402 402 GLU GLU A . n 
A 1 315 ALA 315 403 403 ALA ALA A . n 
A 1 316 CYS 316 404 404 CYS CYS A . n 
A 1 317 TRP 317 405 405 TRP TRP A . n 
A 1 318 ALA 318 406 406 ALA ALA A . n 
A 1 319 ILE 319 407 407 ILE ILE A . n 
A 1 320 SER 320 408 408 SER SER A . n 
A 1 321 ASN 321 409 409 ASN ASN A . n 
A 1 322 ALA 322 410 410 ALA ALA A . n 
A 1 323 SER 323 411 411 SER SER A . n 
A 1 324 SER 324 412 412 SER SER A . n 
A 1 325 GLY 325 413 413 GLY GLY A . n 
A 1 326 GLY 326 414 414 GLY GLY A . n 
A 1 327 LEU 327 415 415 LEU LEU A . n 
A 1 328 GLN 328 416 416 GLN GLN A . n 
A 1 329 ARG 329 417 417 ARG ARG A . n 
A 1 330 PRO 330 418 418 PRO PRO A . n 
A 1 331 ASP 331 419 419 ASP ASP A . n 
A 1 332 ILE 332 420 420 ILE ILE A . n 
A 1 333 ILE 333 421 421 ILE ILE A . n 
A 1 334 ARG 334 422 422 ARG ARG A . n 
A 1 335 TYR 335 423 423 TYR TYR A . n 
A 1 336 LEU 336 424 424 LEU LEU A . n 
A 1 337 VAL 337 425 425 VAL VAL A . n 
A 1 338 SER 338 426 426 SER SER A . n 
A 1 339 GLN 339 427 427 GLN GLN A . n 
A 1 340 GLY 340 428 428 GLY GLY A . n 
A 1 341 CYS 341 429 429 CYS CYS A . n 
A 1 342 ILE 342 430 430 ILE ILE A . n 
A 1 343 LYS 343 431 431 LYS LYS A . n 
A 1 344 PRO 344 432 432 PRO PRO A . n 
A 1 345 LEU 345 433 433 LEU LEU A . n 
A 1 346 CYS 346 434 434 CYS CYS A . n 
A 1 347 ASP 347 435 435 ASP ASP A . n 
A 1 348 LEU 348 436 436 LEU LEU A . n 
A 1 349 LEU 349 437 437 LEU LEU A . n 
A 1 350 GLU 350 438 438 GLU GLU A . n 
A 1 351 ILE 351 439 439 ILE ILE A . n 
A 1 352 ALA 352 440 440 ALA ALA A . n 
A 1 353 ASP 353 441 441 ASP ASP A . n 
A 1 354 ASN 354 442 442 ASN ASN A . n 
A 1 355 ARG 355 443 443 ARG ARG A . n 
A 1 356 ILE 356 444 444 ILE ILE A . n 
A 1 357 ILE 357 445 445 ILE ILE A . n 
A 1 358 GLU 358 446 446 GLU GLU A . n 
A 1 359 VAL 359 447 447 VAL VAL A . n 
A 1 360 THR 360 448 448 THR THR A . n 
A 1 361 LEU 361 449 449 LEU LEU A . n 
A 1 362 ASP 362 450 450 ASP ASP A . n 
A 1 363 ALA 363 451 451 ALA ALA A . n 
A 1 364 LEU 364 452 452 LEU LEU A . n 
A 1 365 GLU 365 453 453 GLU GLU A . n 
A 1 366 ASN 366 454 454 ASN ASN A . n 
A 1 367 ILE 367 455 455 ILE ILE A . n 
A 1 368 ILE 368 456 456 ILE ILE A . n 
A 1 369 LYS 369 457 457 LYS LYS A . n 
A 1 370 MET 370 458 458 MET MET A . n 
A 1 371 GLY 371 459 459 GLY GLY A . n 
A 1 372 GLU 372 460 460 GLU GLU A . n 
A 1 373 ALA 373 461 461 ALA ALA A . n 
A 1 374 ASP 374 462 462 ASP ASP A . n 
A 1 375 LYS 375 463 463 LYS LYS A . n 
A 1 376 GLU 376 464 464 GLU GLU A . n 
A 1 377 ALA 377 465 465 ALA ALA A . n 
A 1 378 ARG 378 466 466 ARG ARG A . n 
A 1 379 GLY 379 467 467 GLY GLY A . n 
A 1 380 LEU 380 468 468 LEU LEU A . n 
A 1 381 ASN 381 469 469 ASN ASN A . n 
A 1 382 ILE 382 470 470 ILE ILE A . n 
A 1 383 ASN 383 471 471 ASN ASN A . n 
A 1 384 GLU 384 472 472 GLU GLU A . n 
A 1 385 ASN 385 473 473 ASN ASN A . n 
A 1 386 ALA 386 474 474 ALA ALA A . n 
A 1 387 ASP 387 475 475 ASP ASP A . n 
A 1 388 PHE 388 476 476 PHE PHE A . n 
A 1 389 ILE 389 477 477 ILE ILE A . n 
A 1 390 GLU 390 478 478 GLU GLU A . n 
A 1 391 LYS 391 479 479 LYS LYS A . n 
A 1 392 ALA 392 480 480 ALA ALA A . n 
A 1 393 GLY 393 481 481 GLY GLY A . n 
A 1 394 GLY 394 482 482 GLY GLY A . n 
A 1 395 MET 395 483 483 MET MET A . n 
A 1 396 GLU 396 484 484 GLU GLU A . n 
A 1 397 LYS 397 485 485 LYS LYS A . n 
A 1 398 ILE 398 486 486 ILE ILE A . n 
A 1 399 PHE 399 487 487 PHE PHE A . n 
A 1 400 ASN 400 488 488 ASN ASN A . n 
A 1 401 CYS 401 489 489 CYS CYS A . n 
A 1 402 GLN 402 490 490 GLN GLN A . n 
A 1 403 GLN 403 491 491 GLN GLN A . n 
A 1 404 ASN 404 492 492 ASN ASN A . n 
A 1 405 GLU 405 493 493 GLU GLU A . n 
A 1 406 ASN 406 494 494 ASN ASN A . n 
A 1 407 ASP 407 495 495 ASP ASP A . n 
A 1 408 LYS 408 496 496 LYS LYS A . n 
A 1 409 ILE 409 497 497 ILE ILE A . n 
A 1 410 TYR 410 498 498 TYR TYR A . n 
A 1 411 GLU 411 499 499 GLU GLU A . n 
A 1 412 LYS 412 500 500 LYS LYS A . n 
A 1 413 ALA 413 501 501 ALA ALA A . n 
A 1 414 TYR 414 502 502 TYR TYR A . n 
A 1 415 LYS 415 503 503 LYS LYS A . n 
A 1 416 ILE 416 504 504 ILE ILE A . n 
A 1 417 ILE 417 505 505 ILE ILE A . n 
A 1 418 GLU 418 506 506 GLU GLU A . n 
A 1 419 THR 419 507 507 THR THR A . n 
A 1 420 TYR 420 508 508 TYR TYR A . n 
A 1 421 PHE 421 509 509 PHE PHE A . n 
A 1 422 GLY 422 510 510 GLY GLY A . n 
B 2 1   LYS 1   127 127 LYS LYS C . n 
B 2 2   LYS 2   128 128 LYS LYS C . n 
B 2 3   LYS 3   129 129 LYS LYS C . n 
B 2 4   ARG 4   130 130 ARG ARG C . n 
B 2 5   LYS 5   131 131 LYS LYS C . n 
B 2 6   VAL 6   132 132 VAL VAL C . n 
C 3 1   ALA 1   127 127 ALA ALA D . n 
C 3 2   LYS 2   128 128 LYS LYS D . n 
C 3 3   LYS 3   129 129 LYS LYS D . n 
C 3 4   ALA 4   130 130 ALA ALA D . n 
C 3 5   ALA 5   131 131 ALA ALA D . n 
D 1 1   LEU 1   89  89  LEU LEU B . n 
D 1 2   PRO 2   90  90  PRO PRO B . n 
D 1 3   GLN 3   91  91  GLN GLN B . n 
D 1 4   MET 4   92  92  MET MET B . n 
D 1 5   THR 5   93  93  THR THR B . n 
D 1 6   GLN 6   94  94  GLN GLN B . n 
D 1 7   GLN 7   95  95  GLN GLN B . n 
D 1 8   LEU 8   96  96  LEU LEU B . n 
D 1 9   ASN 9   97  97  ASN ASN B . n 
D 1 10  SER 10  98  98  SER SER B . n 
D 1 11  ASP 11  99  99  ASP ASP B . n 
D 1 12  ASP 12  100 100 ASP ASP B . n 
D 1 13  MET 13  101 101 MET MET B . n 
D 1 14  GLN 14  102 102 GLN GLN B . n 
D 1 15  GLU 15  103 103 GLU GLU B . n 
D 1 16  GLN 16  104 104 GLN GLN B . n 
D 1 17  LEU 17  105 105 LEU LEU B . n 
D 1 18  SER 18  106 106 SER SER B . n 
D 1 19  ALA 19  107 107 ALA ALA B . n 
D 1 20  THR 20  108 108 THR THR B . n 
D 1 21  VAL 21  109 109 VAL VAL B . n 
D 1 22  LYS 22  110 110 LYS LYS B . n 
D 1 23  PHE 23  111 111 PHE PHE B . n 
D 1 24  ARG 24  112 112 ARG ARG B . n 
D 1 25  GLN 25  113 113 GLN GLN B . n 
D 1 26  ILE 26  114 114 ILE ILE B . n 
D 1 27  LEU 27  115 115 LEU LEU B . n 
D 1 28  SER 28  116 116 SER SER B . n 
D 1 29  ARG 29  117 117 ARG ARG B . n 
D 1 30  GLU 30  118 118 GLU GLU B . n 
D 1 31  HIS 31  119 119 HIS HIS B . n 
D 1 32  ARG 32  120 120 ARG ARG B . n 
D 1 33  PRO 33  121 121 PRO PRO B . n 
D 1 34  PRO 34  122 122 PRO PRO B . n 
D 1 35  ILE 35  123 123 ILE ILE B . n 
D 1 36  ASP 36  124 124 ASP ASP B . n 
D 1 37  VAL 37  125 125 VAL VAL B . n 
D 1 38  VAL 38  126 126 VAL VAL B . n 
D 1 39  ILE 39  127 127 ILE ILE B . n 
D 1 40  GLN 40  128 128 GLN GLN B . n 
D 1 41  ALA 41  129 129 ALA ALA B . n 
D 1 42  GLY 42  130 130 GLY GLY B . n 
D 1 43  VAL 43  131 131 VAL VAL B . n 
D 1 44  VAL 44  132 132 VAL VAL B . n 
D 1 45  PRO 45  133 133 PRO PRO B . n 
D 1 46  ARG 46  134 134 ARG ARG B . n 
D 1 47  LEU 47  135 135 LEU LEU B . n 
D 1 48  VAL 48  136 136 VAL VAL B . n 
D 1 49  GLU 49  137 137 GLU GLU B . n 
D 1 50  PHE 50  138 138 PHE PHE B . n 
D 1 51  MET 51  139 139 MET MET B . n 
D 1 52  ARG 52  140 140 ARG ARG B . n 
D 1 53  GLU 53  141 141 GLU GLU B . n 
D 1 54  ASN 54  142 142 ASN ASN B . n 
D 1 55  GLN 55  143 143 GLN GLN B . n 
D 1 56  PRO 56  144 144 PRO PRO B . n 
D 1 57  GLU 57  145 145 GLU GLU B . n 
D 1 58  MET 58  146 146 MET MET B . n 
D 1 59  LEU 59  147 147 LEU LEU B . n 
D 1 60  GLN 60  148 148 GLN GLN B . n 
D 1 61  LEU 61  149 149 LEU LEU B . n 
D 1 62  GLU 62  150 150 GLU GLU B . n 
D 1 63  ALA 63  151 151 ALA ALA B . n 
D 1 64  ALA 64  152 152 ALA ALA B . n 
D 1 65  TRP 65  153 153 TRP TRP B . n 
D 1 66  ALA 66  154 154 ALA ALA B . n 
D 1 67  LEU 67  155 155 LEU LEU B . n 
D 1 68  THR 68  156 156 THR THR B . n 
D 1 69  ASN 69  157 157 ASN ASN B . n 
D 1 70  ILE 70  158 158 ILE ILE B . n 
D 1 71  ALA 71  159 159 ALA ALA B . n 
D 1 72  SER 72  160 160 SER SER B . n 
D 1 73  GLY 73  161 161 GLY GLY B . n 
D 1 74  THR 74  162 162 THR THR B . n 
D 1 75  SER 75  163 163 SER SER B . n 
D 1 76  ALA 76  164 164 ALA ALA B . n 
D 1 77  GLN 77  165 165 GLN GLN B . n 
D 1 78  THR 78  166 166 THR THR B . n 
D 1 79  LYS 79  167 167 LYS LYS B . n 
D 1 80  VAL 80  168 168 VAL VAL B . n 
D 1 81  VAL 81  169 169 VAL VAL B . n 
D 1 82  VAL 82  170 170 VAL VAL B . n 
D 1 83  ASP 83  171 171 ASP ASP B . n 
D 1 84  ALA 84  172 172 ALA ALA B . n 
D 1 85  ASP 85  173 173 ASP ASP B . n 
D 1 86  ALA 86  174 174 ALA ALA B . n 
D 1 87  VAL 87  175 175 VAL VAL B . n 
D 1 88  PRO 88  176 176 PRO PRO B . n 
D 1 89  LEU 89  177 177 LEU LEU B . n 
D 1 90  PHE 90  178 178 PHE PHE B . n 
D 1 91  ILE 91  179 179 ILE ILE B . n 
D 1 92  GLN 92  180 180 GLN GLN B . n 
D 1 93  LEU 93  181 181 LEU LEU B . n 
D 1 94  LEU 94  182 182 LEU LEU B . n 
D 1 95  TYR 95  183 183 TYR TYR B . n 
D 1 96  THR 96  184 184 THR THR B . n 
D 1 97  GLY 97  185 185 GLY GLY B . n 
D 1 98  SER 98  186 186 SER SER B . n 
D 1 99  VAL 99  187 187 VAL VAL B . n 
D 1 100 GLU 100 188 188 GLU GLU B . n 
D 1 101 VAL 101 189 189 VAL VAL B . n 
D 1 102 LYS 102 190 190 LYS LYS B . n 
D 1 103 GLU 103 191 191 GLU GLU B . n 
D 1 104 GLN 104 192 192 GLN GLN B . n 
D 1 105 ALA 105 193 193 ALA ALA B . n 
D 1 106 ILE 106 194 194 ILE ILE B . n 
D 1 107 TRP 107 195 195 TRP TRP B . n 
D 1 108 ALA 108 196 196 ALA ALA B . n 
D 1 109 LEU 109 197 197 LEU LEU B . n 
D 1 110 GLY 110 198 198 GLY GLY B . n 
D 1 111 ASN 111 199 199 ASN ASN B . n 
D 1 112 VAL 112 200 200 VAL VAL B . n 
D 1 113 ALA 113 201 201 ALA ALA B . n 
D 1 114 GLY 114 202 202 GLY GLY B . n 
D 1 115 ASP 115 203 203 ASP ASP B . n 
D 1 116 SER 116 204 204 SER SER B . n 
D 1 117 THR 117 205 205 THR THR B . n 
D 1 118 ASP 118 206 206 ASP ASP B . n 
D 1 119 TYR 119 207 207 TYR TYR B . n 
D 1 120 ARG 120 208 208 ARG ARG B . n 
D 1 121 ASP 121 209 209 ASP ASP B . n 
D 1 122 TYR 122 210 210 TYR TYR B . n 
D 1 123 VAL 123 211 211 VAL VAL B . n 
D 1 124 LEU 124 212 212 LEU LEU B . n 
D 1 125 GLN 125 213 213 GLN GLN B . n 
D 1 126 CYS 126 214 214 CYS CYS B . n 
D 1 127 ASN 127 215 215 ASN ASN B . n 
D 1 128 ALA 128 216 216 ALA ALA B . n 
D 1 129 MET 129 217 217 MET MET B . n 
D 1 130 GLU 130 218 218 GLU GLU B . n 
D 1 131 PRO 131 219 219 PRO PRO B . n 
D 1 132 ILE 132 220 220 ILE ILE B . n 
D 1 133 LEU 133 221 221 LEU LEU B . n 
D 1 134 GLY 134 222 222 GLY GLY B . n 
D 1 135 LEU 135 223 223 LEU LEU B . n 
D 1 136 PHE 136 224 224 PHE PHE B . n 
D 1 137 ASN 137 225 225 ASN ASN B . n 
D 1 138 SER 138 226 226 SER SER B . n 
D 1 139 ASN 139 227 227 ASN ASN B . n 
D 1 140 LYS 140 228 228 LYS LYS B . n 
D 1 141 PRO 141 229 229 PRO PRO B . n 
D 1 142 SER 142 230 230 SER SER B . n 
D 1 143 LEU 143 231 231 LEU LEU B . n 
D 1 144 ILE 144 232 232 ILE ILE B . n 
D 1 145 ARG 145 233 233 ARG ARG B . n 
D 1 146 THR 146 234 234 THR THR B . n 
D 1 147 ALA 147 235 235 ALA ALA B . n 
D 1 148 THR 148 236 236 THR THR B . n 
D 1 149 TRP 149 237 237 TRP TRP B . n 
D 1 150 THR 150 238 238 THR THR B . n 
D 1 151 LEU 151 239 239 LEU LEU B . n 
D 1 152 SER 152 240 240 SER SER B . n 
D 1 153 ASN 153 241 241 ASN ASN B . n 
D 1 154 LEU 154 242 242 LEU LEU B . n 
D 1 155 CYS 155 243 243 CYS CYS B . n 
D 1 156 ARG 156 244 244 ARG ARG B . n 
D 1 157 GLY 157 245 245 GLY GLY B . n 
D 1 158 LYS 158 246 246 LYS LYS B . n 
D 1 159 LYS 159 247 247 LYS LYS B . n 
D 1 160 PRO 160 248 248 PRO PRO B . n 
D 1 161 GLN 161 249 249 GLN GLN B . n 
D 1 162 PRO 162 250 250 PRO PRO B . n 
D 1 163 ASP 163 251 251 ASP ASP B . n 
D 1 164 TRP 164 252 252 TRP TRP B . n 
D 1 165 SER 165 253 253 SER SER B . n 
D 1 166 VAL 166 254 254 VAL VAL B . n 
D 1 167 VAL 167 255 255 VAL VAL B . n 
D 1 168 SER 168 256 256 SER SER B . n 
D 1 169 GLN 169 257 257 GLN GLN B . n 
D 1 170 ALA 170 258 258 ALA ALA B . n 
D 1 171 LEU 171 259 259 LEU LEU B . n 
D 1 172 PRO 172 260 260 PRO PRO B . n 
D 1 173 THR 173 261 261 THR THR B . n 
D 1 174 LEU 174 262 262 LEU LEU B . n 
D 1 175 ALA 175 263 263 ALA ALA B . n 
D 1 176 LYS 176 264 264 LYS LYS B . n 
D 1 177 LEU 177 265 265 LEU LEU B . n 
D 1 178 ILE 178 266 266 ILE ILE B . n 
D 1 179 TYR 179 267 267 TYR TYR B . n 
D 1 180 SER 180 268 268 SER SER B . n 
D 1 181 MET 181 269 269 MET MET B . n 
D 1 182 ASP 182 270 270 ASP ASP B . n 
D 1 183 THR 183 271 271 THR THR B . n 
D 1 184 GLU 184 272 272 GLU GLU B . n 
D 1 185 THR 185 273 273 THR THR B . n 
D 1 186 LEU 186 274 274 LEU LEU B . n 
D 1 187 VAL 187 275 275 VAL VAL B . n 
D 1 188 ASP 188 276 276 ASP ASP B . n 
D 1 189 ALA 189 277 277 ALA ALA B . n 
D 1 190 CYS 190 278 278 CYS CYS B . n 
D 1 191 TRP 191 279 279 TRP TRP B . n 
D 1 192 ALA 192 280 280 ALA ALA B . n 
D 1 193 ILE 193 281 281 ILE ILE B . n 
D 1 194 SER 194 282 282 SER SER B . n 
D 1 195 TYR 195 283 283 TYR TYR B . n 
D 1 196 LEU 196 284 284 LEU LEU B . n 
D 1 197 SER 197 285 285 SER SER B . n 
D 1 198 ASP 198 286 286 ASP ASP B . n 
D 1 199 GLY 199 287 287 GLY GLY B . n 
D 1 200 PRO 200 288 288 PRO PRO B . n 
D 1 201 GLN 201 289 289 GLN GLN B . n 
D 1 202 GLU 202 290 290 GLU GLU B . n 
D 1 203 ALA 203 291 291 ALA ALA B . n 
D 1 204 ILE 204 292 292 ILE ILE B . n 
D 1 205 GLN 205 293 293 GLN GLN B . n 
D 1 206 ALA 206 294 294 ALA ALA B . n 
D 1 207 VAL 207 295 295 VAL VAL B . n 
D 1 208 ILE 208 296 296 ILE ILE B . n 
D 1 209 ASP 209 297 297 ASP ASP B . n 
D 1 210 VAL 210 298 298 VAL VAL B . n 
D 1 211 ARG 211 299 299 ARG ARG B . n 
D 1 212 ILE 212 300 300 ILE ILE B . n 
D 1 213 PRO 213 301 301 PRO PRO B . n 
D 1 214 LYS 214 302 302 LYS LYS B . n 
D 1 215 ARG 215 303 303 ARG ARG B . n 
D 1 216 LEU 216 304 304 LEU LEU B . n 
D 1 217 VAL 217 305 305 VAL VAL B . n 
D 1 218 GLU 218 306 306 GLU GLU B . n 
D 1 219 LEU 219 307 307 LEU LEU B . n 
D 1 220 LEU 220 308 308 LEU LEU B . n 
D 1 221 SER 221 309 309 SER SER B . n 
D 1 222 HIS 222 310 310 HIS HIS B . n 
D 1 223 GLU 223 311 311 GLU GLU B . n 
D 1 224 SER 224 312 312 SER SER B . n 
D 1 225 THR 225 313 313 THR THR B . n 
D 1 226 LEU 226 314 314 LEU LEU B . n 
D 1 227 VAL 227 315 315 VAL VAL B . n 
D 1 228 GLN 228 316 316 GLN GLN B . n 
D 1 229 THR 229 317 317 THR THR B . n 
D 1 230 PRO 230 318 318 PRO PRO B . n 
D 1 231 ALA 231 319 319 ALA ALA B . n 
D 1 232 LEU 232 320 320 LEU LEU B . n 
D 1 233 ARG 233 321 321 ARG ARG B . n 
D 1 234 ALA 234 322 322 ALA ALA B . n 
D 1 235 VAL 235 323 323 VAL VAL B . n 
D 1 236 GLY 236 324 324 GLY GLY B . n 
D 1 237 ASN 237 325 325 ASN ASN B . n 
D 1 238 ILE 238 326 326 ILE ILE B . n 
D 1 239 VAL 239 327 327 VAL VAL B . n 
D 1 240 THR 240 328 328 THR THR B . n 
D 1 241 GLY 241 329 329 GLY GLY B . n 
D 1 242 ASN 242 330 330 ASN ASN B . n 
D 1 243 ASP 243 331 331 ASP ASP B . n 
D 1 244 LEU 244 332 332 LEU LEU B . n 
D 1 245 GLN 245 333 333 GLN GLN B . n 
D 1 246 THR 246 334 334 THR THR B . n 
D 1 247 GLN 247 335 335 GLN GLN B . n 
D 1 248 VAL 248 336 336 VAL VAL B . n 
D 1 249 VAL 249 337 337 VAL VAL B . n 
D 1 250 ILE 250 338 338 ILE ILE B . n 
D 1 251 ASN 251 339 339 ASN ASN B . n 
D 1 252 ALA 252 340 340 ALA ALA B . n 
D 1 253 GLY 253 341 341 GLY GLY B . n 
D 1 254 VAL 254 342 342 VAL VAL B . n 
D 1 255 LEU 255 343 343 LEU LEU B . n 
D 1 256 PRO 256 344 344 PRO PRO B . n 
D 1 257 ALA 257 345 345 ALA ALA B . n 
D 1 258 LEU 258 346 346 LEU LEU B . n 
D 1 259 ARG 259 347 347 ARG ARG B . n 
D 1 260 LEU 260 348 348 LEU LEU B . n 
D 1 261 LEU 261 349 349 LEU LEU B . n 
D 1 262 LEU 262 350 350 LEU LEU B . n 
D 1 263 SER 263 351 351 SER SER B . n 
D 1 264 SER 264 352 352 SER SER B . n 
D 1 265 PRO 265 353 353 PRO PRO B . n 
D 1 266 LYS 266 354 354 LYS LYS B . n 
D 1 267 GLU 267 355 355 GLU GLU B . n 
D 1 268 ASN 268 356 356 ASN ASN B . n 
D 1 269 ILE 269 357 357 ILE ILE B . n 
D 1 270 LYS 270 358 358 LYS LYS B . n 
D 1 271 LYS 271 359 359 LYS LYS B . n 
D 1 272 GLU 272 360 360 GLU GLU B . n 
D 1 273 ALA 273 361 361 ALA ALA B . n 
D 1 274 CYS 274 362 362 CYS CYS B . n 
D 1 275 TRP 275 363 363 TRP TRP B . n 
D 1 276 THR 276 364 364 THR THR B . n 
D 1 277 ILE 277 365 365 ILE ILE B . n 
D 1 278 SER 278 366 366 SER SER B . n 
D 1 279 ASN 279 367 367 ASN ASN B . n 
D 1 280 ILE 280 368 368 ILE ILE B . n 
D 1 281 THR 281 369 369 THR THR B . n 
D 1 282 ALA 282 370 370 ALA ALA B . n 
D 1 283 GLY 283 371 371 GLY GLY B . n 
D 1 284 ASN 284 372 372 ASN ASN B . n 
D 1 285 THR 285 373 373 THR THR B . n 
D 1 286 GLU 286 374 374 GLU GLU B . n 
D 1 287 GLN 287 375 375 GLN GLN B . n 
D 1 288 ILE 288 376 376 ILE ILE B . n 
D 1 289 GLN 289 377 377 GLN GLN B . n 
D 1 290 ALA 290 378 378 ALA ALA B . n 
D 1 291 VAL 291 379 379 VAL VAL B . n 
D 1 292 ILE 292 380 380 ILE ILE B . n 
D 1 293 ASP 293 381 381 ASP ASP B . n 
D 1 294 ALA 294 382 382 ALA ALA B . n 
D 1 295 ASN 295 383 383 ASN ASN B . n 
D 1 296 LEU 296 384 384 LEU LEU B . n 
D 1 297 ILE 297 385 385 ILE ILE B . n 
D 1 298 PRO 298 386 386 PRO PRO B . n 
D 1 299 PRO 299 387 387 PRO PRO B . n 
D 1 300 LEU 300 388 388 LEU LEU B . n 
D 1 301 VAL 301 389 389 VAL VAL B . n 
D 1 302 LYS 302 390 390 LYS LYS B . n 
D 1 303 LEU 303 391 391 LEU LEU B . n 
D 1 304 LEU 304 392 392 LEU LEU B . n 
D 1 305 GLU 305 393 393 GLU GLU B . n 
D 1 306 VAL 306 394 394 VAL VAL B . n 
D 1 307 ALA 307 395 395 ALA ALA B . n 
D 1 308 GLU 308 396 396 GLU GLU B . n 
D 1 309 TYR 309 397 397 TYR TYR B . n 
D 1 310 LYS 310 398 398 LYS LYS B . n 
D 1 311 THR 311 399 399 THR THR B . n 
D 1 312 LYS 312 400 400 LYS LYS B . n 
D 1 313 LYS 313 401 401 LYS LYS B . n 
D 1 314 GLU 314 402 402 GLU GLU B . n 
D 1 315 ALA 315 403 403 ALA ALA B . n 
D 1 316 CYS 316 404 404 CYS CYS B . n 
D 1 317 TRP 317 405 405 TRP TRP B . n 
D 1 318 ALA 318 406 406 ALA ALA B . n 
D 1 319 ILE 319 407 407 ILE ILE B . n 
D 1 320 SER 320 408 408 SER SER B . n 
D 1 321 ASN 321 409 409 ASN ASN B . n 
D 1 322 ALA 322 410 410 ALA ALA B . n 
D 1 323 SER 323 411 411 SER SER B . n 
D 1 324 SER 324 412 412 SER SER B . n 
D 1 325 GLY 325 413 413 GLY GLY B . n 
D 1 326 GLY 326 414 414 GLY GLY B . n 
D 1 327 LEU 327 415 415 LEU LEU B . n 
D 1 328 GLN 328 416 416 GLN GLN B . n 
D 1 329 ARG 329 417 417 ARG ARG B . n 
D 1 330 PRO 330 418 418 PRO PRO B . n 
D 1 331 ASP 331 419 419 ASP ASP B . n 
D 1 332 ILE 332 420 420 ILE ILE B . n 
D 1 333 ILE 333 421 421 ILE ILE B . n 
D 1 334 ARG 334 422 422 ARG ARG B . n 
D 1 335 TYR 335 423 423 TYR TYR B . n 
D 1 336 LEU 336 424 424 LEU LEU B . n 
D 1 337 VAL 337 425 425 VAL VAL B . n 
D 1 338 SER 338 426 426 SER SER B . n 
D 1 339 GLN 339 427 427 GLN GLN B . n 
D 1 340 GLY 340 428 428 GLY GLY B . n 
D 1 341 CYS 341 429 429 CYS CYS B . n 
D 1 342 ILE 342 430 430 ILE ILE B . n 
D 1 343 LYS 343 431 431 LYS LYS B . n 
D 1 344 PRO 344 432 432 PRO PRO B . n 
D 1 345 LEU 345 433 433 LEU LEU B . n 
D 1 346 CYS 346 434 434 CYS CYS B . n 
D 1 347 ASP 347 435 435 ASP ASP B . n 
D 1 348 LEU 348 436 436 LEU LEU B . n 
D 1 349 LEU 349 437 437 LEU LEU B . n 
D 1 350 GLU 350 438 438 GLU GLU B . n 
D 1 351 ILE 351 439 439 ILE ILE B . n 
D 1 352 ALA 352 440 440 ALA ALA B . n 
D 1 353 ASP 353 441 441 ASP ASP B . n 
D 1 354 ASN 354 442 442 ASN ASN B . n 
D 1 355 ARG 355 443 443 ARG ARG B . n 
D 1 356 ILE 356 444 444 ILE ILE B . n 
D 1 357 ILE 357 445 445 ILE ILE B . n 
D 1 358 GLU 358 446 446 GLU GLU B . n 
D 1 359 VAL 359 447 447 VAL VAL B . n 
D 1 360 THR 360 448 448 THR THR B . n 
D 1 361 LEU 361 449 449 LEU LEU B . n 
D 1 362 ASP 362 450 450 ASP ASP B . n 
D 1 363 ALA 363 451 451 ALA ALA B . n 
D 1 364 LEU 364 452 452 LEU LEU B . n 
D 1 365 GLU 365 453 453 GLU GLU B . n 
D 1 366 ASN 366 454 454 ASN ASN B . n 
D 1 367 ILE 367 455 455 ILE ILE B . n 
D 1 368 ILE 368 456 456 ILE ILE B . n 
D 1 369 LYS 369 457 457 LYS LYS B . n 
D 1 370 MET 370 458 458 MET MET B . n 
D 1 371 GLY 371 459 459 GLY GLY B . n 
D 1 372 GLU 372 460 460 GLU GLU B . n 
D 1 373 ALA 373 461 461 ALA ALA B . n 
D 1 374 ASP 374 462 462 ASP ASP B . n 
D 1 375 LYS 375 463 463 LYS LYS B . n 
D 1 376 GLU 376 464 464 GLU GLU B . n 
D 1 377 ALA 377 465 465 ALA ALA B . n 
D 1 378 ARG 378 466 466 ARG ARG B . n 
D 1 379 GLY 379 467 467 GLY GLY B . n 
D 1 380 LEU 380 468 468 LEU LEU B . n 
D 1 381 ASN 381 469 469 ASN ASN B . n 
D 1 382 ILE 382 470 470 ILE ILE B . n 
D 1 383 ASN 383 471 471 ASN ASN B . n 
D 1 384 GLU 384 472 472 GLU GLU B . n 
D 1 385 ASN 385 473 473 ASN ASN B . n 
D 1 386 ALA 386 474 474 ALA ALA B . n 
D 1 387 ASP 387 475 475 ASP ASP B . n 
D 1 388 PHE 388 476 476 PHE PHE B . n 
D 1 389 ILE 389 477 477 ILE ILE B . n 
D 1 390 GLU 390 478 478 GLU GLU B . n 
D 1 391 LYS 391 479 479 LYS LYS B . n 
D 1 392 ALA 392 480 480 ALA ALA B . n 
D 1 393 GLY 393 481 481 GLY GLY B . n 
D 1 394 GLY 394 482 482 GLY GLY B . n 
D 1 395 MET 395 483 483 MET MET B . n 
D 1 396 GLU 396 484 484 GLU GLU B . n 
D 1 397 LYS 397 485 485 LYS LYS B . n 
D 1 398 ILE 398 486 486 ILE ILE B . n 
D 1 399 PHE 399 487 487 PHE PHE B . n 
D 1 400 ASN 400 488 488 ASN ASN B . n 
D 1 401 CYS 401 489 489 CYS CYS B . n 
D 1 402 GLN 402 490 490 GLN GLN B . n 
D 1 403 GLN 403 491 491 GLN GLN B . n 
D 1 404 ASN 404 492 492 ASN ASN B . n 
D 1 405 GLU 405 493 493 GLU GLU B . n 
D 1 406 ASN 406 494 494 ASN ASN B . n 
D 1 407 ASP 407 495 495 ASP ASP B . n 
D 1 408 LYS 408 496 496 LYS LYS B . n 
D 1 409 ILE 409 497 497 ILE ILE B . n 
D 1 410 TYR 410 498 498 TYR TYR B . n 
D 1 411 GLU 411 499 499 GLU GLU B . n 
D 1 412 LYS 412 500 500 LYS LYS B . n 
D 1 413 ALA 413 501 501 ALA ALA B . n 
D 1 414 TYR 414 502 502 TYR TYR B . n 
D 1 415 LYS 415 503 503 LYS LYS B . n 
D 1 416 ILE 416 504 504 ILE ILE B . n 
D 1 417 ILE 417 505 505 ILE ILE B . n 
D 1 418 GLU 418 506 506 GLU GLU B . n 
D 1 419 THR 419 507 507 THR THR B . n 
D 1 420 TYR 420 508 508 TYR TYR B . n 
D 1 421 PHE 421 509 509 PHE PHE B . n 
D 1 422 GLY 422 510 510 GLY GLY B . n 
E 2 1   LYS 1   127 127 LYS LYS E . n 
E 2 2   LYS 2   128 128 LYS LYS E . n 
E 2 3   LYS 3   129 129 LYS LYS E . n 
E 2 4   ARG 4   130 130 ARG ARG E . n 
E 2 5   LYS 5   131 131 LYS LYS E . n 
E 2 6   VAL 6   132 132 VAL VAL E . n 
F 3 1   ALA 1   127 127 ALA ALA F . n 
F 3 2   LYS 2   128 128 LYS LYS F . n 
F 3 3   LYS 3   129 129 LYS LYS F . n 
F 3 4   ALA 4   130 130 ALA ALA F . n 
F 3 5   ALA 5   131 131 ALA ALA F . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G 
2 1 D,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-01-13 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       0.2 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          0.2 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 B GLN 249 ? ? O B HOH 1 ? ? 2.12 
2 1 OE1 B GLU 191 ? ? O B HOH 4 ? ? 2.15 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N A LYS 247 ? ? CA A LYS 247 ? ? C  A LYS 247 ? ? 93.89  111.00 -17.11 2.70 N 
2 1 C A LYS 247 ? ? N  A PRO 248 ? ? CA A PRO 248 ? ? 108.17 119.30 -11.13 1.50 Y 
3 1 C A LYS 247 ? ? N  A PRO 248 ? ? CD A PRO 248 ? ? 141.37 128.40 12.97  2.10 Y 
4 1 N B LYS 247 ? ? CA B LYS 247 ? ? C  B LYS 247 ? ? 94.62  111.00 -16.38 2.70 N 
5 1 C B LYS 247 ? ? N  B PRO 248 ? ? CA B PRO 248 ? ? 107.37 119.30 -11.93 1.50 Y 
6 1 C B LYS 247 ? ? N  B PRO 248 ? ? CD B PRO 248 ? ? 142.30 128.40 13.90  2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 117 ? ? -56.25 -179.49 
2  1 HIS A 119 ? ? -88.76 -148.43 
3  1 PRO A 122 ? ? -69.24 68.12   
4  1 SER A 186 ? ? -68.83 -171.09 
5  1 LYS A 247 ? ? -71.79 -125.07 
6  1 ASP A 251 ? ? -51.15 106.82  
7  1 VAL A 254 ? ? -92.27 -63.25  
8  1 ASP A 286 ? ? -73.95 25.51   
9  1 VAL A 327 ? ? -62.56 5.56    
10 1 ASN A 383 ? ? 74.93  43.83   
11 1 GLU A 464 ? ? -67.14 -81.41  
12 1 ALA A 465 ? ? -36.11 -76.37  
13 1 ARG A 466 ? ? -59.69 -1.66   
14 1 CYS A 489 ? ? -66.97 0.91    
15 1 ARG B 117 ? ? -59.75 179.16  
16 1 HIS B 119 ? ? -87.86 -148.88 
17 1 PRO B 122 ? ? -67.76 68.51   
18 1 SER B 186 ? ? -65.65 -170.06 
19 1 LYS B 247 ? ? -71.98 -123.59 
20 1 ASP B 251 ? ? -54.74 106.43  
21 1 VAL B 254 ? ? -93.05 -62.74  
22 1 ASP B 286 ? ? -73.59 26.67   
23 1 VAL B 327 ? ? -65.71 2.64    
24 1 ASN B 383 ? ? 75.84  46.51   
25 1 GLU B 464 ? ? -67.44 -80.46  
26 1 ALA B 465 ? ? -38.12 -75.33  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LEU 89  ? CG  ? A LEU 1   CG  
2   1 Y 1 A LEU 89  ? CD1 ? A LEU 1   CD1 
3   1 Y 1 A LEU 89  ? CD2 ? A LEU 1   CD2 
4   1 Y 1 A GLN 91  ? CG  ? A GLN 3   CG  
5   1 Y 1 A GLN 91  ? CD  ? A GLN 3   CD  
6   1 Y 1 A GLN 91  ? OE1 ? A GLN 3   OE1 
7   1 Y 1 A GLN 91  ? NE2 ? A GLN 3   NE2 
8   1 Y 1 A GLU 103 ? CD  ? A GLU 15  CD  
9   1 Y 1 A GLU 103 ? OE1 ? A GLU 15  OE1 
10  1 Y 1 A GLU 103 ? OE2 ? A GLU 15  OE2 
11  1 Y 1 A LYS 110 ? CD  ? A LYS 22  CD  
12  1 Y 1 A LYS 110 ? CE  ? A LYS 22  CE  
13  1 Y 1 A LYS 110 ? NZ  ? A LYS 22  NZ  
14  1 Y 1 A GLU 118 ? CG  ? A GLU 30  CG  
15  1 Y 1 A GLU 118 ? CD  ? A GLU 30  CD  
16  1 Y 1 A GLU 118 ? OE1 ? A GLU 30  OE1 
17  1 Y 1 A GLU 118 ? OE2 ? A GLU 30  OE2 
18  1 Y 1 A HIS 119 ? CG  ? A HIS 31  CG  
19  1 Y 1 A HIS 119 ? ND1 ? A HIS 31  ND1 
20  1 Y 1 A HIS 119 ? CD2 ? A HIS 31  CD2 
21  1 Y 1 A HIS 119 ? CE1 ? A HIS 31  CE1 
22  1 Y 1 A HIS 119 ? NE2 ? A HIS 31  NE2 
23  1 Y 1 A ARG 120 ? CG  ? A ARG 32  CG  
24  1 Y 1 A ARG 120 ? CD  ? A ARG 32  CD  
25  1 Y 1 A ARG 120 ? NE  ? A ARG 32  NE  
26  1 Y 1 A ARG 120 ? CZ  ? A ARG 32  CZ  
27  1 Y 1 A ARG 120 ? NH1 ? A ARG 32  NH1 
28  1 Y 1 A ARG 120 ? NH2 ? A ARG 32  NH2 
29  1 Y 1 A GLU 141 ? CD  ? A GLU 53  CD  
30  1 Y 1 A GLU 141 ? OE1 ? A GLU 53  OE1 
31  1 Y 1 A GLU 141 ? OE2 ? A GLU 53  OE2 
32  1 Y 1 A ASN 215 ? OD1 ? A ASN 127 OD1 
33  1 Y 1 A ASN 215 ? ND2 ? A ASN 127 ND2 
34  1 Y 1 A GLU 218 ? CG  ? A GLU 130 CG  
35  1 Y 1 A GLU 218 ? CD  ? A GLU 130 CD  
36  1 Y 1 A GLU 218 ? OE1 ? A GLU 130 OE1 
37  1 Y 1 A GLU 218 ? OE2 ? A GLU 130 OE2 
38  1 Y 1 A ASN 225 ? CG  ? A ASN 137 CG  
39  1 Y 1 A ASN 225 ? OD1 ? A ASN 137 OD1 
40  1 Y 1 A ASN 225 ? ND2 ? A ASN 137 ND2 
41  1 Y 1 A ASN 227 ? CG  ? A ASN 139 CG  
42  1 Y 1 A ASN 227 ? OD1 ? A ASN 139 OD1 
43  1 Y 1 A ASN 227 ? ND2 ? A ASN 139 ND2 
44  1 Y 1 A LYS 247 ? CG  ? A LYS 159 CG  
45  1 Y 1 A LYS 247 ? CD  ? A LYS 159 CD  
46  1 Y 1 A LYS 247 ? CE  ? A LYS 159 CE  
47  1 Y 1 A LYS 247 ? NZ  ? A LYS 159 NZ  
48  1 Y 1 A LYS 264 ? CD  ? A LYS 176 CD  
49  1 Y 1 A LYS 264 ? CE  ? A LYS 176 CE  
50  1 Y 1 A LYS 264 ? NZ  ? A LYS 176 NZ  
51  1 Y 1 A GLU 290 ? CG  ? A GLU 202 CG  
52  1 Y 1 A GLU 290 ? CD  ? A GLU 202 CD  
53  1 Y 1 A GLU 290 ? OE1 ? A GLU 202 OE1 
54  1 Y 1 A GLU 290 ? OE2 ? A GLU 202 OE2 
55  1 Y 1 A LEU 348 ? CD1 ? A LEU 260 CD1 
56  1 Y 1 A LEU 348 ? CD2 ? A LEU 260 CD2 
57  1 Y 1 A LYS 354 ? CD  ? A LYS 266 CD  
58  1 Y 1 A LYS 354 ? CE  ? A LYS 266 CE  
59  1 Y 1 A LYS 354 ? NZ  ? A LYS 266 NZ  
60  1 Y 1 A GLU 374 ? CG  ? A GLU 286 CG  
61  1 Y 1 A GLU 374 ? CD  ? A GLU 286 CD  
62  1 Y 1 A GLU 374 ? OE1 ? A GLU 286 OE1 
63  1 Y 1 A GLU 374 ? OE2 ? A GLU 286 OE2 
64  1 Y 1 A LEU 415 ? CG  ? A LEU 327 CG  
65  1 Y 1 A LEU 415 ? CD1 ? A LEU 327 CD1 
66  1 Y 1 A LEU 415 ? CD2 ? A LEU 327 CD2 
67  1 Y 1 A GLN 416 ? CG  ? A GLN 328 CG  
68  1 Y 1 A GLN 416 ? CD  ? A GLN 328 CD  
69  1 Y 1 A GLN 416 ? OE1 ? A GLN 328 OE1 
70  1 Y 1 A GLN 416 ? NE2 ? A GLN 328 NE2 
71  1 Y 0 A ARG 443 ? CD  ? A ARG 355 CD  
72  1 Y 0 A ARG 443 ? NE  ? A ARG 355 NE  
73  1 Y 0 A ARG 443 ? CZ  ? A ARG 355 CZ  
74  1 Y 0 A ARG 443 ? NH1 ? A ARG 355 NH1 
75  1 Y 0 A ARG 443 ? NH2 ? A ARG 355 NH2 
76  1 Y 1 A MET 458 ? CG  ? A MET 370 CG  
77  1 Y 1 A MET 458 ? SD  ? A MET 370 SD  
78  1 Y 1 A MET 458 ? CE  ? A MET 370 CE  
79  1 Y 1 A LYS 463 ? CD  ? A LYS 375 CD  
80  1 Y 1 A LYS 463 ? CE  ? A LYS 375 CE  
81  1 Y 1 A LYS 463 ? NZ  ? A LYS 375 NZ  
82  1 Y 1 A GLU 464 ? CG  ? A GLU 376 CG  
83  1 Y 1 A GLU 464 ? CD  ? A GLU 376 CD  
84  1 Y 1 A GLU 464 ? OE1 ? A GLU 376 OE1 
85  1 Y 1 A GLU 464 ? OE2 ? A GLU 376 OE2 
86  1 Y 1 A ARG 466 ? CG  ? A ARG 378 CG  
87  1 Y 1 A ARG 466 ? CD  ? A ARG 378 CD  
88  1 Y 1 A ARG 466 ? NE  ? A ARG 378 NE  
89  1 Y 1 A ARG 466 ? CZ  ? A ARG 378 CZ  
90  1 Y 1 A ARG 466 ? NH1 ? A ARG 378 NH1 
91  1 Y 1 A ARG 466 ? NH2 ? A ARG 378 NH2 
92  1 Y 1 A LEU 468 ? CG  ? A LEU 380 CG  
93  1 Y 1 A LEU 468 ? CD1 ? A LEU 380 CD1 
94  1 Y 1 A LEU 468 ? CD2 ? A LEU 380 CD2 
95  1 Y 1 A ASN 469 ? CG  ? A ASN 381 CG  
96  1 Y 1 A ASN 469 ? OD1 ? A ASN 381 OD1 
97  1 Y 1 A ASN 469 ? ND2 ? A ASN 381 ND2 
98  1 Y 1 A GLU 472 ? CG  ? A GLU 384 CG  
99  1 Y 1 A GLU 472 ? CD  ? A GLU 384 CD  
100 1 Y 1 A GLU 472 ? OE1 ? A GLU 384 OE1 
101 1 Y 1 A GLU 472 ? OE2 ? A GLU 384 OE2 
102 1 Y 1 A ASP 475 ? CG  ? A ASP 387 CG  
103 1 Y 1 A ASP 475 ? OD1 ? A ASP 387 OD1 
104 1 Y 1 A ASP 475 ? OD2 ? A ASP 387 OD2 
105 1 Y 1 A GLU 478 ? CG  ? A GLU 390 CG  
106 1 Y 1 A GLU 478 ? CD  ? A GLU 390 CD  
107 1 Y 1 A GLU 478 ? OE1 ? A GLU 390 OE1 
108 1 Y 1 A GLU 478 ? OE2 ? A GLU 390 OE2 
109 1 Y 1 A GLU 484 ? CD  ? A GLU 396 CD  
110 1 Y 1 A GLU 484 ? OE1 ? A GLU 396 OE1 
111 1 Y 1 A GLU 484 ? OE2 ? A GLU 396 OE2 
112 1 Y 1 A LYS 496 ? CG  ? A LYS 408 CG  
113 1 Y 1 A LYS 496 ? CD  ? A LYS 408 CD  
114 1 Y 1 A LYS 496 ? CE  ? A LYS 408 CE  
115 1 Y 1 A LYS 496 ? NZ  ? A LYS 408 NZ  
116 1 Y 1 A GLU 499 ? CD  ? A GLU 411 CD  
117 1 Y 1 A GLU 499 ? OE1 ? A GLU 411 OE1 
118 1 Y 1 A GLU 499 ? OE2 ? A GLU 411 OE2 
119 1 Y 1 A LYS 500 ? NZ  ? A LYS 412 NZ  
120 1 Y 1 A LYS 503 ? CG  ? A LYS 415 CG  
121 1 Y 1 A LYS 503 ? CD  ? A LYS 415 CD  
122 1 Y 1 A LYS 503 ? CE  ? A LYS 415 CE  
123 1 Y 1 A LYS 503 ? NZ  ? A LYS 415 NZ  
124 1 Y 1 B LEU 89  ? CG  ? D LEU 1   CG  
125 1 Y 1 B LEU 89  ? CD1 ? D LEU 1   CD1 
126 1 Y 1 B LEU 89  ? CD2 ? D LEU 1   CD2 
127 1 Y 1 B GLN 91  ? CG  ? D GLN 3   CG  
128 1 Y 1 B GLN 91  ? CD  ? D GLN 3   CD  
129 1 Y 1 B GLN 91  ? OE1 ? D GLN 3   OE1 
130 1 Y 1 B GLN 91  ? NE2 ? D GLN 3   NE2 
131 1 Y 1 B GLU 103 ? CD  ? D GLU 15  CD  
132 1 Y 1 B GLU 103 ? OE1 ? D GLU 15  OE1 
133 1 Y 1 B GLU 103 ? OE2 ? D GLU 15  OE2 
134 1 Y 1 B LYS 110 ? CD  ? D LYS 22  CD  
135 1 Y 1 B LYS 110 ? CE  ? D LYS 22  CE  
136 1 Y 1 B LYS 110 ? NZ  ? D LYS 22  NZ  
137 1 Y 1 B GLU 118 ? CG  ? D GLU 30  CG  
138 1 Y 1 B GLU 118 ? CD  ? D GLU 30  CD  
139 1 Y 1 B GLU 118 ? OE1 ? D GLU 30  OE1 
140 1 Y 1 B GLU 118 ? OE2 ? D GLU 30  OE2 
141 1 Y 1 B HIS 119 ? CG  ? D HIS 31  CG  
142 1 Y 1 B HIS 119 ? ND1 ? D HIS 31  ND1 
143 1 Y 1 B HIS 119 ? CD2 ? D HIS 31  CD2 
144 1 Y 1 B HIS 119 ? CE1 ? D HIS 31  CE1 
145 1 Y 1 B HIS 119 ? NE2 ? D HIS 31  NE2 
146 1 Y 1 B ARG 120 ? CG  ? D ARG 32  CG  
147 1 Y 1 B ARG 120 ? CD  ? D ARG 32  CD  
148 1 Y 1 B ARG 120 ? NE  ? D ARG 32  NE  
149 1 Y 1 B ARG 120 ? CZ  ? D ARG 32  CZ  
150 1 Y 1 B ARG 120 ? NH1 ? D ARG 32  NH1 
151 1 Y 1 B ARG 120 ? NH2 ? D ARG 32  NH2 
152 1 Y 1 B GLU 141 ? CD  ? D GLU 53  CD  
153 1 Y 1 B GLU 141 ? OE1 ? D GLU 53  OE1 
154 1 Y 1 B GLU 141 ? OE2 ? D GLU 53  OE2 
155 1 Y 1 B ASN 215 ? OD1 ? D ASN 127 OD1 
156 1 Y 1 B ASN 215 ? ND2 ? D ASN 127 ND2 
157 1 Y 1 B GLU 218 ? CG  ? D GLU 130 CG  
158 1 Y 1 B GLU 218 ? CD  ? D GLU 130 CD  
159 1 Y 1 B GLU 218 ? OE1 ? D GLU 130 OE1 
160 1 Y 1 B GLU 218 ? OE2 ? D GLU 130 OE2 
161 1 Y 1 B ASN 225 ? CG  ? D ASN 137 CG  
162 1 Y 1 B ASN 225 ? OD1 ? D ASN 137 OD1 
163 1 Y 1 B ASN 225 ? ND2 ? D ASN 137 ND2 
164 1 Y 1 B ASN 227 ? CG  ? D ASN 139 CG  
165 1 Y 1 B ASN 227 ? OD1 ? D ASN 139 OD1 
166 1 Y 1 B ASN 227 ? ND2 ? D ASN 139 ND2 
167 1 Y 1 B LYS 247 ? CG  ? D LYS 159 CG  
168 1 Y 1 B LYS 247 ? CD  ? D LYS 159 CD  
169 1 Y 1 B LYS 247 ? CE  ? D LYS 159 CE  
170 1 Y 1 B LYS 247 ? NZ  ? D LYS 159 NZ  
171 1 Y 1 B LYS 264 ? CD  ? D LYS 176 CD  
172 1 Y 1 B LYS 264 ? CE  ? D LYS 176 CE  
173 1 Y 1 B LYS 264 ? NZ  ? D LYS 176 NZ  
174 1 Y 1 B GLU 290 ? CG  ? D GLU 202 CG  
175 1 Y 1 B GLU 290 ? CD  ? D GLU 202 CD  
176 1 Y 1 B GLU 290 ? OE1 ? D GLU 202 OE1 
177 1 Y 1 B GLU 290 ? OE2 ? D GLU 202 OE2 
178 1 Y 1 B LEU 348 ? CD1 ? D LEU 260 CD1 
179 1 Y 1 B LEU 348 ? CD2 ? D LEU 260 CD2 
180 1 Y 1 B LYS 354 ? CD  ? D LYS 266 CD  
181 1 Y 1 B LYS 354 ? CE  ? D LYS 266 CE  
182 1 Y 1 B LYS 354 ? NZ  ? D LYS 266 NZ  
183 1 Y 1 B GLU 374 ? CG  ? D GLU 286 CG  
184 1 Y 1 B GLU 374 ? CD  ? D GLU 286 CD  
185 1 Y 1 B GLU 374 ? OE1 ? D GLU 286 OE1 
186 1 Y 1 B GLU 374 ? OE2 ? D GLU 286 OE2 
187 1 Y 1 B LEU 415 ? CG  ? D LEU 327 CG  
188 1 Y 1 B LEU 415 ? CD1 ? D LEU 327 CD1 
189 1 Y 1 B LEU 415 ? CD2 ? D LEU 327 CD2 
190 1 Y 1 B GLN 416 ? CG  ? D GLN 328 CG  
191 1 Y 1 B GLN 416 ? CD  ? D GLN 328 CD  
192 1 Y 1 B GLN 416 ? OE1 ? D GLN 328 OE1 
193 1 Y 1 B GLN 416 ? NE2 ? D GLN 328 NE2 
194 1 Y 0 B ARG 443 ? CD  ? D ARG 355 CD  
195 1 Y 0 B ARG 443 ? NE  ? D ARG 355 NE  
196 1 Y 0 B ARG 443 ? CZ  ? D ARG 355 CZ  
197 1 Y 0 B ARG 443 ? NH1 ? D ARG 355 NH1 
198 1 Y 0 B ARG 443 ? NH2 ? D ARG 355 NH2 
199 1 Y 1 B MET 458 ? CG  ? D MET 370 CG  
200 1 Y 1 B MET 458 ? SD  ? D MET 370 SD  
201 1 Y 1 B MET 458 ? CE  ? D MET 370 CE  
202 1 Y 1 B LYS 463 ? CD  ? D LYS 375 CD  
203 1 Y 1 B LYS 463 ? CE  ? D LYS 375 CE  
204 1 Y 1 B LYS 463 ? NZ  ? D LYS 375 NZ  
205 1 Y 1 B GLU 464 ? CG  ? D GLU 376 CG  
206 1 Y 1 B GLU 464 ? CD  ? D GLU 376 CD  
207 1 Y 1 B GLU 464 ? OE1 ? D GLU 376 OE1 
208 1 Y 1 B GLU 464 ? OE2 ? D GLU 376 OE2 
209 1 Y 1 B ARG 466 ? CG  ? D ARG 378 CG  
210 1 Y 1 B ARG 466 ? CD  ? D ARG 378 CD  
211 1 Y 1 B ARG 466 ? NE  ? D ARG 378 NE  
212 1 Y 1 B ARG 466 ? CZ  ? D ARG 378 CZ  
213 1 Y 1 B ARG 466 ? NH1 ? D ARG 378 NH1 
214 1 Y 1 B ARG 466 ? NH2 ? D ARG 378 NH2 
215 1 Y 1 B LEU 468 ? CG  ? D LEU 380 CG  
216 1 Y 1 B LEU 468 ? CD1 ? D LEU 380 CD1 
217 1 Y 1 B LEU 468 ? CD2 ? D LEU 380 CD2 
218 1 Y 1 B ASN 469 ? CG  ? D ASN 381 CG  
219 1 Y 1 B ASN 469 ? OD1 ? D ASN 381 OD1 
220 1 Y 1 B ASN 469 ? ND2 ? D ASN 381 ND2 
221 1 Y 1 B GLU 472 ? CG  ? D GLU 384 CG  
222 1 Y 1 B GLU 472 ? CD  ? D GLU 384 CD  
223 1 Y 1 B GLU 472 ? OE1 ? D GLU 384 OE1 
224 1 Y 1 B GLU 472 ? OE2 ? D GLU 384 OE2 
225 1 Y 1 B ASP 475 ? CG  ? D ASP 387 CG  
226 1 Y 1 B ASP 475 ? OD1 ? D ASP 387 OD1 
227 1 Y 1 B ASP 475 ? OD2 ? D ASP 387 OD2 
228 1 Y 1 B GLU 478 ? CG  ? D GLU 390 CG  
229 1 Y 1 B GLU 478 ? CD  ? D GLU 390 CD  
230 1 Y 1 B GLU 478 ? OE1 ? D GLU 390 OE1 
231 1 Y 1 B GLU 478 ? OE2 ? D GLU 390 OE2 
232 1 Y 1 B GLU 484 ? CD  ? D GLU 396 CD  
233 1 Y 1 B GLU 484 ? OE1 ? D GLU 396 OE1 
234 1 Y 1 B GLU 484 ? OE2 ? D GLU 396 OE2 
235 1 Y 1 B LYS 496 ? CG  ? D LYS 408 CG  
236 1 Y 1 B LYS 496 ? CD  ? D LYS 408 CD  
237 1 Y 1 B LYS 496 ? CE  ? D LYS 408 CE  
238 1 Y 1 B LYS 496 ? NZ  ? D LYS 408 NZ  
239 1 Y 1 B GLU 499 ? CD  ? D GLU 411 CD  
240 1 Y 1 B GLU 499 ? OE1 ? D GLU 411 OE1 
241 1 Y 1 B GLU 499 ? OE2 ? D GLU 411 OE2 
242 1 Y 1 B LYS 500 ? NZ  ? D LYS 412 NZ  
243 1 Y 1 B LYS 503 ? CG  ? D LYS 415 CG  
244 1 Y 1 B LYS 503 ? CD  ? D LYS 415 CD  
245 1 Y 1 B LYS 503 ? CE  ? D LYS 415 CE  
246 1 Y 1 B LYS 503 ? NZ  ? D LYS 415 NZ  
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 HOH 1 1 1 HOH HOH A . 
G 4 HOH 2 2 2 HOH HOH A . 
G 4 HOH 3 3 3 HOH HOH A . 
G 4 HOH 4 4 4 HOH HOH A . 
G 4 HOH 5 5 5 HOH HOH A . 
G 4 HOH 6 6 6 HOH HOH A . 
H 4 HOH 1 1 1 HOH HOH B . 
H 4 HOH 2 2 2 HOH HOH B . 
H 4 HOH 3 3 3 HOH HOH B . 
H 4 HOH 4 4 4 HOH HOH B . 
H 4 HOH 5 5 5 HOH HOH B . 
H 4 HOH 6 6 6 HOH HOH B . 
#