data_1BLR
# 
_entry.id   1BLR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BLR         
WWPDB D_1000171896 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BLR 
_pdbx_database_status.recvd_initial_deposition_date   1998-07-20 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, L.'      1 
'Li, Y.'        2 
'Abilddard, F.' 3 
'Yan, H.'       4 
'Markely, J.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'NMR solution structure of type II human cellular retinoic acid binding protein: implications for ligand binding.' 
Biochemistry 37 12727 12736 1998 BICHAW US 0006-2960 0033 ? 9737849 10.1021/bi9808924 
1       
;Crystal Structures of Cellular Retinoic Acid Binding Proteins I and II in Complex with All-Trans-Retinoic Acid and a Synthetic Retinoid
;
Structure    2  1241  ?     1994 STRUE6 UK 0969-2126 2005 ? ?       ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, L.'       1  
primary 'Li, Y.'         2  
primary 'Abildgaard, F.' 3  
primary 'Markley, J.L.'  4  
primary 'Yan, H.'        5  
1       'Kleywegt, G.J.' 6  
1       'Bergfors, T.'   7  
1       'Senn, H.'       8  
1       'Le Motte, P.'   9  
1       'Gsell, B.'      10 
1       'Shudo, K.'      11 
1       'Jones, T.A.'    12 
# 
_cell.entry_id           1BLR 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BLR 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'CELLULAR RETINOIC ACID BINDING PROTEIN-TYPE II' 
_entity.formula_weight             15581.802 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ASN n 
1 3   PHE n 
1 4   SER n 
1 5   GLY n 
1 6   ASN n 
1 7   TRP n 
1 8   LYS n 
1 9   ILE n 
1 10  ILE n 
1 11  ARG n 
1 12  SER n 
1 13  GLU n 
1 14  ASN n 
1 15  PHE n 
1 16  GLU n 
1 17  GLU n 
1 18  LEU n 
1 19  LEU n 
1 20  LYS n 
1 21  VAL n 
1 22  LEU n 
1 23  GLY n 
1 24  VAL n 
1 25  ASN n 
1 26  VAL n 
1 27  MET n 
1 28  LEU n 
1 29  ARG n 
1 30  LYS n 
1 31  ILE n 
1 32  ALA n 
1 33  VAL n 
1 34  ALA n 
1 35  ALA n 
1 36  ALA n 
1 37  SER n 
1 38  LYS n 
1 39  PRO n 
1 40  ALA n 
1 41  VAL n 
1 42  GLU n 
1 43  ILE n 
1 44  LYS n 
1 45  GLN n 
1 46  GLU n 
1 47  GLY n 
1 48  ASP n 
1 49  THR n 
1 50  PHE n 
1 51  TYR n 
1 52  ILE n 
1 53  LYS n 
1 54  THR n 
1 55  SER n 
1 56  THR n 
1 57  THR n 
1 58  VAL n 
1 59  ARG n 
1 60  THR n 
1 61  THR n 
1 62  GLU n 
1 63  ILE n 
1 64  ASN n 
1 65  PHE n 
1 66  LYS n 
1 67  VAL n 
1 68  GLY n 
1 69  GLU n 
1 70  GLU n 
1 71  PHE n 
1 72  GLU n 
1 73  GLU n 
1 74  GLN n 
1 75  THR n 
1 76  VAL n 
1 77  ASP n 
1 78  GLY n 
1 79  ARG n 
1 80  PRO n 
1 81  CYS n 
1 82  LYS n 
1 83  SER n 
1 84  LEU n 
1 85  VAL n 
1 86  LYS n 
1 87  TRP n 
1 88  GLU n 
1 89  SER n 
1 90  GLU n 
1 91  ASN n 
1 92  LYS n 
1 93  MET n 
1 94  VAL n 
1 95  CYS n 
1 96  GLU n 
1 97  GLN n 
1 98  LYS n 
1 99  LEU n 
1 100 LEU n 
1 101 LYS n 
1 102 GLY n 
1 103 GLU n 
1 104 GLY n 
1 105 PRO n 
1 106 LYS n 
1 107 THR n 
1 108 SER n 
1 109 TRP n 
1 110 THR n 
1 111 ARG n 
1 112 GLU n 
1 113 LEU n 
1 114 THR n 
1 115 ASN n 
1 116 ASP n 
1 117 GLY n 
1 118 GLU n 
1 119 LEU n 
1 120 ILE n 
1 121 LEU n 
1 122 THR n 
1 123 MET n 
1 124 THR n 
1 125 ALA n 
1 126 ASP n 
1 127 ASP n 
1 128 VAL n 
1 129 VAL n 
1 130 CYS n 
1 131 THR n 
1 132 ARG n 
1 133 VAL n 
1 134 TYR n 
1 135 VAL n 
1 136 ARG n 
1 137 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CRABP-II 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            'BL21 (DE3)/PLYSS' 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'BL21 (DE3)/PLYSS' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET17B/PLYSS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RABP2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P29373 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1BLR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 137 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P29373 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  137 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       137 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY                          1 
2 1 TOCSY                          1 
3 1 'TRIPLE RESONANCE EXPERIMENTS' 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.3 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id   1 
_pdbx_nmr_sample_details.contents      H2O 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
1 INOVA500 Varian 500 
2 DMX-500  Bruker 500 
# 
_pdbx_nmr_refine.entry_id           1BLR 
_pdbx_nmr_refine.method             DGSA 
_pdbx_nmr_refine.details            'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1BLR 
_pdbx_nmr_details.text       
'MODEL 1 - THE RESONANCES WERE DETERMINED BY MEANS OF TRIPLE-RESONANCE NMR EXPERIMENTS ON 13C, 15N-LABELED CRABPII' 
# 
_pdbx_nmr_ensemble.entry_id                             1BLR 
_pdbx_nmr_ensemble.conformers_calculated_total_number   70 
_pdbx_nmr_ensemble.conformers_submitted_total_number    22 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LEAST RESTRAINT VIOLATION' 
# 
_pdbx_nmr_representative.entry_id             1BLR 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR 3.1 BRUNGER 1 
'structure solution' X-PLOR ?   ?       2 
# 
_exptl.entry_id          1BLR 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1BLR 
_struct.title                     'NMR SOLUTION STRUCTURE OF HUMAN CELLULAR RETINOIC ACID BINDING PROTEIN-TYPE II, 22 STRUCTURES' 
_struct.pdbx_descriptor           'CELLULAR RETINOIC ACID BINDING PROTEIN-TYPE II' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BLR 
_struct_keywords.pdbx_keywords   TRANSPORT 
_struct_keywords.text            'CRABPII, VITAMIN A, TRANSPORT' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 15 ? VAL A 21 ? PHE A 15 VAL A 21 1 ? 7 
HELX_P HELX_P2 2 ARG A 29 ? ILE A 31 ? ARG A 29 ILE A 31 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 49  ? LYS A 53  ? THR A 49  LYS A 53  
A 2 VAL A 41  ? GLU A 46  ? VAL A 41  GLU A 46  
A 3 GLY A 5   ? SER A 12  ? GLY A 5   SER A 12  
A 4 ARG A 132 ? ARG A 136 ? ARG A 132 ARG A 136 
B 1 GLU A 70  ? GLN A 74  ? GLU A 70  GLN A 74  
B 2 PRO A 80  ? LEU A 84  ? PRO A 80  LEU A 84  
C 1 VAL A 85  ? TRP A 87  ? VAL A 85  TRP A 87  
C 2 MET A 93  ? CYS A 95  ? MET A 93  CYS A 95  
D 1 THR A 107 ? GLU A 112 ? THR A 107 GLU A 112 
D 2 ILE A 120 ? ALA A 125 ? ILE A 120 ALA A 125 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 49  ? O THR A 49  N GLU A 46  ? N GLU A 46  
A 2 3 O VAL A 41  ? O VAL A 41  N TRP A 7   ? N TRP A 7   
A 3 4 O LYS A 8   ? O LYS A 8   N VAL A 135 ? N VAL A 135 
B 1 2 O PHE A 71  ? O PHE A 71  N SER A 83  ? N SER A 83  
C 1 2 O LYS A 86  ? O LYS A 86  N VAL A 94  ? N VAL A 94  
D 1 2 O SER A 108 ? O SER A 108 N THR A 124 ? N THR A 124 
# 
_database_PDB_matrix.entry_id          1BLR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BLR 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . PRO A 1 1   ? -15.668 0.759   10.126  1.00 0.99 ? 1   PRO A N    1  
ATOM 2     C CA   . PRO A 1 1   ? -14.212 0.698   9.770   1.00 0.73 ? 1   PRO A CA   1  
ATOM 3     C C    . PRO A 1 1   ? -13.760 2.003   9.101   1.00 0.81 ? 1   PRO A C    1  
ATOM 4     O O    . PRO A 1 1   ? -12.597 2.348   9.149   1.00 1.82 ? 1   PRO A O    1  
ATOM 5     C CB   . PRO A 1 1   ? -14.005 -0.463  8.797   1.00 0.51 ? 1   PRO A CB   1  
ATOM 6     C CG   . PRO A 1 1   ? -15.369 -1.102  8.560   1.00 0.72 ? 1   PRO A CG   1  
ATOM 7     C CD   . PRO A 1 1   ? -16.397 -0.281  9.338   1.00 0.94 ? 1   PRO A CD   1  
ATOM 8     H H2   . PRO A 1 1   ? -16.053 1.696   9.906   1.00 1.19 ? 1   PRO A H2   1  
ATOM 9     H H3   . PRO A 1 1   ? -15.782 0.568   11.143  1.00 1.15 ? 1   PRO A H3   1  
ATOM 10    H HA   . PRO A 1 1   ? -13.628 0.527   10.661  1.00 0.87 ? 1   PRO A HA   1  
ATOM 11    H HB2  . PRO A 1 1   ? -13.598 -0.095  7.864   1.00 0.52 ? 1   PRO A HB2  1  
ATOM 12    H HB3  . PRO A 1 1   ? -13.333 -1.188  9.227   1.00 0.54 ? 1   PRO A HB3  1  
ATOM 13    H HG2  . PRO A 1 1   ? -15.604 -1.087  7.504   1.00 0.84 ? 1   PRO A HG2  1  
ATOM 14    H HG3  . PRO A 1 1   ? -15.368 -2.119  8.923   1.00 0.84 ? 1   PRO A HG3  1  
ATOM 15    H HD2  . PRO A 1 1   ? -17.079 0.195   8.648   1.00 1.10 ? 1   PRO A HD2  1  
ATOM 16    H HD3  . PRO A 1 1   ? -16.947 -0.925  10.008  1.00 1.06 ? 1   PRO A HD3  1  
ATOM 17    N N    . ASN A 1 2   ? -14.659 2.716   8.460   1.00 0.42 ? 2   ASN A N    1  
ATOM 18    C CA   . ASN A 1 2   ? -14.270 3.986   7.769   1.00 0.38 ? 2   ASN A CA   1  
ATOM 19    C C    . ASN A 1 2   ? -13.557 3.633   6.464   1.00 0.67 ? 2   ASN A C    1  
ATOM 20    O O    . ASN A 1 2   ? -13.922 2.685   5.804   1.00 1.78 ? 2   ASN A O    1  
ATOM 21    C CB   . ASN A 1 2   ? -13.372 4.834   8.681   1.00 0.35 ? 2   ASN A CB   1  
ATOM 22    C CG   . ASN A 1 2   ? -14.021 4.966   10.061  1.00 0.31 ? 2   ASN A CG   1  
ATOM 23    O OD1  . ASN A 1 2   ? -13.757 4.177   10.946  1.00 1.02 ? 2   ASN A OD1  1  
ATOM 24    N ND2  . ASN A 1 2   ? -14.863 5.937   10.282  1.00 1.11 ? 2   ASN A ND2  1  
ATOM 25    H H    . ASN A 1 2   ? -15.587 2.408   8.418   1.00 1.18 ? 2   ASN A H    1  
ATOM 26    H HA   . ASN A 1 2   ? -15.150 4.550   7.526   1.00 0.34 ? 2   ASN A HA   1  
ATOM 27    H HB2  . ASN A 1 2   ? -12.412 4.361   8.781   1.00 0.38 ? 2   ASN A HB2  1  
ATOM 28    H HB3  . ASN A 1 2   ? -13.247 5.816   8.251   1.00 0.48 ? 2   ASN A HB3  1  
ATOM 29    H HD21 . ASN A 1 2   ? -15.076 6.574   9.568   1.00 1.85 ? 2   ASN A HD21 1  
ATOM 30    H HD22 . ASN A 1 2   ? -15.284 6.030   11.163  1.00 1.16 ? 2   ASN A HD22 1  
ATOM 31    N N    . PHE A 1 3   ? -12.561 4.387   6.089   1.00 0.35 ? 3   PHE A N    1  
ATOM 32    C CA   . PHE A 1 3   ? -11.811 4.123   4.815   1.00 0.16 ? 3   PHE A CA   1  
ATOM 33    C C    . PHE A 1 3   ? -12.587 4.679   3.614   1.00 0.18 ? 3   PHE A C    1  
ATOM 34    O O    . PHE A 1 3   ? -12.032 5.362   2.776   1.00 0.24 ? 3   PHE A O    1  
ATOM 35    C CB   . PHE A 1 3   ? -11.592 2.622   4.589   1.00 0.21 ? 3   PHE A CB   1  
ATOM 36    C CG   . PHE A 1 3   ? -10.745 2.029   5.688   1.00 0.18 ? 3   PHE A CG   1  
ATOM 37    C CD1  . PHE A 1 3   ? -11.341 1.582   6.875   1.00 0.18 ? 3   PHE A CD1  1  
ATOM 38    C CD2  . PHE A 1 3   ? -9.363  1.893   5.507   1.00 0.16 ? 3   PHE A CD2  1  
ATOM 39    C CE1  . PHE A 1 3   ? -10.567 1.000   7.868   1.00 0.17 ? 3   PHE A CE1  1  
ATOM 40    C CE2  . PHE A 1 3   ? -8.587  1.313   6.514   1.00 0.15 ? 3   PHE A CE2  1  
ATOM 41    C CZ   . PHE A 1 3   ? -9.193  0.862   7.693   1.00 0.16 ? 3   PHE A CZ   1  
ATOM 42    H H    . PHE A 1 3   ? -12.304 5.142   6.649   1.00 1.21 ? 3   PHE A H    1  
ATOM 43    H HA   . PHE A 1 3   ? -10.852 4.614   4.870   1.00 0.21 ? 3   PHE A HA   1  
ATOM 44    H HB2  . PHE A 1 3   ? -12.544 2.118   4.561   1.00 0.33 ? 3   PHE A HB2  1  
ATOM 45    H HB3  . PHE A 1 3   ? -11.092 2.478   3.642   1.00 0.29 ? 3   PHE A HB3  1  
ATOM 46    H HD1  . PHE A 1 3   ? -12.398 1.684   7.027   1.00 0.21 ? 3   PHE A HD1  1  
ATOM 47    H HD2  . PHE A 1 3   ? -8.893  2.252   4.600   1.00 0.18 ? 3   PHE A HD2  1  
ATOM 48    H HE1  . PHE A 1 3   ? -11.033 0.664   8.777   1.00 0.19 ? 3   PHE A HE1  1  
ATOM 49    H HE2  . PHE A 1 3   ? -7.525  1.206   6.377   1.00 0.16 ? 3   PHE A HE2  1  
ATOM 50    H HZ   . PHE A 1 3   ? -8.603  0.403   8.467   1.00 0.17 ? 3   PHE A HZ   1  
ATOM 51    N N    . SER A 1 4   ? -13.860 4.376   3.511   1.00 0.19 ? 4   SER A N    1  
ATOM 52    C CA   . SER A 1 4   ? -14.666 4.868   2.352   1.00 0.21 ? 4   SER A CA   1  
ATOM 53    C C    . SER A 1 4   ? -14.425 6.368   2.140   1.00 0.22 ? 4   SER A C    1  
ATOM 54    O O    . SER A 1 4   ? -14.745 7.182   2.984   1.00 0.26 ? 4   SER A O    1  
ATOM 55    C CB   . SER A 1 4   ? -16.153 4.628   2.623   1.00 0.23 ? 4   SER A CB   1  
ATOM 56    O OG   . SER A 1 4   ? -16.664 5.678   3.435   1.00 0.61 ? 4   SER A OG   1  
ATOM 57    H H    . SER A 1 4   ? -14.284 3.814   4.187   1.00 0.22 ? 4   SER A H    1  
ATOM 58    H HA   . SER A 1 4   ? -14.375 4.323   1.463   1.00 0.21 ? 4   SER A HA   1  
ATOM 59    H HB2  . SER A 1 4   ? -16.691 4.608   1.690   1.00 0.50 ? 4   SER A HB2  1  
ATOM 60    H HB3  . SER A 1 4   ? -16.276 3.680   3.126   1.00 0.54 ? 4   SER A HB3  1  
ATOM 61    H HG   . SER A 1 4   ? -17.148 5.282   4.163   1.00 0.97 ? 4   SER A HG   1  
ATOM 62    N N    . GLY A 1 5   ? -13.860 6.737   1.021   1.00 0.23 ? 5   GLY A N    1  
ATOM 63    C CA   . GLY A 1 5   ? -13.597 8.181   0.757   1.00 0.25 ? 5   GLY A CA   1  
ATOM 64    C C    . GLY A 1 5   ? -12.312 8.324   -0.045  1.00 0.25 ? 5   GLY A C    1  
ATOM 65    O O    . GLY A 1 5   ? -11.440 7.480   -0.003  1.00 0.24 ? 5   GLY A O    1  
ATOM 66    H H    . GLY A 1 5   ? -13.607 6.064   0.355   1.00 0.26 ? 5   GLY A H    1  
ATOM 67    H HA2  . GLY A 1 5   ? -14.419 8.609   0.206   1.00 0.27 ? 5   GLY A HA2  1  
ATOM 68    H HA3  . GLY A 1 5   ? -13.485 8.707   1.689   1.00 0.25 ? 5   GLY A HA3  1  
ATOM 69    N N    . ASN A 1 6   ? -12.180 9.406   -0.750  1.00 0.28 ? 6   ASN A N    1  
ATOM 70    C CA   . ASN A 1 6   ? -10.942 9.640   -1.534  1.00 0.29 ? 6   ASN A CA   1  
ATOM 71    C C    . ASN A 1 6   ? -9.872  10.075  -0.551  1.00 0.29 ? 6   ASN A C    1  
ATOM 72    O O    . ASN A 1 6   ? -10.179 10.460  0.561   1.00 0.30 ? 6   ASN A O    1  
ATOM 73    C CB   . ASN A 1 6   ? -11.178 10.738  -2.574  1.00 0.33 ? 6   ASN A CB   1  
ATOM 74    C CG   . ASN A 1 6   ? -9.944  10.867  -3.470  1.00 0.48 ? 6   ASN A CG   1  
ATOM 75    O OD1  . ASN A 1 6   ? -8.937  11.412  -3.061  1.00 1.30 ? 6   ASN A OD1  1  
ATOM 76    N ND2  . ASN A 1 6   ? -9.980  10.387  -4.683  1.00 0.49 ? 6   ASN A ND2  1  
ATOM 77    H H    . ASN A 1 6   ? -12.886 10.074  -0.738  1.00 0.30 ? 6   ASN A H    1  
ATOM 78    H HA   . ASN A 1 6   ? -10.638 8.725   -2.019  1.00 0.29 ? 6   ASN A HA   1  
ATOM 79    H HB2  . ASN A 1 6   ? -12.037 10.483  -3.178  1.00 0.44 ? 6   ASN A HB2  1  
ATOM 80    H HB3  . ASN A 1 6   ? -11.356 11.677  -2.073  1.00 0.44 ? 6   ASN A HB3  1  
ATOM 81    H HD21 . ASN A 1 6   ? -10.792 9.948   -5.012  1.00 1.14 ? 6   ASN A HD21 1  
ATOM 82    H HD22 . ASN A 1 6   ? -9.194  10.465  -5.264  1.00 0.39 ? 6   ASN A HD22 1  
ATOM 83    N N    . TRP A 1 7   ? -8.624  9.993   -0.908  1.00 0.28 ? 7   TRP A N    1  
ATOM 84    C CA   . TRP A 1 7   ? -7.590  10.384  0.083   1.00 0.28 ? 7   TRP A CA   1  
ATOM 85    C C    . TRP A 1 7   ? -6.477  11.207  -0.538  1.00 0.32 ? 7   TRP A C    1  
ATOM 86    O O    . TRP A 1 7   ? -5.884  10.839  -1.533  1.00 0.34 ? 7   TRP A O    1  
ATOM 87    C CB   . TRP A 1 7   ? -7.000  9.126   0.685   1.00 0.26 ? 7   TRP A CB   1  
ATOM 88    C CG   . TRP A 1 7   ? -8.086  8.355   1.339   1.00 0.23 ? 7   TRP A CG   1  
ATOM 89    C CD1  . TRP A 1 7   ? -8.723  7.289   0.812   1.00 0.22 ? 7   TRP A CD1  1  
ATOM 90    C CD2  . TRP A 1 7   ? -8.691  8.604   2.625   1.00 0.21 ? 7   TRP A CD2  1  
ATOM 91    N NE1  . TRP A 1 7   ? -9.651  6.833   1.729   1.00 0.20 ? 7   TRP A NE1  1  
ATOM 92    C CE2  . TRP A 1 7   ? -9.672  7.619   2.865   1.00 0.20 ? 7   TRP A CE2  1  
ATOM 93    C CE3  . TRP A 1 7   ? -8.465  9.576   3.600   1.00 0.23 ? 7   TRP A CE3  1  
ATOM 94    C CZ2  . TRP A 1 7   ? -10.409 7.602   4.049   1.00 0.20 ? 7   TRP A CZ2  1  
ATOM 95    C CZ3  . TRP A 1 7   ? -9.204  9.579   4.783   1.00 0.23 ? 7   TRP A CZ3  1  
ATOM 96    C CH2  . TRP A 1 7   ? -10.177 8.591   5.015   1.00 0.22 ? 7   TRP A CH2  1  
ATOM 97    H H    . TRP A 1 7   ? -8.372  9.652   -1.796  1.00 0.29 ? 7   TRP A H    1  
ATOM 98    H HA   . TRP A 1 7   ? -8.053  10.957  0.868   1.00 0.28 ? 7   TRP A HA   1  
ATOM 99    H HB2  . TRP A 1 7   ? -6.545  8.532   -0.085  1.00 0.26 ? 7   TRP A HB2  1  
ATOM 100   H HB3  . TRP A 1 7   ? -6.259  9.392   1.419   1.00 0.26 ? 7   TRP A HB3  1  
ATOM 101   H HD1  . TRP A 1 7   ? -8.530  6.856   -0.156  1.00 0.24 ? 7   TRP A HD1  1  
ATOM 102   H HE1  . TRP A 1 7   ? -10.231 6.057   1.602   1.00 0.20 ? 7   TRP A HE1  1  
ATOM 103   H HE3  . TRP A 1 7   ? -7.717  10.334  3.431   1.00 0.24 ? 7   TRP A HE3  1  
ATOM 104   H HZ2  . TRP A 1 7   ? -11.146 6.829   4.221   1.00 0.19 ? 7   TRP A HZ2  1  
ATOM 105   H HZ3  . TRP A 1 7   ? -9.030  10.352  5.512   1.00 0.25 ? 7   TRP A HZ3  1  
ATOM 106   H HH2  . TRP A 1 7   ? -10.747 8.596   5.932   1.00 0.23 ? 7   TRP A HH2  1  
ATOM 107   N N    . LYS A 1 8   ? -6.172  12.314  0.078   1.00 0.33 ? 8   LYS A N    1  
ATOM 108   C CA   . LYS A 1 8   ? -5.074  13.171  -0.429  1.00 0.37 ? 8   LYS A CA   1  
ATOM 109   C C    . LYS A 1 8   ? -3.781  12.750  0.274   1.00 0.37 ? 8   LYS A C    1  
ATOM 110   O O    . LYS A 1 8   ? -3.812  12.217  1.367   1.00 0.39 ? 8   LYS A O    1  
ATOM 111   C CB   . LYS A 1 8   ? -5.367  14.645  -0.122  1.00 0.40 ? 8   LYS A CB   1  
ATOM 112   C CG   . LYS A 1 8   ? -6.881  14.886  -0.072  1.00 0.45 ? 8   LYS A CG   1  
ATOM 113   C CD   . LYS A 1 8   ? -7.324  15.038  1.385   1.00 1.70 ? 8   LYS A CD   1  
ATOM 114   C CE   . LYS A 1 8   ? -6.986  16.447  1.877   1.00 2.33 ? 8   LYS A CE   1  
ATOM 115   N NZ   . LYS A 1 8   ? -7.580  17.454  0.952   1.00 3.18 ? 8   LYS A NZ   1  
ATOM 116   H H    . LYS A 1 8   ? -6.661  12.572  0.891   1.00 0.33 ? 8   LYS A H    1  
ATOM 117   H HA   . LYS A 1 8   ? -4.973  13.028  -1.492  1.00 0.39 ? 8   LYS A HA   1  
ATOM 118   H HB2  . LYS A 1 8   ? -4.931  14.904  0.831   1.00 0.41 ? 8   LYS A HB2  1  
ATOM 119   H HB3  . LYS A 1 8   ? -4.934  15.264  -0.892  1.00 0.44 ? 8   LYS A HB3  1  
ATOM 120   H HG2  . LYS A 1 8   ? -7.118  15.786  -0.615  1.00 0.92 ? 8   LYS A HG2  1  
ATOM 121   H HG3  . LYS A 1 8   ? -7.399  14.052  -0.519  1.00 1.00 ? 8   LYS A HG3  1  
ATOM 122   H HD2  . LYS A 1 8   ? -8.389  14.875  1.458   1.00 2.13 ? 8   LYS A HD2  1  
ATOM 123   H HD3  . LYS A 1 8   ? -6.806  14.313  1.995   1.00 2.18 ? 8   LYS A HD3  1  
ATOM 124   H HE2  . LYS A 1 8   ? -7.388  16.588  2.869   1.00 2.46 ? 8   LYS A HE2  1  
ATOM 125   H HE3  . LYS A 1 8   ? -5.913  16.571  1.902   1.00 2.60 ? 8   LYS A HE3  1  
ATOM 126   H HZ1  . LYS A 1 8   ? -8.481  17.095  0.579   1.00 3.57 ? 8   LYS A HZ1  1  
ATOM 127   H HZ2  . LYS A 1 8   ? -7.750  18.340  1.468   1.00 3.56 ? 8   LYS A HZ2  1  
ATOM 128   H HZ3  . LYS A 1 8   ? -6.923  17.630  0.164   1.00 3.54 ? 8   LYS A HZ3  1  
ATOM 129   N N    . ILE A 1 9   ? -2.649  12.974  -0.336  1.00 0.39 ? 9   ILE A N    1  
ATOM 130   C CA   . ILE A 1 9   ? -1.367  12.571  0.312   1.00 0.39 ? 9   ILE A CA   1  
ATOM 131   C C    . ILE A 1 9   ? -1.094  13.478  1.516   1.00 0.40 ? 9   ILE A C    1  
ATOM 132   O O    . ILE A 1 9   ? -1.375  14.660  1.496   1.00 0.42 ? 9   ILE A O    1  
ATOM 133   C CB   . ILE A 1 9   ? -0.222  12.662  -0.713  1.00 0.43 ? 9   ILE A CB   1  
ATOM 134   C CG1  . ILE A 1 9   ? 0.838   11.596  -0.391  1.00 0.82 ? 9   ILE A CG1  1  
ATOM 135   C CG2  . ILE A 1 9   ? 0.417   14.058  -0.697  1.00 0.84 ? 9   ILE A CG2  1  
ATOM 136   C CD1  . ILE A 1 9   ? 1.685   12.022  0.815   1.00 1.01 ? 9   ILE A CD1  1  
ATOM 137   H H    . ILE A 1 9   ? -2.641  13.399  -1.219  1.00 0.42 ? 9   ILE A H    1  
ATOM 138   H HA   . ILE A 1 9   ? -1.454  11.551  0.659   1.00 0.37 ? 9   ILE A HA   1  
ATOM 139   H HB   . ILE A 1 9   ? -0.622  12.473  -1.699  1.00 0.80 ? 9   ILE A HB   1  
ATOM 140   H HG12 . ILE A 1 9   ? 0.347   10.660  -0.168  1.00 1.15 ? 9   ILE A HG12 1  
ATOM 141   H HG13 . ILE A 1 9   ? 1.482   11.464  -1.248  1.00 1.09 ? 9   ILE A HG13 1  
ATOM 142   H HG21 . ILE A 1 9   ? -0.341  14.802  -0.881  1.00 1.46 ? 9   ILE A HG21 1  
ATOM 143   H HG22 . ILE A 1 9   ? 0.871   14.236  0.268   1.00 1.48 ? 9   ILE A HG22 1  
ATOM 144   H HG23 . ILE A 1 9   ? 1.174   14.114  -1.464  1.00 1.32 ? 9   ILE A HG23 1  
ATOM 145   H HD11 . ILE A 1 9   ? 1.268   12.913  1.257   1.00 1.37 ? 9   ILE A HD11 1  
ATOM 146   H HD12 . ILE A 1 9   ? 1.695   11.229  1.548   1.00 1.52 ? 9   ILE A HD12 1  
ATOM 147   H HD13 . ILE A 1 9   ? 2.694   12.224  0.489   1.00 1.54 ? 9   ILE A HD13 1  
ATOM 148   N N    . ILE A 1 10  ? -0.541  12.925  2.558   1.00 0.39 ? 10  ILE A N    1  
ATOM 149   C CA   . ILE A 1 10  ? -0.236  13.729  3.770   1.00 0.40 ? 10  ILE A CA   1  
ATOM 150   C C    . ILE A 1 10  ? 0.946   13.081  4.498   1.00 0.41 ? 10  ILE A C    1  
ATOM 151   O O    . ILE A 1 10  ? 0.830   12.016  5.070   1.00 0.39 ? 10  ILE A O    1  
ATOM 152   C CB   . ILE A 1 10  ? -1.481  13.775  4.668   1.00 0.39 ? 10  ILE A CB   1  
ATOM 153   C CG1  . ILE A 1 10  ? -2.443  14.847  4.140   1.00 0.43 ? 10  ILE A CG1  1  
ATOM 154   C CG2  . ILE A 1 10  ? -1.095  14.117  6.112   1.00 0.42 ? 10  ILE A CG2  1  
ATOM 155   C CD1  . ILE A 1 10  ? -3.581  14.183  3.362   1.00 0.46 ? 10  ILE A CD1  1  
ATOM 156   H H    . ILE A 1 10  ? -0.318  11.973  2.541   1.00 0.38 ? 10  ILE A H    1  
ATOM 157   H HA   . ILE A 1 10  ? 0.029   14.730  3.476   1.00 0.44 ? 10  ILE A HA   1  
ATOM 158   H HB   . ILE A 1 10  ? -1.967  12.816  4.646   1.00 0.37 ? 10  ILE A HB   1  
ATOM 159   H HG12 . ILE A 1 10  ? -2.853  15.403  4.971   1.00 0.47 ? 10  ILE A HG12 1  
ATOM 160   H HG13 . ILE A 1 10  ? -1.909  15.520  3.487   1.00 0.48 ? 10  ILE A HG13 1  
ATOM 161   H HG21 . ILE A 1 10  ? -0.542  15.044  6.127   1.00 1.12 ? 10  ILE A HG21 1  
ATOM 162   H HG22 . ILE A 1 10  ? -1.991  14.223  6.707   1.00 1.05 ? 10  ILE A HG22 1  
ATOM 163   H HG23 . ILE A 1 10  ? -0.484  13.326  6.519   1.00 1.07 ? 10  ILE A HG23 1  
ATOM 164   H HD11 . ILE A 1 10  ? -3.722  13.174  3.721   1.00 1.08 ? 10  ILE A HD11 1  
ATOM 165   H HD12 . ILE A 1 10  ? -4.491  14.746  3.507   1.00 1.14 ? 10  ILE A HD12 1  
ATOM 166   H HD13 . ILE A 1 10  ? -3.337  14.161  2.312   1.00 1.13 ? 10  ILE A HD13 1  
ATOM 167   N N    . ARG A 1 11  ? 2.087   13.716  4.459   1.00 0.49 ? 11  ARG A N    1  
ATOM 168   C CA   . ARG A 1 11  ? 3.303   13.159  5.127   1.00 0.52 ? 11  ARG A CA   1  
ATOM 169   C C    . ARG A 1 11  ? 3.764   11.900  4.387   1.00 0.48 ? 11  ARG A C    1  
ATOM 170   O O    . ARG A 1 11  ? 3.110   10.876  4.413   1.00 0.62 ? 11  ARG A O    1  
ATOM 171   C CB   . ARG A 1 11  ? 2.993   12.818  6.592   1.00 0.56 ? 11  ARG A CB   1  
ATOM 172   C CG   . ARG A 1 11  ? 3.567   13.906  7.503   1.00 0.91 ? 11  ARG A CG   1  
ATOM 173   C CD   . ARG A 1 11  ? 2.924   15.252  7.160   1.00 1.55 ? 11  ARG A CD   1  
ATOM 174   N NE   . ARG A 1 11  ? 3.017   16.163  8.336   1.00 2.35 ? 11  ARG A NE   1  
ATOM 175   C CZ   . ARG A 1 11  ? 1.944   16.744  8.798   1.00 3.04 ? 11  ARG A CZ   1  
ATOM 176   N NH1  . ARG A 1 11  ? 0.833   16.069  8.910   1.00 3.78 ? 11  ARG A NH1  1  
ATOM 177   N NH2  . ARG A 1 11  ? 1.983   18.000  9.150   1.00 3.47 ? 11  ARG A NH2  1  
ATOM 178   H H    . ARG A 1 11  ? 2.147   14.564  3.976   1.00 0.54 ? 11  ARG A H    1  
ATOM 179   H HA   . ARG A 1 11  ? 4.092   13.896  5.093   1.00 0.60 ? 11  ARG A HA   1  
ATOM 180   H HB2  . ARG A 1 11  ? 1.924   12.760  6.732   1.00 1.03 ? 11  ARG A HB2  1  
ATOM 181   H HB3  . ARG A 1 11  ? 3.441   11.869  6.844   1.00 0.90 ? 11  ARG A HB3  1  
ATOM 182   H HG2  . ARG A 1 11  ? 3.357   13.659  8.534   1.00 1.44 ? 11  ARG A HG2  1  
ATOM 183   H HG3  . ARG A 1 11  ? 4.635   13.972  7.359   1.00 1.09 ? 11  ARG A HG3  1  
ATOM 184   H HD2  . ARG A 1 11  ? 3.441   15.693  6.320   1.00 1.76 ? 11  ARG A HD2  1  
ATOM 185   H HD3  . ARG A 1 11  ? 1.886   15.100  6.902   1.00 1.59 ? 11  ARG A HD3  1  
ATOM 186   H HE   . ARG A 1 11  ? 3.885   16.326  8.762   1.00 2.60 ? 11  ARG A HE   1  
ATOM 187   H HH11 . ARG A 1 11  ? 0.804   15.106  8.641   1.00 3.96 ? 11  ARG A HH11 1  
ATOM 188   H HH12 . ARG A 1 11  ? 0.011   16.514  9.264   1.00 4.42 ? 11  ARG A HH12 1  
ATOM 189   H HH21 . ARG A 1 11  ? 2.835   18.517  9.066   1.00 3.42 ? 11  ARG A HH21 1  
ATOM 190   H HH22 . ARG A 1 11  ? 1.160   18.445  9.505   1.00 4.15 ? 11  ARG A HH22 1  
ATOM 191   N N    . SER A 1 12  ? 4.889   11.976  3.725   1.00 0.52 ? 12  SER A N    1  
ATOM 192   C CA   . SER A 1 12  ? 5.406   10.794  2.976   1.00 0.54 ? 12  SER A CA   1  
ATOM 193   C C    . SER A 1 12  ? 6.927   10.899  2.846   1.00 0.69 ? 12  SER A C    1  
ATOM 194   O O    . SER A 1 12  ? 7.444   11.815  2.237   1.00 1.31 ? 12  SER A O    1  
ATOM 195   C CB   . SER A 1 12  ? 4.783   10.764  1.580   1.00 0.63 ? 12  SER A CB   1  
ATOM 196   O OG   . SER A 1 12  ? 4.681   9.416   1.138   1.00 0.85 ? 12  SER A OG   1  
ATOM 197   H H    . SER A 1 12  ? 5.395   12.815  3.719   1.00 0.65 ? 12  SER A H    1  
ATOM 198   H HA   . SER A 1 12  ? 5.149   9.887   3.507   1.00 0.49 ? 12  SER A HA   1  
ATOM 199   H HB2  . SER A 1 12  ? 3.800   11.203  1.611   1.00 0.84 ? 12  SER A HB2  1  
ATOM 200   H HB3  . SER A 1 12  ? 5.405   11.330  0.898   1.00 0.71 ? 12  SER A HB3  1  
ATOM 201   H HG   . SER A 1 12  ? 5.307   9.290   0.421   1.00 0.96 ? 12  SER A HG   1  
ATOM 202   N N    . GLU A 1 13  ? 7.647   9.967   3.410   1.00 0.46 ? 13  GLU A N    1  
ATOM 203   C CA   . GLU A 1 13  ? 9.135   10.010  3.317   1.00 0.54 ? 13  GLU A CA   1  
ATOM 204   C C    . GLU A 1 13  ? 9.695   8.611   3.575   1.00 0.52 ? 13  GLU A C    1  
ATOM 205   O O    . GLU A 1 13  ? 10.360  8.367   4.563   1.00 0.92 ? 13  GLU A O    1  
ATOM 206   C CB   . GLU A 1 13  ? 9.685   10.985  4.361   1.00 0.66 ? 13  GLU A CB   1  
ATOM 207   C CG   . GLU A 1 13  ? 11.088  11.437  3.948   1.00 0.84 ? 13  GLU A CG   1  
ATOM 208   C CD   . GLU A 1 13  ? 11.692  12.304  5.054   1.00 1.07 ? 13  GLU A CD   1  
ATOM 209   O OE1  . GLU A 1 13  ? 11.010  13.206  5.512   1.00 1.57 ? 13  GLU A OE1  1  
ATOM 210   O OE2  . GLU A 1 13  ? 12.827  12.051  5.425   1.00 1.61 ? 13  GLU A OE2  1  
ATOM 211   H H    . GLU A 1 13  ? 7.208   9.237   3.894   1.00 0.76 ? 13  GLU A H    1  
ATOM 212   H HA   . GLU A 1 13  ? 9.424   10.335  2.329   1.00 0.60 ? 13  GLU A HA   1  
ATOM 213   H HB2  . GLU A 1 13  ? 9.034   11.845  4.429   1.00 0.69 ? 13  GLU A HB2  1  
ATOM 214   H HB3  . GLU A 1 13  ? 9.735   10.494  5.321   1.00 0.70 ? 13  GLU A HB3  1  
ATOM 215   H HG2  . GLU A 1 13  ? 11.712  10.570  3.787   1.00 0.91 ? 13  GLU A HG2  1  
ATOM 216   H HG3  . GLU A 1 13  ? 11.028  12.012  3.036   1.00 0.96 ? 13  GLU A HG3  1  
ATOM 217   N N    . ASN A 1 14  ? 9.420   7.687   2.695   1.00 0.52 ? 14  ASN A N    1  
ATOM 218   C CA   . ASN A 1 14  ? 9.922   6.297   2.887   1.00 0.46 ? 14  ASN A CA   1  
ATOM 219   C C    . ASN A 1 14  ? 10.473  5.736   1.568   1.00 0.45 ? 14  ASN A C    1  
ATOM 220   O O    . ASN A 1 14  ? 11.174  4.747   1.566   1.00 0.42 ? 14  ASN A O    1  
ATOM 221   C CB   . ASN A 1 14  ? 8.772   5.414   3.368   1.00 0.46 ? 14  ASN A CB   1  
ATOM 222   C CG   . ASN A 1 14  ? 8.843   5.264   4.890   1.00 0.53 ? 14  ASN A CG   1  
ATOM 223   O OD1  . ASN A 1 14  ? 9.092   4.187   5.395   1.00 1.25 ? 14  ASN A OD1  1  
ATOM 224   N ND2  . ASN A 1 14  ? 8.635   6.307   5.646   1.00 1.22 ? 14  ASN A ND2  1  
ATOM 225   H H    . ASN A 1 14  ? 8.873   7.909   1.914   1.00 0.86 ? 14  ASN A H    1  
ATOM 226   H HA   . ASN A 1 14  ? 10.701  6.294   3.632   1.00 0.46 ? 14  ASN A HA   1  
ATOM 227   H HB2  . ASN A 1 14  ? 7.833   5.871   3.095   1.00 0.58 ? 14  ASN A HB2  1  
ATOM 228   H HB3  . ASN A 1 14  ? 8.847   4.442   2.908   1.00 0.40 ? 14  ASN A HB3  1  
ATOM 229   H HD21 . ASN A 1 14  ? 8.434   7.175   5.238   1.00 1.99 ? 14  ASN A HD21 1  
ATOM 230   H HD22 . ASN A 1 14  ? 8.679   6.222   6.621   1.00 1.27 ? 14  ASN A HD22 1  
ATOM 231   N N    . PHE A 1 15  ? 10.153  6.348   0.450   1.00 0.49 ? 15  PHE A N    1  
ATOM 232   C CA   . PHE A 1 15  ? 10.645  5.838   -0.874  1.00 0.51 ? 15  PHE A CA   1  
ATOM 233   C C    . PHE A 1 15  ? 12.141  5.503   -0.809  1.00 0.50 ? 15  PHE A C    1  
ATOM 234   O O    . PHE A 1 15  ? 12.548  4.404   -1.131  1.00 0.48 ? 15  PHE A O    1  
ATOM 235   C CB   . PHE A 1 15  ? 10.405  6.905   -1.953  1.00 0.59 ? 15  PHE A CB   1  
ATOM 236   C CG   . PHE A 1 15  ? 10.325  6.262   -3.328  1.00 0.78 ? 15  PHE A CG   1  
ATOM 237   C CD1  . PHE A 1 15  ? 11.140  5.169   -3.649  1.00 0.86 ? 15  PHE A CD1  1  
ATOM 238   C CD2  . PHE A 1 15  ? 9.438   6.768   -4.286  1.00 1.58 ? 15  PHE A CD2  1  
ATOM 239   C CE1  . PHE A 1 15  ? 11.070  4.584   -4.914  1.00 1.11 ? 15  PHE A CE1  1  
ATOM 240   C CE2  . PHE A 1 15  ? 9.370   6.181   -5.558  1.00 2.12 ? 15  PHE A CE2  1  
ATOM 241   C CZ   . PHE A 1 15  ? 10.189  5.086   -5.868  1.00 1.76 ? 15  PHE A CZ   1  
ATOM 242   H H    . PHE A 1 15  ? 9.578   7.139   0.476   1.00 0.54 ? 15  PHE A H    1  
ATOM 243   H HA   . PHE A 1 15  ? 10.097  4.943   -1.132  1.00 0.48 ? 15  PHE A HA   1  
ATOM 244   H HB2  . PHE A 1 15  ? 9.479   7.420   -1.746  1.00 0.80 ? 15  PHE A HB2  1  
ATOM 245   H HB3  . PHE A 1 15  ? 11.218  7.616   -1.939  1.00 0.77 ? 15  PHE A HB3  1  
ATOM 246   H HD1  . PHE A 1 15  ? 11.819  4.778   -2.923  1.00 1.26 ? 15  PHE A HD1  1  
ATOM 247   H HD2  . PHE A 1 15  ? 8.806   7.610   -4.046  1.00 1.91 ? 15  PHE A HD2  1  
ATOM 248   H HE1  . PHE A 1 15  ? 11.700  3.740   -5.153  1.00 1.20 ? 15  PHE A HE1  1  
ATOM 249   H HE2  . PHE A 1 15  ? 8.687   6.571   -6.297  1.00 2.87 ? 15  PHE A HE2  1  
ATOM 250   H HZ   . PHE A 1 15  ? 10.144  4.631   -6.845  1.00 2.18 ? 15  PHE A HZ   1  
ATOM 251   N N    . GLU A 1 16  ? 12.966  6.422   -0.409  1.00 0.53 ? 16  GLU A N    1  
ATOM 252   C CA   . GLU A 1 16  ? 14.423  6.115   -0.349  1.00 0.54 ? 16  GLU A CA   1  
ATOM 253   C C    . GLU A 1 16  ? 14.663  5.025   0.689   1.00 0.50 ? 16  GLU A C    1  
ATOM 254   O O    . GLU A 1 16  ? 15.469  4.136   0.491   1.00 0.49 ? 16  GLU A O    1  
ATOM 255   C CB   . GLU A 1 16  ? 15.214  7.375   0.014   1.00 0.60 ? 16  GLU A CB   1  
ATOM 256   C CG   . GLU A 1 16  ? 14.722  7.928   1.354   1.00 1.52 ? 16  GLU A CG   1  
ATOM 257   C CD   . GLU A 1 16  ? 15.461  9.229   1.668   1.00 1.82 ? 16  GLU A CD   1  
ATOM 258   O OE1  . GLU A 1 16  ? 16.681  9.201   1.706   1.00 2.40 ? 16  GLU A OE1  1  
ATOM 259   O OE2  . GLU A 1 16  ? 14.796  10.233  1.866   1.00 2.16 ? 16  GLU A OE2  1  
ATOM 260   H H    . GLU A 1 16  ? 12.634  7.303   -0.157  1.00 0.56 ? 16  GLU A H    1  
ATOM 261   H HA   . GLU A 1 16  ? 14.741  5.747   -1.313  1.00 0.56 ? 16  GLU A HA   1  
ATOM 262   H HB2  . GLU A 1 16  ? 16.264  7.131   0.089   1.00 1.18 ? 16  GLU A HB2  1  
ATOM 263   H HB3  . GLU A 1 16  ? 15.073  8.121   -0.754  1.00 1.17 ? 16  GLU A HB3  1  
ATOM 264   H HG2  . GLU A 1 16  ? 13.661  8.120   1.297   1.00 2.17 ? 16  GLU A HG2  1  
ATOM 265   H HG3  . GLU A 1 16  ? 14.917  7.208   2.134   1.00 2.17 ? 16  GLU A HG3  1  
ATOM 266   N N    . GLU A 1 17  ? 13.952  5.064   1.782   1.00 0.47 ? 17  GLU A N    1  
ATOM 267   C CA   . GLU A 1 17  ? 14.125  4.003   2.810   1.00 0.44 ? 17  GLU A CA   1  
ATOM 268   C C    . GLU A 1 17  ? 13.825  2.648   2.162   1.00 0.40 ? 17  GLU A C    1  
ATOM 269   O O    . GLU A 1 17  ? 14.267  1.617   2.622   1.00 0.38 ? 17  GLU A O    1  
ATOM 270   C CB   . GLU A 1 17  ? 13.154  4.244   3.965   1.00 0.43 ? 17  GLU A CB   1  
ATOM 271   C CG   . GLU A 1 17  ? 13.792  3.792   5.279   1.00 0.68 ? 17  GLU A CG   1  
ATOM 272   C CD   . GLU A 1 17  ? 13.141  4.538   6.445   1.00 0.65 ? 17  GLU A CD   1  
ATOM 273   O OE1  . GLU A 1 17  ? 12.020  4.199   6.787   1.00 1.29 ? 17  GLU A OE1  1  
ATOM 274   O OE2  . GLU A 1 17  ? 13.774  5.436   6.975   1.00 1.34 ? 17  GLU A OE2  1  
ATOM 275   H H    . GLU A 1 17  ? 13.291  5.775   1.915   1.00 0.49 ? 17  GLU A H    1  
ATOM 276   H HA   . GLU A 1 17  ? 15.140  4.013   3.177   1.00 0.47 ? 17  GLU A HA   1  
ATOM 277   H HB2  . GLU A 1 17  ? 12.917  5.297   4.022   1.00 0.52 ? 17  GLU A HB2  1  
ATOM 278   H HB3  . GLU A 1 17  ? 12.252  3.681   3.794   1.00 0.53 ? 17  GLU A HB3  1  
ATOM 279   H HG2  . GLU A 1 17  ? 13.644  2.729   5.403   1.00 1.10 ? 17  GLU A HG2  1  
ATOM 280   H HG3  . GLU A 1 17  ? 14.849  4.010   5.260   1.00 1.05 ? 17  GLU A HG3  1  
ATOM 281   N N    . LEU A 1 18  ? 13.075  2.655   1.086   1.00 0.39 ? 18  LEU A N    1  
ATOM 282   C CA   . LEU A 1 18  ? 12.738  1.388   0.387   1.00 0.37 ? 18  LEU A CA   1  
ATOM 283   C C    . LEU A 1 18  ? 13.951  0.895   -0.379  1.00 0.40 ? 18  LEU A C    1  
ATOM 284   O O    . LEU A 1 18  ? 14.362  -0.241  -0.254  1.00 0.40 ? 18  LEU A O    1  
ATOM 285   C CB   . LEU A 1 18  ? 11.615  1.627   -0.625  1.00 0.38 ? 18  LEU A CB   1  
ATOM 286   C CG   . LEU A 1 18  ? 10.564  2.597   -0.091  1.00 0.38 ? 18  LEU A CG   1  
ATOM 287   C CD1  . LEU A 1 18  ? 9.339   2.524   -0.993  1.00 0.40 ? 18  LEU A CD1  1  
ATOM 288   C CD2  . LEU A 1 18  ? 10.156  2.231   1.334   1.00 0.33 ? 18  LEU A CD2  1  
ATOM 289   H H    . LEU A 1 18  ? 12.735  3.497   0.737   1.00 0.41 ? 18  LEU A H    1  
ATOM 290   H HA   . LEU A 1 18  ? 12.435  0.646   1.103   1.00 0.34 ? 18  LEU A HA   1  
ATOM 291   H HB2  . LEU A 1 18  ? 12.040  2.040   -1.528  1.00 0.44 ? 18  LEU A HB2  1  
ATOM 292   H HB3  . LEU A 1 18  ? 11.145  0.690   -0.854  1.00 0.37 ? 18  LEU A HB3  1  
ATOM 293   H HG   . LEU A 1 18  ? 10.959  3.593   -0.108  1.00 0.41 ? 18  LEU A HG   1  
ATOM 294   H HD11 . LEU A 1 18  ? 9.658   2.413   -2.019  1.00 1.00 ? 18  LEU A HD11 1  
ATOM 295   H HD12 . LEU A 1 18  ? 8.736   1.674   -0.710  1.00 1.13 ? 18  LEU A HD12 1  
ATOM 296   H HD13 . LEU A 1 18  ? 8.762   3.429   -0.889  1.00 1.08 ? 18  LEU A HD13 1  
ATOM 297   H HD21 . LEU A 1 18  ? 11.026  1.930   1.897   1.00 1.12 ? 18  LEU A HD21 1  
ATOM 298   H HD22 . LEU A 1 18  ? 9.702   3.088   1.806   1.00 1.01 ? 18  LEU A HD22 1  
ATOM 299   H HD23 . LEU A 1 18  ? 9.447   1.420   1.302   1.00 1.04 ? 18  LEU A HD23 1  
ATOM 300   N N    . LEU A 1 19  ? 14.519  1.741   -1.187  1.00 0.45 ? 19  LEU A N    1  
ATOM 301   C CA   . LEU A 1 19  ? 15.699  1.317   -1.973  1.00 0.49 ? 19  LEU A CA   1  
ATOM 302   C C    . LEU A 1 19  ? 16.941  1.338   -1.073  1.00 0.50 ? 19  LEU A C    1  
ATOM 303   O O    . LEU A 1 19  ? 18.037  1.031   -1.501  1.00 0.56 ? 19  LEU A O    1  
ATOM 304   C CB   . LEU A 1 19  ? 15.889  2.254   -3.174  1.00 0.56 ? 19  LEU A CB   1  
ATOM 305   C CG   . LEU A 1 19  ? 14.575  2.383   -3.974  1.00 0.58 ? 19  LEU A CG   1  
ATOM 306   C CD1  . LEU A 1 19  ? 13.728  1.109   -3.849  1.00 0.53 ? 19  LEU A CD1  1  
ATOM 307   C CD2  . LEU A 1 19  ? 13.776  3.571   -3.446  1.00 0.62 ? 19  LEU A CD2  1  
ATOM 308   H H    . LEU A 1 19  ? 14.165  2.649   -1.277  1.00 0.46 ? 19  LEU A H    1  
ATOM 309   H HA   . LEU A 1 19  ? 15.529  0.316   -2.326  1.00 0.47 ? 19  LEU A HA   1  
ATOM 310   H HB2  . LEU A 1 19  ? 16.187  3.230   -2.819  1.00 0.60 ? 19  LEU A HB2  1  
ATOM 311   H HB3  . LEU A 1 19  ? 16.659  1.858   -3.817  1.00 0.58 ? 19  LEU A HB3  1  
ATOM 312   H HG   . LEU A 1 19  ? 14.805  2.548   -5.015  1.00 0.63 ? 19  LEU A HG   1  
ATOM 313   H HD11 . LEU A 1 19  ? 14.371  0.244   -3.886  1.00 1.13 ? 19  LEU A HD11 1  
ATOM 314   H HD12 . LEU A 1 19  ? 13.192  1.122   -2.912  1.00 1.19 ? 19  LEU A HD12 1  
ATOM 315   H HD13 . LEU A 1 19  ? 13.022  1.067   -4.665  1.00 1.03 ? 19  LEU A HD13 1  
ATOM 316   H HD21 . LEU A 1 19  ? 14.402  4.174   -2.805  1.00 1.16 ? 19  LEU A HD21 1  
ATOM 317   H HD22 . LEU A 1 19  ? 13.430  4.168   -4.276  1.00 1.06 ? 19  LEU A HD22 1  
ATOM 318   H HD23 . LEU A 1 19  ? 12.927  3.211   -2.885  1.00 1.24 ? 19  LEU A HD23 1  
ATOM 319   N N    . LYS A 1 20  ? 16.770  1.694   0.176   1.00 0.47 ? 20  LYS A N    1  
ATOM 320   C CA   . LYS A 1 20  ? 17.914  1.735   1.121   1.00 0.50 ? 20  LYS A CA   1  
ATOM 321   C C    . LYS A 1 20  ? 17.863  0.504   2.028   1.00 0.47 ? 20  LYS A C    1  
ATOM 322   O O    . LYS A 1 20  ? 18.871  0.041   2.524   1.00 0.50 ? 20  LYS A O    1  
ATOM 323   C CB   . LYS A 1 20  ? 17.799  2.993   1.982   1.00 0.53 ? 20  LYS A CB   1  
ATOM 324   C CG   . LYS A 1 20  ? 18.533  4.151   1.305   1.00 0.59 ? 20  LYS A CG   1  
ATOM 325   C CD   . LYS A 1 20  ? 18.761  5.279   2.318   1.00 0.63 ? 20  LYS A CD   1  
ATOM 326   C CE   . LYS A 1 20  ? 20.261  5.554   2.454   1.00 1.22 ? 20  LYS A CE   1  
ATOM 327   N NZ   . LYS A 1 20  ? 20.527  6.227   3.757   1.00 1.63 ? 20  LYS A NZ   1  
ATOM 328   H H    . LYS A 1 20  ? 15.881  1.933   0.496   1.00 0.45 ? 20  LYS A H    1  
ATOM 329   H HA   . LYS A 1 20  ? 18.839  1.748   0.572   1.00 0.53 ? 20  LYS A HA   1  
ATOM 330   H HB2  . LYS A 1 20  ? 16.757  3.250   2.101   1.00 0.51 ? 20  LYS A HB2  1  
ATOM 331   H HB3  . LYS A 1 20  ? 18.234  2.806   2.949   1.00 0.54 ? 20  LYS A HB3  1  
ATOM 332   H HG2  . LYS A 1 20  ? 19.484  3.802   0.930   1.00 0.62 ? 20  LYS A HG2  1  
ATOM 333   H HG3  . LYS A 1 20  ? 17.937  4.522   0.486   1.00 0.59 ? 20  LYS A HG3  1  
ATOM 334   H HD2  . LYS A 1 20  ? 18.261  6.173   1.977   1.00 1.00 ? 20  LYS A HD2  1  
ATOM 335   H HD3  . LYS A 1 20  ? 18.363  4.988   3.279   1.00 1.02 ? 20  LYS A HD3  1  
ATOM 336   H HE2  . LYS A 1 20  ? 20.804  4.622   2.413   1.00 1.82 ? 20  LYS A HE2  1  
ATOM 337   H HE3  . LYS A 1 20  ? 20.584  6.194   1.646   1.00 1.78 ? 20  LYS A HE3  1  
ATOM 338   H HZ1  . LYS A 1 20  ? 19.858  7.013   3.884   1.00 1.99 ? 20  LYS A HZ1  1  
ATOM 339   H HZ2  . LYS A 1 20  ? 20.407  5.544   4.531   1.00 1.96 ? 20  LYS A HZ2  1  
ATOM 340   H HZ3  . LYS A 1 20  ? 21.500  6.595   3.764   1.00 2.12 ? 20  LYS A HZ3  1  
ATOM 341   N N    . VAL A 1 21  ? 16.688  -0.019  2.255   1.00 0.42 ? 21  VAL A N    1  
ATOM 342   C CA   . VAL A 1 21  ? 16.550  -1.207  3.135   1.00 0.41 ? 21  VAL A CA   1  
ATOM 343   C C    . VAL A 1 21  ? 16.628  -2.480  2.297   1.00 0.39 ? 21  VAL A C    1  
ATOM 344   O O    . VAL A 1 21  ? 17.151  -3.485  2.737   1.00 0.41 ? 21  VAL A O    1  
ATOM 345   C CB   . VAL A 1 21  ? 15.206  -1.149  3.859   1.00 0.38 ? 21  VAL A CB   1  
ATOM 346   C CG1  . VAL A 1 21  ? 15.173  0.074   4.777   1.00 0.43 ? 21  VAL A CG1  1  
ATOM 347   C CG2  . VAL A 1 21  ? 14.068  -1.056  2.839   1.00 0.33 ? 21  VAL A CG2  1  
ATOM 348   H H    . VAL A 1 21  ? 15.895  0.375   1.851   1.00 0.41 ? 21  VAL A H    1  
ATOM 349   H HA   . VAL A 1 21  ? 17.349  -1.210  3.860   1.00 0.44 ? 21  VAL A HA   1  
ATOM 350   H HB   . VAL A 1 21  ? 15.085  -2.038  4.447   1.00 0.39 ? 21  VAL A HB   1  
ATOM 351   H HG11 . VAL A 1 21  ? 15.759  0.868   4.340   1.00 1.20 ? 21  VAL A HG11 1  
ATOM 352   H HG12 . VAL A 1 21  ? 14.152  0.405   4.899   1.00 1.01 ? 21  VAL A HG12 1  
ATOM 353   H HG13 . VAL A 1 21  ? 15.583  -0.189  5.741   1.00 1.10 ? 21  VAL A HG13 1  
ATOM 354   H HG21 . VAL A 1 21  ? 14.464  -0.767  1.879   1.00 0.96 ? 21  VAL A HG21 1  
ATOM 355   H HG22 . VAL A 1 21  ? 13.584  -2.017  2.753   1.00 1.11 ? 21  VAL A HG22 1  
ATOM 356   H HG23 . VAL A 1 21  ? 13.350  -0.320  3.167   1.00 1.07 ? 21  VAL A HG23 1  
ATOM 357   N N    . LEU A 1 22  ? 16.130  -2.449  1.085   1.00 0.39 ? 22  LEU A N    1  
ATOM 358   C CA   . LEU A 1 22  ? 16.207  -3.668  0.232   1.00 0.40 ? 22  LEU A CA   1  
ATOM 359   C C    . LEU A 1 22  ? 17.672  -4.094  0.126   1.00 0.43 ? 22  LEU A C    1  
ATOM 360   O O    . LEU A 1 22  ? 17.982  -5.231  -0.171  1.00 0.49 ? 22  LEU A O    1  
ATOM 361   C CB   . LEU A 1 22  ? 15.628  -3.387  -1.168  1.00 0.45 ? 22  LEU A CB   1  
ATOM 362   C CG   . LEU A 1 22  ? 16.278  -2.159  -1.814  1.00 0.52 ? 22  LEU A CG   1  
ATOM 363   C CD1  . LEU A 1 22  ? 17.721  -2.468  -2.225  1.00 0.74 ? 22  LEU A CD1  1  
ATOM 364   C CD2  . LEU A 1 22  ? 15.477  -1.793  -3.064  1.00 1.29 ? 22  LEU A CD2  1  
ATOM 365   H H    . LEU A 1 22  ? 15.724  -1.630  0.738   1.00 0.39 ? 22  LEU A H    1  
ATOM 366   H HA   . LEU A 1 22  ? 15.641  -4.465  0.699   1.00 0.41 ? 22  LEU A HA   1  
ATOM 367   H HB2  . LEU A 1 22  ? 15.793  -4.242  -1.801  1.00 0.61 ? 22  LEU A HB2  1  
ATOM 368   H HB3  . LEU A 1 22  ? 14.565  -3.211  -1.080  1.00 0.57 ? 22  LEU A HB3  1  
ATOM 369   H HG   . LEU A 1 22  ? 16.266  -1.332  -1.121  1.00 1.07 ? 22  LEU A HG   1  
ATOM 370   H HD11 . LEU A 1 22  ? 17.875  -3.537  -2.227  1.00 1.33 ? 22  LEU A HD11 1  
ATOM 371   H HD12 . LEU A 1 22  ? 17.905  -2.078  -3.215  1.00 1.41 ? 22  LEU A HD12 1  
ATOM 372   H HD13 . LEU A 1 22  ? 18.401  -2.005  -1.526  1.00 1.31 ? 22  LEU A HD13 1  
ATOM 373   H HD21 . LEU A 1 22  ? 15.317  -2.678  -3.660  1.00 1.67 ? 22  LEU A HD21 1  
ATOM 374   H HD22 . LEU A 1 22  ? 14.524  -1.378  -2.771  1.00 1.89 ? 22  LEU A HD22 1  
ATOM 375   H HD23 . LEU A 1 22  ? 16.025  -1.063  -3.642  1.00 1.89 ? 22  LEU A HD23 1  
ATOM 376   N N    . GLY A 1 23  ? 18.577  -3.180  0.376   1.00 0.44 ? 23  GLY A N    1  
ATOM 377   C CA   . GLY A 1 23  ? 20.019  -3.513  0.302   1.00 0.50 ? 23  GLY A CA   1  
ATOM 378   C C    . GLY A 1 23  ? 20.740  -2.466  -0.531  1.00 0.54 ? 23  GLY A C    1  
ATOM 379   O O    . GLY A 1 23  ? 21.103  -2.707  -1.666  1.00 0.58 ? 23  GLY A O    1  
ATOM 380   H H    . GLY A 1 23  ? 18.304  -2.270  0.615   1.00 0.43 ? 23  GLY A H    1  
ATOM 381   H HA2  . GLY A 1 23  ? 20.436  -3.529  1.299   1.00 0.53 ? 23  GLY A HA2  1  
ATOM 382   H HA3  . GLY A 1 23  ? 20.140  -4.473  -0.158  1.00 0.51 ? 23  GLY A HA3  1  
ATOM 383   N N    . VAL A 1 24  ? 20.947  -1.304  0.025   1.00 0.58 ? 24  VAL A N    1  
ATOM 384   C CA   . VAL A 1 24  ? 21.651  -0.223  -0.725  1.00 0.68 ? 24  VAL A CA   1  
ATOM 385   C C    . VAL A 1 24  ? 22.872  -0.807  -1.446  1.00 0.75 ? 24  VAL A C    1  
ATOM 386   O O    . VAL A 1 24  ? 23.565  -1.663  -0.931  1.00 0.78 ? 24  VAL A O    1  
ATOM 387   C CB   . VAL A 1 24  ? 22.078  0.877   0.258   1.00 0.75 ? 24  VAL A CB   1  
ATOM 388   C CG1  . VAL A 1 24  ? 23.606  0.927   0.390   1.00 0.86 ? 24  VAL A CG1  1  
ATOM 389   C CG2  . VAL A 1 24  ? 21.578  2.232   -0.250  1.00 0.80 ? 24  VAL A CG2  1  
ATOM 390   H H    . VAL A 1 24  ? 20.635  -1.141  0.941   1.00 0.58 ? 24  VAL A H    1  
ATOM 391   H HA   . VAL A 1 24  ? 20.976  0.195   -1.458  1.00 0.68 ? 24  VAL A HA   1  
ATOM 392   H HB   . VAL A 1 24  ? 21.642  0.670   1.225   1.00 0.71 ? 24  VAL A HB   1  
ATOM 393   H HG11 . VAL A 1 24  ? 23.976  -0.048  0.670   1.00 1.25 ? 24  VAL A HG11 1  
ATOM 394   H HG12 . VAL A 1 24  ? 24.040  1.217   -0.557  1.00 1.30 ? 24  VAL A HG12 1  
ATOM 395   H HG13 . VAL A 1 24  ? 23.880  1.648   1.146   1.00 1.46 ? 24  VAL A HG13 1  
ATOM 396   H HG21 . VAL A 1 24  ? 20.513  2.182   -0.423  1.00 1.22 ? 24  VAL A HG21 1  
ATOM 397   H HG22 . VAL A 1 24  ? 21.788  2.994   0.487   1.00 1.34 ? 24  VAL A HG22 1  
ATOM 398   H HG23 . VAL A 1 24  ? 22.081  2.478   -1.174  1.00 1.32 ? 24  VAL A HG23 1  
ATOM 399   N N    . ASN A 1 25  ? 23.126  -0.348  -2.634  1.00 0.80 ? 25  ASN A N    1  
ATOM 400   C CA   . ASN A 1 25  ? 24.285  -0.856  -3.418  1.00 0.89 ? 25  ASN A CA   1  
ATOM 401   C C    . ASN A 1 25  ? 24.301  -0.105  -4.739  1.00 0.99 ? 25  ASN A C    1  
ATOM 402   O O    . ASN A 1 25  ? 24.068  -0.669  -5.788  1.00 1.01 ? 25  ASN A O    1  
ATOM 403   C CB   . ASN A 1 25  ? 24.121  -2.358  -3.675  1.00 0.84 ? 25  ASN A CB   1  
ATOM 404   C CG   . ASN A 1 25  ? 25.389  -2.905  -4.335  1.00 1.58 ? 25  ASN A CG   1  
ATOM 405   O OD1  . ASN A 1 25  ? 26.437  -2.295  -4.265  1.00 2.26 ? 25  ASN A OD1  1  
ATOM 406   N ND2  . ASN A 1 25  ? 25.336  -4.040  -4.978  1.00 2.17 ? 25  ASN A ND2  1  
ATOM 407   H H    . ASN A 1 25  ? 22.545  0.343   -3.022  1.00 0.81 ? 25  ASN A H    1  
ATOM 408   H HA   . ASN A 1 25  ? 25.203  -0.671  -2.879  1.00 0.95 ? 25  ASN A HA   1  
ATOM 409   H HB2  . ASN A 1 25  ? 23.953  -2.868  -2.739  1.00 1.29 ? 25  ASN A HB2  1  
ATOM 410   H HB3  . ASN A 1 25  ? 23.278  -2.521  -4.330  1.00 0.94 ? 25  ASN A HB3  1  
ATOM 411   H HD21 . ASN A 1 25  ? 24.491  -4.533  -5.035  1.00 2.34 ? 25  ASN A HD21 1  
ATOM 412   H HD22 . ASN A 1 25  ? 26.143  -4.400  -5.404  1.00 2.78 ? 25  ASN A HD22 1  
ATOM 413   N N    . VAL A 1 26  ? 24.537  1.180   -4.671  1.00 1.09 ? 26  VAL A N    1  
ATOM 414   C CA   . VAL A 1 26  ? 24.539  2.047   -5.888  1.00 1.21 ? 26  VAL A CA   1  
ATOM 415   C C    . VAL A 1 26  ? 23.126  2.587   -6.109  1.00 1.18 ? 26  VAL A C    1  
ATOM 416   O O    . VAL A 1 26  ? 22.929  3.550   -6.825  1.00 1.31 ? 26  VAL A O    1  
ATOM 417   C CB   . VAL A 1 26  ? 24.997  1.279   -7.132  1.00 1.28 ? 26  VAL A CB   1  
ATOM 418   C CG1  . VAL A 1 26  ? 25.119  2.249   -8.306  1.00 1.43 ? 26  VAL A CG1  1  
ATOM 419   C CG2  . VAL A 1 26  ? 26.355  0.625   -6.860  1.00 1.34 ? 26  VAL A CG2  1  
ATOM 420   H H    . VAL A 1 26  ? 24.687  1.591   -3.793  1.00 1.09 ? 26  VAL A H    1  
ATOM 421   H HA   . VAL A 1 26  ? 25.203  2.882   -5.714  1.00 1.32 ? 26  VAL A HA   1  
ATOM 422   H HB   . VAL A 1 26  ? 24.270  0.519   -7.376  1.00 1.21 ? 26  VAL A HB   1  
ATOM 423   H HG11 . VAL A 1 26  ? 25.811  3.037   -8.051  1.00 1.80 ? 26  VAL A HG11 1  
ATOM 424   H HG12 . VAL A 1 26  ? 25.479  1.719   -9.175  1.00 1.74 ? 26  VAL A HG12 1  
ATOM 425   H HG13 . VAL A 1 26  ? 24.150  2.676   -8.521  1.00 1.81 ? 26  VAL A HG13 1  
ATOM 426   H HG21 . VAL A 1 26  ? 26.486  0.497   -5.795  1.00 1.65 ? 26  VAL A HG21 1  
ATOM 427   H HG22 . VAL A 1 26  ? 26.395  -0.338  -7.346  1.00 1.50 ? 26  VAL A HG22 1  
ATOM 428   H HG23 . VAL A 1 26  ? 27.142  1.256   -7.245  1.00 1.90 ? 26  VAL A HG23 1  
ATOM 429   N N    . MET A 1 27  ? 22.141  2.001   -5.472  1.00 1.05 ? 27  MET A N    1  
ATOM 430   C CA   . MET A 1 27  ? 20.758  2.511   -5.618  1.00 1.06 ? 27  MET A CA   1  
ATOM 431   C C    . MET A 1 27  ? 20.762  3.937   -5.088  1.00 1.18 ? 27  MET A C    1  
ATOM 432   O O    . MET A 1 27  ? 20.556  4.884   -5.822  1.00 1.50 ? 27  MET A O    1  
ATOM 433   C CB   . MET A 1 27  ? 19.801  1.654   -4.783  1.00 0.94 ? 27  MET A CB   1  
ATOM 434   C CG   . MET A 1 27  ? 20.039  0.164   -5.063  1.00 0.87 ? 27  MET A CG   1  
ATOM 435   S SD   . MET A 1 27  ? 18.754  -0.458  -6.176  1.00 0.98 ? 27  MET A SD   1  
ATOM 436   C CE   . MET A 1 27  ? 19.753  -1.736  -6.978  1.00 1.55 ? 27  MET A CE   1  
ATOM 437   H H    . MET A 1 27  ? 22.316  1.251   -4.876  1.00 0.97 ? 27  MET A H    1  
ATOM 438   H HA   . MET A 1 27  ? 20.460  2.501   -6.660  1.00 1.14 ? 27  MET A HA   1  
ATOM 439   H HB2  . MET A 1 27  ? 19.967  1.852   -3.734  1.00 0.91 ? 27  MET A HB2  1  
ATOM 440   H HB3  . MET A 1 27  ? 18.787  1.907   -5.037  1.00 0.99 ? 27  MET A HB3  1  
ATOM 441   H HG2  . MET A 1 27  ? 21.006  0.029   -5.521  1.00 0.92 ? 27  MET A HG2  1  
ATOM 442   H HG3  . MET A 1 27  ? 20.004  -0.384  -4.133  1.00 0.78 ? 27  MET A HG3  1  
ATOM 443   H HE1  . MET A 1 27  ? 20.778  -1.398  -7.049  1.00 2.13 ? 27  MET A HE1  1  
ATOM 444   H HE2  . MET A 1 27  ? 19.715  -2.642  -6.397  1.00 1.93 ? 27  MET A HE2  1  
ATOM 445   H HE3  . MET A 1 27  ? 19.363  -1.928  -7.968  1.00 1.94 ? 27  MET A HE3  1  
ATOM 446   N N    . LEU A 1 28  ? 21.042  4.092   -3.817  1.00 1.11 ? 28  LEU A N    1  
ATOM 447   C CA   . LEU A 1 28  ? 21.112  5.453   -3.221  1.00 1.25 ? 28  LEU A CA   1  
ATOM 448   C C    . LEU A 1 28  ? 19.920  6.285   -3.701  1.00 1.32 ? 28  LEU A C    1  
ATOM 449   O O    . LEU A 1 28  ? 20.055  7.154   -4.540  1.00 1.53 ? 28  LEU A O    1  
ATOM 450   C CB   . LEU A 1 28  ? 22.427  6.092   -3.667  1.00 1.33 ? 28  LEU A CB   1  
ATOM 451   C CG   . LEU A 1 28  ? 23.412  6.144   -2.493  1.00 1.38 ? 28  LEU A CG   1  
ATOM 452   C CD1  . LEU A 1 28  ? 22.822  6.980   -1.353  1.00 1.67 ? 28  LEU A CD1  1  
ATOM 453   C CD2  . LEU A 1 28  ? 23.687  4.721   -1.997  1.00 1.41 ? 28  LEU A CD2  1  
ATOM 454   H H    . LEU A 1 28  ? 21.237  3.308   -3.262  1.00 1.10 ? 28  LEU A H    1  
ATOM 455   H HA   . LEU A 1 28  ? 21.093  5.384   -2.149  1.00 1.31 ? 28  LEU A HA   1  
ATOM 456   H HB2  . LEU A 1 28  ? 22.856  5.496   -4.465  1.00 1.44 ? 28  LEU A HB2  1  
ATOM 457   H HB3  . LEU A 1 28  ? 22.239  7.086   -4.023  1.00 1.48 ? 28  LEU A HB3  1  
ATOM 458   H HG   . LEU A 1 28  ? 24.338  6.594   -2.823  1.00 1.53 ? 28  LEU A HG   1  
ATOM 459   H HD11 . LEU A 1 28  ? 21.766  7.130   -1.523  1.00 2.04 ? 28  LEU A HD11 1  
ATOM 460   H HD12 . LEU A 1 28  ? 22.966  6.463   -0.415  1.00 2.20 ? 28  LEU A HD12 1  
ATOM 461   H HD13 . LEU A 1 28  ? 23.319  7.937   -1.316  1.00 1.87 ? 28  LEU A HD13 1  
ATOM 462   H HD21 . LEU A 1 28  ? 23.635  4.034   -2.829  1.00 1.64 ? 28  LEU A HD21 1  
ATOM 463   H HD22 . LEU A 1 28  ? 24.672  4.677   -1.556  1.00 1.61 ? 28  LEU A HD22 1  
ATOM 464   H HD23 . LEU A 1 28  ? 22.949  4.448   -1.258  1.00 2.01 ? 28  LEU A HD23 1  
ATOM 465   N N    . ARG A 1 29  ? 18.745  5.998   -3.198  1.00 1.32 ? 29  ARG A N    1  
ATOM 466   C CA   . ARG A 1 29  ? 17.534  6.743   -3.652  1.00 1.45 ? 29  ARG A CA   1  
ATOM 467   C C    . ARG A 1 29  ? 17.379  6.530   -5.160  1.00 1.47 ? 29  ARG A C    1  
ATOM 468   O O    . ARG A 1 29  ? 16.734  7.298   -5.844  1.00 1.63 ? 29  ARG A O    1  
ATOM 469   C CB   . ARG A 1 29  ? 17.696  8.238   -3.362  1.00 1.66 ? 29  ARG A CB   1  
ATOM 470   C CG   . ARG A 1 29  ? 18.009  8.444   -1.879  1.00 2.26 ? 29  ARG A CG   1  
ATOM 471   C CD   . ARG A 1 29  ? 18.867  9.699   -1.711  1.00 2.70 ? 29  ARG A CD   1  
ATOM 472   N NE   . ARG A 1 29  ? 18.030  10.909  -1.948  1.00 3.09 ? 29  ARG A NE   1  
ATOM 473   C CZ   . ARG A 1 29  ? 18.464  12.084  -1.584  1.00 3.56 ? 29  ARG A CZ   1  
ATOM 474   N NH1  . ARG A 1 29  ? 19.301  12.735  -2.344  1.00 3.97 ? 29  ARG A NH1  1  
ATOM 475   N NH2  . ARG A 1 29  ? 18.063  12.607  -0.458  1.00 4.07 ? 29  ARG A NH2  1  
ATOM 476   H H    . ARG A 1 29  ? 18.658  5.276   -2.542  1.00 1.36 ? 29  ARG A H    1  
ATOM 477   H HA   . ARG A 1 29  ? 16.662  6.363   -3.139  1.00 1.45 ? 29  ARG A HA   1  
ATOM 478   H HB2  . ARG A 1 29  ? 18.503  8.635   -3.959  1.00 1.96 ? 29  ARG A HB2  1  
ATOM 479   H HB3  . ARG A 1 29  ? 16.779  8.752   -3.608  1.00 1.89 ? 29  ARG A HB3  1  
ATOM 480   H HG2  . ARG A 1 29  ? 17.085  8.561   -1.330  1.00 2.62 ? 29  ARG A HG2  1  
ATOM 481   H HG3  . ARG A 1 29  ? 18.547  7.589   -1.501  1.00 2.69 ? 29  ARG A HG3  1  
ATOM 482   H HD2  . ARG A 1 29  ? 19.267  9.730   -0.708  1.00 3.10 ? 29  ARG A HD2  1  
ATOM 483   H HD3  . ARG A 1 29  ? 19.679  9.678   -2.423  1.00 3.00 ? 29  ARG A HD3  1  
ATOM 484   H HE   . ARG A 1 29  ? 17.154  10.822  -2.379  1.00 3.36 ? 29  ARG A HE   1  
ATOM 485   H HH11 . ARG A 1 29  ? 19.609  12.334  -3.207  1.00 4.03 ? 29  ARG A HH11 1  
ATOM 486   H HH12 . ARG A 1 29  ? 19.634  13.635  -2.064  1.00 4.48 ? 29  ARG A HH12 1  
ATOM 487   H HH21 . ARG A 1 29  ? 17.422  12.108  0.126   1.00 4.21 ? 29  ARG A HH21 1  
ATOM 488   H HH22 . ARG A 1 29  ? 18.397  13.508  -0.178  1.00 4.56 ? 29  ARG A HH22 1  
ATOM 489   N N    . LYS A 1 30  ? 17.990  5.489   -5.674  1.00 1.37 ? 30  LYS A N    1  
ATOM 490   C CA   . LYS A 1 30  ? 17.925  5.186   -7.135  1.00 1.48 ? 30  LYS A CA   1  
ATOM 491   C C    . LYS A 1 30  ? 18.093  6.467   -7.964  1.00 1.86 ? 30  LYS A C    1  
ATOM 492   O O    . LYS A 1 30  ? 17.636  6.550   -9.087  1.00 2.27 ? 30  LYS A O    1  
ATOM 493   C CB   . LYS A 1 30  ? 16.595  4.510   -7.459  1.00 1.38 ? 30  LYS A CB   1  
ATOM 494   C CG   . LYS A 1 30  ? 16.836  3.015   -7.680  1.00 1.12 ? 30  LYS A CG   1  
ATOM 495   C CD   . LYS A 1 30  ? 15.556  2.360   -8.202  1.00 1.22 ? 30  LYS A CD   1  
ATOM 496   C CE   . LYS A 1 30  ? 15.917  1.218   -9.153  1.00 1.75 ? 30  LYS A CE   1  
ATOM 497   N NZ   . LYS A 1 30  ? 14.769  0.950   -10.064 1.00 2.05 ? 30  LYS A NZ   1  
ATOM 498   H H    . LYS A 1 30  ? 18.505  4.898   -5.090  1.00 1.29 ? 30  LYS A H    1  
ATOM 499   H HA   . LYS A 1 30  ? 18.727  4.510   -7.381  1.00 1.54 ? 30  LYS A HA   1  
ATOM 500   H HB2  . LYS A 1 30  ? 15.913  4.646   -6.634  1.00 1.59 ? 30  LYS A HB2  1  
ATOM 501   H HB3  . LYS A 1 30  ? 16.175  4.942   -8.354  1.00 1.50 ? 30  LYS A HB3  1  
ATOM 502   H HG2  . LYS A 1 30  ? 17.632  2.882   -8.401  1.00 1.17 ? 30  LYS A HG2  1  
ATOM 503   H HG3  . LYS A 1 30  ? 17.121  2.554   -6.746  1.00 1.12 ? 30  LYS A HG3  1  
ATOM 504   H HD2  . LYS A 1 30  ? 14.986  1.971   -7.370  1.00 1.38 ? 30  LYS A HD2  1  
ATOM 505   H HD3  . LYS A 1 30  ? 14.966  3.093   -8.731  1.00 1.61 ? 30  LYS A HD3  1  
ATOM 506   H HE2  . LYS A 1 30  ? 16.783  1.495   -9.736  1.00 2.27 ? 30  LYS A HE2  1  
ATOM 507   H HE3  . LYS A 1 30  ? 16.138  0.330   -8.581  1.00 2.20 ? 30  LYS A HE3  1  
ATOM 508   H HZ1  . LYS A 1 30  ? 13.885  0.953   -9.518  1.00 2.39 ? 30  LYS A HZ1  1  
ATOM 509   H HZ2  . LYS A 1 30  ? 14.729  1.689   -10.796 1.00 2.36 ? 30  LYS A HZ2  1  
ATOM 510   H HZ3  . LYS A 1 30  ? 14.894  0.022   -10.514 1.00 2.41 ? 30  LYS A HZ3  1  
ATOM 511   N N    . ILE A 1 31  ? 18.767  7.451   -7.414  1.00 1.96 ? 31  ILE A N    1  
ATOM 512   C CA   . ILE A 1 31  ? 19.010  8.741   -8.136  1.00 2.46 ? 31  ILE A CA   1  
ATOM 513   C C    . ILE A 1 31  ? 17.887  9.038   -9.139  1.00 2.52 ? 31  ILE A C    1  
ATOM 514   O O    . ILE A 1 31  ? 18.133  9.342   -10.290 1.00 2.85 ? 31  ILE A O    1  
ATOM 515   C CB   . ILE A 1 31  ? 20.353  8.654   -8.862  1.00 2.73 ? 31  ILE A CB   1  
ATOM 516   C CG1  . ILE A 1 31  ? 21.396  8.013   -7.933  1.00 2.67 ? 31  ILE A CG1  1  
ATOM 517   C CG2  . ILE A 1 31  ? 20.812  10.059  -9.254  1.00 3.02 ? 31  ILE A CG2  1  
ATOM 518   C CD1  . ILE A 1 31  ? 21.694  6.588   -8.403  1.00 3.05 ? 31  ILE A CD1  1  
ATOM 519   H H    . ILE A 1 31  ? 19.134  7.335   -6.516  1.00 1.85 ? 31  ILE A H    1  
ATOM 520   H HA   . ILE A 1 31  ? 19.057  9.540   -7.418  1.00 2.70 ? 31  ILE A HA   1  
ATOM 521   H HB   . ILE A 1 31  ? 20.238  8.055   -9.748  1.00 2.86 ? 31  ILE A HB   1  
ATOM 522   H HG12 . ILE A 1 31  ? 22.306  8.595   -7.951  1.00 2.89 ? 31  ILE A HG12 1  
ATOM 523   H HG13 . ILE A 1 31  ? 21.011  7.981   -6.923  1.00 2.74 ? 31  ILE A HG13 1  
ATOM 524   H HG21 . ILE A 1 31  ? 20.478  10.768  -8.510  1.00 3.06 ? 31  ILE A HG21 1  
ATOM 525   H HG22 . ILE A 1 31  ? 21.890  10.081  -9.315  1.00 3.33 ? 31  ILE A HG22 1  
ATOM 526   H HG23 . ILE A 1 31  ? 20.391  10.320  -10.214 1.00 3.37 ? 31  ILE A HG23 1  
ATOM 527   H HD11 . ILE A 1 31  ? 20.838  6.197   -8.932  1.00 3.45 ? 31  ILE A HD11 1  
ATOM 528   H HD12 . ILE A 1 31  ? 22.551  6.596   -9.060  1.00 3.42 ? 31  ILE A HD12 1  
ATOM 529   H HD13 . ILE A 1 31  ? 21.903  5.963   -7.547  1.00 3.25 ? 31  ILE A HD13 1  
ATOM 530   N N    . ALA A 1 32  ? 16.656  8.953   -8.706  1.00 2.49 ? 32  ALA A N    1  
ATOM 531   C CA   . ALA A 1 32  ? 15.515  9.231   -9.626  1.00 2.57 ? 32  ALA A CA   1  
ATOM 532   C C    . ALA A 1 32  ? 14.203  9.178   -8.838  1.00 2.28 ? 32  ALA A C    1  
ATOM 533   O O    . ALA A 1 32  ? 13.309  9.973   -9.049  1.00 2.54 ? 32  ALA A O    1  
ATOM 534   C CB   . ALA A 1 32  ? 15.487  8.178   -10.736 1.00 2.76 ? 32  ALA A CB   1  
ATOM 535   H H    . ALA A 1 32  ? 16.483  8.708   -7.774  1.00 2.61 ? 32  ALA A H    1  
ATOM 536   H HA   . ALA A 1 32  ? 15.634  10.211  -10.063 1.00 2.78 ? 32  ALA A HA   1  
ATOM 537   H HB1  . ALA A 1 32  ? 15.649  7.199   -10.308 1.00 2.98 ? 32  ALA A HB1  1  
ATOM 538   H HB2  . ALA A 1 32  ? 14.526  8.201   -11.229 1.00 2.92 ? 32  ALA A HB2  1  
ATOM 539   H HB3  . ALA A 1 32  ? 16.265  8.390   -11.454 1.00 3.05 ? 32  ALA A HB3  1  
ATOM 540   N N    . VAL A 1 33  ? 14.083  8.242   -7.935  1.00 1.87 ? 33  VAL A N    1  
ATOM 541   C CA   . VAL A 1 33  ? 12.835  8.124   -7.130  1.00 1.62 ? 33  VAL A CA   1  
ATOM 542   C C    . VAL A 1 33  ? 12.767  9.256   -6.101  1.00 1.96 ? 33  VAL A C    1  
ATOM 543   O O    . VAL A 1 33  ? 13.763  9.639   -5.519  1.00 2.52 ? 33  VAL A O    1  
ATOM 544   C CB   . VAL A 1 33  ? 12.833  6.780   -6.404  1.00 1.55 ? 33  VAL A CB   1  
ATOM 545   C CG1  . VAL A 1 33  ? 12.640  5.651   -7.416  1.00 2.27 ? 33  VAL A CG1  1  
ATOM 546   C CG2  . VAL A 1 33  ? 14.168  6.590   -5.681  1.00 1.58 ? 33  VAL A CG2  1  
ATOM 547   H H    . VAL A 1 33  ? 14.816  7.610   -7.787  1.00 1.82 ? 33  VAL A H    1  
ATOM 548   H HA   . VAL A 1 33  ? 11.979  8.178   -7.783  1.00 1.94 ? 33  VAL A HA   1  
ATOM 549   H HB   . VAL A 1 33  ? 12.030  6.762   -5.688  1.00 1.89 ? 33  VAL A HB   1  
ATOM 550   H HG11 . VAL A 1 33  ? 13.381  5.736   -8.196  1.00 2.67 ? 33  VAL A HG11 1  
ATOM 551   H HG12 . VAL A 1 33  ? 12.748  4.699   -6.918  1.00 2.62 ? 33  VAL A HG12 1  
ATOM 552   H HG13 . VAL A 1 33  ? 11.652  5.721   -7.848  1.00 2.76 ? 33  VAL A HG13 1  
ATOM 553   H HG21 . VAL A 1 33  ? 14.482  7.529   -5.252  1.00 1.81 ? 33  VAL A HG21 1  
ATOM 554   H HG22 . VAL A 1 33  ? 14.055  5.855   -4.899  1.00 2.07 ? 33  VAL A HG22 1  
ATOM 555   H HG23 . VAL A 1 33  ? 14.910  6.252   -6.388  1.00 1.97 ? 33  VAL A HG23 1  
ATOM 556   N N    . ALA A 1 34  ? 11.594  9.789   -5.866  1.00 2.31 ? 34  ALA A N    1  
ATOM 557   C CA   . ALA A 1 34  ? 11.454  10.892  -4.868  1.00 3.06 ? 34  ALA A CA   1  
ATOM 558   C C    . ALA A 1 34  ? 10.011  11.414  -4.875  1.00 3.06 ? 34  ALA A C    1  
ATOM 559   O O    . ALA A 1 34  ? 9.194   11.008  -4.072  1.00 3.68 ? 34  ALA A O    1  
ATOM 560   C CB   . ALA A 1 34  ? 12.420  12.030  -5.219  1.00 4.14 ? 34  ALA A CB   1  
ATOM 561   H H    . ALA A 1 34  ? 10.804  9.459   -6.343  1.00 2.46 ? 34  ALA A H    1  
ATOM 562   H HA   . ALA A 1 34  ? 11.690  10.513  -3.885  1.00 3.25 ? 34  ALA A HA   1  
ATOM 563   H HB1  . ALA A 1 34  ? 12.725  11.937  -6.251  1.00 4.57 ? 34  ALA A HB1  1  
ATOM 564   H HB2  . ALA A 1 34  ? 11.926  12.980  -5.074  1.00 4.52 ? 34  ALA A HB2  1  
ATOM 565   H HB3  . ALA A 1 34  ? 13.289  11.975  -4.580  1.00 4.50 ? 34  ALA A HB3  1  
ATOM 566   N N    . ALA A 1 35  ? 9.691   12.311  -5.774  1.00 2.87 ? 35  ALA A N    1  
ATOM 567   C CA   . ALA A 1 35  ? 8.301   12.856  -5.833  1.00 3.25 ? 35  ALA A CA   1  
ATOM 568   C C    . ALA A 1 35  ? 8.221   13.923  -6.926  1.00 3.01 ? 35  ALA A C    1  
ATOM 569   O O    . ALA A 1 35  ? 8.743   15.012  -6.782  1.00 3.39 ? 35  ALA A O    1  
ATOM 570   C CB   . ALA A 1 35  ? 7.932   13.485  -4.486  1.00 3.95 ? 35  ALA A CB   1  
ATOM 571   H H    . ALA A 1 35  ? 10.363  12.625  -6.413  1.00 2.90 ? 35  ALA A H    1  
ATOM 572   H HA   . ALA A 1 35  ? 7.611   12.057  -6.058  1.00 3.76 ? 35  ALA A HA   1  
ATOM 573   H HB1  . ALA A 1 35  ? 8.769   14.058  -4.115  1.00 4.18 ? 35  ALA A HB1  1  
ATOM 574   H HB2  . ALA A 1 35  ? 7.079   14.135  -4.614  1.00 4.27 ? 35  ALA A HB2  1  
ATOM 575   H HB3  . ALA A 1 35  ? 7.688   12.705  -3.779  1.00 4.43 ? 35  ALA A HB3  1  
ATOM 576   N N    . ALA A 1 36  ? 7.571   13.620  -8.018  1.00 3.03 ? 36  ALA A N    1  
ATOM 577   C CA   . ALA A 1 36  ? 7.457   14.616  -9.122  1.00 3.35 ? 36  ALA A CA   1  
ATOM 578   C C    . ALA A 1 36  ? 6.007   15.090  -9.235  1.00 2.92 ? 36  ALA A C    1  
ATOM 579   O O    . ALA A 1 36  ? 5.742   16.229  -9.568  1.00 3.30 ? 36  ALA A O    1  
ATOM 580   C CB   . ALA A 1 36  ? 7.886   13.966  -10.441 1.00 4.27 ? 36  ALA A CB   1  
ATOM 581   H H    . ALA A 1 36  ? 7.158   12.736  -8.113  1.00 3.27 ? 36  ALA A H    1  
ATOM 582   H HA   . ALA A 1 36  ? 8.096   15.461  -8.913  1.00 3.77 ? 36  ALA A HA   1  
ATOM 583   H HB1  . ALA A 1 36  ? 7.909   12.893  -10.321 1.00 4.58 ? 36  ALA A HB1  1  
ATOM 584   H HB2  . ALA A 1 36  ? 7.182   14.227  -11.218 1.00 4.73 ? 36  ALA A HB2  1  
ATOM 585   H HB3  . ALA A 1 36  ? 8.870   14.319  -10.713 1.00 4.62 ? 36  ALA A HB3  1  
ATOM 586   N N    . SER A 1 37  ? 5.068   14.225  -8.965  1.00 2.73 ? 37  SER A N    1  
ATOM 587   C CA   . SER A 1 37  ? 3.635   14.623  -9.060  1.00 2.83 ? 37  SER A CA   1  
ATOM 588   C C    . SER A 1 37  ? 2.936   14.345  -7.727  1.00 2.70 ? 37  SER A C    1  
ATOM 589   O O    . SER A 1 37  ? 3.572   14.193  -6.702  1.00 3.23 ? 37  SER A O    1  
ATOM 590   C CB   . SER A 1 37  ? 2.960   13.821  -10.173 1.00 3.40 ? 37  SER A CB   1  
ATOM 591   O OG   . SER A 1 37  ? 3.773   13.859  -11.338 1.00 3.92 ? 37  SER A OG   1  
ATOM 592   H H    . SER A 1 37  ? 5.305   13.311  -8.702  1.00 2.97 ? 37  SER A H    1  
ATOM 593   H HA   . SER A 1 37  ? 3.570   15.677  -9.286  1.00 3.13 ? 37  SER A HA   1  
ATOM 594   H HB2  . SER A 1 37  ? 2.837   12.798  -9.858  1.00 3.71 ? 37  SER A HB2  1  
ATOM 595   H HB3  . SER A 1 37  ? 1.989   14.249  -10.384 1.00 3.66 ? 37  SER A HB3  1  
ATOM 596   H HG   . SER A 1 37  ? 4.558   13.331  -11.170 1.00 4.25 ? 37  SER A HG   1  
ATOM 597   N N    . LYS A 1 38  ? 1.632   14.279  -7.732  1.00 2.43 ? 38  LYS A N    1  
ATOM 598   C CA   . LYS A 1 38  ? 0.890   14.014  -6.468  1.00 2.50 ? 38  LYS A CA   1  
ATOM 599   C C    . LYS A 1 38  ? 0.229   12.630  -6.542  1.00 2.04 ? 38  LYS A C    1  
ATOM 600   O O    . LYS A 1 38  ? -0.743  12.456  -7.249  1.00 2.29 ? 38  LYS A O    1  
ATOM 601   C CB   . LYS A 1 38  ? -0.193  15.081  -6.284  1.00 3.22 ? 38  LYS A CB   1  
ATOM 602   C CG   . LYS A 1 38  ? 0.334   16.198  -5.381  1.00 3.89 ? 38  LYS A CG   1  
ATOM 603   C CD   . LYS A 1 38  ? -0.641  17.378  -5.406  1.00 4.62 ? 38  LYS A CD   1  
ATOM 604   C CE   . LYS A 1 38  ? -0.472  18.157  -6.712  1.00 5.30 ? 38  LYS A CE   1  
ATOM 605   N NZ   . LYS A 1 38  ? -1.662  17.931  -7.582  1.00 5.87 ? 38  LYS A NZ   1  
ATOM 606   H H    . LYS A 1 38  ? 1.139   14.407  -8.570  1.00 2.53 ? 38  LYS A H    1  
ATOM 607   H HA   . LYS A 1 38  ? 1.574   14.051  -5.635  1.00 2.68 ? 38  LYS A HA   1  
ATOM 608   H HB2  . LYS A 1 38  ? -0.459  15.492  -7.248  1.00 3.45 ? 38  LYS A HB2  1  
ATOM 609   H HB3  . LYS A 1 38  ? -1.065  14.634  -5.830  1.00 3.54 ? 38  LYS A HB3  1  
ATOM 610   H HG2  . LYS A 1 38  ? 0.428   15.828  -4.370  1.00 4.13 ? 38  LYS A HG2  1  
ATOM 611   H HG3  . LYS A 1 38  ? 1.300   16.524  -5.737  1.00 4.12 ? 38  LYS A HG3  1  
ATOM 612   H HD2  . LYS A 1 38  ? -1.654  17.009  -5.336  1.00 4.84 ? 38  LYS A HD2  1  
ATOM 613   H HD3  . LYS A 1 38  ? -0.437  18.030  -4.571  1.00 4.86 ? 38  LYS A HD3  1  
ATOM 614   H HE2  . LYS A 1 38  ? -0.382  19.210  -6.493  1.00 5.38 ? 38  LYS A HE2  1  
ATOM 615   H HE3  . LYS A 1 38  ? 0.417   17.819  -7.223  1.00 5.67 ? 38  LYS A HE3  1  
ATOM 616   H HZ1  . LYS A 1 38  ? -2.528  18.024  -7.017  1.00 5.84 ? 38  LYS A HZ1  1  
ATOM 617   H HZ2  . LYS A 1 38  ? -1.669  18.635  -8.349  1.00 6.17 ? 38  LYS A HZ2  1  
ATOM 618   H HZ3  . LYS A 1 38  ? -1.617  16.975  -7.989  1.00 6.29 ? 38  LYS A HZ3  1  
ATOM 619   N N    . PRO A 1 39  ? 0.766   11.683  -5.805  1.00 1.73 ? 39  PRO A N    1  
ATOM 620   C CA   . PRO A 1 39  ? 0.227   10.312  -5.776  1.00 1.58 ? 39  PRO A CA   1  
ATOM 621   C C    . PRO A 1 39  ? -1.040  10.267  -4.918  1.00 1.07 ? 39  PRO A C    1  
ATOM 622   O O    . PRO A 1 39  ? -0.981  10.135  -3.712  1.00 1.21 ? 39  PRO A O    1  
ATOM 623   C CB   . PRO A 1 39  ? 1.354   9.491   -5.143  1.00 1.97 ? 39  PRO A CB   1  
ATOM 624   C CG   . PRO A 1 39  ? 2.224   10.489  -4.344  1.00 2.20 ? 39  PRO A CG   1  
ATOM 625   C CD   . PRO A 1 39  ? 1.948   11.884  -4.937  1.00 2.04 ? 39  PRO A CD   1  
ATOM 626   H HA   . PRO A 1 39  ? 0.026   9.958   -6.774  1.00 1.97 ? 39  PRO A HA   1  
ATOM 627   H HB2  . PRO A 1 39  ? 0.939   8.742   -4.482  1.00 2.01 ? 39  PRO A HB2  1  
ATOM 628   H HB3  . PRO A 1 39  ? 1.949   9.022   -5.910  1.00 2.40 ? 39  PRO A HB3  1  
ATOM 629   H HG2  . PRO A 1 39  ? 1.947   10.466  -3.299  1.00 2.30 ? 39  PRO A HG2  1  
ATOM 630   H HG3  . PRO A 1 39  ? 3.269   10.246  -4.458  1.00 2.67 ? 39  PRO A HG3  1  
ATOM 631   H HD2  . PRO A 1 39  ? 1.726   12.591  -4.149  1.00 2.16 ? 39  PRO A HD2  1  
ATOM 632   H HD3  . PRO A 1 39  ? 2.788   12.220  -5.524  1.00 2.37 ? 39  PRO A HD3  1  
ATOM 633   N N    . ALA A 1 40  ? -2.185  10.391  -5.534  1.00 0.85 ? 40  ALA A N    1  
ATOM 634   C CA   . ALA A 1 40  ? -3.458  10.372  -4.760  1.00 0.53 ? 40  ALA A CA   1  
ATOM 635   C C    . ALA A 1 40  ? -4.048  8.960   -4.756  1.00 0.55 ? 40  ALA A C    1  
ATOM 636   O O    . ALA A 1 40  ? -3.449  8.020   -5.241  1.00 0.93 ? 40  ALA A O    1  
ATOM 637   C CB   . ALA A 1 40  ? -4.457  11.333  -5.407  1.00 0.82 ? 40  ALA A CB   1  
ATOM 638   H H    . ALA A 1 40  ? -2.206  10.506  -6.507  1.00 1.18 ? 40  ALA A H    1  
ATOM 639   H HA   . ALA A 1 40  ? -3.266  10.685  -3.745  1.00 0.66 ? 40  ALA A HA   1  
ATOM 640   H HB1  . ALA A 1 40  ? -3.923  12.151  -5.868  1.00 1.22 ? 40  ALA A HB1  1  
ATOM 641   H HB2  . ALA A 1 40  ? -5.028  10.807  -6.157  1.00 1.49 ? 40  ALA A HB2  1  
ATOM 642   H HB3  . ALA A 1 40  ? -5.125  11.719  -4.651  1.00 1.42 ? 40  ALA A HB3  1  
ATOM 643   N N    . VAL A 1 41  ? -5.225  8.816   -4.210  1.00 0.40 ? 41  VAL A N    1  
ATOM 644   C CA   . VAL A 1 41  ? -5.882  7.480   -4.163  1.00 0.36 ? 41  VAL A CA   1  
ATOM 645   C C    . VAL A 1 41  ? -7.382  7.678   -3.969  1.00 0.34 ? 41  VAL A C    1  
ATOM 646   O O    . VAL A 1 41  ? -7.849  8.780   -3.760  1.00 0.35 ? 41  VAL A O    1  
ATOM 647   C CB   . VAL A 1 41  ? -5.312  6.664   -2.989  1.00 0.32 ? 41  VAL A CB   1  
ATOM 648   C CG1  . VAL A 1 41  ? -6.067  6.992   -1.700  1.00 0.28 ? 41  VAL A CG1  1  
ATOM 649   C CG2  . VAL A 1 41  ? -5.457  5.168   -3.279  1.00 0.32 ? 41  VAL A CG2  1  
ATOM 650   H H    . VAL A 1 41  ? -5.682  9.595   -3.831  1.00 0.61 ? 41  VAL A H    1  
ATOM 651   H HA   . VAL A 1 41  ? -5.705  6.953   -5.088  1.00 0.39 ? 41  VAL A HA   1  
ATOM 652   H HB   . VAL A 1 41  ? -4.269  6.907   -2.860  1.00 0.34 ? 41  VAL A HB   1  
ATOM 653   H HG11 . VAL A 1 41  ? -6.459  7.995   -1.760  1.00 0.96 ? 41  VAL A HG11 1  
ATOM 654   H HG12 . VAL A 1 41  ? -6.883  6.294   -1.573  1.00 1.14 ? 41  VAL A HG12 1  
ATOM 655   H HG13 . VAL A 1 41  ? -5.394  6.916   -0.858  1.00 1.02 ? 41  VAL A HG13 1  
ATOM 656   H HG21 . VAL A 1 41  ? -5.956  5.031   -4.225  1.00 1.06 ? 41  VAL A HG21 1  
ATOM 657   H HG22 . VAL A 1 41  ? -4.480  4.716   -3.319  1.00 1.06 ? 41  VAL A HG22 1  
ATOM 658   H HG23 . VAL A 1 41  ? -6.038  4.702   -2.497  1.00 1.07 ? 41  VAL A HG23 1  
ATOM 659   N N    . GLU A 1 42  ? -8.135  6.620   -4.011  1.00 0.32 ? 42  GLU A N    1  
ATOM 660   C CA   . GLU A 1 42  ? -9.598  6.749   -3.800  1.00 0.31 ? 42  GLU A CA   1  
ATOM 661   C C    . GLU A 1 42  ? -10.154 5.412   -3.335  1.00 0.28 ? 42  GLU A C    1  
ATOM 662   O O    . GLU A 1 42  ? -10.130 4.431   -4.053  1.00 0.31 ? 42  GLU A O    1  
ATOM 663   C CB   . GLU A 1 42  ? -10.284 7.181   -5.097  1.00 0.35 ? 42  GLU A CB   1  
ATOM 664   C CG   . GLU A 1 42  ? -9.982  6.169   -6.202  1.00 0.44 ? 42  GLU A CG   1  
ATOM 665   C CD   . GLU A 1 42  ? -10.313 6.787   -7.561  1.00 0.78 ? 42  GLU A CD   1  
ATOM 666   O OE1  . GLU A 1 42  ? -9.495  7.542   -8.062  1.00 1.27 ? 42  GLU A OE1  1  
ATOM 667   O OE2  . GLU A 1 42  ? -11.379 6.497   -8.078  1.00 1.42 ? 42  GLU A OE2  1  
ATOM 668   H H    . GLU A 1 42  ? -7.735  5.739   -4.164  1.00 0.32 ? 42  GLU A H    1  
ATOM 669   H HA   . GLU A 1 42  ? -9.775  7.485   -3.034  1.00 0.30 ? 42  GLU A HA   1  
ATOM 670   H HB2  . GLU A 1 42  ? -11.351 7.233   -4.938  1.00 0.47 ? 42  GLU A HB2  1  
ATOM 671   H HB3  . GLU A 1 42  ? -9.916  8.152   -5.391  1.00 0.53 ? 42  GLU A HB3  1  
ATOM 672   H HG2  . GLU A 1 42  ? -8.936  5.902   -6.170  1.00 0.61 ? 42  GLU A HG2  1  
ATOM 673   H HG3  . GLU A 1 42  ? -10.584 5.286   -6.055  1.00 0.41 ? 42  GLU A HG3  1  
ATOM 674   N N    . ILE A 1 43  ? -10.646 5.364   -2.130  1.00 0.25 ? 43  ILE A N    1  
ATOM 675   C CA   . ILE A 1 43  ? -11.193 4.092   -1.608  1.00 0.23 ? 43  ILE A CA   1  
ATOM 676   C C    . ILE A 1 43  ? -12.709 4.085   -1.750  1.00 0.24 ? 43  ILE A C    1  
ATOM 677   O O    . ILE A 1 43  ? -13.370 5.098   -1.632  1.00 0.27 ? 43  ILE A O    1  
ATOM 678   C CB   . ILE A 1 43  ? -10.797 3.933   -0.145  1.00 0.21 ? 43  ILE A CB   1  
ATOM 679   C CG1  . ILE A 1 43  ? -9.270  4.013   -0.037  1.00 0.22 ? 43  ILE A CG1  1  
ATOM 680   C CG2  . ILE A 1 43  ? -11.283 2.577   0.378   1.00 0.23 ? 43  ILE A CG2  1  
ATOM 681   C CD1  . ILE A 1 43  ? -8.844  3.922   1.428   1.00 1.06 ? 43  ILE A CD1  1  
ATOM 682   H H    . ILE A 1 43  ? -10.647 6.167   -1.568  1.00 0.26 ? 43  ILE A H    1  
ATOM 683   H HA   . ILE A 1 43  ? -10.785 3.274   -2.173  1.00 0.23 ? 43  ILE A HA   1  
ATOM 684   H HB   . ILE A 1 43  ? -11.244 4.723   0.432   1.00 0.22 ? 43  ILE A HB   1  
ATOM 685   H HG12 . ILE A 1 43  ? -8.829  3.197   -0.591  1.00 0.86 ? 43  ILE A HG12 1  
ATOM 686   H HG13 . ILE A 1 43  ? -8.931  4.951   -0.451  1.00 0.88 ? 43  ILE A HG13 1  
ATOM 687   H HG21 . ILE A 1 43  ? -11.536 1.939   -0.456  1.00 1.03 ? 43  ILE A HG21 1  
ATOM 688   H HG22 . ILE A 1 43  ? -10.502 2.114   0.962   1.00 1.02 ? 43  ILE A HG22 1  
ATOM 689   H HG23 . ILE A 1 43  ? -12.156 2.723   0.997   1.00 1.01 ? 43  ILE A HG23 1  
ATOM 690   H HD11 . ILE A 1 43  ? -9.668  3.554   2.021   1.00 1.71 ? 43  ILE A HD11 1  
ATOM 691   H HD12 . ILE A 1 43  ? -8.006  3.249   1.515   1.00 1.64 ? 43  ILE A HD12 1  
ATOM 692   H HD13 . ILE A 1 43  ? -8.556  4.901   1.779   1.00 1.63 ? 43  ILE A HD13 1  
ATOM 693   N N    . LYS A 1 44  ? -13.251 2.939   -2.015  1.00 0.23 ? 44  LYS A N    1  
ATOM 694   C CA   . LYS A 1 44  ? -14.716 2.804   -2.188  1.00 0.24 ? 44  LYS A CA   1  
ATOM 695   C C    . LYS A 1 44  ? -15.133 1.507   -1.506  1.00 0.23 ? 44  LYS A C    1  
ATOM 696   O O    . LYS A 1 44  ? -14.785 0.430   -1.944  1.00 0.28 ? 44  LYS A O    1  
ATOM 697   C CB   . LYS A 1 44  ? -15.014 2.753   -3.687  1.00 0.27 ? 44  LYS A CB   1  
ATOM 698   C CG   . LYS A 1 44  ? -14.366 3.962   -4.363  1.00 0.28 ? 44  LYS A CG   1  
ATOM 699   C CD   . LYS A 1 44  ? -15.003 4.191   -5.731  1.00 0.32 ? 44  LYS A CD   1  
ATOM 700   C CE   . LYS A 1 44  ? -14.712 3.000   -6.647  1.00 0.35 ? 44  LYS A CE   1  
ATOM 701   N NZ   . LYS A 1 44  ? -15.910 2.716   -7.487  1.00 0.71 ? 44  LYS A NZ   1  
ATOM 702   H H    . LYS A 1 44  ? -12.682 2.149   -2.109  1.00 0.24 ? 44  LYS A H    1  
ATOM 703   H HA   . LYS A 1 44  ? -15.224 3.643   -1.731  1.00 0.24 ? 44  LYS A HA   1  
ATOM 704   H HB2  . LYS A 1 44  ? -14.597 1.848   -4.106  1.00 0.28 ? 44  LYS A HB2  1  
ATOM 705   H HB3  . LYS A 1 44  ? -16.079 2.775   -3.851  1.00 0.29 ? 44  LYS A HB3  1  
ATOM 706   H HG2  . LYS A 1 44  ? -14.510 4.836   -3.748  1.00 0.27 ? 44  LYS A HG2  1  
ATOM 707   H HG3  . LYS A 1 44  ? -13.310 3.784   -4.486  1.00 0.28 ? 44  LYS A HG3  1  
ATOM 708   H HD2  . LYS A 1 44  ? -16.069 4.301   -5.613  1.00 0.33 ? 44  LYS A HD2  1  
ATOM 709   H HD3  . LYS A 1 44  ? -14.592 5.086   -6.169  1.00 0.33 ? 44  LYS A HD3  1  
ATOM 710   H HE2  . LYS A 1 44  ? -13.873 3.233   -7.284  1.00 0.70 ? 44  LYS A HE2  1  
ATOM 711   H HE3  . LYS A 1 44  ? -14.480 2.132   -6.048  1.00 0.70 ? 44  LYS A HE3  1  
ATOM 712   H HZ1  . LYS A 1 44  ? -16.750 2.641   -6.880  1.00 1.27 ? 44  LYS A HZ1  1  
ATOM 713   H HZ2  . LYS A 1 44  ? -16.046 3.489   -8.169  1.00 1.33 ? 44  LYS A HZ2  1  
ATOM 714   H HZ3  . LYS A 1 44  ? -15.769 1.821   -7.999  1.00 1.29 ? 44  LYS A HZ3  1  
ATOM 715   N N    . GLN A 1 45  ? -15.822 1.591   -0.404  1.00 0.23 ? 45  GLN A N    1  
ATOM 716   C CA   . GLN A 1 45  ? -16.180 0.342   0.320   1.00 0.24 ? 45  GLN A CA   1  
ATOM 717   C C    . GLN A 1 45  ? -17.641 0.327   0.766   1.00 0.24 ? 45  GLN A C    1  
ATOM 718   O O    . GLN A 1 45  ? -18.260 1.349   0.986   1.00 0.26 ? 45  GLN A O    1  
ATOM 719   C CB   . GLN A 1 45  ? -15.287 0.239   1.556   1.00 0.24 ? 45  GLN A CB   1  
ATOM 720   C CG   . GLN A 1 45  ? -15.421 1.514   2.394   1.00 0.27 ? 45  GLN A CG   1  
ATOM 721   C CD   . GLN A 1 45  ? -16.031 1.179   3.759   1.00 0.48 ? 45  GLN A CD   1  
ATOM 722   O OE1  . GLN A 1 45  ? -15.323 1.034   4.733   1.00 1.23 ? 45  GLN A OE1  1  
ATOM 723   N NE2  . GLN A 1 45  ? -17.324 1.053   3.873   1.00 0.95 ? 45  GLN A NE2  1  
ATOM 724   H H    . GLN A 1 45  ? -16.061 2.467   -0.034  1.00 0.27 ? 45  GLN A H    1  
ATOM 725   H HA   . GLN A 1 45  ? -15.993 -0.507  -0.318  1.00 0.26 ? 45  GLN A HA   1  
ATOM 726   H HB2  . GLN A 1 45  ? -15.585 -0.610  2.145   1.00 0.25 ? 45  GLN A HB2  1  
ATOM 727   H HB3  . GLN A 1 45  ? -14.261 0.121   1.246   1.00 0.28 ? 45  GLN A HB3  1  
ATOM 728   H HG2  . GLN A 1 45  ? -14.444 1.954   2.536   1.00 0.43 ? 45  GLN A HG2  1  
ATOM 729   H HG3  . GLN A 1 45  ? -16.059 2.217   1.881   1.00 0.37 ? 45  GLN A HG3  1  
ATOM 730   H HE21 . GLN A 1 45  ? -17.899 1.173   3.091   1.00 1.57 ? 45  GLN A HE21 1  
ATOM 731   H HE22 . GLN A 1 45  ? -17.720 0.838   4.744   1.00 1.04 ? 45  GLN A HE22 1  
ATOM 732   N N    . GLU A 1 46  ? -18.169 -0.855  0.924   1.00 0.24 ? 46  GLU A N    1  
ATOM 733   C CA   . GLU A 1 46  ? -19.565 -1.028  1.386   1.00 0.27 ? 46  GLU A CA   1  
ATOM 734   C C    . GLU A 1 46  ? -19.562 -2.127  2.454   1.00 0.27 ? 46  GLU A C    1  
ATOM 735   O O    . GLU A 1 46  ? -19.808 -3.284  2.170   1.00 0.29 ? 46  GLU A O    1  
ATOM 736   C CB   . GLU A 1 46  ? -20.438 -1.454  0.209   1.00 0.31 ? 46  GLU A CB   1  
ATOM 737   C CG   . GLU A 1 46  ? -21.892 -1.085  0.498   1.00 0.36 ? 46  GLU A CG   1  
ATOM 738   C CD   . GLU A 1 46  ? -22.696 -1.111  -0.803  1.00 0.76 ? 46  GLU A CD   1  
ATOM 739   O OE1  . GLU A 1 46  ? -22.572 -0.172  -1.573  1.00 1.29 ? 46  GLU A OE1  1  
ATOM 740   O OE2  . GLU A 1 46  ? -23.424 -2.068  -1.008  1.00 1.50 ? 46  GLU A OE2  1  
ATOM 741   H H    . GLU A 1 46  ? -17.629 -1.648  0.748   1.00 0.24 ? 46  GLU A H    1  
ATOM 742   H HA   . GLU A 1 46  ? -19.933 -0.103  1.807   1.00 0.27 ? 46  GLU A HA   1  
ATOM 743   H HB2  . GLU A 1 46  ? -20.104 -0.948  -0.685  1.00 0.31 ? 46  GLU A HB2  1  
ATOM 744   H HB3  . GLU A 1 46  ? -20.357 -2.521  0.071   1.00 0.31 ? 46  GLU A HB3  1  
ATOM 745   H HG2  . GLU A 1 46  ? -22.310 -1.795  1.196   1.00 0.66 ? 46  GLU A HG2  1  
ATOM 746   H HG3  . GLU A 1 46  ? -21.932 -0.094  0.924   1.00 0.65 ? 46  GLU A HG3  1  
ATOM 747   N N    . GLY A 1 47  ? -19.252 -1.779  3.675   1.00 0.26 ? 47  GLY A N    1  
ATOM 748   C CA   . GLY A 1 47  ? -19.201 -2.806  4.756   1.00 0.27 ? 47  GLY A CA   1  
ATOM 749   C C    . GLY A 1 47  ? -17.847 -3.520  4.700   1.00 0.25 ? 47  GLY A C    1  
ATOM 750   O O    . GLY A 1 47  ? -16.807 -2.891  4.712   1.00 0.23 ? 47  GLY A O    1  
ATOM 751   H H    . GLY A 1 47  ? -19.033 -0.845  3.877   1.00 0.25 ? 47  GLY A H    1  
ATOM 752   H HA2  . GLY A 1 47  ? -19.317 -2.324  5.718   1.00 0.28 ? 47  GLY A HA2  1  
ATOM 753   H HA3  . GLY A 1 47  ? -19.991 -3.525  4.612   1.00 0.29 ? 47  GLY A HA3  1  
ATOM 754   N N    . ASP A 1 48  ? -17.849 -4.826  4.632   1.00 0.26 ? 48  ASP A N    1  
ATOM 755   C CA   . ASP A 1 48  ? -16.564 -5.570  4.568   1.00 0.25 ? 48  ASP A CA   1  
ATOM 756   C C    . ASP A 1 48  ? -16.035 -5.575  3.130   1.00 0.25 ? 48  ASP A C    1  
ATOM 757   O O    . ASP A 1 48  ? -14.953 -6.059  2.862   1.00 0.24 ? 48  ASP A O    1  
ATOM 758   C CB   . ASP A 1 48  ? -16.789 -7.002  5.036   1.00 0.28 ? 48  ASP A CB   1  
ATOM 759   C CG   . ASP A 1 48  ? -17.873 -7.660  4.180   1.00 0.31 ? 48  ASP A CG   1  
ATOM 760   O OD1  . ASP A 1 48  ? -17.632 -7.850  2.999   1.00 1.14 ? 48  ASP A OD1  1  
ATOM 761   O OD2  . ASP A 1 48  ? -18.924 -7.962  4.719   1.00 1.06 ? 48  ASP A OD2  1  
ATOM 762   H H    . ASP A 1 48  ? -18.694 -5.317  4.620   1.00 0.29 ? 48  ASP A H    1  
ATOM 763   H HA   . ASP A 1 48  ? -15.838 -5.095  5.210   1.00 0.24 ? 48  ASP A HA   1  
ATOM 764   H HB2  . ASP A 1 48  ? -15.870 -7.549  4.941   1.00 0.27 ? 48  ASP A HB2  1  
ATOM 765   H HB3  . ASP A 1 48  ? -17.100 -6.997  6.069   1.00 0.29 ? 48  ASP A HB3  1  
ATOM 766   N N    . THR A 1 49  ? -16.778 -5.026  2.205   1.00 0.25 ? 49  THR A N    1  
ATOM 767   C CA   . THR A 1 49  ? -16.301 -4.985  0.798   1.00 0.26 ? 49  THR A CA   1  
ATOM 768   C C    . THR A 1 49  ? -15.485 -3.706  0.609   1.00 0.23 ? 49  THR A C    1  
ATOM 769   O O    . THR A 1 49  ? -15.871 -2.650  1.067   1.00 0.22 ? 49  THR A O    1  
ATOM 770   C CB   . THR A 1 49  ? -17.506 -4.971  -0.144  1.00 0.29 ? 49  THR A CB   1  
ATOM 771   O OG1  . THR A 1 49  ? -18.330 -6.097  0.128   1.00 0.32 ? 49  THR A OG1  1  
ATOM 772   C CG2  . THR A 1 49  ? -17.025 -5.027  -1.592  1.00 0.30 ? 49  THR A CG2  1  
ATOM 773   H H    . THR A 1 49  ? -17.643 -4.628  2.438   1.00 0.26 ? 49  THR A H    1  
ATOM 774   H HA   . THR A 1 49  ? -15.684 -5.849  0.593   1.00 0.26 ? 49  THR A HA   1  
ATOM 775   H HB   . THR A 1 49  ? -18.072 -4.065  0.008   1.00 0.28 ? 49  THR A HB   1  
ATOM 776   H HG1  . THR A 1 49  ? -19.186 -5.775  0.419   1.00 0.90 ? 49  THR A HG1  1  
ATOM 777   H HG21 . THR A 1 49  ? -16.184 -4.362  -1.717  1.00 1.04 ? 49  THR A HG21 1  
ATOM 778   H HG22 . THR A 1 49  ? -16.727 -6.036  -1.833  1.00 1.06 ? 49  THR A HG22 1  
ATOM 779   H HG23 . THR A 1 49  ? -17.827 -4.722  -2.249  1.00 1.07 ? 49  THR A HG23 1  
ATOM 780   N N    . PHE A 1 50  ? -14.354 -3.780  -0.038  1.00 0.24 ? 50  PHE A N    1  
ATOM 781   C CA   . PHE A 1 50  ? -13.540 -2.546  -0.217  1.00 0.21 ? 50  PHE A CA   1  
ATOM 782   C C    . PHE A 1 50  ? -12.958 -2.471  -1.626  1.00 0.23 ? 50  PHE A C    1  
ATOM 783   O O    . PHE A 1 50  ? -12.726 -3.467  -2.283  1.00 0.28 ? 50  PHE A O    1  
ATOM 784   C CB   . PHE A 1 50  ? -12.390 -2.532  0.792   1.00 0.19 ? 50  PHE A CB   1  
ATOM 785   C CG   . PHE A 1 50  ? -12.957 -2.578  2.183   1.00 0.18 ? 50  PHE A CG   1  
ATOM 786   C CD1  . PHE A 1 50  ? -13.279 -3.807  2.752   1.00 0.20 ? 50  PHE A CD1  1  
ATOM 787   C CD2  . PHE A 1 50  ? -13.181 -1.395  2.893   1.00 0.17 ? 50  PHE A CD2  1  
ATOM 788   C CE1  . PHE A 1 50  ? -13.831 -3.862  4.033   1.00 0.20 ? 50  PHE A CE1  1  
ATOM 789   C CE2  . PHE A 1 50  ? -13.728 -1.447  4.181   1.00 0.17 ? 50  PHE A CE2  1  
ATOM 790   C CZ   . PHE A 1 50  ? -14.055 -2.684  4.750   1.00 0.19 ? 50  PHE A CZ   1  
ATOM 791   H H    . PHE A 1 50  ? -14.041 -4.636  -0.390  1.00 0.26 ? 50  PHE A H    1  
ATOM 792   H HA   . PHE A 1 50  ? -14.168 -1.683  -0.047  1.00 0.21 ? 50  PHE A HA   1  
ATOM 793   H HB2  . PHE A 1 50  ? -11.757 -3.392  0.631   1.00 0.20 ? 50  PHE A HB2  1  
ATOM 794   H HB3  . PHE A 1 50  ? -11.811 -1.629  0.669   1.00 0.19 ? 50  PHE A HB3  1  
ATOM 795   H HD1  . PHE A 1 50  ? -13.096 -4.715  2.201   1.00 0.21 ? 50  PHE A HD1  1  
ATOM 796   H HD2  . PHE A 1 50  ? -12.925 -0.444  2.450   1.00 0.17 ? 50  PHE A HD2  1  
ATOM 797   H HE1  . PHE A 1 50  ? -14.078 -4.815  4.473   1.00 0.21 ? 50  PHE A HE1  1  
ATOM 798   H HE2  . PHE A 1 50  ? -13.897 -0.535  4.734   1.00 0.17 ? 50  PHE A HE2  1  
ATOM 799   H HZ   . PHE A 1 50  ? -14.483 -2.729  5.741   1.00 0.19 ? 50  PHE A HZ   1  
ATOM 800   N N    . TYR A 1 51  ? -12.694 -1.277  -2.063  1.00 0.23 ? 51  TYR A N    1  
ATOM 801   C CA   . TYR A 1 51  ? -12.091 -1.053  -3.400  1.00 0.25 ? 51  TYR A CA   1  
ATOM 802   C C    . TYR A 1 51  ? -10.959 -0.054  -3.175  1.00 0.24 ? 51  TYR A C    1  
ATOM 803   O O    . TYR A 1 51  ? -11.049 0.801   -2.317  1.00 0.22 ? 51  TYR A O    1  
ATOM 804   C CB   . TYR A 1 51  ? -13.172 -0.513  -4.354  1.00 0.27 ? 51  TYR A CB   1  
ATOM 805   C CG   . TYR A 1 51  ? -12.600 0.414   -5.407  1.00 0.29 ? 51  TYR A CG   1  
ATOM 806   C CD1  . TYR A 1 51  ? -12.246 1.722   -5.067  1.00 0.28 ? 51  TYR A CD1  1  
ATOM 807   C CD2  . TYR A 1 51  ? -12.474 -0.018  -6.732  1.00 0.32 ? 51  TYR A CD2  1  
ATOM 808   C CE1  . TYR A 1 51  ? -11.771 2.597   -6.040  1.00 0.31 ? 51  TYR A CE1  1  
ATOM 809   C CE2  . TYR A 1 51  ? -11.986 0.861   -7.710  1.00 0.34 ? 51  TYR A CE2  1  
ATOM 810   C CZ   . TYR A 1 51  ? -11.638 2.169   -7.363  1.00 0.34 ? 51  TYR A CZ   1  
ATOM 811   O OH   . TYR A 1 51  ? -11.176 3.040   -8.328  1.00 0.37 ? 51  TYR A OH   1  
ATOM 812   H H    . TYR A 1 51  ? -12.875 -0.507  -1.485  1.00 0.25 ? 51  TYR A H    1  
ATOM 813   H HA   . TYR A 1 51  ? -11.688 -1.982  -3.780  1.00 0.26 ? 51  TYR A HA   1  
ATOM 814   H HB2  . TYR A 1 51  ? -13.650 -1.346  -4.847  1.00 0.29 ? 51  TYR A HB2  1  
ATOM 815   H HB3  . TYR A 1 51  ? -13.911 0.021   -3.780  1.00 0.27 ? 51  TYR A HB3  1  
ATOM 816   H HD1  . TYR A 1 51  ? -12.332 2.055   -4.050  1.00 0.26 ? 51  TYR A HD1  1  
ATOM 817   H HD2  . TYR A 1 51  ? -12.743 -1.029  -6.998  1.00 0.34 ? 51  TYR A HD2  1  
ATOM 818   H HE1  . TYR A 1 51  ? -11.509 3.604   -5.766  1.00 0.30 ? 51  TYR A HE1  1  
ATOM 819   H HE2  . TYR A 1 51  ? -11.881 0.531   -8.730  1.00 0.37 ? 51  TYR A HE2  1  
ATOM 820   H HH   . TYR A 1 51  ? -11.934 3.371   -8.816  1.00 0.76 ? 51  TYR A HH   1  
ATOM 821   N N    . ILE A 1 52  ? -9.879  -0.170  -3.884  1.00 0.25 ? 52  ILE A N    1  
ATOM 822   C CA   . ILE A 1 52  ? -8.748  0.765   -3.631  1.00 0.24 ? 52  ILE A CA   1  
ATOM 823   C C    . ILE A 1 52  ? -8.024  1.093   -4.934  1.00 0.28 ? 52  ILE A C    1  
ATOM 824   O O    . ILE A 1 52  ? -7.354  0.259   -5.507  1.00 0.34 ? 52  ILE A O    1  
ATOM 825   C CB   . ILE A 1 52  ? -7.770  0.107   -2.649  1.00 0.24 ? 52  ILE A CB   1  
ATOM 826   C CG1  . ILE A 1 52  ? -8.555  -0.637  -1.559  1.00 0.33 ? 52  ILE A CG1  1  
ATOM 827   C CG2  . ILE A 1 52  ? -6.901  1.181   -1.999  1.00 0.30 ? 52  ILE A CG2  1  
ATOM 828   C CD1  . ILE A 1 52  ? -7.589  -1.292  -0.569  1.00 0.75 ? 52  ILE A CD1  1  
ATOM 829   H H    . ILE A 1 52  ? -9.798  -0.881  -4.549  1.00 0.26 ? 52  ILE A H    1  
ATOM 830   H HA   . ILE A 1 52  ? -9.132  1.671   -3.193  1.00 0.24 ? 52  ILE A HA   1  
ATOM 831   H HB   . ILE A 1 52  ? -7.140  -0.591  -3.182  1.00 0.34 ? 52  ILE A HB   1  
ATOM 832   H HG12 . ILE A 1 52  ? -9.188  0.063   -1.034  1.00 0.96 ? 52  ILE A HG12 1  
ATOM 833   H HG13 . ILE A 1 52  ? -9.167  -1.399  -2.018  1.00 0.72 ? 52  ILE A HG13 1  
ATOM 834   H HG21 . ILE A 1 52  ? -6.765  2.000   -2.688  1.00 1.08 ? 52  ILE A HG21 1  
ATOM 835   H HG22 . ILE A 1 52  ? -7.385  1.539   -1.102  1.00 1.02 ? 52  ILE A HG22 1  
ATOM 836   H HG23 . ILE A 1 52  ? -5.940  0.759   -1.745  1.00 1.06 ? 52  ILE A HG23 1  
ATOM 837   H HD11 . ILE A 1 52  ? -6.775  -0.617  -0.355  1.00 1.43 ? 52  ILE A HD11 1  
ATOM 838   H HD12 . ILE A 1 52  ? -8.115  -1.522  0.346   1.00 1.35 ? 52  ILE A HD12 1  
ATOM 839   H HD13 . ILE A 1 52  ? -7.199  -2.202  -0.996  1.00 1.33 ? 52  ILE A HD13 1  
ATOM 840   N N    . LYS A 1 53  ? -8.145  2.307   -5.404  1.00 0.31 ? 53  LYS A N    1  
ATOM 841   C CA   . LYS A 1 53  ? -7.454  2.682   -6.667  1.00 0.33 ? 53  LYS A CA   1  
ATOM 842   C C    . LYS A 1 53  ? -6.365  3.719   -6.372  1.00 0.35 ? 53  LYS A C    1  
ATOM 843   O O    . LYS A 1 53  ? -6.633  4.899   -6.262  1.00 0.36 ? 53  LYS A O    1  
ATOM 844   C CB   . LYS A 1 53  ? -8.464  3.260   -7.657  1.00 0.37 ? 53  LYS A CB   1  
ATOM 845   C CG   . LYS A 1 53  ? -7.765  3.577   -8.984  1.00 0.55 ? 53  LYS A CG   1  
ATOM 846   C CD   . LYS A 1 53  ? -8.226  4.945   -9.494  1.00 0.76 ? 53  LYS A CD   1  
ATOM 847   C CE   . LYS A 1 53  ? -9.468  4.774   -10.370 1.00 1.25 ? 53  LYS A CE   1  
ATOM 848   N NZ   . LYS A 1 53  ? -9.069  4.792   -11.806 1.00 1.54 ? 53  LYS A NZ   1  
ATOM 849   H H    . LYS A 1 53  ? -8.685  2.969   -4.923  1.00 0.36 ? 53  LYS A H    1  
ATOM 850   H HA   . LYS A 1 53  ? -7.006  1.802   -7.091  1.00 0.36 ? 53  LYS A HA   1  
ATOM 851   H HB2  . LYS A 1 53  ? -9.244  2.535   -7.829  1.00 0.53 ? 53  LYS A HB2  1  
ATOM 852   H HB3  . LYS A 1 53  ? -8.893  4.164   -7.251  1.00 0.47 ? 53  LYS A HB3  1  
ATOM 853   H HG2  . LYS A 1 53  ? -6.695  3.590   -8.834  1.00 0.74 ? 53  LYS A HG2  1  
ATOM 854   H HG3  . LYS A 1 53  ? -8.017  2.822   -9.712  1.00 0.79 ? 53  LYS A HG3  1  
ATOM 855   H HD2  . LYS A 1 53  ? -8.461  5.581   -8.653  1.00 1.40 ? 53  LYS A HD2  1  
ATOM 856   H HD3  . LYS A 1 53  ? -7.436  5.396   -10.076 1.00 1.40 ? 53  LYS A HD3  1  
ATOM 857   H HE2  . LYS A 1 53  ? -9.945  3.832   -10.141 1.00 1.79 ? 53  LYS A HE2  1  
ATOM 858   H HE3  . LYS A 1 53  ? -10.158 5.583   -10.179 1.00 1.87 ? 53  LYS A HE3  1  
ATOM 859   H HZ1  . LYS A 1 53  ? -8.295  4.114   -11.959 1.00 1.89 ? 53  LYS A HZ1  1  
ATOM 860   H HZ2  . LYS A 1 53  ? -9.885  4.528   -12.396 1.00 2.01 ? 53  LYS A HZ2  1  
ATOM 861   H HZ3  . LYS A 1 53  ? -8.747  5.745   -12.065 1.00 1.85 ? 53  LYS A HZ3  1  
ATOM 862   N N    . THR A 1 54  ? -5.139  3.282   -6.245  1.00 0.40 ? 54  THR A N    1  
ATOM 863   C CA   . THR A 1 54  ? -4.024  4.232   -5.954  1.00 0.45 ? 54  THR A CA   1  
ATOM 864   C C    . THR A 1 54  ? -3.388  4.707   -7.260  1.00 0.51 ? 54  THR A C    1  
ATOM 865   O O    . THR A 1 54  ? -2.515  4.061   -7.804  1.00 0.72 ? 54  THR A O    1  
ATOM 866   C CB   . THR A 1 54  ? -2.966  3.524   -5.112  1.00 0.54 ? 54  THR A CB   1  
ATOM 867   O OG1  . THR A 1 54  ? -3.588  2.873   -4.012  1.00 0.53 ? 54  THR A OG1  1  
ATOM 868   C CG2  . THR A 1 54  ? -1.951  4.547   -4.602  1.00 0.66 ? 54  THR A CG2  1  
ATOM 869   H H    . THR A 1 54  ? -4.951  2.325   -6.338  1.00 0.42 ? 54  THR A H    1  
ATOM 870   H HA   . THR A 1 54  ? -4.402  5.079   -5.410  1.00 0.44 ? 54  THR A HA   1  
ATOM 871   H HB   . THR A 1 54  ? -2.460  2.797   -5.719  1.00 0.63 ? 54  THR A HB   1  
ATOM 872   H HG1  . THR A 1 54  ? -3.486  1.926   -4.131  1.00 0.81 ? 54  THR A HG1  1  
ATOM 873   H HG21 . THR A 1 54  ? -1.900  5.377   -5.291  1.00 1.26 ? 54  THR A HG21 1  
ATOM 874   H HG22 . THR A 1 54  ? -2.256  4.904   -3.630  1.00 1.25 ? 54  THR A HG22 1  
ATOM 875   H HG23 . THR A 1 54  ? -0.979  4.082   -4.526  1.00 1.10 ? 54  THR A HG23 1  
ATOM 876   N N    . SER A 1 55  ? -3.812  5.835   -7.766  1.00 0.79 ? 55  SER A N    1  
ATOM 877   C CA   . SER A 1 55  ? -3.224  6.351   -9.036  1.00 0.89 ? 55  SER A CA   1  
ATOM 878   C C    . SER A 1 55  ? -2.562  7.709   -8.785  1.00 0.97 ? 55  SER A C    1  
ATOM 879   O O    . SER A 1 55  ? -2.485  8.172   -7.664  1.00 1.03 ? 55  SER A O    1  
ATOM 880   C CB   . SER A 1 55  ? -4.328  6.502   -10.084 1.00 1.12 ? 55  SER A CB   1  
ATOM 881   O OG   . SER A 1 55  ? -5.051  7.702   -9.839  1.00 1.28 ? 55  SER A OG   1  
ATOM 882   H H    . SER A 1 55  ? -4.513  6.343   -7.310  1.00 1.08 ? 55  SER A H    1  
ATOM 883   H HA   . SER A 1 55  ? -2.483  5.653   -9.392  1.00 0.91 ? 55  SER A HA   1  
ATOM 884   H HB2  . SER A 1 55  ? -3.891  6.544   -11.067 1.00 1.17 ? 55  SER A HB2  1  
ATOM 885   H HB3  . SER A 1 55  ? -4.995  5.651   -10.026 1.00 1.23 ? 55  SER A HB3  1  
ATOM 886   H HG   . SER A 1 55  ? -5.964  7.557   -10.097 1.00 1.55 ? 55  SER A HG   1  
ATOM 887   N N    . THR A 1 56  ? -2.080  8.351   -9.820  1.00 1.22 ? 56  THR A N    1  
ATOM 888   C CA   . THR A 1 56  ? -1.422  9.677   -9.632  1.00 1.49 ? 56  THR A CA   1  
ATOM 889   C C    . THR A 1 56  ? -1.659  10.565  -10.861 1.00 1.76 ? 56  THR A C    1  
ATOM 890   O O    . THR A 1 56  ? -1.931  11.743  -10.737 1.00 2.02 ? 56  THR A O    1  
ATOM 891   C CB   . THR A 1 56  ? 0.081   9.481   -9.418  1.00 1.65 ? 56  THR A CB   1  
ATOM 892   O OG1  . THR A 1 56  ? 0.710   10.749  -9.303  1.00 2.25 ? 56  THR A OG1  1  
ATOM 893   C CG2  . THR A 1 56  ? 0.678   8.722   -10.602 1.00 2.17 ? 56  THR A CG2  1  
ATOM 894   H H    . THR A 1 56  ? -2.150  7.960   -10.716 1.00 1.33 ? 56  THR A H    1  
ATOM 895   H HA   . THR A 1 56  ? -1.841  10.159  -8.764  1.00 1.54 ? 56  THR A HA   1  
ATOM 896   H HB   . THR A 1 56  ? 0.245   8.914   -8.514  1.00 1.83 ? 56  THR A HB   1  
ATOM 897   H HG1  . THR A 1 56  ? 1.155   10.784  -8.453  1.00 2.64 ? 56  THR A HG1  1  
ATOM 898   H HG21 . THR A 1 56  ? 0.174   7.774   -10.712 1.00 2.49 ? 56  THR A HG21 1  
ATOM 899   H HG22 . THR A 1 56  ? 0.552   9.304   -11.502 1.00 2.57 ? 56  THR A HG22 1  
ATOM 900   H HG23 . THR A 1 56  ? 1.730   8.554   -10.426 1.00 2.70 ? 56  THR A HG23 1  
ATOM 901   N N    . THR A 1 57  ? -1.556  10.016  -12.044 1.00 1.82 ? 57  THR A N    1  
ATOM 902   C CA   . THR A 1 57  ? -1.776  10.841  -13.270 1.00 2.19 ? 57  THR A CA   1  
ATOM 903   C C    . THR A 1 57  ? -2.029  9.932   -14.472 1.00 2.30 ? 57  THR A C    1  
ATOM 904   O O    . THR A 1 57  ? -2.890  10.191  -15.289 1.00 2.57 ? 57  THR A O    1  
ATOM 905   C CB   . THR A 1 57  ? -0.539  11.697  -13.545 1.00 2.52 ? 57  THR A CB   1  
ATOM 906   O OG1  . THR A 1 57  ? 0.012   12.148  -12.315 1.00 2.54 ? 57  THR A OG1  1  
ATOM 907   C CG2  . THR A 1 57  ? -0.926  12.901  -14.407 1.00 2.87 ? 57  THR A CG2  1  
ATOM 908   H H    . THR A 1 57  ? -1.334  9.066   -12.127 1.00 1.70 ? 57  THR A H    1  
ATOM 909   H HA   . THR A 1 57  ? -2.624  11.482  -13.124 1.00 2.29 ? 57  THR A HA   1  
ATOM 910   H HB   . THR A 1 57  ? 0.190   11.107  -14.070 1.00 2.65 ? 57  THR A HB   1  
ATOM 911   H HG1  . THR A 1 57  ? 0.914   11.821  -12.257 1.00 2.84 ? 57  THR A HG1  1  
ATOM 912   H HG21 . THR A 1 57  ? -1.995  12.903  -14.569 1.00 3.26 ? 57  THR A HG21 1  
ATOM 913   H HG22 . THR A 1 57  ? -0.638  13.812  -13.904 1.00 3.04 ? 57  THR A HG22 1  
ATOM 914   H HG23 . THR A 1 57  ? -0.419  12.840  -15.359 1.00 3.10 ? 57  THR A HG23 1  
ATOM 915   N N    . VAL A 1 58  ? -1.277  8.874   -14.589 1.00 2.28 ? 58  VAL A N    1  
ATOM 916   C CA   . VAL A 1 58  ? -1.462  7.948   -15.742 1.00 2.50 ? 58  VAL A CA   1  
ATOM 917   C C    . VAL A 1 58  ? -2.299  6.744   -15.306 1.00 2.30 ? 58  VAL A C    1  
ATOM 918   O O    . VAL A 1 58  ? -2.837  6.712   -14.216 1.00 2.29 ? 58  VAL A O    1  
ATOM 919   C CB   . VAL A 1 58  ? -0.093  7.474   -16.232 1.00 2.93 ? 58  VAL A CB   1  
ATOM 920   C CG1  . VAL A 1 58  ? 0.641   8.639   -16.899 1.00 3.46 ? 58  VAL A CG1  1  
ATOM 921   C CG2  . VAL A 1 58  ? 0.723   6.974   -15.040 1.00 3.27 ? 58  VAL A CG2  1  
ATOM 922   H H    . VAL A 1 58  ? -0.585  8.691   -13.921 1.00 2.27 ? 58  VAL A H    1  
ATOM 923   H HA   . VAL A 1 58  ? -1.967  8.466   -16.541 1.00 2.74 ? 58  VAL A HA   1  
ATOM 924   H HB   . VAL A 1 58  ? -0.222  6.673   -16.945 1.00 3.03 ? 58  VAL A HB   1  
ATOM 925   H HG11 . VAL A 1 58  ? -0.079  9.351   -17.273 1.00 3.81 ? 58  VAL A HG11 1  
ATOM 926   H HG12 . VAL A 1 58  ? 1.283   9.121   -16.177 1.00 3.52 ? 58  VAL A HG12 1  
ATOM 927   H HG13 . VAL A 1 58  ? 1.237   8.266   -17.719 1.00 3.90 ? 58  VAL A HG13 1  
ATOM 928   H HG21 . VAL A 1 58  ? 0.077   6.430   -14.366 1.00 3.50 ? 58  VAL A HG21 1  
ATOM 929   H HG22 . VAL A 1 58  ? 1.510   6.324   -15.389 1.00 3.58 ? 58  VAL A HG22 1  
ATOM 930   H HG23 . VAL A 1 58  ? 1.155   7.818   -14.522 1.00 3.56 ? 58  VAL A HG23 1  
ATOM 931   N N    . ARG A 1 59  ? -2.415  5.753   -16.150 1.00 2.54 ? 59  ARG A N    1  
ATOM 932   C CA   . ARG A 1 59  ? -3.218  4.548   -15.792 1.00 2.58 ? 59  ARG A CA   1  
ATOM 933   C C    . ARG A 1 59  ? -2.680  3.934   -14.495 1.00 1.99 ? 59  ARG A C    1  
ATOM 934   O O    . ARG A 1 59  ? -1.568  4.205   -14.086 1.00 2.38 ? 59  ARG A O    1  
ATOM 935   C CB   . ARG A 1 59  ? -3.118  3.522   -16.923 1.00 3.33 ? 59  ARG A CB   1  
ATOM 936   C CG   . ARG A 1 59  ? -4.441  2.766   -17.049 1.00 3.92 ? 59  ARG A CG   1  
ATOM 937   C CD   . ARG A 1 59  ? -4.212  1.470   -17.828 1.00 4.30 ? 59  ARG A CD   1  
ATOM 938   N NE   . ARG A 1 59  ? -3.637  1.792   -19.164 1.00 4.98 ? 59  ARG A NE   1  
ATOM 939   C CZ   . ARG A 1 59  ? -3.435  0.842   -20.034 1.00 5.51 ? 59  ARG A CZ   1  
ATOM 940   N NH1  . ARG A 1 59  ? -2.352  0.117   -19.967 1.00 6.00 ? 59  ARG A NH1  1  
ATOM 941   N NH2  . ARG A 1 59  ? -4.317  0.616   -20.969 1.00 5.84 ? 59  ARG A NH2  1  
ATOM 942   H H    . ARG A 1 59  ? -1.974  5.803   -17.024 1.00 2.92 ? 59  ARG A H    1  
ATOM 943   H HA   . ARG A 1 59  ? -4.251  4.832   -15.655 1.00 2.78 ? 59  ARG A HA   1  
ATOM 944   H HB2  . ARG A 1 59  ? -2.904  4.032   -17.851 1.00 3.70 ? 59  ARG A HB2  1  
ATOM 945   H HB3  . ARG A 1 59  ? -2.325  2.823   -16.705 1.00 3.54 ? 59  ARG A HB3  1  
ATOM 946   H HG2  . ARG A 1 59  ? -4.819  2.533   -16.064 1.00 4.16 ? 59  ARG A HG2  1  
ATOM 947   H HG3  . ARG A 1 59  ? -5.158  3.378   -17.576 1.00 4.28 ? 59  ARG A HG3  1  
ATOM 948   H HD2  . ARG A 1 59  ? -3.525  0.839   -17.284 1.00 4.22 ? 59  ARG A HD2  1  
ATOM 949   H HD3  . ARG A 1 59  ? -5.152  0.954   -17.955 1.00 4.59 ? 59  ARG A HD3  1  
ATOM 950   H HE   . ARG A 1 59  ? -3.410  2.719   -19.389 1.00 5.28 ? 59  ARG A HE   1  
ATOM 951   H HH11 . ARG A 1 59  ? -1.678  0.291   -19.250 1.00 5.99 ? 59  ARG A HH11 1  
ATOM 952   H HH12 . ARG A 1 59  ? -2.196  -0.611  -20.634 1.00 6.55 ? 59  ARG A HH12 1  
ATOM 953   H HH21 . ARG A 1 59  ? -5.148  1.171   -21.018 1.00 5.76 ? 59  ARG A HH21 1  
ATOM 954   H HH22 . ARG A 1 59  ? -4.163  -0.113  -21.636 1.00 6.37 ? 59  ARG A HH22 1  
ATOM 955   N N    . THR A 1 60  ? -3.462  3.111   -13.846 1.00 1.45 ? 60  THR A N    1  
ATOM 956   C CA   . THR A 1 60  ? -2.999  2.479   -12.577 1.00 1.08 ? 60  THR A CA   1  
ATOM 957   C C    . THR A 1 60  ? -3.860  1.247   -12.279 1.00 1.07 ? 60  THR A C    1  
ATOM 958   O O    . THR A 1 60  ? -4.764  0.920   -13.022 1.00 1.71 ? 60  THR A O    1  
ATOM 959   C CB   . THR A 1 60  ? -3.129  3.483   -11.429 1.00 0.87 ? 60  THR A CB   1  
ATOM 960   O OG1  . THR A 1 60  ? -2.859  4.791   -11.913 1.00 0.92 ? 60  THR A OG1  1  
ATOM 961   C CG2  . THR A 1 60  ? -2.133  3.131   -10.324 1.00 1.52 ? 60  THR A CG2  1  
ATOM 962   H H    . THR A 1 60  ? -4.355  2.909   -14.195 1.00 1.72 ? 60  THR A H    1  
ATOM 963   H HA   . THR A 1 60  ? -1.966  2.183   -12.679 1.00 1.51 ? 60  THR A HA   1  
ATOM 964   H HB   . THR A 1 60  ? -4.131  3.447   -11.030 1.00 0.99 ? 60  THR A HB   1  
ATOM 965   H HG1  . THR A 1 60  ? -3.618  5.080   -12.425 1.00 1.34 ? 60  THR A HG1  1  
ATOM 966   H HG21 . THR A 1 60  ? -1.390  2.449   -10.711 1.00 2.14 ? 60  THR A HG21 1  
ATOM 967   H HG22 . THR A 1 60  ? -1.649  4.030   -9.974  1.00 1.75 ? 60  THR A HG22 1  
ATOM 968   H HG23 . THR A 1 60  ? -2.658  2.663   -9.504  1.00 2.03 ? 60  THR A HG23 1  
ATOM 969   N N    . THR A 1 61  ? -3.588  0.561   -11.198 1.00 0.79 ? 61  THR A N    1  
ATOM 970   C CA   . THR A 1 61  ? -4.395  -0.647  -10.859 1.00 0.72 ? 61  THR A CA   1  
ATOM 971   C C    . THR A 1 61  ? -5.134  -0.418  -9.536  1.00 0.59 ? 61  THR A C    1  
ATOM 972   O O    . THR A 1 61  ? -4.795  0.464   -8.770  1.00 0.63 ? 61  THR A O    1  
ATOM 973   C CB   . THR A 1 61  ? -3.474  -1.864  -10.734 1.00 0.88 ? 61  THR A CB   1  
ATOM 974   O OG1  . THR A 1 61  ? -4.253  -3.016  -10.446 1.00 1.64 ? 61  THR A OG1  1  
ATOM 975   C CG2  . THR A 1 61  ? -2.464  -1.638  -9.610  1.00 1.27 ? 61  THR A CG2  1  
ATOM 976   H H    . THR A 1 61  ? -2.856  0.840   -10.612 1.00 1.11 ? 61  THR A H    1  
ATOM 977   H HA   . THR A 1 61  ? -5.114  -0.825  -11.641 1.00 0.74 ? 61  THR A HA   1  
ATOM 978   H HB   . THR A 1 61  ? -2.944  -2.011  -11.662 1.00 1.50 ? 61  THR A HB   1  
ATOM 979   H HG1  . THR A 1 61  ? -4.248  -3.579  -11.224 1.00 2.12 ? 61  THR A HG1  1  
ATOM 980   H HG21 . THR A 1 61  ? -1.959  -0.696  -9.763  1.00 1.85 ? 61  THR A HG21 1  
ATOM 981   H HG22 . THR A 1 61  ? -2.980  -1.620  -8.661  1.00 1.80 ? 61  THR A HG22 1  
ATOM 982   H HG23 . THR A 1 61  ? -1.740  -2.439  -9.611  1.00 1.77 ? 61  THR A HG23 1  
ATOM 983   N N    . GLU A 1 62  ? -6.140  -1.206  -9.264  1.00 0.50 ? 62  GLU A N    1  
ATOM 984   C CA   . GLU A 1 62  ? -6.902  -1.039  -7.992  1.00 0.42 ? 62  GLU A CA   1  
ATOM 985   C C    . GLU A 1 62  ? -7.411  -2.405  -7.523  1.00 0.38 ? 62  GLU A C    1  
ATOM 986   O O    . GLU A 1 62  ? -7.708  -3.269  -8.325  1.00 0.41 ? 62  GLU A O    1  
ATOM 987   C CB   . GLU A 1 62  ? -8.089  -0.093  -8.230  1.00 0.46 ? 62  GLU A CB   1  
ATOM 988   C CG   . GLU A 1 62  ? -9.055  -0.697  -9.255  1.00 0.73 ? 62  GLU A CG   1  
ATOM 989   C CD   . GLU A 1 62  ? -8.519  -0.461  -10.668 1.00 1.29 ? 62  GLU A CD   1  
ATOM 990   O OE1  . GLU A 1 62  ? -7.949  0.593   -10.896 1.00 1.91 ? 62  GLU A OE1  1  
ATOM 991   O OE2  . GLU A 1 62  ? -8.689  -1.338  -11.499 1.00 1.92 ? 62  GLU A OE2  1  
ATOM 992   H H    . GLU A 1 62  ? -6.394  -1.910  -9.896  1.00 0.56 ? 62  GLU A H    1  
ATOM 993   H HA   . GLU A 1 62  ? -6.253  -0.619  -7.238  1.00 0.45 ? 62  GLU A HA   1  
ATOM 994   H HB2  . GLU A 1 62  ? -8.611  0.068   -7.299  1.00 0.85 ? 62  GLU A HB2  1  
ATOM 995   H HB3  . GLU A 1 62  ? -7.723  0.852   -8.602  1.00 0.76 ? 62  GLU A HB3  1  
ATOM 996   H HG2  . GLU A 1 62  ? -9.154  -1.757  -9.078  1.00 1.24 ? 62  GLU A HG2  1  
ATOM 997   H HG3  . GLU A 1 62  ? -10.021 -0.225  -9.157  1.00 1.11 ? 62  GLU A HG3  1  
ATOM 998   N N    . ILE A 1 63  ? -7.520  -2.612  -6.235  1.00 0.32 ? 63  ILE A N    1  
ATOM 999   C CA   . ILE A 1 63  ? -8.018  -3.930  -5.745  1.00 0.30 ? 63  ILE A CA   1  
ATOM 1000  C C    . ILE A 1 63  ? -9.483  -3.819  -5.349  1.00 0.29 ? 63  ILE A C    1  
ATOM 1001  O O    . ILE A 1 63  ? -9.817  -3.354  -4.277  1.00 0.26 ? 63  ILE A O    1  
ATOM 1002  C CB   . ILE A 1 63  ? -7.210  -4.430  -4.540  1.00 0.28 ? 63  ILE A CB   1  
ATOM 1003  C CG1  . ILE A 1 63  ? -6.845  -3.269  -3.606  1.00 0.32 ? 63  ILE A CG1  1  
ATOM 1004  C CG2  . ILE A 1 63  ? -5.941  -5.109  -5.037  1.00 0.34 ? 63  ILE A CG2  1  
ATOM 1005  C CD1  . ILE A 1 63  ? -6.030  -3.798  -2.422  1.00 0.30 ? 63  ILE A CD1  1  
ATOM 1006  H H    . ILE A 1 63  ? -7.282  -1.907  -5.600  1.00 0.32 ? 63  ILE A H    1  
ATOM 1007  H HA   . ILE A 1 63  ? -7.931  -4.652  -6.543  1.00 0.33 ? 63  ILE A HA   1  
ATOM 1008  H HB   . ILE A 1 63  ? -7.802  -5.152  -3.997  1.00 0.29 ? 63  ILE A HB   1  
ATOM 1009  H HG12 . ILE A 1 63  ? -6.260  -2.543  -4.146  1.00 0.42 ? 63  ILE A HG12 1  
ATOM 1010  H HG13 . ILE A 1 63  ? -7.749  -2.807  -3.238  1.00 0.39 ? 63  ILE A HG13 1  
ATOM 1011  H HG21 . ILE A 1 63  ? -6.206  -5.918  -5.701  1.00 1.01 ? 63  ILE A HG21 1  
ATOM 1012  H HG22 . ILE A 1 63  ? -5.334  -4.391  -5.566  1.00 1.11 ? 63  ILE A HG22 1  
ATOM 1013  H HG23 . ILE A 1 63  ? -5.390  -5.499  -4.194  1.00 1.07 ? 63  ILE A HG23 1  
ATOM 1014  H HD11 . ILE A 1 63  ? -5.218  -4.409  -2.787  1.00 1.08 ? 63  ILE A HD11 1  
ATOM 1015  H HD12 . ILE A 1 63  ? -5.630  -2.967  -1.861  1.00 1.01 ? 63  ILE A HD12 1  
ATOM 1016  H HD13 . ILE A 1 63  ? -6.668  -4.391  -1.782  1.00 1.04 ? 63  ILE A HD13 1  
ATOM 1017  N N    . ASN A 1 64  ? -10.358 -4.278  -6.195  1.00 0.32 ? 64  ASN A N    1  
ATOM 1018  C CA   . ASN A 1 64  ? -11.806 -4.243  -5.854  1.00 0.32 ? 64  ASN A CA   1  
ATOM 1019  C C    . ASN A 1 64  ? -12.131 -5.568  -5.175  1.00 0.32 ? 64  ASN A C    1  
ATOM 1020  O O    . ASN A 1 64  ? -12.714 -6.462  -5.756  1.00 0.39 ? 64  ASN A O    1  
ATOM 1021  C CB   . ASN A 1 64  ? -12.678 -4.060  -7.110  1.00 0.37 ? 64  ASN A CB   1  
ATOM 1022  C CG   . ASN A 1 64  ? -12.021 -4.705  -8.339  1.00 0.87 ? 64  ASN A CG   1  
ATOM 1023  O OD1  . ASN A 1 64  ? -12.037 -4.138  -9.413  1.00 0.71 ? 64  ASN A OD1  1  
ATOM 1024  N ND2  . ASN A 1 64  ? -11.442 -5.872  -8.233  1.00 1.89 ? 64  ASN A ND2  1  
ATOM 1025  H H    . ASN A 1 64  ? -10.055 -4.672  -7.037  1.00 0.35 ? 64  ASN A H    1  
ATOM 1026  H HA   . ASN A 1 64  ? -11.980 -3.434  -5.159  1.00 0.29 ? 64  ASN A HA   1  
ATOM 1027  H HB2  . ASN A 1 64  ? -13.641 -4.517  -6.942  1.00 0.90 ? 64  ASN A HB2  1  
ATOM 1028  H HB3  . ASN A 1 64  ? -12.815 -3.004  -7.295  1.00 0.70 ? 64  ASN A HB3  1  
ATOM 1029  H HD21 . ASN A 1 64  ? -11.423 -6.335  -7.372  1.00 2.13 ? 64  ASN A HD21 1  
ATOM 1030  H HD22 . ASN A 1 64  ? -11.026 -6.284  -9.019  1.00 2.44 ? 64  ASN A HD22 1  
ATOM 1031  N N    . PHE A 1 65  ? -11.707 -5.704  -3.956  1.00 0.26 ? 65  PHE A N    1  
ATOM 1032  C CA   . PHE A 1 65  ? -11.915 -6.975  -3.217  1.00 0.27 ? 65  PHE A CA   1  
ATOM 1033  C C    . PHE A 1 65  ? -12.882 -6.766  -2.052  1.00 0.26 ? 65  PHE A C    1  
ATOM 1034  O O    . PHE A 1 65  ? -13.614 -5.800  -1.993  1.00 0.25 ? 65  PHE A O    1  
ATOM 1035  C CB   . PHE A 1 65  ? -10.552 -7.413  -2.658  1.00 0.26 ? 65  PHE A CB   1  
ATOM 1036  C CG   . PHE A 1 65  ? -10.136 -6.432  -1.579  1.00 0.24 ? 65  PHE A CG   1  
ATOM 1037  C CD1  . PHE A 1 65  ? -9.563  -5.203  -1.933  1.00 0.22 ? 65  PHE A CD1  1  
ATOM 1038  C CD2  . PHE A 1 65  ? -10.363 -6.732  -0.229  1.00 0.24 ? 65  PHE A CD2  1  
ATOM 1039  C CE1  . PHE A 1 65  ? -9.215  -4.279  -0.944  1.00 0.20 ? 65  PHE A CE1  1  
ATOM 1040  C CE2  . PHE A 1 65  ? -10.021 -5.805  0.760   1.00 0.22 ? 65  PHE A CE2  1  
ATOM 1041  C CZ   . PHE A 1 65  ? -9.448  -4.578  0.403   1.00 0.20 ? 65  PHE A CZ   1  
ATOM 1042  H H    . PHE A 1 65  ? -11.217 -4.971  -3.531  1.00 0.24 ? 65  PHE A H    1  
ATOM 1043  H HA   . PHE A 1 65  ? -12.294 -7.733  -3.883  1.00 0.30 ? 65  PHE A HA   1  
ATOM 1044  H HB2  . PHE A 1 65  ? -10.632 -8.406  -2.239  1.00 0.28 ? 65  PHE A HB2  1  
ATOM 1045  H HB3  . PHE A 1 65  ? -9.818  -7.412  -3.449  1.00 0.27 ? 65  PHE A HB3  1  
ATOM 1046  H HD1  . PHE A 1 65  ? -9.379  -4.971  -2.968  1.00 0.24 ? 65  PHE A HD1  1  
ATOM 1047  H HD2  . PHE A 1 65  ? -10.803 -7.679  0.050   1.00 0.26 ? 65  PHE A HD2  1  
ATOM 1048  H HE1  . PHE A 1 65  ? -8.777  -3.331  -1.225  1.00 0.20 ? 65  PHE A HE1  1  
ATOM 1049  H HE2  . PHE A 1 65  ? -10.197 -6.038  1.798   1.00 0.23 ? 65  PHE A HE2  1  
ATOM 1050  H HZ   . PHE A 1 65  ? -9.192  -3.861  1.167   1.00 0.19 ? 65  PHE A HZ   1  
ATOM 1051  N N    . LYS A 1 66  ? -12.851 -7.672  -1.118  1.00 0.28 ? 66  LYS A N    1  
ATOM 1052  C CA   . LYS A 1 66  ? -13.708 -7.581  0.087   1.00 0.30 ? 66  LYS A CA   1  
ATOM 1053  C C    . LYS A 1 66  ? -12.935 -8.238  1.225   1.00 0.29 ? 66  LYS A C    1  
ATOM 1054  O O    . LYS A 1 66  ? -12.722 -9.434  1.221   1.00 0.35 ? 66  LYS A O    1  
ATOM 1055  C CB   . LYS A 1 66  ? -15.028 -8.318  -0.151  1.00 0.38 ? 66  LYS A CB   1  
ATOM 1056  C CG   . LYS A 1 66  ? -14.771 -9.604  -0.943  1.00 1.02 ? 66  LYS A CG   1  
ATOM 1057  C CD   . LYS A 1 66  ? -15.993 -10.524 -0.848  1.00 1.28 ? 66  LYS A CD   1  
ATOM 1058  C CE   . LYS A 1 66  ? -16.513 -10.843 -2.253  1.00 1.81 ? 66  LYS A CE   1  
ATOM 1059  N NZ   . LYS A 1 66  ? -18.000 -10.737 -2.269  1.00 2.23 ? 66  LYS A NZ   1  
ATOM 1060  H H    . LYS A 1 66  ? -12.235 -8.424  -1.202  1.00 0.30 ? 66  LYS A H    1  
ATOM 1061  H HA   . LYS A 1 66  ? -13.897 -6.545  0.326   1.00 0.30 ? 66  LYS A HA   1  
ATOM 1062  H HB2  . LYS A 1 66  ? -15.478 -8.563  0.799   1.00 1.12 ? 66  LYS A HB2  1  
ATOM 1063  H HB3  . LYS A 1 66  ? -15.691 -7.682  -0.712  1.00 0.96 ? 66  LYS A HB3  1  
ATOM 1064  H HG2  . LYS A 1 66  ? -14.584 -9.355  -1.977  1.00 1.62 ? 66  LYS A HG2  1  
ATOM 1065  H HG3  . LYS A 1 66  ? -13.910 -10.110 -0.534  1.00 1.75 ? 66  LYS A HG3  1  
ATOM 1066  H HD2  . LYS A 1 66  ? -15.712 -11.442 -0.352  1.00 1.83 ? 66  LYS A HD2  1  
ATOM 1067  H HD3  . LYS A 1 66  ? -16.772 -10.034 -0.281  1.00 1.77 ? 66  LYS A HD3  1  
ATOM 1068  H HE2  . LYS A 1 66  ? -16.096 -10.142 -2.961  1.00 2.30 ? 66  LYS A HE2  1  
ATOM 1069  H HE3  . LYS A 1 66  ? -16.221 -11.847 -2.526  1.00 2.39 ? 66  LYS A HE3  1  
ATOM 1070  H HZ1  . LYS A 1 66  ? -18.402 -11.394 -1.569  1.00 2.68 ? 66  LYS A HZ1  1  
ATOM 1071  H HZ2  . LYS A 1 66  ? -18.281 -9.764  -2.034  1.00 2.58 ? 66  LYS A HZ2  1  
ATOM 1072  H HZ3  . LYS A 1 66  ? -18.355 -10.978 -3.216  1.00 2.53 ? 66  LYS A HZ3  1  
ATOM 1073  N N    . VAL A 1 67  ? -12.478 -7.458  2.175   1.00 0.26 ? 67  VAL A N    1  
ATOM 1074  C CA   . VAL A 1 67  ? -11.673 -8.015  3.306   1.00 0.28 ? 67  VAL A CA   1  
ATOM 1075  C C    . VAL A 1 67  ? -12.105 -9.450  3.619   1.00 0.40 ? 67  VAL A C    1  
ATOM 1076  O O    . VAL A 1 67  ? -13.271 -9.788  3.567   1.00 1.35 ? 67  VAL A O    1  
ATOM 1077  C CB   . VAL A 1 67  ? -11.844 -7.142  4.546   1.00 0.23 ? 67  VAL A CB   1  
ATOM 1078  C CG1  . VAL A 1 67  ? -11.033 -7.744  5.691   1.00 0.22 ? 67  VAL A CG1  1  
ATOM 1079  C CG2  . VAL A 1 67  ? -11.323 -5.734  4.254   1.00 0.20 ? 67  VAL A CG2  1  
ATOM 1080  H H    . VAL A 1 67  ? -12.641 -6.497  2.130   1.00 0.25 ? 67  VAL A H    1  
ATOM 1081  H HA   . VAL A 1 67  ? -10.630 -8.019  3.023   1.00 0.30 ? 67  VAL A HA   1  
ATOM 1082  H HB   . VAL A 1 67  ? -12.891 -7.095  4.819   1.00 0.25 ? 67  VAL A HB   1  
ATOM 1083  H HG11 . VAL A 1 67  ? -10.241 -8.356  5.284   1.00 1.03 ? 67  VAL A HG11 1  
ATOM 1084  H HG12 . VAL A 1 67  ? -10.605 -6.951  6.283   1.00 1.03 ? 67  VAL A HG12 1  
ATOM 1085  H HG13 . VAL A 1 67  ? -11.677 -8.351  6.308   1.00 1.04 ? 67  VAL A HG13 1  
ATOM 1086  H HG21 . VAL A 1 67  ? -11.408 -5.528  3.199   1.00 1.02 ? 67  VAL A HG21 1  
ATOM 1087  H HG22 . VAL A 1 67  ? -11.901 -5.016  4.810   1.00 0.95 ? 67  VAL A HG22 1  
ATOM 1088  H HG23 . VAL A 1 67  ? -10.288 -5.666  4.551   1.00 1.03 ? 67  VAL A HG23 1  
ATOM 1089  N N    . GLY A 1 68  ? -11.160 -10.296 3.913   1.00 0.78 ? 68  GLY A N    1  
ATOM 1090  C CA   . GLY A 1 68  ? -11.488 -11.718 4.193   1.00 0.71 ? 68  GLY A CA   1  
ATOM 1091  C C    . GLY A 1 68  ? -11.184 -12.540 2.938   1.00 0.61 ? 68  GLY A C    1  
ATOM 1092  O O    . GLY A 1 68  ? -11.495 -13.712 2.859   1.00 0.78 ? 68  GLY A O    1  
ATOM 1093  H H    . GLY A 1 68  ? -10.226 -9.999  3.925   1.00 1.57 ? 68  GLY A H    1  
ATOM 1094  H HA2  . GLY A 1 68  ? -10.888 -12.074 5.019   1.00 0.73 ? 68  GLY A HA2  1  
ATOM 1095  H HA3  . GLY A 1 68  ? -12.536 -11.809 4.436   1.00 0.74 ? 68  GLY A HA3  1  
ATOM 1096  N N    . GLU A 1 69  ? -10.575 -11.925 1.952   1.00 0.38 ? 69  GLU A N    1  
ATOM 1097  C CA   . GLU A 1 69  ? -10.244 -12.653 0.698   1.00 0.34 ? 69  GLU A CA   1  
ATOM 1098  C C    . GLU A 1 69  ? -8.836  -12.266 0.240   1.00 0.29 ? 69  GLU A C    1  
ATOM 1099  O O    . GLU A 1 69  ? -8.248  -11.320 0.730   1.00 0.31 ? 69  GLU A O    1  
ATOM 1100  C CB   . GLU A 1 69  ? -11.252 -12.282 -0.392  1.00 0.41 ? 69  GLU A CB   1  
ATOM 1101  C CG   . GLU A 1 69  ? -12.623 -12.872 -0.050  1.00 1.21 ? 69  GLU A CG   1  
ATOM 1102  C CD   . GLU A 1 69  ? -13.278 -13.413 -1.323  1.00 1.99 ? 69  GLU A CD   1  
ATOM 1103  O OE1  . GLU A 1 69  ? -12.578 -14.026 -2.111  1.00 2.62 ? 69  GLU A OE1  1  
ATOM 1104  O OE2  . GLU A 1 69  ? -14.469 -13.204 -1.487  1.00 2.49 ? 69  GLU A OE2  1  
ATOM 1105  H H    . GLU A 1 69  ? -10.335 -10.981 2.040   1.00 0.33 ? 69  GLU A H    1  
ATOM 1106  H HA   . GLU A 1 69  ? -10.285 -13.714 0.881   1.00 0.36 ? 69  GLU A HA   1  
ATOM 1107  H HB2  . GLU A 1 69  ? -11.330 -11.206 -0.458  1.00 1.19 ? 69  GLU A HB2  1  
ATOM 1108  H HB3  . GLU A 1 69  ? -10.918 -12.677 -1.339  1.00 1.03 ? 69  GLU A HB3  1  
ATOM 1109  H HG2  . GLU A 1 69  ? -12.502 -13.676 0.663   1.00 1.57 ? 69  GLU A HG2  1  
ATOM 1110  H HG3  . GLU A 1 69  ? -13.250 -12.104 0.376   1.00 1.72 ? 69  GLU A HG3  1  
ATOM 1111  N N    . GLU A 1 70  ? -8.289  -12.999 -0.692  1.00 0.26 ? 70  GLU A N    1  
ATOM 1112  C CA   . GLU A 1 70  ? -6.912  -12.689 -1.183  1.00 0.24 ? 70  GLU A CA   1  
ATOM 1113  C C    . GLU A 1 70  ? -6.934  -12.286 -2.654  1.00 0.25 ? 70  GLU A C    1  
ATOM 1114  O O    . GLU A 1 70  ? -7.870  -12.565 -3.378  1.00 0.28 ? 70  GLU A O    1  
ATOM 1115  C CB   . GLU A 1 70  ? -6.019  -13.930 -1.061  1.00 0.25 ? 70  GLU A CB   1  
ATOM 1116  C CG   . GLU A 1 70  ? -6.820  -15.199 -1.374  1.00 0.29 ? 70  GLU A CG   1  
ATOM 1117  C CD   . GLU A 1 70  ? -7.312  -15.832 -0.071  1.00 0.83 ? 70  GLU A CD   1  
ATOM 1118  O OE1  . GLU A 1 70  ? -8.234  -15.292 0.517   1.00 1.51 ? 70  GLU A OE1  1  
ATOM 1119  O OE2  . GLU A 1 70  ? -6.756  -16.847 0.317   1.00 1.62 ? 70  GLU A OE2  1  
ATOM 1120  H H    . GLU A 1 70  ? -8.780  -13.758 -1.060  1.00 0.27 ? 70  GLU A H    1  
ATOM 1121  H HA   . GLU A 1 70  ? -6.493  -11.888 -0.595  1.00 0.22 ? 70  GLU A HA   1  
ATOM 1122  H HB2  . GLU A 1 70  ? -5.201  -13.847 -1.761  1.00 0.25 ? 70  GLU A HB2  1  
ATOM 1123  H HB3  . GLU A 1 70  ? -5.625  -13.991 -0.068  1.00 0.26 ? 70  GLU A HB3  1  
ATOM 1124  H HG2  . GLU A 1 70  ? -7.667  -14.947 -1.996  1.00 0.75 ? 70  GLU A HG2  1  
ATOM 1125  H HG3  . GLU A 1 70  ? -6.189  -15.902 -1.896  1.00 0.74 ? 70  GLU A HG3  1  
ATOM 1126  N N    . PHE A 1 71  ? -5.868  -11.682 -3.108  1.00 0.25 ? 71  PHE A N    1  
ATOM 1127  C CA   . PHE A 1 71  ? -5.769  -11.312 -4.543  1.00 0.28 ? 71  PHE A CA   1  
ATOM 1128  C C    . PHE A 1 71  ? -4.588  -12.074 -5.122  1.00 0.27 ? 71  PHE A C    1  
ATOM 1129  O O    . PHE A 1 71  ? -3.983  -12.891 -4.461  1.00 0.26 ? 71  PHE A O    1  
ATOM 1130  C CB   . PHE A 1 71  ? -5.504  -9.810  -4.751  1.00 0.32 ? 71  PHE A CB   1  
ATOM 1131  C CG   . PHE A 1 71  ? -6.069  -8.954  -3.639  1.00 0.27 ? 71  PHE A CG   1  
ATOM 1132  C CD1  . PHE A 1 71  ? -7.309  -9.246  -3.058  1.00 0.27 ? 71  PHE A CD1  1  
ATOM 1133  C CD2  . PHE A 1 71  ? -5.343  -7.835  -3.212  1.00 0.25 ? 71  PHE A CD2  1  
ATOM 1134  C CE1  . PHE A 1 71  ? -7.816  -8.415  -2.047  1.00 0.25 ? 71  PHE A CE1  1  
ATOM 1135  C CE2  . PHE A 1 71  ? -5.852  -7.007  -2.211  1.00 0.22 ? 71  PHE A CE2  1  
ATOM 1136  C CZ   . PHE A 1 71  ? -7.085  -7.295  -1.628  1.00 0.22 ? 71  PHE A CZ   1  
ATOM 1137  H H    . PHE A 1 71  ? -5.111  -11.516 -2.510  1.00 0.24 ? 71  PHE A H    1  
ATOM 1138  H HA   . PHE A 1 71  ? -6.666  -11.603 -5.059  1.00 0.30 ? 71  PHE A HA   1  
ATOM 1139  H HB2  . PHE A 1 71  ? -4.438  -9.646  -4.804  1.00 0.34 ? 71  PHE A HB2  1  
ATOM 1140  H HB3  . PHE A 1 71  ? -5.948  -9.506  -5.689  1.00 0.40 ? 71  PHE A HB3  1  
ATOM 1141  H HD1  . PHE A 1 71  ? -7.871  -10.109 -3.383  1.00 0.29 ? 71  PHE A HD1  1  
ATOM 1142  H HD2  . PHE A 1 71  ? -4.387  -7.611  -3.660  1.00 0.28 ? 71  PHE A HD2  1  
ATOM 1143  H HE1  . PHE A 1 71  ? -8.768  -8.637  -1.591  1.00 0.27 ? 71  PHE A HE1  1  
ATOM 1144  H HE2  . PHE A 1 71  ? -5.289  -6.148  -1.881  1.00 0.22 ? 71  PHE A HE2  1  
ATOM 1145  H HZ   . PHE A 1 71  ? -7.476  -6.645  -0.862  1.00 0.22 ? 71  PHE A HZ   1  
ATOM 1146  N N    . GLU A 1 72  ? -4.243  -11.797 -6.337  1.00 0.30 ? 72  GLU A N    1  
ATOM 1147  C CA   . GLU A 1 72  ? -3.078  -12.486 -6.948  1.00 0.31 ? 72  GLU A CA   1  
ATOM 1148  C C    . GLU A 1 72  ? -2.140  -11.446 -7.539  1.00 0.36 ? 72  GLU A C    1  
ATOM 1149  O O    . GLU A 1 72  ? -2.535  -10.338 -7.844  1.00 0.43 ? 72  GLU A O    1  
ATOM 1150  C CB   . GLU A 1 72  ? -3.534  -13.429 -8.053  1.00 0.39 ? 72  GLU A CB   1  
ATOM 1151  C CG   . GLU A 1 72  ? -4.645  -14.327 -7.522  1.00 0.41 ? 72  GLU A CG   1  
ATOM 1152  C CD   . GLU A 1 72  ? -5.391  -14.971 -8.692  1.00 0.53 ? 72  GLU A CD   1  
ATOM 1153  O OE1  . GLU A 1 72  ? -6.021  -14.242 -9.441  1.00 1.22 ? 72  GLU A OE1  1  
ATOM 1154  O OE2  . GLU A 1 72  ? -5.319  -16.182 -8.820  1.00 1.22 ? 72  GLU A OE2  1  
ATOM 1155  H H    . GLU A 1 72  ? -4.739  -11.124 -6.840  1.00 0.32 ? 72  GLU A H    1  
ATOM 1156  H HA   . GLU A 1 72  ? -2.560  -13.047 -6.188  1.00 0.30 ? 72  GLU A HA   1  
ATOM 1157  H HB2  . GLU A 1 72  ? -3.894  -12.851 -8.885  1.00 0.43 ? 72  GLU A HB2  1  
ATOM 1158  H HB3  . GLU A 1 72  ? -2.702  -14.039 -8.371  1.00 0.42 ? 72  GLU A HB3  1  
ATOM 1159  H HG2  . GLU A 1 72  ? -4.212  -15.095 -6.900  1.00 0.44 ? 72  GLU A HG2  1  
ATOM 1160  H HG3  . GLU A 1 72  ? -5.333  -13.735 -6.939  1.00 0.35 ? 72  GLU A HG3  1  
ATOM 1161  N N    . GLU A 1 73  ? -0.903  -11.796 -7.703  1.00 0.38 ? 73  GLU A N    1  
ATOM 1162  C CA   . GLU A 1 73  ? 0.069   -10.825 -8.279  1.00 0.48 ? 73  GLU A CA   1  
ATOM 1163  C C    . GLU A 1 73  ? 1.409   -11.511 -8.534  1.00 0.49 ? 73  GLU A C    1  
ATOM 1164  O O    . GLU A 1 73  ? 1.567   -12.695 -8.323  1.00 0.48 ? 73  GLU A O    1  
ATOM 1165  C CB   . GLU A 1 73  ? 0.263   -9.660  -7.302  1.00 0.54 ? 73  GLU A CB   1  
ATOM 1166  C CG   . GLU A 1 73  ? 0.025   -8.334  -8.030  1.00 0.77 ? 73  GLU A CG   1  
ATOM 1167  C CD   . GLU A 1 73  ? 0.243   -7.171  -7.059  1.00 1.13 ? 73  GLU A CD   1  
ATOM 1168  O OE1  . GLU A 1 73  ? -0.072  -7.332  -5.892  1.00 1.88 ? 73  GLU A OE1  1  
ATOM 1169  O OE2  . GLU A 1 73  ? 0.722   -6.139  -7.500  1.00 1.66 ? 73  GLU A OE2  1  
ATOM 1170  H H    . GLU A 1 73  ? -0.616  -12.698 -7.447  1.00 0.36 ? 73  GLU A H    1  
ATOM 1171  H HA   . GLU A 1 73  ? -0.317  -10.449 -9.212  1.00 0.56 ? 73  GLU A HA   1  
ATOM 1172  H HB2  . GLU A 1 73  ? -0.440  -9.755  -6.487  1.00 0.66 ? 73  GLU A HB2  1  
ATOM 1173  H HB3  . GLU A 1 73  ? 1.270   -9.678  -6.913  1.00 0.64 ? 73  GLU A HB3  1  
ATOM 1174  H HG2  . GLU A 1 73  ? 0.715   -8.249  -8.857  1.00 1.31 ? 73  GLU A HG2  1  
ATOM 1175  H HG3  . GLU A 1 73  ? -0.989  -8.304  -8.401  1.00 1.15 ? 73  GLU A HG3  1  
ATOM 1176  N N    . GLN A 1 74  ? 2.373   -10.763 -8.993  1.00 0.57 ? 74  GLN A N    1  
ATOM 1177  C CA   . GLN A 1 74  ? 3.717   -11.348 -9.270  1.00 0.61 ? 74  GLN A CA   1  
ATOM 1178  C C    . GLN A 1 74  ? 4.799   -10.375 -8.797  1.00 0.64 ? 74  GLN A C    1  
ATOM 1179  O O    . GLN A 1 74  ? 4.719   -9.185  -9.030  1.00 0.69 ? 74  GLN A O    1  
ATOM 1180  C CB   . GLN A 1 74  ? 3.874   -11.583 -10.773 1.00 0.69 ? 74  GLN A CB   1  
ATOM 1181  C CG   . GLN A 1 74  ? 2.927   -12.699 -11.219 1.00 0.76 ? 74  GLN A CG   1  
ATOM 1182  C CD   . GLN A 1 74  ? 2.924   -12.791 -12.747 1.00 1.00 ? 74  GLN A CD   1  
ATOM 1183  O OE1  . GLN A 1 74  ? 3.821   -12.294 -13.400 1.00 1.53 ? 74  GLN A OE1  1  
ATOM 1184  N NE2  . GLN A 1 74  ? 1.945   -13.410 -13.349 1.00 1.48 ? 74  GLN A NE2  1  
ATOM 1185  H H    . GLN A 1 74  ? 2.208   -9.812  -9.158  1.00 0.64 ? 74  GLN A H    1  
ATOM 1186  H HA   . GLN A 1 74  ? 3.819   -12.286 -8.745  1.00 0.59 ? 74  GLN A HA   1  
ATOM 1187  H HB2  . GLN A 1 74  ? 3.637   -10.673 -11.305 1.00 0.73 ? 74  GLN A HB2  1  
ATOM 1188  H HB3  . GLN A 1 74  ? 4.893   -11.870 -10.987 1.00 0.74 ? 74  GLN A HB3  1  
ATOM 1189  H HG2  . GLN A 1 74  ? 3.258   -13.640 -10.803 1.00 0.79 ? 74  GLN A HG2  1  
ATOM 1190  H HG3  . GLN A 1 74  ? 1.928   -12.484 -10.872 1.00 0.83 ? 74  GLN A HG3  1  
ATOM 1191  H HE21 . GLN A 1 74  ? 1.222   -13.811 -12.823 1.00 2.02 ? 74  GLN A HE21 1  
ATOM 1192  H HE22 . GLN A 1 74  ? 1.934   -13.475 -14.327 1.00 1.64 ? 74  GLN A HE22 1  
ATOM 1193  N N    . THR A 1 75  ? 5.811   -10.870 -8.133  1.00 0.65 ? 75  THR A N    1  
ATOM 1194  C CA   . THR A 1 75  ? 6.893   -9.968  -7.646  1.00 0.71 ? 75  THR A CA   1  
ATOM 1195  C C    . THR A 1 75  ? 7.736   -9.495  -8.831  1.00 0.87 ? 75  THR A C    1  
ATOM 1196  O O    . THR A 1 75  ? 7.402   -9.731  -9.975  1.00 1.13 ? 75  THR A O    1  
ATOM 1197  C CB   . THR A 1 75  ? 7.786   -10.717 -6.654  1.00 0.83 ? 75  THR A CB   1  
ATOM 1198  O OG1  . THR A 1 75  ? 7.985   -12.046 -7.110  1.00 1.59 ? 75  THR A OG1  1  
ATOM 1199  C CG2  . THR A 1 75  ? 7.119   -10.741 -5.278  1.00 1.20 ? 75  THR A CG2  1  
ATOM 1200  H H    . THR A 1 75  ? 5.857   -11.833 -7.954  1.00 0.65 ? 75  THR A H    1  
ATOM 1201  H HA   . THR A 1 75  ? 6.451   -9.115  -7.155  1.00 0.69 ? 75  THR A HA   1  
ATOM 1202  H HB   . THR A 1 75  ? 8.738   -10.217 -6.577  1.00 1.21 ? 75  THR A HB   1  
ATOM 1203  H HG1  . THR A 1 75  ? 8.562   -12.491 -6.485  1.00 1.99 ? 75  THR A HG1  1  
ATOM 1204  H HG21 . THR A 1 75  ? 6.226   -10.134 -5.299  1.00 1.76 ? 75  THR A HG21 1  
ATOM 1205  H HG22 . THR A 1 75  ? 6.858   -11.758 -5.024  1.00 1.72 ? 75  THR A HG22 1  
ATOM 1206  H HG23 . THR A 1 75  ? 7.803   -10.349 -4.540  1.00 1.76 ? 75  THR A HG23 1  
ATOM 1207  N N    . VAL A 1 76  ? 8.826   -8.826  -8.565  1.00 0.98 ? 76  VAL A N    1  
ATOM 1208  C CA   . VAL A 1 76  ? 9.690   -8.334  -9.673  1.00 1.18 ? 76  VAL A CA   1  
ATOM 1209  C C    . VAL A 1 76  ? 10.412  -9.513  -10.329 1.00 1.50 ? 76  VAL A C    1  
ATOM 1210  O O    . VAL A 1 76  ? 10.380  -9.679  -11.533 1.00 2.00 ? 76  VAL A O    1  
ATOM 1211  C CB   . VAL A 1 76  ? 10.717  -7.350  -9.119  1.00 1.21 ? 76  VAL A CB   1  
ATOM 1212  C CG1  . VAL A 1 76  ? 11.514  -6.736  -10.272 1.00 1.63 ? 76  VAL A CG1  1  
ATOM 1213  C CG2  . VAL A 1 76  ? 9.997   -6.240  -8.349  1.00 1.23 ? 76  VAL A CG2  1  
ATOM 1214  H H    . VAL A 1 76  ? 9.074   -8.645  -7.635  1.00 1.09 ? 76  VAL A H    1  
ATOM 1215  H HA   . VAL A 1 76  ? 9.080   -7.835  -10.405 1.00 1.30 ? 76  VAL A HA   1  
ATOM 1216  H HB   . VAL A 1 76  ? 11.385  -7.873  -8.459  1.00 1.46 ? 76  VAL A HB   1  
ATOM 1217  H HG11 . VAL A 1 76  ? 10.901  -6.709  -11.160 1.00 2.14 ? 76  VAL A HG11 1  
ATOM 1218  H HG12 . VAL A 1 76  ? 11.812  -5.732  -10.008 1.00 1.93 ? 76  VAL A HG12 1  
ATOM 1219  H HG13 . VAL A 1 76  ? 12.394  -7.335  -10.460 1.00 2.05 ? 76  VAL A HG13 1  
ATOM 1220  H HG21 . VAL A 1 76  ? 8.990   -6.136  -8.725  1.00 1.54 ? 76  VAL A HG21 1  
ATOM 1221  H HG22 . VAL A 1 76  ? 9.965   -6.493  -7.300  1.00 1.60 ? 76  VAL A HG22 1  
ATOM 1222  H HG23 . VAL A 1 76  ? 10.528  -5.308  -8.479  1.00 1.73 ? 76  VAL A HG23 1  
ATOM 1223  N N    . ASP A 1 77  ? 11.067  -10.333 -9.549  1.00 1.65 ? 77  ASP A N    1  
ATOM 1224  C CA   . ASP A 1 77  ? 11.793  -11.497 -10.134 1.00 2.07 ? 77  ASP A CA   1  
ATOM 1225  C C    . ASP A 1 77  ? 12.004  -12.568 -9.061  1.00 1.56 ? 77  ASP A C    1  
ATOM 1226  O O    . ASP A 1 77  ? 12.355  -12.273 -7.935  1.00 1.65 ? 77  ASP A O    1  
ATOM 1227  C CB   . ASP A 1 77  ? 13.151  -11.032 -10.668 1.00 2.80 ? 77  ASP A CB   1  
ATOM 1228  C CG   . ASP A 1 77  ? 13.191  -11.199 -12.189 1.00 3.60 ? 77  ASP A CG   1  
ATOM 1229  O OD1  . ASP A 1 77  ? 12.178  -10.944 -12.820 1.00 4.03 ? 77  ASP A OD1  1  
ATOM 1230  O OD2  . ASP A 1 77  ? 14.233  -11.579 -12.697 1.00 4.22 ? 77  ASP A OD2  1  
ATOM 1231  H H    . ASP A 1 77  ? 11.083  -10.181 -8.581  1.00 1.77 ? 77  ASP A H    1  
ATOM 1232  H HA   . ASP A 1 77  ? 11.211  -11.912 -10.944 1.00 2.53 ? 77  ASP A HA   1  
ATOM 1233  H HB2  . ASP A 1 77  ? 13.298  -9.991  -10.416 1.00 3.13 ? 77  ASP A HB2  1  
ATOM 1234  H HB3  . ASP A 1 77  ? 13.938  -11.624 -10.223 1.00 2.99 ? 77  ASP A HB3  1  
ATOM 1235  N N    . GLY A 1 78  ? 11.794  -13.810 -9.405  1.00 1.47 ? 78  GLY A N    1  
ATOM 1236  C CA   . GLY A 1 78  ? 11.983  -14.907 -8.415  1.00 1.35 ? 78  GLY A CA   1  
ATOM 1237  C C    . GLY A 1 78  ? 10.780  -15.850 -8.465  1.00 1.21 ? 78  GLY A C    1  
ATOM 1238  O O    . GLY A 1 78  ? 10.833  -16.907 -9.062  1.00 1.43 ? 78  GLY A O    1  
ATOM 1239  H H    . GLY A 1 78  ? 11.512  -14.022 -10.319 1.00 1.82 ? 78  GLY A H    1  
ATOM 1240  H HA2  . GLY A 1 78  ? 12.884  -15.455 -8.653  1.00 1.69 ? 78  GLY A HA2  1  
ATOM 1241  H HA3  . GLY A 1 78  ? 12.066  -14.488 -7.424  1.00 1.43 ? 78  GLY A HA3  1  
ATOM 1242  N N    . ARG A 1 79  ? 9.698   -15.474 -7.842  1.00 0.97 ? 79  ARG A N    1  
ATOM 1243  C CA   . ARG A 1 79  ? 8.487   -16.344 -7.847  1.00 0.99 ? 79  ARG A CA   1  
ATOM 1244  C C    . ARG A 1 79  ? 7.237   -15.454 -7.878  1.00 0.83 ? 79  ARG A C    1  
ATOM 1245  O O    . ARG A 1 79  ? 7.348   -14.250 -7.790  1.00 0.86 ? 79  ARG A O    1  
ATOM 1246  C CB   . ARG A 1 79  ? 8.491   -17.201 -6.577  1.00 1.22 ? 79  ARG A CB   1  
ATOM 1247  C CG   . ARG A 1 79  ? 8.703   -18.671 -6.951  1.00 1.34 ? 79  ARG A CG   1  
ATOM 1248  C CD   . ARG A 1 79  ? 8.835   -19.510 -5.678  1.00 1.98 ? 79  ARG A CD   1  
ATOM 1249  N NE   . ARG A 1 79  ? 10.277  -19.777 -5.407  1.00 2.57 ? 79  ARG A NE   1  
ATOM 1250  C CZ   . ARG A 1 79  ? 10.832  -20.869 -5.855  1.00 3.11 ? 79  ARG A CZ   1  
ATOM 1251  N NH1  . ARG A 1 79  ? 10.362  -22.033 -5.500  1.00 3.60 ? 79  ARG A NH1  1  
ATOM 1252  N NH2  . ARG A 1 79  ? 11.860  -20.797 -6.657  1.00 3.68 ? 79  ARG A NH2  1  
ATOM 1253  H H    . ARG A 1 79  ? 9.681   -14.615 -7.365  1.00 0.92 ? 79  ARG A H    1  
ATOM 1254  H HA   . ARG A 1 79  ? 8.502   -16.981 -8.718  1.00 1.13 ? 79  ARG A HA   1  
ATOM 1255  H HB2  . ARG A 1 79  ? 9.294   -16.876 -5.930  1.00 1.42 ? 79  ARG A HB2  1  
ATOM 1256  H HB3  . ARG A 1 79  ? 7.550   -17.092 -6.061  1.00 1.36 ? 79  ARG A HB3  1  
ATOM 1257  H HG2  . ARG A 1 79  ? 7.861   -19.022 -7.528  1.00 1.56 ? 79  ARG A HG2  1  
ATOM 1258  H HG3  . ARG A 1 79  ? 9.606   -18.767 -7.535  1.00 1.57 ? 79  ARG A HG3  1  
ATOM 1259  H HD2  . ARG A 1 79  ? 8.406   -18.972 -4.845  1.00 2.41 ? 79  ARG A HD2  1  
ATOM 1260  H HD3  . ARG A 1 79  ? 8.315   -20.447 -5.809  1.00 2.42 ? 79  ARG A HD3  1  
ATOM 1261  H HE   . ARG A 1 79  ? 10.807  -19.131 -4.895  1.00 2.97 ? 79  ARG A HE   1  
ATOM 1262  H HH11 . ARG A 1 79  ? 9.575   -22.088 -4.885  1.00 3.69 ? 79  ARG A HH11 1  
ATOM 1263  H HH12 . ARG A 1 79  ? 10.788  -22.870 -5.843  1.00 4.19 ? 79  ARG A HH12 1  
ATOM 1264  H HH21 . ARG A 1 79  ? 12.221  -19.906 -6.929  1.00 3.82 ? 79  ARG A HH21 1  
ATOM 1265  H HH22 . ARG A 1 79  ? 12.286  -21.635 -6.999  1.00 4.26 ? 79  ARG A HH22 1  
ATOM 1266  N N    . PRO A 1 80  ? 6.079   -16.062 -7.999  1.00 0.72 ? 80  PRO A N    1  
ATOM 1267  C CA   . PRO A 1 80  ? 4.810   -15.315 -8.036  1.00 0.60 ? 80  PRO A CA   1  
ATOM 1268  C C    . PRO A 1 80  ? 4.452   -14.831 -6.629  1.00 0.51 ? 80  PRO A C    1  
ATOM 1269  O O    . PRO A 1 80  ? 5.226   -14.983 -5.704  1.00 0.57 ? 80  PRO A O    1  
ATOM 1270  C CB   . PRO A 1 80  ? 3.800   -16.337 -8.559  1.00 0.60 ? 80  PRO A CB   1  
ATOM 1271  C CG   . PRO A 1 80  ? 4.400   -17.732 -8.270  1.00 0.70 ? 80  PRO A CG   1  
ATOM 1272  C CD   . PRO A 1 80  ? 5.918   -17.531 -8.102  1.00 0.77 ? 80  PRO A CD   1  
ATOM 1273  H HA   . PRO A 1 80  ? 4.878   -14.484 -8.717  1.00 0.65 ? 80  PRO A HA   1  
ATOM 1274  H HB2  . PRO A 1 80  ? 2.858   -16.218 -8.044  1.00 0.56 ? 80  PRO A HB2  1  
ATOM 1275  H HB3  . PRO A 1 80  ? 3.662   -16.213 -9.622  1.00 0.65 ? 80  PRO A HB3  1  
ATOM 1276  H HG2  . PRO A 1 80  ? 3.974   -18.136 -7.362  1.00 0.72 ? 80  PRO A HG2  1  
ATOM 1277  H HG3  . PRO A 1 80  ? 4.210   -18.397 -9.098  1.00 0.76 ? 80  PRO A HG3  1  
ATOM 1278  H HD2  . PRO A 1 80  ? 6.259   -18.019 -7.202  1.00 0.84 ? 80  PRO A HD2  1  
ATOM 1279  H HD3  . PRO A 1 80  ? 6.449   -17.904 -8.964  1.00 0.84 ? 80  PRO A HD3  1  
ATOM 1280  N N    . CYS A 1 81  ? 3.301   -14.238 -6.455  1.00 0.41 ? 81  CYS A N    1  
ATOM 1281  C CA   . CYS A 1 81  ? 2.935   -13.741 -5.098  1.00 0.34 ? 81  CYS A CA   1  
ATOM 1282  C C    . CYS A 1 81  ? 1.486   -13.261 -5.064  1.00 0.31 ? 81  CYS A C    1  
ATOM 1283  O O    . CYS A 1 81  ? 1.020   -12.574 -5.951  1.00 0.34 ? 81  CYS A O    1  
ATOM 1284  C CB   . CYS A 1 81  ? 3.858   -12.575 -4.728  1.00 0.34 ? 81  CYS A CB   1  
ATOM 1285  S SG   . CYS A 1 81  ? 3.703   -11.259 -5.962  1.00 0.40 ? 81  CYS A SG   1  
ATOM 1286  H H    . CYS A 1 81  ? 2.691   -14.113 -7.209  1.00 0.42 ? 81  CYS A H    1  
ATOM 1287  H HA   . CYS A 1 81  ? 3.061   -14.538 -4.378  1.00 0.34 ? 81  CYS A HA   1  
ATOM 1288  H HB2  . CYS A 1 81  ? 3.582   -12.192 -3.757  1.00 0.30 ? 81  CYS A HB2  1  
ATOM 1289  H HB3  . CYS A 1 81  ? 4.881   -12.921 -4.700  1.00 0.37 ? 81  CYS A HB3  1  
ATOM 1290  H HG   . CYS A 1 81  ? 3.621   -10.423 -5.496  1.00 0.81 ? 81  CYS A HG   1  
ATOM 1291  N N    . LYS A 1 82  ? 0.785   -13.601 -4.022  1.00 0.28 ? 82  LYS A N    1  
ATOM 1292  C CA   . LYS A 1 82  ? -0.627  -13.159 -3.878  1.00 0.26 ? 82  LYS A CA   1  
ATOM 1293  C C    . LYS A 1 82  ? -0.725  -12.244 -2.664  1.00 0.24 ? 82  LYS A C    1  
ATOM 1294  O O    . LYS A 1 82  ? 0.264   -11.925 -2.032  1.00 0.24 ? 82  LYS A O    1  
ATOM 1295  C CB   . LYS A 1 82  ? -1.528  -14.372 -3.664  1.00 0.26 ? 82  LYS A CB   1  
ATOM 1296  C CG   . LYS A 1 82  ? -1.026  -15.183 -2.463  1.00 0.26 ? 82  LYS A CG   1  
ATOM 1297  C CD   . LYS A 1 82  ? -1.871  -16.456 -2.296  1.00 0.28 ? 82  LYS A CD   1  
ATOM 1298  C CE   . LYS A 1 82  ? -3.325  -16.184 -2.698  1.00 0.28 ? 82  LYS A CE   1  
ATOM 1299  N NZ   . LYS A 1 82  ? -4.206  -17.251 -2.142  1.00 0.32 ? 82  LYS A NZ   1  
ATOM 1300  H H    . LYS A 1 82  ? 1.199   -14.139 -3.316  1.00 0.28 ? 82  LYS A H    1  
ATOM 1301  H HA   . LYS A 1 82  ? -0.946  -12.624 -4.762  1.00 0.27 ? 82  LYS A HA   1  
ATOM 1302  H HB2  . LYS A 1 82  ? -2.536  -14.035 -3.472  1.00 0.25 ? 82  LYS A HB2  1  
ATOM 1303  H HB3  . LYS A 1 82  ? -1.517  -14.992 -4.546  1.00 0.28 ? 82  LYS A HB3  1  
ATOM 1304  H HG2  . LYS A 1 82  ? 0.005   -15.456 -2.624  1.00 0.27 ? 82  LYS A HG2  1  
ATOM 1305  H HG3  . LYS A 1 82  ? -1.100  -14.581 -1.568  1.00 0.26 ? 82  LYS A HG3  1  
ATOM 1306  H HD2  . LYS A 1 82  ? -1.467  -17.237 -2.923  1.00 0.30 ? 82  LYS A HD2  1  
ATOM 1307  H HD3  . LYS A 1 82  ? -1.840  -16.773 -1.264  1.00 0.29 ? 82  LYS A HD3  1  
ATOM 1308  H HE2  . LYS A 1 82  ? -3.631  -15.224 -2.311  1.00 0.26 ? 82  LYS A HE2  1  
ATOM 1309  H HE3  . LYS A 1 82  ? -3.403  -16.177 -3.777  1.00 0.30 ? 82  LYS A HE3  1  
ATOM 1310  H HZ1  . LYS A 1 82  ? -3.689  -18.152 -2.121  1.00 1.03 ? 82  LYS A HZ1  1  
ATOM 1311  H HZ2  . LYS A 1 82  ? -4.493  -16.995 -1.177  1.00 0.96 ? 82  LYS A HZ2  1  
ATOM 1312  H HZ3  . LYS A 1 82  ? -5.051  -17.348 -2.742  1.00 1.04 ? 82  LYS A HZ3  1  
ATOM 1313  N N    . SER A 1 83  ? -1.905  -11.824 -2.334  1.00 0.23 ? 83  SER A N    1  
ATOM 1314  C CA   . SER A 1 83  ? -2.074  -10.929 -1.156  1.00 0.22 ? 83  SER A CA   1  
ATOM 1315  C C    . SER A 1 83  ? -3.327  -11.319 -0.381  1.00 0.21 ? 83  SER A C    1  
ATOM 1316  O O    . SER A 1 83  ? -4.056  -12.207 -0.767  1.00 0.23 ? 83  SER A O    1  
ATOM 1317  C CB   . SER A 1 83  ? -2.210  -9.486  -1.633  1.00 0.22 ? 83  SER A CB   1  
ATOM 1318  O OG   . SER A 1 83  ? -3.331  -9.390  -2.501  1.00 0.25 ? 83  SER A OG   1  
ATOM 1319  H H    . SER A 1 83  ? -2.679  -12.095 -2.863  1.00 0.24 ? 83  SER A H    1  
ATOM 1320  H HA   . SER A 1 83  ? -1.220  -11.019 -0.512  1.00 0.22 ? 83  SER A HA   1  
ATOM 1321  H HB2  . SER A 1 83  ? -2.359  -8.836  -0.787  1.00 0.22 ? 83  SER A HB2  1  
ATOM 1322  H HB3  . SER A 1 83  ? -1.310  -9.192  -2.157  1.00 0.23 ? 83  SER A HB3  1  
ATOM 1323  H HG   . SER A 1 83  ? -4.070  -9.849  -2.088  1.00 0.25 ? 83  SER A HG   1  
ATOM 1324  N N    . LEU A 1 84  ? -3.584  -10.649 0.706   1.00 0.19 ? 84  LEU A N    1  
ATOM 1325  C CA   . LEU A 1 84  ? -4.802  -10.968 1.505   1.00 0.19 ? 84  LEU A CA   1  
ATOM 1326  C C    . LEU A 1 84  ? -5.062  -9.851  2.511   1.00 0.18 ? 84  LEU A C    1  
ATOM 1327  O O    . LEU A 1 84  ? -4.238  -9.558  3.353   1.00 0.18 ? 84  LEU A O    1  
ATOM 1328  C CB   . LEU A 1 84  ? -4.612  -12.291 2.238   1.00 0.21 ? 84  LEU A CB   1  
ATOM 1329  C CG   . LEU A 1 84  ? -5.912  -13.089 2.164   1.00 0.23 ? 84  LEU A CG   1  
ATOM 1330  C CD1  . LEU A 1 84  ? -5.604  -14.578 2.297   1.00 0.25 ? 84  LEU A CD1  1  
ATOM 1331  C CD2  . LEU A 1 84  ? -6.849  -12.656 3.290   1.00 0.24 ? 84  LEU A CD2  1  
ATOM 1332  H H    . LEU A 1 84  ? -2.977  -9.929  0.992   1.00 0.19 ? 84  LEU A H    1  
ATOM 1333  H HA   . LEU A 1 84  ? -5.648  -11.047 0.842   1.00 0.20 ? 84  LEU A HA   1  
ATOM 1334  H HB2  . LEU A 1 84  ? -3.817  -12.850 1.767   1.00 0.21 ? 84  LEU A HB2  1  
ATOM 1335  H HB3  . LEU A 1 84  ? -4.361  -12.103 3.270   1.00 0.21 ? 84  LEU A HB3  1  
ATOM 1336  H HG   . LEU A 1 84  ? -6.389  -12.906 1.213   1.00 0.23 ? 84  LEU A HG   1  
ATOM 1337  H HD11 . LEU A 1 84  ? -4.879  -14.861 1.549   1.00 1.00 ? 84  LEU A HD11 1  
ATOM 1338  H HD12 . LEU A 1 84  ? -5.205  -14.775 3.279   1.00 0.97 ? 84  LEU A HD12 1  
ATOM 1339  H HD13 . LEU A 1 84  ? -6.511  -15.145 2.154   1.00 1.01 ? 84  LEU A HD13 1  
ATOM 1340  H HD21 . LEU A 1 84  ? -6.797  -11.583 3.406   1.00 1.05 ? 84  LEU A HD21 1  
ATOM 1341  H HD22 . LEU A 1 84  ? -7.861  -12.942 3.044   1.00 1.03 ? 84  LEU A HD22 1  
ATOM 1342  H HD23 . LEU A 1 84  ? -6.551  -13.135 4.209   1.00 1.03 ? 84  LEU A HD23 1  
ATOM 1343  N N    . VAL A 1 85  ? -6.201  -9.220  2.417   1.00 0.18 ? 85  VAL A N    1  
ATOM 1344  C CA   . VAL A 1 85  ? -6.518  -8.103  3.349   1.00 0.17 ? 85  VAL A CA   1  
ATOM 1345  C C    . VAL A 1 85  ? -7.285  -8.615  4.575   1.00 0.17 ? 85  VAL A C    1  
ATOM 1346  O O    . VAL A 1 85  ? -8.107  -9.506  4.488   1.00 0.20 ? 85  VAL A O    1  
ATOM 1347  C CB   . VAL A 1 85  ? -7.364  -7.065  2.605   1.00 0.17 ? 85  VAL A CB   1  
ATOM 1348  C CG1  . VAL A 1 85  ? -8.015  -6.102  3.603   1.00 0.16 ? 85  VAL A CG1  1  
ATOM 1349  C CG2  . VAL A 1 85  ? -6.469  -6.276  1.649   1.00 0.17 ? 85  VAL A CG2  1  
ATOM 1350  H H    . VAL A 1 85  ? -6.843  -9.473  1.721   1.00 0.18 ? 85  VAL A H    1  
ATOM 1351  H HA   . VAL A 1 85  ? -5.601  -7.642  3.672   1.00 0.16 ? 85  VAL A HA   1  
ATOM 1352  H HB   . VAL A 1 85  ? -8.131  -7.570  2.041   1.00 0.18 ? 85  VAL A HB   1  
ATOM 1353  H HG11 . VAL A 1 85  ? -7.253  -5.662  4.229   1.00 1.00 ? 85  VAL A HG11 1  
ATOM 1354  H HG12 . VAL A 1 85  ? -8.535  -5.322  3.066   1.00 1.01 ? 85  VAL A HG12 1  
ATOM 1355  H HG13 . VAL A 1 85  ? -8.717  -6.644  4.219   1.00 0.98 ? 85  VAL A HG13 1  
ATOM 1356  H HG21 . VAL A 1 85  ? -5.620  -5.887  2.190   1.00 1.00 ? 85  VAL A HG21 1  
ATOM 1357  H HG22 . VAL A 1 85  ? -6.125  -6.927  0.859   1.00 1.00 ? 85  VAL A HG22 1  
ATOM 1358  H HG23 . VAL A 1 85  ? -7.030  -5.458  1.222   1.00 0.99 ? 85  VAL A HG23 1  
ATOM 1359  N N    . LYS A 1 86  ? -7.021  -8.031  5.715   1.00 0.17 ? 86  LYS A N    1  
ATOM 1360  C CA   . LYS A 1 86  ? -7.718  -8.432  6.965   1.00 0.18 ? 86  LYS A CA   1  
ATOM 1361  C C    . LYS A 1 86  ? -7.859  -7.203  7.863   1.00 0.17 ? 86  LYS A C    1  
ATOM 1362  O O    . LYS A 1 86  ? -7.747  -6.080  7.414   1.00 0.16 ? 86  LYS A O    1  
ATOM 1363  C CB   . LYS A 1 86  ? -6.897  -9.502  7.684   1.00 0.20 ? 86  LYS A CB   1  
ATOM 1364  C CG   . LYS A 1 86  ? -7.823  -10.580 8.251   1.00 0.31 ? 86  LYS A CG   1  
ATOM 1365  C CD   . LYS A 1 86  ? -8.604  -11.252 7.116   1.00 0.59 ? 86  LYS A CD   1  
ATOM 1366  C CE   . LYS A 1 86  ? -10.067 -10.798 7.157   1.00 0.49 ? 86  LYS A CE   1  
ATOM 1367  N NZ   . LYS A 1 86  ? -10.917 -11.901 7.687   1.00 0.79 ? 86  LYS A NZ   1  
ATOM 1368  H H    . LYS A 1 86  ? -6.362  -7.313  5.746   1.00 0.17 ? 86  LYS A H    1  
ATOM 1369  H HA   . LYS A 1 86  ? -8.694  -8.820  6.733   1.00 0.19 ? 86  LYS A HA   1  
ATOM 1370  H HB2  . LYS A 1 86  ? -6.212  -9.951  6.986   1.00 0.26 ? 86  LYS A HB2  1  
ATOM 1371  H HB3  . LYS A 1 86  ? -6.341  -9.049  8.491   1.00 0.22 ? 86  LYS A HB3  1  
ATOM 1372  H HG2  . LYS A 1 86  ? -7.229  -11.319 8.763   1.00 0.75 ? 86  LYS A HG2  1  
ATOM 1373  H HG3  . LYS A 1 86  ? -8.516  -10.132 8.947   1.00 0.83 ? 86  LYS A HG3  1  
ATOM 1374  H HD2  . LYS A 1 86  ? -8.168  -10.978 6.166   1.00 0.99 ? 86  LYS A HD2  1  
ATOM 1375  H HD3  . LYS A 1 86  ? -8.560  -12.325 7.235   1.00 1.02 ? 86  LYS A HD3  1  
ATOM 1376  H HE2  . LYS A 1 86  ? -10.158 -9.934  7.799   1.00 0.45 ? 86  LYS A HE2  1  
ATOM 1377  H HE3  . LYS A 1 86  ? -10.391 -10.540 6.160   1.00 0.46 ? 86  LYS A HE3  1  
ATOM 1378  H HZ1  . LYS A 1 86  ? -10.447 -12.339 8.504   1.00 1.34 ? 86  LYS A HZ1  1  
ATOM 1379  H HZ2  . LYS A 1 86  ? -11.837 -11.519 7.982   1.00 1.23 ? 86  LYS A HZ2  1  
ATOM 1380  H HZ3  . LYS A 1 86  ? -11.060 -12.616 6.943   1.00 1.33 ? 86  LYS A HZ3  1  
ATOM 1381  N N    . TRP A 1 87  ? -8.115  -7.408  9.121   1.00 0.19 ? 87  TRP A N    1  
ATOM 1382  C CA   . TRP A 1 87  ? -8.274  -6.252  10.052  1.00 0.19 ? 87  TRP A CA   1  
ATOM 1383  C C    . TRP A 1 87  ? -7.301  -6.347  11.220  1.00 0.21 ? 87  TRP A C    1  
ATOM 1384  O O    . TRP A 1 87  ? -6.517  -7.269  11.337  1.00 0.25 ? 87  TRP A O    1  
ATOM 1385  C CB   . TRP A 1 87  ? -9.685  -6.242  10.613  1.00 0.21 ? 87  TRP A CB   1  
ATOM 1386  C CG   . TRP A 1 87  ? -10.638 -6.082  9.501   1.00 0.20 ? 87  TRP A CG   1  
ATOM 1387  C CD1  . TRP A 1 87  ? -11.302 -7.090  8.918   1.00 0.21 ? 87  TRP A CD1  1  
ATOM 1388  C CD2  . TRP A 1 87  ? -11.035 -4.864  8.818   1.00 0.19 ? 87  TRP A CD2  1  
ATOM 1389  N NE1  . TRP A 1 87  ? -12.112 -6.571  7.935   1.00 0.21 ? 87  TRP A NE1  1  
ATOM 1390  C CE2  . TRP A 1 87  ? -11.976 -5.201  7.827   1.00 0.20 ? 87  TRP A CE2  1  
ATOM 1391  C CE3  . TRP A 1 87  ? -10.676 -3.513  8.965   1.00 0.18 ? 87  TRP A CE3  1  
ATOM 1392  C CZ2  . TRP A 1 87  ? -12.548 -4.232  7.007   1.00 0.19 ? 87  TRP A CZ2  1  
ATOM 1393  C CZ3  . TRP A 1 87  ? -11.246 -2.534  8.139   1.00 0.17 ? 87  TRP A CZ3  1  
ATOM 1394  C CH2  . TRP A 1 87  ? -12.181 -2.894  7.161   1.00 0.18 ? 87  TRP A CH2  1  
ATOM 1395  H H    . TRP A 1 87  ? -8.216  -8.320  9.448   1.00 0.20 ? 87  TRP A H    1  
ATOM 1396  H HA   . TRP A 1 87  ? -8.102  -5.332  9.518   1.00 0.17 ? 87  TRP A HA   1  
ATOM 1397  H HB2  . TRP A 1 87  ? -9.880  -7.171  11.127  1.00 0.23 ? 87  TRP A HB2  1  
ATOM 1398  H HB3  . TRP A 1 87  ? -9.800  -5.420  11.296  1.00 0.22 ? 87  TRP A HB3  1  
ATOM 1399  H HD1  . TRP A 1 87  ? -11.221 -8.132  9.186   1.00 0.23 ? 87  TRP A HD1  1  
ATOM 1400  H HE1  . TRP A 1 87  ? -12.704 -7.092  7.372   1.00 0.22 ? 87  TRP A HE1  1  
ATOM 1401  H HE3  . TRP A 1 87  ? -9.953  -3.228  9.714   1.00 0.18 ? 87  TRP A HE3  1  
ATOM 1402  H HZ2  . TRP A 1 87  ? -13.265 -4.514  6.257   1.00 0.20 ? 87  TRP A HZ2  1  
ATOM 1403  H HZ3  . TRP A 1 87  ? -10.964 -1.498  8.257   1.00 0.17 ? 87  TRP A HZ3  1  
ATOM 1404  H HH2  . TRP A 1 87  ? -12.615 -2.141  6.525   1.00 0.18 ? 87  TRP A HH2  1  
ATOM 1405  N N    . GLU A 1 88  ? -7.374  -5.383  12.090  1.00 0.22 ? 88  GLU A N    1  
ATOM 1406  C CA   . GLU A 1 88  ? -6.495  -5.355  13.286  1.00 0.26 ? 88  GLU A CA   1  
ATOM 1407  C C    . GLU A 1 88  ? -7.354  -4.956  14.484  1.00 0.28 ? 88  GLU A C    1  
ATOM 1408  O O    . GLU A 1 88  ? -7.424  -5.644  15.484  1.00 0.33 ? 88  GLU A O    1  
ATOM 1409  C CB   . GLU A 1 88  ? -5.383  -4.318  13.053  1.00 0.29 ? 88  GLU A CB   1  
ATOM 1410  C CG   . GLU A 1 88  ? -5.004  -3.604  14.358  1.00 0.90 ? 88  GLU A CG   1  
ATOM 1411  C CD   . GLU A 1 88  ? -4.524  -4.629  15.388  1.00 1.25 ? 88  GLU A CD   1  
ATOM 1412  O OE1  . GLU A 1 88  ? -3.738  -5.487  15.019  1.00 1.75 ? 88  GLU A OE1  1  
ATOM 1413  O OE2  . GLU A 1 88  ? -4.951  -4.540  16.527  1.00 1.83 ? 88  GLU A OE2  1  
ATOM 1414  H H    . GLU A 1 88  ? -8.028  -4.664  11.954  1.00 0.21 ? 88  GLU A H    1  
ATOM 1415  H HA   . GLU A 1 88  ? -6.064  -6.330  13.450  1.00 0.29 ? 88  GLU A HA   1  
ATOM 1416  H HB2  . GLU A 1 88  ? -4.517  -4.816  12.658  1.00 0.73 ? 88  GLU A HB2  1  
ATOM 1417  H HB3  . GLU A 1 88  ? -5.727  -3.587  12.337  1.00 0.72 ? 88  GLU A HB3  1  
ATOM 1418  H HG2  . GLU A 1 88  ? -4.214  -2.895  14.160  1.00 1.31 ? 88  GLU A HG2  1  
ATOM 1419  H HG3  . GLU A 1 88  ? -5.864  -3.079  14.746  1.00 1.24 ? 88  GLU A HG3  1  
ATOM 1420  N N    . SER A 1 89  ? -8.007  -3.840  14.367  1.00 0.27 ? 89  SER A N    1  
ATOM 1421  C CA   . SER A 1 89  ? -8.878  -3.344  15.464  1.00 0.29 ? 89  SER A CA   1  
ATOM 1422  C C    . SER A 1 89  ? -10.306 -3.189  14.941  1.00 0.29 ? 89  SER A C    1  
ATOM 1423  O O    . SER A 1 89  ? -11.253 -3.699  15.504  1.00 0.31 ? 89  SER A O    1  
ATOM 1424  C CB   . SER A 1 89  ? -8.366  -1.979  15.919  1.00 0.30 ? 89  SER A CB   1  
ATOM 1425  O OG   . SER A 1 89  ? -8.207  -1.140  14.776  1.00 0.30 ? 89  SER A OG   1  
ATOM 1426  H H    . SER A 1 89  ? -7.919  -3.319  13.546  1.00 0.27 ? 89  SER A H    1  
ATOM 1427  H HA   . SER A 1 89  ? -8.860  -4.035  16.286  1.00 0.31 ? 89  SER A HA   1  
ATOM 1428  H HB2  . SER A 1 89  ? -9.076  -1.531  16.594  1.00 0.32 ? 89  SER A HB2  1  
ATOM 1429  H HB3  . SER A 1 89  ? -7.417  -2.100  16.425  1.00 0.32 ? 89  SER A HB3  1  
ATOM 1430  H HG   . SER A 1 89  ? -7.915  -0.278  15.080  1.00 0.85 ? 89  SER A HG   1  
ATOM 1431  N N    . GLU A 1 90  ? -10.445 -2.474  13.862  1.00 0.27 ? 90  GLU A N    1  
ATOM 1432  C CA   . GLU A 1 90  ? -11.783 -2.233  13.246  1.00 0.28 ? 90  GLU A CA   1  
ATOM 1433  C C    . GLU A 1 90  ? -11.609 -1.148  12.187  1.00 0.25 ? 90  GLU A C    1  
ATOM 1434  O O    . GLU A 1 90  ? -12.239 -1.159  11.148  1.00 0.25 ? 90  GLU A O    1  
ATOM 1435  C CB   . GLU A 1 90  ? -12.784 -1.755  14.304  1.00 0.31 ? 90  GLU A CB   1  
ATOM 1436  C CG   . GLU A 1 90  ? -12.198 -0.562  15.064  1.00 0.32 ? 90  GLU A CG   1  
ATOM 1437  C CD   . GLU A 1 90  ? -12.631 -0.627  16.530  1.00 0.37 ? 90  GLU A CD   1  
ATOM 1438  O OE1  . GLU A 1 90  ? -13.791 -0.919  16.772  1.00 1.17 ? 90  GLU A OE1  1  
ATOM 1439  O OE2  . GLU A 1 90  ? -11.797 -0.382  17.385  1.00 1.12 ? 90  GLU A OE2  1  
ATOM 1440  H H    . GLU A 1 90  ? -9.651  -2.083  13.446  1.00 0.26 ? 90  GLU A H    1  
ATOM 1441  H HA   . GLU A 1 90  ? -12.138 -3.140  12.782  1.00 0.28 ? 90  GLU A HA   1  
ATOM 1442  H HB2  . GLU A 1 90  ? -13.702 -1.455  13.819  1.00 0.32 ? 90  GLU A HB2  1  
ATOM 1443  H HB3  . GLU A 1 90  ? -12.989 -2.556  14.997  1.00 0.34 ? 90  GLU A HB3  1  
ATOM 1444  H HG2  . GLU A 1 90  ? -11.119 -0.592  15.005  1.00 0.31 ? 90  GLU A HG2  1  
ATOM 1445  H HG3  . GLU A 1 90  ? -12.557 0.356   14.624  1.00 0.32 ? 90  GLU A HG3  1  
ATOM 1446  N N    . ASN A 1 91  ? -10.721 -0.229  12.444  1.00 0.25 ? 91  ASN A N    1  
ATOM 1447  C CA   . ASN A 1 91  ? -10.438 0.858   11.470  1.00 0.23 ? 91  ASN A CA   1  
ATOM 1448  C C    . ASN A 1 91  ? -9.018  0.663   10.949  1.00 0.22 ? 91  ASN A C    1  
ATOM 1449  O O    . ASN A 1 91  ? -8.523  1.447   10.166  1.00 0.21 ? 91  ASN A O    1  
ATOM 1450  C CB   . ASN A 1 91  ? -10.552 2.218   12.156  1.00 0.24 ? 91  ASN A CB   1  
ATOM 1451  C CG   . ASN A 1 91  ? -11.966 2.404   12.708  1.00 0.26 ? 91  ASN A CG   1  
ATOM 1452  O OD1  . ASN A 1 91  ? -12.755 1.479   12.722  1.00 0.27 ? 91  ASN A OD1  1  
ATOM 1453  N ND2  . ASN A 1 91  ? -12.324 3.573   13.164  1.00 0.28 ? 91  ASN A ND2  1  
ATOM 1454  H H    . ASN A 1 91  ? -10.212 -0.272  13.280  1.00 0.26 ? 91  ASN A H    1  
ATOM 1455  H HA   . ASN A 1 91  ? -11.132 0.808   10.638  1.00 0.23 ? 91  ASN A HA   1  
ATOM 1456  H HB2  . ASN A 1 91  ? -9.837  2.275   12.962  1.00 0.25 ? 91  ASN A HB2  1  
ATOM 1457  H HB3  . ASN A 1 91  ? -10.347 2.994   11.438  1.00 0.23 ? 91  ASN A HB3  1  
ATOM 1458  H HD21 . ASN A 1 91  ? -11.689 4.319   13.150  1.00 0.29 ? 91  ASN A HD21 1  
ATOM 1459  H HD22 . ASN A 1 91  ? -13.227 3.705   13.518  1.00 0.30 ? 91  ASN A HD22 1  
ATOM 1460  N N    . LYS A 1 92  ? -8.357  -0.386  11.375  1.00 0.22 ? 92  LYS A N    1  
ATOM 1461  C CA   . LYS A 1 92  ? -6.986  -0.646  10.890  1.00 0.22 ? 92  LYS A CA   1  
ATOM 1462  C C    . LYS A 1 92  ? -6.983  -2.004  10.189  1.00 0.22 ? 92  LYS A C    1  
ATOM 1463  O O    . LYS A 1 92  ? -7.212  -3.026  10.803  1.00 0.39 ? 92  LYS A O    1  
ATOM 1464  C CB   . LYS A 1 92  ? -6.019  -0.674  12.071  1.00 0.24 ? 92  LYS A CB   1  
ATOM 1465  C CG   . LYS A 1 92  ? -4.596  -0.485  11.556  1.00 0.75 ? 92  LYS A CG   1  
ATOM 1466  C CD   . LYS A 1 92  ? -3.939  -1.851  11.354  1.00 1.57 ? 92  LYS A CD   1  
ATOM 1467  C CE   . LYS A 1 92  ? -2.455  -1.663  11.036  1.00 2.10 ? 92  LYS A CE   1  
ATOM 1468  N NZ   . LYS A 1 92  ? -1.676  -1.626  12.306  1.00 2.48 ? 92  LYS A NZ   1  
ATOM 1469  H H    . LYS A 1 92  ? -8.768  -1.012  12.012  1.00 0.23 ? 92  LYS A H    1  
ATOM 1470  H HA   . LYS A 1 92  ? -6.699  0.130   10.193  1.00 0.22 ? 92  LYS A HA   1  
ATOM 1471  H HB2  . LYS A 1 92  ? -6.265  0.123   12.758  1.00 0.60 ? 92  LYS A HB2  1  
ATOM 1472  H HB3  . LYS A 1 92  ? -6.095  -1.624  12.578  1.00 0.62 ? 92  LYS A HB3  1  
ATOM 1473  H HG2  . LYS A 1 92  ? -4.627  0.042   10.615  1.00 1.18 ? 92  LYS A HG2  1  
ATOM 1474  H HG3  . LYS A 1 92  ? -4.029  0.085   12.273  1.00 0.99 ? 92  LYS A HG3  1  
ATOM 1475  H HD2  . LYS A 1 92  ? -4.043  -2.435  12.255  1.00 1.87 ? 92  LYS A HD2  1  
ATOM 1476  H HD3  . LYS A 1 92  ? -4.419  -2.364  10.534  1.00 1.87 ? 92  LYS A HD3  1  
ATOM 1477  H HE2  . LYS A 1 92  ? -2.110  -2.485  10.426  1.00 2.51 ? 92  LYS A HE2  1  
ATOM 1478  H HE3  . LYS A 1 92  ? -2.316  -0.735  10.501  1.00 2.31 ? 92  LYS A HE3  1  
ATOM 1479  H HZ1  . LYS A 1 92  ? -2.014  -2.378  12.941  1.00 2.96 ? 92  LYS A HZ1  1  
ATOM 1480  H HZ2  . LYS A 1 92  ? -0.668  -1.773  12.099  1.00 2.70 ? 92  LYS A HZ2  1  
ATOM 1481  H HZ3  . LYS A 1 92  ? -1.802  -0.702  12.764  1.00 2.75 ? 92  LYS A HZ3  1  
ATOM 1482  N N    . MET A 1 93  ? -6.738  -2.025  8.911   1.00 0.19 ? 93  MET A N    1  
ATOM 1483  C CA   . MET A 1 93  ? -6.732  -3.313  8.173   1.00 0.17 ? 93  MET A CA   1  
ATOM 1484  C C    . MET A 1 93  ? -5.350  -3.559  7.592   1.00 0.16 ? 93  MET A C    1  
ATOM 1485  O O    . MET A 1 93  ? -4.570  -2.650  7.394   1.00 0.17 ? 93  MET A O    1  
ATOM 1486  C CB   . MET A 1 93  ? -7.760  -3.302  7.029   1.00 0.16 ? 93  MET A CB   1  
ATOM 1487  C CG   . MET A 1 93  ? -8.139  -1.867  6.643   1.00 0.19 ? 93  MET A CG   1  
ATOM 1488  S SD   . MET A 1 93  ? -8.597  -1.805  4.891   1.00 0.22 ? 93  MET A SD   1  
ATOM 1489  C CE   . MET A 1 93  ? -9.663  -3.266  4.875   1.00 0.18 ? 93  MET A CE   1  
ATOM 1490  H H    . MET A 1 93  ? -6.559  -1.199  8.439   1.00 0.32 ? 93  MET A H    1  
ATOM 1491  H HA   . MET A 1 93  ? -6.971  -4.111  8.856   1.00 0.18 ? 93  MET A HA   1  
ATOM 1492  H HB2  . MET A 1 93  ? -7.338  -3.799  6.167   1.00 0.17 ? 93  MET A HB2  1  
ATOM 1493  H HB3  . MET A 1 93  ? -8.647  -3.830  7.344   1.00 0.19 ? 93  MET A HB3  1  
ATOM 1494  H HG2  . MET A 1 93  ? -8.975  -1.544  7.243   1.00 0.22 ? 93  MET A HG2  1  
ATOM 1495  H HG3  . MET A 1 93  ? -7.299  -1.214  6.814   1.00 0.23 ? 93  MET A HG3  1  
ATOM 1496  H HE1  . MET A 1 93  ? -10.145 -3.369  5.837   1.00 1.02 ? 93  MET A HE1  1  
ATOM 1497  H HE2  . MET A 1 93  ? -10.412 -3.160  4.108   1.00 1.05 ? 93  MET A HE2  1  
ATOM 1498  H HE3  . MET A 1 93  ? -9.064  -4.142  4.672   1.00 1.02 ? 93  MET A HE3  1  
ATOM 1499  N N    . VAL A 1 94  ? -5.052  -4.791  7.324   1.00 0.15 ? 94  VAL A N    1  
ATOM 1500  C CA   . VAL A 1 94  ? -3.727  -5.141  6.756   1.00 0.15 ? 94  VAL A CA   1  
ATOM 1501  C C    . VAL A 1 94  ? -3.908  -5.784  5.391   1.00 0.15 ? 94  VAL A C    1  
ATOM 1502  O O    . VAL A 1 94  ? -4.998  -5.884  4.865   1.00 0.15 ? 94  VAL A O    1  
ATOM 1503  C CB   . VAL A 1 94  ? -3.035  -6.143  7.673   1.00 0.17 ? 94  VAL A CB   1  
ATOM 1504  C CG1  . VAL A 1 94  ? -2.483  -5.425  8.901   1.00 0.18 ? 94  VAL A CG1  1  
ATOM 1505  C CG2  . VAL A 1 94  ? -4.051  -7.192  8.109   1.00 0.17 ? 94  VAL A CG2  1  
ATOM 1506  H H    . VAL A 1 94  ? -5.708  -5.496  7.505   1.00 0.16 ? 94  VAL A H    1  
ATOM 1507  H HA   . VAL A 1 94  ? -3.118  -4.261  6.663   1.00 0.15 ? 94  VAL A HA   1  
ATOM 1508  H HB   . VAL A 1 94  ? -2.226  -6.622  7.143   1.00 0.17 ? 94  VAL A HB   1  
ATOM 1509  H HG11 . VAL A 1 94  ? -2.660  -4.364  8.807   1.00 1.00 ? 94  VAL A HG11 1  
ATOM 1510  H HG12 . VAL A 1 94  ? -2.976  -5.796  9.787   1.00 1.03 ? 94  VAL A HG12 1  
ATOM 1511  H HG13 . VAL A 1 94  ? -1.422  -5.609  8.975   1.00 1.05 ? 94  VAL A HG13 1  
ATOM 1512  H HG21 . VAL A 1 94  ? -4.566  -7.571  7.238   1.00 1.02 ? 94  VAL A HG21 1  
ATOM 1513  H HG22 . VAL A 1 94  ? -3.542  -7.998  8.610   1.00 1.00 ? 94  VAL A HG22 1  
ATOM 1514  H HG23 . VAL A 1 94  ? -4.765  -6.738  8.780   1.00 1.00 ? 94  VAL A HG23 1  
ATOM 1515  N N    . CYS A 1 95  ? -2.832  -6.233  4.833   1.00 0.15 ? 95  CYS A N    1  
ATOM 1516  C CA   . CYS A 1 95  ? -2.876  -6.903  3.511   1.00 0.16 ? 95  CYS A CA   1  
ATOM 1517  C C    . CYS A 1 95  ? -1.564  -7.644  3.338   1.00 0.17 ? 95  CYS A C    1  
ATOM 1518  O O    . CYS A 1 95  ? -0.689  -7.223  2.608   1.00 0.17 ? 95  CYS A O    1  
ATOM 1519  C CB   . CYS A 1 95  ? -3.043  -5.870  2.405   1.00 0.16 ? 95  CYS A CB   1  
ATOM 1520  S SG   . CYS A 1 95  ? -3.419  -6.716  0.849   1.00 0.18 ? 95  CYS A SG   1  
ATOM 1521  H H    . CYS A 1 95  ? -1.976  -6.137  5.299   1.00 0.16 ? 95  CYS A H    1  
ATOM 1522  H HA   . CYS A 1 95  ? -3.696  -7.601  3.487   1.00 0.16 ? 95  CYS A HA   1  
ATOM 1523  H HB2  . CYS A 1 95  ? -3.849  -5.204  2.658   1.00 0.16 ? 95  CYS A HB2  1  
ATOM 1524  H HB3  . CYS A 1 95  ? -2.136  -5.301  2.297   1.00 0.16 ? 95  CYS A HB3  1  
ATOM 1525  H HG   . CYS A 1 95  ? -2.624  -7.169  0.559   1.00 0.94 ? 95  CYS A HG   1  
ATOM 1526  N N    . GLU A 1 96  ? -1.405  -8.727  4.041   1.00 0.18 ? 96  GLU A N    1  
ATOM 1527  C CA   . GLU A 1 96  ? -0.127  -9.477  3.958   1.00 0.18 ? 96  GLU A CA   1  
ATOM 1528  C C    . GLU A 1 96  ? 0.063   -10.073 2.564   1.00 0.19 ? 96  GLU A C    1  
ATOM 1529  O O    . GLU A 1 96  ? -0.623  -10.996 2.170   1.00 0.20 ? 96  GLU A O    1  
ATOM 1530  C CB   . GLU A 1 96  ? -0.107  -10.600 4.991   1.00 0.19 ? 96  GLU A CB   1  
ATOM 1531  C CG   . GLU A 1 96  ? 1.285   -11.230 5.000   1.00 0.20 ? 96  GLU A CG   1  
ATOM 1532  C CD   . GLU A 1 96  ? 1.266   -12.511 5.836   1.00 0.21 ? 96  GLU A CD   1  
ATOM 1533  O OE1  . GLU A 1 96  ? 0.306   -13.255 5.722   1.00 1.10 ? 96  GLU A OE1  1  
ATOM 1534  O OE2  . GLU A 1 96  ? 2.213   -12.727 6.575   1.00 1.06 ? 96  GLU A OE2  1  
ATOM 1535  H H    . GLU A 1 96  ? -2.120  -9.029  4.643   1.00 0.18 ? 96  GLU A H    1  
ATOM 1536  H HA   . GLU A 1 96  ? 0.683   -8.795  4.166   1.00 0.19 ? 96  GLU A HA   1  
ATOM 1537  H HB2  . GLU A 1 96  ? -0.331  -10.197 5.969   1.00 0.19 ? 96  GLU A HB2  1  
ATOM 1538  H HB3  . GLU A 1 96  ? -0.840  -11.348 4.730   1.00 0.19 ? 96  GLU A HB3  1  
ATOM 1539  H HG2  . GLU A 1 96  ? 1.577   -11.463 3.984   1.00 0.20 ? 96  GLU A HG2  1  
ATOM 1540  H HG3  . GLU A 1 96  ? 1.992   -10.533 5.423   1.00 0.20 ? 96  GLU A HG3  1  
ATOM 1541  N N    . GLN A 1 97  ? 1.007   -9.559  1.827   1.00 0.20 ? 97  GLN A N    1  
ATOM 1542  C CA   . GLN A 1 97  ? 1.277   -10.087 0.471   1.00 0.22 ? 97  GLN A CA   1  
ATOM 1543  C C    . GLN A 1 97  ? 2.492   -11.020 0.539   1.00 0.23 ? 97  GLN A C    1  
ATOM 1544  O O    . GLN A 1 97  ? 3.543   -10.640 1.016   1.00 0.24 ? 97  GLN A O    1  
ATOM 1545  C CB   . GLN A 1 97  ? 1.583   -8.916  -0.457  1.00 0.22 ? 97  GLN A CB   1  
ATOM 1546  C CG   . GLN A 1 97  ? 0.414   -7.929  -0.443  1.00 0.25 ? 97  GLN A CG   1  
ATOM 1547  C CD   . GLN A 1 97  ? 0.267   -7.291  -1.825  1.00 0.30 ? 97  GLN A CD   1  
ATOM 1548  O OE1  . GLN A 1 97  ? 1.219   -7.216  -2.577  1.00 0.57 ? 97  GLN A OE1  1  
ATOM 1549  N NE2  . GLN A 1 97  ? -0.893  -6.822  -2.194  1.00 0.38 ? 97  GLN A NE2  1  
ATOM 1550  H H    . GLN A 1 97  ? 1.549   -8.825  2.171   1.00 0.21 ? 97  GLN A H    1  
ATOM 1551  H HA   . GLN A 1 97  ? 0.415   -10.627 0.111   1.00 0.22 ? 97  GLN A HA   1  
ATOM 1552  H HB2  . GLN A 1 97  ? 2.480   -8.416  -0.121  1.00 0.23 ? 97  GLN A HB2  1  
ATOM 1553  H HB3  . GLN A 1 97  ? 1.730   -9.281  -1.454  1.00 0.26 ? 97  GLN A HB3  1  
ATOM 1554  H HG2  . GLN A 1 97  ? -0.495  -8.452  -0.187  1.00 0.44 ? 97  GLN A HG2  1  
ATOM 1555  H HG3  . GLN A 1 97  ? 0.604   -7.158  0.289   1.00 0.41 ? 97  GLN A HG3  1  
ATOM 1556  H HE21 . GLN A 1 97  ? -1.660  -6.880  -1.588  1.00 0.50 ? 97  GLN A HE21 1  
ATOM 1557  H HE22 . GLN A 1 97  ? -0.997  -6.413  -3.078  1.00 0.51 ? 97  GLN A HE22 1  
ATOM 1558  N N    . LYS A 1 98  ? 2.362   -12.237 0.078   1.00 0.24 ? 98  LYS A N    1  
ATOM 1559  C CA   . LYS A 1 98  ? 3.523   -13.179 0.136   1.00 0.26 ? 98  LYS A CA   1  
ATOM 1560  C C    . LYS A 1 98  ? 3.822   -13.730 -1.261  1.00 0.27 ? 98  LYS A C    1  
ATOM 1561  O O    . LYS A 1 98  ? 3.009   -13.636 -2.159  1.00 0.31 ? 98  LYS A O    1  
ATOM 1562  C CB   . LYS A 1 98  ? 3.188   -14.337 1.079   1.00 0.32 ? 98  LYS A CB   1  
ATOM 1563  C CG   . LYS A 1 98  ? 1.873   -14.987 0.643   1.00 0.54 ? 98  LYS A CG   1  
ATOM 1564  C CD   . LYS A 1 98  ? 1.485   -16.077 1.644   1.00 0.91 ? 98  LYS A CD   1  
ATOM 1565  C CE   . LYS A 1 98  ? 0.275   -16.849 1.115   1.00 1.30 ? 98  LYS A CE   1  
ATOM 1566  N NZ   . LYS A 1 98  ? -0.210  -17.790 2.164   1.00 1.86 ? 98  LYS A NZ   1  
ATOM 1567  H H    . LYS A 1 98  ? 1.503   -12.533 -0.297  1.00 0.24 ? 98  LYS A H    1  
ATOM 1568  H HA   . LYS A 1 98  ? 4.391   -12.655 0.508   1.00 0.27 ? 98  LYS A HA   1  
ATOM 1569  H HB2  . LYS A 1 98  ? 3.981   -15.070 1.045   1.00 0.52 ? 98  LYS A HB2  1  
ATOM 1570  H HB3  . LYS A 1 98  ? 3.085   -13.964 2.087   1.00 0.57 ? 98  LYS A HB3  1  
ATOM 1571  H HG2  . LYS A 1 98  ? 1.095   -14.238 0.608   1.00 0.97 ? 98  LYS A HG2  1  
ATOM 1572  H HG3  . LYS A 1 98  ? 1.995   -15.427 -0.335  1.00 0.99 ? 98  LYS A HG3  1  
ATOM 1573  H HD2  . LYS A 1 98  ? 2.316   -16.755 1.778   1.00 1.59 ? 98  LYS A HD2  1  
ATOM 1574  H HD3  . LYS A 1 98  ? 1.234   -15.624 2.591   1.00 1.46 ? 98  LYS A HD3  1  
ATOM 1575  H HE2  . LYS A 1 98  ? -0.512  -16.155 0.862   1.00 1.83 ? 98  LYS A HE2  1  
ATOM 1576  H HE3  . LYS A 1 98  ? 0.560   -17.407 0.235   1.00 1.83 ? 98  LYS A HE3  1  
ATOM 1577  H HZ1  . LYS A 1 98  ? 0.603   -18.176 2.686   1.00 2.27 ? 98  LYS A HZ1  1  
ATOM 1578  H HZ2  . LYS A 1 98  ? -0.836  -17.284 2.821   1.00 2.28 ? 98  LYS A HZ2  1  
ATOM 1579  H HZ3  . LYS A 1 98  ? -0.736  -18.567 1.717   1.00 2.26 ? 98  LYS A HZ3  1  
ATOM 1580  N N    . LEU A 1 99  ? 4.982   -14.313 -1.450  1.00 0.32 ? 99  LEU A N    1  
ATOM 1581  C CA   . LEU A 1 99  ? 5.318   -14.878 -2.795  1.00 0.33 ? 99  LEU A CA   1  
ATOM 1582  C C    . LEU A 1 99  ? 5.135   -16.396 -2.777  1.00 0.37 ? 99  LEU A C    1  
ATOM 1583  O O    . LEU A 1 99  ? 5.831   -17.124 -3.456  1.00 0.66 ? 99  LEU A O    1  
ATOM 1584  C CB   . LEU A 1 99  ? 6.759   -14.533 -3.220  1.00 0.36 ? 99  LEU A CB   1  
ATOM 1585  C CG   . LEU A 1 99  ? 7.633   -14.227 -2.006  1.00 0.38 ? 99  LEU A CG   1  
ATOM 1586  C CD1  . LEU A 1 99  ? 9.089   -14.572 -2.330  1.00 0.46 ? 99  LEU A CD1  1  
ATOM 1587  C CD2  . LEU A 1 99  ? 7.532   -12.738 -1.671  1.00 0.38 ? 99  LEU A CD2  1  
ATOM 1588  H H    . LEU A 1 99  ? 5.617   -14.386 -0.710  1.00 0.39 ? 99  LEU A H    1  
ATOM 1589  H HA   . LEU A 1 99  ? 4.640   -14.464 -3.514  1.00 0.33 ? 99  LEU A HA   1  
ATOM 1590  H HB2  . LEU A 1 99  ? 7.180   -15.370 -3.757  1.00 0.39 ? 99  LEU A HB2  1  
ATOM 1591  H HB3  . LEU A 1 99  ? 6.739   -13.670 -3.870  1.00 0.37 ? 99  LEU A HB3  1  
ATOM 1592  H HG   . LEU A 1 99  ? 7.299   -14.815 -1.167  1.00 0.37 ? 99  LEU A HG   1  
ATOM 1593  H HD11 . LEU A 1 99  ? 9.319   -14.254 -3.335  1.00 1.13 ? 99  LEU A HD11 1  
ATOM 1594  H HD12 . LEU A 1 99  ? 9.742   -14.065 -1.634  1.00 1.15 ? 99  LEU A HD12 1  
ATOM 1595  H HD13 . LEU A 1 99  ? 9.233   -15.639 -2.247  1.00 1.09 ? 99  LEU A HD13 1  
ATOM 1596  H HD21 . LEU A 1 99  ? 7.397   -12.173 -2.583  1.00 1.11 ? 99  LEU A HD21 1  
ATOM 1597  H HD22 . LEU A 1 99  ? 6.690   -12.572 -1.017  1.00 1.15 ? 99  LEU A HD22 1  
ATOM 1598  H HD23 . LEU A 1 99  ? 8.439   -12.417 -1.181  1.00 0.99 ? 99  LEU A HD23 1  
ATOM 1599  N N    . LEU A 1 100 ? 4.187   -16.872 -2.014  1.00 0.55 ? 100 LEU A N    1  
ATOM 1600  C CA   . LEU A 1 100 ? 3.925   -18.341 -1.951  1.00 0.56 ? 100 LEU A CA   1  
ATOM 1601  C C    . LEU A 1 100 ? 5.167   -19.096 -1.466  1.00 0.65 ? 100 LEU A C    1  
ATOM 1602  O O    . LEU A 1 100 ? 5.254   -20.303 -1.587  1.00 0.68 ? 100 LEU A O    1  
ATOM 1603  C CB   . LEU A 1 100 ? 3.552   -18.844 -3.342  1.00 0.55 ? 100 LEU A CB   1  
ATOM 1604  C CG   . LEU A 1 100 ? 2.325   -18.083 -3.851  1.00 0.51 ? 100 LEU A CG   1  
ATOM 1605  C CD1  . LEU A 1 100 ? 2.105   -18.398 -5.332  1.00 0.61 ? 100 LEU A CD1  1  
ATOM 1606  C CD2  . LEU A 1 100 ? 1.090   -18.508 -3.051  1.00 0.62 ? 100 LEU A CD2  1  
ATOM 1607  H H    . LEU A 1 100 ? 3.633   -16.258 -1.487  1.00 0.84 ? 100 LEU A H    1  
ATOM 1608  H HA   . LEU A 1 100 ? 3.107   -18.526 -1.275  1.00 0.55 ? 100 LEU A HA   1  
ATOM 1609  H HB2  . LEU A 1 100 ? 4.383   -18.682 -4.013  1.00 0.59 ? 100 LEU A HB2  1  
ATOM 1610  H HB3  . LEU A 1 100 ? 3.328   -19.897 -3.293  1.00 0.57 ? 100 LEU A HB3  1  
ATOM 1611  H HG   . LEU A 1 100 ? 2.486   -17.021 -3.730  1.00 0.44 ? 100 LEU A HG   1  
ATOM 1612  H HD11 . LEU A 1 100 ? 3.026   -18.761 -5.764  1.00 1.16 ? 100 LEU A HD11 1  
ATOM 1613  H HD12 . LEU A 1 100 ? 1.339   -19.152 -5.431  1.00 1.18 ? 100 LEU A HD12 1  
ATOM 1614  H HD13 . LEU A 1 100 ? 1.795   -17.501 -5.848  1.00 1.19 ? 100 LEU A HD13 1  
ATOM 1615  H HD21 . LEU A 1 100 ? 1.398   -18.911 -2.098  1.00 1.37 ? 100 LEU A HD21 1  
ATOM 1616  H HD22 . LEU A 1 100 ? 0.454   -17.650 -2.890  1.00 1.17 ? 100 LEU A HD22 1  
ATOM 1617  H HD23 . LEU A 1 100 ? 0.546   -19.261 -3.601  1.00 1.08 ? 100 LEU A HD23 1  
ATOM 1618  N N    . LYS A 1 101 ? 6.126   -18.403 -0.923  1.00 0.83 ? 101 LYS A N    1  
ATOM 1619  C CA   . LYS A 1 101 ? 7.358   -19.086 -0.436  1.00 0.92 ? 101 LYS A CA   1  
ATOM 1620  C C    . LYS A 1 101 ? 8.202   -18.101 0.370   1.00 0.95 ? 101 LYS A C    1  
ATOM 1621  O O    . LYS A 1 101 ? 8.650   -18.396 1.461   1.00 1.57 ? 101 LYS A O    1  
ATOM 1622  C CB   . LYS A 1 101 ? 8.166   -19.589 -1.629  1.00 0.95 ? 101 LYS A CB   1  
ATOM 1623  C CG   . LYS A 1 101 ? 9.029   -20.776 -1.199  1.00 1.82 ? 101 LYS A CG   1  
ATOM 1624  C CD   . LYS A 1 101 ? 8.278   -22.078 -1.478  1.00 2.62 ? 101 LYS A CD   1  
ATOM 1625  C CE   . LYS A 1 101 ? 9.251   -23.257 -1.402  1.00 3.02 ? 101 LYS A CE   1  
ATOM 1626  N NZ   . LYS A 1 101 ? 8.962   -24.212 -2.508  1.00 3.75 ? 101 LYS A NZ   1  
ATOM 1627  H H    . LYS A 1 101 ? 6.038   -17.436 -0.836  1.00 0.98 ? 101 LYS A H    1  
ATOM 1628  H HA   . LYS A 1 101 ? 7.087   -19.917 0.188   1.00 0.96 ? 101 LYS A HA   1  
ATOM 1629  H HB2  . LYS A 1 101 ? 7.493   -19.897 -2.416  1.00 1.28 ? 101 LYS A HB2  1  
ATOM 1630  H HB3  . LYS A 1 101 ? 8.801   -18.797 -1.987  1.00 1.35 ? 101 LYS A HB3  1  
ATOM 1631  H HG2  . LYS A 1 101 ? 9.955   -20.767 -1.754  1.00 2.27 ? 101 LYS A HG2  1  
ATOM 1632  H HG3  . LYS A 1 101 ? 9.241   -20.704 -0.143  1.00 2.37 ? 101 LYS A HG3  1  
ATOM 1633  H HD2  . LYS A 1 101 ? 7.496   -22.207 -0.743  1.00 3.05 ? 101 LYS A HD2  1  
ATOM 1634  H HD3  . LYS A 1 101 ? 7.841   -22.037 -2.465  1.00 3.07 ? 101 LYS A HD3  1  
ATOM 1635  H HE2  . LYS A 1 101 ? 10.264  -22.895 -1.496  1.00 3.31 ? 101 LYS A HE2  1  
ATOM 1636  H HE3  . LYS A 1 101 ? 9.135   -23.760 -0.454  1.00 3.04 ? 101 LYS A HE3  1  
ATOM 1637  H HZ1  . LYS A 1 101 ? 7.934   -24.281 -2.647  1.00 4.15 ? 101 LYS A HZ1  1  
ATOM 1638  H HZ2  . LYS A 1 101 ? 9.410   -23.873 -3.384  1.00 3.86 ? 101 LYS A HZ2  1  
ATOM 1639  H HZ3  . LYS A 1 101 ? 9.340   -25.150 -2.266  1.00 4.23 ? 101 LYS A HZ3  1  
ATOM 1640  N N    . GLY A 1 102 ? 8.421   -16.934 -0.164  1.00 0.50 ? 102 GLY A N    1  
ATOM 1641  C CA   . GLY A 1 102 ? 9.236   -15.918 0.560   1.00 0.46 ? 102 GLY A CA   1  
ATOM 1642  C C    . GLY A 1 102 ? 10.684  -16.393 0.655   1.00 0.46 ? 102 GLY A C    1  
ATOM 1643  O O    . GLY A 1 102 ? 10.957  -17.547 0.922   1.00 0.53 ? 102 GLY A O    1  
ATOM 1644  H H    . GLY A 1 102 ? 8.047   -16.725 -1.044  1.00 0.70 ? 102 GLY A H    1  
ATOM 1645  H HA2  . GLY A 1 102 ? 9.198   -14.981 0.027   1.00 0.44 ? 102 GLY A HA2  1  
ATOM 1646  H HA3  . GLY A 1 102 ? 8.843   -15.780 1.553   1.00 0.49 ? 102 GLY A HA3  1  
ATOM 1647  N N    . GLU A 1 103 ? 11.611  -15.502 0.451   1.00 0.44 ? 103 GLU A N    1  
ATOM 1648  C CA   . GLU A 1 103 ? 13.048  -15.875 0.539   1.00 0.47 ? 103 GLU A CA   1  
ATOM 1649  C C    . GLU A 1 103 ? 13.682  -15.102 1.693   1.00 0.44 ? 103 GLU A C    1  
ATOM 1650  O O    . GLU A 1 103 ? 14.473  -15.627 2.452   1.00 0.49 ? 103 GLU A O    1  
ATOM 1651  C CB   . GLU A 1 103 ? 13.758  -15.528 -0.773  1.00 0.52 ? 103 GLU A CB   1  
ATOM 1652  C CG   . GLU A 1 103 ? 13.521  -14.055 -1.117  1.00 0.50 ? 103 GLU A CG   1  
ATOM 1653  C CD   . GLU A 1 103 ? 14.173  -13.735 -2.463  1.00 0.62 ? 103 GLU A CD   1  
ATOM 1654  O OE1  . GLU A 1 103 ? 13.820  -14.379 -3.437  1.00 1.20 ? 103 GLU A OE1  1  
ATOM 1655  O OE2  . GLU A 1 103 ? 15.014  -12.851 -2.498  1.00 1.25 ? 103 GLU A OE2  1  
ATOM 1656  H H    . GLU A 1 103 ? 11.359  -14.582 0.250   1.00 0.44 ? 103 GLU A H    1  
ATOM 1657  H HA   . GLU A 1 103 ? 13.130  -16.931 0.727   1.00 0.52 ? 103 GLU A HA   1  
ATOM 1658  H HB2  . GLU A 1 103 ? 14.818  -15.706 -0.665  1.00 0.56 ? 103 GLU A HB2  1  
ATOM 1659  H HB3  . GLU A 1 103 ? 13.369  -16.147 -1.567  1.00 0.56 ? 103 GLU A HB3  1  
ATOM 1660  H HG2  . GLU A 1 103 ? 12.460  -13.864 -1.176  1.00 0.50 ? 103 GLU A HG2  1  
ATOM 1661  H HG3  . GLU A 1 103 ? 13.958  -13.431 -0.352  1.00 0.46 ? 103 GLU A HG3  1  
ATOM 1662  N N    . GLY A 1 104 ? 13.319  -13.858 1.835   1.00 0.37 ? 104 GLY A N    1  
ATOM 1663  C CA   . GLY A 1 104 ? 13.866  -13.031 2.941   1.00 0.36 ? 104 GLY A CA   1  
ATOM 1664  C C    . GLY A 1 104 ? 12.744  -12.136 3.477   1.00 0.32 ? 104 GLY A C    1  
ATOM 1665  O O    . GLY A 1 104 ? 12.039  -12.518 4.390   1.00 0.33 ? 104 GLY A O    1  
ATOM 1666  H H    . GLY A 1 104 ? 12.672  -13.468 1.217   1.00 0.35 ? 104 GLY A H    1  
ATOM 1667  H HA2  . GLY A 1 104 ? 14.223  -13.678 3.727   1.00 0.38 ? 104 GLY A HA2  1  
ATOM 1668  H HA3  . GLY A 1 104 ? 14.675  -12.420 2.577   1.00 0.35 ? 104 GLY A HA3  1  
ATOM 1669  N N    . PRO A 1 105 ? 12.597  -10.974 2.885   1.00 0.29 ? 105 PRO A N    1  
ATOM 1670  C CA   . PRO A 1 105 ? 11.553  -10.018 3.281   1.00 0.26 ? 105 PRO A CA   1  
ATOM 1671  C C    . PRO A 1 105 ? 10.216  -10.397 2.638   1.00 0.25 ? 105 PRO A C    1  
ATOM 1672  O O    . PRO A 1 105 ? 10.018  -11.519 2.215   1.00 0.27 ? 105 PRO A O    1  
ATOM 1673  C CB   . PRO A 1 105 ? 12.060  -8.686  2.735   1.00 0.25 ? 105 PRO A CB   1  
ATOM 1674  C CG   . PRO A 1 105 ? 13.039  -9.027  1.586   1.00 0.27 ? 105 PRO A CG   1  
ATOM 1675  C CD   . PRO A 1 105 ? 13.457  -10.498 1.781   1.00 0.30 ? 105 PRO A CD   1  
ATOM 1676  H HA   . PRO A 1 105 ? 11.462  -9.970  4.351   1.00 0.27 ? 105 PRO A HA   1  
ATOM 1677  H HB2  . PRO A 1 105 ? 11.230  -8.106  2.364   1.00 0.24 ? 105 PRO A HB2  1  
ATOM 1678  H HB3  . PRO A 1 105 ? 12.580  -8.143  3.507   1.00 0.26 ? 105 PRO A HB3  1  
ATOM 1679  H HG2  . PRO A 1 105 ? 12.543  -8.903  0.634   1.00 0.27 ? 105 PRO A HG2  1  
ATOM 1680  H HG3  . PRO A 1 105 ? 13.909  -8.390  1.638   1.00 0.28 ? 105 PRO A HG3  1  
ATOM 1681  H HD2  . PRO A 1 105 ? 13.270  -11.066 0.880   1.00 0.31 ? 105 PRO A HD2  1  
ATOM 1682  H HD3  . PRO A 1 105 ? 14.496  -10.563 2.062   1.00 0.32 ? 105 PRO A HD3  1  
ATOM 1683  N N    . LYS A 1 106 ? 9.294   -9.473  2.571   1.00 0.23 ? 106 LYS A N    1  
ATOM 1684  C CA   . LYS A 1 106 ? 7.971   -9.784  1.969   1.00 0.23 ? 106 LYS A CA   1  
ATOM 1685  C C    . LYS A 1 106 ? 7.201   -8.491  1.705   1.00 0.22 ? 106 LYS A C    1  
ATOM 1686  O O    . LYS A 1 106 ? 7.601   -7.420  2.117   1.00 0.21 ? 106 LYS A O    1  
ATOM 1687  C CB   . LYS A 1 106 ? 7.186   -10.639 2.950   1.00 0.25 ? 106 LYS A CB   1  
ATOM 1688  C CG   . LYS A 1 106 ? 6.463   -11.758 2.199   1.00 0.29 ? 106 LYS A CG   1  
ATOM 1689  C CD   . LYS A 1 106 ? 6.298   -12.969 3.120   1.00 0.44 ? 106 LYS A CD   1  
ATOM 1690  C CE   . LYS A 1 106 ? 7.620   -13.734 3.205   1.00 1.23 ? 106 LYS A CE   1  
ATOM 1691  N NZ   . LYS A 1 106 ? 7.389   -15.053 3.859   1.00 1.38 ? 106 LYS A NZ   1  
ATOM 1692  H H    . LYS A 1 106 ? 9.469   -8.583  2.926   1.00 0.22 ? 106 LYS A H    1  
ATOM 1693  H HA   . LYS A 1 106 ? 8.108   -10.324 1.046   1.00 0.25 ? 106 LYS A HA   1  
ATOM 1694  H HB2  . LYS A 1 106 ? 7.872   -11.060 3.665   1.00 0.25 ? 106 LYS A HB2  1  
ATOM 1695  H HB3  . LYS A 1 106 ? 6.462   -10.024 3.463   1.00 0.26 ? 106 LYS A HB3  1  
ATOM 1696  H HG2  . LYS A 1 106 ? 5.490   -11.409 1.885   1.00 0.32 ? 106 LYS A HG2  1  
ATOM 1697  H HG3  . LYS A 1 106 ? 7.040   -12.042 1.332   1.00 0.32 ? 106 LYS A HG3  1  
ATOM 1698  H HD2  . LYS A 1 106 ? 6.012   -12.633 4.107   1.00 1.17 ? 106 LYS A HD2  1  
ATOM 1699  H HD3  . LYS A 1 106 ? 5.533   -13.620 2.726   1.00 1.22 ? 106 LYS A HD3  1  
ATOM 1700  H HE2  . LYS A 1 106 ? 8.011   -13.889 2.210   1.00 1.90 ? 106 LYS A HE2  1  
ATOM 1701  H HE3  . LYS A 1 106 ? 8.330   -13.163 3.786   1.00 1.94 ? 106 LYS A HE3  1  
ATOM 1702  H HZ1  . LYS A 1 106 ? 6.601   -15.540 3.387   1.00 1.69 ? 106 LYS A HZ1  1  
ATOM 1703  H HZ2  . LYS A 1 106 ? 8.250   -15.632 3.785   1.00 1.93 ? 106 LYS A HZ2  1  
ATOM 1704  H HZ3  . LYS A 1 106 ? 7.153   -14.907 4.860   1.00 1.64 ? 106 LYS A HZ3  1  
ATOM 1705  N N    . THR A 1 107 ? 6.090   -8.590  1.030   1.00 0.22 ? 107 THR A N    1  
ATOM 1706  C CA   . THR A 1 107 ? 5.278   -7.380  0.740   1.00 0.22 ? 107 THR A CA   1  
ATOM 1707  C C    . THR A 1 107 ? 4.018   -7.400  1.607   1.00 0.21 ? 107 THR A C    1  
ATOM 1708  O O    . THR A 1 107 ? 3.649   -8.419  2.156   1.00 0.21 ? 107 THR A O    1  
ATOM 1709  C CB   . THR A 1 107 ? 4.884   -7.384  -0.739  1.00 0.24 ? 107 THR A CB   1  
ATOM 1710  O OG1  . THR A 1 107 ? 4.699   -8.722  -1.177  1.00 0.26 ? 107 THR A OG1  1  
ATOM 1711  C CG2  . THR A 1 107 ? 5.987   -6.729  -1.568  1.00 0.25 ? 107 THR A CG2  1  
ATOM 1712  H H    . THR A 1 107 ? 5.785   -9.467  0.715   1.00 0.24 ? 107 THR A H    1  
ATOM 1713  H HA   . THR A 1 107 ? 5.853   -6.493  0.963   1.00 0.22 ? 107 THR A HA   1  
ATOM 1714  H HB   . THR A 1 107 ? 3.970   -6.835  -0.866  1.00 0.25 ? 107 THR A HB   1  
ATOM 1715  H HG1  . THR A 1 107 ? 4.232   -9.197  -0.488  1.00 0.25 ? 107 THR A HG1  1  
ATOM 1716  H HG21 . THR A 1 107 ? 6.951   -7.024  -1.180  1.00 1.02 ? 107 THR A HG21 1  
ATOM 1717  H HG22 . THR A 1 107 ? 5.900   -7.044  -2.596  1.00 1.03 ? 107 THR A HG22 1  
ATOM 1718  H HG23 . THR A 1 107 ? 5.889   -5.656  -1.510  1.00 1.07 ? 107 THR A HG23 1  
ATOM 1719  N N    . SER A 1 108 ? 3.364   -6.277  1.741   1.00 0.20 ? 108 SER A N    1  
ATOM 1720  C CA   . SER A 1 108 ? 2.128   -6.212  2.578   1.00 0.19 ? 108 SER A CA   1  
ATOM 1721  C C    . SER A 1 108 ? 1.707   -4.749  2.724   1.00 0.19 ? 108 SER A C    1  
ATOM 1722  O O    . SER A 1 108 ? 2.451   -3.851  2.384   1.00 0.20 ? 108 SER A O    1  
ATOM 1723  C CB   . SER A 1 108 ? 2.420   -6.783  3.967   1.00 0.19 ? 108 SER A CB   1  
ATOM 1724  O OG   . SER A 1 108 ? 3.747   -6.440  4.346   1.00 0.20 ? 108 SER A OG   1  
ATOM 1725  H H    . SER A 1 108 ? 3.690   -5.469  1.293   1.00 0.21 ? 108 SER A H    1  
ATOM 1726  H HA   . SER A 1 108 ? 1.338   -6.783  2.114   1.00 0.19 ? 108 SER A HA   1  
ATOM 1727  H HB2  . SER A 1 108 ? 1.729   -6.368  4.682   1.00 0.19 ? 108 SER A HB2  1  
ATOM 1728  H HB3  . SER A 1 108 ? 2.308   -7.857  3.943   1.00 0.20 ? 108 SER A HB3  1  
ATOM 1729  H HG   . SER A 1 108 ? 3.891   -6.758  5.240   1.00 0.61 ? 108 SER A HG   1  
ATOM 1730  N N    . TRP A 1 109 ? 0.543   -4.494  3.261   1.00 0.18 ? 109 TRP A N    1  
ATOM 1731  C CA   . TRP A 1 109 ? 0.120   -3.077  3.463   1.00 0.18 ? 109 TRP A CA   1  
ATOM 1732  C C    . TRP A 1 109 ? -1.001  -3.011  4.475   1.00 0.16 ? 109 TRP A C    1  
ATOM 1733  O O    . TRP A 1 109 ? -1.839  -3.887  4.553   1.00 0.15 ? 109 TRP A O    1  
ATOM 1734  C CB   . TRP A 1 109 ? -0.301  -2.393  2.147   1.00 0.19 ? 109 TRP A CB   1  
ATOM 1735  C CG   . TRP A 1 109 ? -1.555  -2.949  1.539   1.00 0.18 ? 109 TRP A CG   1  
ATOM 1736  C CD1  . TRP A 1 109 ? -1.594  -3.562  0.337   1.00 0.19 ? 109 TRP A CD1  1  
ATOM 1737  C CD2  . TRP A 1 109 ? -2.943  -2.900  2.017   1.00 0.16 ? 109 TRP A CD2  1  
ATOM 1738  N NE1  . TRP A 1 109 ? -2.901  -3.902  0.042   1.00 0.19 ? 109 TRP A NE1  1  
ATOM 1739  C CE2  . TRP A 1 109 ? -3.770  -3.522  1.044   1.00 0.17 ? 109 TRP A CE2  1  
ATOM 1740  C CE3  . TRP A 1 109 ? -3.567  -2.396  3.183   1.00 0.15 ? 109 TRP A CE3  1  
ATOM 1741  C CZ2  . TRP A 1 109 ? -5.153  -3.634  1.219   1.00 0.17 ? 109 TRP A CZ2  1  
ATOM 1742  C CZ3  . TRP A 1 109 ? -4.954  -2.514  3.354   1.00 0.14 ? 109 TRP A CZ3  1  
ATOM 1743  C CH2  . TRP A 1 109 ? -5.741  -3.130  2.376   1.00 0.15 ? 109 TRP A CH2  1  
ATOM 1744  H H    . TRP A 1 109 ? -0.034  -5.230  3.562   1.00 0.17 ? 109 TRP A H    1  
ATOM 1745  H HA   . TRP A 1 109 ? 0.960   -2.535  3.872   1.00 0.18 ? 109 TRP A HA   1  
ATOM 1746  H HB2  . TRP A 1 109 ? -0.469  -1.354  2.340   1.00 0.19 ? 109 TRP A HB2  1  
ATOM 1747  H HB3  . TRP A 1 109 ? 0.504   -2.486  1.438   1.00 0.20 ? 109 TRP A HB3  1  
ATOM 1748  H HD1  . TRP A 1 109 ? -0.736  -3.752  -0.290  1.00 0.20 ? 109 TRP A HD1  1  
ATOM 1749  H HE1  . TRP A 1 109 ? -3.194  -4.362  -0.772  1.00 0.20 ? 109 TRP A HE1  1  
ATOM 1750  H HE3  . TRP A 1 109 ? -2.979  -1.920  3.952   1.00 0.15 ? 109 TRP A HE3  1  
ATOM 1751  H HZ2  . TRP A 1 109 ? -5.767  -4.106  0.464   1.00 0.18 ? 109 TRP A HZ2  1  
ATOM 1752  H HZ3  . TRP A 1 109 ? -5.419  -2.126  4.248   1.00 0.14 ? 109 TRP A HZ3  1  
ATOM 1753  H HH2  . TRP A 1 109 ? -6.803  -3.219  2.518   1.00 0.15 ? 109 TRP A HH2  1  
ATOM 1754  N N    . THR A 1 110 ? -1.014  -1.975  5.264   1.00 0.17 ? 110 THR A N    1  
ATOM 1755  C CA   . THR A 1 110 ? -2.080  -1.849  6.287   1.00 0.16 ? 110 THR A CA   1  
ATOM 1756  C C    . THR A 1 110 ? -2.707  -0.462  6.226   1.00 0.16 ? 110 THR A C    1  
ATOM 1757  O O    . THR A 1 110 ? -2.082  0.536   6.518   1.00 0.18 ? 110 THR A O    1  
ATOM 1758  C CB   . THR A 1 110 ? -1.496  -2.088  7.674   1.00 0.17 ? 110 THR A CB   1  
ATOM 1759  O OG1  . THR A 1 110 ? -0.670  -0.991  8.038   1.00 0.19 ? 110 THR A OG1  1  
ATOM 1760  C CG2  . THR A 1 110 ? -0.673  -3.376  7.667   1.00 0.18 ? 110 THR A CG2  1  
ATOM 1761  H H    . THR A 1 110 ? -0.315  -1.286  5.187   1.00 0.18 ? 110 THR A H    1  
ATOM 1762  H HA   . THR A 1 110 ? -2.841  -2.585  6.091   1.00 0.15 ? 110 THR A HA   1  
ATOM 1763  H HB   . THR A 1 110 ? -2.301  -2.186  8.380   1.00 0.16 ? 110 THR A HB   1  
ATOM 1764  H HG1  . THR A 1 110 ? -0.512  -1.040  8.984   1.00 0.88 ? 110 THR A HG1  1  
ATOM 1765  H HG21 . THR A 1 110 ? -1.186  -4.126  7.084   1.00 1.03 ? 110 THR A HG21 1  
ATOM 1766  H HG22 . THR A 1 110 ? 0.295   -3.181  7.231   1.00 1.03 ? 110 THR A HG22 1  
ATOM 1767  H HG23 . THR A 1 110 ? -0.549  -3.728  8.680   1.00 0.99 ? 110 THR A HG23 1  
ATOM 1768  N N    . ARG A 1 111 ? -3.952  -0.409  5.864   1.00 0.16 ? 111 ARG A N    1  
ATOM 1769  C CA   . ARG A 1 111 ? -4.667  0.894   5.785   1.00 0.17 ? 111 ARG A CA   1  
ATOM 1770  C C    . ARG A 1 111 ? -5.297  1.179   7.145   1.00 0.18 ? 111 ARG A C    1  
ATOM 1771  O O    . ARG A 1 111 ? -6.007  0.359   7.681   1.00 0.19 ? 111 ARG A O    1  
ATOM 1772  C CB   . ARG A 1 111 ? -5.753  0.800   4.707   1.00 0.16 ? 111 ARG A CB   1  
ATOM 1773  C CG   . ARG A 1 111 ? -5.095  0.744   3.327   1.00 0.20 ? 111 ARG A CG   1  
ATOM 1774  C CD   . ARG A 1 111 ? -6.137  0.359   2.272   1.00 0.32 ? 111 ARG A CD   1  
ATOM 1775  N NE   . ARG A 1 111 ? -6.047  1.297   1.115   1.00 0.92 ? 111 ARG A NE   1  
ATOM 1776  C CZ   . ARG A 1 111 ? -4.936  1.397   0.436   1.00 1.39 ? 111 ARG A CZ   1  
ATOM 1777  N NH1  . ARG A 1 111 ? -4.227  0.331   0.181   1.00 2.21 ? 111 ARG A NH1  1  
ATOM 1778  N NH2  . ARG A 1 111 ? -4.536  2.564   0.010   1.00 2.00 ? 111 ARG A NH2  1  
ATOM 1779  H H    . ARG A 1 111 ? -4.424  -1.240  5.654   1.00 0.16 ? 111 ARG A H    1  
ATOM 1780  H HA   . ARG A 1 111 ? -3.974  1.681   5.536   1.00 0.18 ? 111 ARG A HA   1  
ATOM 1781  H HB2  . ARG A 1 111 ? -6.338  -0.096  4.863   1.00 0.16 ? 111 ARG A HB2  1  
ATOM 1782  H HB3  . ARG A 1 111 ? -6.394  1.664   4.763   1.00 0.17 ? 111 ARG A HB3  1  
ATOM 1783  H HG2  . ARG A 1 111 ? -4.679  1.711   3.087   1.00 0.21 ? 111 ARG A HG2  1  
ATOM 1784  H HG3  . ARG A 1 111 ? -4.308  0.005   3.335   1.00 0.22 ? 111 ARG A HG3  1  
ATOM 1785  H HD2  . ARG A 1 111 ? -5.950  -0.649  1.933   1.00 0.83 ? 111 ARG A HD2  1  
ATOM 1786  H HD3  . ARG A 1 111 ? -7.126  0.415   2.704   1.00 0.67 ? 111 ARG A HD3  1  
ATOM 1787  H HE   . ARG A 1 111 ? -6.824  1.837   0.863   1.00 1.59 ? 111 ARG A HE   1  
ATOM 1788  H HH11 . ARG A 1 111 ? -4.534  -0.563  0.505   1.00 2.62 ? 111 ARG A HH11 1  
ATOM 1789  H HH12 . ARG A 1 111 ? -3.376  0.410   -0.340  1.00 2.78 ? 111 ARG A HH12 1  
ATOM 1790  H HH21 . ARG A 1 111 ? -5.080  3.381   0.204   1.00 2.31 ? 111 ARG A HH21 1  
ATOM 1791  H HH22 . ARG A 1 111 ? -3.686  2.642   -0.511  1.00 2.61 ? 111 ARG A HH22 1  
ATOM 1792  N N    . GLU A 1 112 ? -5.042  2.322   7.720   1.00 0.18 ? 112 GLU A N    1  
ATOM 1793  C CA   . GLU A 1 112 ? -5.636  2.612   9.055   1.00 0.20 ? 112 GLU A CA   1  
ATOM 1794  C C    . GLU A 1 112 ? -6.324  3.972   9.041   1.00 0.20 ? 112 GLU A C    1  
ATOM 1795  O O    . GLU A 1 112 ? -5.979  4.849   8.277   1.00 0.20 ? 112 GLU A O    1  
ATOM 1796  C CB   . GLU A 1 112 ? -4.539  2.604   10.121  1.00 0.23 ? 112 GLU A CB   1  
ATOM 1797  C CG   . GLU A 1 112 ? -5.179  2.616   11.510  1.00 0.37 ? 112 GLU A CG   1  
ATOM 1798  C CD   . GLU A 1 112 ? -4.083  2.575   12.577  1.00 0.69 ? 112 GLU A CD   1  
ATOM 1799  O OE1  . GLU A 1 112 ? -3.036  3.157   12.346  1.00 1.46 ? 112 GLU A OE1  1  
ATOM 1800  O OE2  . GLU A 1 112 ? -4.310  1.964   13.608  1.00 1.36 ? 112 GLU A OE2  1  
ATOM 1801  H H    . GLU A 1 112 ? -4.460  2.980   7.284   1.00 0.19 ? 112 GLU A H    1  
ATOM 1802  H HA   . GLU A 1 112 ? -6.365  1.851   9.290   1.00 0.20 ? 112 GLU A HA   1  
ATOM 1803  H HB2  . GLU A 1 112 ? -3.933  1.717   10.008  1.00 0.29 ? 112 GLU A HB2  1  
ATOM 1804  H HB3  . GLU A 1 112 ? -3.921  3.477   10.006  1.00 0.28 ? 112 GLU A HB3  1  
ATOM 1805  H HG2  . GLU A 1 112 ? -5.764  3.516   11.628  1.00 0.71 ? 112 GLU A HG2  1  
ATOM 1806  H HG3  . GLU A 1 112 ? -5.818  1.754   11.620  1.00 0.71 ? 112 GLU A HG3  1  
ATOM 1807  N N    . LEU A 1 113 ? -7.306  4.140   9.882   1.00 0.20 ? 113 LEU A N    1  
ATOM 1808  C CA   . LEU A 1 113 ? -8.047  5.426   9.940   1.00 0.21 ? 113 LEU A CA   1  
ATOM 1809  C C    . LEU A 1 113 ? -7.698  6.148   11.244  1.00 0.27 ? 113 LEU A C    1  
ATOM 1810  O O    . LEU A 1 113 ? -7.078  5.585   12.125  1.00 0.30 ? 113 LEU A O    1  
ATOM 1811  C CB   . LEU A 1 113 ? -9.547  5.122   9.910   1.00 0.20 ? 113 LEU A CB   1  
ATOM 1812  C CG   . LEU A 1 113 ? -10.027 4.867   8.477   1.00 0.18 ? 113 LEU A CG   1  
ATOM 1813  C CD1  . LEU A 1 113 ? -10.382 6.197   7.817   1.00 0.24 ? 113 LEU A CD1  1  
ATOM 1814  C CD2  . LEU A 1 113 ? -8.951  4.157   7.658   1.00 0.16 ? 113 LEU A CD2  1  
ATOM 1815  H H    . LEU A 1 113 ? -7.566  3.410   10.476  1.00 0.21 ? 113 LEU A H    1  
ATOM 1816  H HA   . LEU A 1 113 ? -7.781  6.043   9.094   1.00 0.22 ? 113 LEU A HA   1  
ATOM 1817  H HB2  . LEU A 1 113 ? -9.742  4.246   10.503  1.00 0.21 ? 113 LEU A HB2  1  
ATOM 1818  H HB3  . LEU A 1 113 ? -10.089 5.960   10.322  1.00 0.21 ? 113 LEU A HB3  1  
ATOM 1819  H HG   . LEU A 1 113 ? -10.899 4.242   8.509   1.00 0.20 ? 113 LEU A HG   1  
ATOM 1820  H HD11 . LEU A 1 113 ? -9.573  6.897   7.961   1.00 1.04 ? 113 LEU A HD11 1  
ATOM 1821  H HD12 . LEU A 1 113 ? -10.544 6.044   6.762   1.00 1.04 ? 113 LEU A HD12 1  
ATOM 1822  H HD13 . LEU A 1 113 ? -11.283 6.591   8.267   1.00 1.01 ? 113 LEU A HD13 1  
ATOM 1823  H HD21 . LEU A 1 113 ? -8.663  3.243   8.160   1.00 0.98 ? 113 LEU A HD21 1  
ATOM 1824  H HD22 . LEU A 1 113 ? -9.346  3.921   6.684   1.00 0.99 ? 113 LEU A HD22 1  
ATOM 1825  H HD23 . LEU A 1 113 ? -8.094  4.799   7.555   1.00 0.98 ? 113 LEU A HD23 1  
ATOM 1826  N N    . THR A 1 114 ? -8.092  7.386   11.377  1.00 0.30 ? 114 THR A N    1  
ATOM 1827  C CA   . THR A 1 114 ? -7.783  8.134   12.630  1.00 0.37 ? 114 THR A CA   1  
ATOM 1828  C C    . THR A 1 114 ? -8.766  9.295   12.789  1.00 0.71 ? 114 THR A C    1  
ATOM 1829  O O    . THR A 1 114 ? -8.970  10.075  11.880  1.00 1.76 ? 114 THR A O    1  
ATOM 1830  C CB   . THR A 1 114 ? -6.354  8.677   12.567  1.00 0.52 ? 114 THR A CB   1  
ATOM 1831  O OG1  . THR A 1 114 ? -5.577  7.867   11.696  1.00 1.04 ? 114 THR A OG1  1  
ATOM 1832  C CG2  . THR A 1 114 ? -5.738  8.660   13.967  1.00 0.83 ? 114 THR A CG2  1  
ATOM 1833  H H    . THR A 1 114 ? -8.593  7.821   10.656  1.00 0.30 ? 114 THR A H    1  
ATOM 1834  H HA   . THR A 1 114 ? -7.877  7.469   13.476  1.00 0.45 ? 114 THR A HA   1  
ATOM 1835  H HB   . THR A 1 114 ? -6.370  9.691   12.199  1.00 1.01 ? 114 THR A HB   1  
ATOM 1836  H HG1  . THR A 1 114 ? -4.684  8.217   11.683  1.00 1.45 ? 114 THR A HG1  1  
ATOM 1837  H HG21 . THR A 1 114 ? -6.519  8.767   14.705  1.00 1.39 ? 114 THR A HG21 1  
ATOM 1838  H HG22 . THR A 1 114 ? -5.222  7.724   14.122  1.00 1.46 ? 114 THR A HG22 1  
ATOM 1839  H HG23 . THR A 1 114 ? -5.038  9.477   14.062  1.00 1.39 ? 114 THR A HG23 1  
ATOM 1840  N N    . ASN A 1 115 ? -9.374  9.412   13.940  1.00 0.64 ? 115 ASN A N    1  
ATOM 1841  C CA   . ASN A 1 115 ? -10.348 10.518  14.175  1.00 0.75 ? 115 ASN A CA   1  
ATOM 1842  C C    . ASN A 1 115 ? -11.492 10.428  13.157  1.00 0.73 ? 115 ASN A C    1  
ATOM 1843  O O    . ASN A 1 115 ? -12.489 9.773   13.393  1.00 0.84 ? 115 ASN A O    1  
ATOM 1844  C CB   . ASN A 1 115 ? -9.633  11.869  14.047  1.00 0.86 ? 115 ASN A CB   1  
ATOM 1845  C CG   . ASN A 1 115 ? -8.824  12.146  15.318  1.00 1.06 ? 115 ASN A CG   1  
ATOM 1846  O OD1  . ASN A 1 115 ? -8.764  11.321  16.209  1.00 1.47 ? 115 ASN A OD1  1  
ATOM 1847  N ND2  . ASN A 1 115 ? -8.192  13.282  15.438  1.00 1.52 ? 115 ASN A ND2  1  
ATOM 1848  H H    . ASN A 1 115 ? -9.190  8.767   14.654  1.00 1.35 ? 115 ASN A H    1  
ATOM 1849  H HA   . ASN A 1 115 ? -10.754 10.425  15.171  1.00 0.95 ? 115 ASN A HA   1  
ATOM 1850  H HB2  . ASN A 1 115 ? -8.969  11.845  13.196  1.00 0.79 ? 115 ASN A HB2  1  
ATOM 1851  H HB3  . ASN A 1 115 ? -10.364 12.651  13.912  1.00 1.03 ? 115 ASN A HB3  1  
ATOM 1852  H HD21 . ASN A 1 115 ? -8.239  13.947  14.720  1.00 2.06 ? 115 ASN A HD21 1  
ATOM 1853  H HD22 . ASN A 1 115 ? -7.672  13.470  16.247  1.00 1.63 ? 115 ASN A HD22 1  
ATOM 1854  N N    . ASP A 1 116 ? -11.361 11.076  12.029  1.00 0.63 ? 116 ASP A N    1  
ATOM 1855  C CA   . ASP A 1 116 ? -12.442 11.022  11.005  1.00 0.63 ? 116 ASP A CA   1  
ATOM 1856  C C    . ASP A 1 116 ? -11.935 11.633  9.699   1.00 0.52 ? 116 ASP A C    1  
ATOM 1857  O O    . ASP A 1 116 ? -12.675 12.262  8.967   1.00 0.56 ? 116 ASP A O    1  
ATOM 1858  C CB   . ASP A 1 116 ? -13.656 11.811  11.500  1.00 0.74 ? 116 ASP A CB   1  
ATOM 1859  C CG   . ASP A 1 116 ? -14.902 11.367  10.732  1.00 1.27 ? 116 ASP A CG   1  
ATOM 1860  O OD1  . ASP A 1 116 ? -14.996 10.190  10.426  1.00 1.89 ? 116 ASP A OD1  1  
ATOM 1861  O OD2  . ASP A 1 116 ? -15.740 12.211  10.463  1.00 1.94 ? 116 ASP A OD2  1  
ATOM 1862  H H    . ASP A 1 116 ? -10.551 11.599  11.855  1.00 0.58 ? 116 ASP A H    1  
ATOM 1863  H HA   . ASP A 1 116 ? -12.726 9.994   10.835  1.00 0.67 ? 116 ASP A HA   1  
ATOM 1864  H HB2  . ASP A 1 116 ? -13.797 11.629  12.555  1.00 0.97 ? 116 ASP A HB2  1  
ATOM 1865  H HB3  . ASP A 1 116 ? -13.491 12.865  11.335  1.00 1.12 ? 116 ASP A HB3  1  
ATOM 1866  N N    . GLY A 1 117 ? -10.676 11.454  9.402   1.00 0.44 ? 117 GLY A N    1  
ATOM 1867  C CA   . GLY A 1 117 ? -10.116 12.024  8.143   1.00 0.41 ? 117 GLY A CA   1  
ATOM 1868  C C    . GLY A 1 117 ? -8.589  11.945  8.173   1.00 0.42 ? 117 GLY A C    1  
ATOM 1869  O O    . GLY A 1 117 ? -7.900  12.822  7.691   1.00 0.69 ? 117 GLY A O    1  
ATOM 1870  H H    . GLY A 1 117 ? -10.100 10.942  10.008  1.00 0.47 ? 117 GLY A H    1  
ATOM 1871  H HA2  . GLY A 1 117 ? -10.490 11.462  7.298   1.00 0.45 ? 117 GLY A HA2  1  
ATOM 1872  H HA3  . GLY A 1 117 ? -10.418 13.052  8.050   1.00 0.40 ? 117 GLY A HA3  1  
ATOM 1873  N N    . GLU A 1 118 ? -8.058  10.893  8.724   1.00 0.37 ? 118 GLU A N    1  
ATOM 1874  C CA   . GLU A 1 118 ? -6.579  10.732  8.780   1.00 0.34 ? 118 GLU A CA   1  
ATOM 1875  C C    . GLU A 1 118 ? -6.249  9.275   8.456   1.00 0.33 ? 118 GLU A C    1  
ATOM 1876  O O    . GLU A 1 118 ? -5.930  8.487   9.324   1.00 0.51 ? 118 GLU A O    1  
ATOM 1877  C CB   . GLU A 1 118 ? -6.072  11.081  10.182  1.00 0.37 ? 118 GLU A CB   1  
ATOM 1878  C CG   . GLU A 1 118 ? -5.402  12.456  10.157  1.00 0.52 ? 118 GLU A CG   1  
ATOM 1879  C CD   . GLU A 1 118 ? -4.899  12.806  11.559  1.00 0.93 ? 118 GLU A CD   1  
ATOM 1880  O OE1  . GLU A 1 118 ? -5.659  13.397  12.309  1.00 1.46 ? 118 GLU A OE1  1  
ATOM 1881  O OE2  . GLU A 1 118 ? -3.763  12.478  11.858  1.00 1.70 ? 118 GLU A OE2  1  
ATOM 1882  H H    . GLU A 1 118 ? -8.636  10.196  9.095   1.00 0.56 ? 118 GLU A H    1  
ATOM 1883  H HA   . GLU A 1 118 ? -6.118  11.384  8.051   1.00 0.34 ? 118 GLU A HA   1  
ATOM 1884  H HB2  . GLU A 1 118 ? -6.905  11.098  10.871  1.00 0.48 ? 118 GLU A HB2  1  
ATOM 1885  H HB3  . GLU A 1 118 ? -5.355  10.340  10.502  1.00 0.46 ? 118 GLU A HB3  1  
ATOM 1886  H HG2  . GLU A 1 118 ? -4.569  12.437  9.469   1.00 0.94 ? 118 GLU A HG2  1  
ATOM 1887  H HG3  . GLU A 1 118 ? -6.117  13.199  9.837   1.00 0.84 ? 118 GLU A HG3  1  
ATOM 1888  N N    . LEU A 1 119 ? -6.363  8.910   7.210   1.00 0.24 ? 119 LEU A N    1  
ATOM 1889  C CA   . LEU A 1 119 ? -6.102  7.501   6.805   1.00 0.22 ? 119 LEU A CA   1  
ATOM 1890  C C    . LEU A 1 119 ? -4.605  7.259   6.585   1.00 0.23 ? 119 LEU A C    1  
ATOM 1891  O O    . LEU A 1 119 ? -4.057  7.604   5.559   1.00 0.24 ? 119 LEU A O    1  
ATOM 1892  C CB   . LEU A 1 119 ? -6.853  7.231   5.502   1.00 0.21 ? 119 LEU A CB   1  
ATOM 1893  C CG   . LEU A 1 119 ? -6.998  5.725   5.282   1.00 0.19 ? 119 LEU A CG   1  
ATOM 1894  C CD1  . LEU A 1 119 ? -8.422  5.405   4.823   1.00 0.19 ? 119 LEU A CD1  1  
ATOM 1895  C CD2  . LEU A 1 119 ? -6.008  5.278   4.209   1.00 0.21 ? 119 LEU A CD2  1  
ATOM 1896  H H    . LEU A 1 119 ? -6.649  9.563   6.538   1.00 0.33 ? 119 LEU A H    1  
ATOM 1897  H HA   . LEU A 1 119 ? -6.467  6.835   7.570   1.00 0.21 ? 119 LEU A HA   1  
ATOM 1898  H HB2  . LEU A 1 119 ? -7.830  7.684   5.555   1.00 0.21 ? 119 LEU A HB2  1  
ATOM 1899  H HB3  . LEU A 1 119 ? -6.304  7.661   4.679   1.00 0.22 ? 119 LEU A HB3  1  
ATOM 1900  H HG   . LEU A 1 119 ? -6.794  5.204   6.204   1.00 0.18 ? 119 LEU A HG   1  
ATOM 1901  H HD11 . LEU A 1 119 ? -9.127  5.969   5.414   1.00 0.99 ? 119 LEU A HD11 1  
ATOM 1902  H HD12 . LEU A 1 119 ? -8.532  5.669   3.782   1.00 1.03 ? 119 LEU A HD12 1  
ATOM 1903  H HD13 . LEU A 1 119 ? -8.612  4.349   4.947   1.00 1.00 ? 119 LEU A HD13 1  
ATOM 1904  H HD21 . LEU A 1 119 ? -5.963  6.026   3.430   1.00 0.98 ? 119 LEU A HD21 1  
ATOM 1905  H HD22 . LEU A 1 119 ? -5.030  5.158   4.650   1.00 1.02 ? 119 LEU A HD22 1  
ATOM 1906  H HD23 . LEU A 1 119 ? -6.333  4.339   3.788   1.00 1.01 ? 119 LEU A HD23 1  
ATOM 1907  N N    . ILE A 1 120 ? -3.942  6.639   7.525   1.00 0.23 ? 120 ILE A N    1  
ATOM 1908  C CA   . ILE A 1 120 ? -2.490  6.353   7.340   1.00 0.24 ? 120 ILE A CA   1  
ATOM 1909  C C    . ILE A 1 120 ? -2.352  4.968   6.707   1.00 0.22 ? 120 ILE A C    1  
ATOM 1910  O O    . ILE A 1 120 ? -2.677  3.965   7.306   1.00 0.21 ? 120 ILE A O    1  
ATOM 1911  C CB   . ILE A 1 120 ? -1.771  6.403   8.690   1.00 0.26 ? 120 ILE A CB   1  
ATOM 1912  C CG1  . ILE A 1 120 ? -2.327  5.323   9.621   1.00 0.26 ? 120 ILE A CG1  1  
ATOM 1913  C CG2  . ILE A 1 120 ? -1.997  7.774   9.320   1.00 0.29 ? 120 ILE A CG2  1  
ATOM 1914  C CD1  . ILE A 1 120 ? -1.373  4.127   9.643   1.00 0.26 ? 120 ILE A CD1  1  
ATOM 1915  H H    . ILE A 1 120 ? -4.402  6.345   8.340   1.00 0.23 ? 120 ILE A H    1  
ATOM 1916  H HA   . ILE A 1 120 ? -2.063  7.090   6.676   1.00 0.25 ? 120 ILE A HA   1  
ATOM 1917  H HB   . ILE A 1 120 ? -0.712  6.246   8.540   1.00 0.28 ? 120 ILE A HB   1  
ATOM 1918  H HG12 . ILE A 1 120 ? -2.426  5.724   10.620  1.00 0.28 ? 120 ILE A HG12 1  
ATOM 1919  H HG13 . ILE A 1 120 ? -3.293  5.005   9.263   1.00 0.24 ? 120 ILE A HG13 1  
ATOM 1920  H HG21 . ILE A 1 120 ? -2.163  8.503   8.540   1.00 1.12 ? 120 ILE A HG21 1  
ATOM 1921  H HG22 . ILE A 1 120 ? -2.862  7.734   9.965   1.00 0.97 ? 120 ILE A HG22 1  
ATOM 1922  H HG23 . ILE A 1 120 ? -1.128  8.052   9.896   1.00 1.03 ? 120 ILE A HG23 1  
ATOM 1923  H HD11 . ILE A 1 120 ? -0.842  4.074   8.704   1.00 1.07 ? 120 ILE A HD11 1  
ATOM 1924  H HD12 . ILE A 1 120 ? -0.666  4.246   10.450  1.00 1.07 ? 120 ILE A HD12 1  
ATOM 1925  H HD13 . ILE A 1 120 ? -1.938  3.219   9.789   1.00 1.00 ? 120 ILE A HD13 1  
ATOM 1926  N N    . LEU A 1 121 ? -1.906  4.913   5.485   1.00 0.22 ? 121 LEU A N    1  
ATOM 1927  C CA   . LEU A 1 121 ? -1.788  3.602   4.792   1.00 0.21 ? 121 LEU A CA   1  
ATOM 1928  C C    . LEU A 1 121 ? -0.311  3.244   4.565   1.00 0.22 ? 121 LEU A C    1  
ATOM 1929  O O    . LEU A 1 121 ? 0.426   3.954   3.907   1.00 0.26 ? 121 LEU A O    1  
ATOM 1930  C CB   . LEU A 1 121 ? -2.550  3.699   3.453   1.00 0.22 ? 121 LEU A CB   1  
ATOM 1931  C CG   . LEU A 1 121 ? -2.245  2.506   2.533   1.00 0.22 ? 121 LEU A CG   1  
ATOM 1932  C CD1  . LEU A 1 121 ? -0.922  2.739   1.802   1.00 0.26 ? 121 LEU A CD1  1  
ATOM 1933  C CD2  . LEU A 1 121 ? -2.157  1.217   3.349   1.00 0.21 ? 121 LEU A CD2  1  
ATOM 1934  H H    . LEU A 1 121 ? -1.674  5.736   5.014   1.00 0.24 ? 121 LEU A H    1  
ATOM 1935  H HA   . LEU A 1 121 ? -2.245  2.838   5.402   1.00 0.20 ? 121 LEU A HA   1  
ATOM 1936  H HB2  . LEU A 1 121 ? -3.612  3.720   3.656   1.00 0.21 ? 121 LEU A HB2  1  
ATOM 1937  H HB3  . LEU A 1 121 ? -2.272  4.614   2.953   1.00 0.24 ? 121 LEU A HB3  1  
ATOM 1938  H HG   . LEU A 1 121 ? -3.039  2.413   1.805   1.00 0.23 ? 121 LEU A HG   1  
ATOM 1939  H HD11 . LEU A 1 121 ? -0.689  3.794   1.807   1.00 1.12 ? 121 LEU A HD11 1  
ATOM 1940  H HD12 . LEU A 1 121 ? -0.134  2.194   2.302   1.00 1.03 ? 121 LEU A HD12 1  
ATOM 1941  H HD13 . LEU A 1 121 ? -1.008  2.395   0.783   1.00 1.01 ? 121 LEU A HD13 1  
ATOM 1942  H HD21 . LEU A 1 121 ? -2.796  1.295   4.212   1.00 0.97 ? 121 LEU A HD21 1  
ATOM 1943  H HD22 . LEU A 1 121 ? -2.471  0.384   2.740   1.00 0.97 ? 121 LEU A HD22 1  
ATOM 1944  H HD23 . LEU A 1 121 ? -1.142  1.066   3.668   1.00 1.02 ? 121 LEU A HD23 1  
ATOM 1945  N N    . THR A 1 122 ? 0.107   2.127   5.103   1.00 0.22 ? 122 THR A N    1  
ATOM 1946  C CA   . THR A 1 122 ? 1.513   1.662   4.932   1.00 0.22 ? 122 THR A CA   1  
ATOM 1947  C C    . THR A 1 122 ? 1.531   0.553   3.880   1.00 0.21 ? 122 THR A C    1  
ATOM 1948  O O    . THR A 1 122 ? 0.516   -0.029  3.567   1.00 0.21 ? 122 THR A O    1  
ATOM 1949  C CB   . THR A 1 122 ? 2.018   1.092   6.251   1.00 0.21 ? 122 THR A CB   1  
ATOM 1950  O OG1  . THR A 1 122 ? 1.925   2.082   7.266   1.00 0.24 ? 122 THR A OG1  1  
ATOM 1951  C CG2  . THR A 1 122 ? 3.470   0.644   6.097   1.00 0.22 ? 122 THR A CG2  1  
ATOM 1952  H H    . THR A 1 122 ? -0.520  1.578   5.614   1.00 0.22 ? 122 THR A H    1  
ATOM 1953  H HA   . THR A 1 122 ? 2.146   2.476   4.624   1.00 0.25 ? 122 THR A HA   1  
ATOM 1954  H HB   . THR A 1 122 ? 1.418   0.244   6.516   1.00 0.19 ? 122 THR A HB   1  
ATOM 1955  H HG1  . THR A 1 122 ? 1.406   1.719   7.988   1.00 0.69 ? 122 THR A HG1  1  
ATOM 1956  H HG21 . THR A 1 122 ? 4.013   1.378   5.522   1.00 0.97 ? 122 THR A HG21 1  
ATOM 1957  H HG22 . THR A 1 122 ? 3.920   0.543   7.073   1.00 1.08 ? 122 THR A HG22 1  
ATOM 1958  H HG23 . THR A 1 122 ? 3.499   -0.307  5.586   1.00 1.02 ? 122 THR A HG23 1  
ATOM 1959  N N    . MET A 1 123 ? 2.673   0.240   3.346   1.00 0.22 ? 123 MET A N    1  
ATOM 1960  C CA   . MET A 1 123 ? 2.742   -0.848  2.329   1.00 0.22 ? 123 MET A CA   1  
ATOM 1961  C C    . MET A 1 123 ? 4.186   -1.319  2.198   1.00 0.22 ? 123 MET A C    1  
ATOM 1962  O O    . MET A 1 123 ? 4.969   -0.760  1.456   1.00 0.24 ? 123 MET A O    1  
ATOM 1963  C CB   . MET A 1 123 ? 2.243   -0.333  0.979   1.00 0.24 ? 123 MET A CB   1  
ATOM 1964  C CG   . MET A 1 123 ? 2.140   -1.502  -0.005  1.00 0.24 ? 123 MET A CG   1  
ATOM 1965  S SD   . MET A 1 123 ? 3.464   -1.385  -1.236  1.00 0.27 ? 123 MET A SD   1  
ATOM 1966  C CE   . MET A 1 123 ? 3.496   -3.132  -1.704  1.00 1.64 ? 123 MET A CE   1  
ATOM 1967  H H    . MET A 1 123 ? 3.486   0.710   3.623   1.00 0.23 ? 123 MET A H    1  
ATOM 1968  H HA   . MET A 1 123 ? 2.124   -1.673  2.649   1.00 0.20 ? 123 MET A HA   1  
ATOM 1969  H HB2  . MET A 1 123 ? 1.268   0.116   1.106   1.00 0.24 ? 123 MET A HB2  1  
ATOM 1970  H HB3  . MET A 1 123 ? 2.933   0.403   0.595   1.00 0.26 ? 123 MET A HB3  1  
ATOM 1971  H HG2  . MET A 1 123 ? 2.229   -2.436  0.533   1.00 0.22 ? 123 MET A HG2  1  
ATOM 1972  H HG3  . MET A 1 123 ? 1.183   -1.467  -0.500  1.00 0.25 ? 123 MET A HG3  1  
ATOM 1973  H HE1  . MET A 1 123 ? 3.272   -3.741  -0.843  1.00 2.23 ? 123 MET A HE1  1  
ATOM 1974  H HE2  . MET A 1 123 ? 2.756   -3.312  -2.472  1.00 2.19 ? 123 MET A HE2  1  
ATOM 1975  H HE3  . MET A 1 123 ? 4.479   -3.385  -2.076  1.00 2.20 ? 123 MET A HE3  1  
ATOM 1976  N N    . THR A 1 124 ? 4.546   -2.337  2.927   1.00 0.20 ? 124 THR A N    1  
ATOM 1977  C CA   . THR A 1 124 ? 5.948   -2.838  2.866   1.00 0.20 ? 124 THR A CA   1  
ATOM 1978  C C    . THR A 1 124 ? 6.198   -3.573  1.563   1.00 0.22 ? 124 THR A C    1  
ATOM 1979  O O    . THR A 1 124 ? 5.294   -3.835  0.793   1.00 0.23 ? 124 THR A O    1  
ATOM 1980  C CB   . THR A 1 124 ? 6.240   -3.784  4.037   1.00 0.19 ? 124 THR A CB   1  
ATOM 1981  O OG1  . THR A 1 124 ? 6.013   -5.130  3.639   1.00 0.19 ? 124 THR A OG1  1  
ATOM 1982  C CG2  . THR A 1 124 ? 5.348   -3.453  5.233   1.00 0.18 ? 124 THR A CG2  1  
ATOM 1983  H H    . THR A 1 124 ? 3.898   -2.762  3.523   1.00 0.19 ? 124 THR A H    1  
ATOM 1984  H HA   . THR A 1 124 ? 6.620   -2.002  2.913   1.00 0.21 ? 124 THR A HA   1  
ATOM 1985  H HB   . THR A 1 124 ? 7.270   -3.664  4.325   1.00 0.21 ? 124 THR A HB   1  
ATOM 1986  H HG1  . THR A 1 124 ? 6.819   -5.627  3.797   1.00 0.78 ? 124 THR A HG1  1  
ATOM 1987  H HG21 . THR A 1 124 ? 5.116   -2.399  5.226   1.00 1.00 ? 124 THR A HG21 1  
ATOM 1988  H HG22 . THR A 1 124 ? 4.434   -4.024  5.166   1.00 0.99 ? 124 THR A HG22 1  
ATOM 1989  H HG23 . THR A 1 124 ? 5.865   -3.704  6.147   1.00 1.03 ? 124 THR A HG23 1  
ATOM 1990  N N    . ALA A 1 125 ? 7.433   -3.908  1.317   1.00 0.22 ? 125 ALA A N    1  
ATOM 1991  C CA   . ALA A 1 125 ? 7.762   -4.633  0.062   1.00 0.24 ? 125 ALA A CA   1  
ATOM 1992  C C    . ALA A 1 125 ? 9.241   -5.017  0.024   1.00 0.24 ? 125 ALA A C    1  
ATOM 1993  O O    . ALA A 1 125 ? 10.099  -4.192  -0.214  1.00 0.26 ? 125 ALA A O    1  
ATOM 1994  C CB   . ALA A 1 125 ? 7.452   -3.736  -1.132  1.00 0.26 ? 125 ALA A CB   1  
ATOM 1995  H H    . ALA A 1 125 ? 8.139   -3.680  1.963   1.00 0.21 ? 125 ALA A H    1  
ATOM 1996  H HA   . ALA A 1 125 ? 7.163   -5.520  0.008   1.00 0.23 ? 125 ALA A HA   1  
ATOM 1997  H HB1  . ALA A 1 125 ? 7.631   -2.707  -0.862  1.00 0.99 ? 125 ALA A HB1  1  
ATOM 1998  H HB2  . ALA A 1 125 ? 8.091   -4.008  -1.959  1.00 1.04 ? 125 ALA A HB2  1  
ATOM 1999  H HB3  . ALA A 1 125 ? 6.420   -3.859  -1.416  1.00 1.06 ? 125 ALA A HB3  1  
ATOM 2000  N N    . ASP A 1 126 ? 9.549   -6.269  0.232   1.00 0.24 ? 126 ASP A N    1  
ATOM 2001  C CA   . ASP A 1 126 ? 10.978  -6.700  0.188   1.00 0.25 ? 126 ASP A CA   1  
ATOM 2002  C C    . ASP A 1 126 ? 11.747  -6.047  1.337   1.00 0.25 ? 126 ASP A C    1  
ATOM 2003  O O    . ASP A 1 126 ? 12.936  -5.820  1.247   1.00 0.26 ? 126 ASP A O    1  
ATOM 2004  C CB   . ASP A 1 126 ? 11.599  -6.277  -1.144  1.00 0.28 ? 126 ASP A CB   1  
ATOM 2005  C CG   . ASP A 1 126 ? 12.322  -7.468  -1.778  1.00 0.38 ? 126 ASP A CG   1  
ATOM 2006  O OD1  . ASP A 1 126 ? 13.462  -7.705  -1.414  1.00 1.20 ? 126 ASP A OD1  1  
ATOM 2007  O OD2  . ASP A 1 126 ? 11.723  -8.122  -2.615  1.00 1.12 ? 126 ASP A OD2  1  
ATOM 2008  H H    . ASP A 1 126 ? 8.841   -6.929  0.406   1.00 0.23 ? 126 ASP A H    1  
ATOM 2009  H HA   . ASP A 1 126 ? 11.030  -7.774  0.285   1.00 0.25 ? 126 ASP A HA   1  
ATOM 2010  H HB2  . ASP A 1 126 ? 10.819  -5.933  -1.807  1.00 0.32 ? 126 ASP A HB2  1  
ATOM 2011  H HB3  . ASP A 1 126 ? 12.305  -5.478  -0.973  1.00 0.31 ? 126 ASP A HB3  1  
ATOM 2012  N N    . ASP A 1 127 ? 11.060  -5.751  2.412   1.00 0.23 ? 127 ASP A N    1  
ATOM 2013  C CA   . ASP A 1 127 ? 11.697  -5.114  3.613   1.00 0.23 ? 127 ASP A CA   1  
ATOM 2014  C C    . ASP A 1 127 ? 11.480  -3.602  3.579   1.00 0.24 ? 127 ASP A C    1  
ATOM 2015  O O    . ASP A 1 127 ? 11.716  -2.918  4.555   1.00 0.24 ? 127 ASP A O    1  
ATOM 2016  C CB   . ASP A 1 127 ? 13.201  -5.407  3.665   1.00 0.25 ? 127 ASP A CB   1  
ATOM 2017  C CG   . ASP A 1 127 ? 13.709  -5.220  5.096   1.00 0.31 ? 127 ASP A CG   1  
ATOM 2018  O OD1  . ASP A 1 127 ? 13.001  -5.607  6.011   1.00 1.09 ? 127 ASP A OD1  1  
ATOM 2019  O OD2  . ASP A 1 127 ? 14.797  -4.692  5.253   1.00 1.03 ? 127 ASP A OD2  1  
ATOM 2020  H H    . ASP A 1 127 ? 10.105  -5.951  2.430   1.00 0.22 ? 127 ASP A H    1  
ATOM 2021  H HA   . ASP A 1 127 ? 11.230  -5.510  4.503   1.00 0.22 ? 127 ASP A HA   1  
ATOM 2022  H HB2  . ASP A 1 127 ? 13.379  -6.424  3.349   1.00 0.31 ? 127 ASP A HB2  1  
ATOM 2023  H HB3  . ASP A 1 127 ? 13.722  -4.728  3.009   1.00 0.27 ? 127 ASP A HB3  1  
ATOM 2024  N N    . VAL A 1 128 ? 11.020  -3.070  2.478   1.00 0.24 ? 128 VAL A N    1  
ATOM 2025  C CA   . VAL A 1 128 ? 10.784  -1.611  2.415   1.00 0.26 ? 128 VAL A CA   1  
ATOM 2026  C C    . VAL A 1 128 ? 9.434   -1.317  3.059   1.00 0.24 ? 128 VAL A C    1  
ATOM 2027  O O    . VAL A 1 128 ? 8.695   -2.217  3.398   1.00 0.22 ? 128 VAL A O    1  
ATOM 2028  C CB   . VAL A 1 128 ? 10.769  -1.160  0.953   1.00 0.28 ? 128 VAL A CB   1  
ATOM 2029  C CG1  . VAL A 1 128 ? 11.986  -1.729  0.219   1.00 0.30 ? 128 VAL A CG1  1  
ATOM 2030  C CG2  . VAL A 1 128 ? 9.493   -1.654  0.272   1.00 0.27 ? 128 VAL A CG2  1  
ATOM 2031  H H    . VAL A 1 128 ? 10.820  -3.625  1.698   1.00 0.25 ? 128 VAL A H    1  
ATOM 2032  H HA   . VAL A 1 128 ? 11.563  -1.091  2.950   1.00 0.27 ? 128 VAL A HA   1  
ATOM 2033  H HB   . VAL A 1 128 ? 10.799  -0.090  0.917   1.00 0.30 ? 128 VAL A HB   1  
ATOM 2034  H HG11 . VAL A 1 128 ? 12.792  -1.882  0.920   1.00 1.00 ? 128 VAL A HG11 1  
ATOM 2035  H HG12 . VAL A 1 128 ? 11.723  -2.671  -0.238  1.00 1.02 ? 128 VAL A HG12 1  
ATOM 2036  H HG13 . VAL A 1 128 ? 12.301  -1.035  -0.546  1.00 1.07 ? 128 VAL A HG13 1  
ATOM 2037  H HG21 . VAL A 1 128 ? 9.119   -2.514  0.800   1.00 1.04 ? 128 VAL A HG21 1  
ATOM 2038  H HG22 . VAL A 1 128 ? 8.751   -0.870  0.289   1.00 1.06 ? 128 VAL A HG22 1  
ATOM 2039  H HG23 . VAL A 1 128 ? 9.711   -1.924  -0.750  1.00 1.03 ? 128 VAL A HG23 1  
ATOM 2040  N N    . VAL A 1 129 ? 9.103   -0.073  3.223   1.00 0.25 ? 129 VAL A N    1  
ATOM 2041  C CA   . VAL A 1 129 ? 7.791   0.263   3.830   1.00 0.24 ? 129 VAL A CA   1  
ATOM 2042  C C    . VAL A 1 129 ? 7.367   1.665   3.411   1.00 0.27 ? 129 VAL A C    1  
ATOM 2043  O O    . VAL A 1 129 ? 8.000   2.648   3.736   1.00 0.29 ? 129 VAL A O    1  
ATOM 2044  C CB   . VAL A 1 129 ? 7.881   0.146   5.354   1.00 0.23 ? 129 VAL A CB   1  
ATOM 2045  C CG1  . VAL A 1 129 ? 7.104   1.289   6.026   1.00 0.24 ? 129 VAL A CG1  1  
ATOM 2046  C CG2  . VAL A 1 129 ? 7.282   -1.199  5.774   1.00 0.21 ? 129 VAL A CG2  1  
ATOM 2047  H H    . VAL A 1 129 ? 9.711   0.634   2.941   1.00 0.27 ? 129 VAL A H    1  
ATOM 2048  H HA   . VAL A 1 129 ? 7.057   -0.435  3.472   1.00 0.23 ? 129 VAL A HA   1  
ATOM 2049  H HB   . VAL A 1 129 ? 8.917   0.184   5.650   1.00 0.25 ? 129 VAL A HB   1  
ATOM 2050  H HG11 . VAL A 1 129 ? 6.126   1.374   5.574   1.00 1.01 ? 129 VAL A HG11 1  
ATOM 2051  H HG12 . VAL A 1 129 ? 6.998   1.085   7.080   1.00 0.97 ? 129 VAL A HG12 1  
ATOM 2052  H HG13 . VAL A 1 129 ? 7.641   2.218   5.891   1.00 1.04 ? 129 VAL A HG13 1  
ATOM 2053  H HG21 . VAL A 1 129 ? 7.169   -1.823  4.902   1.00 0.98 ? 129 VAL A HG21 1  
ATOM 2054  H HG22 . VAL A 1 129 ? 7.940   -1.684  6.478   1.00 1.07 ? 129 VAL A HG22 1  
ATOM 2055  H HG23 . VAL A 1 129 ? 6.316   -1.041  6.228   1.00 1.04 ? 129 VAL A HG23 1  
ATOM 2056  N N    . CYS A 1 130 ? 6.283   1.748   2.698   1.00 0.28 ? 130 CYS A N    1  
ATOM 2057  C CA   . CYS A 1 130 ? 5.777   3.074   2.247   1.00 0.31 ? 130 CYS A CA   1  
ATOM 2058  C C    . CYS A 1 130 ? 4.688   3.541   3.213   1.00 0.29 ? 130 CYS A C    1  
ATOM 2059  O O    . CYS A 1 130 ? 3.538   3.169   3.090   1.00 0.28 ? 130 CYS A O    1  
ATOM 2060  C CB   . CYS A 1 130 ? 5.191   2.948   0.839   1.00 0.34 ? 130 CYS A CB   1  
ATOM 2061  S SG   . CYS A 1 130 ? 5.385   4.520   -0.038  1.00 0.44 ? 130 CYS A SG   1  
ATOM 2062  H H    . CYS A 1 130 ? 5.795   0.927   2.466   1.00 0.28 ? 130 CYS A H    1  
ATOM 2063  H HA   . CYS A 1 130 ? 6.587   3.789   2.241   1.00 0.34 ? 130 CYS A HA   1  
ATOM 2064  H HB2  . CYS A 1 130 ? 5.710   2.169   0.301   1.00 0.39 ? 130 CYS A HB2  1  
ATOM 2065  H HB3  . CYS A 1 130 ? 4.141   2.702   0.907   1.00 0.35 ? 130 CYS A HB3  1  
ATOM 2066  H HG   . CYS A 1 130 ? 4.660   4.603   -0.662  1.00 0.99 ? 130 CYS A HG   1  
ATOM 2067  N N    . THR A 1 131 ? 5.044   4.344   4.179   1.00 0.29 ? 131 THR A N    1  
ATOM 2068  C CA   . THR A 1 131 ? 4.032   4.824   5.162   1.00 0.28 ? 131 THR A CA   1  
ATOM 2069  C C    . THR A 1 131 ? 3.753   6.310   4.941   1.00 0.30 ? 131 THR A C    1  
ATOM 2070  O O    . THR A 1 131 ? 4.634   7.140   5.053   1.00 0.40 ? 131 THR A O    1  
ATOM 2071  C CB   . THR A 1 131 ? 4.568   4.625   6.580   1.00 0.31 ? 131 THR A CB   1  
ATOM 2072  O OG1  . THR A 1 131 ? 5.331   3.427   6.633   1.00 0.37 ? 131 THR A OG1  1  
ATOM 2073  C CG2  . THR A 1 131 ? 3.401   4.534   7.566   1.00 0.31 ? 131 THR A CG2  1  
ATOM 2074  H H    . THR A 1 131 ? 5.980   4.623   4.264   1.00 0.31 ? 131 THR A H    1  
ATOM 2075  H HA   . THR A 1 131 ? 3.117   4.263   5.042   1.00 0.28 ? 131 THR A HA   1  
ATOM 2076  H HB   . THR A 1 131 ? 5.194   5.464   6.846   1.00 0.34 ? 131 THR A HB   1  
ATOM 2077  H HG1  . THR A 1 131 ? 6.043   3.556   7.263   1.00 0.88 ? 131 THR A HG1  1  
ATOM 2078  H HG21 . THR A 1 131 ? 2.468   4.650   7.034   1.00 1.06 ? 131 THR A HG21 1  
ATOM 2079  H HG22 . THR A 1 131 ? 3.418   3.572   8.057   1.00 1.07 ? 131 THR A HG22 1  
ATOM 2080  H HG23 . THR A 1 131 ? 3.493   5.316   8.305   1.00 1.01 ? 131 THR A HG23 1  
ATOM 2081  N N    . ARG A 1 132 ? 2.530   6.651   4.644   1.00 0.30 ? 132 ARG A N    1  
ATOM 2082  C CA   . ARG A 1 132 ? 2.186   8.086   4.434   1.00 0.32 ? 132 ARG A CA   1  
ATOM 2083  C C    . ARG A 1 132 ? 0.758   8.333   4.917   1.00 0.32 ? 132 ARG A C    1  
ATOM 2084  O O    . ARG A 1 132 ? -0.146  7.572   4.631   1.00 0.43 ? 132 ARG A O    1  
ATOM 2085  C CB   . ARG A 1 132 ? 2.307   8.456   2.950   1.00 0.40 ? 132 ARG A CB   1  
ATOM 2086  C CG   . ARG A 1 132 ? 1.970   7.251   2.072   1.00 0.62 ? 132 ARG A CG   1  
ATOM 2087  C CD   . ARG A 1 132 ? 2.021   7.674   0.605   1.00 0.53 ? 132 ARG A CD   1  
ATOM 2088  N NE   . ARG A 1 132 ? 2.195   6.470   -0.257  1.00 1.11 ? 132 ARG A NE   1  
ATOM 2089  C CZ   . ARG A 1 132 ? 2.460   6.610   -1.527  1.00 1.18 ? 132 ARG A CZ   1  
ATOM 2090  N NH1  . ARG A 1 132 ? 3.689   6.806   -1.920  1.00 1.77 ? 132 ARG A NH1  1  
ATOM 2091  N NH2  . ARG A 1 132 ? 1.496   6.555   -2.405  1.00 1.57 ? 132 ARG A NH2  1  
ATOM 2092  H H    . ARG A 1 132 ? 1.833   5.963   4.570   1.00 0.35 ? 132 ARG A H    1  
ATOM 2093  H HA   . ARG A 1 132 ? 2.864   8.700   5.011   1.00 0.34 ? 132 ARG A HA   1  
ATOM 2094  H HB2  . ARG A 1 132 ? 1.627   9.263   2.725   1.00 0.78 ? 132 ARG A HB2  1  
ATOM 2095  H HB3  . ARG A 1 132 ? 3.317   8.774   2.744   1.00 0.89 ? 132 ARG A HB3  1  
ATOM 2096  H HG2  . ARG A 1 132 ? 2.688   6.464   2.248   1.00 1.09 ? 132 ARG A HG2  1  
ATOM 2097  H HG3  . ARG A 1 132 ? 0.981   6.898   2.309   1.00 1.07 ? 132 ARG A HG3  1  
ATOM 2098  H HD2  . ARG A 1 132 ? 1.102   8.175   0.343   1.00 0.88 ? 132 ARG A HD2  1  
ATOM 2099  H HD3  . ARG A 1 132 ? 2.851   8.347   0.455   1.00 0.42 ? 132 ARG A HD3  1  
ATOM 2100  H HE   . ARG A 1 132 ? 2.111   5.574   0.130   1.00 1.60 ? 132 ARG A HE   1  
ATOM 2101  H HH11 . ARG A 1 132 ? 4.428   6.848   -1.247  1.00 2.39 ? 132 ARG A HH11 1  
ATOM 2102  H HH12 . ARG A 1 132 ? 3.892   6.913   -2.893  1.00 1.91 ? 132 ARG A HH12 1  
ATOM 2103  H HH21 . ARG A 1 132 ? 0.554   6.406   -2.104  1.00 2.16 ? 132 ARG A HH21 1  
ATOM 2104  H HH22 . ARG A 1 132 ? 1.699   6.663   -3.378  1.00 1.71 ? 132 ARG A HH22 1  
ATOM 2105  N N    . VAL A 1 133 ? 0.553   9.386   5.660   1.00 0.31 ? 133 VAL A N    1  
ATOM 2106  C CA   . VAL A 1 133 ? -0.810  9.684   6.180   1.00 0.30 ? 133 VAL A CA   1  
ATOM 2107  C C    . VAL A 1 133 ? -1.684  10.234  5.054   1.00 0.31 ? 133 VAL A C    1  
ATOM 2108  O O    . VAL A 1 133 ? -1.202  10.788  4.088   1.00 0.33 ? 133 VAL A O    1  
ATOM 2109  C CB   . VAL A 1 133 ? -0.701  10.718  7.309   1.00 0.32 ? 133 VAL A CB   1  
ATOM 2110  C CG1  . VAL A 1 133 ? -2.073  11.343  7.582   1.00 0.34 ? 133 VAL A CG1  1  
ATOM 2111  C CG2  . VAL A 1 133 ? -0.191  10.031  8.581   1.00 0.33 ? 133 VAL A CG2  1  
ATOM 2112  H H    . VAL A 1 133 ? 1.301   9.980   5.883   1.00 0.39 ? 133 VAL A H    1  
ATOM 2113  H HA   . VAL A 1 133 ? -1.258  8.780   6.564   1.00 0.29 ? 133 VAL A HA   1  
ATOM 2114  H HB   . VAL A 1 133 ? -0.008  11.492  7.018   1.00 0.34 ? 133 VAL A HB   1  
ATOM 2115  H HG11 . VAL A 1 133 ? -2.814  10.562  7.667   1.00 1.06 ? 133 VAL A HG11 1  
ATOM 2116  H HG12 . VAL A 1 133 ? -2.035  11.906  8.502   1.00 1.05 ? 133 VAL A HG12 1  
ATOM 2117  H HG13 . VAL A 1 133 ? -2.336  12.001  6.766   1.00 1.11 ? 133 VAL A HG13 1  
ATOM 2118  H HG21 . VAL A 1 133 ? 0.073   9.008   8.359   1.00 1.08 ? 133 VAL A HG21 1  
ATOM 2119  H HG22 . VAL A 1 133 ? 0.679   10.556  8.948   1.00 1.10 ? 133 VAL A HG22 1  
ATOM 2120  H HG23 . VAL A 1 133 ? -0.965  10.047  9.335   1.00 1.02 ? 133 VAL A HG23 1  
ATOM 2121  N N    . TYR A 1 134 ? -2.971  10.089  5.189   1.00 0.29 ? 134 TYR A N    1  
ATOM 2122  C CA   . TYR A 1 134 ? -3.902  10.603  4.154   1.00 0.29 ? 134 TYR A CA   1  
ATOM 2123  C C    . TYR A 1 134 ? -5.040  11.344  4.836   1.00 0.29 ? 134 TYR A C    1  
ATOM 2124  O O    . TYR A 1 134 ? -5.255  11.220  6.025   1.00 0.32 ? 134 TYR A O    1  
ATOM 2125  C CB   . TYR A 1 134 ? -4.526  9.448   3.379   1.00 0.26 ? 134 TYR A CB   1  
ATOM 2126  C CG   . TYR A 1 134 ? -3.512  8.811   2.477   1.00 0.27 ? 134 TYR A CG   1  
ATOM 2127  C CD1  . TYR A 1 134 ? -2.487  8.037   3.020   1.00 0.29 ? 134 TYR A CD1  1  
ATOM 2128  C CD2  . TYR A 1 134 ? -3.610  8.981   1.094   1.00 0.29 ? 134 TYR A CD2  1  
ATOM 2129  C CE1  . TYR A 1 134 ? -1.554  7.431   2.181   1.00 0.32 ? 134 TYR A CE1  1  
ATOM 2130  C CE2  . TYR A 1 134 ? -2.676  8.379   0.250   1.00 0.32 ? 134 TYR A CE2  1  
ATOM 2131  C CZ   . TYR A 1 134 ? -1.645  7.601   0.792   1.00 0.34 ? 134 TYR A CZ   1  
ATOM 2132  O OH   . TYR A 1 134 ? -0.723  7.000   -0.041  1.00 0.38 ? 134 TYR A OH   1  
ATOM 2133  H H    . TYR A 1 134 ? -3.327  9.647   5.983   1.00 0.28 ? 134 TYR A H    1  
ATOM 2134  H HA   . TYR A 1 134 ? -3.377  11.257  3.475   1.00 0.31 ? 134 TYR A HA   1  
ATOM 2135  H HB2  . TYR A 1 134 ? -4.900  8.714   4.070   1.00 0.24 ? 134 TYR A HB2  1  
ATOM 2136  H HB3  . TYR A 1 134 ? -5.343  9.825   2.786   1.00 0.26 ? 134 TYR A HB3  1  
ATOM 2137  H HD1  . TYR A 1 134 ? -2.415  7.909   4.090   1.00 0.28 ? 134 TYR A HD1  1  
ATOM 2138  H HD2  . TYR A 1 134 ? -4.407  9.581   0.678   1.00 0.30 ? 134 TYR A HD2  1  
ATOM 2139  H HE1  . TYR A 1 134 ? -0.765  6.834   2.604   1.00 0.34 ? 134 TYR A HE1  1  
ATOM 2140  H HE2  . TYR A 1 134 ? -2.753  8.513   -0.818  1.00 0.35 ? 134 TYR A HE2  1  
ATOM 2141  H HH   . TYR A 1 134 ? -1.054  6.128   -0.269  1.00 0.84 ? 134 TYR A HH   1  
ATOM 2142  N N    . VAL A 1 135 ? -5.797  12.072  4.079   1.00 0.30 ? 135 VAL A N    1  
ATOM 2143  C CA   . VAL A 1 135 ? -6.960  12.783  4.644   1.00 0.30 ? 135 VAL A CA   1  
ATOM 2144  C C    . VAL A 1 135 ? -8.099  12.622  3.655   1.00 0.29 ? 135 VAL A C    1  
ATOM 2145  O O    . VAL A 1 135 ? -7.880  12.253  2.521   1.00 0.29 ? 135 VAL A O    1  
ATOM 2146  C CB   . VAL A 1 135 ? -6.638  14.247  4.840   1.00 0.34 ? 135 VAL A CB   1  
ATOM 2147  C CG1  . VAL A 1 135 ? -7.840  14.936  5.468   1.00 0.35 ? 135 VAL A CG1  1  
ATOM 2148  C CG2  . VAL A 1 135 ? -5.435  14.371  5.770   1.00 0.36 ? 135 VAL A CG2  1  
ATOM 2149  H H    . VAL A 1 135 ? -5.620  12.126  3.119   1.00 0.31 ? 135 VAL A H    1  
ATOM 2150  H HA   . VAL A 1 135 ? -7.229  12.341  5.588   1.00 0.30 ? 135 VAL A HA   1  
ATOM 2151  H HB   . VAL A 1 135 ? -6.419  14.694  3.889   1.00 0.35 ? 135 VAL A HB   1  
ATOM 2152  H HG11 . VAL A 1 135 ? -8.342  14.244  6.127   1.00 1.08 ? 135 VAL A HG11 1  
ATOM 2153  H HG12 . VAL A 1 135 ? -7.508  15.794  6.030   1.00 1.05 ? 135 VAL A HG12 1  
ATOM 2154  H HG13 . VAL A 1 135 ? -8.519  15.249  4.690   1.00 1.04 ? 135 VAL A HG13 1  
ATOM 2155  H HG21 . VAL A 1 135 ? -4.687  13.646  5.487   1.00 1.03 ? 135 VAL A HG21 1  
ATOM 2156  H HG22 . VAL A 1 135 ? -5.023  15.364  5.697   1.00 1.04 ? 135 VAL A HG22 1  
ATOM 2157  H HG23 . VAL A 1 135 ? -5.750  14.182  6.786   1.00 1.15 ? 135 VAL A HG23 1  
ATOM 2158  N N    . ARG A 1 136 ? -9.307  12.865  4.047   1.00 0.30 ? 136 ARG A N    1  
ATOM 2159  C CA   . ARG A 1 136 ? -10.411 12.674  3.068   1.00 0.30 ? 136 ARG A CA   1  
ATOM 2160  C C    . ARG A 1 136 ? -10.569 13.917  2.203   1.00 0.34 ? 136 ARG A C    1  
ATOM 2161  O O    . ARG A 1 136 ? -10.868 14.996  2.677   1.00 0.37 ? 136 ARG A O    1  
ATOM 2162  C CB   . ARG A 1 136 ? -11.730 12.365  3.768   1.00 0.30 ? 136 ARG A CB   1  
ATOM 2163  C CG   . ARG A 1 136 ? -12.012 10.865  3.670   1.00 0.27 ? 136 ARG A CG   1  
ATOM 2164  C CD   . ARG A 1 136 ? -12.650 10.376  4.972   1.00 0.47 ? 136 ARG A CD   1  
ATOM 2165  N NE   . ARG A 1 136 ? -13.954 11.069  5.175   1.00 0.70 ? 136 ARG A NE   1  
ATOM 2166  C CZ   . ARG A 1 136 ? -14.833 10.578  6.005   1.00 1.07 ? 136 ARG A CZ   1  
ATOM 2167  N NH1  . ARG A 1 136 ? -15.183 9.324   5.918   1.00 1.72 ? 136 ARG A NH1  1  
ATOM 2168  N NH2  . ARG A 1 136 ? -15.363 11.342  6.921   1.00 1.86 ? 136 ARG A NH2  1  
ATOM 2169  H H    . ARG A 1 136 ? -9.483  13.154  4.966   1.00 0.31 ? 136 ARG A H    1  
ATOM 2170  H HA   . ARG A 1 136 ? -10.150 11.842  2.431   1.00 0.28 ? 136 ARG A HA   1  
ATOM 2171  H HB2  . ARG A 1 136 ? -11.675 12.659  4.804   1.00 0.32 ? 136 ARG A HB2  1  
ATOM 2172  H HB3  . ARG A 1 136 ? -12.524 12.904  3.276   1.00 0.32 ? 136 ARG A HB3  1  
ATOM 2173  H HG2  . ARG A 1 136 ? -12.686 10.682  2.846   1.00 0.40 ? 136 ARG A HG2  1  
ATOM 2174  H HG3  . ARG A 1 136 ? -11.087 10.337  3.501   1.00 0.37 ? 136 ARG A HG3  1  
ATOM 2175  H HD2  . ARG A 1 136 ? -12.814 9.310   4.914   1.00 1.01 ? 136 ARG A HD2  1  
ATOM 2176  H HD3  . ARG A 1 136 ? -11.992 10.595  5.800   1.00 0.96 ? 136 ARG A HD3  1  
ATOM 2177  H HE   . ARG A 1 136 ? -14.151 11.895  4.685   1.00 1.32 ? 136 ARG A HE   1  
ATOM 2178  H HH11 . ARG A 1 136 ? -14.777 8.739   5.216   1.00 2.20 ? 136 ARG A HH11 1  
ATOM 2179  H HH12 . ARG A 1 136 ? -15.858 8.948   6.554   1.00 2.17 ? 136 ARG A HH12 1  
ATOM 2180  H HH21 . ARG A 1 136 ? -15.096 12.303  6.987   1.00 2.36 ? 136 ARG A HH21 1  
ATOM 2181  H HH22 . ARG A 1 136 ? -16.037 10.966  7.557   1.00 2.34 ? 136 ARG A HH22 1  
ATOM 2182  N N    . GLU A 1 137 ? -10.370 13.757  0.927   1.00 0.35 ? 137 GLU A N    1  
ATOM 2183  C CA   . GLU A 1 137 ? -10.501 14.902  -0.017  1.00 0.40 ? 137 GLU A CA   1  
ATOM 2184  C C    . GLU A 1 137 ? -11.850 15.597  0.190   1.00 0.45 ? 137 GLU A C    1  
ATOM 2185  O O    . GLU A 1 137 ? -12.863 14.964  -0.057  1.00 1.17 ? 137 GLU A O    1  
ATOM 2186  C CB   . GLU A 1 137 ? -10.412 14.387  -1.456  1.00 0.45 ? 137 GLU A CB   1  
ATOM 2187  C CG   . GLU A 1 137 ? -10.018 15.535  -2.386  1.00 0.54 ? 137 GLU A CG   1  
ATOM 2188  C CD   . GLU A 1 137 ? -10.680 15.338  -3.751  1.00 1.09 ? 137 GLU A CD   1  
ATOM 2189  O OE1  . GLU A 1 137 ? -11.893 15.444  -3.820  1.00 1.92 ? 137 GLU A OE1  1  
ATOM 2190  O OE2  . GLU A 1 137 ? -9.962  15.086  -4.704  1.00 1.48 ? 137 GLU A OE2  1  
ATOM 2191  O OXT  . GLU A 1 137 ? -11.846 16.749  0.590   1.00 1.17 ? 137 GLU A OXT  1  
ATOM 2192  H H    . GLU A 1 137 ? -10.130 12.873  0.591   1.00 0.33 ? 137 GLU A H    1  
ATOM 2193  H HA   . GLU A 1 137 ? -9.703  15.602  0.161   1.00 0.41 ? 137 GLU A HA   1  
ATOM 2194  H HB2  . GLU A 1 137 ? -9.669  13.605  -1.512  1.00 0.43 ? 137 GLU A HB2  1  
ATOM 2195  H HB3  . GLU A 1 137 ? -11.372 13.994  -1.758  1.00 0.47 ? 137 GLU A HB3  1  
ATOM 2196  H HG2  . GLU A 1 137 ? -10.344 16.473  -1.958  1.00 0.71 ? 137 GLU A HG2  1  
ATOM 2197  H HG3  . GLU A 1 137 ? -8.945  15.549  -2.507  1.00 0.69 ? 137 GLU A HG3  1  
ATOM 2198  N N    . PRO A 1 1   ? -15.912 -1.750  9.677   1.00 0.00 ? 1   PRO A N    2  
ATOM 2199  C CA   . PRO A 1 1   ? -14.465 -1.632  9.290   1.00 0.00 ? 1   PRO A CA   2  
ATOM 2200  C C    . PRO A 1 1   ? -14.167 -0.256  8.671   1.00 0.00 ? 1   PRO A C    2  
ATOM 2201  O O    . PRO A 1 1   ? -13.057 0.223   8.761   1.00 0.00 ? 1   PRO A O    2  
ATOM 2202  C CB   . PRO A 1 1   ? -14.157 -2.720  8.257   1.00 0.00 ? 1   PRO A CB   2  
ATOM 2203  C CG   . PRO A 1 1   ? -15.456 -3.478  8.003   1.00 0.00 ? 1   PRO A CG   2  
ATOM 2204  C CD   . PRO A 1 1   ? -16.557 -2.765  8.790   1.00 0.00 ? 1   PRO A CD   2  
ATOM 2205  H H2   . PRO A 1 1   ? -16.393 -0.838  9.575   1.00 0.00 ? 1   PRO A H2   2  
ATOM 2206  H H3   . PRO A 1 1   ? -15.977 -2.064  10.667  1.00 0.00 ? 1   PRO A H3   2  
ATOM 2207  H HA   . PRO A 1 1   ? -13.844 -1.780  10.161  1.00 0.00 ? 1   PRO A HA   2  
ATOM 2208  H HB2  . PRO A 1 1   ? -13.791 -2.275  7.339   1.00 0.00 ? 1   PRO A HB2  2  
ATOM 2209  H HB3  . PRO A 1 1   ? -13.416 -3.398  8.649   1.00 0.00 ? 1   PRO A HB3  2  
ATOM 2210  H HG2  . PRO A 1 1   ? -15.688 -3.465  6.947   1.00 0.00 ? 1   PRO A HG2  2  
ATOM 2211  H HG3  . PRO A 1 1   ? -15.364 -4.496  8.349   1.00 0.00 ? 1   PRO A HG3  2  
ATOM 2212  H HD2  . PRO A 1 1   ? -17.236 -2.276  8.106   1.00 0.00 ? 1   PRO A HD2  2  
ATOM 2213  H HD3  . PRO A 1 1   ? -17.098 -3.481  9.392   1.00 0.00 ? 1   PRO A HD3  2  
ATOM 2214  N N    . ASN A 1 2   ? -15.133 0.360   8.013   1.00 0.00 ? 2   ASN A N    2  
ATOM 2215  C CA   . ASN A 1 2   ? -14.895 1.686   7.354   1.00 0.00 ? 2   ASN A CA   2  
ATOM 2216  C C    . ASN A 1 2   ? -14.048 1.450   6.098   1.00 0.00 ? 2   ASN A C    2  
ATOM 2217  O O    . ASN A 1 2   ? -14.254 0.467   5.423   1.00 0.00 ? 2   ASN A O    2  
ATOM 2218  C CB   . ASN A 1 2   ? -14.259 2.682   8.346   1.00 0.00 ? 2   ASN A CB   2  
ATOM 2219  C CG   . ASN A 1 2   ? -15.192 2.865   9.545   1.00 0.00 ? 2   ASN A CG   2  
ATOM 2220  O OD1  . ASN A 1 2   ? -16.370 3.109   9.380   1.00 0.00 ? 2   ASN A OD1  2  
ATOM 2221  N ND2  . ASN A 1 2   ? -14.711 2.756   10.753  1.00 0.00 ? 2   ASN A ND2  2  
ATOM 2222  H H    . ASN A 1 2   ? -16.009 -0.065  7.924   1.00 0.00 ? 2   ASN A H    2  
ATOM 2223  H HA   . ASN A 1 2   ? -15.830 2.091   7.027   1.00 0.00 ? 2   ASN A HA   2  
ATOM 2224  H HB2  . ASN A 1 2   ? -13.317 2.314   8.687   1.00 0.00 ? 2   ASN A HB2  2  
ATOM 2225  H HB3  . ASN A 1 2   ? -14.120 3.636   7.862   1.00 0.00 ? 2   ASN A HB3  2  
ATOM 2226  H HD21 . ASN A 1 2   ? -13.760 2.559   10.886  1.00 0.00 ? 2   ASN A HD21 2  
ATOM 2227  H HD22 . ASN A 1 2   ? -15.301 2.871   11.527  1.00 0.00 ? 2   ASN A HD22 2  
ATOM 2228  N N    . PHE A 1 3   ? -13.130 2.327   5.775   1.00 0.00 ? 3   PHE A N    2  
ATOM 2229  C CA   . PHE A 1 3   ? -12.265 2.186   4.541   1.00 0.00 ? 3   PHE A CA   2  
ATOM 2230  C C    . PHE A 1 3   ? -13.017 2.656   3.278   1.00 0.00 ? 3   PHE A C    2  
ATOM 2231  O O    . PHE A 1 3   ? -12.467 3.368   2.460   1.00 0.00 ? 3   PHE A O    2  
ATOM 2232  C CB   . PHE A 1 3   ? -11.793 0.741   4.291   1.00 0.00 ? 3   PHE A CB   2  
ATOM 2233  C CG   . PHE A 1 3   ? -10.958 0.210   5.435   1.00 0.00 ? 3   PHE A CG   2  
ATOM 2234  C CD1  . PHE A 1 3   ? -11.570 -0.368  6.551   1.00 0.00 ? 3   PHE A CD1  2  
ATOM 2235  C CD2  . PHE A 1 3   ? -9.560  0.246   5.352   1.00 0.00 ? 3   PHE A CD2  2  
ATOM 2236  C CE1  . PHE A 1 3   ? -10.806 -0.911  7.566   1.00 0.00 ? 3   PHE A CE1  2  
ATOM 2237  C CE2  . PHE A 1 3   ? -8.787  -0.293  6.389   1.00 0.00 ? 3   PHE A CE2  2  
ATOM 2238  C CZ   . PHE A 1 3   ? -9.419  -0.881  7.498   1.00 0.00 ? 3   PHE A CZ   2  
ATOM 2239  H H    . PHE A 1 3   ? -13.006 3.100   6.344   1.00 0.00 ? 3   PHE A H    2  
ATOM 2240  H HA   . PHE A 1 3   ? -11.397 2.813   4.671   1.00 0.00 ? 3   PHE A HA   2  
ATOM 2241  H HB2  . PHE A 1 3   ? -12.641 0.098   4.143   1.00 0.00 ? 3   PHE A HB2  2  
ATOM 2242  H HB3  . PHE A 1 3   ? -11.194 0.728   3.392   1.00 0.00 ? 3   PHE A HB3  2  
ATOM 2243  H HD1  . PHE A 1 3   ? -12.633 -0.402  6.634   1.00 0.00 ? 3   PHE A HD1  2  
ATOM 2244  H HD2  . PHE A 1 3   ? -9.078  0.712   4.503   1.00 0.00 ? 3   PHE A HD2  2  
ATOM 2245  H HE1  . PHE A 1 3   ? -11.295 -1.345  8.414   1.00 0.00 ? 3   PHE A HE1  2  
ATOM 2246  H HE2  . PHE A 1 3   ? -7.710  -0.260  6.326   1.00 0.00 ? 3   PHE A HE2  2  
ATOM 2247  H HZ   . PHE A 1 3   ? -8.839  -1.329  8.294   1.00 0.00 ? 3   PHE A HZ   2  
ATOM 2248  N N    . SER A 1 4   ? -14.255 2.245   3.089   1.00 0.00 ? 4   SER A N    2  
ATOM 2249  C CA   . SER A 1 4   ? -15.026 2.639   1.865   1.00 0.00 ? 4   SER A CA   2  
ATOM 2250  C C    . SER A 1 4   ? -14.960 4.158   1.638   1.00 0.00 ? 4   SER A C    2  
ATOM 2251  O O    . SER A 1 4   ? -15.315 4.934   2.506   1.00 0.00 ? 4   SER A O    2  
ATOM 2252  C CB   . SER A 1 4   ? -16.491 2.222   2.040   1.00 0.00 ? 4   SER A CB   2  
ATOM 2253  O OG   . SER A 1 4   ? -17.182 3.194   2.819   1.00 0.00 ? 4   SER A OG   2  
ATOM 2254  H H    . SER A 1 4   ? -14.674 1.659   3.738   1.00 0.00 ? 4   SER A H    2  
ATOM 2255  H HA   . SER A 1 4   ? -14.615 2.122   1.008   1.00 0.00 ? 4   SER A HA   2  
ATOM 2256  H HB2  . SER A 1 4   ? -16.961 2.143   1.074   1.00 0.00 ? 4   SER A HB2  2  
ATOM 2257  H HB3  . SER A 1 4   ? -16.530 1.263   2.534   1.00 0.00 ? 4   SER A HB3  2  
ATOM 2258  H HG   . SER A 1 4   ? -17.891 2.748   3.288   1.00 0.00 ? 4   SER A HG   2  
ATOM 2259  N N    . GLY A 1 5   ? -14.526 4.584   0.477   1.00 0.00 ? 5   GLY A N    2  
ATOM 2260  C CA   . GLY A 1 5   ? -14.459 6.048   0.197   1.00 0.00 ? 5   GLY A CA   2  
ATOM 2261  C C    . GLY A 1 5   ? -13.181 6.378   -0.559  1.00 0.00 ? 5   GLY A C    2  
ATOM 2262  O O    . GLY A 1 5   ? -12.184 5.690   -0.455  1.00 0.00 ? 5   GLY A O    2  
ATOM 2263  H H    . GLY A 1 5   ? -14.252 3.942   -0.213  1.00 0.00 ? 5   GLY A H    2  
ATOM 2264  H HA2  . GLY A 1 5   ? -15.312 6.345   -0.392  1.00 0.00 ? 5   GLY A HA2  2  
ATOM 2265  H HA3  . GLY A 1 5   ? -14.465 6.595   1.123   1.00 0.00 ? 5   GLY A HA3  2  
ATOM 2266  N N    . ASN A 1 6   ? -13.205 7.453   -1.292  1.00 0.00 ? 6   ASN A N    2  
ATOM 2267  C CA   . ASN A 1 6   ? -11.997 7.882   -2.039  1.00 0.00 ? 6   ASN A CA   2  
ATOM 2268  C C    . ASN A 1 6   ? -11.057 8.502   -1.028  1.00 0.00 ? 6   ASN A C    2  
ATOM 2269  O O    . ASN A 1 6   ? -11.500 8.980   0.003   1.00 0.00 ? 6   ASN A O    2  
ATOM 2270  C CB   . ASN A 1 6   ? -12.373 8.908   -3.111  1.00 0.00 ? 6   ASN A CB   2  
ATOM 2271  C CG   . ASN A 1 6   ? -11.141 9.241   -3.954  1.00 0.00 ? 6   ASN A CG   2  
ATOM 2272  O OD1  . ASN A 1 6   ? -10.233 9.902   -3.489  1.00 0.00 ? 6   ASN A OD1  2  
ATOM 2273  N ND2  . ASN A 1 6   ? -11.070 8.809   -5.183  1.00 0.00 ? 6   ASN A ND2  2  
ATOM 2274  H H    . ASN A 1 6   ? -14.014 7.990   -1.323  1.00 0.00 ? 6   ASN A H    2  
ATOM 2275  H HA   . ASN A 1 6   ? -11.526 7.025   -2.489  1.00 0.00 ? 6   ASN A HA   2  
ATOM 2276  H HB2  . ASN A 1 6   ? -13.145 8.498   -3.746  1.00 0.00 ? 6   ASN A HB2  2  
ATOM 2277  H HB3  . ASN A 1 6   ? -12.736 9.807   -2.637  1.00 0.00 ? 6   ASN A HB3  2  
ATOM 2278  H HD21 . ASN A 1 6   ? -11.802 8.275   -5.557  1.00 0.00 ? 6   ASN A HD21 2  
ATOM 2279  H HD22 . ASN A 1 6   ? -10.285 9.017   -5.731  1.00 0.00 ? 6   ASN A HD22 2  
ATOM 2280  N N    . TRP A 1 7   ? -9.771  8.465   -1.265  1.00 0.00 ? 7   TRP A N    2  
ATOM 2281  C CA   . TRP A 1 7   ? -8.845  9.024   -0.238  1.00 0.00 ? 7   TRP A CA   2  
ATOM 2282  C C    . TRP A 1 7   ? -7.834  9.991   -0.814  1.00 0.00 ? 7   TRP A C    2  
ATOM 2283  O O    . TRP A 1 7   ? -7.165  9.717   -1.793  1.00 0.00 ? 7   TRP A O    2  
ATOM 2284  C CB   . TRP A 1 7   ? -8.101  7.878   0.409   1.00 0.00 ? 7   TRP A CB   2  
ATOM 2285  C CG   . TRP A 1 7   ? -9.073  6.956   1.043   1.00 0.00 ? 7   TRP A CG   2  
ATOM 2286  C CD1  . TRP A 1 7   ? -9.548  5.818   0.499   1.00 0.00 ? 7   TRP A CD1  2  
ATOM 2287  C CD2  . TRP A 1 7   ? -9.714  7.101   2.326   1.00 0.00 ? 7   TRP A CD2  2  
ATOM 2288  N NE1  . TRP A 1 7   ? -10.405 5.222   1.404   1.00 0.00 ? 7   TRP A NE1  2  
ATOM 2289  C CE2  . TRP A 1 7   ? -10.546 5.986   2.549   1.00 0.00 ? 7   TRP A CE2  2  
ATOM 2290  C CE3  . TRP A 1 7   ? -9.633  8.086   3.310   1.00 0.00 ? 7   TRP A CE3  2  
ATOM 2291  C CZ2  . TRP A 1 7   ? -11.280 5.854   3.730   1.00 0.00 ? 7   TRP A CZ2  2  
ATOM 2292  C CZ3  . TRP A 1 7   ? -10.372 7.978   4.487   1.00 0.00 ? 7   TRP A CZ3  2  
ATOM 2293  C CH2  . TRP A 1 7   ? -11.197 6.860   4.705   1.00 0.00 ? 7   TRP A CH2  2  
ATOM 2294  H H    . TRP A 1 7   ? -9.419  8.035   -2.086  1.00 0.00 ? 7   TRP A H    2  
ATOM 2295  H HA   . TRP A 1 7   ? -9.416  9.539   0.519   1.00 0.00 ? 7   TRP A HA   2  
ATOM 2296  H HB2  . TRP A 1 7   ? -7.533  7.353   -0.328  1.00 0.00 ? 7   TRP A HB2  2  
ATOM 2297  H HB3  . TRP A 1 7   ? -7.440  8.263   1.156   1.00 0.00 ? 7   TRP A HB3  2  
ATOM 2298  H HD1  . TRP A 1 7   ? -9.288  5.430   -0.475  1.00 0.00 ? 7   TRP A HD1  2  
ATOM 2299  H HE1  . TRP A 1 7   ? -10.868 4.376   1.264   1.00 0.00 ? 7   TRP A HE1  2  
ATOM 2300  H HE3  . TRP A 1 7   ? -8.994  8.936   3.155   1.00 0.00 ? 7   TRP A HE3  2  
ATOM 2301  H HZ2  . TRP A 1 7   ? -11.898 4.982   3.893   1.00 0.00 ? 7   TRP A HZ2  2  
ATOM 2302  H HZ3  . TRP A 1 7   ? -10.318 8.769   5.219   1.00 0.00 ? 7   TRP A HZ3  2  
ATOM 2303  H HH2  . TRP A 1 7   ? -11.769 6.778   5.617   1.00 0.00 ? 7   TRP A HH2  2  
ATOM 2304  N N    . LYS A 1 8   ? -7.703  11.120  -0.172  1.00 0.00 ? 8   LYS A N    2  
ATOM 2305  C CA   . LYS A 1 8   ? -6.716  12.126  -0.622  1.00 0.00 ? 8   LYS A CA   2  
ATOM 2306  C C    . LYS A 1 8   ? -5.427  11.926  0.179   1.00 0.00 ? 8   LYS A C    2  
ATOM 2307  O O    . LYS A 1 8   ? -5.455  11.422  1.287   1.00 0.00 ? 8   LYS A O    2  
ATOM 2308  C CB   . LYS A 1 8   ? -7.263  13.541  -0.386  1.00 0.00 ? 8   LYS A CB   2  
ATOM 2309  C CG   . LYS A 1 8   ? -8.745  13.603  -0.777  1.00 0.00 ? 8   LYS A CG   2  
ATOM 2310  C CD   . LYS A 1 8   ? -8.900  13.271  -2.264  1.00 0.00 ? 8   LYS A CD   2  
ATOM 2311  C CE   . LYS A 1 8   ? -8.384  14.439  -3.107  1.00 0.00 ? 8   LYS A CE   2  
ATOM 2312  N NZ   . LYS A 1 8   ? -9.098  15.689  -2.717  1.00 0.00 ? 8   LYS A NZ   2  
ATOM 2313  H H    . LYS A 1 8   ? -8.254  11.298  0.624   1.00 0.00 ? 8   LYS A H    2  
ATOM 2314  H HA   . LYS A 1 8   ? -6.521  11.977  -1.668  1.00 0.00 ? 8   LYS A HA   2  
ATOM 2315  H HB2  . LYS A 1 8   ? -7.157  13.795  0.659   1.00 0.00 ? 8   LYS A HB2  2  
ATOM 2316  H HB3  . LYS A 1 8   ? -6.706  14.245  -0.984  1.00 0.00 ? 8   LYS A HB3  2  
ATOM 2317  H HG2  . LYS A 1 8   ? -9.299  12.885  -0.190  1.00 0.00 ? 8   LYS A HG2  2  
ATOM 2318  H HG3  . LYS A 1 8   ? -9.125  14.589  -0.586  1.00 0.00 ? 8   LYS A HG3  2  
ATOM 2319  H HD2  . LYS A 1 8   ? -8.334  12.380  -2.493  1.00 0.00 ? 8   LYS A HD2  2  
ATOM 2320  H HD3  . LYS A 1 8   ? -9.939  13.100  -2.486  1.00 0.00 ? 8   LYS A HD3  2  
ATOM 2321  H HE2  . LYS A 1 8   ? -7.325  14.563  -2.940  1.00 0.00 ? 8   LYS A HE2  2  
ATOM 2322  H HE3  . LYS A 1 8   ? -8.562  14.235  -4.152  1.00 0.00 ? 8   LYS A HE3  2  
ATOM 2323  H HZ1  . LYS A 1 8   ? -10.081 15.463  -2.466  1.00 0.00 ? 8   LYS A HZ1  2  
ATOM 2324  H HZ2  . LYS A 1 8   ? -8.620  16.119  -1.899  1.00 0.00 ? 8   LYS A HZ2  2  
ATOM 2325  H HZ3  . LYS A 1 8   ? -9.090  16.356  -3.514  1.00 0.00 ? 8   LYS A HZ3  2  
ATOM 2326  N N    . ILE A 1 9   ? -4.301  12.302  -0.371  1.00 0.00 ? 9   ILE A N    2  
ATOM 2327  C CA   . ILE A 1 9   ? -3.013  12.118  0.360   1.00 0.00 ? 9   ILE A CA   2  
ATOM 2328  C C    . ILE A 1 9   ? -2.928  13.131  1.514   1.00 0.00 ? 9   ILE A C    2  
ATOM 2329  O O    . ILE A 1 9   ? -3.354  14.263  1.397   1.00 0.00 ? 9   ILE A O    2  
ATOM 2330  C CB   . ILE A 1 9   ? -1.839  12.255  -0.646  1.00 0.00 ? 9   ILE A CB   2  
ATOM 2331  C CG1  . ILE A 1 9   ? -0.721  11.270  -0.271  1.00 0.00 ? 9   ILE A CG1  2  
ATOM 2332  C CG2  . ILE A 1 9   ? -1.278  13.687  -0.695  1.00 0.00 ? 9   ILE A CG2  2  
ATOM 2333  C CD1  . ILE A 1 9   ? -0.123  11.623  1.095   1.00 0.00 ? 9   ILE A CD1  2  
ATOM 2334  H H    . ILE A 1 9   ? -4.302  12.697  -1.268  1.00 0.00 ? 9   ILE A H    2  
ATOM 2335  H HA   . ILE A 1 9   ? -2.997  11.121  0.786   1.00 0.00 ? 9   ILE A HA   2  
ATOM 2336  H HB   . ILE A 1 9   ? -2.205  12.001  -1.630  1.00 0.00 ? 9   ILE A HB   2  
ATOM 2337  H HG12 . ILE A 1 9   ? -1.126  10.269  -0.234  1.00 0.00 ? 9   ILE A HG12 2  
ATOM 2338  H HG13 . ILE A 1 9   ? 0.056   11.312  -1.020  1.00 0.00 ? 9   ILE A HG13 2  
ATOM 2339  H HG21 . ILE A 1 9   ? -2.082  14.381  -0.884  1.00 0.00 ? 9   ILE A HG21 2  
ATOM 2340  H HG22 . ILE A 1 9   ? -0.815  13.922  0.252   1.00 0.00 ? 9   ILE A HG22 2  
ATOM 2341  H HG23 . ILE A 1 9   ? -0.544  13.758  -1.483  1.00 0.00 ? 9   ILE A HG23 2  
ATOM 2342  H HD11 . ILE A 1 9   ? -0.412  12.625  1.372   1.00 0.00 ? 9   ILE A HD11 2  
ATOM 2343  H HD12 . ILE A 1 9   ? -0.480  10.925  1.837   1.00 0.00 ? 9   ILE A HD12 2  
ATOM 2344  H HD13 . ILE A 1 9   ? 0.952   11.564  1.037   1.00 0.00 ? 9   ILE A HD13 2  
ATOM 2345  N N    . ILE A 1 10  ? -2.376  12.713  2.616   1.00 0.00 ? 10  ILE A N    2  
ATOM 2346  C CA   . ILE A 1 10  ? -2.241  13.598  3.796   1.00 0.00 ? 10  ILE A CA   2  
ATOM 2347  C C    . ILE A 1 10  ? -1.011  13.127  4.588   1.00 0.00 ? 10  ILE A C    2  
ATOM 2348  O O    . ILE A 1 10  ? -0.958  12.014  5.070   1.00 0.00 ? 10  ILE A O    2  
ATOM 2349  C CB   . ILE A 1 10  ? -3.540  13.510  4.632   1.00 0.00 ? 10  ILE A CB   2  
ATOM 2350  C CG1  . ILE A 1 10  ? -4.632  14.363  3.962   1.00 0.00 ? 10  ILE A CG1  2  
ATOM 2351  C CG2  . ILE A 1 10  ? -3.325  14.021  6.066   1.00 0.00 ? 10  ILE A CG2  2  
ATOM 2352  C CD1  . ILE A 1 10  ? -5.578  13.466  3.157   1.00 0.00 ? 10  ILE A CD1  2  
ATOM 2353  H H    . ILE A 1 10  ? -2.038  11.804  2.666   1.00 0.00 ? 10  ILE A H    2  
ATOM 2354  H HA   . ILE A 1 10  ? -2.092  14.612  3.469   1.00 0.00 ? 10  ILE A HA   2  
ATOM 2355  H HB   . ILE A 1 10  ? -3.862  12.485  4.667   1.00 0.00 ? 10  ILE A HB   2  
ATOM 2356  H HG12 . ILE A 1 10  ? -5.198  14.886  4.719   1.00 0.00 ? 10  ILE A HG12 2  
ATOM 2357  H HG13 . ILE A 1 10  ? -4.173  15.082  3.301   1.00 0.00 ? 10  ILE A HG13 2  
ATOM 2358  H HG21 . ILE A 1 10  ? -2.925  15.024  6.035   1.00 0.00 ? 10  ILE A HG21 2  
ATOM 2359  H HG22 . ILE A 1 10  ? -4.270  14.026  6.590   1.00 0.00 ? 10  ILE A HG22 2  
ATOM 2360  H HG23 . ILE A 1 10  ? -2.632  13.372  6.580   1.00 0.00 ? 10  ILE A HG23 2  
ATOM 2361  H HD11 . ILE A 1 10  ? -5.501  12.450  3.512   1.00 0.00 ? 10  ILE A HD11 2  
ATOM 2362  H HD12 . ILE A 1 10  ? -6.592  13.814  3.281   1.00 0.00 ? 10  ILE A HD12 2  
ATOM 2363  H HD13 . ILE A 1 10  ? -5.313  13.504  2.112   1.00 0.00 ? 10  ILE A HD13 2  
ATOM 2364  N N    . ARG A 1 11  ? -0.023  13.971  4.691   1.00 0.00 ? 11  ARG A N    2  
ATOM 2365  C CA   . ARG A 1 11  ? 1.235   13.622  5.423   1.00 0.00 ? 11  ARG A CA   2  
ATOM 2366  C C    . ARG A 1 11  ? 1.949   12.471  4.710   1.00 0.00 ? 11  ARG A C    2  
ATOM 2367  O O    . ARG A 1 11  ? 1.384   11.419  4.483   1.00 0.00 ? 11  ARG A O    2  
ATOM 2368  C CB   . ARG A 1 11  ? 0.919   13.227  6.871   1.00 0.00 ? 11  ARG A CB   2  
ATOM 2369  C CG   . ARG A 1 11  ? 0.862   14.487  7.738   1.00 0.00 ? 11  ARG A CG   2  
ATOM 2370  C CD   . ARG A 1 11  ? -0.313  15.359  7.292   1.00 0.00 ? 11  ARG A CD   2  
ATOM 2371  N NE   . ARG A 1 11  ? -0.659  16.321  8.376   1.00 0.00 ? 11  ARG A NE   2  
ATOM 2372  C CZ   . ARG A 1 11  ? -1.642  17.163  8.212   1.00 0.00 ? 11  ARG A CZ   2  
ATOM 2373  N NH1  . ARG A 1 11  ? -2.870  16.727  8.138   1.00 0.00 ? 11  ARG A NH1  2  
ATOM 2374  N NH2  . ARG A 1 11  ? -1.397  18.442  8.121   1.00 0.00 ? 11  ARG A NH2  2  
ATOM 2375  H H    . ARG A 1 11  ? -0.105  14.842  4.267   1.00 0.00 ? 11  ARG A H    2  
ATOM 2376  H HA   . ARG A 1 11  ? 1.885   14.485  5.428   1.00 0.00 ? 11  ARG A HA   2  
ATOM 2377  H HB2  . ARG A 1 11  ? -0.032  12.721  6.914   1.00 0.00 ? 11  ARG A HB2  2  
ATOM 2378  H HB3  . ARG A 1 11  ? 1.692   12.573  7.243   1.00 0.00 ? 11  ARG A HB3  2  
ATOM 2379  H HG2  . ARG A 1 11  ? 0.731   14.206  8.773   1.00 0.00 ? 11  ARG A HG2  2  
ATOM 2380  H HG3  . ARG A 1 11  ? 1.782   15.041  7.629   1.00 0.00 ? 11  ARG A HG3  2  
ATOM 2381  H HD2  . ARG A 1 11  ? -0.038  15.904  6.400   1.00 0.00 ? 11  ARG A HD2  2  
ATOM 2382  H HD3  . ARG A 1 11  ? -1.165  14.731  7.079   1.00 0.00 ? 11  ARG A HD3  2  
ATOM 2383  H HE   . ARG A 1 11  ? -0.148  16.321  9.212   1.00 0.00 ? 11  ARG A HE   2  
ATOM 2384  H HH11 . ARG A 1 11  ? -3.058  15.748  8.208   1.00 0.00 ? 11  ARG A HH11 2  
ATOM 2385  H HH12 . ARG A 1 11  ? -3.624  17.373  8.012   1.00 0.00 ? 11  ARG A HH12 2  
ATOM 2386  H HH21 . ARG A 1 11  ? -0.457  18.776  8.178   1.00 0.00 ? 11  ARG A HH21 2  
ATOM 2387  H HH22 . ARG A 1 11  ? -2.151  19.088  7.996   1.00 0.00 ? 11  ARG A HH22 2  
ATOM 2388  N N    . SER A 1 12  ? 3.193   12.676  4.350   1.00 0.00 ? 12  SER A N    2  
ATOM 2389  C CA   . SER A 1 12  ? 3.962   11.610  3.642   1.00 0.00 ? 12  SER A CA   2  
ATOM 2390  C C    . SER A 1 12  ? 5.460   11.924  3.713   1.00 0.00 ? 12  SER A C    2  
ATOM 2391  O O    . SER A 1 12  ? 5.874   13.057  3.557   1.00 0.00 ? 12  SER A O    2  
ATOM 2392  C CB   . SER A 1 12  ? 3.523   11.564  2.177   1.00 0.00 ? 12  SER A CB   2  
ATOM 2393  O OG   . SER A 1 12  ? 3.491   10.214  1.736   1.00 0.00 ? 12  SER A OG   2  
ATOM 2394  H H    . SER A 1 12  ? 3.620   13.537  4.543   1.00 0.00 ? 12  SER A H    2  
ATOM 2395  H HA   . SER A 1 12  ? 3.770   10.652  4.109   1.00 0.00 ? 12  SER A HA   2  
ATOM 2396  H HB2  . SER A 1 12  ? 2.540   11.994  2.081   1.00 0.00 ? 12  SER A HB2  2  
ATOM 2397  H HB3  . SER A 1 12  ? 4.219   12.134  1.574   1.00 0.00 ? 12  SER A HB3  2  
ATOM 2398  H HG   . SER A 1 12  ? 4.330   10.019  1.314   1.00 0.00 ? 12  SER A HG   2  
ATOM 2399  N N    . GLU A 1 13  ? 6.270   10.922  3.939   1.00 0.00 ? 13  GLU A N    2  
ATOM 2400  C CA   . GLU A 1 13  ? 7.746   11.136  4.016   1.00 0.00 ? 13  GLU A CA   2  
ATOM 2401  C C    . GLU A 1 13  ? 8.424   9.783   4.238   1.00 0.00 ? 13  GLU A C    2  
ATOM 2402  O O    . GLU A 1 13  ? 9.061   9.548   5.249   1.00 0.00 ? 13  GLU A O    2  
ATOM 2403  C CB   . GLU A 1 13  ? 8.072   12.084  5.178   1.00 0.00 ? 13  GLU A CB   2  
ATOM 2404  C CG   . GLU A 1 13  ? 9.576   12.368  5.203   1.00 0.00 ? 13  GLU A CG   2  
ATOM 2405  C CD   . GLU A 1 13  ? 9.844   13.631  6.024   1.00 0.00 ? 13  GLU A CD   2  
ATOM 2406  O OE1  . GLU A 1 13  ? 9.951   13.515  7.234   1.00 0.00 ? 13  GLU A OE1  2  
ATOM 2407  O OE2  . GLU A 1 13  ? 9.937   14.692  5.429   1.00 0.00 ? 13  GLU A OE2  2  
ATOM 2408  H H    . GLU A 1 13  ? 5.904   10.021  4.055   1.00 0.00 ? 13  GLU A H    2  
ATOM 2409  H HA   . GLU A 1 13  ? 8.096   11.562  3.088   1.00 0.00 ? 13  GLU A HA   2  
ATOM 2410  H HB2  . GLU A 1 13  ? 7.533   13.011  5.048   1.00 0.00 ? 13  GLU A HB2  2  
ATOM 2411  H HB3  . GLU A 1 13  ? 7.779   11.625  6.110   1.00 0.00 ? 13  GLU A HB3  2  
ATOM 2412  H HG2  . GLU A 1 13  ? 10.092  11.531  5.650   1.00 0.00 ? 13  GLU A HG2  2  
ATOM 2413  H HG3  . GLU A 1 13  ? 9.932   12.514  4.195   1.00 0.00 ? 13  GLU A HG3  2  
ATOM 2414  N N    . ASN A 1 14  ? 8.266   8.885   3.302   1.00 0.00 ? 14  ASN A N    2  
ATOM 2415  C CA   . ASN A 1 14  ? 8.872   7.527   3.450   1.00 0.00 ? 14  ASN A CA   2  
ATOM 2416  C C    . ASN A 1 14  ? 9.576   7.074   2.158   1.00 0.00 ? 14  ASN A C    2  
ATOM 2417  O O    . ASN A 1 14  ? 10.429  6.217   2.207   1.00 0.00 ? 14  ASN A O    2  
ATOM 2418  C CB   . ASN A 1 14  ? 7.770   6.531   3.790   1.00 0.00 ? 14  ASN A CB   2  
ATOM 2419  C CG   . ASN A 1 14  ? 7.593   6.460   5.308   1.00 0.00 ? 14  ASN A CG   2  
ATOM 2420  O OD1  . ASN A 1 14  ? 6.622   6.959   5.842   1.00 0.00 ? 14  ASN A OD1  2  
ATOM 2421  N ND2  . ASN A 1 14  ? 8.496   5.857   6.030   1.00 0.00 ? 14  ASN A ND2  2  
ATOM 2422  H H    . ASN A 1 14  ? 7.730   9.102   2.514   1.00 0.00 ? 14  ASN A H    2  
ATOM 2423  H HA   . ASN A 1 14  ? 9.585   7.538   4.257   1.00 0.00 ? 14  ASN A HA   2  
ATOM 2424  H HB2  . ASN A 1 14  ? 6.847   6.850   3.333   1.00 0.00 ? 14  ASN A HB2  2  
ATOM 2425  H HB3  . ASN A 1 14  ? 8.041   5.560   3.416   1.00 0.00 ? 14  ASN A HB3  2  
ATOM 2426  H HD21 . ASN A 1 14  ? 9.279   5.454   5.600   1.00 0.00 ? 14  ASN A HD21 2  
ATOM 2427  H HD22 . ASN A 1 14  ? 8.392   5.805   7.004   1.00 0.00 ? 14  ASN A HD22 2  
ATOM 2428  N N    . PHE A 1 15  ? 9.218   7.619   1.009   1.00 0.00 ? 15  PHE A N    2  
ATOM 2429  C CA   . PHE A 1 15  ? 9.854   7.194   -0.295  1.00 0.00 ? 15  PHE A CA   2  
ATOM 2430  C C    . PHE A 1 15  ? 11.386  7.089   -0.172  1.00 0.00 ? 15  PHE A C    2  
ATOM 2431  O O    . PHE A 1 15  ? 11.975  6.092   -0.537  1.00 0.00 ? 15  PHE A O    2  
ATOM 2432  C CB   . PHE A 1 15  ? 9.504   8.217   -1.393  1.00 0.00 ? 15  PHE A CB   2  
ATOM 2433  C CG   . PHE A 1 15  ? 9.606   7.615   -2.801  1.00 0.00 ? 15  PHE A CG   2  
ATOM 2434  C CD1  . PHE A 1 15  ? 10.305  6.416   -3.051  1.00 0.00 ? 15  PHE A CD1  2  
ATOM 2435  C CD2  . PHE A 1 15  ? 9.000   8.286   -3.873  1.00 0.00 ? 15  PHE A CD2  2  
ATOM 2436  C CE1  . PHE A 1 15  ? 10.390  5.902   -4.344  1.00 0.00 ? 15  PHE A CE1  2  
ATOM 2437  C CE2  . PHE A 1 15  ? 9.092   7.767   -5.173  1.00 0.00 ? 15  PHE A CE2  2  
ATOM 2438  C CZ   . PHE A 1 15  ? 9.788   6.573   -5.404  1.00 0.00 ? 15  PHE A CZ   2  
ATOM 2439  H H    . PHE A 1 15  ? 8.515   8.296   0.995   1.00 0.00 ? 15  PHE A H    2  
ATOM 2440  H HA   . PHE A 1 15  ? 9.461   6.227   -0.578  1.00 0.00 ? 15  PHE A HA   2  
ATOM 2441  H HB2  . PHE A 1 15  ? 8.496   8.567   -1.236  1.00 0.00 ? 15  PHE A HB2  2  
ATOM 2442  H HB3  . PHE A 1 15  ? 10.182  9.055   -1.318  1.00 0.00 ? 15  PHE A HB3  2  
ATOM 2443  H HD1  . PHE A 1 15  ? 10.771  5.888   -2.249  1.00 0.00 ? 15  PHE A HD1  2  
ATOM 2444  H HD2  . PHE A 1 15  ? 8.461   9.205   -3.697  1.00 0.00 ? 15  PHE A HD2  2  
ATOM 2445  H HE1  . PHE A 1 15  ? 10.926  4.982   -4.524  1.00 0.00 ? 15  PHE A HE1  2  
ATOM 2446  H HE2  . PHE A 1 15  ? 8.623   8.286   -5.996  1.00 0.00 ? 15  PHE A HE2  2  
ATOM 2447  H HZ   . PHE A 1 15  ? 9.867   6.173   -6.402  1.00 0.00 ? 15  PHE A HZ   2  
ATOM 2448  N N    . GLU A 1 16  ? 12.035  8.092   0.334   1.00 0.00 ? 16  GLU A N    2  
ATOM 2449  C CA   . GLU A 1 16  ? 13.520  8.012   0.456   1.00 0.00 ? 16  GLU A CA   2  
ATOM 2450  C C    . GLU A 1 16  ? 13.878  6.952   1.488   1.00 0.00 ? 16  GLU A C    2  
ATOM 2451  O O    . GLU A 1 16  ? 14.845  6.229   1.333   1.00 0.00 ? 16  GLU A O    2  
ATOM 2452  C CB   . GLU A 1 16  ? 14.100  9.369   0.870   1.00 0.00 ? 16  GLU A CB   2  
ATOM 2453  C CG   . GLU A 1 16  ? 13.521  10.478  -0.019  1.00 0.00 ? 16  GLU A CG   2  
ATOM 2454  C CD   . GLU A 1 16  ? 12.422  11.226  0.739   1.00 0.00 ? 16  GLU A CD   2  
ATOM 2455  O OE1  . GLU A 1 16  ? 12.713  11.749  1.803   1.00 0.00 ? 16  GLU A OE1  2  
ATOM 2456  O OE2  . GLU A 1 16  ? 11.308  11.265  0.243   1.00 0.00 ? 16  GLU A OE2  2  
ATOM 2457  H H    . GLU A 1 16  ? 11.556  8.885   0.628   1.00 0.00 ? 16  GLU A H    2  
ATOM 2458  H HA   . GLU A 1 16  ? 13.926  7.706   -0.496  1.00 0.00 ? 16  GLU A HA   2  
ATOM 2459  H HB2  . GLU A 1 16  ? 13.851  9.565   1.903   1.00 0.00 ? 16  GLU A HB2  2  
ATOM 2460  H HB3  . GLU A 1 16  ? 15.174  9.348   0.759   1.00 0.00 ? 16  GLU A HB3  2  
ATOM 2461  H HG2  . GLU A 1 16  ? 14.307  11.168  -0.286  1.00 0.00 ? 16  GLU A HG2  2  
ATOM 2462  H HG3  . GLU A 1 16  ? 13.105  10.043  -0.915  1.00 0.00 ? 16  GLU A HG3  2  
ATOM 2463  N N    . GLU A 1 17  ? 13.090  6.830   2.522   1.00 0.00 ? 17  GLU A N    2  
ATOM 2464  C CA   . GLU A 1 17  ? 13.364  5.785   3.547   1.00 0.00 ? 17  GLU A CA   2  
ATOM 2465  C C    . GLU A 1 17  ? 13.286  4.402   2.881   1.00 0.00 ? 17  GLU A C    2  
ATOM 2466  O O    . GLU A 1 17  ? 13.856  3.444   3.358   1.00 0.00 ? 17  GLU A O    2  
ATOM 2467  C CB   . GLU A 1 17  ? 12.317  5.878   4.657   1.00 0.00 ? 17  GLU A CB   2  
ATOM 2468  C CG   . GLU A 1 17  ? 12.941  5.467   5.990   1.00 0.00 ? 17  GLU A CG   2  
ATOM 2469  C CD   . GLU A 1 17  ? 12.089  6.007   7.140   1.00 0.00 ? 17  GLU A CD   2  
ATOM 2470  O OE1  . GLU A 1 17  ? 12.020  7.217   7.283   1.00 0.00 ? 17  GLU A OE1  2  
ATOM 2471  O OE2  . GLU A 1 17  ? 11.520  5.202   7.859   1.00 0.00 ? 17  GLU A OE2  2  
ATOM 2472  H H    . GLU A 1 17  ? 12.304  7.408   2.610   1.00 0.00 ? 17  GLU A H    2  
ATOM 2473  H HA   . GLU A 1 17  ? 14.350  5.933   3.962   1.00 0.00 ? 17  GLU A HA   2  
ATOM 2474  H HB2  . GLU A 1 17  ? 11.955  6.894   4.725   1.00 0.00 ? 17  GLU A HB2  2  
ATOM 2475  H HB3  . GLU A 1 17  ? 11.498  5.218   4.427   1.00 0.00 ? 17  GLU A HB3  2  
ATOM 2476  H HG2  . GLU A 1 17  ? 12.984  4.389   6.048   1.00 0.00 ? 17  GLU A HG2  2  
ATOM 2477  H HG3  . GLU A 1 17  ? 13.937  5.873   6.062   1.00 0.00 ? 17  GLU A HG3  2  
ATOM 2478  N N    . LEU A 1 18  ? 12.586  4.305   1.773   1.00 0.00 ? 18  LEU A N    2  
ATOM 2479  C CA   . LEU A 1 18  ? 12.459  3.008   1.054   1.00 0.00 ? 18  LEU A CA   2  
ATOM 2480  C C    . LEU A 1 18  ? 13.747  2.709   0.329   1.00 0.00 ? 18  LEU A C    2  
ATOM 2481  O O    . LEU A 1 18  ? 14.287  1.624   0.427   1.00 0.00 ? 18  LEU A O    2  
ATOM 2482  C CB   . LEU A 1 18  ? 11.338  3.079   0.007   1.00 0.00 ? 18  LEU A CB   2  
ATOM 2483  C CG   . LEU A 1 18  ? 10.144  3.915   0.470   1.00 0.00 ? 18  LEU A CG   2  
ATOM 2484  C CD1  . LEU A 1 18  ? 8.994   3.682   -0.497  1.00 0.00 ? 18  LEU A CD1  2  
ATOM 2485  C CD2  . LEU A 1 18  ? 9.683   3.541   1.874   1.00 0.00 ? 18  LEU A CD2  2  
ATOM 2486  H H    . LEU A 1 18  ? 12.147  5.088   1.410   1.00 0.00 ? 18  LEU A H    2  
ATOM 2487  H HA   . LEU A 1 18  ? 12.256  2.224   1.754   1.00 0.00 ? 18  LEU A HA   2  
ATOM 2488  H HB2  . LEU A 1 18  ? 11.733  3.528   -0.893  1.00 0.00 ? 18  LEU A HB2  2  
ATOM 2489  H HB3  . LEU A 1 18  ? 11.005  2.085   -0.215  1.00 0.00 ? 18  LEU A HB3  2  
ATOM 2490  H HG   . LEU A 1 18  ? 10.416  4.941   0.450   1.00 0.00 ? 18  LEU A HG   2  
ATOM 2491  H HD11 . LEU A 1 18  ? 9.375   3.672   -1.507  1.00 0.00 ? 18  LEU A HD11 2  
ATOM 2492  H HD12 . LEU A 1 18  ? 8.531   2.731   -0.277  1.00 0.00 ? 18  LEU A HD12 2  
ATOM 2493  H HD13 . LEU A 1 18  ? 8.269   4.472   -0.389  1.00 0.00 ? 18  LEU A HD13 2  
ATOM 2494  H HD21 . LEU A 1 18  ? 10.535  3.302   2.491   1.00 0.00 ? 18  LEU A HD21 2  
ATOM 2495  H HD22 . LEU A 1 18  ? 9.154   4.374   2.306   1.00 0.00 ? 18  LEU A HD22 2  
ATOM 2496  H HD23 . LEU A 1 18  ? 9.026   2.690   1.816   1.00 0.00 ? 18  LEU A HD23 2  
ATOM 2497  N N    . LEU A 1 19  ? 14.249  3.666   -0.399  1.00 0.00 ? 19  LEU A N    2  
ATOM 2498  C CA   . LEU A 1 19  ? 15.512  3.432   -1.129  1.00 0.00 ? 19  LEU A CA   2  
ATOM 2499  C C    . LEU A 1 19  ? 16.713  3.633   -0.181  1.00 0.00 ? 19  LEU A C    2  
ATOM 2500  O O    . LEU A 1 19  ? 17.855  3.556   -0.589  1.00 0.00 ? 19  LEU A O    2  
ATOM 2501  C CB   . LEU A 1 19  ? 15.588  4.373   -2.346  1.00 0.00 ? 19  LEU A CB   2  
ATOM 2502  C CG   . LEU A 1 19  ? 14.315  4.259   -3.239  1.00 0.00 ? 19  LEU A CG   2  
ATOM 2503  C CD1  . LEU A 1 19  ? 13.692  2.849   -3.186  1.00 0.00 ? 19  LEU A CD1  2  
ATOM 2504  C CD2  . LEU A 1 19  ? 13.276  5.286   -2.781  1.00 0.00 ? 19  LEU A CD2  2  
ATOM 2505  H H    . LEU A 1 19  ? 13.795  4.532   -0.460  1.00 0.00 ? 19  LEU A H    2  
ATOM 2506  H HA   . LEU A 1 19  ? 15.503  2.415   -1.472  1.00 0.00 ? 19  LEU A HA   2  
ATOM 2507  H HB2  . LEU A 1 19  ? 15.684  5.391   -1.998  1.00 0.00 ? 19  LEU A HB2  2  
ATOM 2508  H HB3  . LEU A 1 19  ? 16.456  4.118   -2.935  1.00 0.00 ? 19  LEU A HB3  2  
ATOM 2509  H HG   . LEU A 1 19  ? 14.584  4.475   -4.261  1.00 0.00 ? 19  LEU A HG   2  
ATOM 2510  H HD11 . LEU A 1 19  ? 14.472  2.106   -3.254  1.00 0.00 ? 19  LEU A HD11 2  
ATOM 2511  H HD12 . LEU A 1 19  ? 13.160  2.725   -2.253  1.00 0.00 ? 19  LEU A HD12 2  
ATOM 2512  H HD13 . LEU A 1 19  ? 13.004  2.727   -4.009  1.00 0.00 ? 19  LEU A HD13 2  
ATOM 2513  H HD21 . LEU A 1 19  ? 13.741  6.005   -2.122  1.00 0.00 ? 19  LEU A HD21 2  
ATOM 2514  H HD22 . LEU A 1 19  ? 12.875  5.797   -3.644  1.00 0.00 ? 19  LEU A HD22 2  
ATOM 2515  H HD23 . LEU A 1 19  ? 12.476  4.783   -2.259  1.00 0.00 ? 19  LEU A HD23 2  
ATOM 2516  N N    . LYS A 1 20  ? 16.454  3.869   1.088   1.00 0.00 ? 20  LYS A N    2  
ATOM 2517  C CA   . LYS A 1 20  ? 17.540  4.051   2.082   1.00 0.00 ? 20  LYS A CA   2  
ATOM 2518  C C    . LYS A 1 20  ? 17.598  2.827   3.008   1.00 0.00 ? 20  LYS A C    2  
ATOM 2519  O O    . LYS A 1 20  ? 18.608  2.549   3.626   1.00 0.00 ? 20  LYS A O    2  
ATOM 2520  C CB   . LYS A 1 20  ? 17.218  5.283   2.923   1.00 0.00 ? 20  LYS A CB   2  
ATOM 2521  C CG   . LYS A 1 20  ? 17.846  6.516   2.284   1.00 0.00 ? 20  LYS A CG   2  
ATOM 2522  C CD   . LYS A 1 20  ? 17.980  7.626   3.329   1.00 0.00 ? 20  LYS A CD   2  
ATOM 2523  C CE   . LYS A 1 20  ? 18.677  8.835   2.704   1.00 0.00 ? 20  LYS A CE   2  
ATOM 2524  N NZ   . LYS A 1 20  ? 18.280  10.071  3.437   1.00 0.00 ? 20  LYS A NZ   2  
ATOM 2525  H H    . LYS A 1 20  ? 15.536  3.916   1.397   1.00 0.00 ? 20  LYS A H    2  
ATOM 2526  H HA   . LYS A 1 20  ? 18.480  4.179   1.580   1.00 0.00 ? 20  LYS A HA   2  
ATOM 2527  H HB2  . LYS A 1 20  ? 16.146  5.411   2.970   1.00 0.00 ? 20  LYS A HB2  2  
ATOM 2528  H HB3  . LYS A 1 20  ? 17.604  5.149   3.918   1.00 0.00 ? 20  LYS A HB3  2  
ATOM 2529  H HG2  . LYS A 1 20  ? 18.821  6.262   1.899   1.00 0.00 ? 20  LYS A HG2  2  
ATOM 2530  H HG3  . LYS A 1 20  ? 17.217  6.856   1.477   1.00 0.00 ? 20  LYS A HG3  2  
ATOM 2531  H HD2  . LYS A 1 20  ? 16.997  7.914   3.675   1.00 0.00 ? 20  LYS A HD2  2  
ATOM 2532  H HD3  . LYS A 1 20  ? 18.564  7.267   4.163   1.00 0.00 ? 20  LYS A HD3  2  
ATOM 2533  H HE2  . LYS A 1 20  ? 19.748  8.707   2.769   1.00 0.00 ? 20  LYS A HE2  2  
ATOM 2534  H HE3  . LYS A 1 20  ? 18.387  8.922   1.668   1.00 0.00 ? 20  LYS A HE3  2  
ATOM 2535  H HZ1  . LYS A 1 20  ? 18.389  9.918   4.460   1.00 0.00 ? 20  LYS A HZ1  2  
ATOM 2536  H HZ2  . LYS A 1 20  ? 18.887  10.861  3.137   1.00 0.00 ? 20  LYS A HZ2  2  
ATOM 2537  H HZ3  . LYS A 1 20  ? 17.288  10.295  3.227   1.00 0.00 ? 20  LYS A HZ3  2  
ATOM 2538  N N    . VAL A 1 21  ? 16.513  2.105   3.105   1.00 0.00 ? 21  VAL A N    2  
ATOM 2539  C CA   . VAL A 1 21  ? 16.461  0.909   3.975   1.00 0.00 ? 21  VAL A CA   2  
ATOM 2540  C C    . VAL A 1 21  ? 16.676  -0.331  3.118   1.00 0.00 ? 21  VAL A C    2  
ATOM 2541  O O    . VAL A 1 21  ? 17.214  -1.321  3.581   1.00 0.00 ? 21  VAL A O    2  
ATOM 2542  C CB   . VAL A 1 21  ? 15.098  0.842   4.668   1.00 0.00 ? 21  VAL A CB   2  
ATOM 2543  C CG1  . VAL A 1 21  ? 14.890  2.100   5.512   1.00 0.00 ? 21  VAL A CG1  2  
ATOM 2544  C CG2  . VAL A 1 21  ? 13.978  0.736   3.627   1.00 0.00 ? 21  VAL A CG2  2  
ATOM 2545  H H    . VAL A 1 21  ? 15.730  2.350   2.602   1.00 0.00 ? 21  VAL A H    2  
ATOM 2546  H HA   . VAL A 1 21  ? 17.242  0.971   4.717   1.00 0.00 ? 21  VAL A HA   2  
ATOM 2547  H HB   . VAL A 1 21  ? 15.071  -0.019  5.305   1.00 0.00 ? 21  VAL A HB   2  
ATOM 2548  H HG11 . VAL A 1 21  ? 15.442  2.920   5.077   1.00 0.00 ? 21  VAL A HG11 2  
ATOM 2549  H HG12 . VAL A 1 21  ? 13.839  2.346   5.537   1.00 0.00 ? 21  VAL A HG12 2  
ATOM 2550  H HG13 . VAL A 1 21  ? 15.242  1.921   6.517   1.00 0.00 ? 21  VAL A HG13 2  
ATOM 2551  H HG21 . VAL A 1 21  ? 14.358  1.008   2.654   1.00 0.00 ? 21  VAL A HG21 2  
ATOM 2552  H HG22 . VAL A 1 21  ? 13.617  -0.280  3.595   1.00 0.00 ? 21  VAL A HG22 2  
ATOM 2553  H HG23 . VAL A 1 21  ? 13.169  1.397   3.893   1.00 0.00 ? 21  VAL A HG23 2  
ATOM 2554  N N    . LEU A 1 22  ? 16.298  -0.280  1.851   1.00 0.00 ? 22  LEU A N    2  
ATOM 2555  C CA   . LEU A 1 22  ? 16.536  -1.458  0.961   1.00 0.00 ? 22  LEU A CA   2  
ATOM 2556  C C    . LEU A 1 22  ? 18.031  -1.793  1.013   1.00 0.00 ? 22  LEU A C    2  
ATOM 2557  O O    . LEU A 1 22  ? 18.440  -2.917  0.791   1.00 0.00 ? 22  LEU A O    2  
ATOM 2558  C CB   . LEU A 1 22  ? 16.078  -1.166  -0.495  1.00 0.00 ? 22  LEU A CB   2  
ATOM 2559  C CG   . LEU A 1 22  ? 16.735  0.081   -1.117  1.00 0.00 ? 22  LEU A CG   2  
ATOM 2560  C CD1  . LEU A 1 22  ? 18.235  -0.133  -1.373  1.00 0.00 ? 22  LEU A CD1  2  
ATOM 2561  C CD2  . LEU A 1 22  ? 16.050  0.341   -2.462  1.00 0.00 ? 22  LEU A CD2  2  
ATOM 2562  H H    . LEU A 1 22  ? 15.897  0.535   1.490   1.00 0.00 ? 22  LEU A H    2  
ATOM 2563  H HA   . LEU A 1 22  ? 15.977  -2.307  1.345   1.00 0.00 ? 22  LEU A HA   2  
ATOM 2564  H HB2  . LEU A 1 22  ? 16.308  -2.012  -1.115  1.00 0.00 ? 22  LEU A HB2  2  
ATOM 2565  H HB3  . LEU A 1 22  ? 15.005  -1.017  -0.495  1.00 0.00 ? 22  LEU A HB3  2  
ATOM 2566  H HG   . LEU A 1 22  ? 16.592  0.932   -0.469  1.00 0.00 ? 22  LEU A HG   2  
ATOM 2567  H HD11 . LEU A 1 22  ? 18.463  -1.186  -1.329  1.00 0.00 ? 22  LEU A HD11 2  
ATOM 2568  H HD12 . LEU A 1 22  ? 18.495  0.250   -2.349  1.00 0.00 ? 22  LEU A HD12 2  
ATOM 2569  H HD13 . LEU A 1 22  ? 18.805  0.394   -0.625  1.00 0.00 ? 22  LEU A HD13 2  
ATOM 2570  H HD21 . LEU A 1 22  ? 14.983  0.420   -2.312  1.00 0.00 ? 22  LEU A HD21 2  
ATOM 2571  H HD22 . LEU A 1 22  ? 16.424  1.262   -2.884  1.00 0.00 ? 22  LEU A HD22 2  
ATOM 2572  H HD23 . LEU A 1 22  ? 16.260  -0.476  -3.136  1.00 0.00 ? 22  LEU A HD23 2  
ATOM 2573  N N    . GLY A 1 23  ? 18.843  -0.807  1.329   1.00 0.00 ? 23  GLY A N    2  
ATOM 2574  C CA   . GLY A 1 23  ? 20.295  -1.030  1.428   1.00 0.00 ? 23  GLY A CA   2  
ATOM 2575  C C    . GLY A 1 23  ? 21.025  0.029   0.624   1.00 0.00 ? 23  GLY A C    2  
ATOM 2576  O O    . GLY A 1 23  ? 21.506  -0.227  -0.463  1.00 0.00 ? 23  GLY A O    2  
ATOM 2577  H H    . GLY A 1 23  ? 18.487  0.089   1.511   1.00 0.00 ? 23  GLY A H    2  
ATOM 2578  H HA2  . GLY A 1 23  ? 20.591  -0.960  2.465   1.00 0.00 ? 23  GLY A HA2  2  
ATOM 2579  H HA3  . GLY A 1 23  ? 20.532  -1.996  1.042   1.00 0.00 ? 23  GLY A HA3  2  
ATOM 2580  N N    . VAL A 1 24  ? 21.102  1.225   1.153   1.00 0.00 ? 24  VAL A N    2  
ATOM 2581  C CA   . VAL A 1 24  ? 21.799  2.343   0.436   1.00 0.00 ? 24  VAL A CA   2  
ATOM 2582  C C    . VAL A 1 24  ? 23.164  1.868   -0.112  1.00 0.00 ? 24  VAL A C    2  
ATOM 2583  O O    . VAL A 1 24  ? 23.892  1.135   0.529   1.00 0.00 ? 24  VAL A O    2  
ATOM 2584  C CB   . VAL A 1 24  ? 21.936  3.550   1.413   1.00 0.00 ? 24  VAL A CB   2  
ATOM 2585  C CG1  . VAL A 1 24  ? 23.402  3.872   1.772   1.00 0.00 ? 24  VAL A CG1  2  
ATOM 2586  C CG2  . VAL A 1 24  ? 21.312  4.793   0.771   1.00 0.00 ? 24  VAL A CG2  2  
ATOM 2587  H H    . VAL A 1 24  ? 20.681  1.392   2.028   1.00 0.00 ? 24  VAL A H    2  
ATOM 2588  H HA   . VAL A 1 24  ? 21.184  2.641   -0.402  1.00 0.00 ? 24  VAL A HA   2  
ATOM 2589  H HB   . VAL A 1 24  ? 21.398  3.317   2.321   1.00 0.00 ? 24  VAL A HB   2  
ATOM 2590  H HG11 . VAL A 1 24  ? 23.900  2.971   2.098   1.00 0.00 ? 24  VAL A HG11 2  
ATOM 2591  H HG12 . VAL A 1 24  ? 23.906  4.266   0.901   1.00 0.00 ? 24  VAL A HG12 2  
ATOM 2592  H HG13 . VAL A 1 24  ? 23.427  4.606   2.564   1.00 0.00 ? 24  VAL A HG13 2  
ATOM 2593  H HG21 . VAL A 1 24  ? 21.448  4.751   -0.300  1.00 0.00 ? 24  VAL A HG21 2  
ATOM 2594  H HG22 . VAL A 1 24  ? 20.259  4.827   0.998   1.00 0.00 ? 24  VAL A HG22 2  
ATOM 2595  H HG23 . VAL A 1 24  ? 21.793  5.679   1.159   1.00 0.00 ? 24  VAL A HG23 2  
ATOM 2596  N N    . ASN A 1 25  ? 23.486  2.296   -1.294  1.00 0.00 ? 25  ASN A N    2  
ATOM 2597  C CA   . ASN A 1 25  ? 24.773  1.910   -1.940  1.00 0.00 ? 25  ASN A CA   2  
ATOM 2598  C C    . ASN A 1 25  ? 24.797  2.600   -3.294  1.00 0.00 ? 25  ASN A C    2  
ATOM 2599  O O    . ASN A 1 25  ? 24.639  1.977   -4.324  1.00 0.00 ? 25  ASN A O    2  
ATOM 2600  C CB   . ASN A 1 25  ? 24.842  0.390   -2.119  1.00 0.00 ? 25  ASN A CB   2  
ATOM 2601  C CG   . ASN A 1 25  ? 26.305  -0.041  -2.245  1.00 0.00 ? 25  ASN A CG   2  
ATOM 2602  O OD1  . ASN A 1 25  ? 27.109  0.662   -2.824  1.00 0.00 ? 25  ASN A OD1  2  
ATOM 2603  N ND2  . ASN A 1 25  ? 26.687  -1.174  -1.724  1.00 0.00 ? 25  ASN A ND2  2  
ATOM 2604  H H    . ASN A 1 25  ? 22.866  2.889   -1.774  1.00 0.00 ? 25  ASN A H    2  
ATOM 2605  H HA   . ASN A 1 25  ? 25.604  2.255   -1.342  1.00 0.00 ? 25  ASN A HA   2  
ATOM 2606  H HB2  . ASN A 1 25  ? 24.395  -0.096  -1.265  1.00 0.00 ? 25  ASN A HB2  2  
ATOM 2607  H HB3  . ASN A 1 25  ? 24.309  0.108   -3.014  1.00 0.00 ? 25  ASN A HB3  2  
ATOM 2608  H HD21 . ASN A 1 25  ? 26.039  -1.742  -1.257  1.00 0.00 ? 25  ASN A HD21 2  
ATOM 2609  H HD22 . ASN A 1 25  ? 27.622  -1.458  -1.799  1.00 0.00 ? 25  ASN A HD22 2  
ATOM 2610  N N    . VAL A 1 26  ? 24.929  3.907   -3.262  1.00 0.00 ? 26  VAL A N    2  
ATOM 2611  C CA   . VAL A 1 26  ? 24.906  4.764   -4.493  1.00 0.00 ? 26  VAL A CA   2  
ATOM 2612  C C    . VAL A 1 26  ? 23.458  5.149   -4.814  1.00 0.00 ? 26  VAL A C    2  
ATOM 2613  O O    . VAL A 1 26  ? 23.217  6.055   -5.590  1.00 0.00 ? 26  VAL A O    2  
ATOM 2614  C CB   . VAL A 1 26  ? 25.543  4.082   -5.715  1.00 0.00 ? 26  VAL A CB   2  
ATOM 2615  C CG1  . VAL A 1 26  ? 25.638  5.093   -6.855  1.00 0.00 ? 26  VAL A CG1  2  
ATOM 2616  C CG2  . VAL A 1 26  ? 26.944  3.583   -5.353  1.00 0.00 ? 26  VAL A CG2  2  
ATOM 2617  H H    . VAL A 1 26  ? 25.001  4.349   -2.389  1.00 0.00 ? 26  VAL A H    2  
ATOM 2618  H HA   . VAL A 1 26  ? 25.448  5.674   -4.272  1.00 0.00 ? 26  VAL A HA   2  
ATOM 2619  H HB   . VAL A 1 26  ? 24.929  3.254   -6.033  1.00 0.00 ? 26  VAL A HB   2  
ATOM 2620  H HG11 . VAL A 1 26  ? 25.805  6.078   -6.447  1.00 0.00 ? 26  VAL A HG11 2  
ATOM 2621  H HG12 . VAL A 1 26  ? 26.455  4.826   -7.506  1.00 0.00 ? 26  VAL A HG12 2  
ATOM 2622  H HG13 . VAL A 1 26  ? 24.713  5.087   -7.414  1.00 0.00 ? 26  VAL A HG13 2  
ATOM 2623  H HG21 . VAL A 1 26  ? 27.426  4.302   -4.708  1.00 0.00 ? 26  VAL A HG21 2  
ATOM 2624  H HG22 . VAL A 1 26  ? 26.867  2.635   -4.843  1.00 0.00 ? 26  VAL A HG22 2  
ATOM 2625  H HG23 . VAL A 1 26  ? 27.526  3.461   -6.255  1.00 0.00 ? 26  VAL A HG23 2  
ATOM 2626  N N    . MET A 1 27  ? 22.485  4.505   -4.196  1.00 0.00 ? 27  MET A N    2  
ATOM 2627  C CA   . MET A 1 27  ? 21.070  4.877   -4.438  1.00 0.00 ? 27  MET A CA   2  
ATOM 2628  C C    . MET A 1 27  ? 20.900  6.294   -3.906  1.00 0.00 ? 27  MET A C    2  
ATOM 2629  O O    . MET A 1 27  ? 20.653  7.221   -4.652  1.00 0.00 ? 27  MET A O    2  
ATOM 2630  C CB   . MET A 1 27  ? 20.151  3.922   -3.668  1.00 0.00 ? 27  MET A CB   2  
ATOM 2631  C CG   . MET A 1 27  ? 20.521  2.462   -3.977  1.00 0.00 ? 27  MET A CG   2  
ATOM 2632  S SD   . MET A 1 27  ? 19.320  1.748   -5.133  1.00 0.00 ? 27  MET A SD   2  
ATOM 2633  C CE   . MET A 1 27  ? 20.331  0.347   -5.672  1.00 0.00 ? 27  MET A CE   2  
ATOM 2634  H H    . MET A 1 27  ? 22.684  3.805   -3.551  1.00 0.00 ? 27  MET A H    2  
ATOM 2635  H HA   . MET A 1 27  ? 20.845  4.845   -5.498  1.00 0.00 ? 27  MET A HA   2  
ATOM 2636  H HB2  . MET A 1 27  ? 20.260  4.101   -2.608  1.00 0.00 ? 27  MET A HB2  2  
ATOM 2637  H HB3  . MET A 1 27  ? 19.131  4.105   -3.955  1.00 0.00 ? 27  MET A HB3  2  
ATOM 2638  H HG2  . MET A 1 27  ? 21.505  2.420   -4.416  1.00 0.00 ? 27  MET A HG2  2  
ATOM 2639  H HG3  . MET A 1 27  ? 20.517  1.892   -3.059  1.00 0.00 ? 27  MET A HG3  2  
ATOM 2640  H HE1  . MET A 1 27  ? 20.869  -0.055  -4.824  1.00 0.00 ? 27  MET A HE1  2  
ATOM 2641  H HE2  . MET A 1 27  ? 19.691  -0.415  -6.095  1.00 0.00 ? 27  MET A HE2  2  
ATOM 2642  H HE3  . MET A 1 27  ? 21.036  0.676   -6.418  1.00 0.00 ? 27  MET A HE3  2  
ATOM 2643  N N    . LEU A 1 28  ? 21.082  6.469   -2.611  1.00 0.00 ? 28  LEU A N    2  
ATOM 2644  C CA   . LEU A 1 28  ? 20.985  7.831   -1.996  1.00 0.00 ? 28  LEU A CA   2  
ATOM 2645  C C    . LEU A 1 28  ? 19.721  8.539   -2.495  1.00 0.00 ? 28  LEU A C    2  
ATOM 2646  O O    . LEU A 1 28  ? 19.787  9.433   -3.316  1.00 0.00 ? 28  LEU A O    2  
ATOM 2647  C CB   . LEU A 1 28  ? 22.241  8.613   -2.399  1.00 0.00 ? 28  LEU A CB   2  
ATOM 2648  C CG   . LEU A 1 28  ? 23.184  8.780   -1.195  1.00 0.00 ? 28  LEU A CG   2  
ATOM 2649  C CD1  . LEU A 1 28  ? 22.469  9.527   -0.066  1.00 0.00 ? 28  LEU A CD1  2  
ATOM 2650  C CD2  . LEU A 1 28  ? 23.628  7.403   -0.692  1.00 0.00 ? 28  LEU A CD2  2  
ATOM 2651  H H    . LEU A 1 28  ? 21.315  5.702   -2.048  1.00 0.00 ? 28  LEU A H    2  
ATOM 2652  H HA   . LEU A 1 28  ? 20.947  7.746   -0.929  1.00 0.00 ? 28  LEU A HA   2  
ATOM 2653  H HB2  . LEU A 1 28  ? 22.759  8.067   -3.179  1.00 0.00 ? 28  LEU A HB2  2  
ATOM 2654  H HB3  . LEU A 1 28  ? 21.958  9.579   -2.768  1.00 0.00 ? 28  LEU A HB3  2  
ATOM 2655  H HG   . LEU A 1 28  ? 24.052  9.347   -1.501  1.00 0.00 ? 28  LEU A HG   2  
ATOM 2656  H HD11 . LEU A 1 28  ? 21.750  10.213  -0.487  1.00 0.00 ? 28  LEU A HD11 2  
ATOM 2657  H HD12 . LEU A 1 28  ? 21.961  8.817   0.569   1.00 0.00 ? 28  LEU A HD12 2  
ATOM 2658  H HD13 . LEU A 1 28  ? 23.194  10.077  0.517   1.00 0.00 ? 28  LEU A HD13 2  
ATOM 2659  H HD21 . LEU A 1 28  ? 22.759  6.782   -0.529  1.00 0.00 ? 28  LEU A HD21 2  
ATOM 2660  H HD22 . LEU A 1 28  ? 24.268  6.939   -1.429  1.00 0.00 ? 28  LEU A HD22 2  
ATOM 2661  H HD23 . LEU A 1 28  ? 24.170  7.516   0.235   1.00 0.00 ? 28  LEU A HD23 2  
ATOM 2662  N N    . ARG A 1 29  ? 18.566  8.098   -2.050  1.00 0.00 ? 29  ARG A N    2  
ATOM 2663  C CA   . ARG A 1 29  ? 17.290  8.694   -2.556  1.00 0.00 ? 29  ARG A CA   2  
ATOM 2664  C C    . ARG A 1 29  ? 17.224  8.445   -4.075  1.00 0.00 ? 29  ARG A C    2  
ATOM 2665  O O    . ARG A 1 29  ? 16.555  9.148   -4.804  1.00 0.00 ? 29  ARG A O    2  
ATOM 2666  C CB   . ARG A 1 29  ? 17.267  10.202  -2.275  1.00 0.00 ? 29  ARG A CB   2  
ATOM 2667  C CG   . ARG A 1 29  ? 15.847  10.742  -2.468  1.00 0.00 ? 29  ARG A CG   2  
ATOM 2668  C CD   . ARG A 1 29  ? 15.788  12.199  -2.003  1.00 0.00 ? 29  ARG A CD   2  
ATOM 2669  N NE   . ARG A 1 29  ? 16.469  13.068  -3.003  1.00 0.00 ? 29  ARG A NE   2  
ATOM 2670  C CZ   . ARG A 1 29  ? 17.384  13.914  -2.616  1.00 0.00 ? 29  ARG A CZ   2  
ATOM 2671  N NH1  . ARG A 1 29  ? 18.491  13.479  -2.081  1.00 0.00 ? 29  ARG A NH1  2  
ATOM 2672  N NH2  . ARG A 1 29  ? 17.190  15.197  -2.763  1.00 0.00 ? 29  ARG A NH2  2  
ATOM 2673  H H    . ARG A 1 29  ? 18.538  7.344   -1.424  1.00 0.00 ? 29  ARG A H    2  
ATOM 2674  H HA   . ARG A 1 29  ? 16.448  8.217   -2.073  1.00 0.00 ? 29  ARG A HA   2  
ATOM 2675  H HB2  . ARG A 1 29  ? 17.585  10.382  -1.259  1.00 0.00 ? 29  ARG A HB2  2  
ATOM 2676  H HB3  . ARG A 1 29  ? 17.936  10.705  -2.957  1.00 0.00 ? 29  ARG A HB3  2  
ATOM 2677  H HG2  . ARG A 1 29  ? 15.579  10.686  -3.512  1.00 0.00 ? 29  ARG A HG2  2  
ATOM 2678  H HG3  . ARG A 1 29  ? 15.155  10.152  -1.885  1.00 0.00 ? 29  ARG A HG3  2  
ATOM 2679  H HD2  . ARG A 1 29  ? 14.756  12.503  -1.905  1.00 0.00 ? 29  ARG A HD2  2  
ATOM 2680  H HD3  . ARG A 1 29  ? 16.283  12.292  -1.048  1.00 0.00 ? 29  ARG A HD3  2  
ATOM 2681  H HE   . ARG A 1 29  ? 16.230  13.005  -3.952  1.00 0.00 ? 29  ARG A HE   2  
ATOM 2682  H HH11 . ARG A 1 29  ? 18.639  12.497  -1.968  1.00 0.00 ? 29  ARG A HH11 2  
ATOM 2683  H HH12 . ARG A 1 29  ? 19.192  14.128  -1.784  1.00 0.00 ? 29  ARG A HH12 2  
ATOM 2684  H HH21 . ARG A 1 29  ? 16.342  15.531  -3.173  1.00 0.00 ? 29  ARG A HH21 2  
ATOM 2685  H HH22 . ARG A 1 29  ? 17.891  15.845  -2.465  1.00 0.00 ? 29  ARG A HH22 2  
ATOM 2686  N N    . LYS A 1 30  ? 17.958  7.449   -4.549  1.00 0.00 ? 30  LYS A N    2  
ATOM 2687  C CA   . LYS A 1 30  ? 18.015  7.111   -6.006  1.00 0.00 ? 30  LYS A CA   2  
ATOM 2688  C C    . LYS A 1 30  ? 18.132  8.373   -6.873  1.00 0.00 ? 30  LYS A C    2  
ATOM 2689  O O    . LYS A 1 30  ? 17.764  8.364   -8.031  1.00 0.00 ? 30  LYS A O    2  
ATOM 2690  C CB   . LYS A 1 30  ? 16.780  6.295   -6.397  1.00 0.00 ? 30  LYS A CB   2  
ATOM 2691  C CG   . LYS A 1 30  ? 17.184  4.828   -6.587  1.00 0.00 ? 30  LYS A CG   2  
ATOM 2692  C CD   . LYS A 1 30  ? 15.990  4.030   -7.117  1.00 0.00 ? 30  LYS A CD   2  
ATOM 2693  C CE   . LYS A 1 30  ? 16.315  2.536   -7.074  1.00 0.00 ? 30  LYS A CE   2  
ATOM 2694  N NZ   . LYS A 1 30  ? 15.626  1.845   -8.200  1.00 0.00 ? 30  LYS A NZ   2  
ATOM 2695  H H    . LYS A 1 30  ? 18.496  6.918   -3.932  1.00 0.00 ? 30  LYS A H    2  
ATOM 2696  H HA   . LYS A 1 30  ? 18.891  6.511   -6.174  1.00 0.00 ? 30  LYS A HA   2  
ATOM 2697  H HB2  . LYS A 1 30  ? 16.043  6.364   -5.613  1.00 0.00 ? 30  LYS A HB2  2  
ATOM 2698  H HB3  . LYS A 1 30  ? 16.367  6.676   -7.319  1.00 0.00 ? 30  LYS A HB3  2  
ATOM 2699  H HG2  . LYS A 1 30  ? 18.001  4.770   -7.292  1.00 0.00 ? 30  LYS A HG2  2  
ATOM 2700  H HG3  . LYS A 1 30  ? 17.501  4.417   -5.640  1.00 0.00 ? 30  LYS A HG3  2  
ATOM 2701  H HD2  . LYS A 1 30  ? 15.124  4.229   -6.503  1.00 0.00 ? 30  LYS A HD2  2  
ATOM 2702  H HD3  . LYS A 1 30  ? 15.785  4.323   -8.136  1.00 0.00 ? 30  LYS A HD3  2  
ATOM 2703  H HE2  . LYS A 1 30  ? 17.382  2.397   -7.165  1.00 0.00 ? 30  LYS A HE2  2  
ATOM 2704  H HE3  . LYS A 1 30  ? 15.977  2.121   -6.136  1.00 0.00 ? 30  LYS A HE3  2  
ATOM 2705  H HZ1  . LYS A 1 30  ? 14.663  2.227   -8.303  1.00 0.00 ? 30  LYS A HZ1  2  
ATOM 2706  H HZ2  . LYS A 1 30  ? 16.157  2.001   -9.080  1.00 0.00 ? 30  LYS A HZ2  2  
ATOM 2707  H HZ3  . LYS A 1 30  ? 15.577  0.826   -8.004  1.00 0.00 ? 30  LYS A HZ3  2  
ATOM 2708  N N    . ILE A 1 31  ? 18.685  9.437   -6.313  1.00 0.00 ? 31  ILE A N    2  
ATOM 2709  C CA   . ILE A 1 31  ? 18.897  10.732  -7.047  1.00 0.00 ? 31  ILE A CA   2  
ATOM 2710  C C    . ILE A 1 31  ? 17.800  10.998  -8.092  1.00 0.00 ? 31  ILE A C    2  
ATOM 2711  O O    . ILE A 1 31  ? 18.058  11.508  -9.166  1.00 0.00 ? 31  ILE A O    2  
ATOM 2712  C CB   . ILE A 1 31  ? 20.272  10.685  -7.708  1.00 0.00 ? 31  ILE A CB   2  
ATOM 2713  C CG1  . ILE A 1 31  ? 21.334  10.306  -6.651  1.00 0.00 ? 31  ILE A CG1  2  
ATOM 2714  C CG2  . ILE A 1 31  ? 20.599  12.052  -8.310  1.00 0.00 ? 31  ILE A CG2  2  
ATOM 2715  C CD1  . ILE A 1 31  ? 21.392  11.368  -5.542  1.00 0.00 ? 31  ILE A CD1  2  
ATOM 2716  H H    . ILE A 1 31  ? 18.999  9.377   -5.394  1.00 0.00 ? 31  ILE A H    2  
ATOM 2717  H HA   . ILE A 1 31  ? 18.892  11.537  -6.333  1.00 0.00 ? 31  ILE A HA   2  
ATOM 2718  H HB   . ILE A 1 31  ? 20.262  9.945   -8.488  1.00 0.00 ? 31  ILE A HB   2  
ATOM 2719  H HG12 . ILE A 1 31  ? 21.074  9.352   -6.210  1.00 0.00 ? 31  ILE A HG12 2  
ATOM 2720  H HG13 . ILE A 1 31  ? 22.301  10.229  -7.121  1.00 0.00 ? 31  ILE A HG13 2  
ATOM 2721  H HG21 . ILE A 1 31  ? 20.139  12.825  -7.713  1.00 0.00 ? 31  ILE A HG21 2  
ATOM 2722  H HG22 . ILE A 1 31  ? 21.669  12.192  -8.319  1.00 0.00 ? 31  ILE A HG22 2  
ATOM 2723  H HG23 . ILE A 1 31  ? 20.219  12.100  -9.319  1.00 0.00 ? 31  ILE A HG23 2  
ATOM 2724  H HD11 . ILE A 1 31  ? 20.800  12.225  -5.829  1.00 0.00 ? 31  ILE A HD11 2  
ATOM 2725  H HD12 . ILE A 1 31  ? 21.002  10.951  -4.625  1.00 0.00 ? 31  ILE A HD12 2  
ATOM 2726  H HD13 . ILE A 1 31  ? 22.416  11.674  -5.391  1.00 0.00 ? 31  ILE A HD13 2  
ATOM 2727  N N    . ALA A 1 32  ? 16.578  10.645  -7.776  1.00 0.00 ? 32  ALA A N    2  
ATOM 2728  C CA   . ALA A 1 32  ? 15.457  10.862  -8.734  1.00 0.00 ? 32  ALA A CA   2  
ATOM 2729  C C    . ALA A 1 32  ? 14.121  10.783  -7.989  1.00 0.00 ? 32  ALA A C    2  
ATOM 2730  O O    . ALA A 1 32  ? 13.235  11.584  -8.213  1.00 0.00 ? 32  ALA A O    2  
ATOM 2731  C CB   . ALA A 1 32  ? 15.499  9.784   -9.819  1.00 0.00 ? 32  ALA A CB   2  
ATOM 2732  H H    . ALA A 1 32  ? 16.402  10.233  -6.905  1.00 0.00 ? 32  ALA A H    2  
ATOM 2733  H HA   . ALA A 1 32  ? 15.556  11.835  -9.191  1.00 0.00 ? 32  ALA A HA   2  
ATOM 2734  H HB1  . ALA A 1 32  ? 15.860  8.859   -9.393  1.00 0.00 ? 32  ALA A HB1  2  
ATOM 2735  H HB2  . ALA A 1 32  ? 14.506  9.634   -10.216 1.00 0.00 ? 32  ALA A HB2  2  
ATOM 2736  H HB3  . ALA A 1 32  ? 16.161  10.097  -10.612 1.00 0.00 ? 32  ALA A HB3  2  
ATOM 2737  N N    . VAL A 1 33  ? 13.972  9.821   -7.110  1.00 0.00 ? 33  VAL A N    2  
ATOM 2738  C CA   . VAL A 1 33  ? 12.692  9.683   -6.351  1.00 0.00 ? 33  VAL A CA   2  
ATOM 2739  C C    . VAL A 1 33  ? 12.519  10.873  -5.399  1.00 0.00 ? 33  VAL A C    2  
ATOM 2740  O O    . VAL A 1 33  ? 12.932  10.833  -4.256  1.00 0.00 ? 33  VAL A O    2  
ATOM 2741  C CB   . VAL A 1 33  ? 12.690  8.374   -5.548  1.00 0.00 ? 33  VAL A CB   2  
ATOM 2742  C CG1  . VAL A 1 33  ? 12.486  7.191   -6.494  1.00 0.00 ? 33  VAL A CG1  2  
ATOM 2743  C CG2  . VAL A 1 33  ? 14.017  8.192   -4.807  1.00 0.00 ? 33  VAL A CG2  2  
ATOM 2744  H H    . VAL A 1 33  ? 14.700  9.186   -6.954  1.00 0.00 ? 33  VAL A H    2  
ATOM 2745  H HA   . VAL A 1 33  ? 11.870  9.668   -7.048  1.00 0.00 ? 33  VAL A HA   2  
ATOM 2746  H HB   . VAL A 1 33  ? 11.884  8.400   -4.836  1.00 0.00 ? 33  VAL A HB   2  
ATOM 2747  H HG11 . VAL A 1 33  ? 11.625  7.376   -7.119  1.00 0.00 ? 33  VAL A HG11 2  
ATOM 2748  H HG12 . VAL A 1 33  ? 13.361  7.069   -7.111  1.00 0.00 ? 33  VAL A HG12 2  
ATOM 2749  H HG13 . VAL A 1 33  ? 12.324  6.293   -5.915  1.00 0.00 ? 33  VAL A HG13 2  
ATOM 2750  H HG21 . VAL A 1 33  ? 14.333  9.135   -4.390  1.00 0.00 ? 33  VAL A HG21 2  
ATOM 2751  H HG22 . VAL A 1 33  ? 13.891  7.471   -4.014  1.00 0.00 ? 33  VAL A HG22 2  
ATOM 2752  H HG23 . VAL A 1 33  ? 14.765  7.838   -5.498  1.00 0.00 ? 33  VAL A HG23 2  
ATOM 2753  N N    . ALA A 1 34  ? 11.903  11.934  -5.864  1.00 0.00 ? 34  ALA A N    2  
ATOM 2754  C CA   . ALA A 1 34  ? 11.691  13.135  -4.997  1.00 0.00 ? 34  ALA A CA   2  
ATOM 2755  C C    . ALA A 1 34  ? 11.022  14.242  -5.817  1.00 0.00 ? 34  ALA A C    2  
ATOM 2756  O O    . ALA A 1 34  ? 11.347  15.407  -5.686  1.00 0.00 ? 34  ALA A O    2  
ATOM 2757  C CB   . ALA A 1 34  ? 13.040  13.640  -4.468  1.00 0.00 ? 34  ALA A CB   2  
ATOM 2758  H H    . ALA A 1 34  ? 11.574  11.939  -6.787  1.00 0.00 ? 34  ALA A H    2  
ATOM 2759  H HA   . ALA A 1 34  ? 11.055  12.869  -4.165  1.00 0.00 ? 34  ALA A HA   2  
ATOM 2760  H HB1  . ALA A 1 34  ? 13.785  13.557  -5.245  1.00 0.00 ? 34  ALA A HB1  2  
ATOM 2761  H HB2  . ALA A 1 34  ? 12.945  14.673  -4.169  1.00 0.00 ? 34  ALA A HB2  2  
ATOM 2762  H HB3  . ALA A 1 34  ? 13.339  13.045  -3.618  1.00 0.00 ? 34  ALA A HB3  2  
ATOM 2763  N N    . ALA A 1 35  ? 10.090  13.884  -6.666  1.00 0.00 ? 35  ALA A N    2  
ATOM 2764  C CA   . ALA A 1 35  ? 9.397   14.908  -7.502  1.00 0.00 ? 35  ALA A CA   2  
ATOM 2765  C C    . ALA A 1 35  ? 8.125   15.377  -6.793  1.00 0.00 ? 35  ALA A C    2  
ATOM 2766  O O    . ALA A 1 35  ? 7.744   14.845  -5.766  1.00 0.00 ? 35  ALA A O    2  
ATOM 2767  C CB   . ALA A 1 35  ? 9.030   14.297  -8.856  1.00 0.00 ? 35  ALA A CB   2  
ATOM 2768  H H    . ALA A 1 35  ? 9.848   12.938  -6.753  1.00 0.00 ? 35  ALA A H    2  
ATOM 2769  H HA   . ALA A 1 35  ? 10.054  15.751  -7.654  1.00 0.00 ? 35  ALA A HA   2  
ATOM 2770  H HB1  . ALA A 1 35  ? 8.614   13.312  -8.705  1.00 0.00 ? 35  ALA A HB1  2  
ATOM 2771  H HB2  . ALA A 1 35  ? 8.301   14.924  -9.347  1.00 0.00 ? 35  ALA A HB2  2  
ATOM 2772  H HB3  . ALA A 1 35  ? 9.915   14.225  -9.470  1.00 0.00 ? 35  ALA A HB3  2  
ATOM 2773  N N    . ALA A 1 36  ? 7.466   16.369  -7.336  1.00 0.00 ? 36  ALA A N    2  
ATOM 2774  C CA   . ALA A 1 36  ? 6.216   16.883  -6.704  1.00 0.00 ? 36  ALA A CA   2  
ATOM 2775  C C    . ALA A 1 36  ? 5.012   16.493  -7.565  1.00 0.00 ? 36  ALA A C    2  
ATOM 2776  O O    . ALA A 1 36  ? 4.638   17.204  -8.479  1.00 0.00 ? 36  ALA A O    2  
ATOM 2777  C CB   . ALA A 1 36  ? 6.291   18.407  -6.592  1.00 0.00 ? 36  ALA A CB   2  
ATOM 2778  H H    . ALA A 1 36  ? 7.797   16.777  -8.163  1.00 0.00 ? 36  ALA A H    2  
ATOM 2779  H HA   . ALA A 1 36  ? 6.107   16.454  -5.719  1.00 0.00 ? 36  ALA A HA   2  
ATOM 2780  H HB1  . ALA A 1 36  ? 6.912   18.796  -7.385  1.00 0.00 ? 36  ALA A HB1  2  
ATOM 2781  H HB2  . ALA A 1 36  ? 5.298   18.824  -6.675  1.00 0.00 ? 36  ALA A HB2  2  
ATOM 2782  H HB3  . ALA A 1 36  ? 6.716   18.677  -5.637  1.00 0.00 ? 36  ALA A HB3  2  
ATOM 2783  N N    . SER A 1 37  ? 4.405   15.369  -7.279  1.00 0.00 ? 37  SER A N    2  
ATOM 2784  C CA   . SER A 1 37  ? 3.225   14.924  -8.076  1.00 0.00 ? 37  SER A CA   2  
ATOM 2785  C C    . SER A 1 37  ? 1.987   14.887  -7.177  1.00 0.00 ? 37  SER A C    2  
ATOM 2786  O O    . SER A 1 37  ? 2.058   15.176  -5.997  1.00 0.00 ? 37  SER A O    2  
ATOM 2787  C CB   . SER A 1 37  ? 3.487   13.528  -8.640  1.00 0.00 ? 37  SER A CB   2  
ATOM 2788  O OG   . SER A 1 37  ? 3.528   12.590  -7.573  1.00 0.00 ? 37  SER A OG   2  
ATOM 2789  H H    . SER A 1 37  ? 4.729   14.816  -6.537  1.00 0.00 ? 37  SER A H    2  
ATOM 2790  H HA   . SER A 1 37  ? 3.058   15.616  -8.888  1.00 0.00 ? 37  SER A HA   2  
ATOM 2791  H HB2  . SER A 1 37  ? 2.696   13.257  -9.319  1.00 0.00 ? 37  SER A HB2  2  
ATOM 2792  H HB3  . SER A 1 37  ? 4.430   13.526  -9.171  1.00 0.00 ? 37  SER A HB3  2  
ATOM 2793  H HG   . SER A 1 37  ? 2.684   12.132  -7.548  1.00 0.00 ? 37  SER A HG   2  
ATOM 2794  N N    . LYS A 1 38  ? 0.854   14.532  -7.729  1.00 0.00 ? 38  LYS A N    2  
ATOM 2795  C CA   . LYS A 1 38  ? -0.395  14.472  -6.915  1.00 0.00 ? 38  LYS A CA   2  
ATOM 2796  C C    . LYS A 1 38  ? -1.046  13.085  -7.072  1.00 0.00 ? 38  LYS A C    2  
ATOM 2797  O O    . LYS A 1 38  ? -1.935  12.920  -7.885  1.00 0.00 ? 38  LYS A O    2  
ATOM 2798  C CB   . LYS A 1 38  ? -1.369  15.552  -7.396  1.00 0.00 ? 38  LYS A CB   2  
ATOM 2799  C CG   . LYS A 1 38  ? -1.205  16.809  -6.539  1.00 0.00 ? 38  LYS A CG   2  
ATOM 2800  C CD   . LYS A 1 38  ? -2.412  17.727  -6.743  1.00 0.00 ? 38  LYS A CD   2  
ATOM 2801  C CE   . LYS A 1 38  ? -2.120  18.711  -7.877  1.00 0.00 ? 38  LYS A CE   2  
ATOM 2802  N NZ   . LYS A 1 38  ? -3.319  19.562  -8.118  1.00 0.00 ? 38  LYS A NZ   2  
ATOM 2803  H H    . LYS A 1 38  ? 0.826   14.304  -8.682  1.00 0.00 ? 38  LYS A H    2  
ATOM 2804  H HA   . LYS A 1 38  ? -0.155  14.641  -5.876  1.00 0.00 ? 38  LYS A HA   2  
ATOM 2805  H HB2  . LYS A 1 38  ? -1.159  15.790  -8.429  1.00 0.00 ? 38  LYS A HB2  2  
ATOM 2806  H HB3  . LYS A 1 38  ? -2.381  15.188  -7.309  1.00 0.00 ? 38  LYS A HB3  2  
ATOM 2807  H HG2  . LYS A 1 38  ? -1.138  16.527  -5.498  1.00 0.00 ? 38  LYS A HG2  2  
ATOM 2808  H HG3  . LYS A 1 38  ? -0.306  17.329  -6.831  1.00 0.00 ? 38  LYS A HG3  2  
ATOM 2809  H HD2  . LYS A 1 38  ? -3.278  17.132  -6.996  1.00 0.00 ? 38  LYS A HD2  2  
ATOM 2810  H HD3  . LYS A 1 38  ? -2.605  18.276  -5.834  1.00 0.00 ? 38  LYS A HD3  2  
ATOM 2811  H HE2  . LYS A 1 38  ? -1.283  19.337  -7.604  1.00 0.00 ? 38  LYS A HE2  2  
ATOM 2812  H HE3  . LYS A 1 38  ? -1.881  18.163  -8.777  1.00 0.00 ? 38  LYS A HE3  2  
ATOM 2813  H HZ1  . LYS A 1 38  ? -3.663  19.941  -7.213  1.00 0.00 ? 38  LYS A HZ1  2  
ATOM 2814  H HZ2  . LYS A 1 38  ? -3.066  20.349  -8.747  1.00 0.00 ? 38  LYS A HZ2  2  
ATOM 2815  H HZ3  . LYS A 1 38  ? -4.066  18.989  -8.561  1.00 0.00 ? 38  LYS A HZ3  2  
ATOM 2816  N N    . PRO A 1 39  ? -0.593  12.117  -6.292  1.00 0.00 ? 39  PRO A N    2  
ATOM 2817  C CA   . PRO A 1 39  ? -1.141  10.750  -6.352  1.00 0.00 ? 39  PRO A CA   2  
ATOM 2818  C C    . PRO A 1 39  ? -2.478  10.683  -5.608  1.00 0.00 ? 39  PRO A C    2  
ATOM 2819  O O    . PRO A 1 39  ? -2.902  11.643  -4.992  1.00 0.00 ? 39  PRO A O    2  
ATOM 2820  C CB   . PRO A 1 39  ? -0.080  9.901   -5.648  1.00 0.00 ? 39  PRO A CB   2  
ATOM 2821  C CG   . PRO A 1 39  ? 0.719   10.864  -4.738  1.00 0.00 ? 39  PRO A CG   2  
ATOM 2822  C CD   . PRO A 1 39  ? 0.491   12.283  -5.290  1.00 0.00 ? 39  PRO A CD   2  
ATOM 2823  H HA   . PRO A 1 39  ? -1.255  10.428  -7.374  1.00 0.00 ? 39  PRO A HA   2  
ATOM 2824  H HB2  . PRO A 1 39  ? -0.557  9.133   -5.053  1.00 0.00 ? 39  PRO A HB2  2  
ATOM 2825  H HB3  . PRO A 1 39  ? 0.580   9.454   -6.374  1.00 0.00 ? 39  PRO A HB3  2  
ATOM 2826  H HG2  . PRO A 1 39  ? 0.358   10.796  -3.721  1.00 0.00 ? 39  PRO A HG2  2  
ATOM 2827  H HG3  . PRO A 1 39  ? 1.770   10.623  -4.777  1.00 0.00 ? 39  PRO A HG3  2  
ATOM 2828  H HD2  . PRO A 1 39  ? 0.179   12.949  -4.498  1.00 0.00 ? 39  PRO A HD2  2  
ATOM 2829  H HD3  . PRO A 1 39  ? 1.385   12.652  -5.768  1.00 0.00 ? 39  PRO A HD3  2  
ATOM 2830  N N    . ALA A 1 40  ? -3.143  9.556   -5.663  1.00 0.00 ? 40  ALA A N    2  
ATOM 2831  C CA   . ALA A 1 40  ? -4.453  9.421   -4.961  1.00 0.00 ? 40  ALA A CA   2  
ATOM 2832  C C    . ALA A 1 40  ? -4.932  7.971   -5.039  1.00 0.00 ? 40  ALA A C    2  
ATOM 2833  O O    . ALA A 1 40  ? -4.315  7.137   -5.675  1.00 0.00 ? 40  ALA A O    2  
ATOM 2834  C CB   . ALA A 1 40  ? -5.484  10.333  -5.629  1.00 0.00 ? 40  ALA A CB   2  
ATOM 2835  H H    . ALA A 1 40  ? -2.779  8.798   -6.167  1.00 0.00 ? 40  ALA A H    2  
ATOM 2836  H HA   . ALA A 1 40  ? -4.338  9.707   -3.926  1.00 0.00 ? 40  ALA A HA   2  
ATOM 2837  H HB1  . ALA A 1 40  ? -5.073  11.325  -5.734  1.00 0.00 ? 40  ALA A HB1  2  
ATOM 2838  H HB2  . ALA A 1 40  ? -5.732  9.941   -6.605  1.00 0.00 ? 40  ALA A HB2  2  
ATOM 2839  H HB3  . ALA A 1 40  ? -6.376  10.374  -5.021  1.00 0.00 ? 40  ALA A HB3  2  
ATOM 2840  N N    . VAL A 1 41  ? -6.031  7.669   -4.396  1.00 0.00 ? 41  VAL A N    2  
ATOM 2841  C CA   . VAL A 1 41  ? -6.566  6.277   -4.424  1.00 0.00 ? 41  VAL A CA   2  
ATOM 2842  C C    . VAL A 1 41  ? -8.093  6.324   -4.318  1.00 0.00 ? 41  VAL A C    2  
ATOM 2843  O O    . VAL A 1 41  ? -8.678  7.373   -4.125  1.00 0.00 ? 41  VAL A O    2  
ATOM 2844  C CB   . VAL A 1 41  ? -5.948  5.469   -3.251  1.00 0.00 ? 41  VAL A CB   2  
ATOM 2845  C CG1  . VAL A 1 41  ? -6.705  5.707   -1.935  1.00 0.00 ? 41  VAL A CG1  2  
ATOM 2846  C CG2  . VAL A 1 41  ? -5.967  3.970   -3.583  1.00 0.00 ? 41  VAL A CG2  2  
ATOM 2847  H H    . VAL A 1 41  ? -6.507  8.363   -3.894  1.00 0.00 ? 41  VAL A H    2  
ATOM 2848  H HA   . VAL A 1 41  ? -6.294  5.809   -5.355  1.00 0.00 ? 41  VAL A HA   2  
ATOM 2849  H HB   . VAL A 1 41  ? -4.929  5.787   -3.117  1.00 0.00 ? 41  VAL A HB   2  
ATOM 2850  H HG11 . VAL A 1 41  ? -7.284  6.611   -2.020  1.00 0.00 ? 41  VAL A HG11 2  
ATOM 2851  H HG12 . VAL A 1 41  ? -7.367  4.874   -1.742  1.00 0.00 ? 41  VAL A HG12 2  
ATOM 2852  H HG13 . VAL A 1 41  ? -6.000  5.803   -1.124  1.00 0.00 ? 41  VAL A HG13 2  
ATOM 2853  H HG21 . VAL A 1 41  ? -6.334  3.826   -4.585  1.00 0.00 ? 41  VAL A HG21 2  
ATOM 2854  H HG22 . VAL A 1 41  ? -4.967  3.575   -3.509  1.00 0.00 ? 41  VAL A HG22 2  
ATOM 2855  H HG23 . VAL A 1 41  ? -6.611  3.449   -2.889  1.00 0.00 ? 41  VAL A HG23 2  
ATOM 2856  N N    . GLU A 1 42  ? -8.726  5.191   -4.409  1.00 0.00 ? 42  GLU A N    2  
ATOM 2857  C CA   . GLU A 1 42  ? -10.202 5.152   -4.277  1.00 0.00 ? 42  GLU A CA   2  
ATOM 2858  C C    . GLU A 1 42  ? -10.618 3.761   -3.825  1.00 0.00 ? 42  GLU A C    2  
ATOM 2859  O O    . GLU A 1 42  ? -10.458 2.790   -4.541  1.00 0.00 ? 42  GLU A O    2  
ATOM 2860  C CB   . GLU A 1 42  ? -10.861 5.501   -5.610  1.00 0.00 ? 42  GLU A CB   2  
ATOM 2861  C CG   . GLU A 1 42  ? -10.363 4.544   -6.693  1.00 0.00 ? 42  GLU A CG   2  
ATOM 2862  C CD   . GLU A 1 42  ? -10.387 5.251   -8.049  1.00 0.00 ? 42  GLU A CD   2  
ATOM 2863  O OE1  . GLU A 1 42  ? -9.427  5.939   -8.354  1.00 0.00 ? 42  GLU A OE1  2  
ATOM 2864  O OE2  . GLU A 1 42  ? -11.365 5.093   -8.761  1.00 0.00 ? 42  GLU A OE2  2  
ATOM 2865  H H    . GLU A 1 42  ? -8.226  4.362   -4.543  1.00 0.00 ? 42  GLU A H    2  
ATOM 2866  H HA   . GLU A 1 42  ? -10.498 5.862   -3.530  1.00 0.00 ? 42  GLU A HA   2  
ATOM 2867  H HB2  . GLU A 1 42  ? -11.933 5.413   -5.513  1.00 0.00 ? 42  GLU A HB2  2  
ATOM 2868  H HB3  . GLU A 1 42  ? -10.605 6.514   -5.880  1.00 0.00 ? 42  GLU A HB3  2  
ATOM 2869  H HG2  . GLU A 1 42  ? -9.353  4.237   -6.462  1.00 0.00 ? 42  GLU A HG2  2  
ATOM 2870  H HG3  . GLU A 1 42  ? -11.005 3.678   -6.728  1.00 0.00 ? 42  GLU A HG3  2  
ATOM 2871  N N    . ILE A 1 43  ? -11.138 3.659   -2.632  1.00 0.00 ? 43  ILE A N    2  
ATOM 2872  C CA   . ILE A 1 43  ? -11.552 2.336   -2.112  1.00 0.00 ? 43  ILE A CA   2  
ATOM 2873  C C    . ILE A 1 43  ? -13.051 2.156   -2.307  1.00 0.00 ? 43  ILE A C    2  
ATOM 2874  O O    . ILE A 1 43  ? -13.823 3.094   -2.250  1.00 0.00 ? 43  ILE A O    2  
ATOM 2875  C CB   . ILE A 1 43  ? -11.184 2.231   -0.636  1.00 0.00 ? 43  ILE A CB   2  
ATOM 2876  C CG1  . ILE A 1 43  ? -9.680  2.492   -0.484  1.00 0.00 ? 43  ILE A CG1  2  
ATOM 2877  C CG2  . ILE A 1 43  ? -11.515 0.827   -0.120  1.00 0.00 ? 43  ILE A CG2  2  
ATOM 2878  C CD1  . ILE A 1 43  ? -9.292  2.489   0.996   1.00 0.00 ? 43  ILE A CD1  2  
ATOM 2879  H H    . ILE A 1 43  ? -11.249 4.458   -2.077  1.00 0.00 ? 43  ILE A H    2  
ATOM 2880  H HA   . ILE A 1 43  ? -11.034 1.567   -2.659  1.00 0.00 ? 43  ILE A HA   2  
ATOM 2881  H HB   . ILE A 1 43  ? -11.738 2.963   -0.077  1.00 0.00 ? 43  ILE A HB   2  
ATOM 2882  H HG12 . ILE A 1 43  ? -9.129  1.719   -1.000  1.00 0.00 ? 43  ILE A HG12 2  
ATOM 2883  H HG13 . ILE A 1 43  ? -9.439  3.452   -0.914  1.00 0.00 ? 43  ILE A HG13 2  
ATOM 2884  H HG21 . ILE A 1 43  ? -11.081 0.090   -0.778  1.00 0.00 ? 43  ILE A HG21 2  
ATOM 2885  H HG22 . ILE A 1 43  ? -11.111 0.705   0.874   1.00 0.00 ? 43  ILE A HG22 2  
ATOM 2886  H HG23 . ILE A 1 43  ? -12.587 0.698   -0.091  1.00 0.00 ? 43  ILE A HG23 2  
ATOM 2887  H HD11 . ILE A 1 43  ? -10.182 2.533   1.606   1.00 0.00 ? 43  ILE A HD11 2  
ATOM 2888  H HD12 . ILE A 1 43  ? -8.744  1.587   1.222   1.00 0.00 ? 43  ILE A HD12 2  
ATOM 2889  H HD13 . ILE A 1 43  ? -8.671  3.349   1.204   1.00 0.00 ? 43  ILE A HD13 2  
ATOM 2890  N N    . LYS A 1 44  ? -13.448 0.949   -2.559  1.00 0.00 ? 44  LYS A N    2  
ATOM 2891  C CA   . LYS A 1 44  ? -14.879 0.640   -2.793  1.00 0.00 ? 44  LYS A CA   2  
ATOM 2892  C C    . LYS A 1 44  ? -15.153 -0.708  -2.135  1.00 0.00 ? 44  LYS A C    2  
ATOM 2893  O O    . LYS A 1 44  ? -14.685 -1.727  -2.596  1.00 0.00 ? 44  LYS A O    2  
ATOM 2894  C CB   . LYS A 1 44  ? -15.099 0.566   -4.308  1.00 0.00 ? 44  LYS A CB   2  
ATOM 2895  C CG   . LYS A 1 44  ? -14.582 1.852   -4.957  1.00 0.00 ? 44  LYS A CG   2  
ATOM 2896  C CD   . LYS A 1 44  ? -15.225 2.030   -6.327  1.00 0.00 ? 44  LYS A CD   2  
ATOM 2897  C CE   . LYS A 1 44  ? -14.778 0.905   -7.264  1.00 0.00 ? 44  LYS A CE   2  
ATOM 2898  N NZ   . LYS A 1 44  ? -15.921 0.499   -8.130  1.00 0.00 ? 44  LYS A NZ   2  
ATOM 2899  H H    . LYS A 1 44  ? -12.790 0.229   -2.611  1.00 0.00 ? 44  LYS A H    2  
ATOM 2900  H HA   . LYS A 1 44  ? -15.506 1.405   -2.355  1.00 0.00 ? 44  LYS A HA   2  
ATOM 2901  H HB2  . LYS A 1 44  ? -14.551 -0.275  -4.711  1.00 0.00 ? 44  LYS A HB2  2  
ATOM 2902  H HB3  . LYS A 1 44  ? -16.149 0.452   -4.521  1.00 0.00 ? 44  LYS A HB3  2  
ATOM 2903  H HG2  . LYS A 1 44  ? -14.825 2.692   -4.332  1.00 0.00 ? 44  LYS A HG2  2  
ATOM 2904  H HG3  . LYS A 1 44  ? -13.513 1.797   -5.070  1.00 0.00 ? 44  LYS A HG3  2  
ATOM 2905  H HD2  . LYS A 1 44  ? -16.296 2.006   -6.221  1.00 0.00 ? 44  LYS A HD2  2  
ATOM 2906  H HD3  . LYS A 1 44  ? -14.921 2.979   -6.739  1.00 0.00 ? 44  LYS A HD3  2  
ATOM 2907  H HE2  . LYS A 1 44  ? -13.966 1.255   -7.883  1.00 0.00 ? 44  LYS A HE2  2  
ATOM 2908  H HE3  . LYS A 1 44  ? -14.449 0.058   -6.681  1.00 0.00 ? 44  LYS A HE3  2  
ATOM 2909  H HZ1  . LYS A 1 44  ? -16.468 1.340   -8.400  1.00 0.00 ? 44  LYS A HZ1  2  
ATOM 2910  H HZ2  . LYS A 1 44  ? -15.557 0.032   -8.986  1.00 0.00 ? 44  LYS A HZ2  2  
ATOM 2911  H HZ3  . LYS A 1 44  ? -16.534 -0.159  -7.610  1.00 0.00 ? 44  LYS A HZ3  2  
ATOM 2912  N N    . GLN A 1 45  ? -15.844 -0.725  -1.024  1.00 0.00 ? 45  GLN A N    2  
ATOM 2913  C CA   . GLN A 1 45  ? -16.050 -2.025  -0.321  1.00 0.00 ? 45  GLN A CA   2  
ATOM 2914  C C    . GLN A 1 45  ? -17.506 -2.261  0.090   1.00 0.00 ? 45  GLN A C    2  
ATOM 2915  O O    . GLN A 1 45  ? -18.232 -1.356  0.451   1.00 0.00 ? 45  GLN A O    2  
ATOM 2916  C CB   . GLN A 1 45  ? -15.155 -2.028  0.923   1.00 0.00 ? 45  GLN A CB   2  
ATOM 2917  C CG   . GLN A 1 45  ? -15.616 -0.953  1.920   1.00 0.00 ? 45  GLN A CG   2  
ATOM 2918  C CD   . GLN A 1 45  ? -16.064 -1.610  3.231   1.00 0.00 ? 45  GLN A CD   2  
ATOM 2919  O OE1  . GLN A 1 45  ? -15.814 -1.091  4.299   1.00 0.00 ? 45  GLN A OE1  2  
ATOM 2920  N NE2  . GLN A 1 45  ? -16.723 -2.737  3.196   1.00 0.00 ? 45  GLN A NE2  2  
ATOM 2921  H H    . GLN A 1 45  ? -16.173 0.111   -0.633  1.00 0.00 ? 45  GLN A H    2  
ATOM 2922  H HA   . GLN A 1 45  ? -15.738 -2.829  -0.969  1.00 0.00 ? 45  GLN A HA   2  
ATOM 2923  H HB2  . GLN A 1 45  ? -15.193 -2.993  1.391   1.00 0.00 ? 45  GLN A HB2  2  
ATOM 2924  H HB3  . GLN A 1 45  ? -14.139 -1.818  0.625   1.00 0.00 ? 45  GLN A HB3  2  
ATOM 2925  H HG2  . GLN A 1 45  ? -14.798 -0.276  2.120   1.00 0.00 ? 45  GLN A HG2  2  
ATOM 2926  H HG3  . GLN A 1 45  ? -16.442 -0.401  1.498   1.00 0.00 ? 45  GLN A HG3  2  
ATOM 2927  H HE21 . GLN A 1 45  ? -16.929 -3.159  2.337   1.00 0.00 ? 45  GLN A HE21 2  
ATOM 2928  H HE22 . GLN A 1 45  ? -17.011 -3.161  4.031   1.00 0.00 ? 45  GLN A HE22 2  
ATOM 2929  N N    . GLU A 1 46  ? -17.902 -3.504  0.066   1.00 0.00 ? 46  GLU A N    2  
ATOM 2930  C CA   . GLU A 1 46  ? -19.272 -3.891  0.478   1.00 0.00 ? 46  GLU A CA   2  
ATOM 2931  C C    . GLU A 1 46  ? -19.146 -4.978  1.553   1.00 0.00 ? 46  GLU A C    2  
ATOM 2932  O O    . GLU A 1 46  ? -19.202 -6.159  1.262   1.00 0.00 ? 46  GLU A O    2  
ATOM 2933  C CB   . GLU A 1 46  ? -20.021 -4.450  -0.731  1.00 0.00 ? 46  GLU A CB   2  
ATOM 2934  C CG   . GLU A 1 46  ? -21.518 -4.532  -0.419  1.00 0.00 ? 46  GLU A CG   2  
ATOM 2935  C CD   . GLU A 1 46  ? -22.257 -3.390  -1.123  1.00 0.00 ? 46  GLU A CD   2  
ATOM 2936  O OE1  . GLU A 1 46  ? -22.336 -3.423  -2.340  1.00 0.00 ? 46  GLU A OE1  2  
ATOM 2937  O OE2  . GLU A 1 46  ? -22.731 -2.504  -0.432  1.00 0.00 ? 46  GLU A OE2  2  
ATOM 2938  H H    . GLU A 1 46  ? -17.277 -4.200  -0.211  1.00 0.00 ? 46  GLU A H    2  
ATOM 2939  H HA   . GLU A 1 46  ? -19.795 -3.035  0.877   1.00 0.00 ? 46  GLU A HA   2  
ATOM 2940  H HB2  . GLU A 1 46  ? -19.857 -3.805  -1.581  1.00 0.00 ? 46  GLU A HB2  2  
ATOM 2941  H HB3  . GLU A 1 46  ? -19.649 -5.439  -0.955  1.00 0.00 ? 46  GLU A HB3  2  
ATOM 2942  H HG2  . GLU A 1 46  ? -21.902 -5.478  -0.769  1.00 0.00 ? 46  GLU A HG2  2  
ATOM 2943  H HG3  . GLU A 1 46  ? -21.671 -4.454  0.647   1.00 0.00 ? 46  GLU A HG3  2  
ATOM 2944  N N    . GLY A 1 47  ? -18.947 -4.588  2.788   1.00 0.00 ? 47  GLY A N    2  
ATOM 2945  C CA   . GLY A 1 47  ? -18.791 -5.595  3.883   1.00 0.00 ? 47  GLY A CA   2  
ATOM 2946  C C    . GLY A 1 47  ? -17.354 -6.126  3.873   1.00 0.00 ? 47  GLY A C    2  
ATOM 2947  O O    . GLY A 1 47  ? -16.406 -5.364  3.859   1.00 0.00 ? 47  GLY A O    2  
ATOM 2948  H H    . GLY A 1 47  ? -18.885 -3.632  2.993   1.00 0.00 ? 47  GLY A H    2  
ATOM 2949  H HA2  . GLY A 1 47  ? -18.998 -5.127  4.835   1.00 0.00 ? 47  GLY A HA2  2  
ATOM 2950  H HA3  . GLY A 1 47  ? -19.475 -6.413  3.724   1.00 0.00 ? 47  GLY A HA3  2  
ATOM 2951  N N    . ASP A 1 48  ? -17.185 -7.427  3.873   1.00 0.00 ? 48  ASP A N    2  
ATOM 2952  C CA   . ASP A 1 48  ? -15.813 -8.008  3.855   1.00 0.00 ? 48  ASP A CA   2  
ATOM 2953  C C    . ASP A 1 48  ? -15.224 -7.957  2.440   1.00 0.00 ? 48  ASP A C    2  
ATOM 2954  O O    . ASP A 1 48  ? -14.089 -8.342  2.230   1.00 0.00 ? 48  ASP A O    2  
ATOM 2955  C CB   . ASP A 1 48  ? -15.870 -9.454  4.328   1.00 0.00 ? 48  ASP A CB   2  
ATOM 2956  C CG   . ASP A 1 48  ? -16.874 -10.236 3.479   1.00 0.00 ? 48  ASP A CG   2  
ATOM 2957  O OD1  . ASP A 1 48  ? -16.487 -10.704 2.421   1.00 0.00 ? 48  ASP A OD1  2  
ATOM 2958  O OD2  . ASP A 1 48  ? -18.012 -10.353 3.902   1.00 0.00 ? 48  ASP A OD2  2  
ATOM 2959  H H    . ASP A 1 48  ? -17.961 -8.022  3.880   1.00 0.00 ? 48  ASP A H    2  
ATOM 2960  H HA   . ASP A 1 48  ? -15.175 -7.446  4.520   1.00 0.00 ? 48  ASP A HA   2  
ATOM 2961  H HB2  . ASP A 1 48  ? -14.894 -9.891  4.229   1.00 0.00 ? 48  ASP A HB2  2  
ATOM 2962  H HB3  . ASP A 1 48  ? -16.173 -9.481  5.361   1.00 0.00 ? 48  ASP A HB3  2  
ATOM 2963  N N    . THR A 1 49  ? -15.963 -7.469  1.472   1.00 0.00 ? 49  THR A N    2  
ATOM 2964  C CA   . THR A 1 49  ? -15.417 -7.377  0.092   1.00 0.00 ? 49  THR A CA   2  
ATOM 2965  C C    . THR A 1 49  ? -14.786 -5.992  -0.071  1.00 0.00 ? 49  THR A C    2  
ATOM 2966  O O    . THR A 1 49  ? -15.344 -5.006  0.366   1.00 0.00 ? 49  THR A O    2  
ATOM 2967  C CB   . THR A 1 49  ? -16.554 -7.545  -0.916  1.00 0.00 ? 49  THR A CB   2  
ATOM 2968  O OG1  . THR A 1 49  ? -17.230 -8.769  -0.663  1.00 0.00 ? 49  THR A OG1  2  
ATOM 2969  C CG2  . THR A 1 49  ? -15.982 -7.558  -2.331  1.00 0.00 ? 49  THR A CG2  2  
ATOM 2970  H H    . THR A 1 49  ? -16.869 -7.146  1.653   1.00 0.00 ? 49  THR A H    2  
ATOM 2971  H HA   . THR A 1 49  ? -14.672 -8.147  -0.061  1.00 0.00 ? 49  THR A HA   2  
ATOM 2972  H HB   . THR A 1 49  ? -17.246 -6.723  -0.819  1.00 0.00 ? 49  THR A HB   2  
ATOM 2973  H HG1  . THR A 1 49  ? -18.143 -8.564  -0.445  1.00 0.00 ? 49  THR A HG1  2  
ATOM 2974  H HG21 . THR A 1 49  ? -15.176 -6.842  -2.399  1.00 0.00 ? 49  THR A HG21 2  
ATOM 2975  H HG22 . THR A 1 49  ? -15.607 -8.545  -2.558  1.00 0.00 ? 49  THR A HG22 2  
ATOM 2976  H HG23 . THR A 1 49  ? -16.758 -7.296  -3.034  1.00 0.00 ? 49  THR A HG23 2  
ATOM 2977  N N    . PHE A 1 50  ? -13.627 -5.901  -0.673  1.00 0.00 ? 50  PHE A N    2  
ATOM 2978  C CA   . PHE A 1 50  ? -12.987 -4.562  -0.833  1.00 0.00 ? 50  PHE A CA   2  
ATOM 2979  C C    . PHE A 1 50  ? -12.365 -4.408  -2.222  1.00 0.00 ? 50  PHE A C    2  
ATOM 2980  O O    . PHE A 1 50  ? -11.925 -5.355  -2.843  1.00 0.00 ? 50  PHE A O    2  
ATOM 2981  C CB   . PHE A 1 50  ? -11.891 -4.378  0.222   1.00 0.00 ? 50  PHE A CB   2  
ATOM 2982  C CG   . PHE A 1 50  ? -12.497 -4.519  1.591   1.00 0.00 ? 50  PHE A CG   2  
ATOM 2983  C CD1  . PHE A 1 50  ? -12.681 -5.786  2.133   1.00 0.00 ? 50  PHE A CD1  2  
ATOM 2984  C CD2  . PHE A 1 50  ? -12.895 -3.385  2.305   1.00 0.00 ? 50  PHE A CD2  2  
ATOM 2985  C CE1  . PHE A 1 50  ? -13.268 -5.931  3.388   1.00 0.00 ? 50  PHE A CE1  2  
ATOM 2986  C CE2  . PHE A 1 50  ? -13.479 -3.526  3.571   1.00 0.00 ? 50  PHE A CE2  2  
ATOM 2987  C CZ   . PHE A 1 50  ? -13.667 -4.806  4.109   1.00 0.00 ? 50  PHE A CZ   2  
ATOM 2988  H H    . PHE A 1 50  ? -13.182 -6.702  -1.001  1.00 0.00 ? 50  PHE A H    2  
ATOM 2989  H HA   . PHE A 1 50  ? -13.740 -3.798  -0.695  1.00 0.00 ? 50  PHE A HA   2  
ATOM 2990  H HB2  . PHE A 1 50  ? -11.128 -5.131  0.085   1.00 0.00 ? 50  PHE A HB2  2  
ATOM 2991  H HB3  . PHE A 1 50  ? -11.453 -3.397  0.120   1.00 0.00 ? 50  PHE A HB3  2  
ATOM 2992  H HD1  . PHE A 1 50  ? -12.366 -6.654  1.584   1.00 0.00 ? 50  PHE A HD1  2  
ATOM 2993  H HD2  . PHE A 1 50  ? -12.743 -2.403  1.883   1.00 0.00 ? 50  PHE A HD2  2  
ATOM 2994  H HE1  . PHE A 1 50  ? -13.407 -6.916  3.807   1.00 0.00 ? 50  PHE A HE1  2  
ATOM 2995  H HE2  . PHE A 1 50  ? -13.785 -2.651  4.129   1.00 0.00 ? 50  PHE A HE2  2  
ATOM 2996  H HZ   . PHE A 1 50  ? -14.123 -4.926  5.081   1.00 0.00 ? 50  PHE A HZ   2  
ATOM 2997  N N    . TYR A 1 51  ? -12.303 -3.192  -2.678  1.00 0.00 ? 51  TYR A N    2  
ATOM 2998  C CA   . TYR A 1 51  ? -11.689 -2.873  -3.993  1.00 0.00 ? 51  TYR A CA   2  
ATOM 2999  C C    . TYR A 1 51  ? -10.697 -1.744  -3.698  1.00 0.00 ? 51  TYR A C    2  
ATOM 3000  O O    . TYR A 1 51  ? -10.933 -0.937  -2.818  1.00 0.00 ? 51  TYR A O    2  
ATOM 3001  C CB   . TYR A 1 51  ? -12.817 -2.467  -4.980  1.00 0.00 ? 51  TYR A CB   2  
ATOM 3002  C CG   . TYR A 1 51  ? -12.371 -1.469  -6.033  1.00 0.00 ? 51  TYR A CG   2  
ATOM 3003  C CD1  . TYR A 1 51  ? -12.167 -0.134  -5.688  1.00 0.00 ? 51  TYR A CD1  2  
ATOM 3004  C CD2  . TYR A 1 51  ? -12.211 -1.875  -7.357  1.00 0.00 ? 51  TYR A CD2  2  
ATOM 3005  C CE1  . TYR A 1 51  ? -11.804 0.796   -6.653  1.00 0.00 ? 51  TYR A CE1  2  
ATOM 3006  C CE2  . TYR A 1 51  ? -11.834 -0.941  -8.334  1.00 0.00 ? 51  TYR A CE2  2  
ATOM 3007  C CZ   . TYR A 1 51  ? -11.632 0.396   -7.980  1.00 0.00 ? 51  TYR A CZ   2  
ATOM 3008  O OH   . TYR A 1 51  ? -11.281 1.320   -8.943  1.00 0.00 ? 51  TYR A OH   2  
ATOM 3009  H H    . TYR A 1 51  ? -12.645 -2.460  -2.124  1.00 0.00 ? 51  TYR A H    2  
ATOM 3010  H HA   . TYR A 1 51  ? -11.158 -3.737  -4.371  1.00 0.00 ? 51  TYR A HA   2  
ATOM 3011  H HB2  . TYR A 1 51  ? -13.173 -3.354  -5.480  1.00 0.00 ? 51  TYR A HB2  2  
ATOM 3012  H HB3  . TYR A 1 51  ? -13.630 -2.041  -4.423  1.00 0.00 ? 51  TYR A HB3  2  
ATOM 3013  H HD1  . TYR A 1 51  ? -12.284 0.182   -4.670  1.00 0.00 ? 51  TYR A HD1  2  
ATOM 3014  H HD2  . TYR A 1 51  ? -12.374 -2.907  -7.624  1.00 0.00 ? 51  TYR A HD2  2  
ATOM 3015  H HE1  . TYR A 1 51  ? -11.658 1.824   -6.370  1.00 0.00 ? 51  TYR A HE1  2  
ATOM 3016  H HE2  . TYR A 1 51  ? -11.697 -1.249  -9.356  1.00 0.00 ? 51  TYR A HE2  2  
ATOM 3017  H HH   . TYR A 1 51  ? -11.888 2.061   -8.878  1.00 0.00 ? 51  TYR A HH   2  
ATOM 3018  N N    . ILE A 1 52  ? -9.582  -1.694  -4.373  1.00 0.00 ? 52  ILE A N    2  
ATOM 3019  C CA   . ILE A 1 52  ? -8.586  -0.621  -4.057  1.00 0.00 ? 52  ILE A CA   2  
ATOM 3020  C C    . ILE A 1 52  ? -7.855  -0.193  -5.326  1.00 0.00 ? 52  ILE A C    2  
ATOM 3021  O O    . ILE A 1 52  ? -7.039  -0.925  -5.852  1.00 0.00 ? 52  ILE A O    2  
ATOM 3022  C CB   . ILE A 1 52  ? -7.565  -1.140  -3.029  1.00 0.00 ? 52  ILE A CB   2  
ATOM 3023  C CG1  . ILE A 1 52  ? -8.277  -1.996  -1.958  1.00 0.00 ? 52  ILE A CG1  2  
ATOM 3024  C CG2  . ILE A 1 52  ? -6.880  0.059   -2.364  1.00 0.00 ? 52  ILE A CG2  2  
ATOM 3025  C CD1  . ILE A 1 52  ? -7.296  -2.402  -0.851  1.00 0.00 ? 52  ILE A CD1  2  
ATOM 3026  H H    . ILE A 1 52  ? -9.389  -2.366  -5.058  1.00 0.00 ? 52  ILE A H    2  
ATOM 3027  H HA   . ILE A 1 52  ? -9.107  0.228   -3.642  1.00 0.00 ? 52  ILE A HA   2  
ATOM 3028  H HB   . ILE A 1 52  ? -6.821  -1.739  -3.536  1.00 0.00 ? 52  ILE A HB   2  
ATOM 3029  H HG12 . ILE A 1 52  ? -9.087  -1.428  -1.528  1.00 0.00 ? 52  ILE A HG12 2  
ATOM 3030  H HG13 . ILE A 1 52  ? -8.675  -2.887  -2.424  1.00 0.00 ? 52  ILE A HG13 2  
ATOM 3031  H HG21 . ILE A 1 52  ? -6.763  0.852   -3.086  1.00 0.00 ? 52  ILE A HG21 2  
ATOM 3032  H HG22 . ILE A 1 52  ? -7.486  0.405   -1.540  1.00 0.00 ? 52  ILE A HG22 2  
ATOM 3033  H HG23 . ILE A 1 52  ? -5.910  -0.242  -1.996  1.00 0.00 ? 52  ILE A HG23 2  
ATOM 3034  H HD11 . ILE A 1 52  ? -6.299  -2.456  -1.259  1.00 0.00 ? 52  ILE A HD11 2  
ATOM 3035  H HD12 . ILE A 1 52  ? -7.322  -1.667  -0.064  1.00 0.00 ? 52  ILE A HD12 2  
ATOM 3036  H HD13 . ILE A 1 52  ? -7.576  -3.363  -0.450  1.00 0.00 ? 52  ILE A HD13 2  
ATOM 3037  N N    . LYS A 1 53  ? -8.140  0.989   -5.820  1.00 0.00 ? 53  LYS A N    2  
ATOM 3038  C CA   . LYS A 1 53  ? -7.463  1.460   -7.061  1.00 0.00 ? 53  LYS A CA   2  
ATOM 3039  C C    . LYS A 1 53  ? -6.575  2.671   -6.771  1.00 0.00 ? 53  LYS A C    2  
ATOM 3040  O O    . LYS A 1 53  ? -7.044  3.790   -6.685  1.00 0.00 ? 53  LYS A O    2  
ATOM 3041  C CB   . LYS A 1 53  ? -8.511  1.835   -8.110  1.00 0.00 ? 53  LYS A CB   2  
ATOM 3042  C CG   . LYS A 1 53  ? -7.836  2.037   -9.477  1.00 0.00 ? 53  LYS A CG   2  
ATOM 3043  C CD   . LYS A 1 53  ? -8.170  3.428   -10.026 1.00 0.00 ? 53  LYS A CD   2  
ATOM 3044  C CE   . LYS A 1 53  ? -9.658  3.499   -10.369 1.00 0.00 ? 53  LYS A CE   2  
ATOM 3045  N NZ   . LYS A 1 53  ? -9.957  2.562   -11.489 1.00 0.00 ? 53  LYS A NZ   2  
ATOM 3046  H H    . LYS A 1 53  ? -8.800  1.559   -5.375  1.00 0.00 ? 53  LYS A H    2  
ATOM 3047  H HA   . LYS A 1 53  ? -6.856  0.666   -7.441  1.00 0.00 ? 53  LYS A HA   2  
ATOM 3048  H HB2  . LYS A 1 53  ? -9.233  1.037   -8.183  1.00 0.00 ? 53  LYS A HB2  2  
ATOM 3049  H HB3  . LYS A 1 53  ? -9.008  2.746   -7.812  1.00 0.00 ? 53  LYS A HB3  2  
ATOM 3050  H HG2  . LYS A 1 53  ? -6.764  1.942   -9.372  1.00 0.00 ? 53  LYS A HG2  2  
ATOM 3051  H HG3  . LYS A 1 53  ? -8.194  1.287   -10.166 1.00 0.00 ? 53  LYS A HG3  2  
ATOM 3052  H HD2  . LYS A 1 53  ? -7.935  4.174   -9.281  1.00 0.00 ? 53  LYS A HD2  2  
ATOM 3053  H HD3  . LYS A 1 53  ? -7.588  3.612   -10.916 1.00 0.00 ? 53  LYS A HD3  2  
ATOM 3054  H HE2  . LYS A 1 53  ? -10.241 3.224   -9.504  1.00 0.00 ? 53  LYS A HE2  2  
ATOM 3055  H HE3  . LYS A 1 53  ? -9.911  4.507   -10.667 1.00 0.00 ? 53  LYS A HE3  2  
ATOM 3056  H HZ1  . LYS A 1 53  ? -9.257  2.695   -12.248 1.00 0.00 ? 53  LYS A HZ1  2  
ATOM 3057  H HZ2  . LYS A 1 53  ? -9.913  1.583   -11.143 1.00 0.00 ? 53  LYS A HZ2  2  
ATOM 3058  H HZ3  . LYS A 1 53  ? -10.909 2.754   -11.858 1.00 0.00 ? 53  LYS A HZ3  2  
ATOM 3059  N N    . THR A 1 54  ? -5.290  2.451   -6.637  1.00 0.00 ? 54  THR A N    2  
ATOM 3060  C CA   . THR A 1 54  ? -4.350  3.580   -6.369  1.00 0.00 ? 54  THR A CA   2  
ATOM 3061  C C    . THR A 1 54  ? -3.964  4.242   -7.688  1.00 0.00 ? 54  THR A C    2  
ATOM 3062  O O    . THR A 1 54  ? -2.938  3.938   -8.267  1.00 0.00 ? 54  THR A O    2  
ATOM 3063  C CB   . THR A 1 54  ? -3.093  3.047   -5.683  1.00 0.00 ? 54  THR A CB   2  
ATOM 3064  O OG1  . THR A 1 54  ? -3.460  2.289   -4.539  1.00 0.00 ? 54  THR A OG1  2  
ATOM 3065  C CG2  . THR A 1 54  ? -2.206  4.220   -5.262  1.00 0.00 ? 54  THR A CG2  2  
ATOM 3066  H H    . THR A 1 54  ? -4.941  1.540   -6.725  1.00 0.00 ? 54  THR A H    2  
ATOM 3067  H HA   . THR A 1 54  ? -4.821  4.304   -5.735  1.00 0.00 ? 54  THR A HA   2  
ATOM 3068  H HB   . THR A 1 54  ? -2.553  2.424   -6.370  1.00 0.00 ? 54  THR A HB   2  
ATOM 3069  H HG1  . THR A 1 54  ? -3.096  1.406   -4.639  1.00 0.00 ? 54  THR A HG1  2  
ATOM 3070  H HG21 . THR A 1 54  ? -2.825  5.029   -4.905  1.00 0.00 ? 54  THR A HG21 2  
ATOM 3071  H HG22 . THR A 1 54  ? -1.538  3.902   -4.476  1.00 0.00 ? 54  THR A HG22 2  
ATOM 3072  H HG23 . THR A 1 54  ? -1.629  4.557   -6.111  1.00 0.00 ? 54  THR A HG23 2  
ATOM 3073  N N    . SER A 1 55  ? -4.779  5.146   -8.166  1.00 0.00 ? 55  SER A N    2  
ATOM 3074  C CA   . SER A 1 55  ? -4.466  5.831   -9.450  1.00 0.00 ? 55  SER A CA   2  
ATOM 3075  C C    . SER A 1 55  ? -4.281  7.330   -9.205  1.00 0.00 ? 55  SER A C    2  
ATOM 3076  O O    . SER A 1 55  ? -4.154  7.773   -8.079  1.00 0.00 ? 55  SER A O    2  
ATOM 3077  C CB   . SER A 1 55  ? -5.611  5.609   -10.440 1.00 0.00 ? 55  SER A CB   2  
ATOM 3078  O OG   . SER A 1 55  ? -6.711  6.437   -10.084 1.00 0.00 ? 55  SER A OG   2  
ATOM 3079  H H    . SER A 1 55  ? -5.598  5.371   -7.680  1.00 0.00 ? 55  SER A H    2  
ATOM 3080  H HA   . SER A 1 55  ? -3.556  5.419   -9.853  1.00 0.00 ? 55  SER A HA   2  
ATOM 3081  H HB2  . SER A 1 55  ? -5.284  5.863   -11.435 1.00 0.00 ? 55  SER A HB2  2  
ATOM 3082  H HB3  . SER A 1 55  ? -5.908  4.569   -10.416 1.00 0.00 ? 55  SER A HB3  2  
ATOM 3083  H HG   . SER A 1 55  ? -7.494  6.093   -10.520 1.00 0.00 ? 55  SER A HG   2  
ATOM 3084  N N    . THR A 1 56  ? -4.267  8.112   -10.255 1.00 0.00 ? 56  THR A N    2  
ATOM 3085  C CA   . THR A 1 56  ? -4.091  9.586   -10.097 1.00 0.00 ? 56  THR A CA   2  
ATOM 3086  C C    . THR A 1 56  ? -4.837  10.320  -11.216 1.00 0.00 ? 56  THR A C    2  
ATOM 3087  O O    . THR A 1 56  ? -5.508  11.306  -10.976 1.00 0.00 ? 56  THR A O    2  
ATOM 3088  C CB   . THR A 1 56  ? -2.603  9.934   -10.160 1.00 0.00 ? 56  THR A CB   2  
ATOM 3089  O OG1  . THR A 1 56  ? -2.449  11.347  -10.157 1.00 0.00 ? 56  THR A OG1  2  
ATOM 3090  C CG2  . THR A 1 56  ? -1.995  9.355   -11.435 1.00 0.00 ? 56  THR A CG2  2  
ATOM 3091  H H    . THR A 1 56  ? -4.372  7.726   -11.149 1.00 0.00 ? 56  THR A H    2  
ATOM 3092  H HA   . THR A 1 56  ? -4.488  9.892   -9.143  1.00 0.00 ? 56  THR A HA   2  
ATOM 3093  H HB   . THR A 1 56  ? -2.098  9.515   -9.303  1.00 0.00 ? 56  THR A HB   2  
ATOM 3094  H HG1  . THR A 1 56  ? -1.609  11.553  -9.740  1.00 0.00 ? 56  THR A HG1  2  
ATOM 3095  H HG21 . THR A 1 56  ? -2.290  8.321   -11.535 1.00 0.00 ? 56  THR A HG21 2  
ATOM 3096  H HG22 . THR A 1 56  ? -2.351  9.914   -12.288 1.00 0.00 ? 56  THR A HG22 2  
ATOM 3097  H HG23 . THR A 1 56  ? -0.919  9.420   -11.383 1.00 0.00 ? 56  THR A HG23 2  
ATOM 3098  N N    . THR A 1 57  ? -4.722  9.850   -12.434 1.00 0.00 ? 57  THR A N    2  
ATOM 3099  C CA   . THR A 1 57  ? -5.422  10.524  -13.569 1.00 0.00 ? 57  THR A CA   2  
ATOM 3100  C C    . THR A 1 57  ? -5.761  9.500   -14.653 1.00 0.00 ? 57  THR A C    2  
ATOM 3101  O O    . THR A 1 57  ? -6.857  9.482   -15.181 1.00 0.00 ? 57  THR A O    2  
ATOM 3102  C CB   . THR A 1 57  ? -4.517  11.607  -14.158 1.00 0.00 ? 57  THR A CB   2  
ATOM 3103  O OG1  . THR A 1 57  ? -3.623  12.076  -13.158 1.00 0.00 ? 57  THR A OG1  2  
ATOM 3104  C CG2  . THR A 1 57  ? -5.372  12.768  -14.667 1.00 0.00 ? 57  THR A CG2  2  
ATOM 3105  H H    . THR A 1 57  ? -4.174  9.057   -12.602 1.00 0.00 ? 57  THR A H    2  
ATOM 3106  H HA   . THR A 1 57  ? -6.328  10.974  -13.213 1.00 0.00 ? 57  THR A HA   2  
ATOM 3107  H HB   . THR A 1 57  ? -3.955  11.195  -14.979 1.00 0.00 ? 57  THR A HB   2  
ATOM 3108  H HG1  . THR A 1 57  ? -2.854  12.447  -13.598 1.00 0.00 ? 57  THR A HG1  2  
ATOM 3109  H HG21 . THR A 1 57  ? -6.102  12.397  -15.371 1.00 0.00 ? 57  THR A HG21 2  
ATOM 3110  H HG22 . THR A 1 57  ? -5.880  13.233  -13.834 1.00 0.00 ? 57  THR A HG22 2  
ATOM 3111  H HG23 . THR A 1 57  ? -4.740  13.496  -15.153 1.00 0.00 ? 57  THR A HG23 2  
ATOM 3112  N N    . VAL A 1 58  ? -4.826  8.653   -14.987 1.00 0.00 ? 58  VAL A N    2  
ATOM 3113  C CA   . VAL A 1 58  ? -5.077  7.624   -16.042 1.00 0.00 ? 58  VAL A CA   2  
ATOM 3114  C C    . VAL A 1 58  ? -5.397  6.280   -15.383 1.00 0.00 ? 58  VAL A C    2  
ATOM 3115  O O    . VAL A 1 58  ? -5.537  6.189   -14.178 1.00 0.00 ? 58  VAL A O    2  
ATOM 3116  C CB   . VAL A 1 58  ? -3.833  7.480   -16.922 1.00 0.00 ? 58  VAL A CB   2  
ATOM 3117  C CG1  . VAL A 1 58  ? -3.637  8.756   -17.742 1.00 0.00 ? 58  VAL A CG1  2  
ATOM 3118  C CG2  . VAL A 1 58  ? -2.609  7.253   -16.034 1.00 0.00 ? 58  VAL A CG2  2  
ATOM 3119  H H    . VAL A 1 58  ? -3.953  8.695   -14.545 1.00 0.00 ? 58  VAL A H    2  
ATOM 3120  H HA   . VAL A 1 58  ? -5.911  7.932   -16.651 1.00 0.00 ? 58  VAL A HA   2  
ATOM 3121  H HB   . VAL A 1 58  ? -3.959  6.639   -17.589 1.00 0.00 ? 58  VAL A HB   2  
ATOM 3122  H HG11 . VAL A 1 58  ? -4.596  9.118   -18.079 1.00 0.00 ? 58  VAL A HG11 2  
ATOM 3123  H HG12 . VAL A 1 58  ? -3.163  9.508   -17.129 1.00 0.00 ? 58  VAL A HG12 2  
ATOM 3124  H HG13 . VAL A 1 58  ? -3.012  8.541   -18.596 1.00 0.00 ? 58  VAL A HG13 2  
ATOM 3125  H HG21 . VAL A 1 58  ? -2.855  6.539   -15.262 1.00 0.00 ? 58  VAL A HG21 2  
ATOM 3126  H HG22 . VAL A 1 58  ? -1.796  6.874   -16.632 1.00 0.00 ? 58  VAL A HG22 2  
ATOM 3127  H HG23 . VAL A 1 58  ? -2.319  8.189   -15.580 1.00 0.00 ? 58  VAL A HG23 2  
ATOM 3128  N N    . ARG A 1 59  ? -5.513  5.236   -16.167 1.00 0.00 ? 59  ARG A N    2  
ATOM 3129  C CA   . ARG A 1 59  ? -5.824  3.890   -15.596 1.00 0.00 ? 59  ARG A CA   2  
ATOM 3130  C C    . ARG A 1 59  ? -4.719  3.479   -14.619 1.00 0.00 ? 59  ARG A C    2  
ATOM 3131  O O    . ARG A 1 59  ? -3.630  4.023   -14.639 1.00 0.00 ? 59  ARG A O    2  
ATOM 3132  C CB   . ARG A 1 59  ? -5.912  2.863   -16.728 1.00 0.00 ? 59  ARG A CB   2  
ATOM 3133  C CG   . ARG A 1 59  ? -6.960  1.804   -16.377 1.00 0.00 ? 59  ARG A CG   2  
ATOM 3134  C CD   . ARG A 1 59  ? -6.985  0.726   -17.464 1.00 0.00 ? 59  ARG A CD   2  
ATOM 3135  N NE   . ARG A 1 59  ? -8.079  1.022   -18.431 1.00 0.00 ? 59  ARG A NE   2  
ATOM 3136  C CZ   . ARG A 1 59  ? -8.401  0.143   -19.342 1.00 0.00 ? 59  ARG A CZ   2  
ATOM 3137  N NH1  . ARG A 1 59  ? -7.662  0.010   -20.409 1.00 0.00 ? 59  ARG A NH1  2  
ATOM 3138  N NH2  . ARG A 1 59  ? -9.461  -0.601  -19.184 1.00 0.00 ? 59  ARG A NH2  2  
ATOM 3139  H H    . ARG A 1 59  ? -5.396  5.338   -17.135 1.00 0.00 ? 59  ARG A H    2  
ATOM 3140  H HA   . ARG A 1 59  ? -6.769  3.931   -15.074 1.00 0.00 ? 59  ARG A HA   2  
ATOM 3141  H HB2  . ARG A 1 59  ? -6.195  3.362   -17.644 1.00 0.00 ? 59  ARG A HB2  2  
ATOM 3142  H HB3  . ARG A 1 59  ? -4.952  2.388   -16.859 1.00 0.00 ? 59  ARG A HB3  2  
ATOM 3143  H HG2  . ARG A 1 59  ? -6.710  1.352   -15.428 1.00 0.00 ? 59  ARG A HG2  2  
ATOM 3144  H HG3  . ARG A 1 59  ? -7.932  2.267   -16.311 1.00 0.00 ? 59  ARG A HG3  2  
ATOM 3145  H HD2  . ARG A 1 59  ? -6.038  0.714   -17.984 1.00 0.00 ? 59  ARG A HD2  2  
ATOM 3146  H HD3  . ARG A 1 59  ? -7.158  -0.238  -17.009 1.00 0.00 ? 59  ARG A HD3  2  
ATOM 3147  H HE   . ARG A 1 59  ? -8.558  1.875   -18.383 1.00 0.00 ? 59  ARG A HE   2  
ATOM 3148  H HH11 . ARG A 1 59  ? -6.849  0.580   -20.529 1.00 0.00 ? 59  ARG A HH11 2  
ATOM 3149  H HH12 . ARG A 1 59  ? -7.908  -0.663  -21.107 1.00 0.00 ? 59  ARG A HH12 2  
ATOM 3150  H HH21 . ARG A 1 59  ? -10.027 -0.499  -18.366 1.00 0.00 ? 59  ARG A HH21 2  
ATOM 3151  H HH22 . ARG A 1 59  ? -9.708  -1.274  -19.882 1.00 0.00 ? 59  ARG A HH22 2  
ATOM 3152  N N    . THR A 1 60  ? -4.994  2.529   -13.762 1.00 0.00 ? 60  THR A N    2  
ATOM 3153  C CA   . THR A 1 60  ? -3.966  2.082   -12.777 1.00 0.00 ? 60  THR A CA   2  
ATOM 3154  C C    . THR A 1 60  ? -4.357  0.717   -12.210 1.00 0.00 ? 60  THR A C    2  
ATOM 3155  O O    . THR A 1 60  ? -5.512  0.333   -12.234 1.00 0.00 ? 60  THR A O    2  
ATOM 3156  C CB   . THR A 1 60  ? -3.885  3.100   -11.637 1.00 0.00 ? 60  THR A CB   2  
ATOM 3157  O OG1  . THR A 1 60  ? -3.727  4.404   -12.179 1.00 0.00 ? 60  THR A OG1  2  
ATOM 3158  C CG2  . THR A 1 60  ? -2.694  2.774   -10.735 1.00 0.00 ? 60  THR A CG2  2  
ATOM 3159  H H    . THR A 1 60  ? -5.880  2.110   -13.766 1.00 0.00 ? 60  THR A H    2  
ATOM 3160  H HA   . THR A 1 60  ? -3.005  2.009   -13.265 1.00 0.00 ? 60  THR A HA   2  
ATOM 3161  H HB   . THR A 1 60  ? -4.792  3.060   -11.055 1.00 0.00 ? 60  THR A HB   2  
ATOM 3162  H HG1  . THR A 1 60  ? -2.854  4.456   -12.577 1.00 0.00 ? 60  THR A HG1  2  
ATOM 3163  H HG21 . THR A 1 60  ? -1.964  2.205   -11.291 1.00 0.00 ? 60  THR A HG21 2  
ATOM 3164  H HG22 . THR A 1 60  ? -2.245  3.692   -10.387 1.00 0.00 ? 60  THR A HG22 2  
ATOM 3165  H HG23 . THR A 1 60  ? -3.033  2.195   -9.888  1.00 0.00 ? 60  THR A HG23 2  
ATOM 3166  N N    . THR A 1 61  ? -3.402  -0.016  -11.697 1.00 0.00 ? 61  THR A N    2  
ATOM 3167  C CA   . THR A 1 61  ? -3.706  -1.357  -11.121 1.00 0.00 ? 61  THR A CA   2  
ATOM 3168  C C    . THR A 1 61  ? -4.633  -1.195  -9.916  1.00 0.00 ? 61  THR A C    2  
ATOM 3169  O O    . THR A 1 61  ? -4.811  -0.106  -9.403  1.00 0.00 ? 61  THR A O    2  
ATOM 3170  C CB   . THR A 1 61  ? -2.408  -2.028  -10.679 1.00 0.00 ? 61  THR A CB   2  
ATOM 3171  O OG1  . THR A 1 61  ? -1.422  -1.863  -11.689 1.00 0.00 ? 61  THR A OG1  2  
ATOM 3172  C CG2  . THR A 1 61  ? -2.656  -3.517  -10.440 1.00 0.00 ? 61  THR A CG2  2  
ATOM 3173  H H    . THR A 1 61  ? -2.481  0.320   -11.689 1.00 0.00 ? 61  THR A H    2  
ATOM 3174  H HA   . THR A 1 61  ? -4.187  -1.968  -11.865 1.00 0.00 ? 61  THR A HA   2  
ATOM 3175  H HB   . THR A 1 61  ? -2.069  -1.574  -9.766  1.00 0.00 ? 61  THR A HB   2  
ATOM 3176  H HG1  . THR A 1 61  ? -0.568  -1.779  -11.258 1.00 0.00 ? 61  THR A HG1  2  
ATOM 3177  H HG21 . THR A 1 61  ? -3.357  -3.888  -11.174 1.00 0.00 ? 61  THR A HG21 2  
ATOM 3178  H HG22 . THR A 1 61  ? -1.724  -4.056  -10.528 1.00 0.00 ? 61  THR A HG22 2  
ATOM 3179  H HG23 . THR A 1 61  ? -3.063  -3.660  -9.450  1.00 0.00 ? 61  THR A HG23 2  
ATOM 3180  N N    . GLU A 1 62  ? -5.222  -2.271  -9.461  1.00 0.00 ? 62  GLU A N    2  
ATOM 3181  C CA   . GLU A 1 62  ? -6.140  -2.189  -8.289  1.00 0.00 ? 62  GLU A CA   2  
ATOM 3182  C C    . GLU A 1 62  ? -6.526  -3.606  -7.849  1.00 0.00 ? 62  GLU A C    2  
ATOM 3183  O O    . GLU A 1 62  ? -6.781  -4.465  -8.673  1.00 0.00 ? 62  GLU A O    2  
ATOM 3184  C CB   . GLU A 1 62  ? -7.389  -1.371  -8.675  1.00 0.00 ? 62  GLU A CB   2  
ATOM 3185  C CG   . GLU A 1 62  ? -8.211  -2.077  -9.756  1.00 0.00 ? 62  GLU A CG   2  
ATOM 3186  C CD   . GLU A 1 62  ? -7.504  -1.964  -11.108 1.00 0.00 ? 62  GLU A CD   2  
ATOM 3187  O OE1  . GLU A 1 62  ? -7.619  -0.919  -11.728 1.00 0.00 ? 62  GLU A OE1  2  
ATOM 3188  O OE2  . GLU A 1 62  ? -6.861  -2.923  -11.501 1.00 0.00 ? 62  GLU A OE2  2  
ATOM 3189  H H    . GLU A 1 62  ? -5.061  -3.136  -9.894  1.00 0.00 ? 62  GLU A H    2  
ATOM 3190  H HA   . GLU A 1 62  ? -5.629  -1.694  -7.475  1.00 0.00 ? 62  GLU A HA   2  
ATOM 3191  H HB2  . GLU A 1 62  ? -8.007  -1.230  -7.804  1.00 0.00 ? 62  GLU A HB2  2  
ATOM 3192  H HB3  . GLU A 1 62  ? -7.076  -0.408  -9.049  1.00 0.00 ? 62  GLU A HB3  2  
ATOM 3193  H HG2  . GLU A 1 62  ? -8.333  -3.115  -9.494  1.00 0.00 ? 62  GLU A HG2  2  
ATOM 3194  H HG3  . GLU A 1 62  ? -9.184  -1.609  -9.820  1.00 0.00 ? 62  GLU A HG3  2  
ATOM 3195  N N    . ILE A 1 63  ? -6.564  -3.864  -6.559  1.00 0.00 ? 63  ILE A N    2  
ATOM 3196  C CA   . ILE A 1 63  ? -6.932  -5.236  -6.095  1.00 0.00 ? 63  ILE A CA   2  
ATOM 3197  C C    . ILE A 1 63  ? -8.430  -5.325  -5.861  1.00 0.00 ? 63  ILE A C    2  
ATOM 3198  O O    . ILE A 1 63  ? -8.953  -4.811  -4.890  1.00 0.00 ? 63  ILE A O    2  
ATOM 3199  C CB   . ILE A 1 63  ? -6.196  -5.622  -4.805  1.00 0.00 ? 63  ILE A CB   2  
ATOM 3200  C CG1  . ILE A 1 63  ? -6.208  -4.475  -3.795  1.00 0.00 ? 63  ILE A CG1  2  
ATOM 3201  C CG2  . ILE A 1 63  ? -4.756  -5.985  -5.136  1.00 0.00 ? 63  ILE A CG2  2  
ATOM 3202  C CD1  . ILE A 1 63  ? -5.667  -4.992  -2.460  1.00 0.00 ? 63  ILE A CD1  2  
ATOM 3203  H H    . ILE A 1 63  ? -6.350  -3.163  -5.910  1.00 0.00 ? 63  ILE A H    2  
ATOM 3204  H HA   . ILE A 1 63  ? -6.666  -5.941  -6.863  1.00 0.00 ? 63  ILE A HA   2  
ATOM 3205  H HB   . ILE A 1 63  ? -6.679  -6.486  -4.368  1.00 0.00 ? 63  ILE A HB   2  
ATOM 3206  H HG12 . ILE A 1 63  ? -5.584  -3.670  -4.151  1.00 0.00 ? 63  ILE A HG12 2  
ATOM 3207  H HG13 . ILE A 1 63  ? -7.218  -4.122  -3.658  1.00 0.00 ? 63  ILE A HG13 2  
ATOM 3208  H HG21 . ILE A 1 63  ? -4.392  -5.331  -5.913  1.00 0.00 ? 63  ILE A HG21 2  
ATOM 3209  H HG22 . ILE A 1 63  ? -4.147  -5.874  -4.253  1.00 0.00 ? 63  ILE A HG22 2  
ATOM 3210  H HG23 . ILE A 1 63  ? -4.716  -7.009  -5.476  1.00 0.00 ? 63  ILE A HG23 2  
ATOM 3211  H HD11 . ILE A 1 63  ? -6.072  -5.974  -2.266  1.00 0.00 ? 63  ILE A HD11 2  
ATOM 3212  H HD12 . ILE A 1 63  ? -4.590  -5.050  -2.507  1.00 0.00 ? 63  ILE A HD12 2  
ATOM 3213  H HD13 . ILE A 1 63  ? -5.956  -4.324  -1.668  1.00 0.00 ? 63  ILE A HD13 2  
ATOM 3214  N N    . ASN A 1 64  ? -9.117  -6.014  -6.730  1.00 0.00 ? 64  ASN A N    2  
ATOM 3215  C CA   . ASN A 1 64  ? -10.575 -6.196  -6.549  1.00 0.00 ? 64  ASN A CA   2  
ATOM 3216  C C    . ASN A 1 64  ? -10.733 -7.533  -5.857  1.00 0.00 ? 64  ASN A C    2  
ATOM 3217  O O    . ASN A 1 64  ? -10.930 -8.558  -6.482  1.00 0.00 ? 64  ASN A O    2  
ATOM 3218  C CB   . ASN A 1 64  ? -11.298 -6.213  -7.901  1.00 0.00 ? 64  ASN A CB   2  
ATOM 3219  C CG   . ASN A 1 64  ? -10.824 -5.047  -8.775  1.00 0.00 ? 64  ASN A CG   2  
ATOM 3220  O OD1  . ASN A 1 64  ? -10.803 -5.153  -9.985  1.00 0.00 ? 64  ASN A OD1  2  
ATOM 3221  N ND2  . ASN A 1 64  ? -10.438 -3.932  -8.215  1.00 0.00 ? 64  ASN A ND2  2  
ATOM 3222  H H    . ASN A 1 64  ? -8.661  -6.441  -7.481  1.00 0.00 ? 64  ASN A H    2  
ATOM 3223  H HA   . ASN A 1 64  ? -10.957 -5.406  -5.916  1.00 0.00 ? 64  ASN A HA   2  
ATOM 3224  H HB2  . ASN A 1 64  ? -11.089 -7.145  -8.406  1.00 0.00 ? 64  ASN A HB2  2  
ATOM 3225  H HB3  . ASN A 1 64  ? -12.362 -6.126  -7.739  1.00 0.00 ? 64  ASN A HB3  2  
ATOM 3226  H HD21 . ASN A 1 64  ? -10.446 -3.841  -7.240  1.00 0.00 ? 64  ASN A HD21 2  
ATOM 3227  H HD22 . ASN A 1 64  ? -10.162 -3.180  -8.771  1.00 0.00 ? 64  ASN A HD22 2  
ATOM 3228  N N    . PHE A 1 65  ? -10.572 -7.525  -4.572  1.00 0.00 ? 65  PHE A N    2  
ATOM 3229  C CA   . PHE A 1 65  ? -10.622 -8.788  -3.801  1.00 0.00 ? 65  PHE A CA   2  
ATOM 3230  C C    . PHE A 1 65  ? -11.688 -8.707  -2.704  1.00 0.00 ? 65  PHE A C    2  
ATOM 3231  O O    . PHE A 1 65  ? -12.542 -7.849  -2.704  1.00 0.00 ? 65  PHE A O    2  
ATOM 3232  C CB   . PHE A 1 65  ? -9.226  -8.981  -3.161  1.00 0.00 ? 65  PHE A CB   2  
ATOM 3233  C CG   . PHE A 1 65  ? -9.012  -7.936  -2.068  1.00 0.00 ? 65  PHE A CG   2  
ATOM 3234  C CD1  . PHE A 1 65  ? -8.611  -6.633  -2.402  1.00 0.00 ? 65  PHE A CD1  2  
ATOM 3235  C CD2  . PHE A 1 65  ? -9.263  -8.260  -0.724  1.00 0.00 ? 65  PHE A CD2  2  
ATOM 3236  C CE1  . PHE A 1 65  ? -8.459  -5.669  -1.412  1.00 0.00 ? 65  PHE A CE1  2  
ATOM 3237  C CE2  . PHE A 1 65  ? -9.116  -7.287  0.268   1.00 0.00 ? 65  PHE A CE2  2  
ATOM 3238  C CZ   . PHE A 1 65  ? -8.715  -5.991  -0.074  1.00 0.00 ? 65  PHE A CZ   2  
ATOM 3239  H H    . PHE A 1 65  ? -10.366 -6.682  -4.116  1.00 0.00 ? 65  PHE A H    2  
ATOM 3240  H HA   . PHE A 1 65  ? -10.833 -9.615  -4.461  1.00 0.00 ? 65  PHE A HA   2  
ATOM 3241  H HB2  . PHE A 1 65  ? -9.158  -9.970  -2.735  1.00 0.00 ? 65  PHE A HB2  2  
ATOM 3242  H HB3  . PHE A 1 65  ? -8.466  -8.865  -3.919  1.00 0.00 ? 65  PHE A HB3  2  
ATOM 3243  H HD1  . PHE A 1 65  ? -8.406  -6.371  -3.423  1.00 0.00 ? 65  PHE A HD1  2  
ATOM 3244  H HD2  . PHE A 1 65  ? -9.568  -9.258  -0.451  1.00 0.00 ? 65  PHE A HD2  2  
ATOM 3245  H HE1  . PHE A 1 65  ? -8.155  -4.672  -1.687  1.00 0.00 ? 65  PHE A HE1  2  
ATOM 3246  H HE2  . PHE A 1 65  ? -9.311  -7.538  1.299   1.00 0.00 ? 65  PHE A HE2  2  
ATOM 3247  H HZ   . PHE A 1 65  ? -8.608  -5.241  0.692   1.00 0.00 ? 65  PHE A HZ   2  
ATOM 3248  N N    . LYS A 1 66  ? -11.578 -9.584  -1.753  1.00 0.00 ? 66  LYS A N    2  
ATOM 3249  C CA   . LYS A 1 66  ? -12.483 -9.602  -0.588  1.00 0.00 ? 66  LYS A CA   2  
ATOM 3250  C C    . LYS A 1 66  ? -11.648 -10.166 0.551   1.00 0.00 ? 66  LYS A C    2  
ATOM 3251  O O    . LYS A 1 66  ? -11.079 -11.234 0.430   1.00 0.00 ? 66  LYS A O    2  
ATOM 3252  C CB   . LYS A 1 66  ? -13.708 -10.478 -0.855  1.00 0.00 ? 66  LYS A CB   2  
ATOM 3253  C CG   . LYS A 1 66  ? -13.288 -11.802 -1.499  1.00 0.00 ? 66  LYS A CG   2  
ATOM 3254  C CD   . LYS A 1 66  ? -13.537 -11.744 -3.008  1.00 0.00 ? 66  LYS A CD   2  
ATOM 3255  C CE   . LYS A 1 66  ? -15.013 -12.029 -3.294  1.00 0.00 ? 66  LYS A CE   2  
ATOM 3256  N NZ   . LYS A 1 66  ? -15.408 -11.367 -4.569  1.00 0.00 ? 66  LYS A NZ   2  
ATOM 3257  H H    . LYS A 1 66  ? -10.852 -10.234 -1.788  1.00 0.00 ? 66  LYS A H    2  
ATOM 3258  H HA   . LYS A 1 66  ? -12.785 -8.593  -0.346  1.00 0.00 ? 66  LYS A HA   2  
ATOM 3259  H HB2  . LYS A 1 66  ? -14.206 -10.678 0.079   1.00 0.00 ? 66  LYS A HB2  2  
ATOM 3260  H HB3  . LYS A 1 66  ? -14.379 -9.954  -1.515  1.00 0.00 ? 66  LYS A HB3  2  
ATOM 3261  H HG2  . LYS A 1 66  ? -12.240 -11.975 -1.314  1.00 0.00 ? 66  LYS A HG2  2  
ATOM 3262  H HG3  . LYS A 1 66  ? -13.868 -12.605 -1.071  1.00 0.00 ? 66  LYS A HG3  2  
ATOM 3263  H HD2  . LYS A 1 66  ? -13.281 -10.761 -3.377  1.00 0.00 ? 66  LYS A HD2  2  
ATOM 3264  H HD3  . LYS A 1 66  ? -12.927 -12.485 -3.503  1.00 0.00 ? 66  LYS A HD3  2  
ATOM 3265  H HE2  . LYS A 1 66  ? -15.163 -13.095 -3.380  1.00 0.00 ? 66  LYS A HE2  2  
ATOM 3266  H HE3  . LYS A 1 66  ? -15.617 -11.644 -2.486  1.00 0.00 ? 66  LYS A HE3  2  
ATOM 3267  H HZ1  . LYS A 1 66  ? -14.940 -10.442 -4.639  1.00 0.00 ? 66  LYS A HZ1  2  
ATOM 3268  H HZ2  . LYS A 1 66  ? -15.120 -11.961 -5.372  1.00 0.00 ? 66  LYS A HZ2  2  
ATOM 3269  H HZ3  . LYS A 1 66  ? -16.441 -11.237 -4.585  1.00 0.00 ? 66  LYS A HZ3  2  
ATOM 3270  N N    . VAL A 1 67  ? -11.511 -9.431  1.625   1.00 0.00 ? 67  VAL A N    2  
ATOM 3271  C CA   . VAL A 1 67  ? -10.647 -9.883  2.763   1.00 0.00 ? 67  VAL A CA   2  
ATOM 3272  C C    . VAL A 1 67  ? -10.893 -11.364 3.087   1.00 0.00 ? 67  VAL A C    2  
ATOM 3273  O O    . VAL A 1 67  ? -11.993 -11.869 2.972   1.00 0.00 ? 67  VAL A O    2  
ATOM 3274  C CB   . VAL A 1 67  ? -10.910 -9.009  3.987   1.00 0.00 ? 67  VAL A CB   2  
ATOM 3275  C CG1  . VAL A 1 67  ? -10.007 -9.463  5.135   1.00 0.00 ? 67  VAL A CG1  2  
ATOM 3276  C CG2  . VAL A 1 67  ? -10.575 -7.555  3.650   1.00 0.00 ? 67  VAL A CG2  2  
ATOM 3277  H H    . VAL A 1 67  ? -11.943 -8.559  1.665   1.00 0.00 ? 67  VAL A H    2  
ATOM 3278  H HA   . VAL A 1 67  ? -9.610  -9.765  2.472   1.00 0.00 ? 67  VAL A HA   2  
ATOM 3279  H HB   . VAL A 1 67  ? -11.951 -9.086  4.274   1.00 0.00 ? 67  VAL A HB   2  
ATOM 3280  H HG11 . VAL A 1 67  ? -9.122  -9.931  4.732   1.00 0.00 ? 67  VAL A HG11 2  
ATOM 3281  H HG12 . VAL A 1 67  ? -9.721  -8.607  5.729   1.00 0.00 ? 67  VAL A HG12 2  
ATOM 3282  H HG13 . VAL A 1 67  ? -10.540 -10.169 5.752   1.00 0.00 ? 67  VAL A HG13 2  
ATOM 3283  H HG21 . VAL A 1 67  ? -10.783 -7.364  2.611   1.00 0.00 ? 67  VAL A HG21 2  
ATOM 3284  H HG22 . VAL A 1 67  ? -11.169 -6.901  4.262   1.00 0.00 ? 67  VAL A HG22 2  
ATOM 3285  H HG23 . VAL A 1 67  ? -9.531  -7.376  3.845   1.00 0.00 ? 67  VAL A HG23 2  
ATOM 3286  N N    . GLY A 1 68  ? -9.847  -12.057 3.439   1.00 0.00 ? 68  GLY A N    2  
ATOM 3287  C CA   . GLY A 1 68  ? -9.959  -13.513 3.717   1.00 0.00 ? 68  GLY A CA   2  
ATOM 3288  C C    . GLY A 1 68  ? -9.505  -14.286 2.468   1.00 0.00 ? 68  GLY A C    2  
ATOM 3289  O O    . GLY A 1 68  ? -9.781  -15.462 2.324   1.00 0.00 ? 68  GLY A O    2  
ATOM 3290  H H    . GLY A 1 68  ? -8.970  -11.621 3.482   1.00 0.00 ? 68  GLY A H    2  
ATOM 3291  H HA2  . GLY A 1 68  ? -9.328  -13.772 4.556   1.00 0.00 ? 68  GLY A HA2  2  
ATOM 3292  H HA3  . GLY A 1 68  ? -10.984 -13.764 3.940   1.00 0.00 ? 68  GLY A HA3  2  
ATOM 3293  N N    . GLU A 1 69  ? -8.809  -13.628 1.559   1.00 0.00 ? 69  GLU A N    2  
ATOM 3294  C CA   . GLU A 1 69  ? -8.339  -14.311 0.323   1.00 0.00 ? 69  GLU A CA   2  
ATOM 3295  C C    . GLU A 1 69  ? -6.996  -13.714 -0.110  1.00 0.00 ? 69  GLU A C    2  
ATOM 3296  O O    . GLU A 1 69  ? -6.528  -12.736 0.449   1.00 0.00 ? 69  GLU A O    2  
ATOM 3297  C CB   . GLU A 1 69  ? -9.369  -14.118 -0.793  1.00 0.00 ? 69  GLU A CB   2  
ATOM 3298  C CG   . GLU A 1 69  ? -10.624 -14.938 -0.482  1.00 0.00 ? 69  GLU A CG   2  
ATOM 3299  C CD   . GLU A 1 69  ? -10.284 -16.430 -0.513  1.00 0.00 ? 69  GLU A CD   2  
ATOM 3300  O OE1  . GLU A 1 69  ? -9.554  -16.833 -1.403  1.00 0.00 ? 69  GLU A OE1  2  
ATOM 3301  O OE2  . GLU A 1 69  ? -10.760 -17.143 0.355   1.00 0.00 ? 69  GLU A OE2  2  
ATOM 3302  H H    . GLU A 1 69  ? -8.598  -12.681 1.692   1.00 0.00 ? 69  GLU A H    2  
ATOM 3303  H HA   . GLU A 1 69  ? -8.217  -15.363 0.522   1.00 0.00 ? 69  GLU A HA   2  
ATOM 3304  H HB2  . GLU A 1 69  ? -9.630  -13.071 -0.863  1.00 0.00 ? 69  GLU A HB2  2  
ATOM 3305  H HB3  . GLU A 1 69  ? -8.949  -14.448 -1.731  1.00 0.00 ? 69  GLU A HB3  2  
ATOM 3306  H HG2  . GLU A 1 69  ? -10.993 -14.672 0.498   1.00 0.00 ? 69  GLU A HG2  2  
ATOM 3307  H HG3  . GLU A 1 69  ? -11.382 -14.729 -1.221  1.00 0.00 ? 69  GLU A HG3  2  
ATOM 3308  N N    . GLU A 1 70  ? -6.366  -14.310 -1.091  1.00 0.00 ? 70  GLU A N    2  
ATOM 3309  C CA   . GLU A 1 70  ? -5.039  -13.805 -1.559  1.00 0.00 ? 70  GLU A CA   2  
ATOM 3310  C C    . GLU A 1 70  ? -5.093  -13.352 -3.013  1.00 0.00 ? 70  GLU A C    2  
ATOM 3311  O O    . GLU A 1 70  ? -5.999  -13.679 -3.755  1.00 0.00 ? 70  GLU A O    2  
ATOM 3312  C CB   . GLU A 1 70  ? -4.001  -14.930 -1.487  1.00 0.00 ? 70  GLU A CB   2  
ATOM 3313  C CG   . GLU A 1 70  ? -4.575  -16.218 -2.087  1.00 0.00 ? 70  GLU A CG   2  
ATOM 3314  C CD   . GLU A 1 70  ? -5.068  -17.135 -0.965  1.00 0.00 ? 70  GLU A CD   2  
ATOM 3315  O OE1  . GLU A 1 70  ? -5.860  -16.679 -0.158  1.00 0.00 ? 70  GLU A OE1  2  
ATOM 3316  O OE2  . GLU A 1 70  ? -4.644  -18.279 -0.933  1.00 0.00 ? 70  GLU A OE2  2  
ATOM 3317  H H    . GLU A 1 70  ? -6.758  -15.103 -1.505  1.00 0.00 ? 70  GLU A H    2  
ATOM 3318  H HA   . GLU A 1 70  ? -4.724  -12.985 -0.935  1.00 0.00 ? 70  GLU A HA   2  
ATOM 3319  H HB2  . GLU A 1 70  ? -3.127  -14.641 -2.050  1.00 0.00 ? 70  GLU A HB2  2  
ATOM 3320  H HB3  . GLU A 1 70  ? -3.725  -15.099 -0.469  1.00 0.00 ? 70  GLU A HB3  2  
ATOM 3321  H HG2  . GLU A 1 70  ? -5.399  -15.973 -2.741  1.00 0.00 ? 70  GLU A HG2  2  
ATOM 3322  H HG3  . GLU A 1 70  ? -3.806  -16.723 -2.651  1.00 0.00 ? 70  GLU A HG3  2  
ATOM 3323  N N    . PHE A 1 71  ? -4.068  -12.657 -3.430  1.00 0.00 ? 71  PHE A N    2  
ATOM 3324  C CA   . PHE A 1 71  ? -3.962  -12.228 -4.850  1.00 0.00 ? 71  PHE A CA   2  
ATOM 3325  C C    . PHE A 1 71  ? -2.639  -12.775 -5.363  1.00 0.00 ? 71  PHE A C    2  
ATOM 3326  O O    . PHE A 1 71  ? -1.949  -13.490 -4.666  1.00 0.00 ? 71  PHE A O    2  
ATOM 3327  C CB   . PHE A 1 71  ? -3.941  -10.691 -5.032  1.00 0.00 ? 71  PHE A CB   2  
ATOM 3328  C CG   . PHE A 1 71  ? -4.619  -9.940  -3.906  1.00 0.00 ? 71  PHE A CG   2  
ATOM 3329  C CD1  . PHE A 1 71  ? -5.824  -10.389 -3.355  1.00 0.00 ? 71  PHE A CD1  2  
ATOM 3330  C CD2  . PHE A 1 71  ? -4.038  -8.753  -3.441  1.00 0.00 ? 71  PHE A CD2  2  
ATOM 3331  C CE1  . PHE A 1 71  ? -6.438  -9.648  -2.334  1.00 0.00 ? 71  PHE A CE1  2  
ATOM 3332  C CE2  . PHE A 1 71  ? -4.659  -8.015  -2.431  1.00 0.00 ? 71  PHE A CE2  2  
ATOM 3333  C CZ   . PHE A 1 71  ? -5.852  -8.461  -1.879  1.00 0.00 ? 71  PHE A CZ   2  
ATOM 3334  H H    . PHE A 1 71  ? -3.331  -12.467 -2.812  1.00 0.00 ? 71  PHE A H    2  
ATOM 3335  H HA   . PHE A 1 71  ? -4.766  -12.657 -5.421  1.00 0.00 ? 71  PHE A HA   2  
ATOM 3336  H HB2  . PHE A 1 71  ? -2.917  -10.356 -5.094  1.00 0.00 ? 71  PHE A HB2  2  
ATOM 3337  H HB3  . PHE A 1 71  ? -4.438  -10.449 -5.961  1.00 0.00 ? 71  PHE A HB3  2  
ATOM 3338  H HD1  . PHE A 1 71  ? -6.277  -11.301 -3.709  1.00 0.00 ? 71  PHE A HD1  2  
ATOM 3339  H HD2  . PHE A 1 71  ? -3.108  -8.406  -3.866  1.00 0.00 ? 71  PHE A HD2  2  
ATOM 3340  H HE1  . PHE A 1 71  ? -7.363  -9.991  -1.897  1.00 0.00 ? 71  PHE A HE1  2  
ATOM 3341  H HE2  . PHE A 1 71  ? -4.210  -7.103  -2.069  1.00 0.00 ? 71  PHE A HE2  2  
ATOM 3342  H HZ   . PHE A 1 71  ? -6.331  -7.878  -1.112  1.00 0.00 ? 71  PHE A HZ   2  
ATOM 3343  N N    . GLU A 1 72  ? -2.268  -12.422 -6.554  1.00 0.00 ? 72  GLU A N    2  
ATOM 3344  C CA   . GLU A 1 72  ? -0.966  -12.892 -7.099  1.00 0.00 ? 72  GLU A CA   2  
ATOM 3345  C C    . GLU A 1 72  ? -0.137  -11.682 -7.495  1.00 0.00 ? 72  GLU A C    2  
ATOM 3346  O O    . GLU A 1 72  ? -0.661  -10.603 -7.704  1.00 0.00 ? 72  GLU A O    2  
ATOM 3347  C CB   . GLU A 1 72  ? -1.181  -13.770 -8.322  1.00 0.00 ? 72  GLU A CB   2  
ATOM 3348  C CG   . GLU A 1 72  ? -2.134  -14.905 -7.965  1.00 0.00 ? 72  GLU A CG   2  
ATOM 3349  C CD   . GLU A 1 72  ? -2.747  -15.485 -9.241  1.00 0.00 ? 72  GLU A CD   2  
ATOM 3350  O OE1  . GLU A 1 72  ? -3.245  -14.710 -10.041 1.00 0.00 ? 72  GLU A OE1  2  
ATOM 3351  O OE2  . GLU A 1 72  ? -2.706  -16.694 -9.397  1.00 0.00 ? 72  GLU A OE2  2  
ATOM 3352  H H    . GLU A 1 72  ? -2.838  -11.831 -7.080  1.00 0.00 ? 72  GLU A H    2  
ATOM 3353  H HA   . GLU A 1 72  ? -0.446  -13.453 -6.341  1.00 0.00 ? 72  GLU A HA   2  
ATOM 3354  H HB2  . GLU A 1 72  ? -1.595  -13.176 -9.114  1.00 0.00 ? 72  GLU A HB2  2  
ATOM 3355  H HB3  . GLU A 1 72  ? -0.235  -14.184 -8.638  1.00 0.00 ? 72  GLU A HB3  2  
ATOM 3356  H HG2  . GLU A 1 72  ? -1.587  -15.675 -7.442  1.00 0.00 ? 72  GLU A HG2  2  
ATOM 3357  H HG3  . GLU A 1 72  ? -2.918  -14.526 -7.329  1.00 0.00 ? 72  GLU A HG3  2  
ATOM 3358  N N    . GLU A 1 73  ? 1.149   -11.852 -7.595  1.00 0.00 ? 73  GLU A N    2  
ATOM 3359  C CA   . GLU A 1 73  ? 2.018   -10.698 -7.978  1.00 0.00 ? 73  GLU A CA   2  
ATOM 3360  C C    . GLU A 1 73  ? 3.440   -11.164 -8.294  1.00 0.00 ? 73  GLU A C    2  
ATOM 3361  O O    . GLU A 1 73  ? 3.747   -12.338 -8.272  1.00 0.00 ? 73  GLU A O    2  
ATOM 3362  C CB   . GLU A 1 73  ? 2.055   -9.694  -6.820  1.00 0.00 ? 73  GLU A CB   2  
ATOM 3363  C CG   . GLU A 1 73  ? 2.004   -8.267  -7.371  1.00 0.00 ? 73  GLU A CG   2  
ATOM 3364  C CD   . GLU A 1 73  ? 1.309   -7.354  -6.359  1.00 0.00 ? 73  GLU A CD   2  
ATOM 3365  O OE1  . GLU A 1 73  ? 0.150   -7.600  -6.068  1.00 0.00 ? 73  GLU A OE1  2  
ATOM 3366  O OE2  . GLU A 1 73  ? 1.948   -6.425  -5.892  1.00 0.00 ? 73  GLU A OE2  2  
ATOM 3367  H H    . GLU A 1 73  ? 1.535   -12.737 -7.415  1.00 0.00 ? 73  GLU A H    2  
ATOM 3368  H HA   . GLU A 1 73  ? 1.603   -10.220 -8.849  1.00 0.00 ? 73  GLU A HA   2  
ATOM 3369  H HB2  . GLU A 1 73  ? 1.204   -9.860  -6.174  1.00 0.00 ? 73  GLU A HB2  2  
ATOM 3370  H HB3  . GLU A 1 73  ? 2.965   -9.827  -6.254  1.00 0.00 ? 73  GLU A HB3  2  
ATOM 3371  H HG2  . GLU A 1 73  ? 3.010   -7.913  -7.546  1.00 0.00 ? 73  GLU A HG2  2  
ATOM 3372  H HG3  . GLU A 1 73  ? 1.452   -8.259  -8.299  1.00 0.00 ? 73  GLU A HG3  2  
ATOM 3373  N N    . GLN A 1 74  ? 4.304   -10.229 -8.589  1.00 0.00 ? 74  GLN A N    2  
ATOM 3374  C CA   . GLN A 1 74  ? 5.724   -10.565 -8.911  1.00 0.00 ? 74  GLN A CA   2  
ATOM 3375  C C    . GLN A 1 74  ? 6.626   -9.427  -8.429  1.00 0.00 ? 74  GLN A C    2  
ATOM 3376  O O    . GLN A 1 74  ? 6.329   -8.266  -8.640  1.00 0.00 ? 74  GLN A O    2  
ATOM 3377  C CB   . GLN A 1 74  ? 5.889   -10.723 -10.421 1.00 0.00 ? 74  GLN A CB   2  
ATOM 3378  C CG   . GLN A 1 74  ? 5.208   -12.013 -10.882 1.00 0.00 ? 74  GLN A CG   2  
ATOM 3379  C CD   . GLN A 1 74  ? 5.172   -12.053 -12.411 1.00 0.00 ? 74  GLN A CD   2  
ATOM 3380  O OE1  . GLN A 1 74  ? 6.160   -11.772 -13.061 1.00 0.00 ? 74  GLN A OE1  2  
ATOM 3381  N NE2  . GLN A 1 74  ? 4.067   -12.392 -13.016 1.00 0.00 ? 74  GLN A NE2  2  
ATOM 3382  H H    . GLN A 1 74  ? 4.012   -9.294  -8.598  1.00 0.00 ? 74  GLN A H    2  
ATOM 3383  H HA   . GLN A 1 74  ? 6.001   -11.484 -8.416  1.00 0.00 ? 74  GLN A HA   2  
ATOM 3384  H HB2  . GLN A 1 74  ? 5.439   -9.877  -10.919 1.00 0.00 ? 74  GLN A HB2  2  
ATOM 3385  H HB3  . GLN A 1 74  ? 6.941   -10.765 -10.662 1.00 0.00 ? 74  GLN A HB3  2  
ATOM 3386  H HG2  . GLN A 1 74  ? 5.762   -12.864 -10.512 1.00 0.00 ? 74  GLN A HG2  2  
ATOM 3387  H HG3  . GLN A 1 74  ? 4.199   -12.045 -10.500 1.00 0.00 ? 74  GLN A HG3  2  
ATOM 3388  H HE21 . GLN A 1 74  ? 3.271   -12.618 -12.492 1.00 0.00 ? 74  GLN A HE21 2  
ATOM 3389  H HE22 . GLN A 1 74  ? 4.034   -12.420 -13.996 1.00 0.00 ? 74  GLN A HE22 2  
ATOM 3390  N N    . THR A 1 75  ? 7.720   -9.746  -7.780  1.00 0.00 ? 75  THR A N    2  
ATOM 3391  C CA   . THR A 1 75  ? 8.631   -8.671  -7.285  1.00 0.00 ? 75  THR A CA   2  
ATOM 3392  C C    . THR A 1 75  ? 9.245   -7.928  -8.464  1.00 0.00 ? 75  THR A C    2  
ATOM 3393  O O    . THR A 1 75  ? 9.174   -8.357  -9.599  1.00 0.00 ? 75  THR A O    2  
ATOM 3394  C CB   . THR A 1 75  ? 9.762   -9.263  -6.433  1.00 0.00 ? 75  THR A CB   2  
ATOM 3395  O OG1  . THR A 1 75  ? 10.752  -8.269  -6.207  1.00 0.00 ? 75  THR A OG1  2  
ATOM 3396  C CG2  . THR A 1 75  ? 10.399  -10.452 -7.151  1.00 0.00 ? 75  THR A CG2  2  
ATOM 3397  H H    . THR A 1 75  ? 7.938   -10.688 -7.618  1.00 0.00 ? 75  THR A H    2  
ATOM 3398  H HA   . THR A 1 75  ? 8.065   -7.980  -6.687  1.00 0.00 ? 75  THR A HA   2  
ATOM 3399  H HB   . THR A 1 75  ? 9.368   -9.586  -5.487  1.00 0.00 ? 75  THR A HB   2  
ATOM 3400  H HG1  . THR A 1 75  ? 10.494  -7.764  -5.433  1.00 0.00 ? 75  THR A HG1  2  
ATOM 3401  H HG21 . THR A 1 75  ? 9.877   -10.642 -8.078  1.00 0.00 ? 75  THR A HG21 2  
ATOM 3402  H HG22 . THR A 1 75  ? 11.434  -10.229 -7.362  1.00 0.00 ? 75  THR A HG22 2  
ATOM 3403  H HG23 . THR A 1 75  ? 10.340  -11.325 -6.520  1.00 0.00 ? 75  THR A HG23 2  
ATOM 3404  N N    . VAL A 1 76  ? 9.862   -6.814  -8.185  1.00 0.00 ? 76  VAL A N    2  
ATOM 3405  C CA   . VAL A 1 76  ? 10.525  -5.992  -9.245  1.00 0.00 ? 76  VAL A CA   2  
ATOM 3406  C C    . VAL A 1 76  ? 11.401  -6.872  -10.154 1.00 0.00 ? 76  VAL A C    2  
ATOM 3407  O O    . VAL A 1 76  ? 11.495  -6.639  -11.344 1.00 0.00 ? 76  VAL A O    2  
ATOM 3408  C CB   . VAL A 1 76  ? 11.405  -4.922  -8.577  1.00 0.00 ? 76  VAL A CB   2  
ATOM 3409  C CG1  . VAL A 1 76  ? 10.531  -3.741  -8.146  1.00 0.00 ? 76  VAL A CG1  2  
ATOM 3410  C CG2  . VAL A 1 76  ? 12.127  -5.506  -7.343  1.00 0.00 ? 76  VAL A CG2  2  
ATOM 3411  H H    . VAL A 1 76  ? 9.898   -6.509  -7.257  1.00 0.00 ? 76  VAL A H    2  
ATOM 3412  H HA   . VAL A 1 76  ? 9.768   -5.505  -9.842  1.00 0.00 ? 76  VAL A HA   2  
ATOM 3413  H HB   . VAL A 1 76  ? 12.137  -4.577  -9.288  1.00 0.00 ? 76  VAL A HB   2  
ATOM 3414  H HG11 . VAL A 1 76  ? 9.540   -4.097  -7.905  1.00 0.00 ? 76  VAL A HG11 2  
ATOM 3415  H HG12 . VAL A 1 76  ? 10.965  -3.270  -7.277  1.00 0.00 ? 76  VAL A HG12 2  
ATOM 3416  H HG13 . VAL A 1 76  ? 10.470  -3.025  -8.952  1.00 0.00 ? 76  VAL A HG13 2  
ATOM 3417  H HG21 . VAL A 1 76  ? 12.032  -6.583  -7.346  1.00 0.00 ? 76  VAL A HG21 2  
ATOM 3418  H HG22 . VAL A 1 76  ? 13.170  -5.240  -7.373  1.00 0.00 ? 76  VAL A HG22 2  
ATOM 3419  H HG23 . VAL A 1 76  ? 11.679  -5.114  -6.440  1.00 0.00 ? 76  VAL A HG23 2  
ATOM 3420  N N    . ASP A 1 77  ? 12.035  -7.879  -9.602  1.00 0.00 ? 77  ASP A N    2  
ATOM 3421  C CA   . ASP A 1 77  ? 12.902  -8.776  -10.428 1.00 0.00 ? 77  ASP A CA   2  
ATOM 3422  C C    . ASP A 1 77  ? 13.545  -9.834  -9.527  1.00 0.00 ? 77  ASP A C    2  
ATOM 3423  O O    . ASP A 1 77  ? 14.332  -9.520  -8.653  1.00 0.00 ? 77  ASP A O    2  
ATOM 3424  C CB   . ASP A 1 77  ? 14.005  -7.952  -11.109 1.00 0.00 ? 77  ASP A CB   2  
ATOM 3425  C CG   . ASP A 1 77  ? 14.239  -8.479  -12.526 1.00 0.00 ? 77  ASP A CG   2  
ATOM 3426  O OD1  . ASP A 1 77  ? 14.894  -9.500  -12.657 1.00 0.00 ? 77  ASP A OD1  2  
ATOM 3427  O OD2  . ASP A 1 77  ? 13.760  -7.853  -13.457 1.00 0.00 ? 77  ASP A OD2  2  
ATOM 3428  H H    . ASP A 1 77  ? 11.939  -8.048  -8.643  1.00 0.00 ? 77  ASP A H    2  
ATOM 3429  H HA   . ASP A 1 77  ? 12.299  -9.263  -11.180 1.00 0.00 ? 77  ASP A HA   2  
ATOM 3430  H HB2  . ASP A 1 77  ? 13.703  -6.916  -11.155 1.00 0.00 ? 77  ASP A HB2  2  
ATOM 3431  H HB3  . ASP A 1 77  ? 14.920  -8.033  -10.541 1.00 0.00 ? 77  ASP A HB3  2  
ATOM 3432  N N    . GLY A 1 78  ? 13.219  -11.085 -9.737  1.00 0.00 ? 78  GLY A N    2  
ATOM 3433  C CA   . GLY A 1 78  ? 13.811  -12.169 -8.898  1.00 0.00 ? 78  GLY A CA   2  
ATOM 3434  C C    . GLY A 1 78  ? 12.888  -13.388 -8.910  1.00 0.00 ? 78  GLY A C    2  
ATOM 3435  O O    . GLY A 1 78  ? 13.001  -14.255 -9.756  1.00 0.00 ? 78  GLY A O    2  
ATOM 3436  H H    . GLY A 1 78  ? 12.585  -11.311 -10.448 1.00 0.00 ? 78  GLY A H    2  
ATOM 3437  H HA2  . GLY A 1 78  ? 14.778  -12.444 -9.297  1.00 0.00 ? 78  GLY A HA2  2  
ATOM 3438  H HA3  . GLY A 1 78  ? 13.926  -11.819 -7.884  1.00 0.00 ? 78  GLY A HA3  2  
ATOM 3439  N N    . ARG A 1 79  ? 11.977  -13.457 -7.975  1.00 0.00 ? 79  ARG A N    2  
ATOM 3440  C CA   . ARG A 1 79  ? 11.038  -14.615 -7.918  1.00 0.00 ? 79  ARG A CA   2  
ATOM 3441  C C    . ARG A 1 79  ? 9.594   -14.083 -7.898  1.00 0.00 ? 79  ARG A C    2  
ATOM 3442  O O    . ARG A 1 79  ? 9.395   -12.890 -7.818  1.00 0.00 ? 79  ARG A O    2  
ATOM 3443  C CB   . ARG A 1 79  ? 11.320  -15.423 -6.642  1.00 0.00 ? 79  ARG A CB   2  
ATOM 3444  C CG   . ARG A 1 79  ? 11.952  -16.773 -7.006  1.00 0.00 ? 79  ARG A CG   2  
ATOM 3445  C CD   . ARG A 1 79  ? 11.340  -17.883 -6.147  1.00 0.00 ? 79  ARG A CD   2  
ATOM 3446  N NE   . ARG A 1 79  ? 12.396  -18.873 -5.786  1.00 0.00 ? 79  ARG A NE   2  
ATOM 3447  C CZ   . ARG A 1 79  ? 13.001  -19.556 -6.721  1.00 0.00 ? 79  ARG A CZ   2  
ATOM 3448  N NH1  . ARG A 1 79  ? 12.317  -20.043 -7.721  1.00 0.00 ? 79  ARG A NH1  2  
ATOM 3449  N NH2  . ARG A 1 79  ? 14.290  -19.752 -6.655  1.00 0.00 ? 79  ARG A NH2  2  
ATOM 3450  H H    . ARG A 1 79  ? 11.910  -12.742 -7.304  1.00 0.00 ? 79  ARG A H    2  
ATOM 3451  H HA   . ARG A 1 79  ? 11.181  -15.239 -8.788  1.00 0.00 ? 79  ARG A HA   2  
ATOM 3452  H HB2  . ARG A 1 79  ? 12.003  -14.867 -6.014  1.00 0.00 ? 79  ARG A HB2  2  
ATOM 3453  H HB3  . ARG A 1 79  ? 10.398  -15.588 -6.104  1.00 0.00 ? 79  ARG A HB3  2  
ATOM 3454  H HG2  . ARG A 1 79  ? 11.771  -16.987 -8.050  1.00 0.00 ? 79  ARG A HG2  2  
ATOM 3455  H HG3  . ARG A 1 79  ? 13.016  -16.730 -6.828  1.00 0.00 ? 79  ARG A HG3  2  
ATOM 3456  H HD2  . ARG A 1 79  ? 10.926  -17.455 -5.246  1.00 0.00 ? 79  ARG A HD2  2  
ATOM 3457  H HD3  . ARG A 1 79  ? 10.558  -18.378 -6.703  1.00 0.00 ? 79  ARG A HD3  2  
ATOM 3458  H HE   . ARG A 1 79  ? 12.636  -19.012 -4.847  1.00 0.00 ? 79  ARG A HE   2  
ATOM 3459  H HH11 . ARG A 1 79  ? 11.330  -19.893 -7.772  1.00 0.00 ? 79  ARG A HH11 2  
ATOM 3460  H HH12 . ARG A 1 79  ? 12.781  -20.566 -8.436  1.00 0.00 ? 79  ARG A HH12 2  
ATOM 3461  H HH21 . ARG A 1 79  ? 14.814  -19.379 -5.890  1.00 0.00 ? 79  ARG A HH21 2  
ATOM 3462  H HH22 . ARG A 1 79  ? 14.753  -20.275 -7.371  1.00 0.00 ? 79  ARG A HH22 2  
ATOM 3463  N N    . PRO A 1 80  ? 8.615   -14.965 -7.967  1.00 0.00 ? 80  PRO A N    2  
ATOM 3464  C CA   . PRO A 1 80  ? 7.205   -14.542 -7.949  1.00 0.00 ? 80  PRO A CA   2  
ATOM 3465  C C    . PRO A 1 80  ? 6.802   -14.128 -6.532  1.00 0.00 ? 80  PRO A C    2  
ATOM 3466  O O    . PRO A 1 80  ? 7.615   -14.124 -5.626  1.00 0.00 ? 80  PRO A O    2  
ATOM 3467  C CB   . PRO A 1 80  ? 6.441   -15.783 -8.410  1.00 0.00 ? 80  PRO A CB   2  
ATOM 3468  C CG   . PRO A 1 80  ? 7.364   -16.991 -8.136  1.00 0.00 ? 80  PRO A CG   2  
ATOM 3469  C CD   . PRO A 1 80  ? 8.800   -16.437 -8.064  1.00 0.00 ? 80  PRO A CD   2  
ATOM 3470  H HA   . PRO A 1 80  ? 7.043   -13.733 -8.640  1.00 0.00 ? 80  PRO A HA   2  
ATOM 3471  H HB2  . PRO A 1 80  ? 5.522   -15.877 -7.851  1.00 0.00 ? 80  PRO A HB2  2  
ATOM 3472  H HB3  . PRO A 1 80  ? 6.230   -15.719 -9.466  1.00 0.00 ? 80  PRO A HB3  2  
ATOM 3473  H HG2  . PRO A 1 80  ? 7.095   -17.455 -7.198  1.00 0.00 ? 80  PRO A HG2  2  
ATOM 3474  H HG3  . PRO A 1 80  ? 7.289   -17.705 -8.940  1.00 0.00 ? 80  PRO A HG3  2  
ATOM 3475  H HD2  . PRO A 1 80  ? 9.305   -16.820 -7.189  1.00 0.00 ? 80  PRO A HD2  2  
ATOM 3476  H HD3  . PRO A 1 80  ? 9.348   -16.685 -8.959  1.00 0.00 ? 80  PRO A HD3  2  
ATOM 3477  N N    . CYS A 1 81  ? 5.559   -13.775 -6.336  1.00 0.00 ? 81  CYS A N    2  
ATOM 3478  C CA   . CYS A 1 81  ? 5.103   -13.354 -4.979  1.00 0.00 ? 81  CYS A CA   2  
ATOM 3479  C C    . CYS A 1 81  ? 3.607   -13.068 -4.993  1.00 0.00 ? 81  CYS A C    2  
ATOM 3480  O O    . CYS A 1 81  ? 3.092   -12.416 -5.879  1.00 0.00 ? 81  CYS A O    2  
ATOM 3481  C CB   . CYS A 1 81  ? 5.862   -12.091 -4.543  1.00 0.00 ? 81  CYS A CB   2  
ATOM 3482  S SG   . CYS A 1 81  ? 5.608   -10.762 -5.746  1.00 0.00 ? 81  CYS A SG   2  
ATOM 3483  H H    . CYS A 1 81  ? 4.927   -13.787 -7.083  1.00 0.00 ? 81  CYS A H    2  
ATOM 3484  H HA   . CYS A 1 81  ? 5.295   -14.152 -4.273  1.00 0.00 ? 81  CYS A HA   2  
ATOM 3485  H HB2  . CYS A 1 81  ? 5.500   -11.771 -3.578  1.00 0.00 ? 81  CYS A HB2  2  
ATOM 3486  H HB3  . CYS A 1 81  ? 6.916   -12.314 -4.473  1.00 0.00 ? 81  CYS A HB3  2  
ATOM 3487  H HG   . CYS A 1 81  ? 6.347   -10.154 -5.676  1.00 0.00 ? 81  CYS A HG   2  
ATOM 3488  N N    . LYS A 1 82  ? 2.920   -13.546 -4.001  1.00 0.00 ? 82  LYS A N    2  
ATOM 3489  C CA   . LYS A 1 82  ? 1.456   -13.319 -3.907  1.00 0.00 ? 82  LYS A CA   2  
ATOM 3490  C C    . LYS A 1 82  ? 1.166   -12.443 -2.694  1.00 0.00 ? 82  LYS A C    2  
ATOM 3491  O O    . LYS A 1 82  ? 2.067   -11.945 -2.044  1.00 0.00 ? 82  LYS A O    2  
ATOM 3492  C CB   . LYS A 1 82  ? 0.751   -14.661 -3.752  1.00 0.00 ? 82  LYS A CB   2  
ATOM 3493  C CG   . LYS A 1 82  ? 1.288   -15.409 -2.518  1.00 0.00 ? 82  LYS A CG   2  
ATOM 3494  C CD   . LYS A 1 82  ? 0.650   -16.811 -2.403  1.00 0.00 ? 82  LYS A CD   2  
ATOM 3495  C CE   . LYS A 1 82  ? -0.839  -16.775 -2.779  1.00 0.00 ? 82  LYS A CE   2  
ATOM 3496  N NZ   . LYS A 1 82  ? -1.565  -17.867 -2.070  1.00 0.00 ? 82  LYS A NZ   2  
ATOM 3497  H H    . LYS A 1 82  ? 3.378   -14.055 -3.303  1.00 0.00 ? 82  LYS A H    2  
ATOM 3498  H HA   . LYS A 1 82  ? 1.094   -12.826 -4.801  1.00 0.00 ? 82  LYS A HA   2  
ATOM 3499  H HB2  . LYS A 1 82  ? -0.307  -14.491 -3.629  1.00 0.00 ? 82  LYS A HB2  2  
ATOM 3500  H HB3  . LYS A 1 82  ? 0.917   -15.259 -4.634  1.00 0.00 ? 82  LYS A HB3  2  
ATOM 3501  H HG2  . LYS A 1 82  ? 2.357   -15.520 -2.609  1.00 0.00 ? 82  LYS A HG2  2  
ATOM 3502  H HG3  . LYS A 1 82  ? 1.067   -14.837 -1.628  1.00 0.00 ? 82  LYS A HG3  2  
ATOM 3503  H HD2  . LYS A 1 82  ? 1.166   -17.491 -3.065  1.00 0.00 ? 82  LYS A HD2  2  
ATOM 3504  H HD3  . LYS A 1 82  ? 0.751   -17.163 -1.387  1.00 0.00 ? 82  LYS A HD3  2  
ATOM 3505  H HE2  . LYS A 1 82  ? -1.254  -15.818 -2.498  1.00 0.00 ? 82  LYS A HE2  2  
ATOM 3506  H HE3  . LYS A 1 82  ? -0.937  -16.906 -3.849  1.00 0.00 ? 82  LYS A HE3  2  
ATOM 3507  H HZ1  . LYS A 1 82  ? -0.937  -18.689 -1.963  1.00 0.00 ? 82  LYS A HZ1  2  
ATOM 3508  H HZ2  . LYS A 1 82  ? -1.863  -17.532 -1.131  1.00 0.00 ? 82  LYS A HZ2  2  
ATOM 3509  H HZ3  . LYS A 1 82  ? -2.401  -18.143 -2.622  1.00 0.00 ? 82  LYS A HZ3  2  
ATOM 3510  N N    . SER A 1 83  ? -0.085  -12.249 -2.394  1.00 0.00 ? 83  SER A N    2  
ATOM 3511  C CA   . SER A 1 83  ? -0.454  -11.398 -1.227  1.00 0.00 ? 83  SER A CA   2  
ATOM 3512  C C    . SER A 1 83  ? -1.667  -11.971 -0.511  1.00 0.00 ? 83  SER A C    2  
ATOM 3513  O O    . SER A 1 83  ? -2.237  -12.951 -0.932  1.00 0.00 ? 83  SER A O    2  
ATOM 3514  C CB   . SER A 1 83  ? -0.794  -9.997  -1.724  1.00 0.00 ? 83  SER A CB   2  
ATOM 3515  O OG   . SER A 1 83  ? -1.774  -10.098 -2.754  1.00 0.00 ? 83  SER A OG   2  
ATOM 3516  H H    . SER A 1 83  ? -0.780  -12.657 -2.946  1.00 0.00 ? 83  SER A H    2  
ATOM 3517  H HA   . SER A 1 83  ? 0.367   -11.351 -0.544  1.00 0.00 ? 83  SER A HA   2  
ATOM 3518  H HB2  . SER A 1 83  ? -1.190  -9.410  -0.912  1.00 0.00 ? 83  SER A HB2  2  
ATOM 3519  H HB3  . SER A 1 83  ? 0.100   -9.524  -2.108  1.00 0.00 ? 83  SER A HB3  2  
ATOM 3520  H HG   . SER A 1 83  ? -2.469  -10.697 -2.456  1.00 0.00 ? 83  SER A HG   2  
ATOM 3521  N N    . LEU A 1 84  ? -2.068  -11.350 0.567   1.00 0.00 ? 84  LEU A N    2  
ATOM 3522  C CA   . LEU A 1 84  ? -3.267  -11.846 1.310   1.00 0.00 ? 84  LEU A CA   2  
ATOM 3523  C C    . LEU A 1 84  ? -3.722  -10.808 2.331   1.00 0.00 ? 84  LEU A C    2  
ATOM 3524  O O    . LEU A 1 84  ? -3.000  -10.468 3.244   1.00 0.00 ? 84  LEU A O    2  
ATOM 3525  C CB   . LEU A 1 84  ? -2.932  -13.159 2.011   1.00 0.00 ? 84  LEU A CB   2  
ATOM 3526  C CG   . LEU A 1 84  ? -4.104  -14.125 1.847   1.00 0.00 ? 84  LEU A CG   2  
ATOM 3527  C CD1  . LEU A 1 84  ? -3.599  -15.560 1.951   1.00 0.00 ? 84  LEU A CD1  2  
ATOM 3528  C CD2  . LEU A 1 84  ? -5.141  -13.861 2.937   1.00 0.00 ? 84  LEU A CD2  2  
ATOM 3529  H H    . LEU A 1 84  ? -1.582  -10.550 0.879   1.00 0.00 ? 84  LEU A H    2  
ATOM 3530  H HA   . LEU A 1 84  ? -4.065  -12.011 0.606   1.00 0.00 ? 84  LEU A HA   2  
ATOM 3531  H HB2  . LEU A 1 84  ? -2.047  -13.587 1.563   1.00 0.00 ? 84  LEU A HB2  2  
ATOM 3532  H HB3  . LEU A 1 84  ? -2.755  -12.979 3.059   1.00 0.00 ? 84  LEU A HB3  2  
ATOM 3533  H HG   . LEU A 1 84  ? -4.557  -13.972 0.880   1.00 0.00 ? 84  LEU A HG   2  
ATOM 3534  H HD11 . LEU A 1 84  ? -2.714  -15.671 1.342   1.00 0.00 ? 84  LEU A HD11 2  
ATOM 3535  H HD12 . LEU A 1 84  ? -3.362  -15.784 2.978   1.00 0.00 ? 84  LEU A HD12 2  
ATOM 3536  H HD13 . LEU A 1 84  ? -4.365  -16.234 1.599   1.00 0.00 ? 84  LEU A HD13 2  
ATOM 3537  H HD21 . LEU A 1 84  ? -5.174  -12.803 3.152   1.00 0.00 ? 84  LEU A HD21 2  
ATOM 3538  H HD22 . LEU A 1 84  ? -6.112  -14.188 2.593   1.00 0.00 ? 84  LEU A HD22 2  
ATOM 3539  H HD23 . LEU A 1 84  ? -4.873  -14.404 3.829   1.00 0.00 ? 84  LEU A HD23 2  
ATOM 3540  N N    . VAL A 1 85  ? -4.921  -10.303 2.170   1.00 0.00 ? 85  VAL A N    2  
ATOM 3541  C CA   . VAL A 1 85  ? -5.444  -9.265  3.109   1.00 0.00 ? 85  VAL A CA   2  
ATOM 3542  C C    . VAL A 1 85  ? -6.201  -9.914  4.280   1.00 0.00 ? 85  VAL A C    2  
ATOM 3543  O O    . VAL A 1 85  ? -6.871  -10.916 4.133   1.00 0.00 ? 85  VAL A O    2  
ATOM 3544  C CB   . VAL A 1 85  ? -6.373  -8.316  2.326   1.00 0.00 ? 85  VAL A CB   2  
ATOM 3545  C CG1  . VAL A 1 85  ? -7.113  -7.361  3.278   1.00 0.00 ? 85  VAL A CG1  2  
ATOM 3546  C CG2  . VAL A 1 85  ? -5.533  -7.492  1.348   1.00 0.00 ? 85  VAL A CG2  2  
ATOM 3547  H H    . VAL A 1 85  ? -5.476  -10.602 1.417   1.00 0.00 ? 85  VAL A H    2  
ATOM 3548  H HA   . VAL A 1 85  ? -4.618  -8.699  3.498   1.00 0.00 ? 85  VAL A HA   2  
ATOM 3549  H HB   . VAL A 1 85  ? -7.090  -8.899  1.771   1.00 0.00 ? 85  VAL A HB   2  
ATOM 3550  H HG11 . VAL A 1 85  ? -7.651  -7.935  4.019   1.00 0.00 ? 85  VAL A HG11 2  
ATOM 3551  H HG12 . VAL A 1 85  ? -6.401  -6.718  3.771   1.00 0.00 ? 85  VAL A HG12 2  
ATOM 3552  H HG13 . VAL A 1 85  ? -7.812  -6.761  2.715   1.00 0.00 ? 85  VAL A HG13 2  
ATOM 3553  H HG21 . VAL A 1 85  ? -4.942  -8.155  0.733   1.00 0.00 ? 85  VAL A HG21 2  
ATOM 3554  H HG22 . VAL A 1 85  ? -6.187  -6.905  0.720   1.00 0.00 ? 85  VAL A HG22 2  
ATOM 3555  H HG23 . VAL A 1 85  ? -4.880  -6.835  1.901   1.00 0.00 ? 85  VAL A HG23 2  
ATOM 3556  N N    . LYS A 1 86  ? -6.099  -9.310  5.439   1.00 0.00 ? 86  LYS A N    2  
ATOM 3557  C CA   . LYS A 1 86  ? -6.802  -9.821  6.647   1.00 0.00 ? 86  LYS A CA   2  
ATOM 3558  C C    . LYS A 1 86  ? -7.148  -8.633  7.554   1.00 0.00 ? 86  LYS A C    2  
ATOM 3559  O O    . LYS A 1 86  ? -7.177  -7.501  7.119   1.00 0.00 ? 86  LYS A O    2  
ATOM 3560  C CB   . LYS A 1 86  ? -5.887  -10.798 7.390   1.00 0.00 ? 86  LYS A CB   2  
ATOM 3561  C CG   . LYS A 1 86  ? -6.691  -12.007 7.884   1.00 0.00 ? 86  LYS A CG   2  
ATOM 3562  C CD   . LYS A 1 86  ? -7.309  -12.758 6.695   1.00 0.00 ? 86  LYS A CD   2  
ATOM 3563  C CE   . LYS A 1 86  ? -8.824  -12.512 6.645   1.00 0.00 ? 86  LYS A CE   2  
ATOM 3564  N NZ   . LYS A 1 86  ? -9.543  -13.793 6.897   1.00 0.00 ? 86  LYS A NZ   2  
ATOM 3565  H H    . LYS A 1 86  ? -5.560  -8.501  5.511   1.00 0.00 ? 86  LYS A H    2  
ATOM 3566  H HA   . LYS A 1 86  ? -7.708  -10.321 6.357   1.00 0.00 ? 86  LYS A HA   2  
ATOM 3567  H HB2  . LYS A 1 86  ? -5.114  -11.134 6.721   1.00 0.00 ? 86  LYS A HB2  2  
ATOM 3568  H HB3  . LYS A 1 86  ? -5.437  -10.300 8.235   1.00 0.00 ? 86  LYS A HB3  2  
ATOM 3569  H HG2  . LYS A 1 86  ? -6.030  -12.668 8.418   1.00 0.00 ? 86  LYS A HG2  2  
ATOM 3570  H HG3  . LYS A 1 86  ? -7.475  -11.675 8.546   1.00 0.00 ? 86  LYS A HG3  2  
ATOM 3571  H HD2  . LYS A 1 86  ? -6.858  -12.412 5.778   1.00 0.00 ? 86  LYS A HD2  2  
ATOM 3572  H HD3  . LYS A 1 86  ? -7.123  -13.815 6.807   1.00 0.00 ? 86  LYS A HD3  2  
ATOM 3573  H HE2  . LYS A 1 86  ? -9.103  -11.790 7.399   1.00 0.00 ? 86  LYS A HE2  2  
ATOM 3574  H HE3  . LYS A 1 86  ? -9.095  -12.134 5.670   1.00 0.00 ? 86  LYS A HE3  2  
ATOM 3575  H HZ1  . LYS A 1 86  ? -9.051  -14.569 6.410   1.00 0.00 ? 86  LYS A HZ1  2  
ATOM 3576  H HZ2  . LYS A 1 86  ? -9.562  -13.986 7.918   1.00 0.00 ? 86  LYS A HZ2  2  
ATOM 3577  H HZ3  . LYS A 1 86  ? -10.517 -13.719 6.538   1.00 0.00 ? 86  LYS A HZ3  2  
ATOM 3578  N N    . TRP A 1 87  ? -7.423  -8.891  8.803   1.00 0.00 ? 87  TRP A N    2  
ATOM 3579  C CA   . TRP A 1 87  ? -7.781  -7.793  9.753   1.00 0.00 ? 87  TRP A CA   2  
ATOM 3580  C C    . TRP A 1 87  ? -6.894  -7.832  10.992  1.00 0.00 ? 87  TRP A C    2  
ATOM 3581  O O    . TRP A 1 87  ? -6.045  -8.688  11.150  1.00 0.00 ? 87  TRP A O    2  
ATOM 3582  C CB   . TRP A 1 87  ? -9.214  -7.981  10.212  1.00 0.00 ? 87  TRP A CB   2  
ATOM 3583  C CG   . TRP A 1 87  ? -10.097 -7.898  9.041   1.00 0.00 ? 87  TRP A CG   2  
ATOM 3584  C CD1  . TRP A 1 87  ? -10.584 -8.955  8.379   1.00 0.00 ? 87  TRP A CD1  2  
ATOM 3585  C CD2  . TRP A 1 87  ? -10.587 -6.714  8.366   1.00 0.00 ? 87  TRP A CD2  2  
ATOM 3586  N NE1  . TRP A 1 87  ? -11.385 -8.501  7.362   1.00 0.00 ? 87  TRP A NE1  2  
ATOM 3587  C CE2  . TRP A 1 87  ? -11.409 -7.125  7.303   1.00 0.00 ? 87  TRP A CE2  2  
ATOM 3588  C CE3  . TRP A 1 87  ? -10.408 -5.338  8.576   1.00 0.00 ? 87  TRP A CE3  2  
ATOM 3589  C CZ2  . TRP A 1 87  ? -12.036 -6.207  6.473   1.00 0.00 ? 87  TRP A CZ2  2  
ATOM 3590  C CZ3  . TRP A 1 87  ? -11.034 -4.407  7.737   1.00 0.00 ? 87  TRP A CZ3  2  
ATOM 3591  C CH2  . TRP A 1 87  ? -11.848 -4.842  6.686   1.00 0.00 ? 87  TRP A CH2  2  
ATOM 3592  H H    . TRP A 1 87  ? -7.407  -9.812  9.110   1.00 0.00 ? 87  TRP A H    2  
ATOM 3593  H HA   . TRP A 1 87  ? -7.694  -6.832  9.265   1.00 0.00 ? 87  TRP A HA   2  
ATOM 3594  H HB2  . TRP A 1 87  ? -9.323  -8.947  10.681  1.00 0.00 ? 87  TRP A HB2  2  
ATOM 3595  H HB3  . TRP A 1 87  ? -9.478  -7.207  10.910  1.00 0.00 ? 87  TRP A HB3  2  
ATOM 3596  H HD1  . TRP A 1 87  ? -10.391 -9.988  8.620   1.00 0.00 ? 87  TRP A HD1  2  
ATOM 3597  H HE1  . TRP A 1 87  ? -11.869 -9.067  6.742   1.00 0.00 ? 87  TRP A HE1  2  
ATOM 3598  H HE3  . TRP A 1 87  ? -9.776  -4.994  9.379   1.00 0.00 ? 87  TRP A HE3  2  
ATOM 3599  H HZ2  . TRP A 1 87  ? -12.656 -6.548  5.669   1.00 0.00 ? 87  TRP A HZ2  2  
ATOM 3600  H HZ3  . TRP A 1 87  ? -10.888 -3.353  7.903   1.00 0.00 ? 87  TRP A HZ3  2  
ATOM 3601  H HH2  . TRP A 1 87  ? -12.324 -4.126  6.037   1.00 0.00 ? 87  TRP A HH2  2  
ATOM 3602  N N    . GLU A 1 88  ? -7.126  -6.911  11.881  1.00 0.00 ? 88  GLU A N    2  
ATOM 3603  C CA   . GLU A 1 88  ? -6.354  -6.854  13.154  1.00 0.00 ? 88  GLU A CA   2  
ATOM 3604  C C    . GLU A 1 88  ? -7.346  -6.630  14.288  1.00 0.00 ? 88  GLU A C    2  
ATOM 3605  O O    . GLU A 1 88  ? -7.371  -7.343  15.273  1.00 0.00 ? 88  GLU A O    2  
ATOM 3606  C CB   . GLU A 1 88  ? -5.376  -5.681  13.136  1.00 0.00 ? 88  GLU A CB   2  
ATOM 3607  C CG   . GLU A 1 88  ? -4.605  -5.635  11.816  1.00 0.00 ? 88  GLU A CG   2  
ATOM 3608  C CD   . GLU A 1 88  ? -3.408  -6.584  11.893  1.00 0.00 ? 88  GLU A CD   2  
ATOM 3609  O OE1  . GLU A 1 88  ? -2.366  -6.155  12.360  1.00 0.00 ? 88  GLU A OE1  2  
ATOM 3610  O OE2  . GLU A 1 88  ? -3.554  -7.724  11.485  1.00 0.00 ? 88  GLU A OE2  2  
ATOM 3611  H H    . GLU A 1 88  ? -7.833  -6.254  11.715  1.00 0.00 ? 88  GLU A H    2  
ATOM 3612  H HA   . GLU A 1 88  ? -5.821  -7.774  13.307  1.00 0.00 ? 88  GLU A HA   2  
ATOM 3613  H HB2  . GLU A 1 88  ? -5.927  -4.768  13.260  1.00 0.00 ? 88  GLU A HB2  2  
ATOM 3614  H HB3  . GLU A 1 88  ? -4.680  -5.787  13.952  1.00 0.00 ? 88  GLU A HB3  2  
ATOM 3615  H HG2  . GLU A 1 88  ? -5.252  -5.931  11.004  1.00 0.00 ? 88  GLU A HG2  2  
ATOM 3616  H HG3  . GLU A 1 88  ? -4.254  -4.629  11.645  1.00 0.00 ? 88  GLU A HG3  2  
ATOM 3617  N N    . SER A 1 89  ? -8.163  -5.626  14.137  1.00 0.00 ? 89  SER A N    2  
ATOM 3618  C CA   . SER A 1 89  ? -9.177  -5.297  15.168  1.00 0.00 ? 89  SER A CA   2  
ATOM 3619  C C    . SER A 1 89  ? -10.563 -5.310  14.525  1.00 0.00 ? 89  SER A C    2  
ATOM 3620  O O    . SER A 1 89  ? -11.480 -5.953  14.993  1.00 0.00 ? 89  SER A O    2  
ATOM 3621  C CB   . SER A 1 89  ? -8.891  -3.893  15.701  1.00 0.00 ? 89  SER A CB   2  
ATOM 3622  O OG   . SER A 1 89  ? -8.689  -3.011  14.597  1.00 0.00 ? 89  SER A OG   2  
ATOM 3623  H H    . SER A 1 89  ? -8.104  -5.078  13.331  1.00 0.00 ? 89  SER A H    2  
ATOM 3624  H HA   . SER A 1 89  ? -9.133  -6.011  15.969  1.00 0.00 ? 89  SER A HA   2  
ATOM 3625  H HB2  . SER A 1 89  ? -9.729  -3.548  16.284  1.00 0.00 ? 89  SER A HB2  2  
ATOM 3626  H HB3  . SER A 1 89  ? -8.006  -3.918  16.323  1.00 0.00 ? 89  SER A HB3  2  
ATOM 3627  H HG   . SER A 1 89  ? -7.770  -2.734  14.603  1.00 0.00 ? 89  SER A HG   2  
ATOM 3628  N N    . GLU A 1 90  ? -10.698 -4.588  13.447  1.00 0.00 ? 90  GLU A N    2  
ATOM 3629  C CA   . GLU A 1 90  ? -11.993 -4.489  12.705  1.00 0.00 ? 90  GLU A CA   2  
ATOM 3630  C C    . GLU A 1 90  ? -11.857 -3.343  11.706  1.00 0.00 ? 90  GLU A C    2  
ATOM 3631  O O    . GLU A 1 90  ? -12.343 -3.403  10.595  1.00 0.00 ? 90  GLU A O    2  
ATOM 3632  C CB   . GLU A 1 90  ? -13.163 -4.193  13.657  1.00 0.00 ? 90  GLU A CB   2  
ATOM 3633  C CG   . GLU A 1 90  ? -12.821 -2.991  14.545  1.00 0.00 ? 90  GLU A CG   2  
ATOM 3634  C CD   . GLU A 1 90  ? -13.399 -3.207  15.946  1.00 0.00 ? 90  GLU A CD   2  
ATOM 3635  O OE1  . GLU A 1 90  ? -13.010 -4.173  16.582  1.00 0.00 ? 90  GLU A OE1  2  
ATOM 3636  O OE2  . GLU A 1 90  ? -14.219 -2.404  16.357  1.00 0.00 ? 90  GLU A OE2  2  
ATOM 3637  H H    . GLU A 1 90  ? -9.924  -4.092  13.114  1.00 0.00 ? 90  GLU A H    2  
ATOM 3638  H HA   . GLU A 1 90  ? -12.172 -5.409  12.172  1.00 0.00 ? 90  GLU A HA   2  
ATOM 3639  H HB2  . GLU A 1 90  ? -14.046 -3.968  13.076  1.00 0.00 ? 90  GLU A HB2  2  
ATOM 3640  H HB3  . GLU A 1 90  ? -13.355 -5.055  14.276  1.00 0.00 ? 90  GLU A HB3  2  
ATOM 3641  H HG2  . GLU A 1 90  ? -11.750 -2.880  14.610  1.00 0.00 ? 90  GLU A HG2  2  
ATOM 3642  H HG3  . GLU A 1 90  ? -13.249 -2.097  14.117  1.00 0.00 ? 90  GLU A HG3  2  
ATOM 3643  N N    . ASN A 1 91  ? -11.159 -2.312  12.100  1.00 0.00 ? 91  ASN A N    2  
ATOM 3644  C CA   . ASN A 1 91  ? -10.924 -1.151  11.198  1.00 0.00 ? 91  ASN A CA   2  
ATOM 3645  C C    . ASN A 1 91  ? -9.443  -1.116  10.806  1.00 0.00 ? 91  ASN A C    2  
ATOM 3646  O O    . ASN A 1 91  ? -9.004  -0.202  10.134  1.00 0.00 ? 91  ASN A O    2  
ATOM 3647  C CB   . ASN A 1 91  ? -11.284 0.142   11.921  1.00 0.00 ? 91  ASN A CB   2  
ATOM 3648  C CG   . ASN A 1 91  ? -12.755 0.121   12.345  1.00 0.00 ? 91  ASN A CG   2  
ATOM 3649  O OD1  . ASN A 1 91  ? -13.420 -0.893  12.252  1.00 0.00 ? 91  ASN A OD1  2  
ATOM 3650  N ND2  . ASN A 1 91  ? -13.297 1.215   12.806  1.00 0.00 ? 91  ASN A ND2  2  
ATOM 3651  H H    . ASN A 1 91  ? -10.756 -2.314  12.993  1.00 0.00 ? 91  ASN A H    2  
ATOM 3652  H HA   . ASN A 1 91  ? -11.525 -1.241  10.303  1.00 0.00 ? 91  ASN A HA   2  
ATOM 3653  H HB2  . ASN A 1 91  ? -10.655 0.252   12.788  1.00 0.00 ? 91  ASN A HB2  2  
ATOM 3654  H HB3  . ASN A 1 91  ? -11.124 0.968   11.257  1.00 0.00 ? 91  ASN A HB3  2  
ATOM 3655  H HD21 . ASN A 1 91  ? -12.762 2.033   12.878  1.00 0.00 ? 91  ASN A HD21 2  
ATOM 3656  H HD22 . ASN A 1 91  ? -14.237 1.221   13.076  1.00 0.00 ? 91  ASN A HD22 2  
ATOM 3657  N N    . LYS A 1 92  ? -8.664  -2.102  11.215  1.00 0.00 ? 92  LYS A N    2  
ATOM 3658  C CA   . LYS A 1 92  ? -7.233  -2.119  10.845  1.00 0.00 ? 92  LYS A CA   2  
ATOM 3659  C C    . LYS A 1 92  ? -6.941  -3.437  10.132  1.00 0.00 ? 92  LYS A C    2  
ATOM 3660  O O    . LYS A 1 92  ? -6.915  -4.485  10.744  1.00 0.00 ? 92  LYS A O    2  
ATOM 3661  C CB   . LYS A 1 92  ? -6.376  -2.023  12.106  1.00 0.00 ? 92  LYS A CB   2  
ATOM 3662  C CG   . LYS A 1 92  ? -5.129  -1.199  11.807  1.00 0.00 ? 92  LYS A CG   2  
ATOM 3663  C CD   . LYS A 1 92  ? -4.281  -1.893  10.732  1.00 0.00 ? 92  LYS A CD   2  
ATOM 3664  C CE   . LYS A 1 92  ? -2.796  -1.765  11.082  1.00 0.00 ? 92  LYS A CE   2  
ATOM 3665  N NZ   . LYS A 1 92  ? -2.540  -2.381  12.416  1.00 0.00 ? 92  LYS A NZ   2  
ATOM 3666  H H    . LYS A 1 92  ? -9.021  -2.835  11.763  1.00 0.00 ? 92  LYS A H    2  
ATOM 3667  H HA   . LYS A 1 92  ? -7.020  -1.287  10.187  1.00 0.00 ? 92  LYS A HA   2  
ATOM 3668  H HB2  . LYS A 1 92  ? -6.944  -1.545  12.891  1.00 0.00 ? 92  LYS A HB2  2  
ATOM 3669  H HB3  . LYS A 1 92  ? -6.084  -3.010  12.422  1.00 0.00 ? 92  LYS A HB3  2  
ATOM 3670  H HG2  . LYS A 1 92  ? -5.430  -0.229  11.455  1.00 0.00 ? 92  LYS A HG2  2  
ATOM 3671  H HG3  . LYS A 1 92  ? -4.551  -1.092  12.707  1.00 0.00 ? 92  LYS A HG3  2  
ATOM 3672  H HD2  . LYS A 1 92  ? -4.552  -2.937  10.679  1.00 0.00 ? 92  LYS A HD2  2  
ATOM 3673  H HD3  . LYS A 1 92  ? -4.464  -1.426  9.776   1.00 0.00 ? 92  LYS A HD3  2  
ATOM 3674  H HE2  . LYS A 1 92  ? -2.205  -2.272  10.334  1.00 0.00 ? 92  LYS A HE2  2  
ATOM 3675  H HE3  . LYS A 1 92  ? -2.522  -0.721  11.110  1.00 0.00 ? 92  LYS A HE3  2  
ATOM 3676  H HZ1  . LYS A 1 92  ? -3.186  -3.186  12.557  1.00 0.00 ? 92  LYS A HZ1  2  
ATOM 3677  H HZ2  . LYS A 1 92  ? -1.557  -2.714  12.462  1.00 0.00 ? 92  LYS A HZ2  2  
ATOM 3678  H HZ3  . LYS A 1 92  ? -2.699  -1.674  13.161  1.00 0.00 ? 92  LYS A HZ3  2  
ATOM 3679  N N    . MET A 1 93  ? -6.736  -3.393  8.845   1.00 0.00 ? 93  MET A N    2  
ATOM 3680  C CA   . MET A 1 93  ? -6.461  -4.638  8.084   1.00 0.00 ? 93  MET A CA   2  
ATOM 3681  C C    . MET A 1 93  ? -5.032  -4.657  7.577   1.00 0.00 ? 93  MET A C    2  
ATOM 3682  O O    . MET A 1 93  ? -4.360  -3.648  7.491   1.00 0.00 ? 93  MET A O    2  
ATOM 3683  C CB   . MET A 1 93  ? -7.408  -4.795  6.885   1.00 0.00 ? 93  MET A CB   2  
ATOM 3684  C CG   . MET A 1 93  ? -7.756  -3.440  6.255   1.00 0.00 ? 93  MET A CG   2  
ATOM 3685  S SD   . MET A 1 93  ? -7.927  -3.626  4.462   1.00 0.00 ? 93  MET A SD   2  
ATOM 3686  C CE   . MET A 1 93  ? -9.142  -4.963  4.501   1.00 0.00 ? 93  MET A CE   2  
ATOM 3687  H H    . MET A 1 93  ? -6.770  -2.550  8.386   1.00 0.00 ? 93  MET A H    2  
ATOM 3688  H HA   . MET A 1 93  ? -6.595  -5.475  8.738   1.00 0.00 ? 93  MET A HA   2  
ATOM 3689  H HB2  . MET A 1 93  ? -6.927  -5.416  6.142   1.00 0.00 ? 93  MET A HB2  2  
ATOM 3690  H HB3  . MET A 1 93  ? -8.314  -5.277  7.213   1.00 0.00 ? 93  MET A HB3  2  
ATOM 3691  H HG2  . MET A 1 93  ? -8.690  -3.089  6.665   1.00 0.00 ? 93  MET A HG2  2  
ATOM 3692  H HG3  . MET A 1 93  ? -6.977  -2.730  6.469   1.00 0.00 ? 93  MET A HG3  2  
ATOM 3693  H HE1  . MET A 1 93  ? -8.724  -5.810  5.030   1.00 0.00 ? 93  MET A HE1  2  
ATOM 3694  H HE2  . MET A 1 93  ? -10.032 -4.620  5.009   1.00 0.00 ? 93  MET A HE2  2  
ATOM 3695  H HE3  . MET A 1 93  ? -9.391  -5.256  3.497   1.00 0.00 ? 93  MET A HE3  2  
ATOM 3696  N N    . VAL A 1 94  ? -4.579  -5.826  7.247   1.00 0.00 ? 94  VAL A N    2  
ATOM 3697  C CA   . VAL A 1 94  ? -3.194  -6.003  6.738   1.00 0.00 ? 94  VAL A CA   2  
ATOM 3698  C C    . VAL A 1 94  ? -3.237  -6.619  5.349   1.00 0.00 ? 94  VAL A C    2  
ATOM 3699  O O    . VAL A 1 94  ? -4.286  -6.848  4.780   1.00 0.00 ? 94  VAL A O    2  
ATOM 3700  C CB   . VAL A 1 94  ? -2.428  -6.958  7.657   1.00 0.00 ? 94  VAL A CB   2  
ATOM 3701  C CG1  . VAL A 1 94  ? -2.016  -6.237  8.934   1.00 0.00 ? 94  VAL A CG1  2  
ATOM 3702  C CG2  . VAL A 1 94  ? -3.327  -8.140  8.003   1.00 0.00 ? 94  VAL A CG2  2  
ATOM 3703  H H    . VAL A 1 94  ? -5.163  -6.611  7.344   1.00 0.00 ? 94  VAL A H    2  
ATOM 3704  H HA   . VAL A 1 94  ? -2.688  -5.058  6.701   1.00 0.00 ? 94  VAL A HA   2  
ATOM 3705  H HB   . VAL A 1 94  ? -1.545  -7.317  7.151   1.00 0.00 ? 94  VAL A HB   2  
ATOM 3706  H HG11 . VAL A 1 94  ? -2.627  -5.357  9.065   1.00 0.00 ? 94  VAL A HG11 2  
ATOM 3707  H HG12 . VAL A 1 94  ? -2.147  -6.897  9.777   1.00 0.00 ? 94  VAL A HG12 2  
ATOM 3708  H HG13 . VAL A 1 94  ? -0.979  -5.951  8.861   1.00 0.00 ? 94  VAL A HG13 2  
ATOM 3709  H HG21 . VAL A 1 94  ? -3.770  -8.525  7.096   1.00 0.00 ? 94  VAL A HG21 2  
ATOM 3710  H HG22 . VAL A 1 94  ? -2.745  -8.907  8.481   1.00 0.00 ? 94  VAL A HG22 2  
ATOM 3711  H HG23 . VAL A 1 94  ? -4.109  -7.804  8.669   1.00 0.00 ? 94  VAL A HG23 2  
ATOM 3712  N N    . CYS A 1 95  ? -2.090  -6.906  4.822   1.00 0.00 ? 95  CYS A N    2  
ATOM 3713  C CA   . CYS A 1 95  ? -1.996  -7.539  3.487   1.00 0.00 ? 95  CYS A CA   2  
ATOM 3714  C C    . CYS A 1 95  ? -0.589  -8.087  3.350   1.00 0.00 ? 95  CYS A C    2  
ATOM 3715  O O    . CYS A 1 95  ? 0.250   -7.509  2.690   1.00 0.00 ? 95  CYS A O    2  
ATOM 3716  C CB   . CYS A 1 95  ? -2.267  -6.513  2.398   1.00 0.00 ? 95  CYS A CB   2  
ATOM 3717  S SG   . CYS A 1 95  ? -2.344  -7.348  0.793   1.00 0.00 ? 95  CYS A SG   2  
ATOM 3718  H H    . CYS A 1 95  ? -1.270  -6.714  5.323   1.00 0.00 ? 95  CYS A H    2  
ATOM 3719  H HA   . CYS A 1 95  ? -2.708  -8.340  3.420   1.00 0.00 ? 95  CYS A HA   2  
ATOM 3720  H HB2  . CYS A 1 95  ? -3.203  -6.025  2.596   1.00 0.00 ? 95  CYS A HB2  2  
ATOM 3721  H HB3  . CYS A 1 95  ? -1.483  -5.777  2.384   1.00 0.00 ? 95  CYS A HB3  2  
ATOM 3722  H HG   . CYS A 1 95  ? -1.656  -6.980  0.234   1.00 0.00 ? 95  CYS A HG   2  
ATOM 3723  N N    . GLU A 1 96  ? -0.315  -9.180  4.008   1.00 0.00 ? 96  GLU A N    2  
ATOM 3724  C CA   . GLU A 1 96  ? 1.059   -9.743  3.963   1.00 0.00 ? 96  GLU A CA   2  
ATOM 3725  C C    . GLU A 1 96  ? 1.392   -10.259 2.564   1.00 0.00 ? 96  GLU A C    2  
ATOM 3726  O O    . GLU A 1 96  ? 0.842   -11.241 2.103   1.00 0.00 ? 96  GLU A O    2  
ATOM 3727  C CB   . GLU A 1 96  ? 1.195   -10.886 4.966   1.00 0.00 ? 96  GLU A CB   2  
ATOM 3728  C CG   . GLU A 1 96  ? 2.668   -11.290 5.053   1.00 0.00 ? 96  GLU A CG   2  
ATOM 3729  C CD   . GLU A 1 96  ? 2.804   -12.569 5.880   1.00 0.00 ? 96  GLU A CD   2  
ATOM 3730  O OE1  . GLU A 1 96  ? 2.384   -12.558 7.026   1.00 0.00 ? 96  GLU A OE1  2  
ATOM 3731  O OE2  . GLU A 1 96  ? 3.326   -13.539 5.355   1.00 0.00 ? 96  GLU A OE2  2  
ATOM 3732  H H    . GLU A 1 96  ? -1.008  -9.610  4.556   1.00 0.00 ? 96  GLU A H    2  
ATOM 3733  H HA   . GLU A 1 96  ? 1.756   -8.962  4.226   1.00 0.00 ? 96  GLU A HA   2  
ATOM 3734  H HB2  . GLU A 1 96  ? 0.849   -10.560 5.936   1.00 0.00 ? 96  GLU A HB2  2  
ATOM 3735  H HB3  . GLU A 1 96  ? 0.610   -11.731 4.636   1.00 0.00 ? 96  GLU A HB3  2  
ATOM 3736  H HG2  . GLU A 1 96  ? 3.051   -11.458 4.055   1.00 0.00 ? 96  GLU A HG2  2  
ATOM 3737  H HG3  . GLU A 1 96  ? 3.231   -10.496 5.521   1.00 0.00 ? 96  GLU A HG3  2  
ATOM 3738  N N    . GLN A 1 97  ? 2.309   -9.607  1.903   1.00 0.00 ? 97  GLN A N    2  
ATOM 3739  C CA   . GLN A 1 97  ? 2.722   -10.043 0.550   1.00 0.00 ? 97  GLN A CA   2  
ATOM 3740  C C    . GLN A 1 97  ? 4.054   -10.793 0.663   1.00 0.00 ? 97  GLN A C    2  
ATOM 3741  O O    . GLN A 1 97  ? 5.012   -10.274 1.206   1.00 0.00 ? 97  GLN A O    2  
ATOM 3742  C CB   . GLN A 1 97  ? 2.903   -8.809  -0.331  1.00 0.00 ? 97  GLN A CB   2  
ATOM 3743  C CG   . GLN A 1 97  ? 1.580   -8.047  -0.432  1.00 0.00 ? 97  GLN A CG   2  
ATOM 3744  C CD   . GLN A 1 97  ? 1.435   -7.429  -1.829  1.00 0.00 ? 97  GLN A CD   2  
ATOM 3745  O OE1  . GLN A 1 97  ? 2.281   -7.607  -2.684  1.00 0.00 ? 97  GLN A OE1  2  
ATOM 3746  N NE2  . GLN A 1 97  ? 0.386   -6.700  -2.097  1.00 0.00 ? 97  GLN A NE2  2  
ATOM 3747  H H    . GLN A 1 97  ? 2.738   -8.831  2.306   1.00 0.00 ? 97  GLN A H    2  
ATOM 3748  H HA   . GLN A 1 97  ? 1.968   -10.687 0.131   1.00 0.00 ? 97  GLN A HA   2  
ATOM 3749  H HB2  . GLN A 1 97  ? 3.652   -8.166  0.103   1.00 0.00 ? 97  GLN A HB2  2  
ATOM 3750  H HB3  . GLN A 1 97  ? 3.216   -9.114  -1.310  1.00 0.00 ? 97  GLN A HB3  2  
ATOM 3751  H HG2  . GLN A 1 97  ? 0.762   -8.727  -0.252  1.00 0.00 ? 97  GLN A HG2  2  
ATOM 3752  H HG3  . GLN A 1 97  ? 1.564   -7.262  0.309   1.00 0.00 ? 97  GLN A HG3  2  
ATOM 3753  H HE21 . GLN A 1 97  ? -0.298  -6.554  -1.410  1.00 0.00 ? 97  GLN A HE21 2  
ATOM 3754  H HE22 . GLN A 1 97  ? 0.282   -6.299  -2.985  1.00 0.00 ? 97  GLN A HE22 2  
ATOM 3755  N N    . LYS A 1 98  ? 4.124   -12.009 0.176   1.00 0.00 ? 98  LYS A N    2  
ATOM 3756  C CA   . LYS A 1 98  ? 5.407   -12.779 0.283   1.00 0.00 ? 98  LYS A CA   2  
ATOM 3757  C C    . LYS A 1 98  ? 5.841   -13.287 -1.096  1.00 0.00 ? 98  LYS A C    2  
ATOM 3758  O O    . LYS A 1 98  ? 5.056   -13.330 -2.024  1.00 0.00 ? 98  LYS A O    2  
ATOM 3759  C CB   . LYS A 1 98  ? 5.209   -13.969 1.225   1.00 0.00 ? 98  LYS A CB   2  
ATOM 3760  C CG   . LYS A 1 98  ? 3.988   -14.779 0.781   1.00 0.00 ? 98  LYS A CG   2  
ATOM 3761  C CD   . LYS A 1 98  ? 4.176   -16.244 1.175   1.00 0.00 ? 98  LYS A CD   2  
ATOM 3762  C CE   . LYS A 1 98  ? 3.805   -16.430 2.648   1.00 0.00 ? 98  LYS A CE   2  
ATOM 3763  N NZ   . LYS A 1 98  ? 3.198   -17.777 2.842   1.00 0.00 ? 98  LYS A NZ   2  
ATOM 3764  H H    . LYS A 1 98  ? 3.333   -12.420 -0.246  1.00 0.00 ? 98  LYS A H    2  
ATOM 3765  H HA   . LYS A 1 98  ? 6.177   -12.134 0.682   1.00 0.00 ? 98  LYS A HA   2  
ATOM 3766  H HB2  . LYS A 1 98  ? 6.087   -14.598 1.199   1.00 0.00 ? 98  LYS A HB2  2  
ATOM 3767  H HB3  . LYS A 1 98  ? 5.053   -13.610 2.231   1.00 0.00 ? 98  LYS A HB3  2  
ATOM 3768  H HG2  . LYS A 1 98  ? 3.103   -14.387 1.261   1.00 0.00 ? 98  LYS A HG2  2  
ATOM 3769  H HG3  . LYS A 1 98  ? 3.879   -14.708 -0.290  1.00 0.00 ? 98  LYS A HG3  2  
ATOM 3770  H HD2  . LYS A 1 98  ? 3.540   -16.865 0.562   1.00 0.00 ? 98  LYS A HD2  2  
ATOM 3771  H HD3  . LYS A 1 98  ? 5.207   -16.527 1.028   1.00 0.00 ? 98  LYS A HD3  2  
ATOM 3772  H HE2  . LYS A 1 98  ? 4.694   -16.345 3.257   1.00 0.00 ? 98  LYS A HE2  2  
ATOM 3773  H HE3  . LYS A 1 98  ? 3.096   -15.670 2.939   1.00 0.00 ? 98  LYS A HE3  2  
ATOM 3774  H HZ1  . LYS A 1 98  ? 2.428   -17.912 2.157   1.00 0.00 ? 98  LYS A HZ1  2  
ATOM 3775  H HZ2  . LYS A 1 98  ? 3.922   -18.509 2.694   1.00 0.00 ? 98  LYS A HZ2  2  
ATOM 3776  H HZ3  . LYS A 1 98  ? 2.821   -17.851 3.809   1.00 0.00 ? 98  LYS A HZ3  2  
ATOM 3777  N N    . LEU A 1 99  ? 7.088   -13.686 -1.231  1.00 0.00 ? 99  LEU A N    2  
ATOM 3778  C CA   . LEU A 1 99  ? 7.569   -14.210 -2.554  1.00 0.00 ? 99  LEU A CA   2  
ATOM 3779  C C    . LEU A 1 99  ? 7.611   -15.736 -2.521  1.00 0.00 ? 99  LEU A C    2  
ATOM 3780  O O    . LEU A 1 99  ? 8.461   -16.359 -3.125  1.00 0.00 ? 99  LEU A O    2  
ATOM 3781  C CB   . LEU A 1 99  ? 8.953   -13.652 -2.959  1.00 0.00 ? 99  LEU A CB   2  
ATOM 3782  C CG   . LEU A 1 99  ? 9.795   -13.281 -1.740  1.00 0.00 ? 99  LEU A CG   2  
ATOM 3783  C CD1  . LEU A 1 99  ? 11.275  -13.515 -2.051  1.00 0.00 ? 99  LEU A CD1  2  
ATOM 3784  C CD2  . LEU A 1 99  ? 9.578   -11.802 -1.408  1.00 0.00 ? 99  LEU A CD2  2  
ATOM 3785  H H    . LEU A 1 99  ? 7.691   -13.651 -0.464  1.00 0.00 ? 99  LEU A H    2  
ATOM 3786  H HA   . LEU A 1 99  ? 6.861   -13.920 -3.297  1.00 0.00 ? 99  LEU A HA   2  
ATOM 3787  H HB2  . LEU A 1 99  ? 9.478   -14.399 -3.534  1.00 0.00 ? 99  LEU A HB2  2  
ATOM 3788  H HB3  . LEU A 1 99  ? 8.811   -12.773 -3.572  1.00 0.00 ? 99  LEU A HB3  2  
ATOM 3789  H HG   . LEU A 1 99  ? 9.502   -13.892 -0.905  1.00 0.00 ? 99  LEU A HG   2  
ATOM 3790  H HD11 . LEU A 1 99  ? 11.452  -13.351 -3.104  1.00 0.00 ? 99  LEU A HD11 2  
ATOM 3791  H HD12 . LEU A 1 99  ? 11.877  -12.828 -1.474  1.00 0.00 ? 99  LEU A HD12 2  
ATOM 3792  H HD13 . LEU A 1 99  ? 11.541  -14.529 -1.795  1.00 0.00 ? 99  LEU A HD13 2  
ATOM 3793  H HD21 . LEU A 1 99  ? 8.520   -11.590 -1.381  1.00 0.00 ? 99  LEU A HD21 2  
ATOM 3794  H HD22 . LEU A 1 99  ? 10.016  -11.580 -0.447  1.00 0.00 ? 99  LEU A HD22 2  
ATOM 3795  H HD23 . LEU A 1 99  ? 10.047  -11.192 -2.167  1.00 0.00 ? 99  LEU A HD23 2  
ATOM 3796  N N    . LEU A 1 100 ? 6.671   -16.338 -1.837  1.00 0.00 ? 100 LEU A N    2  
ATOM 3797  C CA   . LEU A 1 100 ? 6.601   -17.830 -1.767  1.00 0.00 ? 100 LEU A CA   2  
ATOM 3798  C C    . LEU A 1 100 ? 7.875   -18.430 -1.157  1.00 0.00 ? 100 LEU A C    2  
ATOM 3799  O O    . LEU A 1 100 ? 8.119   -19.616 -1.278  1.00 0.00 ? 100 LEU A O    2  
ATOM 3800  C CB   . LEU A 1 100 ? 6.414   -18.387 -3.173  1.00 0.00 ? 100 LEU A CB   2  
ATOM 3801  C CG   . LEU A 1 100 ? 5.155   -17.780 -3.796  1.00 0.00 ? 100 LEU A CG   2  
ATOM 3802  C CD1  . LEU A 1 100 ? 5.134   -18.066 -5.299  1.00 0.00 ? 100 LEU A CD1  2  
ATOM 3803  C CD2  . LEU A 1 100 ? 3.916   -18.394 -3.139  1.00 0.00 ? 100 LEU A CD2  2  
ATOM 3804  H H    . LEU A 1 100 ? 5.990   -15.801 -1.381  1.00 0.00 ? 100 LEU A H    2  
ATOM 3805  H HA   . LEU A 1 100 ? 5.752   -18.111 -1.164  1.00 0.00 ? 100 LEU A HA   2  
ATOM 3806  H HB2  . LEU A 1 100 ? 7.276   -18.133 -3.773  1.00 0.00 ? 100 LEU A HB2  2  
ATOM 3807  H HB3  . LEU A 1 100 ? 6.311   -19.458 -3.121  1.00 0.00 ? 100 LEU A HB3  2  
ATOM 3808  H HG   . LEU A 1 100 ? 5.157   -16.711 -3.635  1.00 0.00 ? 100 LEU A HG   2  
ATOM 3809  H HD11 . LEU A 1 100 ? 6.140   -18.252 -5.644  1.00 0.00 ? 100 LEU A HD11 2  
ATOM 3810  H HD12 . LEU A 1 100 ? 4.521   -18.934 -5.493  1.00 0.00 ? 100 LEU A HD12 2  
ATOM 3811  H HD13 . LEU A 1 100 ? 4.726   -17.213 -5.821  1.00 0.00 ? 100 LEU A HD13 2  
ATOM 3812  H HD21 . LEU A 1 100 ? 4.084   -19.446 -2.967  1.00 0.00 ? 100 LEU A HD21 2  
ATOM 3813  H HD22 . LEU A 1 100 ? 3.726   -17.900 -2.198  1.00 0.00 ? 100 LEU A HD22 2  
ATOM 3814  H HD23 . LEU A 1 100 ? 3.064   -18.267 -3.791  1.00 0.00 ? 100 LEU A HD23 2  
ATOM 3815  N N    . LYS A 1 101 ? 8.678   -17.636 -0.501  1.00 0.00 ? 101 LYS A N    2  
ATOM 3816  C CA   . LYS A 1 101 ? 9.928   -18.174 0.122   1.00 0.00 ? 101 LYS A CA   2  
ATOM 3817  C C    . LYS A 1 101 ? 10.663  -17.052 0.856   1.00 0.00 ? 101 LYS A C    2  
ATOM 3818  O O    . LYS A 1 101 ? 11.226  -17.259 1.914   1.00 0.00 ? 101 LYS A O    2  
ATOM 3819  C CB   . LYS A 1 101 ? 10.841  -18.769 -0.959  1.00 0.00 ? 101 LYS A CB   2  
ATOM 3820  C CG   . LYS A 1 101 ? 11.101  -17.733 -2.057  1.00 0.00 ? 101 LYS A CG   2  
ATOM 3821  C CD   . LYS A 1 101 ? 12.446  -17.042 -1.810  1.00 0.00 ? 101 LYS A CD   2  
ATOM 3822  C CE   . LYS A 1 101 ? 13.586  -17.996 -2.169  1.00 0.00 ? 101 LYS A CE   2  
ATOM 3823  N NZ   . LYS A 1 101 ? 14.795  -17.205 -2.537  1.00 0.00 ? 101 LYS A NZ   2  
ATOM 3824  H H    . LYS A 1 101 ? 8.458   -16.692 -0.411  1.00 0.00 ? 101 LYS A H    2  
ATOM 3825  H HA   . LYS A 1 101 ? 9.666   -18.945 0.829   1.00 0.00 ? 101 LYS A HA   2  
ATOM 3826  H HB2  . LYS A 1 101 ? 11.779  -19.063 -0.512  1.00 0.00 ? 101 LYS A HB2  2  
ATOM 3827  H HB3  . LYS A 1 101 ? 10.364  -19.636 -1.392  1.00 0.00 ? 101 LYS A HB3  2  
ATOM 3828  H HG2  . LYS A 1 101 ? 11.123  -18.229 -3.017  1.00 0.00 ? 101 LYS A HG2  2  
ATOM 3829  H HG3  . LYS A 1 101 ? 10.314  -16.997 -2.053  1.00 0.00 ? 101 LYS A HG3  2  
ATOM 3830  H HD2  . LYS A 1 101 ? 12.512  -16.155 -2.423  1.00 0.00 ? 101 LYS A HD2  2  
ATOM 3831  H HD3  . LYS A 1 101 ? 12.526  -16.767 -0.771  1.00 0.00 ? 101 LYS A HD3  2  
ATOM 3832  H HE2  . LYS A 1 101 ? 13.812  -18.623 -1.319  1.00 0.00 ? 101 LYS A HE2  2  
ATOM 3833  H HE3  . LYS A 1 101 ? 13.291  -18.613 -3.004  1.00 0.00 ? 101 LYS A HE3  2  
ATOM 3834  H HZ1  . LYS A 1 101 ? 14.518  -16.414 -3.152  1.00 0.00 ? 101 LYS A HZ1  2  
ATOM 3835  H HZ2  . LYS A 1 101 ? 15.242  -16.834 -1.674  1.00 0.00 ? 101 LYS A HZ2  2  
ATOM 3836  H HZ3  . LYS A 1 101 ? 15.468  -17.815 -3.043  1.00 0.00 ? 101 LYS A HZ3  2  
ATOM 3837  N N    . GLY A 1 102 ? 10.658  -15.868 0.303   1.00 0.00 ? 102 GLY A N    2  
ATOM 3838  C CA   . GLY A 1 102 ? 11.352  -14.723 0.959   1.00 0.00 ? 102 GLY A CA   2  
ATOM 3839  C C    . GLY A 1 102 ? 12.859  -14.976 0.992   1.00 0.00 ? 102 GLY A C    2  
ATOM 3840  O O    . GLY A 1 102 ? 13.313  -16.069 1.274   1.00 0.00 ? 102 GLY A O    2  
ATOM 3841  H H    . GLY A 1 102 ? 10.194  -15.732 -0.547  1.00 0.00 ? 102 GLY A H    2  
ATOM 3842  H HA2  . GLY A 1 102 ? 11.151  -13.817 0.408   1.00 0.00 ? 102 GLY A HA2  2  
ATOM 3843  H HA3  . GLY A 1 102 ? 10.992  -14.613 1.968   1.00 0.00 ? 102 GLY A HA3  2  
ATOM 3844  N N    . GLU A 1 103 ? 13.633  -13.960 0.720   1.00 0.00 ? 103 GLU A N    2  
ATOM 3845  C CA   . GLU A 1 103 ? 15.116  -14.105 0.747   1.00 0.00 ? 103 GLU A CA   2  
ATOM 3846  C C    . GLU A 1 103 ? 15.660  -13.299 1.926   1.00 0.00 ? 103 GLU A C    2  
ATOM 3847  O O    . GLU A 1 103 ? 16.576  -13.714 2.610   1.00 0.00 ? 103 GLU A O    2  
ATOM 3848  C CB   . GLU A 1 103 ? 15.722  -13.590 -0.565  1.00 0.00 ? 103 GLU A CB   2  
ATOM 3849  C CG   . GLU A 1 103 ? 15.179  -12.194 -0.883  1.00 0.00 ? 103 GLU A CG   2  
ATOM 3850  C CD   . GLU A 1 103 ? 15.864  -11.658 -2.141  1.00 0.00 ? 103 GLU A CD   2  
ATOM 3851  O OE1  . GLU A 1 103 ? 17.080  -11.732 -2.207  1.00 0.00 ? 103 GLU A OE1  2  
ATOM 3852  O OE2  . GLU A 1 103 ? 15.162  -11.182 -3.018  1.00 0.00 ? 103 GLU A OE2  2  
ATOM 3853  H H    . GLU A 1 103 ? 13.234  -13.095 0.512   1.00 0.00 ? 103 GLU A H    2  
ATOM 3854  H HA   . GLU A 1 103 ? 15.367  -15.144 0.877   1.00 0.00 ? 103 GLU A HA   2  
ATOM 3855  H HB2  . GLU A 1 103 ? 16.797  -13.543 -0.468  1.00 0.00 ? 103 GLU A HB2  2  
ATOM 3856  H HB3  . GLU A 1 103 ? 15.464  -14.264 -1.368  1.00 0.00 ? 103 GLU A HB3  2  
ATOM 3857  H HG2  . GLU A 1 103 ? 14.113  -12.250 -1.050  1.00 0.00 ? 103 GLU A HG2  2  
ATOM 3858  H HG3  . GLU A 1 103 ? 15.381  -11.530 -0.057  1.00 0.00 ? 103 GLU A HG3  2  
ATOM 3859  N N    . GLY A 1 104 ? 15.079  -12.157 2.173   1.00 0.00 ? 104 GLY A N    2  
ATOM 3860  C CA   . GLY A 1 104 ? 15.514  -11.305 3.311   1.00 0.00 ? 104 GLY A CA   2  
ATOM 3861  C C    . GLY A 1 104 ? 14.284  -10.549 3.839   1.00 0.00 ? 104 GLY A C    2  
ATOM 3862  O O    . GLY A 1 104 ? 13.621  -11.028 4.737   1.00 0.00 ? 104 GLY A O    2  
ATOM 3863  H H    . GLY A 1 104 ? 14.337  -11.861 1.611   1.00 0.00 ? 104 GLY A H    2  
ATOM 3864  H HA2  . GLY A 1 104 ? 15.924  -11.930 4.091   1.00 0.00 ? 104 GLY A HA2  2  
ATOM 3865  H HA3  . GLY A 1 104 ? 16.258  -10.600 2.979   1.00 0.00 ? 104 GLY A HA3  2  
ATOM 3866  N N    . PRO A 1 105 ? 13.990  -9.397  3.260   1.00 0.00 ? 105 PRO A N    2  
ATOM 3867  C CA   . PRO A 1 105 ? 12.823  -8.601  3.668   1.00 0.00 ? 105 PRO A CA   2  
ATOM 3868  C C    . PRO A 1 105 ? 11.558  -9.136  2.981   1.00 0.00 ? 105 PRO A C    2  
ATOM 3869  O O    . PRO A 1 105 ? 11.528  -10.265 2.527   1.00 0.00 ? 105 PRO A O    2  
ATOM 3870  C CB   . PRO A 1 105 ? 13.162  -7.192  3.185   1.00 0.00 ? 105 PRO A CB   2  
ATOM 3871  C CG   . PRO A 1 105 ? 14.201  -7.349  2.048   1.00 0.00 ? 105 PRO A CG   2  
ATOM 3872  C CD   . PRO A 1 105 ? 14.781  -8.772  2.170   1.00 0.00 ? 105 PRO A CD   2  
ATOM 3873  H HA   . PRO A 1 105 ? 12.708  -8.609  4.737   1.00 0.00 ? 105 PRO A HA   2  
ATOM 3874  H HB2  . PRO A 1 105 ? 12.274  -6.711  2.815   1.00 0.00 ? 105 PRO A HB2  2  
ATOM 3875  H HB3  . PRO A 1 105 ? 13.590  -6.617  3.991   1.00 0.00 ? 105 PRO A HB3  2  
ATOM 3876  H HG2  . PRO A 1 105 ? 13.718  -7.223  1.091   1.00 0.00 ? 105 PRO A HG2  2  
ATOM 3877  H HG3  . PRO A 1 105 ? 14.991  -6.621  2.164   1.00 0.00 ? 105 PRO A HG3  2  
ATOM 3878  H HD2  . PRO A 1 105 ? 14.646  -9.314  1.244   1.00 0.00 ? 105 PRO A HD2  2  
ATOM 3879  H HD3  . PRO A 1 105 ? 15.823  -8.738  2.441   1.00 0.00 ? 105 PRO A HD3  2  
ATOM 3880  N N    . LYS A 1 106 ? 10.513  -8.344  2.912   1.00 0.00 ? 106 LYS A N    2  
ATOM 3881  C CA   . LYS A 1 106 ? 9.255   -8.819  2.268   1.00 0.00 ? 106 LYS A CA   2  
ATOM 3882  C C    . LYS A 1 106 ? 8.311   -7.640  2.024   1.00 0.00 ? 106 LYS A C    2  
ATOM 3883  O O    . LYS A 1 106 ? 8.528   -6.546  2.510   1.00 0.00 ? 106 LYS A O    2  
ATOM 3884  C CB   . LYS A 1 106 ? 8.587   -9.818  3.206   1.00 0.00 ? 106 LYS A CB   2  
ATOM 3885  C CG   . LYS A 1 106 ? 8.133   -11.056 2.424   1.00 0.00 ? 106 LYS A CG   2  
ATOM 3886  C CD   . LYS A 1 106 ? 8.381   -12.313 3.262   1.00 0.00 ? 106 LYS A CD   2  
ATOM 3887  C CE   . LYS A 1 106 ? 7.411   -12.338 4.444   1.00 0.00 ? 106 LYS A CE   2  
ATOM 3888  N NZ   . LYS A 1 106 ? 7.539   -13.637 5.164   1.00 0.00 ? 106 LYS A NZ   2  
ATOM 3889  H H    . LYS A 1 106 ? 10.552  -7.448  3.291   1.00 0.00 ? 106 LYS A H    2  
ATOM 3890  H HA   . LYS A 1 106 ? 9.487   -9.301  1.332   1.00 0.00 ? 106 LYS A HA   2  
ATOM 3891  H HB2  . LYS A 1 106 ? 9.300   -10.105 3.960   1.00 0.00 ? 106 LYS A HB2  2  
ATOM 3892  H HB3  . LYS A 1 106 ? 7.732   -9.357  3.678   1.00 0.00 ? 106 LYS A HB3  2  
ATOM 3893  H HG2  . LYS A 1 106 ? 7.079   -10.974 2.202   1.00 0.00 ? 106 LYS A HG2  2  
ATOM 3894  H HG3  . LYS A 1 106 ? 8.690   -11.125 1.502   1.00 0.00 ? 106 LYS A HG3  2  
ATOM 3895  H HD2  . LYS A 1 106 ? 8.227   -13.190 2.650   1.00 0.00 ? 106 LYS A HD2  2  
ATOM 3896  H HD3  . LYS A 1 106 ? 9.395   -12.305 3.632   1.00 0.00 ? 106 LYS A HD3  2  
ATOM 3897  H HE2  . LYS A 1 106 ? 7.643   -11.528 5.119   1.00 0.00 ? 106 LYS A HE2  2  
ATOM 3898  H HE3  . LYS A 1 106 ? 6.399   -12.226 4.082   1.00 0.00 ? 106 LYS A HE3  2  
ATOM 3899  H HZ1  . LYS A 1 106 ? 7.724   -14.397 4.480   1.00 0.00 ? 106 LYS A HZ1  2  
ATOM 3900  H HZ2  . LYS A 1 106 ? 8.327   -13.583 5.840   1.00 0.00 ? 106 LYS A HZ2  2  
ATOM 3901  H HZ3  . LYS A 1 106 ? 6.656   -13.838 5.676   1.00 0.00 ? 106 LYS A HZ3  2  
ATOM 3902  N N    . THR A 1 107 ? 7.258   -7.865  1.280   1.00 0.00 ? 107 THR A N    2  
ATOM 3903  C CA   . THR A 1 107 ? 6.284   -6.778  0.996   1.00 0.00 ? 107 THR A CA   2  
ATOM 3904  C C    . THR A 1 107 ? 5.021   -7.005  1.825   1.00 0.00 ? 107 THR A C    2  
ATOM 3905  O O    . THR A 1 107 ? 4.803   -8.074  2.355   1.00 0.00 ? 107 THR A O    2  
ATOM 3906  C CB   . THR A 1 107 ? 5.926   -6.813  -0.496  1.00 0.00 ? 107 THR A CB   2  
ATOM 3907  O OG1  . THR A 1 107 ? 5.918   -8.158  -0.955  1.00 0.00 ? 107 THR A OG1  2  
ATOM 3908  C CG2  . THR A 1 107 ? 6.955   -6.023  -1.297  1.00 0.00 ? 107 THR A CG2  2  
ATOM 3909  H H    . THR A 1 107 ? 7.104   -8.759  0.909   1.00 0.00 ? 107 THR A H    2  
ATOM 3910  H HA   . THR A 1 107 ? 6.714   -5.823  1.250   1.00 0.00 ? 107 THR A HA   2  
ATOM 3911  H HB   . THR A 1 107 ? 4.954   -6.378  -0.639  1.00 0.00 ? 107 THR A HB   2  
ATOM 3912  H HG1  . THR A 1 107 ? 5.500   -8.700  -0.287  1.00 0.00 ? 107 THR A HG1  2  
ATOM 3913  H HG21 . THR A 1 107 ? 7.935   -6.166  -0.864  1.00 0.00 ? 107 THR A HG21 2  
ATOM 3914  H HG22 . THR A 1 107 ? 6.958   -6.366  -2.319  1.00 0.00 ? 107 THR A HG22 2  
ATOM 3915  H HG23 . THR A 1 107 ? 6.700   -4.976  -1.269  1.00 0.00 ? 107 THR A HG23 2  
ATOM 3916  N N    . SER A 1 108 ? 4.190   -5.998  1.940   1.00 0.00 ? 108 SER A N    2  
ATOM 3917  C CA   . SER A 1 108 ? 2.926   -6.128  2.732   1.00 0.00 ? 108 SER A CA   2  
ATOM 3918  C C    . SER A 1 108 ? 2.276   -4.747  2.849   1.00 0.00 ? 108 SER A C    2  
ATOM 3919  O O    . SER A 1 108 ? 2.879   -3.749  2.504   1.00 0.00 ? 108 SER A O    2  
ATOM 3920  C CB   . SER A 1 108 ? 3.237   -6.643  4.142   1.00 0.00 ? 108 SER A CB   2  
ATOM 3921  O OG   . SER A 1 108 ? 4.467   -6.085  4.585   1.00 0.00 ? 108 SER A OG   2  
ATOM 3922  H H    . SER A 1 108 ? 4.401   -5.146  1.502   1.00 0.00 ? 108 SER A H    2  
ATOM 3923  H HA   . SER A 1 108 ? 2.255   -6.813  2.239   1.00 0.00 ? 108 SER A HA   2  
ATOM 3924  H HB2  . SER A 1 108 ? 2.451   -6.349  4.817   1.00 0.00 ? 108 SER A HB2  2  
ATOM 3925  H HB3  . SER A 1 108 ? 3.306   -7.722  4.122   1.00 0.00 ? 108 SER A HB3  2  
ATOM 3926  H HG   . SER A 1 108 ? 4.443   -6.038  5.544   1.00 0.00 ? 108 SER A HG   2  
ATOM 3927  N N    . TRP A 1 109 ? 1.076   -4.671  3.372   1.00 0.00 ? 109 TRP A N    2  
ATOM 3928  C CA   . TRP A 1 109 ? 0.431   -3.335  3.560   1.00 0.00 ? 109 TRP A CA   2  
ATOM 3929  C C    . TRP A 1 109 ? -0.705  -3.441  4.543   1.00 0.00 ? 109 TRP A C    2  
ATOM 3930  O O    . TRP A 1 109 ? -1.434  -4.415  4.571   1.00 0.00 ? 109 TRP A O    2  
ATOM 3931  C CB   . TRP A 1 109 ? -0.055  -2.695  2.239   1.00 0.00 ? 109 TRP A CB   2  
ATOM 3932  C CG   . TRP A 1 109 ? -1.206  -3.388  1.568   1.00 0.00 ? 109 TRP A CG   2  
ATOM 3933  C CD1  . TRP A 1 109 ? -1.118  -3.952  0.345   1.00 0.00 ? 109 TRP A CD1  2  
ATOM 3934  C CD2  . TRP A 1 109 ? -2.613  -3.525  1.982   1.00 0.00 ? 109 TRP A CD2  2  
ATOM 3935  N NE1  . TRP A 1 109 ? -2.358  -4.438  -0.023  1.00 0.00 ? 109 TRP A NE1  2  
ATOM 3936  C CE2  . TRP A 1 109 ? -3.311  -4.207  0.947   1.00 0.00 ? 109 TRP A CE2  2  
ATOM 3937  C CE3  . TRP A 1 109 ? -3.351  -3.148  3.133   1.00 0.00 ? 109 TRP A CE3  2  
ATOM 3938  C CZ2  . TRP A 1 109 ? -4.675  -4.496  1.049   1.00 0.00 ? 109 TRP A CZ2  2  
ATOM 3939  C CZ3  . TRP A 1 109 ? -4.718  -3.445  3.228   1.00 0.00 ? 109 TRP A CZ3  2  
ATOM 3940  C CH2  . TRP A 1 109 ? -5.374  -4.114  2.191   1.00 0.00 ? 109 TRP A CH2  2  
ATOM 3941  H H    . TRP A 1 109 ? 0.620   -5.486  3.682   1.00 0.00 ? 109 TRP A H    2  
ATOM 3942  H HA   . TRP A 1 109 ? 1.170   -2.677  3.994   1.00 0.00 ? 109 TRP A HA   2  
ATOM 3943  H HB2  . TRP A 1 109 ? -0.373  -1.698  2.447   1.00 0.00 ? 109 TRP A HB2  2  
ATOM 3944  H HB3  . TRP A 1 109 ? 0.774   -2.653  1.555   1.00 0.00 ? 109 TRP A HB3  2  
ATOM 3945  H HD1  . TRP A 1 109 ? -0.216  -4.011  -0.247  1.00 0.00 ? 109 TRP A HD1  2  
ATOM 3946  H HE1  . TRP A 1 109 ? -2.556  -4.899  -0.865  1.00 0.00 ? 109 TRP A HE1  2  
ATOM 3947  H HE3  . TRP A 1 109 ? -2.870  -2.635  3.949   1.00 0.00 ? 109 TRP A HE3  2  
ATOM 3948  H HZ2  . TRP A 1 109 ? -5.191  -5.010  0.247   1.00 0.00 ? 109 TRP A HZ2  2  
ATOM 3949  H HZ3  . TRP A 1 109 ? -5.268  -3.153  4.110   1.00 0.00 ? 109 TRP A HZ3  2  
ATOM 3950  H HH2  . TRP A 1 109 ? -6.420  -4.341  2.278   1.00 0.00 ? 109 TRP A HH2  2  
ATOM 3951  N N    . THR A 1 110 ? -0.853  -2.437  5.365   1.00 0.00 ? 110 THR A N    2  
ATOM 3952  C CA   . THR A 1 110 ? -1.946  -2.457  6.368   1.00 0.00 ? 110 THR A CA   2  
ATOM 3953  C C    . THR A 1 110 ? -2.718  -1.151  6.318   1.00 0.00 ? 110 THR A C    2  
ATOM 3954  O O    . THR A 1 110 ? -2.231  -0.107  6.701   1.00 0.00 ? 110 THR A O    2  
ATOM 3955  C CB   . THR A 1 110 ? -1.377  -2.658  7.767   1.00 0.00 ? 110 THR A CB   2  
ATOM 3956  O OG1  . THR A 1 110 ? -0.729  -1.468  8.192   1.00 0.00 ? 110 THR A OG1  2  
ATOM 3957  C CG2  . THR A 1 110 ? -0.379  -3.815  7.758   1.00 0.00 ? 110 THR A CG2  2  
ATOM 3958  H H    . THR A 1 110 ? -0.235  -1.671  5.323   1.00 0.00 ? 110 THR A H    2  
ATOM 3959  H HA   . THR A 1 110 ? -2.618  -3.264  6.137   1.00 0.00 ? 110 THR A HA   2  
ATOM 3960  H HB   . THR A 1 110 ? -2.185  -2.891  8.437   1.00 0.00 ? 110 THR A HB   2  
ATOM 3961  H HG1  . THR A 1 110 ? -1.347  -0.971  8.734   1.00 0.00 ? 110 THR A HG1  2  
ATOM 3962  H HG21 . THR A 1 110 ? -0.797  -4.645  7.206   1.00 0.00 ? 110 THR A HG21 2  
ATOM 3963  H HG22 . THR A 1 110 ? 0.537   -3.494  7.286   1.00 0.00 ? 110 THR A HG22 2  
ATOM 3964  H HG23 . THR A 1 110 ? -0.176  -4.122  8.772   1.00 0.00 ? 110 THR A HG23 2  
ATOM 3965  N N    . ARG A 1 111 ? -3.932  -1.222  5.866   1.00 0.00 ? 111 ARG A N    2  
ATOM 3966  C CA   . ARG A 1 111 ? -4.787  -0.004  5.792   1.00 0.00 ? 111 ARG A CA   2  
ATOM 3967  C C    . ARG A 1 111 ? -5.436  0.190   7.157   1.00 0.00 ? 111 ARG A C    2  
ATOM 3968  O O    . ARG A 1 111 ? -5.909  -0.752  7.745   1.00 0.00 ? 111 ARG A O    2  
ATOM 3969  C CB   . ARG A 1 111 ? -5.849  -0.206  4.702   1.00 0.00 ? 111 ARG A CB   2  
ATOM 3970  C CG   . ARG A 1 111 ? -5.215  0.014   3.328   1.00 0.00 ? 111 ARG A CG   2  
ATOM 3971  C CD   . ARG A 1 111 ? -6.258  -0.221  2.235   1.00 0.00 ? 111 ARG A CD   2  
ATOM 3972  N NE   . ARG A 1 111 ? -5.568  -0.446  0.934   1.00 0.00 ? 111 ARG A NE   2  
ATOM 3973  C CZ   . ARG A 1 111 ? -5.098  0.568   0.259   1.00 0.00 ? 111 ARG A CZ   2  
ATOM 3974  N NH1  . ARG A 1 111 ? -5.891  1.546   -0.086  1.00 0.00 ? 111 ARG A NH1  2  
ATOM 3975  N NH2  . ARG A 1 111 ? -3.836  0.605   -0.070  1.00 0.00 ? 111 ARG A NH2  2  
ATOM 3976  H H    . ARG A 1 111 ? -4.291  -2.096  5.593   1.00 0.00 ? 111 ARG A H    2  
ATOM 3977  H HA   . ARG A 1 111 ? -4.183  0.859   5.561   1.00 0.00 ? 111 ARG A HA   2  
ATOM 3978  H HB2  . ARG A 1 111 ? -6.237  -1.215  4.759   1.00 0.00 ? 111 ARG A HB2  2  
ATOM 3979  H HB3  . ARG A 1 111 ? -6.652  0.498   4.841   1.00 0.00 ? 111 ARG A HB3  2  
ATOM 3980  H HG2  . ARG A 1 111 ? -4.845  1.027   3.261   1.00 0.00 ? 111 ARG A HG2  2  
ATOM 3981  H HG3  . ARG A 1 111 ? -4.397  -0.677  3.196   1.00 0.00 ? 111 ARG A HG3  2  
ATOM 3982  H HD2  . ARG A 1 111 ? -6.851  -1.089  2.483   1.00 0.00 ? 111 ARG A HD2  2  
ATOM 3983  H HD3  . ARG A 1 111 ? -6.901  0.643   2.157   1.00 0.00 ? 111 ARG A HD3  2  
ATOM 3984  H HE   . ARG A 1 111 ? -5.463  -1.356  0.586   1.00 0.00 ? 111 ARG A HE   2  
ATOM 3985  H HH11 . ARG A 1 111 ? -6.858  1.518   0.166   1.00 0.00 ? 111 ARG A HH11 2  
ATOM 3986  H HH12 . ARG A 1 111 ? -5.531  2.323   -0.601  1.00 0.00 ? 111 ARG A HH12 2  
ATOM 3987  H HH21 . ARG A 1 111 ? -3.229  -0.144  0.194   1.00 0.00 ? 111 ARG A HH21 2  
ATOM 3988  H HH22 . ARG A 1 111 ? -3.477  1.381   -0.587  1.00 0.00 ? 111 ARG A HH22 2  
ATOM 3989  N N    . GLU A 1 112 ? -5.439  1.388   7.686   1.00 0.00 ? 112 GLU A N    2  
ATOM 3990  C CA   . GLU A 1 112 ? -6.039  1.587   9.036   1.00 0.00 ? 112 GLU A CA   2  
ATOM 3991  C C    . GLU A 1 112 ? -6.963  2.803   9.024   1.00 0.00 ? 112 GLU A C    2  
ATOM 3992  O O    . GLU A 1 112 ? -6.763  3.745   8.292   1.00 0.00 ? 112 GLU A O    2  
ATOM 3993  C CB   . GLU A 1 112 ? -4.902  1.769   10.059  1.00 0.00 ? 112 GLU A CB   2  
ATOM 3994  C CG   . GLU A 1 112 ? -5.447  2.225   11.424  1.00 0.00 ? 112 GLU A CG   2  
ATOM 3995  C CD   . GLU A 1 112 ? -4.370  2.037   12.494  1.00 0.00 ? 112 GLU A CD   2  
ATOM 3996  O OE1  . GLU A 1 112 ? -3.293  2.585   12.325  1.00 0.00 ? 112 GLU A OE1  2  
ATOM 3997  O OE2  . GLU A 1 112 ? -4.640  1.348   13.464  1.00 0.00 ? 112 GLU A OE2  2  
ATOM 3998  H H    . GLU A 1 112 ? -5.032  2.146   7.209   1.00 0.00 ? 112 GLU A H    2  
ATOM 3999  H HA   . GLU A 1 112 ? -6.616  0.711   9.295   1.00 0.00 ? 112 GLU A HA   2  
ATOM 4000  H HB2  . GLU A 1 112 ? -4.383  0.831   10.180  1.00 0.00 ? 112 GLU A HB2  2  
ATOM 4001  H HB3  . GLU A 1 112 ? -4.211  2.503   9.690   1.00 0.00 ? 112 GLU A HB3  2  
ATOM 4002  H HG2  . GLU A 1 112 ? -5.724  3.268   11.370  1.00 0.00 ? 112 GLU A HG2  2  
ATOM 4003  H HG3  . GLU A 1 112 ? -6.314  1.635   11.681  1.00 0.00 ? 112 GLU A HG3  2  
ATOM 4004  N N    . LEU A 1 113 ? -7.979  2.765   9.838   1.00 0.00 ? 113 LEU A N    2  
ATOM 4005  C CA   . LEU A 1 113 ? -8.951  3.885   9.914   1.00 0.00 ? 113 LEU A CA   2  
ATOM 4006  C C    . LEU A 1 113 ? -8.805  4.575   11.273  1.00 0.00 ? 113 LEU A C    2  
ATOM 4007  O O    . LEU A 1 113 ? -8.213  4.032   12.187  1.00 0.00 ? 113 LEU A O    2  
ATOM 4008  C CB   . LEU A 1 113 ? -10.358 3.291   9.792   1.00 0.00 ? 113 LEU A CB   2  
ATOM 4009  C CG   . LEU A 1 113 ? -10.773 3.062   8.329   1.00 0.00 ? 113 LEU A CG   2  
ATOM 4010  C CD1  . LEU A 1 113 ? -11.292 4.367   7.728   1.00 0.00 ? 113 LEU A CD1  2  
ATOM 4011  C CD2  . LEU A 1 113 ? -9.615  2.527   7.492   1.00 0.00 ? 113 LEU A CD2  2  
ATOM 4012  H H    . LEU A 1 113 ? -8.111  1.982   10.406  1.00 0.00 ? 113 LEU A H    2  
ATOM 4013  H HA   . LEU A 1 113 ? -8.775  4.589   9.115   1.00 0.00 ? 113 LEU A HA   2  
ATOM 4014  H HB2  . LEU A 1 113 ? -10.372 2.346   10.296  1.00 0.00 ? 113 LEU A HB2  2  
ATOM 4015  H HB3  . LEU A 1 113 ? -11.066 3.956   10.263  1.00 0.00 ? 113 LEU A HB3  2  
ATOM 4016  H HG   . LEU A 1 113 ? -11.557 2.334   8.309   1.00 0.00 ? 113 LEU A HG   2  
ATOM 4017  H HD11 . LEU A 1 113 ? -10.588 5.160   7.927   1.00 0.00 ? 113 LEU A HD11 2  
ATOM 4018  H HD12 . LEU A 1 113 ? -11.414 4.250   6.663   1.00 0.00 ? 113 LEU A HD12 2  
ATOM 4019  H HD13 . LEU A 1 113 ? -12.246 4.611   8.175   1.00 0.00 ? 113 LEU A HD13 2  
ATOM 4020  H HD21 . LEU A 1 113 ? -9.258  1.602   7.926   1.00 0.00 ? 113 LEU A HD21 2  
ATOM 4021  H HD22 . LEU A 1 113 ? -9.962  2.345   6.492   1.00 0.00 ? 113 LEU A HD22 2  
ATOM 4022  H HD23 . LEU A 1 113 ? -8.823  3.250   7.475   1.00 0.00 ? 113 LEU A HD23 2  
ATOM 4023  N N    . THR A 1 114 ? -9.343  5.758   11.416  1.00 0.00 ? 114 THR A N    2  
ATOM 4024  C CA   . THR A 1 114 ? -9.241  6.475   12.723  1.00 0.00 ? 114 THR A CA   2  
ATOM 4025  C C    . THR A 1 114 ? -10.645 6.696   13.286  1.00 0.00 ? 114 THR A C    2  
ATOM 4026  O O    . THR A 1 114 ? -10.984 6.203   14.345  1.00 0.00 ? 114 THR A O    2  
ATOM 4027  C CB   . THR A 1 114 ? -8.551  7.824   12.515  1.00 0.00 ? 114 THR A CB   2  
ATOM 4028  O OG1  . THR A 1 114 ? -7.345  7.629   11.791  1.00 0.00 ? 114 THR A OG1  2  
ATOM 4029  C CG2  . THR A 1 114 ? -8.236  8.454   13.873  1.00 0.00 ? 114 THR A CG2  2  
ATOM 4030  H H    . THR A 1 114 ? -9.820  6.173   10.665  1.00 0.00 ? 114 THR A H    2  
ATOM 4031  H HA   . THR A 1 114 ? -8.665  5.878   13.415  1.00 0.00 ? 114 THR A HA   2  
ATOM 4032  H HB   . THR A 1 114 ? -9.203  8.481   11.962  1.00 0.00 ? 114 THR A HB   2  
ATOM 4033  H HG1  . THR A 1 114 ? -6.782  7.044   12.305  1.00 0.00 ? 114 THR A HG1  2  
ATOM 4034  H HG21 . THR A 1 114 ? -9.001  8.177   14.585  1.00 0.00 ? 114 THR A HG21 2  
ATOM 4035  H HG22 . THR A 1 114 ? -7.277  8.100   14.220  1.00 0.00 ? 114 THR A HG22 2  
ATOM 4036  H HG23 . THR A 1 114 ? -8.209  9.529   13.774  1.00 0.00 ? 114 THR A HG23 2  
ATOM 4037  N N    . ASN A 1 115 ? -11.464 7.426   12.576  1.00 0.00 ? 115 ASN A N    2  
ATOM 4038  C CA   . ASN A 1 115 ? -12.855 7.682   13.049  1.00 0.00 ? 115 ASN A CA   2  
ATOM 4039  C C    . ASN A 1 115 ? -13.807 7.549   11.864  1.00 0.00 ? 115 ASN A C    2  
ATOM 4040  O O    . ASN A 1 115 ? -14.684 6.706   11.848  1.00 0.00 ? 115 ASN A O    2  
ATOM 4041  C CB   . ASN A 1 115 ? -12.949 9.094   13.629  1.00 0.00 ? 115 ASN A CB   2  
ATOM 4042  C CG   . ASN A 1 115 ? -12.283 9.126   15.005  1.00 0.00 ? 115 ASN A CG   2  
ATOM 4043  O OD1  . ASN A 1 115 ? -11.267 9.767   15.187  1.00 0.00 ? 115 ASN A OD1  2  
ATOM 4044  N ND2  . ASN A 1 115 ? -12.816 8.455   15.990  1.00 0.00 ? 115 ASN A ND2  2  
ATOM 4045  H H    . ASN A 1 115 ? -11.163 7.803   11.723  1.00 0.00 ? 115 ASN A H    2  
ATOM 4046  H HA   . ASN A 1 115 ? -13.118 6.961   13.804  1.00 0.00 ? 115 ASN A HA   2  
ATOM 4047  H HB2  . ASN A 1 115 ? -12.448 9.788   12.969  1.00 0.00 ? 115 ASN A HB2  2  
ATOM 4048  H HB3  . ASN A 1 115 ? -13.987 9.375   13.727  1.00 0.00 ? 115 ASN A HB3  2  
ATOM 4049  H HD21 . ASN A 1 115 ? -13.635 7.937   15.843  1.00 0.00 ? 115 ASN A HD21 2  
ATOM 4050  H HD22 . ASN A 1 115 ? -12.397 8.468   16.876  1.00 0.00 ? 115 ASN A HD22 2  
ATOM 4051  N N    . ASP A 1 116 ? -13.629 8.375   10.871  1.00 0.00 ? 116 ASP A N    2  
ATOM 4052  C CA   . ASP A 1 116 ? -14.506 8.312   9.666   1.00 0.00 ? 116 ASP A CA   2  
ATOM 4053  C C    . ASP A 1 116 ? -13.947 9.232   8.579   1.00 0.00 ? 116 ASP A C    2  
ATOM 4054  O O    . ASP A 1 116 ? -14.687 9.816   7.810   1.00 0.00 ? 116 ASP A O    2  
ATOM 4055  C CB   . ASP A 1 116 ? -15.918 8.764   10.037  1.00 0.00 ? 116 ASP A CB   2  
ATOM 4056  C CG   . ASP A 1 116 ? -16.936 8.024   9.168   1.00 0.00 ? 116 ASP A CG   2  
ATOM 4057  O OD1  . ASP A 1 116 ? -16.727 6.849   8.915   1.00 0.00 ? 116 ASP A OD1  2  
ATOM 4058  O OD2  . ASP A 1 116 ? -17.908 8.644   8.769   1.00 0.00 ? 116 ASP A OD2  2  
ATOM 4059  H H    . ASP A 1 116 ? -12.910 9.037   10.918  1.00 0.00 ? 116 ASP A H    2  
ATOM 4060  H HA   . ASP A 1 116 ? -14.536 7.297   9.298   1.00 0.00 ? 116 ASP A HA   2  
ATOM 4061  H HB2  . ASP A 1 116 ? -16.105 8.546   11.078  1.00 0.00 ? 116 ASP A HB2  2  
ATOM 4062  H HB3  . ASP A 1 116 ? -16.010 9.827   9.869   1.00 0.00 ? 116 ASP A HB3  2  
ATOM 4063  N N    . GLY A 1 117 ? -12.646 9.362   8.510   1.00 0.00 ? 117 GLY A N    2  
ATOM 4064  C CA   . GLY A 1 117 ? -12.031 10.243  7.474   1.00 0.00 ? 117 GLY A CA   2  
ATOM 4065  C C    . GLY A 1 117 ? -10.555 10.474  7.799   1.00 0.00 ? 117 GLY A C    2  
ATOM 4066  O O    . GLY A 1 117 ? -10.037 11.565  7.659   1.00 0.00 ? 117 GLY A O    2  
ATOM 4067  H H    . GLY A 1 117 ? -12.075 8.880   9.141   1.00 0.00 ? 117 GLY A H    2  
ATOM 4068  H HA2  . GLY A 1 117 ? -12.117 9.770   6.506   1.00 0.00 ? 117 GLY A HA2  2  
ATOM 4069  H HA3  . GLY A 1 117 ? -12.544 11.185  7.457   1.00 0.00 ? 117 GLY A HA3  2  
ATOM 4070  N N    . GLU A 1 118 ? -9.879  9.444   8.220   1.00 0.00 ? 118 GLU A N    2  
ATOM 4071  C CA   . GLU A 1 118 ? -8.429  9.556   8.548   1.00 0.00 ? 118 GLU A CA   2  
ATOM 4072  C C    . GLU A 1 118 ? -7.816  8.171   8.349   1.00 0.00 ? 118 GLU A C    2  
ATOM 4073  O O    . GLU A 1 118 ? -7.465  7.484   9.288   1.00 0.00 ? 118 GLU A O    2  
ATOM 4074  C CB   . GLU A 1 118 ? -8.259  10.007  10.002  1.00 0.00 ? 118 GLU A CB   2  
ATOM 4075  C CG   . GLU A 1 118 ? -7.885  11.491  10.042  1.00 0.00 ? 118 GLU A CG   2  
ATOM 4076  C CD   . GLU A 1 118 ? -7.682  11.927  11.494  1.00 0.00 ? 118 GLU A CD   2  
ATOM 4077  O OE1  . GLU A 1 118 ? -6.856  11.327  12.162  1.00 0.00 ? 118 GLU A OE1  2  
ATOM 4078  O OE2  . GLU A 1 118 ? -8.355  12.853  11.914  1.00 0.00 ? 118 GLU A OE2  2  
ATOM 4079  H H    . GLU A 1 118 ? -10.328 8.579   8.309   1.00 0.00 ? 118 GLU A H    2  
ATOM 4080  H HA   . GLU A 1 118 ? -7.961  10.267  7.879   1.00 0.00 ? 118 GLU A HA   2  
ATOM 4081  H HB2  . GLU A 1 118 ? -9.187  9.857   10.534  1.00 0.00 ? 118 GLU A HB2  2  
ATOM 4082  H HB3  . GLU A 1 118 ? -7.477  9.429   10.470  1.00 0.00 ? 118 GLU A HB3  2  
ATOM 4083  H HG2  . GLU A 1 118 ? -6.971  11.646  9.487   1.00 0.00 ? 118 GLU A HG2  2  
ATOM 4084  H HG3  . GLU A 1 118 ? -8.678  12.075  9.601   1.00 0.00 ? 118 GLU A HG3  2  
ATOM 4085  N N    . LEU A 1 119 ? -7.742  7.750   7.119   1.00 0.00 ? 119 LEU A N    2  
ATOM 4086  C CA   . LEU A 1 119 ? -7.219  6.394   6.797   1.00 0.00 ? 119 LEU A CA   2  
ATOM 4087  C C    . LEU A 1 119 ? -5.693  6.402   6.635   1.00 0.00 ? 119 LEU A C    2  
ATOM 4088  O O    . LEU A 1 119 ? -5.177  6.870   5.645   1.00 0.00 ? 119 LEU A O    2  
ATOM 4089  C CB   . LEU A 1 119 ? -7.867  5.964   5.479   1.00 0.00 ? 119 LEU A CB   2  
ATOM 4090  C CG   . LEU A 1 119 ? -7.750  4.450   5.284   1.00 0.00 ? 119 LEU A CG   2  
ATOM 4091  C CD1  . LEU A 1 119 ? -9.078  3.892   4.762   1.00 0.00 ? 119 LEU A CD1  2  
ATOM 4092  C CD2  . LEU A 1 119 ? -6.644  4.155   4.271   1.00 0.00 ? 119 LEU A CD2  2  
ATOM 4093  H H    . LEU A 1 119 ? -8.073  8.321   6.395   1.00 0.00 ? 119 LEU A H    2  
ATOM 4094  H HA   . LEU A 1 119 ? -7.500  5.704   7.574   1.00 0.00 ? 119 LEU A HA   2  
ATOM 4095  H HB2  . LEU A 1 119 ? -8.907  6.244   5.495   1.00 0.00 ? 119 LEU A HB2  2  
ATOM 4096  H HB3  . LEU A 1 119 ? -7.377  6.470   4.663   1.00 0.00 ? 119 LEU A HB3  2  
ATOM 4097  H HG   . LEU A 1 119 ? -7.513  3.984   6.223   1.00 0.00 ? 119 LEU A HG   2  
ATOM 4098  H HD11 . LEU A 1 119 ? -9.887  4.240   5.388   1.00 0.00 ? 119 LEU A HD11 2  
ATOM 4099  H HD12 . LEU A 1 119 ? -9.238  4.228   3.748   1.00 0.00 ? 119 LEU A HD12 2  
ATOM 4100  H HD13 . LEU A 1 119 ? -9.049  2.812   4.782   1.00 0.00 ? 119 LEU A HD13 2  
ATOM 4101  H HD21 . LEU A 1 119 ? -5.809  4.816   4.451   1.00 0.00 ? 119 LEU A HD21 2  
ATOM 4102  H HD22 . LEU A 1 119 ? -6.324  3.131   4.377   1.00 0.00 ? 119 LEU A HD22 2  
ATOM 4103  H HD23 . LEU A 1 119 ? -7.022  4.315   3.272   1.00 0.00 ? 119 LEU A HD23 2  
ATOM 4104  N N    . ILE A 1 120 ? -4.967  5.853   7.580   1.00 0.00 ? 120 ILE A N    2  
ATOM 4105  C CA   . ILE A 1 120 ? -3.477  5.804   7.437   1.00 0.00 ? 120 ILE A CA   2  
ATOM 4106  C C    . ILE A 1 120 ? -3.112  4.453   6.820   1.00 0.00 ? 120 ILE A C    2  
ATOM 4107  O O    . ILE A 1 120 ? -3.285  3.415   7.423   1.00 0.00 ? 120 ILE A O    2  
ATOM 4108  C CB   . ILE A 1 120 ? -2.807  6.006   8.800   1.00 0.00 ? 120 ILE A CB   2  
ATOM 4109  C CG1  . ILE A 1 120 ? -3.148  4.852   9.748   1.00 0.00 ? 120 ILE A CG1  2  
ATOM 4110  C CG2  . ILE A 1 120 ? -3.322  7.309   9.396   1.00 0.00 ? 120 ILE A CG2  2  
ATOM 4111  C CD1  . ILE A 1 120 ? -1.980  3.862   9.785   1.00 0.00 ? 120 ILE A CD1  2  
ATOM 4112  H H    . ILE A 1 120 ? -5.400  5.454   8.365   1.00 0.00 ? 120 ILE A H    2  
ATOM 4113  H HA   . ILE A 1 120 ? -3.164  6.587   6.762   1.00 0.00 ? 120 ILE A HA   2  
ATOM 4114  H HB   . ILE A 1 120 ? -1.737  6.070   8.668   1.00 0.00 ? 120 ILE A HB   2  
ATOM 4115  H HG12 . ILE A 1 120 ? -3.325  5.238   10.743  1.00 0.00 ? 120 ILE A HG12 2  
ATOM 4116  H HG13 . ILE A 1 120 ? -4.034  4.355   9.393   1.00 0.00 ? 120 ILE A HG13 2  
ATOM 4117  H HG21 . ILE A 1 120 ? -3.474  8.027   8.605   1.00 0.00 ? 120 ILE A HG21 2  
ATOM 4118  H HG22 . ILE A 1 120 ? -4.260  7.124   9.899   1.00 0.00 ? 120 ILE A HG22 2  
ATOM 4119  H HG23 . ILE A 1 120 ? -2.601  7.690   10.101  1.00 0.00 ? 120 ILE A HG23 2  
ATOM 4120  H HD11 . ILE A 1 120 ? -1.558  3.766   8.795   1.00 0.00 ? 120 ILE A HD11 2  
ATOM 4121  H HD12 . ILE A 1 120 ? -1.223  4.225   10.464  1.00 0.00 ? 120 ILE A HD12 2  
ATOM 4122  H HD13 . ILE A 1 120 ? -2.332  2.899   10.121  1.00 0.00 ? 120 ILE A HD13 2  
ATOM 4123  N N    . LEU A 1 121 ? -2.662  4.467   5.596   1.00 0.00 ? 121 LEU A N    2  
ATOM 4124  C CA   . LEU A 1 121 ? -2.348  3.198   4.888   1.00 0.00 ? 121 LEU A CA   2  
ATOM 4125  C C    . LEU A 1 121 ? -0.826  3.022   4.709   1.00 0.00 ? 121 LEU A C    2  
ATOM 4126  O O    . LEU A 1 121 ? -0.147  3.846   4.126   1.00 0.00 ? 121 LEU A O    2  
ATOM 4127  C CB   . LEU A 1 121 ? -3.098  3.245   3.534   1.00 0.00 ? 121 LEU A CB   2  
ATOM 4128  C CG   . LEU A 1 121 ? -2.648  2.160   2.538   1.00 0.00 ? 121 LEU A CG   2  
ATOM 4129  C CD1  . LEU A 1 121 ? -1.397  2.635   1.799   1.00 0.00 ? 121 LEU A CD1  2  
ATOM 4130  C CD2  . LEU A 1 121 ? -2.346  0.841   3.247   1.00 0.00 ? 121 LEU A CD2  2  
ATOM 4131  H H    . LEU A 1 121 ? -2.571  5.317   5.125   1.00 0.00 ? 121 LEU A H    2  
ATOM 4132  H HA   . LEU A 1 121 ? -2.729  2.370   5.466   1.00 0.00 ? 121 LEU A HA   2  
ATOM 4133  H HB2  . LEU A 1 121 ? -4.154  3.117   3.722   1.00 0.00 ? 121 LEU A HB2  2  
ATOM 4134  H HB3  . LEU A 1 121 ? -2.945  4.216   3.087   1.00 0.00 ? 121 LEU A HB3  2  
ATOM 4135  H HG   . LEU A 1 121 ? -3.443  2.000   1.823   1.00 0.00 ? 121 LEU A HG   2  
ATOM 4136  H HD11 . LEU A 1 121 ? -1.402  3.713   1.743   1.00 0.00 ? 121 LEU A HD11 2  
ATOM 4137  H HD12 . LEU A 1 121 ? -0.518  2.305   2.334   1.00 0.00 ? 121 LEU A HD12 2  
ATOM 4138  H HD13 . LEU A 1 121 ? -1.390  2.221   0.803   1.00 0.00 ? 121 LEU A HD13 2  
ATOM 4139  H HD21 . LEU A 1 121 ? -2.903  0.792   4.164   1.00 0.00 ? 121 LEU A HD21 2  
ATOM 4140  H HD22 . LEU A 1 121 ? -2.622  0.017   2.610   1.00 0.00 ? 121 LEU A HD22 2  
ATOM 4141  H HD23 . LEU A 1 121 ? -1.300  0.794   3.463   1.00 0.00 ? 121 LEU A HD23 2  
ATOM 4142  N N    . THR A 1 122 ? -0.309  1.929   5.220   1.00 0.00 ? 122 THR A N    2  
ATOM 4143  C CA   . THR A 1 122 ? 1.151   1.618   5.118   1.00 0.00 ? 122 THR A CA   2  
ATOM 4144  C C    . THR A 1 122 ? 1.354   0.519   4.076   1.00 0.00 ? 122 THR A C    2  
ATOM 4145  O O    . THR A 1 122 ? 0.468   -0.255  3.810   1.00 0.00 ? 122 THR A O    2  
ATOM 4146  C CB   . THR A 1 122 ? 1.637   1.080   6.455   1.00 0.00 ? 122 THR A CB   2  
ATOM 4147  O OG1  . THR A 1 122 ? 1.277   1.977   7.495   1.00 0.00 ? 122 THR A OG1  2  
ATOM 4148  C CG2  . THR A 1 122 ? 3.153   0.905   6.421   1.00 0.00 ? 122 THR A CG2  2  
ATOM 4149  H H    . THR A 1 122 ? -0.896  1.297   5.676   1.00 0.00 ? 122 THR A H    2  
ATOM 4150  H HA   . THR A 1 122 ? 1.715   2.496   4.854   1.00 0.00 ? 122 THR A HA   2  
ATOM 4151  H HB   . THR A 1 122 ? 1.182   0.123   6.624   1.00 0.00 ? 122 THR A HB   2  
ATOM 4152  H HG1  . THR A 1 122 ? 1.607   1.620   8.323   1.00 0.00 ? 122 THR A HG1  2  
ATOM 4153  H HG21 . THR A 1 122 ? 3.594   1.703   5.845   1.00 0.00 ? 122 THR A HG21 2  
ATOM 4154  H HG22 . THR A 1 122 ? 3.539   0.926   7.428   1.00 0.00 ? 122 THR A HG22 2  
ATOM 4155  H HG23 . THR A 1 122 ? 3.391   -0.045  5.963   1.00 0.00 ? 122 THR A HG23 2  
ATOM 4156  N N    . MET A 1 123 ? 2.522   0.421   3.517   1.00 0.00 ? 123 MET A N    2  
ATOM 4157  C CA   . MET A 1 123 ? 2.780   -0.657  2.515   1.00 0.00 ? 123 MET A CA   2  
ATOM 4158  C C    . MET A 1 123 ? 4.276   -0.928  2.446   1.00 0.00 ? 123 MET A C    2  
ATOM 4159  O O    . MET A 1 123 ? 5.010   -0.258  1.745   1.00 0.00 ? 123 MET A O    2  
ATOM 4160  C CB   . MET A 1 123 ? 2.261   -0.231  1.144   1.00 0.00 ? 123 MET A CB   2  
ATOM 4161  C CG   . MET A 1 123 ? 2.380   -1.405  0.163   1.00 0.00 ? 123 MET A CG   2  
ATOM 4162  S SD   . MET A 1 123 ? 3.778   -1.142  -0.960  1.00 0.00 ? 123 MET A SD   2  
ATOM 4163  C CE   . MET A 1 123 ? 4.018   -2.873  -1.431  1.00 0.00 ? 123 MET A CE   2  
ATOM 4164  H H    . MET A 1 123 ? 3.237   1.039   3.773   1.00 0.00 ? 123 MET A H    2  
ATOM 4165  H HA   . MET A 1 123 ? 2.270   -1.556  2.823   1.00 0.00 ? 123 MET A HA   2  
ATOM 4166  H HB2  . MET A 1 123 ? 1.223   0.055   1.234   1.00 0.00 ? 123 MET A HB2  2  
ATOM 4167  H HB3  . MET A 1 123 ? 2.837   0.608   0.784   1.00 0.00 ? 123 MET A HB3  2  
ATOM 4168  H HG2  . MET A 1 123 ? 2.530   -2.325  0.714   1.00 0.00 ? 123 MET A HG2  2  
ATOM 4169  H HG3  . MET A 1 123 ? 1.469   -1.481  -0.408  1.00 0.00 ? 123 MET A HG3  2  
ATOM 4170  H HE1  . MET A 1 123 ? 3.232   -3.475  -0.997  1.00 0.00 ? 123 MET A HE1  2  
ATOM 4171  H HE2  . MET A 1 123 ? 3.991   -2.959  -2.509  1.00 0.00 ? 123 MET A HE2  2  
ATOM 4172  H HE3  . MET A 1 123 ? 4.973   -3.218  -1.069  1.00 0.00 ? 123 MET A HE3  2  
ATOM 4173  N N    . THR A 1 124 ? 4.729   -1.900  3.188   1.00 0.00 ? 124 THR A N    2  
ATOM 4174  C CA   . THR A 1 124 ? 6.187   -2.217  3.202   1.00 0.00 ? 124 THR A CA   2  
ATOM 4175  C C    . THR A 1 124 ? 6.595   -2.870  1.896   1.00 0.00 ? 124 THR A C    2  
ATOM 4176  O O    . THR A 1 124 ? 5.769   -3.246  1.085   1.00 0.00 ? 124 THR A O    2  
ATOM 4177  C CB   . THR A 1 124 ? 6.571   -3.143  4.385   1.00 0.00 ? 124 THR A CB   2  
ATOM 4178  O OG1  . THR A 1 124 ? 6.569   -4.506  3.972   1.00 0.00 ? 124 THR A OG1  2  
ATOM 4179  C CG2  . THR A 1 124 ? 5.610   -2.992  5.569   1.00 0.00 ? 124 THR A CG2  2  
ATOM 4180  H H    . THR A 1 124 ? 4.110   -2.409  3.748   1.00 0.00 ? 124 THR A H    2  
ATOM 4181  H HA   . THR A 1 124 ? 6.735   -1.299  3.286   1.00 0.00 ? 124 THR A HA   2  
ATOM 4182  H HB   . THR A 1 124 ? 7.561   -2.875  4.710   1.00 0.00 ? 124 THR A HB   2  
ATOM 4183  H HG1  . THR A 1 124 ? 6.923   -5.035  4.691   1.00 0.00 ? 124 THR A HG1  2  
ATOM 4184  H HG21 . THR A 1 124 ? 5.057   -2.070  5.471   1.00 0.00 ? 124 THR A HG21 2  
ATOM 4185  H HG22 . THR A 1 124 ? 4.924   -3.824  5.580   1.00 0.00 ? 124 THR A HG22 2  
ATOM 4186  H HG23 . THR A 1 124 ? 6.175   -2.977  6.488   1.00 0.00 ? 124 THR A HG23 2  
ATOM 4187  N N    . ALA A 1 125 ? 7.878   -3.004  1.698   1.00 0.00 ? 125 ALA A N    2  
ATOM 4188  C CA   . ALA A 1 125 ? 8.366   -3.638  0.441   1.00 0.00 ? 125 ALA A CA   2  
ATOM 4189  C C    . ALA A 1 125 ? 9.885   -3.813  0.440   1.00 0.00 ? 125 ALA A C    2  
ATOM 4190  O O    . ALA A 1 125 ? 10.629  -2.885  0.200   1.00 0.00 ? 125 ALA A O    2  
ATOM 4191  C CB   . ALA A 1 125 ? 7.965   -2.775  -0.752  1.00 0.00 ? 125 ALA A CB   2  
ATOM 4192  H H    . ALA A 1 125 ? 8.512   -2.686  2.383   1.00 0.00 ? 125 ALA A H    2  
ATOM 4193  H HA   . ALA A 1 125 ? 7.909   -4.594  0.354   1.00 0.00 ? 125 ALA A HA   2  
ATOM 4194  H HB1  . ALA A 1 125 ? 7.965   -1.738  -0.458  1.00 0.00 ? 125 ALA A HB1  2  
ATOM 4195  H HB2  . ALA A 1 125 ? 8.672   -2.924  -1.554  1.00 0.00 ? 125 ALA A HB2  2  
ATOM 4196  H HB3  . ALA A 1 125 ? 6.979   -3.053  -1.081  1.00 0.00 ? 125 ALA A HB3  2  
ATOM 4197  N N    . ASP A 1 126 ? 10.357  -5.011  0.668   1.00 0.00 ? 126 ASP A N    2  
ATOM 4198  C CA   . ASP A 1 126 ? 11.834  -5.251  0.656   1.00 0.00 ? 126 ASP A CA   2  
ATOM 4199  C C    . ASP A 1 126 ? 12.478  -4.487  1.815   1.00 0.00 ? 126 ASP A C    2  
ATOM 4200  O O    . ASP A 1 126 ? 13.597  -4.024  1.716   1.00 0.00 ? 126 ASP A O    2  
ATOM 4201  C CB   . ASP A 1 126 ? 12.429  -4.770  -0.675  1.00 0.00 ? 126 ASP A CB   2  
ATOM 4202  C CG   . ASP A 1 126 ? 13.162  -5.922  -1.369  1.00 0.00 ? 126 ASP A CG   2  
ATOM 4203  O OD1  . ASP A 1 126 ? 12.543  -6.952  -1.578  1.00 0.00 ? 126 ASP A OD1  2  
ATOM 4204  O OD2  . ASP A 1 126 ? 14.330  -5.754  -1.678  1.00 0.00 ? 126 ASP A OD2  2  
ATOM 4205  H H    . ASP A 1 126 ? 9.741   -5.760  0.831   1.00 0.00 ? 126 ASP A H    2  
ATOM 4206  H HA   . ASP A 1 126 ? 12.019  -6.307  0.777   1.00 0.00 ? 126 ASP A HA   2  
ATOM 4207  H HB2  . ASP A 1 126 ? 11.629  -4.419  -1.310  1.00 0.00 ? 126 ASP A HB2  2  
ATOM 4208  H HB3  . ASP A 1 126 ? 13.121  -3.963  -0.491  1.00 0.00 ? 126 ASP A HB3  2  
ATOM 4209  N N    . ASP A 1 127 ? 11.755  -4.371  2.908   1.00 0.00 ? 127 ASP A N    2  
ATOM 4210  C CA   . ASP A 1 127 ? 12.234  -3.664  4.152   1.00 0.00 ? 127 ASP A CA   2  
ATOM 4211  C C    . ASP A 1 127 ? 11.827  -2.191  4.131   1.00 0.00 ? 127 ASP A C    2  
ATOM 4212  O O    . ASP A 1 127 ? 12.004  -1.492  5.113   1.00 0.00 ? 127 ASP A O    2  
ATOM 4213  C CB   . ASP A 1 127 ? 13.756  -3.772  4.332   1.00 0.00 ? 127 ASP A CB   2  
ATOM 4214  C CG   . ASP A 1 127 ? 14.101  -3.724  5.822   1.00 0.00 ? 127 ASP A CG   2  
ATOM 4215  O OD1  . ASP A 1 127 ? 13.444  -4.414  6.584   1.00 0.00 ? 127 ASP A OD1  2  
ATOM 4216  O OD2  . ASP A 1 127 ? 15.016  -2.999  6.175   1.00 0.00 ? 127 ASP A OD2  2  
ATOM 4217  H H    . ASP A 1 127 ? 10.863  -4.761  2.910   1.00 0.00 ? 127 ASP A H    2  
ATOM 4218  H HA   . ASP A 1 127 ? 11.755  -4.129  5.004   1.00 0.00 ? 127 ASP A HA   2  
ATOM 4219  H HB2  . ASP A 1 127 ? 14.101  -4.704  3.910   1.00 0.00 ? 127 ASP A HB2  2  
ATOM 4220  H HB3  . ASP A 1 127 ? 14.235  -2.948  3.826   1.00 0.00 ? 127 ASP A HB3  2  
ATOM 4221  N N    . VAL A 1 128 ? 11.266  -1.707  3.047   1.00 0.00 ? 128 VAL A N    2  
ATOM 4222  C CA   . VAL A 1 128 ? 10.841  -0.290  3.014   1.00 0.00 ? 128 VAL A CA   2  
ATOM 4223  C C    . VAL A 1 128 ? 9.451   -0.194  3.638   1.00 0.00 ? 128 VAL A C    2  
ATOM 4224  O O    . VAL A 1 128 ? 8.845   -1.191  3.978   1.00 0.00 ? 128 VAL A O    2  
ATOM 4225  C CB   . VAL A 1 128 ? 10.802  0.211   1.557   1.00 0.00 ? 128 VAL A CB   2  
ATOM 4226  C CG1  . VAL A 1 128 ? 12.126  -0.105  0.858   1.00 0.00 ? 128 VAL A CG1  2  
ATOM 4227  C CG2  . VAL A 1 128 ? 9.665   -0.460  0.786   1.00 0.00 ? 128 VAL A CG2  2  
ATOM 4228  H H    . VAL A 1 128 ? 11.109  -2.272  2.265   1.00 0.00 ? 128 VAL A H    2  
ATOM 4229  H HA   . VAL A 1 128 ? 11.532  0.310   3.586   1.00 0.00 ? 128 VAL A HA   2  
ATOM 4230  H HB   . VAL A 1 128 ? 10.643  1.269   1.561   1.00 0.00 ? 128 VAL A HB   2  
ATOM 4231  H HG11 . VAL A 1 128 ? 12.946  0.191   1.485   1.00 0.00 ? 128 VAL A HG11 2  
ATOM 4232  H HG12 . VAL A 1 128 ? 12.185  -1.167  0.665   1.00 0.00 ? 128 VAL A HG12 2  
ATOM 4233  H HG13 . VAL A 1 128 ? 12.176  0.433   -0.077  1.00 0.00 ? 128 VAL A HG13 2  
ATOM 4234  H HG21 . VAL A 1 128 ? 9.417   -1.385  1.270   1.00 0.00 ? 128 VAL A HG21 2  
ATOM 4235  H HG22 . VAL A 1 128 ? 8.802   0.185   0.781   1.00 0.00 ? 128 VAL A HG22 2  
ATOM 4236  H HG23 . VAL A 1 128 ? 9.977   -0.658  -0.228  1.00 0.00 ? 128 VAL A HG23 2  
ATOM 4237  N N    . VAL A 1 129 ? 8.943   0.991   3.765   1.00 0.00 ? 129 VAL A N    2  
ATOM 4238  C CA   . VAL A 1 129 ? 7.586   1.164   4.331   1.00 0.00 ? 129 VAL A CA   2  
ATOM 4239  C C    . VAL A 1 129 ? 7.010   2.497   3.859   1.00 0.00 ? 129 VAL A C    2  
ATOM 4240  O O    . VAL A 1 129 ? 7.518   3.556   4.163   1.00 0.00 ? 129 VAL A O    2  
ATOM 4241  C CB   . VAL A 1 129 ? 7.656   1.034   5.868   1.00 0.00 ? 129 VAL A CB   2  
ATOM 4242  C CG1  . VAL A 1 129 ? 6.703   2.015   6.585   1.00 0.00 ? 129 VAL A CG1  2  
ATOM 4243  C CG2  . VAL A 1 129 ? 7.264   -0.398  6.229   1.00 0.00 ? 129 VAL A CG2  2  
ATOM 4244  H H    . VAL A 1 129 ? 9.453   1.764   3.477   1.00 0.00 ? 129 VAL A H    2  
ATOM 4245  H HA   . VAL A 1 129 ? 6.960   0.382   3.944   1.00 0.00 ? 129 VAL A HA   2  
ATOM 4246  H HB   . VAL A 1 129 ? 8.668   1.210   6.186   1.00 0.00 ? 129 VAL A HB   2  
ATOM 4247  H HG11 . VAL A 1 129 ? 5.770   2.073   6.042   1.00 0.00 ? 129 VAL A HG11 2  
ATOM 4248  H HG12 . VAL A 1 129 ? 6.513   1.670   7.589   1.00 0.00 ? 129 VAL A HG12 2  
ATOM 4249  H HG13 . VAL A 1 129 ? 7.156   2.997   6.620   1.00 0.00 ? 129 VAL A HG13 2  
ATOM 4250  H HG21 . VAL A 1 129 ? 6.473   -0.715  5.571   1.00 0.00 ? 129 VAL A HG21 2  
ATOM 4251  H HG22 . VAL A 1 129 ? 8.117   -1.050  6.102   1.00 0.00 ? 129 VAL A HG22 2  
ATOM 4252  H HG23 . VAL A 1 129 ? 6.923   -0.439  7.250   1.00 0.00 ? 129 VAL A HG23 2  
ATOM 4253  N N    . CYS A 1 130 ? 5.939   2.423   3.124   1.00 0.00 ? 130 CYS A N    2  
ATOM 4254  C CA   . CYS A 1 130 ? 5.282   3.659   2.612   1.00 0.00 ? 130 CYS A CA   2  
ATOM 4255  C C    . CYS A 1 130 ? 4.107   4.004   3.525   1.00 0.00 ? 130 CYS A C    2  
ATOM 4256  O O    . CYS A 1 130 ? 3.009   3.512   3.347   1.00 0.00 ? 130 CYS A O    2  
ATOM 4257  C CB   . CYS A 1 130 ? 4.772   3.417   1.190   1.00 0.00 ? 130 CYS A CB   2  
ATOM 4258  S SG   . CYS A 1 130 ? 4.489   5.007   0.372   1.00 0.00 ? 130 CYS A SG   2  
ATOM 4259  H H    . CYS A 1 130 ? 5.560   1.538   2.917   1.00 0.00 ? 130 CYS A H    2  
ATOM 4260  H HA   . CYS A 1 130 ? 5.992   4.474   2.609   1.00 0.00 ? 130 CYS A HA   2  
ATOM 4261  H HB2  . CYS A 1 130 ? 5.506   2.852   0.635   1.00 0.00 ? 130 CYS A HB2  2  
ATOM 4262  H HB3  . CYS A 1 130 ? 3.846   2.862   1.229   1.00 0.00 ? 130 CYS A HB3  2  
ATOM 4263  H HG   . CYS A 1 130 ? 5.305   5.266   -0.062  1.00 0.00 ? 130 CYS A HG   2  
ATOM 4264  N N    . THR A 1 131 ? 4.337   4.831   4.511   1.00 0.00 ? 131 THR A N    2  
ATOM 4265  C CA   . THR A 1 131 ? 3.243   5.199   5.456   1.00 0.00 ? 131 THR A CA   2  
ATOM 4266  C C    . THR A 1 131 ? 2.787   6.635   5.206   1.00 0.00 ? 131 THR A C    2  
ATOM 4267  O O    . THR A 1 131 ? 3.559   7.570   5.314   1.00 0.00 ? 131 THR A O    2  
ATOM 4268  C CB   . THR A 1 131 ? 3.757   5.089   6.893   1.00 0.00 ? 131 THR A CB   2  
ATOM 4269  O OG1  . THR A 1 131 ? 4.766   4.091   6.959   1.00 0.00 ? 131 THR A OG1  2  
ATOM 4270  C CG2  . THR A 1 131 ? 2.605   4.717   7.830   1.00 0.00 ? 131 THR A CG2  2  
ATOM 4271  H H    . THR A 1 131 ? 5.235   5.202   4.638   1.00 0.00 ? 131 THR A H    2  
ATOM 4272  H HA   . THR A 1 131 ? 2.407   4.527   5.321   1.00 0.00 ? 131 THR A HA   2  
ATOM 4273  H HB   . THR A 1 131 ? 4.169   6.041   7.197   1.00 0.00 ? 131 THR A HB   2  
ATOM 4274  H HG1  . THR A 1 131 ? 5.422   4.375   7.600   1.00 0.00 ? 131 THR A HG1  2  
ATOM 4275  H HG21 . THR A 1 131 ? 1.662   4.943   7.353   1.00 0.00 ? 131 THR A HG21 2  
ATOM 4276  H HG22 . THR A 1 131 ? 2.651   3.661   8.054   1.00 0.00 ? 131 THR A HG22 2  
ATOM 4277  H HG23 . THR A 1 131 ? 2.689   5.283   8.746   1.00 0.00 ? 131 THR A HG23 2  
ATOM 4278  N N    . ARG A 1 132 ? 1.532   6.813   4.896   1.00 0.00 ? 132 ARG A N    2  
ATOM 4279  C CA   . ARG A 1 132 ? 0.998   8.188   4.661   1.00 0.00 ? 132 ARG A CA   2  
ATOM 4280  C C    . ARG A 1 132 ? -0.465  8.221   5.090   1.00 0.00 ? 132 ARG A C    2  
ATOM 4281  O O    . ARG A 1 132 ? -1.208  7.285   4.860   1.00 0.00 ? 132 ARG A O    2  
ATOM 4282  C CB   . ARG A 1 132 ? 1.120   8.597   3.180   1.00 0.00 ? 132 ARG A CB   2  
ATOM 4283  C CG   . ARG A 1 132 ? 0.976   7.385   2.256   1.00 0.00 ? 132 ARG A CG   2  
ATOM 4284  C CD   . ARG A 1 132 ? 0.975   7.858   0.803   1.00 0.00 ? 132 ARG A CD   2  
ATOM 4285  N NE   . ARG A 1 132 ? 1.300   6.713   -0.094  1.00 0.00 ? 132 ARG A NE   2  
ATOM 4286  C CZ   . ARG A 1 132 ? 1.846   6.931   -1.259  1.00 0.00 ? 132 ARG A CZ   2  
ATOM 4287  N NH1  . ARG A 1 132 ? 2.932   7.650   -1.346  1.00 0.00 ? 132 ARG A NH1  2  
ATOM 4288  N NH2  . ARG A 1 132 ? 1.307   6.430   -2.337  1.00 0.00 ? 132 ARG A NH2  2  
ATOM 4289  H H    . ARG A 1 132 ? 0.931   6.038   4.832   1.00 0.00 ? 132 ARG A H    2  
ATOM 4290  H HA   . ARG A 1 132 ? 1.553   8.888   5.269   1.00 0.00 ? 132 ARG A HA   2  
ATOM 4291  H HB2  . ARG A 1 132 ? 0.347   9.312   2.945   1.00 0.00 ? 132 ARG A HB2  2  
ATOM 4292  H HB3  . ARG A 1 132 ? 2.083   9.051   3.018   1.00 0.00 ? 132 ARG A HB3  2  
ATOM 4293  H HG2  . ARG A 1 132 ? 1.802   6.709   2.416   1.00 0.00 ? 132 ARG A HG2  2  
ATOM 4294  H HG3  . ARG A 1 132 ? 0.051   6.879   2.467   1.00 0.00 ? 132 ARG A HG3  2  
ATOM 4295  H HD2  . ARG A 1 132 ? 0.001   8.248   0.553   1.00 0.00 ? 132 ARG A HD2  2  
ATOM 4296  H HD3  . ARG A 1 132 ? 1.715   8.635   0.679   1.00 0.00 ? 132 ARG A HD3  2  
ATOM 4297  H HE   . ARG A 1 132 ? 1.103   5.796   0.191   1.00 0.00 ? 132 ARG A HE   2  
ATOM 4298  H HH11 . ARG A 1 132 ? 3.345   8.033   -0.520  1.00 0.00 ? 132 ARG A HH11 2  
ATOM 4299  H HH12 . ARG A 1 132 ? 3.352   7.817   -2.238  1.00 0.00 ? 132 ARG A HH12 2  
ATOM 4300  H HH21 . ARG A 1 132 ? 0.475   5.879   -2.270  1.00 0.00 ? 132 ARG A HH21 2  
ATOM 4301  H HH22 . ARG A 1 132 ? 1.726   6.597   -3.230  1.00 0.00 ? 132 ARG A HH22 2  
ATOM 4302  N N    . VAL A 1 133 ? -0.878  9.286   5.726   1.00 0.00 ? 133 VAL A N    2  
ATOM 4303  C CA   . VAL A 1 133 ? -2.289  9.380   6.190   1.00 0.00 ? 133 VAL A CA   2  
ATOM 4304  C C    . VAL A 1 133 ? -3.187  9.749   5.016   1.00 0.00 ? 133 VAL A C    2  
ATOM 4305  O O    . VAL A 1 133 ? -2.744  10.277  4.020   1.00 0.00 ? 133 VAL A O    2  
ATOM 4306  C CB   . VAL A 1 133 ? -2.391  10.449  7.290   1.00 0.00 ? 133 VAL A CB   2  
ATOM 4307  C CG1  . VAL A 1 133 ? -3.854  10.654  7.695   1.00 0.00 ? 133 VAL A CG1  2  
ATOM 4308  C CG2  . VAL A 1 133 ? -1.588  9.994   8.510   1.00 0.00 ? 133 VAL A CG2  2  
ATOM 4309  H H    . VAL A 1 133 ? -0.254  10.024  5.904   1.00 0.00 ? 133 VAL A H    2  
ATOM 4310  H HA   . VAL A 1 133 ? -2.603  8.428   6.587   1.00 0.00 ? 133 VAL A HA   2  
ATOM 4311  H HB   . VAL A 1 133 ? -1.990  11.380  6.923   1.00 0.00 ? 133 VAL A HB   2  
ATOM 4312  H HG11 . VAL A 1 133 ? -4.308  9.696   7.899   1.00 0.00 ? 133 VAL A HG11 2  
ATOM 4313  H HG12 . VAL A 1 133 ? -3.900  11.273  8.576   1.00 0.00 ? 133 VAL A HG12 2  
ATOM 4314  H HG13 . VAL A 1 133 ? -4.384  11.137  6.885   1.00 0.00 ? 133 VAL A HG13 2  
ATOM 4315  H HG21 . VAL A 1 133 ? -1.573  8.915   8.549   1.00 0.00 ? 133 VAL A HG21 2  
ATOM 4316  H HG22 . VAL A 1 133 ? -0.577  10.365  8.434   1.00 0.00 ? 133 VAL A HG22 2  
ATOM 4317  H HG23 . VAL A 1 133 ? -2.048  10.381  9.408   1.00 0.00 ? 133 VAL A HG23 2  
ATOM 4318  N N    . TYR A 1 134 ? -4.454  9.485   5.150   1.00 0.00 ? 134 TYR A N    2  
ATOM 4319  C CA   . TYR A 1 134 ? -5.416  9.828   4.077   1.00 0.00 ? 134 TYR A CA   2  
ATOM 4320  C C    . TYR A 1 134 ? -6.675  10.396  4.711   1.00 0.00 ? 134 TYR A C    2  
ATOM 4321  O O    . TYR A 1 134 ? -6.924  10.221  5.889   1.00 0.00 ? 134 TYR A O    2  
ATOM 4322  C CB   . TYR A 1 134 ? -5.841  8.589   3.308   1.00 0.00 ? 134 TYR A CB   2  
ATOM 4323  C CG   . TYR A 1 134 ? -4.711  8.060   2.479   1.00 0.00 ? 134 TYR A CG   2  
ATOM 4324  C CD1  . TYR A 1 134 ? -3.633  7.427   3.096   1.00 0.00 ? 134 TYR A CD1  2  
ATOM 4325  C CD2  . TYR A 1 134 ? -4.753  8.183   1.088   1.00 0.00 ? 134 TYR A CD2  2  
ATOM 4326  C CE1  . TYR A 1 134 ? -2.593  6.916   2.326   1.00 0.00 ? 134 TYR A CE1  2  
ATOM 4327  C CE2  . TYR A 1 134 ? -3.713  7.676   0.312   1.00 0.00 ? 134 TYR A CE2  2  
ATOM 4328  C CZ   . TYR A 1 134 ? -2.627  7.039   0.930   1.00 0.00 ? 134 TYR A CZ   2  
ATOM 4329  O OH   . TYR A 1 134 ? -1.596  6.532   0.165   1.00 0.00 ? 134 TYR A OH   2  
ATOM 4330  H H    . TYR A 1 134 ? -4.776  9.070   5.973   1.00 0.00 ? 134 TYR A H    2  
ATOM 4331  H HA   . TYR A 1 134 ? -4.973  10.541  3.399   1.00 0.00 ? 134 TYR A HA   2  
ATOM 4332  H HB2  . TYR A 1 134 ? -6.164  7.834   3.997   1.00 0.00 ? 134 TYR A HB2  2  
ATOM 4333  H HB3  . TYR A 1 134 ? -6.660  8.852   2.669   1.00 0.00 ? 134 TYR A HB3  2  
ATOM 4334  H HD1  . TYR A 1 134 ? -3.602  7.336   4.169   1.00 0.00 ? 134 TYR A HD1  2  
ATOM 4335  H HD2  . TYR A 1 134 ? -5.590  8.673   0.614   1.00 0.00 ? 134 TYR A HD2  2  
ATOM 4336  H HE1  . TYR A 1 134 ? -1.768  6.425   2.809   1.00 0.00 ? 134 TYR A HE1  2  
ATOM 4337  H HE2  . TYR A 1 134 ? -3.748  7.775   -0.760  1.00 0.00 ? 134 TYR A HE2  2  
ATOM 4338  H HH   . TYR A 1 134 ? -1.826  5.633   -0.084  1.00 0.00 ? 134 TYR A HH   2  
ATOM 4339  N N    . VAL A 1 135 ? -7.491  11.023  3.922   1.00 0.00 ? 135 VAL A N    2  
ATOM 4340  C CA   . VAL A 1 135 ? -8.771  11.556  4.431   1.00 0.00 ? 135 VAL A CA   2  
ATOM 4341  C C    . VAL A 1 135 ? -9.830  11.195  3.412   1.00 0.00 ? 135 VAL A C    2  
ATOM 4342  O O    . VAL A 1 135 ? -9.510  10.876  2.288   1.00 0.00 ? 135 VAL A O    2  
ATOM 4343  C CB   . VAL A 1 135 ? -8.696  13.056  4.588   1.00 0.00 ? 135 VAL A CB   2  
ATOM 4344  C CG1  . VAL A 1 135 ? -10.011 13.555  5.168   1.00 0.00 ? 135 VAL A CG1  2  
ATOM 4345  C CG2  . VAL A 1 135 ? -7.556  13.397  5.538   1.00 0.00 ? 135 VAL A CG2  2  
ATOM 4346  H H    . VAL A 1 135 ? -7.279  11.112  2.973   1.00 0.00 ? 135 VAL A H    2  
ATOM 4347  H HA   . VAL A 1 135 ? -9.001  11.102  5.379   1.00 0.00 ? 135 VAL A HA   2  
ATOM 4348  H HB   . VAL A 1 135 ? -8.528  13.507  3.630   1.00 0.00 ? 135 VAL A HB   2  
ATOM 4349  H HG11 . VAL A 1 135 ? -10.402 12.812  5.846   1.00 0.00 ? 135 VAL A HG11 2  
ATOM 4350  H HG12 . VAL A 1 135 ? -9.843  14.477  5.696   1.00 0.00 ? 135 VAL A HG12 2  
ATOM 4351  H HG13 . VAL A 1 135 ? -10.714 13.714  4.365   1.00 0.00 ? 135 VAL A HG13 2  
ATOM 4352  H HG21 . VAL A 1 135 ? -6.690  12.807  5.283   1.00 0.00 ? 135 VAL A HG21 2  
ATOM 4353  H HG22 . VAL A 1 135 ? -7.319  14.444  5.452   1.00 0.00 ? 135 VAL A HG22 2  
ATOM 4354  H HG23 . VAL A 1 135 ? -7.858  13.173  6.550   1.00 0.00 ? 135 VAL A HG23 2  
ATOM 4355  N N    . ARG A 1 136 ? -11.075 11.225  3.771   1.00 0.00 ? 136 ARG A N    2  
ATOM 4356  C CA   . ARG A 1 136 ? -12.104 10.850  2.766   1.00 0.00 ? 136 ARG A CA   2  
ATOM 4357  C C    . ARG A 1 136 ? -12.477 12.067  1.932   1.00 0.00 ? 136 ARG A C    2  
ATOM 4358  O O    . ARG A 1 136 ? -13.001 13.045  2.427   1.00 0.00 ? 136 ARG A O    2  
ATOM 4359  C CB   . ARG A 1 136 ? -13.355 10.271  3.428   1.00 0.00 ? 136 ARG A CB   2  
ATOM 4360  C CG   . ARG A 1 136 ? -13.365 8.748   3.260   1.00 0.00 ? 136 ARG A CG   2  
ATOM 4361  C CD   . ARG A 1 136 ? -13.925 8.093   4.525   1.00 0.00 ? 136 ARG A CD   2  
ATOM 4362  N NE   . ARG A 1 136 ? -15.369 8.435   4.664   1.00 0.00 ? 136 ARG A NE   2  
ATOM 4363  C CZ   . ARG A 1 136 ? -16.280 7.597   4.251   1.00 0.00 ? 136 ARG A CZ   2  
ATOM 4364  N NH1  . ARG A 1 136 ? -16.470 6.473   4.888   1.00 0.00 ? 136 ARG A NH1  2  
ATOM 4365  N NH2  . ARG A 1 136 ? -17.002 7.883   3.202   1.00 0.00 ? 136 ARG A NH2  2  
ATOM 4366  H H    . ARG A 1 136 ? -11.320 11.482  4.683   1.00 0.00 ? 136 ARG A H    2  
ATOM 4367  H HA   . ARG A 1 136 ? -11.671 10.105  2.114   1.00 0.00 ? 136 ARG A HA   2  
ATOM 4368  H HB2  . ARG A 1 136 ? -13.366 10.522  4.476   1.00 0.00 ? 136 ARG A HB2  2  
ATOM 4369  H HB3  . ARG A 1 136 ? -14.229 10.680  2.945   1.00 0.00 ? 136 ARG A HB3  2  
ATOM 4370  H HG2  . ARG A 1 136 ? -13.983 8.488   2.414   1.00 0.00 ? 136 ARG A HG2  2  
ATOM 4371  H HG3  . ARG A 1 136 ? -12.359 8.399   3.088   1.00 0.00 ? 136 ARG A HG3  2  
ATOM 4372  H HD2  . ARG A 1 136 ? -13.814 7.021   4.455   1.00 0.00 ? 136 ARG A HD2  2  
ATOM 4373  H HD3  . ARG A 1 136 ? -13.385 8.455   5.387   1.00 0.00 ? 136 ARG A HD3  2  
ATOM 4374  H HE   . ARG A 1 136 ? -15.634 9.289   5.065   1.00 0.00 ? 136 ARG A HE   2  
ATOM 4375  H HH11 . ARG A 1 136 ? -15.916 6.254   5.691   1.00 0.00 ? 136 ARG A HH11 2  
ATOM 4376  H HH12 . ARG A 1 136 ? -17.169 5.832   4.572   1.00 0.00 ? 136 ARG A HH12 2  
ATOM 4377  H HH21 . ARG A 1 136 ? -16.857 8.744   2.715   1.00 0.00 ? 136 ARG A HH21 2  
ATOM 4378  H HH22 . ARG A 1 136 ? -17.701 7.241   2.886   1.00 0.00 ? 136 ARG A HH22 2  
ATOM 4379  N N    . GLU A 1 137 ? -12.201 11.995  0.658   1.00 0.00 ? 137 GLU A N    2  
ATOM 4380  C CA   . GLU A 1 137 ? -12.518 13.120  -0.281  1.00 0.00 ? 137 GLU A CA   2  
ATOM 4381  C C    . GLU A 1 137 ? -13.937 13.658  -0.040  1.00 0.00 ? 137 GLU A C    2  
ATOM 4382  O O    . GLU A 1 137 ? -14.127 14.855  -0.178  1.00 0.00 ? 137 GLU A O    2  
ATOM 4383  C CB   . GLU A 1 137 ? -12.430 12.605  -1.718  1.00 0.00 ? 137 GLU A CB   2  
ATOM 4384  C CG   . GLU A 1 137 ? -12.528 13.784  -2.686  1.00 0.00 ? 137 GLU A CG   2  
ATOM 4385  C CD   . GLU A 1 137 ? -13.173 13.320  -3.993  1.00 0.00 ? 137 GLU A CD   2  
ATOM 4386  O OE1  . GLU A 1 137 ? -12.527 12.586  -4.722  1.00 0.00 ? 137 GLU A OE1  2  
ATOM 4387  O OE2  . GLU A 1 137 ? -14.303 13.706  -4.243  1.00 0.00 ? 137 GLU A OE2  2  
ATOM 4388  O OXT  . GLU A 1 137 ? -14.806 12.862  0.277   1.00 0.00 ? 137 GLU A OXT  2  
ATOM 4389  H H    . GLU A 1 137 ? -11.769 11.186  0.315   1.00 0.00 ? 137 GLU A H    2  
ATOM 4390  H HA   . GLU A 1 137 ? -11.802 13.912  -0.143  1.00 0.00 ? 137 GLU A HA   2  
ATOM 4391  H HB2  . GLU A 1 137 ? -11.491 12.092  -1.861  1.00 0.00 ? 137 GLU A HB2  2  
ATOM 4392  H HB3  . GLU A 1 137 ? -13.244 11.921  -1.905  1.00 0.00 ? 137 GLU A HB3  2  
ATOM 4393  H HG2  . GLU A 1 137 ? -13.131 14.562  -2.242  1.00 0.00 ? 137 GLU A HG2  2  
ATOM 4394  H HG3  . GLU A 1 137 ? -11.541 14.167  -2.890  1.00 0.00 ? 137 GLU A HG3  2  
ATOM 4395  N N    . PRO A 1 1   ? 15.048  0.417   11.345  1.00 0.00 ? 1   PRO A N    3  
ATOM 4396  C CA   . PRO A 1 1   ? 13.652  0.365   10.794  1.00 0.00 ? 1   PRO A CA   3  
ATOM 4397  C C    . PRO A 1 1   ? 13.433  -0.903  9.950   1.00 0.00 ? 1   PRO A C    3  
ATOM 4398  O O    . PRO A 1 1   ? 12.323  -1.374  9.842   1.00 0.00 ? 1   PRO A O    3  
ATOM 4399  C CB   . PRO A 1 1   ? 13.443  1.596   9.906   1.00 0.00 ? 1   PRO A CB   3  
ATOM 4400  C CG   . PRO A 1 1   ? 14.752  2.378   9.910   1.00 0.00 ? 1   PRO A CG   3  
ATOM 4401  C CD   . PRO A 1 1   ? 15.773  1.546   10.687  1.00 0.00 ? 1   PRO A CD   3  
ATOM 4402  H H2   . PRO A 1 1   ? 15.546  -0.473  11.165  1.00 0.00 ? 1   PRO A H2   3  
ATOM 4403  H H3   . PRO A 1 1   ? 15.004  0.586   12.371  1.00 0.00 ? 1   PRO A H3   3  
ATOM 4404  H HA   . PRO A 1 1   ? 12.942  0.385   11.606  1.00 0.00 ? 1   PRO A HA   3  
ATOM 4405  H HB2  . PRO A 1 1   ? 13.184  1.294   8.898   1.00 0.00 ? 1   PRO A HB2  3  
ATOM 4406  H HB3  . PRO A 1 1   ? 12.655  2.211   10.312  1.00 0.00 ? 1   PRO A HB3  3  
ATOM 4407  H HG2  . PRO A 1 1   ? 15.092  2.529   8.894   1.00 0.00 ? 1   PRO A HG2  3  
ATOM 4408  H HG3  . PRO A 1 1   ? 14.612  3.330   10.398  1.00 0.00 ? 1   PRO A HG3  3  
ATOM 4409  H HD2  . PRO A 1 1   ? 16.519  1.157   10.008  1.00 0.00 ? 1   PRO A HD2  3  
ATOM 4410  H HD3  . PRO A 1 1   ? 16.248  2.159   11.438  1.00 0.00 ? 1   PRO A HD3  3  
ATOM 4411  N N    . ASN A 1 2   ? 14.471  -1.431  9.324   1.00 0.00 ? 2   ASN A N    3  
ATOM 4412  C CA   . ASN A 1 2   ? 14.312  -2.644  8.457   1.00 0.00 ? 2   ASN A CA   3  
ATOM 4413  C C    . ASN A 1 2   ? 13.601  -2.219  7.167   1.00 0.00 ? 2   ASN A C    3  
ATOM 4414  O O    . ASN A 1 2   ? 13.874  -1.150  6.668   1.00 0.00 ? 2   ASN A O    3  
ATOM 4415  C CB   . ASN A 1 2   ? 13.589  -3.771  9.226   1.00 0.00 ? 2   ASN A CB   3  
ATOM 4416  C CG   . ASN A 1 2   ? 14.458  -4.208  10.406  1.00 0.00 ? 2   ASN A CG   3  
ATOM 4417  O OD1  . ASN A 1 2   ? 14.198  -3.842  11.535  1.00 0.00 ? 2   ASN A OD1  3  
ATOM 4418  N ND2  . ASN A 1 2   ? 15.487  -4.981  10.192  1.00 0.00 ? 2   ASN A ND2  3  
ATOM 4419  H H    . ASN A 1 2   ? 15.350  -1.010  9.398   1.00 0.00 ? 2   ASN A H    3  
ATOM 4420  H HA   . ASN A 1 2   ? 15.278  -3.003  8.171   1.00 0.00 ? 2   ASN A HA   3  
ATOM 4421  H HB2  . ASN A 1 2   ? 12.647  -3.426  9.593   1.00 0.00 ? 2   ASN A HB2  3  
ATOM 4422  H HB3  . ASN A 1 2   ? 13.436  -4.616  8.574   1.00 0.00 ? 2   ASN A HB3  3  
ATOM 4423  H HD21 . ASN A 1 2   ? 15.698  -5.276  9.281   1.00 0.00 ? 2   ASN A HD21 3  
ATOM 4424  H HD22 . ASN A 1 2   ? 16.050  -5.266  10.942  1.00 0.00 ? 2   ASN A HD22 3  
ATOM 4425  N N    . PHE A 1 3   ? 12.731  -3.031  6.621   1.00 0.00 ? 3   PHE A N    3  
ATOM 4426  C CA   . PHE A 1 3   ? 12.004  -2.708  5.334   1.00 0.00 ? 3   PHE A CA   3  
ATOM 4427  C C    . PHE A 1 3   ? 12.897  -3.003  4.112   1.00 0.00 ? 3   PHE A C    3  
ATOM 4428  O O    . PHE A 1 3   ? 12.460  -3.620  3.160   1.00 0.00 ? 3   PHE A O    3  
ATOM 4429  C CB   . PHE A 1 3   ? 11.555  -1.238  5.241   1.00 0.00 ? 3   PHE A CB   3  
ATOM 4430  C CG   . PHE A 1 3   ? 10.598  -0.877  6.352   1.00 0.00 ? 3   PHE A CG   3  
ATOM 4431  C CD1  . PHE A 1 3   ? 11.083  -0.462  7.597   1.00 0.00 ? 3   PHE A CD1  3  
ATOM 4432  C CD2  . PHE A 1 3   ? 9.216   -0.908  6.119   1.00 0.00 ? 3   PHE A CD2  3  
ATOM 4433  C CE1  . PHE A 1 3   ? 10.209  -0.077  8.594   1.00 0.00 ? 3   PHE A CE1  3  
ATOM 4434  C CE2  . PHE A 1 3   ? 8.334   -0.529  7.133   1.00 0.00 ? 3   PHE A CE2  3  
ATOM 4435  C CZ   . PHE A 1 3   ? 8.838   -0.105  8.377   1.00 0.00 ? 3   PHE A CZ   3  
ATOM 4436  H H    . PHE A 1 3   ? 12.553  -3.877  7.053   1.00 0.00 ? 3   PHE A H    3  
ATOM 4437  H HA   . PHE A 1 3   ? 11.132  -3.339  5.277   1.00 0.00 ? 3   PHE A HA   3  
ATOM 4438  H HB2  . PHE A 1 3   ? 12.411  -0.589  5.282   1.00 0.00 ? 3   PHE A HB2  3  
ATOM 4439  H HB3  . PHE A 1 3   ? 11.058  -1.091  4.294   1.00 0.00 ? 3   PHE A HB3  3  
ATOM 4440  H HD1  . PHE A 1 3   ? 12.131  -0.436  7.794   1.00 0.00 ? 3   PHE A HD1  3  
ATOM 4441  H HD2  . PHE A 1 3   ? 8.831   -1.249  5.167   1.00 0.00 ? 3   PHE A HD2  3  
ATOM 4442  H HE1  . PHE A 1 3   ? 10.599  0.232   9.543   1.00 0.00 ? 3   PHE A HE1  3  
ATOM 4443  H HE2  . PHE A 1 3   ? 7.271   -0.559  6.951   1.00 0.00 ? 3   PHE A HE2  3  
ATOM 4444  H HZ   . PHE A 1 3   ? 8.174   0.213   9.168   1.00 0.00 ? 3   PHE A HZ   3  
ATOM 4445  N N    . SER A 1 4   ? 14.133  -2.547  4.114   1.00 0.00 ? 4   SER A N    3  
ATOM 4446  C CA   . SER A 1 4   ? 15.045  -2.770  2.948   1.00 0.00 ? 4   SER A CA   3  
ATOM 4447  C C    . SER A 1 4   ? 15.052  -4.249  2.532   1.00 0.00 ? 4   SER A C    3  
ATOM 4448  O O    . SER A 1 4   ? 15.458  -5.109  3.290   1.00 0.00 ? 4   SER A O    3  
ATOM 4449  C CB   . SER A 1 4   ? 16.466  -2.350  3.342   1.00 0.00 ? 4   SER A CB   3  
ATOM 4450  O OG   . SER A 1 4   ? 17.091  -3.394  4.081   1.00 0.00 ? 4   SER A OG   3  
ATOM 4451  H H    . SER A 1 4   ? 14.459  -2.041  4.873   1.00 0.00 ? 4   SER A H    3  
ATOM 4452  H HA   . SER A 1 4   ? 14.715  -2.157  2.119   1.00 0.00 ? 4   SER A HA   3  
ATOM 4453  H HB2  . SER A 1 4   ? 17.043  -2.150  2.455   1.00 0.00 ? 4   SER A HB2  3  
ATOM 4454  H HB3  . SER A 1 4   ? 16.416  -1.455  3.944   1.00 0.00 ? 4   SER A HB3  3  
ATOM 4455  H HG   . SER A 1 4   ? 17.967  -3.094  4.334   1.00 0.00 ? 4   SER A HG   3  
ATOM 4456  N N    . GLY A 1 5   ? 14.613  -4.545  1.334   1.00 0.00 ? 5   GLY A N    3  
ATOM 4457  C CA   . GLY A 1 5   ? 14.603  -5.962  0.872   1.00 0.00 ? 5   GLY A CA   3  
ATOM 4458  C C    . GLY A 1 5   ? 13.430  -6.193  -0.066  1.00 0.00 ? 5   GLY A C    3  
ATOM 4459  O O    . GLY A 1 5   ? 12.415  -5.527  0.009   1.00 0.00 ? 5   GLY A O    3  
ATOM 4460  H H    . GLY A 1 5   ? 14.292  -3.834  0.737   1.00 0.00 ? 5   GLY A H    3  
ATOM 4461  H HA2  . GLY A 1 5   ? 15.525  -6.187  0.359   1.00 0.00 ? 5   GLY A HA2  3  
ATOM 4462  H HA3  . GLY A 1 5   ? 14.504  -6.619  1.717   1.00 0.00 ? 5   GLY A HA3  3  
ATOM 4463  N N    . ASN A 1 6   ? 13.557  -7.162  -0.921  1.00 0.00 ? 6   ASN A N    3  
ATOM 4464  C CA   . ASN A 1 6   ? 12.458  -7.498  -1.850  1.00 0.00 ? 6   ASN A CA   3  
ATOM 4465  C C    . ASN A 1 6   ? 11.440  -8.271  -1.033  1.00 0.00 ? 6   ASN A C    3  
ATOM 4466  O O    . ASN A 1 6   ? 11.804  -8.906  -0.059  1.00 0.00 ? 6   ASN A O    3  
ATOM 4467  C CB   . ASN A 1 6   ? 13.015  -8.357  -2.988  1.00 0.00 ? 6   ASN A CB   3  
ATOM 4468  C CG   . ASN A 1 6   ? 12.474  -7.864  -4.332  1.00 0.00 ? 6   ASN A CG   3  
ATOM 4469  O OD1  . ASN A 1 6   ? 13.158  -7.165  -5.054  1.00 0.00 ? 6   ASN A OD1  3  
ATOM 4470  N ND2  . ASN A 1 6   ? 11.270  -8.199  -4.703  1.00 0.00 ? 6   ASN A ND2  3  
ATOM 4471  H H    . ASN A 1 6   ? 14.370  -7.693  -0.926  1.00 0.00 ? 6   ASN A H    3  
ATOM 4472  H HA   . ASN A 1 6   ? 12.011  -6.597  -2.234  1.00 0.00 ? 6   ASN A HA   3  
ATOM 4473  H HB2  . ASN A 1 6   ? 14.094  -8.286  -2.990  1.00 0.00 ? 6   ASN A HB2  3  
ATOM 4474  H HB3  . ASN A 1 6   ? 12.729  -9.383  -2.836  1.00 0.00 ? 6   ASN A HB3  3  
ATOM 4475  H HD21 . ASN A 1 6   ? 10.717  -8.760  -4.123  1.00 0.00 ? 6   ASN A HD21 3  
ATOM 4476  H HD22 . ASN A 1 6   ? 10.919  -7.888  -5.563  1.00 0.00 ? 6   ASN A HD22 3  
ATOM 4477  N N    . TRP A 1 7   ? 10.174  -8.193  -1.359  1.00 0.00 ? 7   TRP A N    3  
ATOM 4478  C CA   . TRP A 1 7   ? 9.177   -8.905  -0.505  1.00 0.00 ? 7   TRP A CA   3  
ATOM 4479  C C    . TRP A 1 7   ? 8.264   -9.822  -1.299  1.00 0.00 ? 7   TRP A C    3  
ATOM 4480  O O    . TRP A 1 7   ? 7.674   -9.440  -2.292  1.00 0.00 ? 7   TRP A O    3  
ATOM 4481  C CB   . TRP A 1 7   ? 8.339   -7.867  0.209   1.00 0.00 ? 7   TRP A CB   3  
ATOM 4482  C CG   . TRP A 1 7   ? 9.229   -7.019  1.040   1.00 0.00 ? 7   TRP A CG   3  
ATOM 4483  C CD1  . TRP A 1 7   ? 9.722   -5.815  0.687   1.00 0.00 ? 7   TRP A CD1  3  
ATOM 4484  C CD2  . TRP A 1 7   ? 9.764   -7.320  2.345   1.00 0.00 ? 7   TRP A CD2  3  
ATOM 4485  N NE1  . TRP A 1 7   ? 10.487  -5.330  1.731   1.00 0.00 ? 7   TRP A NE1  3  
ATOM 4486  C CE2  . TRP A 1 7   ? 10.549  -6.232  2.778   1.00 0.00 ? 7   TRP A CE2  3  
ATOM 4487  C CE3  . TRP A 1 7   ? 9.625   -8.424  3.188   1.00 0.00 ? 7   TRP A CE3  3  
ATOM 4488  C CZ2  . TRP A 1 7   ? 11.179  -6.242  4.023   1.00 0.00 ? 7   TRP A CZ2  3  
ATOM 4489  C CZ3  . TRP A 1 7   ? 10.261  -8.455  4.428   1.00 0.00 ? 7   TRP A CZ3  3  
ATOM 4490  C CH2  . TRP A 1 7   ? 11.039  -7.364  4.853   1.00 0.00 ? 7   TRP A CH2  3  
ATOM 4491  H H    . TRP A 1 7   ? 9.879   -7.634  -2.122  1.00 0.00 ? 7   TRP A H    3  
ATOM 4492  H HA   . TRP A 1 7   ? 9.695   -9.493  0.237   1.00 0.00 ? 7   TRP A HA   3  
ATOM 4493  H HB2  . TRP A 1 7   ? 7.822   -7.263  -0.504  1.00 0.00 ? 7   TRP A HB2  3  
ATOM 4494  H HB3  . TRP A 1 7   ? 7.630   -8.357  0.840   1.00 0.00 ? 7   TRP A HB3  3  
ATOM 4495  H HD1  . TRP A 1 7   ? 9.537   -5.309  -0.248  1.00 0.00 ? 7   TRP A HD1  3  
ATOM 4496  H HE1  . TRP A 1 7   ? 10.942  -4.467  1.740   1.00 0.00 ? 7   TRP A HE1  3  
ATOM 4497  H HE3  . TRP A 1 7   ? 9.022   -9.258  2.875   1.00 0.00 ? 7   TRP A HE3  3  
ATOM 4498  H HZ2  . TRP A 1 7   ? 11.761  -5.389  4.346   1.00 0.00 ? 7   TRP A HZ2  3  
ATOM 4499  H HZ3  . TRP A 1 7   ? 10.167  -9.334  5.046   1.00 0.00 ? 7   TRP A HZ3  3  
ATOM 4500  H HH2  . TRP A 1 7   ? 11.531  -7.391  5.815   1.00 0.00 ? 7   TRP A HH2  3  
ATOM 4501  N N    . LYS A 1 8   ? 8.129   -11.034 -0.830  1.00 0.00 ? 8   LYS A N    3  
ATOM 4502  C CA   . LYS A 1 8   ? 7.236   -12.009 -1.502  1.00 0.00 ? 8   LYS A CA   3  
ATOM 4503  C C    . LYS A 1 8   ? 5.855   -11.889 -0.854  1.00 0.00 ? 8   LYS A C    3  
ATOM 4504  O O    . LYS A 1 8   ? 5.735   -11.425 0.267   1.00 0.00 ? 8   LYS A O    3  
ATOM 4505  C CB   . LYS A 1 8   ? 7.753   -13.453 -1.322  1.00 0.00 ? 8   LYS A CB   3  
ATOM 4506  C CG   . LYS A 1 8   ? 9.283   -13.490 -1.138  1.00 0.00 ? 8   LYS A CG   3  
ATOM 4507  C CD   . LYS A 1 8   ? 9.613   -13.709 0.341   1.00 0.00 ? 8   LYS A CD   3  
ATOM 4508  C CE   . LYS A 1 8   ? 9.426   -15.187 0.691   1.00 0.00 ? 8   LYS A CE   3  
ATOM 4509  N NZ   . LYS A 1 8   ? 10.533  -15.985 0.091   1.00 0.00 ? 8   LYS A NZ   3  
ATOM 4510  H H    . LYS A 1 8   ? 8.611   -11.301 -0.017  1.00 0.00 ? 8   LYS A H    3  
ATOM 4511  H HA   . LYS A 1 8   ? 7.169   -11.766 -2.549  1.00 0.00 ? 8   LYS A HA   3  
ATOM 4512  H HB2  . LYS A 1 8   ? 7.283   -13.888 -0.453  1.00 0.00 ? 8   LYS A HB2  3  
ATOM 4513  H HB3  . LYS A 1 8   ? 7.489   -14.034 -2.191  1.00 0.00 ? 8   LYS A HB3  3  
ATOM 4514  H HG2  . LYS A 1 8   ? 9.694   -14.296 -1.718  1.00 0.00 ? 8   LYS A HG2  3  
ATOM 4515  H HG3  . LYS A 1 8   ? 9.715   -12.558 -1.467  1.00 0.00 ? 8   LYS A HG3  3  
ATOM 4516  H HD2  . LYS A 1 8   ? 10.635  -13.421 0.530   1.00 0.00 ? 8   LYS A HD2  3  
ATOM 4517  H HD3  . LYS A 1 8   ? 8.952   -13.111 0.948   1.00 0.00 ? 8   LYS A HD3  3  
ATOM 4518  H HE2  . LYS A 1 8   ? 9.439   -15.308 1.764   1.00 0.00 ? 8   LYS A HE2  3  
ATOM 4519  H HE3  . LYS A 1 8   ? 8.481   -15.533 0.301   1.00 0.00 ? 8   LYS A HE3  3  
ATOM 4520  H HZ1  . LYS A 1 8   ? 11.447  -15.573 0.364   1.00 0.00 ? 8   LYS A HZ1  3  
ATOM 4521  H HZ2  . LYS A 1 8   ? 10.478  -16.966 0.434   1.00 0.00 ? 8   LYS A HZ2  3  
ATOM 4522  H HZ3  . LYS A 1 8   ? 10.447  -15.974 -0.945  1.00 0.00 ? 8   LYS A HZ3  3  
ATOM 4523  N N    . ILE A 1 9   ? 4.816   -12.297 -1.540  1.00 0.00 ? 9   ILE A N    3  
ATOM 4524  C CA   . ILE A 1 9   ? 3.446   -12.197 -0.952  1.00 0.00 ? 9   ILE A CA   3  
ATOM 4525  C C    . ILE A 1 9   ? 3.246   -13.326 0.068   1.00 0.00 ? 9   ILE A C    3  
ATOM 4526  O O    . ILE A 1 9   ? 3.691   -14.441 -0.121  1.00 0.00 ? 9   ILE A O    3  
ATOM 4527  C CB   . ILE A 1 9   ? 2.396   -12.240 -2.090  1.00 0.00 ? 9   ILE A CB   3  
ATOM 4528  C CG1  . ILE A 1 9   ? 1.129   -11.479 -1.658  1.00 0.00 ? 9   ILE A CG1  3  
ATOM 4529  C CG2  . ILE A 1 9   ? 2.040   -13.683 -2.485  1.00 0.00 ? 9   ILE A CG2  3  
ATOM 4530  C CD1  . ILE A 1 9   ? 0.402   -12.211 -0.520  1.00 0.00 ? 9   ILE A CD1  3  
ATOM 4531  H H    . ILE A 1 9   ? 4.937   -12.664 -2.440  1.00 0.00 ? 9   ILE A H    3  
ATOM 4532  H HA   . ILE A 1 9   ? 3.362   -11.252 -0.428  1.00 0.00 ? 9   ILE A HA   3  
ATOM 4533  H HB   . ILE A 1 9   ? 2.815   -11.746 -2.955  1.00 0.00 ? 9   ILE A HB   3  
ATOM 4534  H HG12 . ILE A 1 9   ? 1.406   -10.491 -1.322  1.00 0.00 ? 9   ILE A HG12 3  
ATOM 4535  H HG13 . ILE A 1 9   ? 0.463   -11.391 -2.504  1.00 0.00 ? 9   ILE A HG13 3  
ATOM 4536  H HG21 . ILE A 1 9   ? 2.942   -14.222 -2.728  1.00 0.00 ? 9   ILE A HG21 3  
ATOM 4537  H HG22 . ILE A 1 9   ? 1.543   -14.167 -1.656  1.00 0.00 ? 9   ILE A HG22 3  
ATOM 4538  H HG23 . ILE A 1 9   ? 1.383   -13.669 -3.340  1.00 0.00 ? 9   ILE A HG23 3  
ATOM 4539  H HD11 . ILE A 1 9   ? 0.819   -13.197 -0.392  1.00 0.00 ? 9   ILE A HD11 3  
ATOM 4540  H HD12 . ILE A 1 9   ? 0.510   -11.651 0.397   1.00 0.00 ? 9   ILE A HD12 3  
ATOM 4541  H HD13 . ILE A 1 9   ? -0.644  -12.297 -0.764  1.00 0.00 ? 9   ILE A HD13 3  
ATOM 4542  N N    . ILE A 1 10  ? 2.572   -13.025 1.138   1.00 0.00 ? 10  ILE A N    3  
ATOM 4543  C CA   . ILE A 1 10  ? 2.318   -14.027 2.198   1.00 0.00 ? 10  ILE A CA   3  
ATOM 4544  C C    . ILE A 1 10  ? 1.027   -13.614 2.920   1.00 0.00 ? 10  ILE A C    3  
ATOM 4545  O O    . ILE A 1 10  ? 0.922   -12.531 3.459   1.00 0.00 ? 10  ILE A O    3  
ATOM 4546  C CB   . ILE A 1 10  ? 3.532   -14.049 3.153   1.00 0.00 ? 10  ILE A CB   3  
ATOM 4547  C CG1  . ILE A 1 10  ? 4.687   -14.811 2.483   1.00 0.00 ? 10  ILE A CG1  3  
ATOM 4548  C CG2  . ILE A 1 10  ? 3.191   -14.738 4.484   1.00 0.00 ? 10  ILE A CG2  3  
ATOM 4549  C CD1  . ILE A 1 10  ? 5.641   -13.827 1.793   1.00 0.00 ? 10  ILE A CD1  3  
ATOM 4550  H H    . ILE A 1 10  ? 2.221   -12.127 1.244   1.00 0.00 ? 10  ILE A H    3  
ATOM 4551  H HA   . ILE A 1 10  ? 2.190   -14.998 1.754   1.00 0.00 ? 10  ILE A HA   3  
ATOM 4552  H HB   . ILE A 1 10  ? 3.841   -13.038 3.346   1.00 0.00 ? 10  ILE A HB   3  
ATOM 4553  H HG12 . ILE A 1 10  ? 5.232   -15.370 3.231   1.00 0.00 ? 10  ILE A HG12 3  
ATOM 4554  H HG13 . ILE A 1 10  ? 4.287   -15.495 1.750   1.00 0.00 ? 10  ILE A HG13 3  
ATOM 4555  H HG21 . ILE A 1 10  ? 2.759   -15.707 4.288   1.00 0.00 ? 10  ILE A HG21 3  
ATOM 4556  H HG22 . ILE A 1 10  ? 4.094   -14.857 5.066   1.00 0.00 ? 10  ILE A HG22 3  
ATOM 4557  H HG23 . ILE A 1 10  ? 2.487   -14.131 5.033   1.00 0.00 ? 10  ILE A HG23 3  
ATOM 4558  H HD11 . ILE A 1 10  ? 5.306   -12.816 1.963   1.00 0.00 ? 10  ILE A HD11 3  
ATOM 4559  H HD12 . ILE A 1 10  ? 6.632   -13.949 2.195   1.00 0.00 ? 10  ILE A HD12 3  
ATOM 4560  H HD13 . ILE A 1 10  ? 5.663   -14.026 0.734   1.00 0.00 ? 10  ILE A HD13 3  
ATOM 4561  N N    . ARG A 1 11  ? 0.045   -14.469 2.897   1.00 0.00 ? 11  ARG A N    3  
ATOM 4562  C CA   . ARG A 1 11  ? -1.269  -14.168 3.548   1.00 0.00 ? 11  ARG A CA   3  
ATOM 4563  C C    . ARG A 1 11  ? -1.936  -12.994 2.826   1.00 0.00 ? 11  ARG A C    3  
ATOM 4564  O O    . ARG A 1 11  ? -1.529  -11.856 2.961   1.00 0.00 ? 11  ARG A O    3  
ATOM 4565  C CB   . ARG A 1 11  ? -1.068  -13.825 5.031   1.00 0.00 ? 11  ARG A CB   3  
ATOM 4566  C CG   . ARG A 1 11  ? -1.249  -15.088 5.874   1.00 0.00 ? 11  ARG A CG   3  
ATOM 4567  C CD   . ARG A 1 11  ? -0.127  -16.078 5.555   1.00 0.00 ? 11  ARG A CD   3  
ATOM 4568  N NE   . ARG A 1 11  ? 0.027   -17.037 6.685   1.00 0.00 ? 11  ARG A NE   3  
ATOM 4569  C CZ   . ARG A 1 11  ? 1.217   -17.354 7.115   1.00 0.00 ? 11  ARG A CZ   3  
ATOM 4570  N NH1  . ARG A 1 11  ? 2.109   -17.820 6.284   1.00 0.00 ? 11  ARG A NH1  3  
ATOM 4571  N NH2  . ARG A 1 11  ? 1.516   -17.205 8.377   1.00 0.00 ? 11  ARG A NH2  3  
ATOM 4572  H H    . ARG A 1 11  ? 0.167   -15.313 2.429   1.00 0.00 ? 11  ARG A H    3  
ATOM 4573  H HA   . ARG A 1 11  ? -1.907  -15.036 3.468   1.00 0.00 ? 11  ARG A HA   3  
ATOM 4574  H HB2  . ARG A 1 11  ? -0.074  -13.434 5.184   1.00 0.00 ? 11  ARG A HB2  3  
ATOM 4575  H HB3  . ARG A 1 11  ? -1.796  -13.087 5.332   1.00 0.00 ? 11  ARG A HB3  3  
ATOM 4576  H HG2  . ARG A 1 11  ? -1.215  -14.829 6.923   1.00 0.00 ? 11  ARG A HG2  3  
ATOM 4577  H HG3  . ARG A 1 11  ? -2.202  -15.541 5.645   1.00 0.00 ? 11  ARG A HG3  3  
ATOM 4578  H HD2  . ARG A 1 11  ? -0.371  -16.620 4.653   1.00 0.00 ? 11  ARG A HD2  3  
ATOM 4579  H HD3  . ARG A 1 11  ? 0.798   -15.539 5.411   1.00 0.00 ? 11  ARG A HD3  3  
ATOM 4580  H HE   . ARG A 1 11  ? -0.767  -17.429 7.106   1.00 0.00 ? 11  ARG A HE   3  
ATOM 4581  H HH11 . ARG A 1 11  ? 1.880   -17.934 5.318   1.00 0.00 ? 11  ARG A HH11 3  
ATOM 4582  H HH12 . ARG A 1 11  ? 3.021   -18.063 6.614   1.00 0.00 ? 11  ARG A HH12 3  
ATOM 4583  H HH21 . ARG A 1 11  ? 0.833   -16.848 9.014   1.00 0.00 ? 11  ARG A HH21 3  
ATOM 4584  H HH22 . ARG A 1 11  ? 2.428   -17.448 8.707   1.00 0.00 ? 11  ARG A HH22 3  
ATOM 4585  N N    . SER A 1 12  ? -2.958  -13.273 2.055   1.00 0.00 ? 12  SER A N    3  
ATOM 4586  C CA   . SER A 1 12  ? -3.663  -12.189 1.307   1.00 0.00 ? 12  SER A CA   3  
ATOM 4587  C C    . SER A 1 12  ? -5.157  -12.521 1.212   1.00 0.00 ? 12  SER A C    3  
ATOM 4588  O O    . SER A 1 12  ? -5.536  -13.634 0.900   1.00 0.00 ? 12  SER A O    3  
ATOM 4589  C CB   . SER A 1 12  ? -3.072  -12.087 -0.106  1.00 0.00 ? 12  SER A CB   3  
ATOM 4590  O OG   . SER A 1 12  ? -2.299  -10.900 -0.208  1.00 0.00 ? 12  SER A OG   3  
ATOM 4591  H H    . SER A 1 12  ? -3.259  -14.201 1.963   1.00 0.00 ? 12  SER A H    3  
ATOM 4592  H HA   . SER A 1 12  ? -3.534  -11.246 1.825   1.00 0.00 ? 12  SER A HA   3  
ATOM 4593  H HB2  . SER A 1 12  ? -2.439  -12.939 -0.296  1.00 0.00 ? 12  SER A HB2  3  
ATOM 4594  H HB3  . SER A 1 12  ? -3.872  -12.069 -0.835  1.00 0.00 ? 12  SER A HB3  3  
ATOM 4595  H HG   . SER A 1 12  ? -2.753  -10.301 -0.805  1.00 0.00 ? 12  SER A HG   3  
ATOM 4596  N N    . GLU A 1 13  ? -6.003  -11.557 1.472   1.00 0.00 ? 13  GLU A N    3  
ATOM 4597  C CA   . GLU A 1 13  ? -7.476  -11.792 1.394   1.00 0.00 ? 13  GLU A CA   3  
ATOM 4598  C C    . GLU A 1 13  ? -8.203  -10.485 1.721   1.00 0.00 ? 13  GLU A C    3  
ATOM 4599  O O    . GLU A 1 13  ? -8.890  -10.373 2.720   1.00 0.00 ? 13  GLU A O    3  
ATOM 4600  C CB   . GLU A 1 13  ? -7.882  -12.877 2.397   1.00 0.00 ? 13  GLU A CB   3  
ATOM 4601  C CG   . GLU A 1 13  ? -9.104  -13.630 1.867   1.00 0.00 ? 13  GLU A CG   3  
ATOM 4602  C CD   . GLU A 1 13  ? -9.257  -14.952 2.621   1.00 0.00 ? 13  GLU A CD   3  
ATOM 4603  O OE1  . GLU A 1 13  ? -8.261  -15.636 2.786   1.00 0.00 ? 13  GLU A OE1  3  
ATOM 4604  O OE2  . GLU A 1 13  ? -10.369 -15.258 3.020   1.00 0.00 ? 13  GLU A OE2  3  
ATOM 4605  H H    . GLU A 1 13  ? -5.665  -10.669 1.714   1.00 0.00 ? 13  GLU A H    3  
ATOM 4606  H HA   . GLU A 1 13  ? -7.736  -12.106 0.394   1.00 0.00 ? 13  GLU A HA   3  
ATOM 4607  H HB2  . GLU A 1 13  ? -7.063  -13.568 2.532   1.00 0.00 ? 13  GLU A HB2  3  
ATOM 4608  H HB3  . GLU A 1 13  ? -8.127  -12.419 3.343   1.00 0.00 ? 13  GLU A HB3  3  
ATOM 4609  H HG2  . GLU A 1 13  ? -9.988  -13.026 2.013   1.00 0.00 ? 13  GLU A HG2  3  
ATOM 4610  H HG3  . GLU A 1 13  ? -8.974  -13.831 0.814   1.00 0.00 ? 13  GLU A HG3  3  
ATOM 4611  N N    . ASN A 1 14  ? -8.034  -9.489  0.890   1.00 0.00 ? 14  ASN A N    3  
ATOM 4612  C CA   . ASN A 1 14  ? -8.691  -8.172  1.152   1.00 0.00 ? 14  ASN A CA   3  
ATOM 4613  C C    . ASN A 1 14  ? -9.294  -7.570  -0.128  1.00 0.00 ? 14  ASN A C    3  
ATOM 4614  O O    . ASN A 1 14  ? -10.193 -6.765  -0.045  1.00 0.00 ? 14  ASN A O    3  
ATOM 4615  C CB   . ASN A 1 14  ? -7.655  -7.205  1.711   1.00 0.00 ? 14  ASN A CB   3  
ATOM 4616  C CG   . ASN A 1 14  ? -7.462  -7.468  3.205   1.00 0.00 ? 14  ASN A CG   3  
ATOM 4617  O OD1  . ASN A 1 14  ? -7.906  -6.696  4.032   1.00 0.00 ? 14  ASN A OD1  3  
ATOM 4618  N ND2  . ASN A 1 14  ? -6.813  -8.533  3.589   1.00 0.00 ? 14  ASN A ND2  3  
ATOM 4619  H H    . ASN A 1 14  ? -7.460  -9.607  0.107   1.00 0.00 ? 14  ASN A H    3  
ATOM 4620  H HA   . ASN A 1 14  ? -9.471  -8.298  1.884   1.00 0.00 ? 14  ASN A HA   3  
ATOM 4621  H HB2  . ASN A 1 14  ? -6.721  -7.347  1.195   1.00 0.00 ? 14  ASN A HB2  3  
ATOM 4622  H HB3  . ASN A 1 14  ? -7.999  -6.195  1.567   1.00 0.00 ? 14  ASN A HB3  3  
ATOM 4623  H HD21 . ASN A 1 14  ? -6.455  -9.156  2.923   1.00 0.00 ? 14  ASN A HD21 3  
ATOM 4624  H HD22 . ASN A 1 14  ? -6.684  -8.711  4.544   1.00 0.00 ? 14  ASN A HD22 3  
ATOM 4625  N N    . PHE A 1 15  ? -8.800  -7.928  -1.302  1.00 0.00 ? 15  PHE A N    3  
ATOM 4626  C CA   . PHE A 1 15  ? -9.336  -7.345  -2.590  1.00 0.00 ? 15  PHE A CA   3  
ATOM 4627  C C    . PHE A 1 15  ? -10.875 -7.309  -2.600  1.00 0.00 ? 15  PHE A C    3  
ATOM 4628  O O    . PHE A 1 15  ? -11.472 -6.287  -2.869  1.00 0.00 ? 15  PHE A O    3  
ATOM 4629  C CB   . PHE A 1 15  ? -8.839  -8.182  -3.786  1.00 0.00 ? 15  PHE A CB   3  
ATOM 4630  C CG   . PHE A 1 15  ? -8.823  -7.371  -5.090  1.00 0.00 ? 15  PHE A CG   3  
ATOM 4631  C CD1  . PHE A 1 15  ? -9.551  -6.171  -5.225  1.00 0.00 ? 15  PHE A CD1  3  
ATOM 4632  C CD2  . PHE A 1 15  ? -8.078  -7.842  -6.181  1.00 0.00 ? 15  PHE A CD2  3  
ATOM 4633  C CE1  . PHE A 1 15  ? -9.531  -5.461  -6.425  1.00 0.00 ? 15  PHE A CE1  3  
ATOM 4634  C CE2  . PHE A 1 15  ? -8.065  -7.126  -7.388  1.00 0.00 ? 15  PHE A CE2  3  
ATOM 4635  C CZ   . PHE A 1 15  ? -8.794  -5.935  -7.506  1.00 0.00 ? 15  PHE A CZ   3  
ATOM 4636  H H    . PHE A 1 15  ? -8.063  -8.566  -1.340  1.00 0.00 ? 15  PHE A H    3  
ATOM 4637  H HA   . PHE A 1 15  ? -8.965  -6.335  -2.695  1.00 0.00 ? 15  PHE A HA   3  
ATOM 4638  H HB2  . PHE A 1 15  ? -7.839  -8.531  -3.579  1.00 0.00 ? 15  PHE A HB2  3  
ATOM 4639  H HB3  . PHE A 1 15  ? -9.490  -9.036  -3.910  1.00 0.00 ? 15  PHE A HB3  3  
ATOM 4640  H HD1  . PHE A 1 15  ? -10.118 -5.794  -4.404  1.00 0.00 ? 15  PHE A HD1  3  
ATOM 4641  H HD2  . PHE A 1 15  ? -7.516  -8.760  -6.093  1.00 0.00 ? 15  PHE A HD2  3  
ATOM 4642  H HE1  . PHE A 1 15  ? -10.093 -4.543  -6.517  1.00 0.00 ? 15  PHE A HE1  3  
ATOM 4643  H HE2  . PHE A 1 15  ? -7.491  -7.492  -8.226  1.00 0.00 ? 15  PHE A HE2  3  
ATOM 4644  H HZ   . PHE A 1 15  ? -8.793  -5.384  -8.433  1.00 0.00 ? 15  PHE A HZ   3  
ATOM 4645  N N    . GLU A 1 16  ? -11.524 -8.395  -2.307  1.00 0.00 ? 16  GLU A N    3  
ATOM 4646  C CA   . GLU A 1 16  ? -13.016 -8.374  -2.313  1.00 0.00 ? 16  GLU A CA   3  
ATOM 4647  C C    . GLU A 1 16  ? -13.509 -7.482  -1.180  1.00 0.00 ? 16  GLU A C    3  
ATOM 4648  O O    . GLU A 1 16  ? -14.484 -6.768  -1.325  1.00 0.00 ? 16  GLU A O    3  
ATOM 4649  C CB   . GLU A 1 16  ? -13.571 -9.794  -2.157  1.00 0.00 ? 16  GLU A CB   3  
ATOM 4650  C CG   . GLU A 1 16  ? -13.062 -10.412 -0.851  1.00 0.00 ? 16  GLU A CG   3  
ATOM 4651  C CD   . GLU A 1 16  ? -12.919 -11.926 -1.024  1.00 0.00 ? 16  GLU A CD   3  
ATOM 4652  O OE1  . GLU A 1 16  ? -13.742 -12.504 -1.713  1.00 0.00 ? 16  GLU A OE1  3  
ATOM 4653  O OE2  . GLU A 1 16  ? -11.988 -12.481 -0.463  1.00 0.00 ? 16  GLU A OE2  3  
ATOM 4654  H H    . GLU A 1 16  ? -11.040 -9.208  -2.086  1.00 0.00 ? 16  GLU A H    3  
ATOM 4655  H HA   . GLU A 1 16  ? -13.347 -7.947  -3.247  1.00 0.00 ? 16  GLU A HA   3  
ATOM 4656  H HB2  . GLU A 1 16  ? -14.649 -9.756  -2.139  1.00 0.00 ? 16  GLU A HB2  3  
ATOM 4657  H HB3  . GLU A 1 16  ? -13.246 -10.400 -2.989  1.00 0.00 ? 16  GLU A HB3  3  
ATOM 4658  H HG2  . GLU A 1 16  ? -12.102 -9.986  -0.600  1.00 0.00 ? 16  GLU A HG2  3  
ATOM 4659  H HG3  . GLU A 1 16  ? -13.765 -10.208 -0.058  1.00 0.00 ? 16  GLU A HG3  3  
ATOM 4660  N N    . GLU A 1 17  ? -12.827 -7.491  -0.067  1.00 0.00 ? 17  GLU A N    3  
ATOM 4661  C CA   . GLU A 1 17  ? -13.233 -6.613  1.068   1.00 0.00 ? 17  GLU A CA   3  
ATOM 4662  C C    . GLU A 1 17  ? -13.162 -5.145  0.609   1.00 0.00 ? 17  GLU A C    3  
ATOM 4663  O O    . GLU A 1 17  ? -13.810 -4.281  1.162   1.00 0.00 ? 17  GLU A O    3  
ATOM 4664  C CB   . GLU A 1 17  ? -12.269 -6.840  2.244   1.00 0.00 ? 17  GLU A CB   3  
ATOM 4665  C CG   . GLU A 1 17  ? -13.051 -7.266  3.490   1.00 0.00 ? 17  GLU A CG   3  
ATOM 4666  C CD   . GLU A 1 17  ? -12.462 -6.587  4.729   1.00 0.00 ? 17  GLU A CD   3  
ATOM 4667  O OE1  . GLU A 1 17  ? -11.255 -6.651  4.898   1.00 0.00 ? 17  GLU A OE1  3  
ATOM 4668  O OE2  . GLU A 1 17  ? -13.227 -6.016  5.488   1.00 0.00 ? 17  GLU A OE2  3  
ATOM 4669  H H    . GLU A 1 17  ? -12.031 -8.058  0.014   1.00 0.00 ? 17  GLU A H    3  
ATOM 4670  H HA   . GLU A 1 17  ? -14.247 -6.851  1.365   1.00 0.00 ? 17  GLU A HA   3  
ATOM 4671  H HB2  . GLU A 1 17  ? -11.566 -7.617  1.982   1.00 0.00 ? 17  GLU A HB2  3  
ATOM 4672  H HB3  . GLU A 1 17  ? -11.728 -5.928  2.454   1.00 0.00 ? 17  GLU A HB3  3  
ATOM 4673  H HG2  . GLU A 1 17  ? -14.085 -6.979  3.380   1.00 0.00 ? 17  GLU A HG2  3  
ATOM 4674  H HG3  . GLU A 1 17  ? -12.985 -8.337  3.605   1.00 0.00 ? 17  GLU A HG3  3  
ATOM 4675  N N    . LEU A 1 18  ? -12.377 -4.871  -0.408  1.00 0.00 ? 18  LEU A N    3  
ATOM 4676  C CA   . LEU A 1 18  ? -12.243 -3.484  -0.926  1.00 0.00 ? 18  LEU A CA   3  
ATOM 4677  C C    . LEU A 1 18  ? -13.474 -3.127  -1.724  1.00 0.00 ? 18  LEU A C    3  
ATOM 4678  O O    . LEU A 1 18  ? -14.075 -2.090  -1.521  1.00 0.00 ? 18  LEU A O    3  
ATOM 4679  C CB   . LEU A 1 18  ? -11.029 -3.373  -1.859  1.00 0.00 ? 18  LEU A CB   3  
ATOM 4680  C CG   . LEU A 1 18  ? -9.845  -4.225  -1.396  1.00 0.00 ? 18  LEU A CG   3  
ATOM 4681  C CD1  . LEU A 1 18  ? -8.620  -3.819  -2.199  1.00 0.00 ? 18  LEU A CD1  3  
ATOM 4682  C CD2  . LEU A 1 18  ? -9.540  -4.034  0.086   1.00 0.00 ? 18  LEU A CD2  3  
ATOM 4683  H H    . LEU A 1 18  ? -11.875 -5.581  -0.833  1.00 0.00 ? 18  LEU A H    3  
ATOM 4684  H HA   . LEU A 1 18  ? -12.140 -2.800  -0.110  1.00 0.00 ? 18  LEU A HA   3  
ATOM 4685  H HB2  . LEU A 1 18  ? -11.318 -3.706  -2.845  1.00 0.00 ? 18  LEU A HB2  3  
ATOM 4686  H HB3  . LEU A 1 18  ? -10.722 -2.348  -1.912  1.00 0.00 ? 18  LEU A HB3  3  
ATOM 4687  H HG   . LEU A 1 18  ? -10.063 -5.246  -1.582  1.00 0.00 ? 18  LEU A HG   3  
ATOM 4688  H HD11 . LEU A 1 18  ? -8.458  -2.756  -2.086  1.00 0.00 ? 18  LEU A HD11 3  
ATOM 4689  H HD12 . LEU A 1 18  ? -7.759  -4.357  -1.838  1.00 0.00 ? 18  LEU A HD12 3  
ATOM 4690  H HD13 . LEU A 1 18  ? -8.784  -4.050  -3.240  1.00 0.00 ? 18  LEU A HD13 3  
ATOM 4691  H HD21 . LEU A 1 18  ? -10.459 -4.002  0.650   1.00 0.00 ? 18  LEU A HD21 3  
ATOM 4692  H HD22 . LEU A 1 18  ? -8.937  -4.859  0.432   1.00 0.00 ? 18  LEU A HD22 3  
ATOM 4693  H HD23 . LEU A 1 18  ? -8.999  -3.113  0.219   1.00 0.00 ? 18  LEU A HD23 3  
ATOM 4694  N N    . LEU A 1 19  ? -13.856 -3.978  -2.634  1.00 0.00 ? 19  LEU A N    3  
ATOM 4695  C CA   . LEU A 1 19  ? -15.056 -3.682  -3.445  1.00 0.00 ? 19  LEU A CA   3  
ATOM 4696  C C    . LEU A 1 19  ? -16.330 -4.036  -2.651  1.00 0.00 ? 19  LEU A C    3  
ATOM 4697  O O    . LEU A 1 19  ? -17.434 -3.890  -3.138  1.00 0.00 ? 19  LEU A O    3  
ATOM 4698  C CB   . LEU A 1 19  ? -14.991 -4.457  -4.775  1.00 0.00 ? 19  LEU A CB   3  
ATOM 4699  C CG   . LEU A 1 19  ? -13.640 -4.216  -5.515  1.00 0.00 ? 19  LEU A CG   3  
ATOM 4700  C CD1  . LEU A 1 19  ? -13.050 -2.823  -5.212  1.00 0.00 ? 19  LEU A CD1  3  
ATOM 4701  C CD2  . LEU A 1 19  ? -12.631 -5.293  -5.103  1.00 0.00 ? 19  LEU A CD2  3  
ATOM 4702  H H    . LEU A 1 19  ? -13.354 -4.807  -2.777  1.00 0.00 ? 19  LEU A H    3  
ATOM 4703  H HA   . LEU A 1 19  ? -15.055 -2.628  -3.653  1.00 0.00 ? 19  LEU A HA   3  
ATOM 4704  H HB2  . LEU A 1 19  ? -15.098 -5.512  -4.573  1.00 0.00 ? 19  LEU A HB2  3  
ATOM 4705  H HB3  . LEU A 1 19  ? -15.802 -4.136  -5.410  1.00 0.00 ? 19  LEU A HB3  3  
ATOM 4706  H HG   . LEU A 1 19  ? -13.805 -4.292  -6.578  1.00 0.00 ? 19  LEU A HG   3  
ATOM 4707  H HD11 . LEU A 1 19  ? -13.841 -2.090  -5.209  1.00 0.00 ? 19  LEU A HD11 3  
ATOM 4708  H HD12 . LEU A 1 19  ? -12.572 -2.840  -4.242  1.00 0.00 ? 19  LEU A HD12 3  
ATOM 4709  H HD13 . LEU A 1 19  ? -12.322 -2.567  -5.966  1.00 0.00 ? 19  LEU A HD13 3  
ATOM 4710  H HD21 . LEU A 1 19  ? -13.127 -6.054  -4.518  1.00 0.00 ? 19  LEU A HD21 3  
ATOM 4711  H HD22 . LEU A 1 19  ? -12.205 -5.742  -5.988  1.00 0.00 ? 19  LEU A HD22 3  
ATOM 4712  H HD23 . LEU A 1 19  ? -11.844 -4.844  -4.515  1.00 0.00 ? 19  LEU A HD23 3  
ATOM 4713  N N    . LYS A 1 20  ? -16.178 -4.479  -1.421  1.00 0.00 ? 20  LYS A N    3  
ATOM 4714  C CA   . LYS A 1 20  ? -17.345 -4.822  -0.570  1.00 0.00 ? 20  LYS A CA   3  
ATOM 4715  C C    . LYS A 1 20  ? -17.550 -3.725  0.484   1.00 0.00 ? 20  LYS A C    3  
ATOM 4716  O O    . LYS A 1 20  ? -18.624 -3.566  1.031   1.00 0.00 ? 20  LYS A O    3  
ATOM 4717  C CB   . LYS A 1 20  ? -17.045 -6.136  0.145   1.00 0.00 ? 20  LYS A CB   3  
ATOM 4718  C CG   . LYS A 1 20  ? -17.576 -7.299  -0.682  1.00 0.00 ? 20  LYS A CG   3  
ATOM 4719  C CD   . LYS A 1 20  ? -17.812 -8.510  0.224   1.00 0.00 ? 20  LYS A CD   3  
ATOM 4720  C CE   . LYS A 1 20  ? -19.262 -8.507  0.713   1.00 0.00 ? 20  LYS A CE   3  
ATOM 4721  N NZ   . LYS A 1 20  ? -19.648 -9.885  1.129   1.00 0.00 ? 20  LYS A NZ   3  
ATOM 4722  H H    . LYS A 1 20  ? -15.289 -4.578  -1.045  1.00 0.00 ? 20  LYS A H    3  
ATOM 4723  H HA   . LYS A 1 20  ? -18.227 -4.923  -1.177  1.00 0.00 ? 20  LYS A HA   3  
ATOM 4724  H HB2  . LYS A 1 20  ? -15.976 -6.240  0.265   1.00 0.00 ? 20  LYS A HB2  3  
ATOM 4725  H HB3  . LYS A 1 20  ? -17.513 -6.134  1.114   1.00 0.00 ? 20  LYS A HB3  3  
ATOM 4726  H HG2  . LYS A 1 20  ? -18.503 -7.011  -1.151  1.00 0.00 ? 20  LYS A HG2  3  
ATOM 4727  H HG3  . LYS A 1 20  ? -16.853 -7.553  -1.440  1.00 0.00 ? 20  LYS A HG3  3  
ATOM 4728  H HD2  . LYS A 1 20  ? -17.620 -9.417  -0.330  1.00 0.00 ? 20  LYS A HD2  3  
ATOM 4729  H HD3  . LYS A 1 20  ? -17.148 -8.458  1.073   1.00 0.00 ? 20  LYS A HD3  3  
ATOM 4730  H HE2  . LYS A 1 20  ? -19.356 -7.837  1.556   1.00 0.00 ? 20  LYS A HE2  3  
ATOM 4731  H HE3  . LYS A 1 20  ? -19.910 -8.176  -0.084  1.00 0.00 ? 20  LYS A HE3  3  
ATOM 4732  H HZ1  . LYS A 1 20  ? -19.008 -10.212 1.881   1.00 0.00 ? 20  LYS A HZ1  3  
ATOM 4733  H HZ2  . LYS A 1 20  ? -20.626 -9.879  1.482   1.00 0.00 ? 20  LYS A HZ2  3  
ATOM 4734  H HZ3  . LYS A 1 20  ? -19.581 -10.525 0.312   1.00 0.00 ? 20  LYS A HZ3  3  
ATOM 4735  N N    . VAL A 1 21  ? -16.515 -2.979  0.774   1.00 0.00 ? 21  VAL A N    3  
ATOM 4736  C CA   . VAL A 1 21  ? -16.604 -1.903  1.786   1.00 0.00 ? 21  VAL A CA   3  
ATOM 4737  C C    . VAL A 1 21  ? -16.803 -0.569  1.078   1.00 0.00 ? 21  VAL A C    3  
ATOM 4738  O O    . VAL A 1 21  ? -17.437 0.326   1.606   1.00 0.00 ? 21  VAL A O    3  
ATOM 4739  C CB   . VAL A 1 21  ? -15.316 -1.877  2.612   1.00 0.00 ? 21  VAL A CB   3  
ATOM 4740  C CG1  . VAL A 1 21  ? -15.137 -3.223  3.317   1.00 0.00 ? 21  VAL A CG1  3  
ATOM 4741  C CG2  . VAL A 1 21  ? -14.107 -1.610  1.705   1.00 0.00 ? 21  VAL A CG2  3  
ATOM 4742  H H    . VAL A 1 21  ? -15.676 -3.132  0.326   1.00 0.00 ? 21  VAL A H    3  
ATOM 4743  H HA   . VAL A 1 21  ? -17.445 -2.090  2.435   1.00 0.00 ? 21  VAL A HA   3  
ATOM 4744  H HB   . VAL A 1 21  ? -15.387 -1.099  3.347   1.00 0.00 ? 21  VAL A HB   3  
ATOM 4745  H HG11 . VAL A 1 21  ? -15.613 -3.998  2.736   1.00 0.00 ? 21  VAL A HG11 3  
ATOM 4746  H HG12 . VAL A 1 21  ? -14.084 -3.440  3.414   1.00 0.00 ? 21  VAL A HG12 3  
ATOM 4747  H HG13 . VAL A 1 21  ? -15.588 -3.178  4.297   1.00 0.00 ? 21  VAL A HG13 3  
ATOM 4748  H HG21 . VAL A 1 21  ? -14.382 -1.767  0.674   1.00 0.00 ? 21  VAL A HG21 3  
ATOM 4749  H HG22 . VAL A 1 21  ? -13.783 -0.590  1.835   1.00 0.00 ? 21  VAL A HG22 3  
ATOM 4750  H HG23 . VAL A 1 21  ? -13.300 -2.277  1.967   1.00 0.00 ? 21  VAL A HG23 3  
ATOM 4751  N N    . LEU A 1 22  ? -16.306 -0.436  -0.138  1.00 0.00 ? 22  LEU A N    3  
ATOM 4752  C CA   . LEU A 1 22  ? -16.523 0.840   -0.888  1.00 0.00 ? 22  LEU A CA   3  
ATOM 4753  C C    . LEU A 1 22  ? -18.034 1.091   -0.962  1.00 0.00 ? 22  LEU A C    3  
ATOM 4754  O O    . LEU A 1 22  ? -18.486 2.213   -1.087  1.00 0.00 ? 22  LEU A O    3  
ATOM 4755  C CB   . LEU A 1 22  ? -15.897 0.770   -2.308  1.00 0.00 ? 22  LEU A CB   3  
ATOM 4756  C CG   . LEU A 1 22  ? -16.401 -0.417  -3.151  1.00 0.00 ? 22  LEU A CG   3  
ATOM 4757  C CD1  . LEU A 1 22  ? -17.876 -0.251  -3.546  1.00 0.00 ? 22  LEU A CD1  3  
ATOM 4758  C CD2  . LEU A 1 22  ? -15.562 -0.458  -4.432  1.00 0.00 ? 22  LEU A CD2  3  
ATOM 4759  H H    . LEU A 1 22  ? -15.830 -1.178  -0.558  1.00 0.00 ? 22  LEU A H    3  
ATOM 4760  H HA   . LEU A 1 22  ? -16.061 1.655   -0.336  1.00 0.00 ? 22  LEU A HA   3  
ATOM 4761  H HB2  . LEU A 1 22  ? -16.120 1.677   -2.837  1.00 0.00 ? 22  LEU A HB2  3  
ATOM 4762  H HB3  . LEU A 1 22  ? -14.824 0.680   -2.206  1.00 0.00 ? 22  LEU A HB3  3  
ATOM 4763  H HG   . LEU A 1 22  ? -16.269 -1.337  -2.603  1.00 0.00 ? 22  LEU A HG   3  
ATOM 4764  H HD11 . LEU A 1 22  ? -18.178 0.774   -3.397  1.00 0.00 ? 22  LEU A HD11 3  
ATOM 4765  H HD12 . LEU A 1 22  ? -18.007 -0.515  -4.585  1.00 0.00 ? 22  LEU A HD12 3  
ATOM 4766  H HD13 . LEU A 1 22  ? -18.486 -0.900  -2.937  1.00 0.00 ? 22  LEU A HD13 3  
ATOM 4767  H HD21 . LEU A 1 22  ? -14.513 -0.480  -4.174  1.00 0.00 ? 22  LEU A HD21 3  
ATOM 4768  H HD22 . LEU A 1 22  ? -15.812 -1.344  -4.997  1.00 0.00 ? 22  LEU A HD22 3  
ATOM 4769  H HD23 . LEU A 1 22  ? -15.769 0.419   -5.026  1.00 0.00 ? 22  LEU A HD23 3  
ATOM 4770  N N    . GLY A 1 23  ? -18.812 0.033   -0.866  1.00 0.00 ? 23  GLY A N    3  
ATOM 4771  C CA   . GLY A 1 23  ? -20.278 0.172   -0.906  1.00 0.00 ? 23  GLY A CA   3  
ATOM 4772  C C    . GLY A 1 23  ? -20.861 -0.868  -1.846  1.00 0.00 ? 23  GLY A C    3  
ATOM 4773  O O    . GLY A 1 23  ? -21.240 -0.569  -2.962  1.00 0.00 ? 23  GLY A O    3  
ATOM 4774  H H    . GLY A 1 23  ? -18.421 -0.860  -0.759  1.00 0.00 ? 23  GLY A H    3  
ATOM 4775  H HA2  . GLY A 1 23  ? -20.674 0.018   0.088   1.00 0.00 ? 23  GLY A HA2  3  
ATOM 4776  H HA3  . GLY A 1 23  ? -20.532 1.148   -1.256  1.00 0.00 ? 23  GLY A HA3  3  
ATOM 4777  N N    . VAL A 1 24  ? -20.927 -2.095  -1.400  1.00 0.00 ? 24  VAL A N    3  
ATOM 4778  C CA   . VAL A 1 24  ? -21.482 -3.191  -2.253  1.00 0.00 ? 24  VAL A CA   3  
ATOM 4779  C C    . VAL A 1 24  ? -22.842 -2.767  -2.854  1.00 0.00 ? 24  VAL A C    3  
ATOM 4780  O O    . VAL A 1 24  ? -23.655 -2.130  -2.213  1.00 0.00 ? 24  VAL A O    3  
ATOM 4781  C CB   . VAL A 1 24  ? -21.582 -4.487  -1.393  1.00 0.00 ? 24  VAL A CB   3  
ATOM 4782  C CG1  . VAL A 1 24  ? -23.034 -4.959  -1.179  1.00 0.00 ? 24  VAL A CG1  3  
ATOM 4783  C CG2  . VAL A 1 24  ? -20.802 -5.611  -2.081  1.00 0.00 ? 24  VAL A CG2  3  
ATOM 4784  H H    . VAL A 1 24  ? -20.597 -2.299  -0.496  1.00 0.00 ? 24  VAL A H    3  
ATOM 4785  H HA   . VAL A 1 24  ? -20.793 -3.365  -3.069  1.00 0.00 ? 24  VAL A HA   3  
ATOM 4786  H HB   . VAL A 1 24  ? -21.134 -4.289  -0.429  1.00 0.00 ? 24  VAL A HB   3  
ATOM 4787  H HG11 . VAL A 1 24  ? -23.521 -5.068  -2.139  1.00 0.00 ? 24  VAL A HG11 3  
ATOM 4788  H HG12 . VAL A 1 24  ? -23.033 -5.911  -0.669  1.00 0.00 ? 24  VAL A HG12 3  
ATOM 4789  H HG13 . VAL A 1 24  ? -23.567 -4.232  -0.586  1.00 0.00 ? 24  VAL A HG13 3  
ATOM 4790  H HG21 . VAL A 1 24  ? -19.831 -5.245  -2.382  1.00 0.00 ? 24  VAL A HG21 3  
ATOM 4791  H HG22 . VAL A 1 24  ? -20.680 -6.437  -1.397  1.00 0.00 ? 24  VAL A HG22 3  
ATOM 4792  H HG23 . VAL A 1 24  ? -21.346 -5.944  -2.954  1.00 0.00 ? 24  VAL A HG23 3  
ATOM 4793  N N    . ASN A 1 25  ? -23.063 -3.127  -4.082  1.00 0.00 ? 25  ASN A N    3  
ATOM 4794  C CA   . ASN A 1 25  ? -24.333 -2.779  -4.783  1.00 0.00 ? 25  ASN A CA   3  
ATOM 4795  C C    . ASN A 1 25  ? -24.214 -3.345  -6.190  1.00 0.00 ? 25  ASN A C    3  
ATOM 4796  O O    . ASN A 1 25  ? -24.064 -2.620  -7.152  1.00 0.00 ? 25  ASN A O    3  
ATOM 4797  C CB   . ASN A 1 25  ? -24.508 -1.257  -4.832  1.00 0.00 ? 25  ASN A CB   3  
ATOM 4798  C CG   . ASN A 1 25  ? -25.996 -0.911  -4.755  1.00 0.00 ? 25  ASN A CG   3  
ATOM 4799  O OD1  . ASN A 1 25  ? -26.503 -0.590  -3.698  1.00 0.00 ? 25  ASN A OD1  3  
ATOM 4800  N ND2  . ASN A 1 25  ? -26.722 -0.963  -5.838  1.00 0.00 ? 25  ASN A ND2  3  
ATOM 4801  H H    . ASN A 1 25  ? -22.375 -3.640  -4.559  1.00 0.00 ? 25  ASN A H    3  
ATOM 4802  H HA   . ASN A 1 25  ? -25.170 -3.236  -4.278  1.00 0.00 ? 25  ASN A HA   3  
ATOM 4803  H HB2  . ASN A 1 25  ? -23.990 -0.810  -3.996  1.00 0.00 ? 25  ASN A HB2  3  
ATOM 4804  H HB3  . ASN A 1 25  ? -24.098 -0.875  -5.754  1.00 0.00 ? 25  ASN A HB3  3  
ATOM 4805  H HD21 . ASN A 1 25  ? -26.314 -1.222  -6.690  1.00 0.00 ? 25  ASN A HD21 3  
ATOM 4806  H HD22 . ASN A 1 25  ? -27.676 -0.743  -5.798  1.00 0.00 ? 25  ASN A HD22 3  
ATOM 4807  N N    . VAL A 1 26  ? -24.210 -4.659  -6.272  1.00 0.00 ? 26  VAL A N    3  
ATOM 4808  C CA   . VAL A 1 26  ? -24.030 -5.405  -7.564  1.00 0.00 ? 26  VAL A CA   3  
ATOM 4809  C C    . VAL A 1 26  ? -22.538 -5.676  -7.773  1.00 0.00 ? 26  VAL A C    3  
ATOM 4810  O O    . VAL A 1 26  ? -22.167 -6.550  -8.534  1.00 0.00 ? 26  VAL A O    3  
ATOM 4811  C CB   . VAL A 1 26  ? -24.595 -4.660  -8.784  1.00 0.00 ? 26  VAL A CB   3  
ATOM 4812  C CG1  . VAL A 1 26  ? -24.531 -5.581  -9.999  1.00 0.00 ? 26  VAL A CG1  3  
ATOM 4813  C CG2  . VAL A 1 26  ? -26.048 -4.262  -8.516  1.00 0.00 ? 26  VAL A CG2  3  
ATOM 4814  H H    . VAL A 1 26  ? -24.283 -5.178  -5.443  1.00 0.00 ? 26  VAL A H    3  
ATOM 4815  H HA   . VAL A 1 26  ? -24.528 -6.361  -7.467  1.00 0.00 ? 26  VAL A HA   3  
ATOM 4816  H HB   . VAL A 1 26  ? -24.003 -3.780  -8.979  1.00 0.00 ? 26  VAL A HB   3  
ATOM 4817  H HG11 . VAL A 1 26  ? -24.738 -6.595  -9.691  1.00 0.00 ? 26  VAL A HG11 3  
ATOM 4818  H HG12 . VAL A 1 26  ? -25.261 -5.267  -10.727 1.00 0.00 ? 26  VAL A HG12 3  
ATOM 4819  H HG13 . VAL A 1 26  ? -23.542 -5.531  -10.432 1.00 0.00 ? 26  VAL A HG13 3  
ATOM 4820  H HG21 . VAL A 1 26  ? -26.555 -5.070  -8.010  1.00 0.00 ? 26  VAL A HG21 3  
ATOM 4821  H HG22 . VAL A 1 26  ? -26.071 -3.378  -7.896  1.00 0.00 ? 26  VAL A HG22 3  
ATOM 4822  H HG23 . VAL A 1 26  ? -26.544 -4.057  -9.453  1.00 0.00 ? 26  VAL A HG23 3  
ATOM 4823  N N    . MET A 1 27  ? -21.672 -4.971  -7.070  1.00 0.00 ? 27  MET A N    3  
ATOM 4824  C CA   . MET A 1 27  ? -20.219 -5.230  -7.190  1.00 0.00 ? 27  MET A CA   3  
ATOM 4825  C C    . MET A 1 27  ? -19.990 -6.641  -6.674  1.00 0.00 ? 27  MET A C    3  
ATOM 4826  O O    . MET A 1 27  ? -19.448 -7.487  -7.358  1.00 0.00 ? 27  MET A O    3  
ATOM 4827  C CB   . MET A 1 27  ? -19.453 -4.234  -6.313  1.00 0.00 ? 27  MET A CB   3  
ATOM 4828  C CG   . MET A 1 27  ? -19.890 -2.797  -6.636  1.00 0.00 ? 27  MET A CG   3  
ATOM 4829  S SD   . MET A 1 27  ? -18.644 -1.989  -7.676  1.00 0.00 ? 27  MET A SD   3  
ATOM 4830  C CE   . MET A 1 27  ? -19.371 -0.333  -7.657  1.00 0.00 ? 27  MET A CE   3  
ATOM 4831  H H    . MET A 1 27  ? -21.978 -4.302  -6.436  1.00 0.00 ? 27  MET A H    3  
ATOM 4832  H HA   . MET A 1 27  ? -19.897 -5.149  -8.222  1.00 0.00 ? 27  MET A HA   3  
ATOM 4833  H HB2  . MET A 1 27  ? -19.661 -4.445  -5.274  1.00 0.00 ? 27  MET A HB2  3  
ATOM 4834  H HB3  . MET A 1 27  ? -18.399 -4.341  -6.492  1.00 0.00 ? 27  MET A HB3  3  
ATOM 4835  H HG2  . MET A 1 27  ? -20.834 -2.813  -7.159  1.00 0.00 ? 27  MET A HG2  3  
ATOM 4836  H HG3  . MET A 1 27  ? -20.003 -2.244  -5.716  1.00 0.00 ? 27  MET A HG3  3  
ATOM 4837  H HE1  . MET A 1 27  ? -20.152 -0.289  -6.915  1.00 0.00 ? 27  MET A HE1  3  
ATOM 4838  H HE2  . MET A 1 27  ? -18.606 0.393   -7.416  1.00 0.00 ? 27  MET A HE2  3  
ATOM 4839  H HE3  . MET A 1 27  ? -19.789 -0.113  -8.630  1.00 0.00 ? 27  MET A HE3  3  
ATOM 4840  N N    . LEU A 1 28  ? -20.441 -6.906  -5.463  1.00 0.00 ? 28  LEU A N    3  
ATOM 4841  C CA   . LEU A 1 28  ? -20.299 -8.271  -4.873  1.00 0.00 ? 28  LEU A CA   3  
ATOM 4842  C C    . LEU A 1 28  ? -18.853 -8.744  -5.030  1.00 0.00 ? 28  LEU A C    3  
ATOM 4843  O O    . LEU A 1 28  ? -18.550 -9.599  -5.840  1.00 0.00 ? 28  LEU A O    3  
ATOM 4844  C CB   . LEU A 1 28  ? -21.271 -9.202  -5.607  1.00 0.00 ? 28  LEU A CB   3  
ATOM 4845  C CG   . LEU A 1 28  ? -22.347 -9.729  -4.643  1.00 0.00 ? 28  LEU A CG   3  
ATOM 4846  C CD1  . LEU A 1 28  ? -21.691 -10.488 -3.486  1.00 0.00 ? 28  LEU A CD1  3  
ATOM 4847  C CD2  . LEU A 1 28  ? -23.159 -8.555  -4.086  1.00 0.00 ? 28  LEU A CD2  3  
ATOM 4848  H H    . LEU A 1 28  ? -20.895 -6.203  -4.953  1.00 0.00 ? 28  LEU A H    3  
ATOM 4849  H HA   . LEU A 1 28  ? -20.549 -8.242  -3.834  1.00 0.00 ? 28  LEU A HA   3  
ATOM 4850  H HB2  . LEU A 1 28  ? -21.753 -8.648  -6.404  1.00 0.00 ? 28  LEU A HB2  3  
ATOM 4851  H HB3  . LEU A 1 28  ? -20.730 -10.026 -6.022  1.00 0.00 ? 28  LEU A HB3  3  
ATOM 4852  H HG   . LEU A 1 28  ? -23.006 -10.398 -5.178  1.00 0.00 ? 28  LEU A HG   3  
ATOM 4853  H HD11 . LEU A 1 28  ? -20.748 -10.898 -3.814  1.00 0.00 ? 28  LEU A HD11 3  
ATOM 4854  H HD12 . LEU A 1 28  ? -21.523 -9.811  -2.662  1.00 0.00 ? 28  LEU A HD12 3  
ATOM 4855  H HD13 . LEU A 1 28  ? -22.341 -11.289 -3.167  1.00 0.00 ? 28  LEU A HD13 3  
ATOM 4856  H HD21 . LEU A 1 28  ? -23.437 -7.895  -4.893  1.00 0.00 ? 28  LEU A HD21 3  
ATOM 4857  H HD22 . LEU A 1 28  ? -24.050 -8.930  -3.604  1.00 0.00 ? 28  LEU A HD22 3  
ATOM 4858  H HD23 . LEU A 1 28  ? -22.562 -8.014  -3.367  1.00 0.00 ? 28  LEU A HD23 3  
ATOM 4859  N N    . ARG A 1 29  ? -17.946 -8.133  -4.301  1.00 0.00 ? 29  ARG A N    3  
ATOM 4860  C CA   . ARG A 1 29  ? -16.499 -8.481  -4.454  1.00 0.00 ? 29  ARG A CA   3  
ATOM 4861  C C    . ARG A 1 29  ? -16.095 -8.189  -5.910  1.00 0.00 ? 29  ARG A C    3  
ATOM 4862  O O    . ARG A 1 29  ? -15.138 -8.738  -6.420  1.00 0.00 ? 29  ARG A O    3  
ATOM 4863  C CB   . ARG A 1 29  ? -16.279 -9.969  -4.149  1.00 0.00 ? 29  ARG A CB   3  
ATOM 4864  C CG   . ARG A 1 29  ? -16.968 -10.339 -2.831  1.00 0.00 ? 29  ARG A CG   3  
ATOM 4865  C CD   . ARG A 1 29  ? -16.597 -11.772 -2.439  1.00 0.00 ? 29  ARG A CD   3  
ATOM 4866  N NE   . ARG A 1 29  ? -17.808 -12.479 -1.936  1.00 0.00 ? 29  ARG A NE   3  
ATOM 4867  C CZ   . ARG A 1 29  ? -17.987 -13.742 -2.210  1.00 0.00 ? 29  ARG A CZ   3  
ATOM 4868  N NH1  . ARG A 1 29  ? -17.344 -14.654 -1.533  1.00 0.00 ? 29  ARG A NH1  3  
ATOM 4869  N NH2  . ARG A 1 29  ? -18.809 -14.093 -3.161  1.00 0.00 ? 29  ARG A NH2  3  
ATOM 4870  H H    . ARG A 1 29  ? -18.213 -7.411  -3.694  1.00 0.00 ? 29  ARG A H    3  
ATOM 4871  H HA   . ARG A 1 29  ? -15.906 -7.876  -3.783  1.00 0.00 ? 29  ARG A HA   3  
ATOM 4872  H HB2  . ARG A 1 29  ? -16.693 -10.564 -4.951  1.00 0.00 ? 29  ARG A HB2  3  
ATOM 4873  H HB3  . ARG A 1 29  ? -15.220 -10.165 -4.066  1.00 0.00 ? 29  ARG A HB3  3  
ATOM 4874  H HG2  . ARG A 1 29  ? -16.646 -9.659  -2.056  1.00 0.00 ? 29  ARG A HG2  3  
ATOM 4875  H HG3  . ARG A 1 29  ? -18.038 -10.267 -2.952  1.00 0.00 ? 29  ARG A HG3  3  
ATOM 4876  H HD2  . ARG A 1 29  ? -16.207 -12.296 -3.299  1.00 0.00 ? 29  ARG A HD2  3  
ATOM 4877  H HD3  . ARG A 1 29  ? -15.847 -11.749 -1.662  1.00 0.00 ? 29  ARG A HD3  3  
ATOM 4878  H HE   . ARG A 1 29  ? -18.470 -11.995 -1.400  1.00 0.00 ? 29  ARG A HE   3  
ATOM 4879  H HH11 . ARG A 1 29  ? -16.714 -14.385 -0.805  1.00 0.00 ? 29  ARG A HH11 3  
ATOM 4880  H HH12 . ARG A 1 29  ? -17.481 -15.622 -1.743  1.00 0.00 ? 29  ARG A HH12 3  
ATOM 4881  H HH21 . ARG A 1 29  ? -19.302 -13.394 -3.679  1.00 0.00 ? 29  ARG A HH21 3  
ATOM 4882  H HH22 . ARG A 1 29  ? -18.947 -15.061 -3.371  1.00 0.00 ? 29  ARG A HH22 3  
ATOM 4883  N N    . LYS A 1 30  ? -16.855 -7.330  -6.580  1.00 0.00 ? 30  LYS A N    3  
ATOM 4884  C CA   . LYS A 1 30  ? -16.602 -6.972  -8.011  1.00 0.00 ? 30  LYS A CA   3  
ATOM 4885  C C    . LYS A 1 30  ? -16.229 -8.214  -8.821  1.00 0.00 ? 30  LYS A C    3  
ATOM 4886  O O    . LYS A 1 30  ? -15.079 -8.446  -9.108  1.00 0.00 ? 30  LYS A O    3  
ATOM 4887  C CB   . LYS A 1 30  ? -15.499 -5.916  -8.100  1.00 0.00 ? 30  LYS A CB   3  
ATOM 4888  C CG   . LYS A 1 30  ? -16.130 -4.550  -8.399  1.00 0.00 ? 30  LYS A CG   3  
ATOM 4889  C CD   . LYS A 1 30  ? -15.030 -3.516  -8.647  1.00 0.00 ? 30  LYS A CD   3  
ATOM 4890  C CE   . LYS A 1 30  ? -15.508 -2.500  -9.686  1.00 0.00 ? 30  LYS A CE   3  
ATOM 4891  N NZ   . LYS A 1 30  ? -14.341 -1.729  -10.200 1.00 0.00 ? 30  LYS A NZ   3  
ATOM 4892  H H    . LYS A 1 30  ? -17.614 -6.918  -6.132  1.00 0.00 ? 30  LYS A H    3  
ATOM 4893  H HA   . LYS A 1 30  ? -17.509 -6.564  -8.424  1.00 0.00 ? 30  LYS A HA   3  
ATOM 4894  H HB2  . LYS A 1 30  ? -14.971 -5.870  -7.160  1.00 0.00 ? 30  LYS A HB2  3  
ATOM 4895  H HB3  . LYS A 1 30  ? -14.813 -6.173  -8.891  1.00 0.00 ? 30  LYS A HB3  3  
ATOM 4896  H HG2  . LYS A 1 30  ? -16.758 -4.629  -9.275  1.00 0.00 ? 30  LYS A HG2  3  
ATOM 4897  H HG3  . LYS A 1 30  ? -16.732 -4.240  -7.557  1.00 0.00 ? 30  LYS A HG3  3  
ATOM 4898  H HD2  . LYS A 1 30  ? -14.802 -3.006  -7.722  1.00 0.00 ? 30  LYS A HD2  3  
ATOM 4899  H HD3  . LYS A 1 30  ? -14.145 -4.013  -9.013  1.00 0.00 ? 30  LYS A HD3  3  
ATOM 4900  H HE2  . LYS A 1 30  ? -15.986 -3.018  -10.504 1.00 0.00 ? 30  LYS A HE2  3  
ATOM 4901  H HE3  . LYS A 1 30  ? -16.214 -1.822  -9.228  1.00 0.00 ? 30  LYS A HE3  3  
ATOM 4902  H HZ1  . LYS A 1 30  ? -13.579 -2.386  -10.460 1.00 0.00 ? 30  LYS A HZ1  3  
ATOM 4903  H HZ2  . LYS A 1 30  ? -14.629 -1.181  -11.036 1.00 0.00 ? 30  LYS A HZ2  3  
ATOM 4904  H HZ3  . LYS A 1 30  ? -14.000 -1.082  -9.461  1.00 0.00 ? 30  LYS A HZ3  3  
ATOM 4905  N N    . ILE A 1 31  ? -17.208 -9.016  -9.172  1.00 0.00 ? 31  ILE A N    3  
ATOM 4906  C CA   . ILE A 1 31  ? -16.939 -10.267 -9.960  1.00 0.00 ? 31  ILE A CA   3  
ATOM 4907  C C    . ILE A 1 31  ? -16.085 -9.949  -11.198 1.00 0.00 ? 31  ILE A C    3  
ATOM 4908  O O    . ILE A 1 31  ? -16.595 -9.632  -12.255 1.00 0.00 ? 31  ILE A O    3  
ATOM 4909  C CB   . ILE A 1 31  ? -18.265 -10.886 -10.406 1.00 0.00 ? 31  ILE A CB   3  
ATOM 4910  C CG1  . ILE A 1 31  ? -19.211 -11.029 -9.198  1.00 0.00 ? 31  ILE A CG1  3  
ATOM 4911  C CG2  . ILE A 1 31  ? -17.997 -12.265 -11.016 1.00 0.00 ? 31  ILE A CG2  3  
ATOM 4912  C CD1  . ILE A 1 31  ? -20.365 -10.029 -9.322  1.00 0.00 ? 31  ILE A CD1  3  
ATOM 4913  H H    . ILE A 1 31  ? -18.129 -8.800  -8.901  1.00 0.00 ? 31  ILE A H    3  
ATOM 4914  H HA   . ILE A 1 31  ? -16.414 -10.972 -9.340  1.00 0.00 ? 31  ILE A HA   3  
ATOM 4915  H HB   . ILE A 1 31  ? -18.715 -10.251 -11.149 1.00 0.00 ? 31  ILE A HB   3  
ATOM 4916  H HG12 . ILE A 1 31  ? -19.610 -12.033 -9.167  1.00 0.00 ? 31  ILE A HG12 3  
ATOM 4917  H HG13 . ILE A 1 31  ? -18.667 -10.833 -8.285  1.00 0.00 ? 31  ILE A HG13 3  
ATOM 4918  H HG21 . ILE A 1 31  ? -17.323 -12.816 -10.378 1.00 0.00 ? 31  ILE A HG21 3  
ATOM 4919  H HG22 . ILE A 1 31  ? -18.928 -12.805 -11.108 1.00 0.00 ? 31  ILE A HG22 3  
ATOM 4920  H HG23 . ILE A 1 31  ? -17.552 -12.146 -11.993 1.00 0.00 ? 31  ILE A HG23 3  
ATOM 4921  H HD11 . ILE A 1 31  ? -20.578 -9.852  -10.365 1.00 0.00 ? 31  ILE A HD11 3  
ATOM 4922  H HD12 . ILE A 1 31  ? -21.243 -10.432 -8.839  1.00 0.00 ? 31  ILE A HD12 3  
ATOM 4923  H HD13 . ILE A 1 31  ? -20.090 -9.099  -8.848  1.00 0.00 ? 31  ILE A HD13 3  
ATOM 4924  N N    . ALA A 1 32  ? -14.784 -10.027 -11.055 1.00 0.00 ? 32  ALA A N    3  
ATOM 4925  C CA   . ALA A 1 32  ? -13.840 -9.729  -12.180 1.00 0.00 ? 32  ALA A CA   3  
ATOM 4926  C C    . ALA A 1 32  ? -12.446 -9.551  -11.578 1.00 0.00 ? 32  ALA A C    3  
ATOM 4927  O O    . ALA A 1 32  ? -11.473 -10.111 -12.045 1.00 0.00 ? 32  ALA A O    3  
ATOM 4928  C CB   . ALA A 1 32  ? -14.238 -8.434  -12.903 1.00 0.00 ? 32  ALA A CB   3  
ATOM 4929  H H    . ALA A 1 32  ? -14.417 -10.282 -10.183 1.00 0.00 ? 32  ALA A H    3  
ATOM 4930  H HA   . ALA A 1 32  ? -13.833 -10.554 -12.878 1.00 0.00 ? 32  ALA A HA   3  
ATOM 4931  H HB1  . ALA A 1 32  ? -14.647 -7.734  -12.189 1.00 0.00 ? 32  ALA A HB1  3  
ATOM 4932  H HB2  . ALA A 1 32  ? -13.367 -8.001  -13.373 1.00 0.00 ? 32  ALA A HB2  3  
ATOM 4933  H HB3  . ALA A 1 32  ? -14.981 -8.655  -13.655 1.00 0.00 ? 32  ALA A HB3  3  
ATOM 4934  N N    . VAL A 1 33  ? -12.356 -8.772  -10.527 1.00 0.00 ? 33  VAL A N    3  
ATOM 4935  C CA   . VAL A 1 33  ? -11.045 -8.536  -9.849  1.00 0.00 ? 33  VAL A CA   3  
ATOM 4936  C C    . VAL A 1 33  ? -10.410 -9.872  -9.446  1.00 0.00 ? 33  VAL A C    3  
ATOM 4937  O O    . VAL A 1 33  ? -9.204  -9.982  -9.331  1.00 0.00 ? 33  VAL A O    3  
ATOM 4938  C CB   . VAL A 1 33  ? -11.246 -7.676  -8.589  1.00 0.00 ? 33  VAL A CB   3  
ATOM 4939  C CG1  . VAL A 1 33  ? -11.389 -6.205  -8.981  1.00 0.00 ? 33  VAL A CG1  3  
ATOM 4940  C CG2  . VAL A 1 33  ? -12.498 -8.120  -7.820  1.00 0.00 ? 33  VAL A CG2  3  
ATOM 4941  H H    . VAL A 1 33  ? -13.159 -8.343  -10.177 1.00 0.00 ? 33  VAL A H    3  
ATOM 4942  H HA   . VAL A 1 33  ? -10.385 -8.019  -10.526 1.00 0.00 ? 33  VAL A HA   3  
ATOM 4943  H HB   . VAL A 1 33  ? -10.386 -7.789  -7.954  1.00 0.00 ? 33  VAL A HB   3  
ATOM 4944  H HG11 . VAL A 1 33  ? -10.506 -5.888  -9.515  1.00 0.00 ? 33  VAL A HG11 3  
ATOM 4945  H HG12 . VAL A 1 33  ? -12.256 -6.083  -9.611  1.00 0.00 ? 33  VAL A HG12 3  
ATOM 4946  H HG13 . VAL A 1 33  ? -11.505 -5.606  -8.089  1.00 0.00 ? 33  VAL A HG13 3  
ATOM 4947  H HG21 . VAL A 1 33  ? -12.730 -9.143  -8.071  1.00 0.00 ? 33  VAL A HG21 3  
ATOM 4948  H HG22 . VAL A 1 33  ? -12.315 -8.041  -6.759  1.00 0.00 ? 33  VAL A HG22 3  
ATOM 4949  H HG23 . VAL A 1 33  ? -13.329 -7.485  -8.090  1.00 0.00 ? 33  VAL A HG23 3  
ATOM 4950  N N    . ALA A 1 34  ? -11.213 -10.885 -9.230  1.00 0.00 ? 34  ALA A N    3  
ATOM 4951  C CA   . ALA A 1 34  ? -10.661 -12.215 -8.833  1.00 0.00 ? 34  ALA A CA   3  
ATOM 4952  C C    . ALA A 1 34  ? -9.746  -12.742 -9.942  1.00 0.00 ? 34  ALA A C    3  
ATOM 4953  O O    . ALA A 1 34  ? -10.191 -13.390 -10.870 1.00 0.00 ? 34  ALA A O    3  
ATOM 4954  C CB   . ALA A 1 34  ? -11.812 -13.198 -8.611  1.00 0.00 ? 34  ALA A CB   3  
ATOM 4955  H H    . ALA A 1 34  ? -12.181 -10.770 -9.328  1.00 0.00 ? 34  ALA A H    3  
ATOM 4956  H HA   . ALA A 1 34  ? -10.095 -12.111 -7.919  1.00 0.00 ? 34  ALA A HA   3  
ATOM 4957  H HB1  . ALA A 1 34  ? -12.532 -12.762 -7.934  1.00 0.00 ? 34  ALA A HB1  3  
ATOM 4958  H HB2  . ALA A 1 34  ? -12.289 -13.412 -9.556  1.00 0.00 ? 34  ALA A HB2  3  
ATOM 4959  H HB3  . ALA A 1 34  ? -11.426 -14.113 -8.186  1.00 0.00 ? 34  ALA A HB3  3  
ATOM 4960  N N    . ALA A 1 35  ? -8.469  -12.466 -9.848  1.00 0.00 ? 35  ALA A N    3  
ATOM 4961  C CA   . ALA A 1 35  ? -7.515  -12.945 -10.890 1.00 0.00 ? 35  ALA A CA   3  
ATOM 4962  C C    . ALA A 1 35  ? -6.087  -12.560 -10.486 1.00 0.00 ? 35  ALA A C    3  
ATOM 4963  O O    . ALA A 1 35  ? -5.426  -11.784 -11.153 1.00 0.00 ? 35  ALA A O    3  
ATOM 4964  C CB   . ALA A 1 35  ? -7.866  -12.301 -12.235 1.00 0.00 ? 35  ALA A CB   3  
ATOM 4965  H H    . ALA A 1 35  ? -8.139  -11.942 -9.089  1.00 0.00 ? 35  ALA A H    3  
ATOM 4966  H HA   . ALA A 1 35  ? -7.586  -14.019 -10.976 1.00 0.00 ? 35  ALA A HA   3  
ATOM 4967  H HB1  . ALA A 1 35  ? -7.927  -11.230 -12.116 1.00 0.00 ? 35  ALA A HB1  3  
ATOM 4968  H HB2  . ALA A 1 35  ? -7.100  -12.540 -12.959 1.00 0.00 ? 35  ALA A HB2  3  
ATOM 4969  H HB3  . ALA A 1 35  ? -8.817  -12.681 -12.578 1.00 0.00 ? 35  ALA A HB3  3  
ATOM 4970  N N    . ALA A 1 36  ? -5.608  -13.100 -9.393  1.00 0.00 ? 36  ALA A N    3  
ATOM 4971  C CA   . ALA A 1 36  ? -4.227  -12.775 -8.933  1.00 0.00 ? 36  ALA A CA   3  
ATOM 4972  C C    . ALA A 1 36  ? -3.228  -13.717 -9.608  1.00 0.00 ? 36  ALA A C    3  
ATOM 4973  O O    . ALA A 1 36  ? -3.259  -14.916 -9.404  1.00 0.00 ? 36  ALA A O    3  
ATOM 4974  C CB   . ALA A 1 36  ? -4.142  -12.946 -7.415  1.00 0.00 ? 36  ALA A CB   3  
ATOM 4975  H H    . ALA A 1 36  ? -6.161  -13.721 -8.875  1.00 0.00 ? 36  ALA A H    3  
ATOM 4976  H HA   . ALA A 1 36  ? -3.991  -11.754 -9.194  1.00 0.00 ? 36  ALA A HA   3  
ATOM 4977  H HB1  . ALA A 1 36  ? -5.009  -12.498 -6.953  1.00 0.00 ? 36  ALA A HB1  3  
ATOM 4978  H HB2  . ALA A 1 36  ? -4.107  -13.998 -7.172  1.00 0.00 ? 36  ALA A HB2  3  
ATOM 4979  H HB3  . ALA A 1 36  ? -3.249  -12.463 -7.048  1.00 0.00 ? 36  ALA A HB3  3  
ATOM 4980  N N    . SER A 1 37  ? -2.344  -13.181 -10.410 1.00 0.00 ? 37  SER A N    3  
ATOM 4981  C CA   . SER A 1 37  ? -1.337  -14.037 -11.103 1.00 0.00 ? 37  SER A CA   3  
ATOM 4982  C C    . SER A 1 37  ? -0.100  -14.186 -10.216 1.00 0.00 ? 37  SER A C    3  
ATOM 4983  O O    . SER A 1 37  ? 0.343   -15.284 -9.934  1.00 0.00 ? 37  SER A O    3  
ATOM 4984  C CB   . SER A 1 37  ? -0.939  -13.384 -12.428 1.00 0.00 ? 37  SER A CB   3  
ATOM 4985  O OG   . SER A 1 37  ? -2.111  -13.085 -13.175 1.00 0.00 ? 37  SER A OG   3  
ATOM 4986  H H    . SER A 1 37  ? -2.342  -12.212 -10.556 1.00 0.00 ? 37  SER A H    3  
ATOM 4987  H HA   . SER A 1 37  ? -1.763  -15.010 -11.295 1.00 0.00 ? 37  SER A HA   3  
ATOM 4988  H HB2  . SER A 1 37  ? -0.400  -12.471 -12.234 1.00 0.00 ? 37  SER A HB2  3  
ATOM 4989  H HB3  . SER A 1 37  ? -0.306  -14.061 -12.986 1.00 0.00 ? 37  SER A HB3  3  
ATOM 4990  H HG   . SER A 1 37  ? -2.475  -12.263 -12.839 1.00 0.00 ? 37  SER A HG   3  
ATOM 4991  N N    . LYS A 1 38  ? 0.460   -13.088 -9.775  1.00 0.00 ? 38  LYS A N    3  
ATOM 4992  C CA   . LYS A 1 38  ? 1.671   -13.153 -8.903  1.00 0.00 ? 38  LYS A CA   3  
ATOM 4993  C C    . LYS A 1 38  ? 2.086   -11.727 -8.495  1.00 0.00 ? 38  LYS A C    3  
ATOM 4994  O O    . LYS A 1 38  ? 2.948   -11.143 -9.121  1.00 0.00 ? 38  LYS A O    3  
ATOM 4995  C CB   . LYS A 1 38  ? 2.822   -13.828 -9.661  1.00 0.00 ? 38  LYS A CB   3  
ATOM 4996  C CG   . LYS A 1 38  ? 2.979   -13.194 -11.048 1.00 0.00 ? 38  LYS A CG   3  
ATOM 4997  C CD   . LYS A 1 38  ? 4.465   -13.097 -11.404 1.00 0.00 ? 38  LYS A CD   3  
ATOM 4998  C CE   . LYS A 1 38  ? 4.983   -14.478 -11.812 1.00 0.00 ? 38  LYS A CE   3  
ATOM 4999  N NZ   . LYS A 1 38  ? 6.463   -14.425 -11.974 1.00 0.00 ? 38  LYS A NZ   3  
ATOM 5000  H H    . LYS A 1 38  ? 0.081   -12.217 -10.019 1.00 0.00 ? 38  LYS A H    3  
ATOM 5001  H HA   . LYS A 1 38  ? 1.441   -13.725 -8.016  1.00 0.00 ? 38  LYS A HA   3  
ATOM 5002  H HB2  . LYS A 1 38  ? 3.739   -13.704 -9.102  1.00 0.00 ? 38  LYS A HB2  3  
ATOM 5003  H HB3  . LYS A 1 38  ? 2.610   -14.881 -9.771  1.00 0.00 ? 38  LYS A HB3  3  
ATOM 5004  H HG2  . LYS A 1 38  ? 2.473   -13.806 -11.781 1.00 0.00 ? 38  LYS A HG2  3  
ATOM 5005  H HG3  . LYS A 1 38  ? 2.546   -12.206 -11.044 1.00 0.00 ? 38  LYS A HG3  3  
ATOM 5006  H HD2  . LYS A 1 38  ? 4.593   -12.406 -12.224 1.00 0.00 ? 38  LYS A HD2  3  
ATOM 5007  H HD3  . LYS A 1 38  ? 5.018   -12.746 -10.546 1.00 0.00 ? 38  LYS A HD3  3  
ATOM 5008  H HE2  . LYS A 1 38  ? 4.730   -15.198 -11.048 1.00 0.00 ? 38  LYS A HE2  3  
ATOM 5009  H HE3  . LYS A 1 38  ? 4.528   -14.770 -12.747 1.00 0.00 ? 38  LYS A HE3  3  
ATOM 5010  H HZ1  . LYS A 1 38  ? 6.888   -13.968 -11.143 1.00 0.00 ? 38  LYS A HZ1  3  
ATOM 5011  H HZ2  . LYS A 1 38  ? 6.836   -15.392 -12.068 1.00 0.00 ? 38  LYS A HZ2  3  
ATOM 5012  H HZ3  . LYS A 1 38  ? 6.700   -13.878 -12.826 1.00 0.00 ? 38  LYS A HZ3  3  
ATOM 5013  N N    . PRO A 1 39  ? 1.466   -11.196 -7.454  1.00 0.00 ? 39  PRO A N    3  
ATOM 5014  C CA   . PRO A 1 39  ? 1.779   -9.838  -6.971  1.00 0.00 ? 39  PRO A CA   3  
ATOM 5015  C C    . PRO A 1 39  ? 3.079   -9.847  -6.162  1.00 0.00 ? 39  PRO A C    3  
ATOM 5016  O O    . PRO A 1 39  ? 3.402   -10.818 -5.504  1.00 0.00 ? 39  PRO A O    3  
ATOM 5017  C CB   . PRO A 1 39  ? 0.585   -9.483  -6.081  1.00 0.00 ? 39  PRO A CB   3  
ATOM 5018  C CG   . PRO A 1 39  ? -0.051  -10.825 -5.645  1.00 0.00 ? 39  PRO A CG   3  
ATOM 5019  C CD   . PRO A 1 39  ? 0.410   -11.882 -6.665  1.00 0.00 ? 39  PRO A CD   3  
ATOM 5020  H HA   . PRO A 1 39  ? 1.845   -9.146  -7.794  1.00 0.00 ? 39  PRO A HA   3  
ATOM 5021  H HB2  . PRO A 1 39  ? 0.921   -8.929  -5.215  1.00 0.00 ? 39  PRO A HB2  3  
ATOM 5022  H HB3  . PRO A 1 39  ? -0.135  -8.904  -6.638  1.00 0.00 ? 39  PRO A HB3  3  
ATOM 5023  H HG2  . PRO A 1 39  ? 0.290   -11.089 -4.653  1.00 0.00 ? 39  PRO A HG2  3  
ATOM 5024  H HG3  . PRO A 1 39  ? -1.127  -10.748 -5.661  1.00 0.00 ? 39  PRO A HG3  3  
ATOM 5025  H HD2  . PRO A 1 39  ? 0.815   -12.745 -6.155  1.00 0.00 ? 39  PRO A HD2  3  
ATOM 5026  H HD3  . PRO A 1 39  ? -0.407  -12.169 -7.308  1.00 0.00 ? 39  PRO A HD3  3  
ATOM 5027  N N    . ALA A 1 40  ? 3.824   -8.772  -6.209  1.00 0.00 ? 40  ALA A N    3  
ATOM 5028  C CA   . ALA A 1 40  ? 5.105   -8.711  -5.447  1.00 0.00 ? 40  ALA A CA   3  
ATOM 5029  C C    . ALA A 1 40  ? 5.554   -7.254  -5.309  1.00 0.00 ? 40  ALA A C    3  
ATOM 5030  O O    . ALA A 1 40  ? 4.918   -6.348  -5.813  1.00 0.00 ? 40  ALA A O    3  
ATOM 5031  C CB   . ALA A 1 40  ? 6.180   -9.505  -6.192  1.00 0.00 ? 40  ALA A CB   3  
ATOM 5032  H H    . ALA A 1 40  ? 3.540   -8.005  -6.748  1.00 0.00 ? 40  ALA A H    3  
ATOM 5033  H HA   . ALA A 1 40  ? 4.960   -9.136  -4.465  1.00 0.00 ? 40  ALA A HA   3  
ATOM 5034  H HB1  . ALA A 1 40  ? 5.803   -10.490 -6.425  1.00 0.00 ? 40  ALA A HB1  3  
ATOM 5035  H HB2  . ALA A 1 40  ? 6.438   -8.992  -7.106  1.00 0.00 ? 40  ALA A HB2  3  
ATOM 5036  H HB3  . ALA A 1 40  ? 7.058   -9.594  -5.569  1.00 0.00 ? 40  ALA A HB3  3  
ATOM 5037  N N    . VAL A 1 41  ? 6.648   -7.029  -4.629  1.00 0.00 ? 41  VAL A N    3  
ATOM 5038  C CA   . VAL A 1 41  ? 7.157   -5.639  -4.448  1.00 0.00 ? 41  VAL A CA   3  
ATOM 5039  C C    . VAL A 1 41  ? 8.669   -5.690  -4.215  1.00 0.00 ? 41  VAL A C    3  
ATOM 5040  O O    . VAL A 1 41  ? 9.242   -6.750  -4.067  1.00 0.00 ? 41  VAL A O    3  
ATOM 5041  C CB   . VAL A 1 41  ? 6.431   -4.982  -3.244  1.00 0.00 ? 41  VAL A CB   3  
ATOM 5042  C CG1  . VAL A 1 41  ? 7.062   -5.396  -1.908  1.00 0.00 ? 41  VAL A CG1  3  
ATOM 5043  C CG2  . VAL A 1 41  ? 6.478   -3.453  -3.375  1.00 0.00 ? 41  VAL A CG2  3  
ATOM 5044  H H    . VAL A 1 41  ? 7.139   -7.781  -4.236  1.00 0.00 ? 41  VAL A H    3  
ATOM 5045  H HA   . VAL A 1 41  ? 6.957   -5.066  -5.338  1.00 0.00 ? 41  VAL A HA   3  
ATOM 5046  H HB   . VAL A 1 41  ? 5.407   -5.306  -3.248  1.00 0.00 ? 41  VAL A HB   3  
ATOM 5047  H HG11 . VAL A 1 41  ? 7.659   -6.278  -2.061  1.00 0.00 ? 41  VAL A HG11 3  
ATOM 5048  H HG12 . VAL A 1 41  ? 7.690   -4.596  -1.540  1.00 0.00 ? 41  VAL A HG12 3  
ATOM 5049  H HG13 . VAL A 1 41  ? 6.284   -5.604  -1.190  1.00 0.00 ? 41  VAL A HG13 3  
ATOM 5050  H HG21 . VAL A 1 41  ? 6.910   -3.184  -4.324  1.00 0.00 ? 41  VAL A HG21 3  
ATOM 5051  H HG22 . VAL A 1 41  ? 5.476   -3.058  -3.314  1.00 0.00 ? 41  VAL A HG22 3  
ATOM 5052  H HG23 . VAL A 1 41  ? 7.077   -3.035  -2.579  1.00 0.00 ? 41  VAL A HG23 3  
ATOM 5053  N N    . GLU A 1 42  ? 9.298   -4.554  -4.144  1.00 0.00 ? 42  GLU A N    3  
ATOM 5054  C CA   . GLU A 1 42  ? 10.758  -4.528  -3.877  1.00 0.00 ? 42  GLU A CA   3  
ATOM 5055  C C    . GLU A 1 42  ? 11.104  -3.211  -3.201  1.00 0.00 ? 42  GLU A C    3  
ATOM 5056  O O    . GLU A 1 42  ? 11.018  -2.155  -3.796  1.00 0.00 ? 42  GLU A O    3  
ATOM 5057  C CB   . GLU A 1 42  ? 11.542  -4.682  -5.178  1.00 0.00 ? 42  GLU A CB   3  
ATOM 5058  C CG   . GLU A 1 42  ? 11.118  -3.592  -6.161  1.00 0.00 ? 42  GLU A CG   3  
ATOM 5059  C CD   . GLU A 1 42  ? 11.234  -4.119  -7.592  1.00 0.00 ? 42  GLU A CD   3  
ATOM 5060  O OE1  . GLU A 1 42  ? 10.364  -4.872  -7.998  1.00 0.00 ? 42  GLU A OE1  3  
ATOM 5061  O OE2  . GLU A 1 42  ? 12.190  -3.760  -8.259  1.00 0.00 ? 42  GLU A OE2  3  
ATOM 5062  H H    . GLU A 1 42  ? 8.804   -3.715  -4.243  1.00 0.00 ? 42  GLU A H    3  
ATOM 5063  H HA   . GLU A 1 42  ? 11.001  -5.334  -3.210  1.00 0.00 ? 42  GLU A HA   3  
ATOM 5064  H HB2  . GLU A 1 42  ? 12.598  -4.594  -4.971  1.00 0.00 ? 42  GLU A HB2  3  
ATOM 5065  H HB3  . GLU A 1 42  ? 11.337  -5.652  -5.605  1.00 0.00 ? 42  GLU A HB3  3  
ATOM 5066  H HG2  . GLU A 1 42  ? 10.095  -3.310  -5.960  1.00 0.00 ? 42  GLU A HG2  3  
ATOM 5067  H HG3  . GLU A 1 42  ? 11.760  -2.733  -6.041  1.00 0.00 ? 42  GLU A HG3  3  
ATOM 5068  N N    . ILE A 1 43  ? 11.479  -3.269  -1.953  1.00 0.00 ? 43  ILE A N    3  
ATOM 5069  C CA   . ILE A 1 43  ? 11.809  -2.026  -1.218  1.00 0.00 ? 43  ILE A CA   3  
ATOM 5070  C C    . ILE A 1 43  ? 13.314  -1.800  -1.230  1.00 0.00 ? 43  ILE A C    3  
ATOM 5071  O O    . ILE A 1 43  ? 14.104  -2.723  -1.199  1.00 0.00 ? 43  ILE A O    3  
ATOM 5072  C CB   . ILE A 1 43  ? 11.293  -2.127  0.214   1.00 0.00 ? 43  ILE A CB   3  
ATOM 5073  C CG1  . ILE A 1 43  ? 9.792   -2.432  0.178   1.00 0.00 ? 43  ILE A CG1  3  
ATOM 5074  C CG2  . ILE A 1 43  ? 11.527  -0.800  0.942   1.00 0.00 ? 43  ILE A CG2  3  
ATOM 5075  C CD1  . ILE A 1 43  ? 9.264   -2.654  1.598   1.00 0.00 ? 43  ILE A CD1  3  
ATOM 5076  H H    . ILE A 1 43  ? 11.532  -4.134  -1.499  1.00 0.00 ? 43  ILE A H    3  
ATOM 5077  H HA   . ILE A 1 43  ? 11.330  -1.195  -1.704  1.00 0.00 ? 43  ILE A HA   3  
ATOM 5078  H HB   . ILE A 1 43  ? 11.813  -2.917  0.725   1.00 0.00 ? 43  ILE A HB   3  
ATOM 5079  H HG12 . ILE A 1 43  ? 9.269   -1.601  -0.272  1.00 0.00 ? 43  ILE A HG12 3  
ATOM 5080  H HG13 . ILE A 1 43  ? 9.621   -3.322  -0.409  1.00 0.00 ? 43  ILE A HG13 3  
ATOM 5081  H HG21 . ILE A 1 43  ? 11.002  -0.010  0.426   1.00 0.00 ? 43  ILE A HG21 3  
ATOM 5082  H HG22 . ILE A 1 43  ? 11.160  -0.876  1.955   1.00 0.00 ? 43  ILE A HG22 3  
ATOM 5083  H HG23 . ILE A 1 43  ? 12.584  -0.580  0.958   1.00 0.00 ? 43  ILE A HG23 3  
ATOM 5084  H HD11 . ILE A 1 43  ? 10.094  -2.745  2.284   1.00 0.00 ? 43  ILE A HD11 3  
ATOM 5085  H HD12 . ILE A 1 43  ? 8.647   -1.817  1.886   1.00 0.00 ? 43  ILE A HD12 3  
ATOM 5086  H HD13 . ILE A 1 43  ? 8.677   -3.560  1.623   1.00 0.00 ? 43  ILE A HD13 3  
ATOM 5087  N N    . LYS A 1 44  ? 13.696  -0.563  -1.290  1.00 0.00 ? 44  LYS A N    3  
ATOM 5088  C CA   . LYS A 1 44  ? 15.132  -0.199  -1.325  1.00 0.00 ? 44  LYS A CA   3  
ATOM 5089  C C    . LYS A 1 44  ? 15.288  1.044   -0.455  1.00 0.00 ? 44  LYS A C    3  
ATOM 5090  O O    . LYS A 1 44  ? 14.673  2.057   -0.717  1.00 0.00 ? 44  LYS A O    3  
ATOM 5091  C CB   . LYS A 1 44  ? 15.510  0.095   -2.781  1.00 0.00 ? 44  LYS A CB   3  
ATOM 5092  C CG   . LYS A 1 44  ? 15.109  -1.099  -3.656  1.00 0.00 ? 44  LYS A CG   3  
ATOM 5093  C CD   . LYS A 1 44  ? 15.887  -1.070  -4.970  1.00 0.00 ? 44  LYS A CD   3  
ATOM 5094  C CE   . LYS A 1 44  ? 15.545  0.195   -5.762  1.00 0.00 ? 44  LYS A CE   3  
ATOM 5095  N NZ   . LYS A 1 44  ? 16.788  0.754   -6.365  1.00 0.00 ? 44  LYS A NZ   3  
ATOM 5096  H H    . LYS A 1 44  ? 13.023  0.146   -1.324  1.00 0.00 ? 44  LYS A H    3  
ATOM 5097  H HA   . LYS A 1 44  ? 15.733  -1.008  -0.934  1.00 0.00 ? 44  LYS A HA   3  
ATOM 5098  H HB2  . LYS A 1 44  ? 14.978  0.974   -3.120  1.00 0.00 ? 44  LYS A HB2  3  
ATOM 5099  H HB3  . LYS A 1 44  ? 16.572  0.258   -2.858  1.00 0.00 ? 44  LYS A HB3  3  
ATOM 5100  H HG2  . LYS A 1 44  ? 15.325  -2.013  -3.131  1.00 0.00 ? 44  LYS A HG2  3  
ATOM 5101  H HG3  . LYS A 1 44  ? 14.055  -1.058  -3.866  1.00 0.00 ? 44  LYS A HG3  3  
ATOM 5102  H HD2  . LYS A 1 44  ? 16.943  -1.085  -4.757  1.00 0.00 ? 44  LYS A HD2  3  
ATOM 5103  H HD3  . LYS A 1 44  ? 15.623  -1.937  -5.554  1.00 0.00 ? 44  LYS A HD3  3  
ATOM 5104  H HE2  . LYS A 1 44  ? 14.846  -0.051  -6.546  1.00 0.00 ? 44  LYS A HE2  3  
ATOM 5105  H HE3  . LYS A 1 44  ? 15.105  0.928   -5.103  1.00 0.00 ? 44  LYS A HE3  3  
ATOM 5106  H HZ1  . LYS A 1 44  ? 17.367  -0.021  -6.746  1.00 0.00 ? 44  LYS A HZ1  3  
ATOM 5107  H HZ2  . LYS A 1 44  ? 16.536  1.410   -7.133  1.00 0.00 ? 44  LYS A HZ2  3  
ATOM 5108  H HZ3  . LYS A 1 44  ? 17.329  1.262   -5.637  1.00 0.00 ? 44  LYS A HZ3  3  
ATOM 5109  N N    . GLN A 1 45  ? 16.044  0.974   0.612   1.00 0.00 ? 45  GLN A N    3  
ATOM 5110  C CA   . GLN A 1 45  ? 16.134  2.168   1.500   1.00 0.00 ? 45  GLN A CA   3  
ATOM 5111  C C    . GLN A 1 45  ? 17.511  2.328   2.142   1.00 0.00 ? 45  GLN A C    3  
ATOM 5112  O O    . GLN A 1 45  ? 18.219  1.376   2.401   1.00 0.00 ? 45  GLN A O    3  
ATOM 5113  C CB   . GLN A 1 45  ? 15.085  2.011   2.599   1.00 0.00 ? 45  GLN A CB   3  
ATOM 5114  C CG   . GLN A 1 45  ? 15.321  0.703   3.361   1.00 0.00 ? 45  GLN A CG   3  
ATOM 5115  C CD   . GLN A 1 45  ? 16.075  0.993   4.662   1.00 0.00 ? 45  GLN A CD   3  
ATOM 5116  O OE1  . GLN A 1 45  ? 15.552  1.638   5.549   1.00 0.00 ? 45  GLN A OE1  3  
ATOM 5117  N NE2  . GLN A 1 45  ? 17.291  0.544   4.816   1.00 0.00 ? 45  GLN A NE2  3  
ATOM 5118  H H    . GLN A 1 45  ? 16.500  0.140   0.848   1.00 0.00 ? 45  GLN A H    3  
ATOM 5119  H HA   . GLN A 1 45  ? 15.906  3.053   0.927   1.00 0.00 ? 45  GLN A HA   3  
ATOM 5120  H HB2  . GLN A 1 45  ? 15.151  2.839   3.282   1.00 0.00 ? 45  GLN A HB2  3  
ATOM 5121  H HB3  . GLN A 1 45  ? 14.103  1.991   2.153   1.00 0.00 ? 45  GLN A HB3  3  
ATOM 5122  H HG2  . GLN A 1 45  ? 14.370  0.244   3.590   1.00 0.00 ? 45  GLN A HG2  3  
ATOM 5123  H HG3  . GLN A 1 45  ? 15.905  0.031   2.751   1.00 0.00 ? 45  GLN A HG3  3  
ATOM 5124  H HE21 . GLN A 1 45  ? 17.717  0.025   4.103   1.00 0.00 ? 45  GLN A HE21 3  
ATOM 5125  H HE22 . GLN A 1 45  ? 17.779  0.725   5.647   1.00 0.00 ? 45  GLN A HE22 3  
ATOM 5126  N N    . GLU A 1 46  ? 17.863  3.554   2.420   1.00 0.00 ? 46  GLU A N    3  
ATOM 5127  C CA   . GLU A 1 46  ? 19.157  3.862   3.075   1.00 0.00 ? 46  GLU A CA   3  
ATOM 5128  C C    . GLU A 1 46  ? 18.885  4.860   4.206   1.00 0.00 ? 46  GLU A C    3  
ATOM 5129  O O    . GLU A 1 46  ? 18.911  6.061   4.005   1.00 0.00 ? 46  GLU A O    3  
ATOM 5130  C CB   . GLU A 1 46  ? 20.102  4.487   2.053   1.00 0.00 ? 46  GLU A CB   3  
ATOM 5131  C CG   . GLU A 1 46  ? 21.544  4.308   2.523   1.00 0.00 ? 46  GLU A CG   3  
ATOM 5132  C CD   . GLU A 1 46  ? 22.489  4.390   1.323   1.00 0.00 ? 46  GLU A CD   3  
ATOM 5133  O OE1  . GLU A 1 46  ? 22.855  5.495   0.956   1.00 0.00 ? 46  GLU A OE1  3  
ATOM 5134  O OE2  . GLU A 1 46  ? 22.831  3.347   0.790   1.00 0.00 ? 46  GLU A OE2  3  
ATOM 5135  H H    . GLU A 1 46  ? 17.254  4.287   2.205   1.00 0.00 ? 46  GLU A H    3  
ATOM 5136  H HA   . GLU A 1 46  ? 19.590  2.958   3.477   1.00 0.00 ? 46  GLU A HA   3  
ATOM 5137  H HB2  . GLU A 1 46  ? 19.967  4.002   1.098   1.00 0.00 ? 46  GLU A HB2  3  
ATOM 5138  H HB3  . GLU A 1 46  ? 19.883  5.539   1.958   1.00 0.00 ? 46  GLU A HB3  3  
ATOM 5139  H HG2  . GLU A 1 46  ? 21.789  5.086   3.231   1.00 0.00 ? 46  GLU A HG2  3  
ATOM 5140  H HG3  . GLU A 1 46  ? 21.649  3.344   2.996   1.00 0.00 ? 46  GLU A HG3  3  
ATOM 5141  N N    . GLY A 1 47  ? 18.595  4.372   5.387   1.00 0.00 ? 47  GLY A N    3  
ATOM 5142  C CA   . GLY A 1 47  ? 18.294  5.288   6.529   1.00 0.00 ? 47  GLY A CA   3  
ATOM 5143  C C    . GLY A 1 47  ? 16.844  5.767   6.416   1.00 0.00 ? 47  GLY A C    3  
ATOM 5144  O O    . GLY A 1 47  ? 15.941  4.979   6.206   1.00 0.00 ? 47  GLY A O    3  
ATOM 5145  H H    . GLY A 1 47  ? 18.560  3.401   5.518   1.00 0.00 ? 47  GLY A H    3  
ATOM 5146  H HA2  . GLY A 1 47  ? 18.431  4.759   7.462   1.00 0.00 ? 47  GLY A HA2  3  
ATOM 5147  H HA3  . GLY A 1 47  ? 18.956  6.140   6.495   1.00 0.00 ? 47  GLY A HA3  3  
ATOM 5148  N N    . ASP A 1 48  ? 16.614  7.052   6.544   1.00 0.00 ? 48  ASP A N    3  
ATOM 5149  C CA   . ASP A 1 48  ? 15.226  7.583   6.435   1.00 0.00 ? 48  ASP A CA   3  
ATOM 5150  C C    . ASP A 1 48  ? 14.804  7.690   4.963   1.00 0.00 ? 48  ASP A C    3  
ATOM 5151  O O    . ASP A 1 48  ? 13.687  8.068   4.668   1.00 0.00 ? 48  ASP A O    3  
ATOM 5152  C CB   . ASP A 1 48  ? 15.160  8.958   7.083   1.00 0.00 ? 48  ASP A CB   3  
ATOM 5153  C CG   . ASP A 1 48  ? 16.207  9.879   6.453   1.00 0.00 ? 48  ASP A CG   3  
ATOM 5154  O OD1  . ASP A 1 48  ? 16.134  10.092  5.254   1.00 0.00 ? 48  ASP A OD1  3  
ATOM 5155  O OD2  . ASP A 1 48  ? 17.063  10.355  7.179   1.00 0.00 ? 48  ASP A OD2  3  
ATOM 5156  H H    . ASP A 1 48  ? 17.355  7.669   6.707   1.00 0.00 ? 48  ASP A H    3  
ATOM 5157  H HA   . ASP A 1 48  ? 14.545  6.920   6.946   1.00 0.00 ? 48  ASP A HA   3  
ATOM 5158  H HB2  . ASP A 1 48  ? 14.178  9.368   6.933   1.00 0.00 ? 48  ASP A HB2  3  
ATOM 5159  H HB3  . ASP A 1 48  ? 15.352  8.865   8.139   1.00 0.00 ? 48  ASP A HB3  3  
ATOM 5160  N N    . THR A 1 49  ? 15.670  7.345   4.039   1.00 0.00 ? 49  THR A N    3  
ATOM 5161  C CA   . THR A 1 49  ? 15.292  7.409   2.601   1.00 0.00 ? 49  THR A CA   3  
ATOM 5162  C C    . THR A 1 49  ? 14.723  6.045   2.205   1.00 0.00 ? 49  THR A C    3  
ATOM 5163  O O    . THR A 1 49  ? 15.243  5.021   2.602   1.00 0.00 ? 49  THR A O    3  
ATOM 5164  C CB   . THR A 1 49  ? 16.537  7.710   1.766   1.00 0.00 ? 49  THR A CB   3  
ATOM 5165  O OG1  . THR A 1 49  ? 17.130  8.919   2.221   1.00 0.00 ? 49  THR A OG1  3  
ATOM 5166  C CG2  . THR A 1 49  ? 16.148  7.853   0.296   1.00 0.00 ? 49  THR A CG2  3  
ATOM 5167  H H    . THR A 1 49  ? 16.561  7.028   4.287   1.00 0.00 ? 49  THR A H    3  
ATOM 5168  H HA   . THR A 1 49  ? 14.548  8.182   2.448   1.00 0.00 ? 49  THR A HA   3  
ATOM 5169  H HB   . THR A 1 49  ? 17.244  6.901   1.869   1.00 0.00 ? 49  THR A HB   3  
ATOM 5170  H HG1  . THR A 1 49  ? 18.075  8.864   2.062   1.00 0.00 ? 49  THR A HG1  3  
ATOM 5171  H HG21 . THR A 1 49  ? 15.398  7.116   0.050   1.00 0.00 ? 49  THR A HG21 3  
ATOM 5172  H HG22 . THR A 1 49  ? 15.752  8.843   0.124   1.00 0.00 ? 49  THR A HG22 3  
ATOM 5173  H HG23 . THR A 1 49  ? 17.020  7.701   -0.323  1.00 0.00 ? 49  THR A HG23 3  
ATOM 5174  N N    . PHE A 1 50  ? 13.660  6.013   1.444   1.00 0.00 ? 50  PHE A N    3  
ATOM 5175  C CA   . PHE A 1 50  ? 13.077  4.698   1.048   1.00 0.00 ? 50  PHE A CA   3  
ATOM 5176  C C    . PHE A 1 50  ? 12.628  4.716   -0.416  1.00 0.00 ? 50  PHE A C    3  
ATOM 5177  O O    . PHE A 1 50  ? 12.440  5.753   -1.023  1.00 0.00 ? 50  PHE A O    3  
ATOM 5178  C CB   . PHE A 1 50  ? 11.873  4.372   1.939   1.00 0.00 ? 50  PHE A CB   3  
ATOM 5179  C CG   . PHE A 1 50  ? 12.319  4.345   3.377   1.00 0.00 ? 50  PHE A CG   3  
ATOM 5180  C CD1  . PHE A 1 50  ? 12.388  5.534   4.099   1.00 0.00 ? 50  PHE A CD1  3  
ATOM 5181  C CD2  . PHE A 1 50  ? 12.682  3.137   3.980   1.00 0.00 ? 50  PHE A CD2  3  
ATOM 5182  C CE1  . PHE A 1 50  ? 12.825  5.524   5.423   1.00 0.00 ? 50  PHE A CE1  3  
ATOM 5183  C CE2  . PHE A 1 50  ? 13.115  3.124   5.313   1.00 0.00 ? 50  PHE A CE2  3  
ATOM 5184  C CZ   . PHE A 1 50  ? 13.189  4.324   6.032   1.00 0.00 ? 50  PHE A CZ   3  
ATOM 5185  H H    . PHE A 1 50  ? 13.246  6.843   1.148   1.00 0.00 ? 50  PHE A H    3  
ATOM 5186  H HA   . PHE A 1 50  ? 13.830  3.931   1.178   1.00 0.00 ? 50  PHE A HA   3  
ATOM 5187  H HB2  . PHE A 1 50  ? 11.114  5.129   1.809   1.00 0.00 ? 50  PHE A HB2  3  
ATOM 5188  H HB3  . PHE A 1 50  ? 11.473  3.407   1.667   1.00 0.00 ? 50  PHE A HB3  3  
ATOM 5189  H HD1  . PHE A 1 50  ? 12.101  6.458   3.634   1.00 0.00 ? 50  PHE A HD1  3  
ATOM 5190  H HD2  . PHE A 1 50  ? 12.619  2.216   3.422   1.00 0.00 ? 50  PHE A HD2  3  
ATOM 5191  H HE1  . PHE A 1 50  ? 12.876  6.448   5.979   1.00 0.00 ? 50  PHE A HE1  3  
ATOM 5192  H HE2  . PHE A 1 50  ? 13.394  2.191   5.783   1.00 0.00 ? 50  PHE A HE2  3  
ATOM 5193  H HZ   . PHE A 1 50  ? 13.529  4.324   7.057   1.00 0.00 ? 50  PHE A HZ   3  
ATOM 5194  N N    . TYR A 1 51  ? 12.440  3.550   -0.961  1.00 0.00 ? 51  TYR A N    3  
ATOM 5195  C CA   . TYR A 1 51  ? 11.985  3.399   -2.369  1.00 0.00 ? 51  TYR A CA   3  
ATOM 5196  C C    . TYR A 1 51  ? 10.991  2.231   -2.345  1.00 0.00 ? 51  TYR A C    3  
ATOM 5197  O O    . TYR A 1 51  ? 11.147  1.312   -1.561  1.00 0.00 ? 51  TYR A O    3  
ATOM 5198  C CB   . TYR A 1 51  ? 13.231  3.140   -3.258  1.00 0.00 ? 51  TYR A CB   3  
ATOM 5199  C CG   . TYR A 1 51  ? 12.939  2.290   -4.480  1.00 0.00 ? 51  TYR A CG   3  
ATOM 5200  C CD1  . TYR A 1 51  ? 12.731  0.918   -4.342  1.00 0.00 ? 51  TYR A CD1  3  
ATOM 5201  C CD2  . TYR A 1 51  ? 12.925  2.870   -5.748  1.00 0.00 ? 51  TYR A CD2  3  
ATOM 5202  C CE1  . TYR A 1 51  ? 12.506  0.123   -5.461  1.00 0.00 ? 51  TYR A CE1  3  
ATOM 5203  C CE2  . TYR A 1 51  ? 12.690  2.075   -6.879  1.00 0.00 ? 51  TYR A CE2  3  
ATOM 5204  C CZ   . TYR A 1 51  ? 12.481  0.700   -6.735  1.00 0.00 ? 51  TYR A CZ   3  
ATOM 5205  O OH   . TYR A 1 51  ? 12.266  -0.085  -7.850  1.00 0.00 ? 51  TYR A OH   3  
ATOM 5206  H H    . TYR A 1 51  ? 12.589  2.746   -0.423  1.00 0.00 ? 51  TYR A H    3  
ATOM 5207  H HA   . TYR A 1 51  ? 11.481  4.301   -2.692  1.00 0.00 ? 51  TYR A HA   3  
ATOM 5208  H HB2  . TYR A 1 51  ? 13.621  4.089   -3.590  1.00 0.00 ? 51  TYR A HB2  3  
ATOM 5209  H HB3  . TYR A 1 51  ? 13.984  2.650   -2.668  1.00 0.00 ? 51  TYR A HB3  3  
ATOM 5210  H HD1  . TYR A 1 51  ? 12.738  0.469   -3.368  1.00 0.00 ? 51  TYR A HD1  3  
ATOM 5211  H HD2  . TYR A 1 51  ? 13.093  3.929   -5.852  1.00 0.00 ? 51  TYR A HD2  3  
ATOM 5212  H HE1  . TYR A 1 51  ? 12.355  -0.935  -5.337  1.00 0.00 ? 51  TYR A HE1  3  
ATOM 5213  H HE2  . TYR A 1 51  ? 12.670  2.519   -7.860  1.00 0.00 ? 51  TYR A HE2  3  
ATOM 5214  H HH   . TYR A 1 51  ? 13.042  -0.635  -7.980  1.00 0.00 ? 51  TYR A HH   3  
ATOM 5215  N N    . ILE A 1 52  ? 9.960   2.265   -3.147  1.00 0.00 ? 52  ILE A N    3  
ATOM 5216  C CA   . ILE A 1 52  ? 8.959   1.149   -3.093  1.00 0.00 ? 52  ILE A CA   3  
ATOM 5217  C C    . ILE A 1 52  ? 8.401   0.852   -4.485  1.00 0.00 ? 52  ILE A C    3  
ATOM 5218  O O    . ILE A 1 52  ? 7.603   1.601   -5.012  1.00 0.00 ? 52  ILE A O    3  
ATOM 5219  C CB   . ILE A 1 52  ? 7.794   1.525   -2.158  1.00 0.00 ? 52  ILE A CB   3  
ATOM 5220  C CG1  . ILE A 1 52  ? 8.311   2.301   -0.930  1.00 0.00 ? 52  ILE A CG1  3  
ATOM 5221  C CG2  . ILE A 1 52  ? 7.104   0.245   -1.690  1.00 0.00 ? 52  ILE A CG2  3  
ATOM 5222  C CD1  . ILE A 1 52  ? 7.148   2.640   0.018   1.00 0.00 ? 52  ILE A CD1  3  
ATOM 5223  H H    . ILE A 1 52  ? 9.830   3.023   -3.752  1.00 0.00 ? 52  ILE A H    3  
ATOM 5224  H HA   . ILE A 1 52  ? 9.446   0.264   -2.711  1.00 0.00 ? 52  ILE A HA   3  
ATOM 5225  H HB   . ILE A 1 52  ? 7.085   2.135   -2.700  1.00 0.00 ? 52  ILE A HB   3  
ATOM 5226  H HG12 . ILE A 1 52  ? 9.036   1.697   -0.405  1.00 0.00 ? 52  ILE A HG12 3  
ATOM 5227  H HG13 . ILE A 1 52  ? 8.781   3.215   -1.259  1.00 0.00 ? 52  ILE A HG13 3  
ATOM 5228  H HG21 . ILE A 1 52  ? 7.219   -0.521  -2.439  1.00 0.00 ? 52  ILE A HG21 3  
ATOM 5229  H HG22 . ILE A 1 52  ? 7.552   -0.083  -0.763  1.00 0.00 ? 52  ILE A HG22 3  
ATOM 5230  H HG23 . ILE A 1 52  ? 6.054   0.443   -1.531  1.00 0.00 ? 52  ILE A HG23 3  
ATOM 5231  H HD11 . ILE A 1 52  ? 6.262   2.109   -0.292  1.00 0.00 ? 52  ILE A HD11 3  
ATOM 5232  H HD12 . ILE A 1 52  ? 7.409   2.348   1.024   1.00 0.00 ? 52  ILE A HD12 3  
ATOM 5233  H HD13 . ILE A 1 52  ? 6.953   3.697   -0.007  1.00 0.00 ? 52  ILE A HD13 3  
ATOM 5234  N N    . LYS A 1 53  ? 8.808   -0.246  -5.072  1.00 0.00 ? 53  LYS A N    3  
ATOM 5235  C CA   . LYS A 1 53  ? 8.307   -0.612  -6.429  1.00 0.00 ? 53  LYS A CA   3  
ATOM 5236  C C    . LYS A 1 53  ? 7.310   -1.769  -6.327  1.00 0.00 ? 53  LYS A C    3  
ATOM 5237  O O    . LYS A 1 53  ? 7.684   -2.926  -6.381  1.00 0.00 ? 53  LYS A O    3  
ATOM 5238  C CB   . LYS A 1 53  ? 9.490   -1.029  -7.306  1.00 0.00 ? 53  LYS A CB   3  
ATOM 5239  C CG   . LYS A 1 53  ? 9.368   -0.386  -8.690  1.00 0.00 ? 53  LYS A CG   3  
ATOM 5240  C CD   . LYS A 1 53  ? 10.118  -1.237  -9.717  1.00 0.00 ? 53  LYS A CD   3  
ATOM 5241  C CE   . LYS A 1 53  ? 9.153   -2.238  -10.354 1.00 0.00 ? 53  LYS A CE   3  
ATOM 5242  N NZ   . LYS A 1 53  ? 8.323   -1.544  -11.379 1.00 0.00 ? 53  LYS A NZ   3  
ATOM 5243  H H    . LYS A 1 53  ? 9.442   -0.833  -4.615  1.00 0.00 ? 53  LYS A H    3  
ATOM 5244  H HA   . LYS A 1 53  ? 7.819   0.239   -6.865  1.00 0.00 ? 53  LYS A HA   3  
ATOM 5245  H HB2  . LYS A 1 53  ? 10.404  -0.704  -6.839  1.00 0.00 ? 53  LYS A HB2  3  
ATOM 5246  H HB3  . LYS A 1 53  ? 9.504   -2.104  -7.413  1.00 0.00 ? 53  LYS A HB3  3  
ATOM 5247  H HG2  . LYS A 1 53  ? 8.325   -0.323  -8.967  1.00 0.00 ? 53  LYS A HG2  3  
ATOM 5248  H HG3  . LYS A 1 53  ? 9.795   0.605   -8.666  1.00 0.00 ? 53  LYS A HG3  3  
ATOM 5249  H HD2  . LYS A 1 53  ? 10.531  -0.596  -10.482 1.00 0.00 ? 53  LYS A HD2  3  
ATOM 5250  H HD3  . LYS A 1 53  ? 10.917  -1.773  -9.226  1.00 0.00 ? 53  LYS A HD3  3  
ATOM 5251  H HE2  . LYS A 1 53  ? 9.715   -3.031  -10.823 1.00 0.00 ? 53  LYS A HE2  3  
ATOM 5252  H HE3  . LYS A 1 53  ? 8.511   -2.653  -9.592  1.00 0.00 ? 53  LYS A HE3  3  
ATOM 5253  H HZ1  . LYS A 1 53  ? 8.034   -0.612  -11.018 1.00 0.00 ? 53  LYS A HZ1  3  
ATOM 5254  H HZ2  . LYS A 1 53  ? 8.878   -1.419  -12.249 1.00 0.00 ? 53  LYS A HZ2  3  
ATOM 5255  H HZ3  . LYS A 1 53  ? 7.478   -2.115  -11.584 1.00 0.00 ? 53  LYS A HZ3  3  
ATOM 5256  N N    . THR A 1 54  ? 6.044   -1.462  -6.191  1.00 0.00 ? 54  THR A N    3  
ATOM 5257  C CA   . THR A 1 54  ? 5.010   -2.535  -6.094  1.00 0.00 ? 54  THR A CA   3  
ATOM 5258  C C    . THR A 1 54  ? 4.567   -2.945  -7.495  1.00 0.00 ? 54  THR A C    3  
ATOM 5259  O O    . THR A 1 54  ? 3.638   -2.387  -8.048  1.00 0.00 ? 54  THR A O    3  
ATOM 5260  C CB   . THR A 1 54  ? 3.804   -2.015  -5.316  1.00 0.00 ? 54  THR A CB   3  
ATOM 5261  O OG1  . THR A 1 54  ? 4.246   -1.373  -4.128  1.00 0.00 ? 54  THR A OG1  3  
ATOM 5262  C CG2  . THR A 1 54  ? 2.884   -3.182  -4.960  1.00 0.00 ? 54  THR A CG2  3  
ATOM 5263  H H    . THR A 1 54  ? 5.773   -0.521  -6.158  1.00 0.00 ? 54  THR A H    3  
ATOM 5264  H HA   . THR A 1 54  ? 5.418   -3.390  -5.588  1.00 0.00 ? 54  THR A HA   3  
ATOM 5265  H HB   . THR A 1 54  ? 3.266   -1.313  -5.926  1.00 0.00 ? 54  THR A HB   3  
ATOM 5266  H HG1  . THR A 1 54  ? 4.538   -0.488  -4.360  1.00 0.00 ? 54  THR A HG1  3  
ATOM 5267  H HG21 . THR A 1 54  ? 3.479   -4.033  -4.662  1.00 0.00 ? 54  THR A HG21 3  
ATOM 5268  H HG22 . THR A 1 54  ? 2.235   -2.895  -4.146  1.00 0.00 ? 54  THR A HG22 3  
ATOM 5269  H HG23 . THR A 1 54  ? 2.286   -3.445  -5.820  1.00 0.00 ? 54  THR A HG23 3  
ATOM 5270  N N    . SER A 1 55  ? 5.225   -3.918  -8.071  1.00 0.00 ? 55  SER A N    3  
ATOM 5271  C CA   . SER A 1 55  ? 4.845   -4.371  -9.438  1.00 0.00 ? 55  SER A CA   3  
ATOM 5272  C C    . SER A 1 55  ? 4.679   -5.892  -9.446  1.00 0.00 ? 55  SER A C    3  
ATOM 5273  O O    . SER A 1 55  ? 5.387   -6.605  -8.760  1.00 0.00 ? 55  SER A O    3  
ATOM 5274  C CB   . SER A 1 55  ? 5.936   -3.970  -10.431 1.00 0.00 ? 55  SER A CB   3  
ATOM 5275  O OG   . SER A 1 55  ? 7.071   -4.805  -10.244 1.00 0.00 ? 55  SER A OG   3  
ATOM 5276  H H    . SER A 1 55  ? 5.968   -4.351  -7.601  1.00 0.00 ? 55  SER A H    3  
ATOM 5277  H HA   . SER A 1 55  ? 3.914   -3.905  -9.718  1.00 0.00 ? 55  SER A HA   3  
ATOM 5278  H HB2  . SER A 1 55  ? 5.571   -4.089  -11.437 1.00 0.00 ? 55  SER A HB2  3  
ATOM 5279  H HB3  . SER A 1 55  ? 6.207   -2.935  -10.268 1.00 0.00 ? 55  SER A HB3  3  
ATOM 5280  H HG   . SER A 1 55  ? 7.535   -4.504  -9.460  1.00 0.00 ? 55  SER A HG   3  
ATOM 5281  N N    . THR A 1 56  ? 3.747   -6.390  -10.219 1.00 0.00 ? 56  THR A N    3  
ATOM 5282  C CA   . THR A 1 56  ? 3.526   -7.865  -10.279 1.00 0.00 ? 56  THR A CA   3  
ATOM 5283  C C    . THR A 1 56  ? 4.468   -8.488  -11.313 1.00 0.00 ? 56  THR A C    3  
ATOM 5284  O O    . THR A 1 56  ? 4.828   -9.646  -11.214 1.00 0.00 ? 56  THR A O    3  
ATOM 5285  C CB   . THR A 1 56  ? 2.075   -8.151  -10.671 1.00 0.00 ? 56  THR A CB   3  
ATOM 5286  O OG1  . THR A 1 56  ? 1.904   -9.550  -10.857 1.00 0.00 ? 56  THR A OG1  3  
ATOM 5287  C CG2  . THR A 1 56  ? 1.740   -7.418  -11.968 1.00 0.00 ? 56  THR A CG2  3  
ATOM 5288  H H    . THR A 1 56  ? 3.192   -5.790  -10.760 1.00 0.00 ? 56  THR A H    3  
ATOM 5289  H HA   . THR A 1 56  ? 3.724   -8.295  -9.312  1.00 0.00 ? 56  THR A HA   3  
ATOM 5290  H HB   . THR A 1 56  ? 1.416   -7.809  -9.889  1.00 0.00 ? 56  THR A HB   3  
ATOM 5291  H HG1  . THR A 1 56  ? 0.974   -9.715  -11.026 1.00 0.00 ? 56  THR A HG1  3  
ATOM 5292  H HG21 . THR A 1 56  ? 2.565   -7.513  -12.658 1.00 0.00 ? 56  THR A HG21 3  
ATOM 5293  H HG22 . THR A 1 56  ? 0.853   -7.851  -12.406 1.00 0.00 ? 56  THR A HG22 3  
ATOM 5294  H HG23 . THR A 1 56  ? 1.565   -6.374  -11.756 1.00 0.00 ? 56  THR A HG23 3  
ATOM 5295  N N    . THR A 1 57  ? 4.869   -7.729  -12.303 1.00 0.00 ? 57  THR A N    3  
ATOM 5296  C CA   . THR A 1 57  ? 5.787   -8.274  -13.345 1.00 0.00 ? 57  THR A CA   3  
ATOM 5297  C C    . THR A 1 57  ? 6.528   -7.120  -14.025 1.00 0.00 ? 57  THR A C    3  
ATOM 5298  O O    . THR A 1 57  ? 7.733   -6.997  -13.916 1.00 0.00 ? 57  THR A O    3  
ATOM 5299  C CB   . THR A 1 57  ? 4.979   -9.051  -14.389 1.00 0.00 ? 57  THR A CB   3  
ATOM 5300  O OG1  . THR A 1 57  ? 3.757   -9.494  -13.814 1.00 0.00 ? 57  THR A OG1  3  
ATOM 5301  C CG2  . THR A 1 57  ? 5.785   -10.260 -14.868 1.00 0.00 ? 57  THR A CG2  3  
ATOM 5302  H H    . THR A 1 57  ? 4.564   -6.800  -12.361 1.00 0.00 ? 57  THR A H    3  
ATOM 5303  H HA   . THR A 1 57  ? 6.503   -8.935  -12.883 1.00 0.00 ? 57  THR A HA   3  
ATOM 5304  H HB   . THR A 1 57  ? 4.770   -8.410  -15.228 1.00 0.00 ? 57  THR A HB   3  
ATOM 5305  H HG1  . THR A 1 57  ? 3.044   -8.980  -14.199 1.00 0.00 ? 57  THR A HG1  3  
ATOM 5306  H HG21 . THR A 1 57  ? 6.478   -10.559 -14.096 1.00 0.00 ? 57  THR A HG21 3  
ATOM 5307  H HG22 . THR A 1 57  ? 5.114   -11.077 -15.085 1.00 0.00 ? 57  THR A HG22 3  
ATOM 5308  H HG23 . THR A 1 57  ? 6.332   -9.996  -15.761 1.00 0.00 ? 57  THR A HG23 3  
ATOM 5309  N N    . VAL A 1 58  ? 5.812   -6.275  -14.724 1.00 0.00 ? 58  VAL A N    3  
ATOM 5310  C CA   . VAL A 1 58  ? 6.466   -5.125  -15.415 1.00 0.00 ? 58  VAL A CA   3  
ATOM 5311  C C    . VAL A 1 58  ? 5.453   -3.990  -15.589 1.00 0.00 ? 58  VAL A C    3  
ATOM 5312  O O    . VAL A 1 58  ? 4.268   -4.168  -15.382 1.00 0.00 ? 58  VAL A O    3  
ATOM 5313  C CB   . VAL A 1 58  ? 6.973   -5.572  -16.786 1.00 0.00 ? 58  VAL A CB   3  
ATOM 5314  C CG1  . VAL A 1 58  ? 8.097   -6.594  -16.608 1.00 0.00 ? 58  VAL A CG1  3  
ATOM 5315  C CG2  . VAL A 1 58  ? 5.824   -6.210  -17.567 1.00 0.00 ? 58  VAL A CG2  3  
ATOM 5316  H H    . VAL A 1 58  ? 4.843   -6.399  -14.794 1.00 0.00 ? 58  VAL A H    3  
ATOM 5317  H HA   . VAL A 1 58  ? 7.296   -4.776  -14.823 1.00 0.00 ? 58  VAL A HA   3  
ATOM 5318  H HB   . VAL A 1 58  ? 7.348   -4.715  -17.328 1.00 0.00 ? 58  VAL A HB   3  
ATOM 5319  H HG11 . VAL A 1 58  ? 8.750   -6.275  -15.809 1.00 0.00 ? 58  VAL A HG11 3  
ATOM 5320  H HG12 . VAL A 1 58  ? 7.672   -7.556  -16.363 1.00 0.00 ? 58  VAL A HG12 3  
ATOM 5321  H HG13 . VAL A 1 58  ? 8.661   -6.673  -17.525 1.00 0.00 ? 58  VAL A HG13 3  
ATOM 5322  H HG21 . VAL A 1 58  ? 4.999   -5.516  -17.622 1.00 0.00 ? 58  VAL A HG21 3  
ATOM 5323  H HG22 . VAL A 1 58  ? 6.159   -6.453  -18.564 1.00 0.00 ? 58  VAL A HG22 3  
ATOM 5324  H HG23 . VAL A 1 58  ? 5.505   -7.111  -17.064 1.00 0.00 ? 58  VAL A HG23 3  
ATOM 5325  N N    . ARG A 1 59  ? 5.915   -2.825  -15.970 1.00 0.00 ? 59  ARG A N    3  
ATOM 5326  C CA   . ARG A 1 59  ? 4.990   -1.665  -16.164 1.00 0.00 ? 59  ARG A CA   3  
ATOM 5327  C C    . ARG A 1 59  ? 4.264   -1.356  -14.852 1.00 0.00 ? 59  ARG A C    3  
ATOM 5328  O O    . ARG A 1 59  ? 3.163   -1.819  -14.619 1.00 0.00 ? 59  ARG A O    3  
ATOM 5329  C CB   . ARG A 1 59  ? 3.962   -2.002  -17.250 1.00 0.00 ? 59  ARG A CB   3  
ATOM 5330  C CG   . ARG A 1 59  ? 4.463   -1.506  -18.616 1.00 0.00 ? 59  ARG A CG   3  
ATOM 5331  C CD   . ARG A 1 59  ? 3.437   -0.550  -19.233 1.00 0.00 ? 59  ARG A CD   3  
ATOM 5332  N NE   . ARG A 1 59  ? 3.647   -0.482  -20.707 1.00 0.00 ? 59  ARG A NE   3  
ATOM 5333  C CZ   . ARG A 1 59  ? 3.108   -1.380  -21.485 1.00 0.00 ? 59  ARG A CZ   3  
ATOM 5334  N NH1  . ARG A 1 59  ? 1.821   -1.367  -21.703 1.00 0.00 ? 59  ARG A NH1  3  
ATOM 5335  N NH2  . ARG A 1 59  ? 3.855   -2.291  -22.045 1.00 0.00 ? 59  ARG A NH2  3  
ATOM 5336  H H    . ARG A 1 59  ? 6.875   -2.711  -16.129 1.00 0.00 ? 59  ARG A H    3  
ATOM 5337  H HA   . ARG A 1 59  ? 5.561   -0.800  -16.468 1.00 0.00 ? 59  ARG A HA   3  
ATOM 5338  H HB2  . ARG A 1 59  ? 3.820   -3.072  -17.287 1.00 0.00 ? 59  ARG A HB2  3  
ATOM 5339  H HB3  . ARG A 1 59  ? 3.023   -1.524  -17.014 1.00 0.00 ? 59  ARG A HB3  3  
ATOM 5340  H HG2  . ARG A 1 59  ? 5.405   -0.990  -18.494 1.00 0.00 ? 59  ARG A HG2  3  
ATOM 5341  H HG3  . ARG A 1 59  ? 4.601   -2.351  -19.274 1.00 0.00 ? 59  ARG A HG3  3  
ATOM 5342  H HD2  . ARG A 1 59  ? 2.440   -0.910  -19.028 1.00 0.00 ? 59  ARG A HD2  3  
ATOM 5343  H HD3  . ARG A 1 59  ? 3.560   0.434   -18.806 1.00 0.00 ? 59  ARG A HD3  3  
ATOM 5344  H HE   . ARG A 1 59  ? 4.189   0.238   -21.092 1.00 0.00 ? 59  ARG A HE   3  
ATOM 5345  H HH11 . ARG A 1 59  ? 1.248   -0.669  -21.274 1.00 0.00 ? 59  ARG A HH11 3  
ATOM 5346  H HH12 . ARG A 1 59  ? 1.408   -2.056  -22.300 1.00 0.00 ? 59  ARG A HH12 3  
ATOM 5347  H HH21 . ARG A 1 59  ? 4.841   -2.301  -21.878 1.00 0.00 ? 59  ARG A HH21 3  
ATOM 5348  H HH22 . ARG A 1 59  ? 3.442   -2.980  -22.641 1.00 0.00 ? 59  ARG A HH22 3  
ATOM 5349  N N    . THR A 1 60  ? 4.874   -0.575  -13.997 1.00 0.00 ? 60  THR A N    3  
ATOM 5350  C CA   . THR A 1 60  ? 4.228   -0.228  -12.697 1.00 0.00 ? 60  THR A CA   3  
ATOM 5351  C C    . THR A 1 60  ? 4.863   1.046   -12.137 1.00 0.00 ? 60  THR A C    3  
ATOM 5352  O O    . THR A 1 60  ? 5.932   1.451   -12.555 1.00 0.00 ? 60  THR A O    3  
ATOM 5353  C CB   . THR A 1 60  ? 4.424   -1.376  -11.705 1.00 0.00 ? 60  THR A CB   3  
ATOM 5354  O OG1  . THR A 1 60  ? 4.143   -2.610  -12.351 1.00 0.00 ? 60  THR A OG1  3  
ATOM 5355  C CG2  . THR A 1 60  ? 3.479   -1.195  -10.514 1.00 0.00 ? 60  THR A CG2  3  
ATOM 5356  H H    . THR A 1 60  ? 5.760   -0.216  -14.212 1.00 0.00 ? 60  THR A H    3  
ATOM 5357  H HA   . THR A 1 60  ? 3.172   -0.064  -12.853 1.00 0.00 ? 60  THR A HA   3  
ATOM 5358  H HB   . THR A 1 60  ? 5.444   -1.378  -11.353 1.00 0.00 ? 60  THR A HB   3  
ATOM 5359  H HG1  . THR A 1 60  ? 3.201   -2.643  -12.532 1.00 0.00 ? 60  THR A HG1  3  
ATOM 5360  H HG21 . THR A 1 60  ? 2.661   -0.549  -10.795 1.00 0.00 ? 60  THR A HG21 3  
ATOM 5361  H HG22 . THR A 1 60  ? 3.091   -2.157  -10.214 1.00 0.00 ? 60  THR A HG22 3  
ATOM 5362  H HG23 . THR A 1 60  ? 4.020   -0.753  -9.690  1.00 0.00 ? 60  THR A HG23 3  
ATOM 5363  N N    . THR A 1 61  ? 4.212   1.680   -11.195 1.00 0.00 ? 61  THR A N    3  
ATOM 5364  C CA   . THR A 1 61  ? 4.771   2.931   -10.601 1.00 0.00 ? 61  THR A CA   3  
ATOM 5365  C C    . THR A 1 61  ? 5.475   2.602   -9.283  1.00 0.00 ? 61  THR A C    3  
ATOM 5366  O O    . THR A 1 61  ? 5.374   1.501   -8.774  1.00 0.00 ? 61  THR A O    3  
ATOM 5367  C CB   . THR A 1 61  ? 3.638   3.925   -10.342 1.00 0.00 ? 61  THR A CB   3  
ATOM 5368  O OG1  . THR A 1 61  ? 4.152   5.055   -9.650  1.00 0.00 ? 61  THR A OG1  3  
ATOM 5369  C CG2  . THR A 1 61  ? 2.557   3.256   -9.497  1.00 0.00 ? 61  THR A CG2  3  
ATOM 5370  H H    . THR A 1 61  ? 3.353   1.332   -10.877 1.00 0.00 ? 61  THR A H    3  
ATOM 5371  H HA   . THR A 1 61  ? 5.479   3.367   -11.287 1.00 0.00 ? 61  THR A HA   3  
ATOM 5372  H HB   . THR A 1 61  ? 3.212   4.240   -11.281 1.00 0.00 ? 61  THR A HB   3  
ATOM 5373  H HG1  . THR A 1 61  ? 4.718   5.541   -10.254 1.00 0.00 ? 61  THR A HG1  3  
ATOM 5374  H HG21 . THR A 1 61  ? 3.017   2.564   -8.808  1.00 0.00 ? 61  THR A HG21 3  
ATOM 5375  H HG22 . THR A 1 61  ? 2.015   4.008   -8.945  1.00 0.00 ? 61  THR A HG22 3  
ATOM 5376  H HG23 . THR A 1 61  ? 1.876   2.722   -10.143 1.00 0.00 ? 61  THR A HG23 3  
ATOM 5377  N N    . GLU A 1 62  ? 6.188   3.550   -8.730  1.00 0.00 ? 62  GLU A N    3  
ATOM 5378  C CA   . GLU A 1 62  ? 6.904   3.304   -7.444  1.00 0.00 ? 62  GLU A CA   3  
ATOM 5379  C C    . GLU A 1 62  ? 7.208   4.647   -6.768  1.00 0.00 ? 62  GLU A C    3  
ATOM 5380  O O    . GLU A 1 62  ? 7.432   5.641   -7.434  1.00 0.00 ? 62  GLU A O    3  
ATOM 5381  C CB   . GLU A 1 62  ? 8.201   2.521   -7.723  1.00 0.00 ? 62  GLU A CB   3  
ATOM 5382  C CG   . GLU A 1 62  ? 9.180   3.345   -8.561  1.00 0.00 ? 62  GLU A CG   3  
ATOM 5383  C CD   . GLU A 1 62  ? 8.707   3.398   -10.016 1.00 0.00 ? 62  GLU A CD   3  
ATOM 5384  O OE1  . GLU A 1 62  ? 8.878   2.409   -10.710 1.00 0.00 ? 62  GLU A OE1  3  
ATOM 5385  O OE2  . GLU A 1 62  ? 8.182   4.426   -10.410 1.00 0.00 ? 62  GLU A OE2  3  
ATOM 5386  H H    . GLU A 1 62  ? 6.251   4.427   -9.162  1.00 0.00 ? 62  GLU A H    3  
ATOM 5387  H HA   . GLU A 1 62  ? 6.269   2.718   -6.794  1.00 0.00 ? 62  GLU A HA   3  
ATOM 5388  H HB2  . GLU A 1 62  ? 8.673   2.264   -6.790  1.00 0.00 ? 62  GLU A HB2  3  
ATOM 5389  H HB3  . GLU A 1 62  ? 7.956   1.617   -8.259  1.00 0.00 ? 62  GLU A HB3  3  
ATOM 5390  H HG2  . GLU A 1 62  ? 9.242   4.344   -8.161  1.00 0.00 ? 62  GLU A HG2  3  
ATOM 5391  H HG3  . GLU A 1 62  ? 10.158  2.881   -8.519  1.00 0.00 ? 62  GLU A HG3  3  
ATOM 5392  N N    . ILE A 1 63  ? 7.212   4.687   -5.455  1.00 0.00 ? 63  ILE A N    3  
ATOM 5393  C CA   . ILE A 1 63  ? 7.496   5.979   -4.753  1.00 0.00 ? 63  ILE A CA   3  
ATOM 5394  C C    . ILE A 1 63  ? 8.958   6.042   -4.329  1.00 0.00 ? 63  ILE A C    3  
ATOM 5395  O O    . ILE A 1 63  ? 9.371   5.404   -3.380  1.00 0.00 ? 63  ILE A O    3  
ATOM 5396  C CB   . ILE A 1 63  ? 6.601   6.174   -3.512  1.00 0.00 ? 63  ILE A CB   3  
ATOM 5397  C CG1  . ILE A 1 63  ? 6.415   4.855   -2.744  1.00 0.00 ? 63  ILE A CG1  3  
ATOM 5398  C CG2  . ILE A 1 63  ? 5.242   6.706   -3.959  1.00 0.00 ? 63  ILE A CG2  3  
ATOM 5399  C CD1  . ILE A 1 63  ? 5.552   5.095   -1.501  1.00 0.00 ? 63  ILE A CD1  3  
ATOM 5400  H H    . ILE A 1 63  ? 7.028   3.875   -4.942  1.00 0.00 ? 63  ILE A H    3  
ATOM 5401  H HA   . ILE A 1 63  ? 7.308   6.790   -5.438  1.00 0.00 ? 63  ILE A HA   3  
ATOM 5402  H HB   . ILE A 1 63  ? 7.063   6.904   -2.859  1.00 0.00 ? 63  ILE A HB   3  
ATOM 5403  H HG12 . ILE A 1 63  ? 5.927   4.134   -3.377  1.00 0.00 ? 63  ILE A HG12 3  
ATOM 5404  H HG13 . ILE A 1 63  ? 7.379   4.479   -2.439  1.00 0.00 ? 63  ILE A HG13 3  
ATOM 5405  H HG21 . ILE A 1 63  ? 4.820   6.039   -4.695  1.00 0.00 ? 63  ILE A HG21 3  
ATOM 5406  H HG22 . ILE A 1 63  ? 4.584   6.768   -3.106  1.00 0.00 ? 63  ILE A HG22 3  
ATOM 5407  H HG23 . ILE A 1 63  ? 5.367   7.688   -4.390  1.00 0.00 ? 63  ILE A HG23 3  
ATOM 5408  H HD11 . ILE A 1 63  ? 4.632   5.577   -1.793  1.00 0.00 ? 63  ILE A HD11 3  
ATOM 5409  H HD12 . ILE A 1 63  ? 5.327   4.149   -1.031  1.00 0.00 ? 63  ILE A HD12 3  
ATOM 5410  H HD13 . ILE A 1 63  ? 6.086   5.726   -0.806  1.00 0.00 ? 63  ILE A HD13 3  
ATOM 5411  N N    . ASN A 1 64  ? 9.731   6.846   -5.010  1.00 0.00 ? 64  ASN A N    3  
ATOM 5412  C CA   . ASN A 1 64  ? 11.157  7.013   -4.636  1.00 0.00 ? 64  ASN A CA   3  
ATOM 5413  C C    . ASN A 1 64  ? 11.211  8.256   -3.771  1.00 0.00 ? 64  ASN A C    3  
ATOM 5414  O O    . ASN A 1 64  ? 11.425  9.356   -4.245  1.00 0.00 ? 64  ASN A O    3  
ATOM 5415  C CB   . ASN A 1 64  ? 12.030  7.206   -5.883  1.00 0.00 ? 64  ASN A CB   3  
ATOM 5416  C CG   . ASN A 1 64  ? 11.666  6.176   -6.958  1.00 0.00 ? 64  ASN A CG   3  
ATOM 5417  O OD1  . ASN A 1 64  ? 11.776  6.450   -8.136  1.00 0.00 ? 64  ASN A OD1  3  
ATOM 5418  N ND2  . ASN A 1 64  ? 11.233  4.997   -6.604  1.00 0.00 ? 64  ASN A ND2  3  
ATOM 5419  H H    . ASN A 1 64  ? 9.359   7.370   -5.744  1.00 0.00 ? 64  ASN A H    3  
ATOM 5420  H HA   . ASN A 1 64  ? 11.482  6.151   -4.069  1.00 0.00 ? 64  ASN A HA   3  
ATOM 5421  H HB2  . ASN A 1 64  ? 11.876  8.201   -6.275  1.00 0.00 ? 64  ASN A HB2  3  
ATOM 5422  H HB3  . ASN A 1 64  ? 13.069  7.086   -5.613  1.00 0.00 ? 64  ASN A HB3  3  
ATOM 5423  H HD21 . ASN A 1 64  ? 11.137  4.771   -5.656  1.00 0.00 ? 64  ASN A HD21 3  
ATOM 5424  H HD22 . ASN A 1 64  ? 11.021  4.333   -7.286  1.00 0.00 ? 64  ASN A HD22 3  
ATOM 5425  N N    . PHE A 1 65  ? 10.942  8.084   -2.516  1.00 0.00 ? 65  PHE A N    3  
ATOM 5426  C CA   . PHE A 1 65  ? 10.884  9.244   -1.593  1.00 0.00 ? 65  PHE A CA   3  
ATOM 5427  C C    . PHE A 1 65  ? 11.829  9.036   -0.401  1.00 0.00 ? 65  PHE A C    3  
ATOM 5428  O O    . PHE A 1 65  ? 12.708  8.204   -0.420  1.00 0.00 ? 65  PHE A O    3  
ATOM 5429  C CB   . PHE A 1 65  ? 9.423   9.345   -1.090  1.00 0.00 ? 65  PHE A CB   3  
ATOM 5430  C CG   . PHE A 1 65  ? 9.119   8.173   -0.161  1.00 0.00 ? 65  PHE A CG   3  
ATOM 5431  C CD1  . PHE A 1 65  ? 8.807   6.915   -0.693  1.00 0.00 ? 65  PHE A CD1  3  
ATOM 5432  C CD2  . PHE A 1 65  ? 9.203   8.335   1.233   1.00 0.00 ? 65  PHE A CD2  3  
ATOM 5433  C CE1  . PHE A 1 65  ? 8.579   5.834   0.152   1.00 0.00 ? 65  PHE A CE1  3  
ATOM 5434  C CE2  . PHE A 1 65  ? 8.979   7.244   2.078   1.00 0.00 ? 65  PHE A CE2  3  
ATOM 5435  C CZ   . PHE A 1 65  ? 8.668   5.992   1.537   1.00 0.00 ? 65  PHE A CZ   3  
ATOM 5436  H H    . PHE A 1 65  ? 10.726  7.186   -2.189  1.00 0.00 ? 65  PHE A H    3  
ATOM 5437  H HA   . PHE A 1 65  ? 11.148  10.148  -2.119  1.00 0.00 ? 65  PHE A HA   3  
ATOM 5438  H HB2  . PHE A 1 65  ? 9.287   10.275  -0.559  1.00 0.00 ? 65  PHE A HB2  3  
ATOM 5439  H HB3  . PHE A 1 65  ? 8.751   9.314   -1.935  1.00 0.00 ? 65  PHE A HB3  3  
ATOM 5440  H HD1  . PHE A 1 65  ? 8.728   6.779   -1.757  1.00 0.00 ? 65  PHE A HD1  3  
ATOM 5441  H HD2  . PHE A 1 65  ? 9.439   9.299   1.658   1.00 0.00 ? 65  PHE A HD2  3  
ATOM 5442  H HE1  . PHE A 1 65  ? 8.349   4.873   -0.270  1.00 0.00 ? 65  PHE A HE1  3  
ATOM 5443  H HE2  . PHE A 1 65  ? 9.047   7.369   3.148   1.00 0.00 ? 65  PHE A HE2  3  
ATOM 5444  H HZ   . PHE A 1 65  ? 8.500   5.147   2.187   1.00 0.00 ? 65  PHE A HZ   3  
ATOM 5445  N N    . LYS A 1 66  ? 11.588  9.776   0.642   1.00 0.00 ? 66  LYS A N    3  
ATOM 5446  C CA   . LYS A 1 66  ? 12.359  9.657   1.896   1.00 0.00 ? 66  LYS A CA   3  
ATOM 5447  C C    . LYS A 1 66  ? 11.384  10.052  2.995   1.00 0.00 ? 66  LYS A C    3  
ATOM 5448  O O    . LYS A 1 66  ? 10.800  11.117  2.946   1.00 0.00 ? 66  LYS A O    3  
ATOM 5449  C CB   . LYS A 1 66  ? 13.567  10.592  1.887   1.00 0.00 ? 66  LYS A CB   3  
ATOM 5450  C CG   . LYS A 1 66  ? 13.138  11.994  1.458   1.00 0.00 ? 66  LYS A CG   3  
ATOM 5451  C CD   . LYS A 1 66  ? 14.371  12.891  1.333   1.00 0.00 ? 66  LYS A CD   3  
ATOM 5452  C CE   . LYS A 1 66  ? 14.604  13.625  2.655   1.00 0.00 ? 66  LYS A CE   3  
ATOM 5453  N NZ   . LYS A 1 66  ? 16.054  13.940  2.800   1.00 0.00 ? 66  LYS A NZ   3  
ATOM 5454  H H    . LYS A 1 66  ? 10.847  10.411  0.612   1.00 0.00 ? 66  LYS A H    3  
ATOM 5455  H HA   . LYS A 1 66  ? 12.672  8.633   2.041   1.00 0.00 ? 66  LYS A HA   3  
ATOM 5456  H HB2  . LYS A 1 66  ? 13.988  10.635  2.878   1.00 0.00 ? 66  LYS A HB2  3  
ATOM 5457  H HB3  . LYS A 1 66  ? 14.306  10.216  1.197   1.00 0.00 ? 66  LYS A HB3  3  
ATOM 5458  H HG2  . LYS A 1 66  ? 12.635  11.936  0.504   1.00 0.00 ? 66  LYS A HG2  3  
ATOM 5459  H HG3  . LYS A 1 66  ? 12.469  12.405  2.196   1.00 0.00 ? 66  LYS A HG3  3  
ATOM 5460  H HD2  . LYS A 1 66  ? 15.235  12.285  1.099   1.00 0.00 ? 66  LYS A HD2  3  
ATOM 5461  H HD3  . LYS A 1 66  ? 14.213  13.613  0.546   1.00 0.00 ? 66  LYS A HD3  3  
ATOM 5462  H HE2  . LYS A 1 66  ? 14.034  14.542  2.663   1.00 0.00 ? 66  LYS A HE2  3  
ATOM 5463  H HE3  . LYS A 1 66  ? 14.289  12.998  3.476   1.00 0.00 ? 66  LYS A HE3  3  
ATOM 5464  H HZ1  . LYS A 1 66  ? 16.612  13.072  2.676   1.00 0.00 ? 66  LYS A HZ1  3  
ATOM 5465  H HZ2  . LYS A 1 66  ? 16.332  14.634  2.078   1.00 0.00 ? 66  LYS A HZ2  3  
ATOM 5466  H HZ3  . LYS A 1 66  ? 16.230  14.334  3.747   1.00 0.00 ? 66  LYS A HZ3  3  
ATOM 5467  N N    . VAL A 1 67  ? 11.149  9.180   3.945   1.00 0.00 ? 67  VAL A N    3  
ATOM 5468  C CA   . VAL A 1 67  ? 10.150  9.465   5.026   1.00 0.00 ? 67  VAL A CA   3  
ATOM 5469  C C    . VAL A 1 67  ? 10.299  10.900  5.555   1.00 0.00 ? 67  VAL A C    3  
ATOM 5470  O O    . VAL A 1 67  ? 11.381  11.456  5.593   1.00 0.00 ? 67  VAL A O    3  
ATOM 5471  C CB   . VAL A 1 67  ? 10.317  8.450   6.156   1.00 0.00 ? 67  VAL A CB   3  
ATOM 5472  C CG1  . VAL A 1 67  ? 9.296   8.743   7.258   1.00 0.00 ? 67  VAL A CG1  3  
ATOM 5473  C CG2  . VAL A 1 67  ? 10.060  7.043   5.614   1.00 0.00 ? 67  VAL A CG2  3  
ATOM 5474  H H    . VAL A 1 67  ? 11.601  8.318   3.923   1.00 0.00 ? 67  VAL A H    3  
ATOM 5475  H HA   . VAL A 1 67  ? 9.156   9.356   4.609   1.00 0.00 ? 67  VAL A HA   3  
ATOM 5476  H HB   . VAL A 1 67  ? 11.322  8.509   6.552   1.00 0.00 ? 67  VAL A HB   3  
ATOM 5477  H HG11 . VAL A 1 67  ? 8.447   9.256   6.832   1.00 0.00 ? 67  VAL A HG11 3  
ATOM 5478  H HG12 . VAL A 1 67  ? 8.969   7.815   7.703   1.00 0.00 ? 67  VAL A HG12 3  
ATOM 5479  H HG13 . VAL A 1 67  ? 9.751   9.365   8.012   1.00 0.00 ? 67  VAL A HG13 3  
ATOM 5480  H HG21 . VAL A 1 67  ? 10.367  6.988   4.583   1.00 0.00 ? 67  VAL A HG21 3  
ATOM 5481  H HG22 . VAL A 1 67  ? 10.617  6.329   6.195   1.00 0.00 ? 67  VAL A HG22 3  
ATOM 5482  H HG23 . VAL A 1 67  ? 9.008   6.820   5.687   1.00 0.00 ? 67  VAL A HG23 3  
ATOM 5483  N N    . GLY A 1 68  ? 9.199   11.503  5.908   1.00 0.00 ? 68  GLY A N    3  
ATOM 5484  C CA   . GLY A 1 68  ? 9.224   12.914  6.379   1.00 0.00 ? 68  GLY A CA   3  
ATOM 5485  C C    . GLY A 1 68  ? 8.897   13.837  5.191   1.00 0.00 ? 68  GLY A C    3  
ATOM 5486  O O    . GLY A 1 68  ? 9.108   15.033  5.252   1.00 0.00 ? 68  GLY A O    3  
ATOM 5487  H H    . GLY A 1 68  ? 8.342   11.035  5.827   1.00 0.00 ? 68  GLY A H    3  
ATOM 5488  H HA2  . GLY A 1 68  ? 8.488   13.049  7.159   1.00 0.00 ? 68  GLY A HA2  3  
ATOM 5489  H HA3  . GLY A 1 68  ? 10.205  13.154  6.758   1.00 0.00 ? 68  GLY A HA3  3  
ATOM 5490  N N    . GLU A 1 69  ? 8.383   13.285  4.108   1.00 0.00 ? 69  GLU A N    3  
ATOM 5491  C CA   . GLU A 1 69  ? 8.044   14.114  2.919   1.00 0.00 ? 69  GLU A CA   3  
ATOM 5492  C C    . GLU A 1 69  ? 6.770   13.564  2.267   1.00 0.00 ? 69  GLU A C    3  
ATOM 5493  O O    . GLU A 1 69  ? 6.299   12.492  2.606   1.00 0.00 ? 69  GLU A O    3  
ATOM 5494  C CB   . GLU A 1 69  ? 9.196   14.063  1.913   1.00 0.00 ? 69  GLU A CB   3  
ATOM 5495  C CG   . GLU A 1 69  ? 10.301  15.027  2.349   1.00 0.00 ? 69  GLU A CG   3  
ATOM 5496  C CD   . GLU A 1 69  ? 9.940   16.448  1.913   1.00 0.00 ? 69  GLU A CD   3  
ATOM 5497  O OE1  . GLU A 1 69  ? 8.769   16.785  1.969   1.00 0.00 ? 69  GLU A OE1  3  
ATOM 5498  O OE2  . GLU A 1 69  ? 10.842  17.175  1.529   1.00 0.00 ? 69  GLU A OE2  3  
ATOM 5499  H H    . GLU A 1 69  ? 8.221   12.322  4.077   1.00 0.00 ? 69  GLU A H    3  
ATOM 5500  H HA   . GLU A 1 69  ? 7.879   15.133  3.229   1.00 0.00 ? 69  GLU A HA   3  
ATOM 5501  H HB2  . GLU A 1 69  ? 9.590   13.058  1.869   1.00 0.00 ? 69  GLU A HB2  3  
ATOM 5502  H HB3  . GLU A 1 69  ? 8.834   14.351  0.937   1.00 0.00 ? 69  GLU A HB3  3  
ATOM 5503  H HG2  . GLU A 1 69  ? 10.404  14.994  3.424   1.00 0.00 ? 69  GLU A HG2  3  
ATOM 5504  H HG3  . GLU A 1 69  ? 11.233  14.737  1.889   1.00 0.00 ? 69  GLU A HG3  3  
ATOM 5505  N N    . GLU A 1 70  ? 6.204   14.302  1.347   1.00 0.00 ? 70  GLU A N    3  
ATOM 5506  C CA   . GLU A 1 70  ? 4.947   13.846  0.676   1.00 0.00 ? 70  GLU A CA   3  
ATOM 5507  C C    . GLU A 1 70  ? 5.168   13.583  -0.806  1.00 0.00 ? 70  GLU A C    3  
ATOM 5508  O O    . GLU A 1 70  ? 6.146   14.000  -1.395  1.00 0.00 ? 70  GLU A O    3  
ATOM 5509  C CB   . GLU A 1 70  ? 3.878   14.940  0.774   1.00 0.00 ? 70  GLU A CB   3  
ATOM 5510  C CG   . GLU A 1 70  ? 4.482   16.301  0.409   1.00 0.00 ? 70  GLU A CG   3  
ATOM 5511  C CD   . GLU A 1 70  ? 4.811   17.079  1.685   1.00 0.00 ? 70  GLU A CD   3  
ATOM 5512  O OE1  . GLU A 1 70  ? 3.892   17.609  2.287   1.00 0.00 ? 70  GLU A OE1  3  
ATOM 5513  O OE2  . GLU A 1 70  ? 5.978   17.133  2.039   1.00 0.00 ? 70  GLU A OE2  3  
ATOM 5514  H H    . GLU A 1 70  ? 6.595   15.165  1.110   1.00 0.00 ? 70  GLU A H    3  
ATOM 5515  H HA   . GLU A 1 70  ? 4.588   12.949  1.153   1.00 0.00 ? 70  GLU A HA   3  
ATOM 5516  H HB2  . GLU A 1 70  ? 3.078   14.716  0.085   1.00 0.00 ? 70  GLU A HB2  3  
ATOM 5517  H HB3  . GLU A 1 70  ? 3.488   14.975  1.767   1.00 0.00 ? 70  GLU A HB3  3  
ATOM 5518  H HG2  . GLU A 1 70  ? 5.385   16.150  -0.165  1.00 0.00 ? 70  GLU A HG2  3  
ATOM 5519  H HG3  . GLU A 1 70  ? 3.772   16.862  -0.180  1.00 0.00 ? 70  GLU A HG3  3  
ATOM 5520  N N    . PHE A 1 71  ? 4.205   12.946  -1.419  1.00 0.00 ? 71  PHE A N    3  
ATOM 5521  C CA   . PHE A 1 71  ? 4.264   12.700  -2.881  1.00 0.00 ? 71  PHE A CA   3  
ATOM 5522  C C    . PHE A 1 71  ? 3.023   13.348  -3.472  1.00 0.00 ? 71  PHE A C    3  
ATOM 5523  O O    . PHE A 1 71  ? 2.268   13.999  -2.777  1.00 0.00 ? 71  PHE A O    3  
ATOM 5524  C CB   . PHE A 1 71  ? 4.235   11.198  -3.249  1.00 0.00 ? 71  PHE A CB   3  
ATOM 5525  C CG   . PHE A 1 71  ? 4.842   10.308  -2.183  1.00 0.00 ? 71  PHE A CG   3  
ATOM 5526  C CD1  . PHE A 1 71  ? 5.983   10.698  -1.473  1.00 0.00 ? 71  PHE A CD1  3  
ATOM 5527  C CD2  . PHE A 1 71  ? 4.257   9.060   -1.933  1.00 0.00 ? 71  PHE A CD2  3  
ATOM 5528  C CE1  . PHE A 1 71  ? 6.530   9.836   -0.511  1.00 0.00 ? 71  PHE A CE1  3  
ATOM 5529  C CE2  . PHE A 1 71  ? 4.811   8.203   -0.981  1.00 0.00 ? 71  PHE A CE2  3  
ATOM 5530  C CZ   . PHE A 1 71  ? 5.941   8.589   -0.271  1.00 0.00 ? 71  PHE A CZ   3  
ATOM 5531  H H    . PHE A 1 71  ? 3.407   12.679  -0.917  1.00 0.00 ? 71  PHE A H    3  
ATOM 5532  H HA   . PHE A 1 71  ? 5.140   13.166  -3.296  1.00 0.00 ? 71  PHE A HA   3  
ATOM 5533  H HB2  . PHE A 1 71  ? 3.211   10.893  -3.403  1.00 0.00 ? 71  PHE A HB2  3  
ATOM 5534  H HB3  . PHE A 1 71  ? 4.780   11.058  -4.172  1.00 0.00 ? 71  PHE A HB3  3  
ATOM 5535  H HD1  . PHE A 1 71  ? 6.440   11.656  -1.662  1.00 0.00 ? 71  PHE A HD1  3  
ATOM 5536  H HD2  . PHE A 1 71  ? 3.377   8.758   -2.480  1.00 0.00 ? 71  PHE A HD2  3  
ATOM 5537  H HE1  . PHE A 1 71  ? 7.402   10.135  0.049   1.00 0.00 ? 71  PHE A HE1  3  
ATOM 5538  H HE2  . PHE A 1 71  ? 4.358   7.246   -0.783  1.00 0.00 ? 71  PHE A HE2  3  
ATOM 5539  H HZ   . PHE A 1 71  ? 6.368   7.916   0.450   1.00 0.00 ? 71  PHE A HZ   3  
ATOM 5540  N N    . GLU A 1 72  ? 2.794   13.155  -4.732  1.00 0.00 ? 72  GLU A N    3  
ATOM 5541  C CA   . GLU A 1 72  ? 1.578   13.734  -5.362  1.00 0.00 ? 72  GLU A CA   3  
ATOM 5542  C C    . GLU A 1 72  ? 0.869   12.650  -6.152  1.00 0.00 ? 72  GLU A C    3  
ATOM 5543  O O    . GLU A 1 72  ? 1.465   11.669  -6.555  1.00 0.00 ? 72  GLU A O    3  
ATOM 5544  C CB   . GLU A 1 72  ? 1.948   14.872  -6.301  1.00 0.00 ? 72  GLU A CB   3  
ATOM 5545  C CG   . GLU A 1 72  ? 2.820   15.878  -5.558  1.00 0.00 ? 72  GLU A CG   3  
ATOM 5546  C CD   . GLU A 1 72  ? 3.570   16.752  -6.564  1.00 0.00 ? 72  GLU A CD   3  
ATOM 5547  O OE1  . GLU A 1 72  ? 2.916   17.497  -7.275  1.00 0.00 ? 72  GLU A OE1  3  
ATOM 5548  O OE2  . GLU A 1 72  ? 4.786   16.662  -6.607  1.00 0.00 ? 72  GLU A OE2  3  
ATOM 5549  H H    . GLU A 1 72  ? 3.412   12.613  -5.258  1.00 0.00 ? 72  GLU A H    3  
ATOM 5550  H HA   . GLU A 1 72  ? 0.923   14.104  -4.592  1.00 0.00 ? 72  GLU A HA   3  
ATOM 5551  H HB2  . GLU A 1 72  ? 2.480   14.474  -7.143  1.00 0.00 ? 72  GLU A HB2  3  
ATOM 5552  H HB3  . GLU A 1 72  ? 1.049   15.363  -6.643  1.00 0.00 ? 72  GLU A HB3  3  
ATOM 5553  H HG2  . GLU A 1 72  ? 2.192   16.498  -4.936  1.00 0.00 ? 72  GLU A HG2  3  
ATOM 5554  H HG3  . GLU A 1 72  ? 3.529   15.350  -4.941  1.00 0.00 ? 72  GLU A HG3  3  
ATOM 5555  N N    . GLU A 1 73  ? -0.399  12.824  -6.372  1.00 0.00 ? 73  GLU A N    3  
ATOM 5556  C CA   . GLU A 1 73  ? -1.166  11.799  -7.141  1.00 0.00 ? 73  GLU A CA   3  
ATOM 5557  C C    . GLU A 1 73  ? -2.543  12.337  -7.526  1.00 0.00 ? 73  GLU A C    3  
ATOM 5558  O O    . GLU A 1 73  ? -2.880  13.471  -7.254  1.00 0.00 ? 73  GLU A O    3  
ATOM 5559  C CB   . GLU A 1 73  ? -1.328  10.540  -6.280  1.00 0.00 ? 73  GLU A CB   3  
ATOM 5560  C CG   . GLU A 1 73  ? -1.104  9.292   -7.139  1.00 0.00 ? 73  GLU A CG   3  
ATOM 5561  C CD   . GLU A 1 73  ? -1.965  8.145   -6.606  1.00 0.00 ? 73  GLU A CD   3  
ATOM 5562  O OE1  . GLU A 1 73  ? -1.760  7.754   -5.469  1.00 0.00 ? 73  GLU A OE1  3  
ATOM 5563  O OE2  . GLU A 1 73  ? -2.816  7.676   -7.345  1.00 0.00 ? 73  GLU A OE2  3  
ATOM 5564  H H    . GLU A 1 73  ? -0.842  13.629  -6.027  1.00 0.00 ? 73  GLU A H    3  
ATOM 5565  H HA   . GLU A 1 73  ? -0.622  11.551  -8.037  1.00 0.00 ? 73  GLU A HA   3  
ATOM 5566  H HB2  . GLU A 1 73  ? -0.602  10.558  -5.479  1.00 0.00 ? 73  GLU A HB2  3  
ATOM 5567  H HB3  . GLU A 1 73  ? -2.323  10.512  -5.861  1.00 0.00 ? 73  GLU A HB3  3  
ATOM 5568  H HG2  . GLU A 1 73  ? -1.378  9.504   -8.162  1.00 0.00 ? 73  GLU A HG2  3  
ATOM 5569  H HG3  . GLU A 1 73  ? -0.064  9.007   -7.096  1.00 0.00 ? 73  GLU A HG3  3  
ATOM 5570  N N    . GLN A 1 74  ? -3.335  11.515  -8.161  1.00 0.00 ? 74  GLN A N    3  
ATOM 5571  C CA   . GLN A 1 74  ? -4.704  11.938  -8.578  1.00 0.00 ? 74  GLN A CA   3  
ATOM 5572  C C    . GLN A 1 74  ? -5.695  10.816  -8.257  1.00 0.00 ? 74  GLN A C    3  
ATOM 5573  O O    . GLN A 1 74  ? -5.382  9.648   -8.395  1.00 0.00 ? 74  GLN A O    3  
ATOM 5574  C CB   . GLN A 1 74  ? -4.725  12.210  -10.082 1.00 0.00 ? 74  GLN A CB   3  
ATOM 5575  C CG   . GLN A 1 74  ? -3.830  13.409  -10.400 1.00 0.00 ? 74  GLN A CG   3  
ATOM 5576  C CD   . GLN A 1 74  ? -3.747  13.595  -11.916 1.00 0.00 ? 74  GLN A CD   3  
ATOM 5577  O OE1  . GLN A 1 74  ? -4.695  13.325  -12.626 1.00 0.00 ? 74  GLN A OE1  3  
ATOM 5578  N NE2  . GLN A 1 74  ? -2.644  14.050  -12.445 1.00 0.00 ? 74  GLN A NE2  3  
ATOM 5579  H H    . GLN A 1 74  ? -3.022  10.609  -8.364  1.00 0.00 ? 74  GLN A H    3  
ATOM 5580  H HA   . GLN A 1 74  ? -4.985  12.834  -8.044  1.00 0.00 ? 74  GLN A HA   3  
ATOM 5581  H HB2  . GLN A 1 74  ? -4.364  11.338  -10.609 1.00 0.00 ? 74  GLN A HB2  3  
ATOM 5582  H HB3  . GLN A 1 74  ? -5.737  12.425  -10.393 1.00 0.00 ? 74  GLN A HB3  3  
ATOM 5583  H HG2  . GLN A 1 74  ? -4.246  14.298  -9.949  1.00 0.00 ? 74  GLN A HG2  3  
ATOM 5584  H HG3  . GLN A 1 74  ? -2.840  13.234  -10.006 1.00 0.00 ? 74  GLN A HG3  3  
ATOM 5585  H HE21 . GLN A 1 74  ? -1.879  14.268  -11.873 1.00 0.00 ? 74  GLN A HE21 3  
ATOM 5586  H HE22 . GLN A 1 74  ? -2.580  14.173  -13.415 1.00 0.00 ? 74  GLN A HE22 3  
ATOM 5587  N N    . THR A 1 75  ? -6.883  11.161  -7.827  1.00 0.00 ? 75  THR A N    3  
ATOM 5588  C CA   . THR A 1 75  ? -7.893  10.113  -7.492  1.00 0.00 ? 75  THR A CA   3  
ATOM 5589  C C    . THR A 1 75  ? -8.342  9.414   -8.774  1.00 0.00 ? 75  THR A C    3  
ATOM 5590  O O    . THR A 1 75  ? -7.726  9.556   -9.814  1.00 0.00 ? 75  THR A O    3  
ATOM 5591  C CB   . THR A 1 75  ? -9.105  10.755  -6.816  1.00 0.00 ? 75  THR A CB   3  
ATOM 5592  O OG1  . THR A 1 75  ? -9.764  11.611  -7.738  1.00 0.00 ? 75  THR A OG1  3  
ATOM 5593  C CG2  . THR A 1 75  ? -8.645  11.557  -5.603  1.00 0.00 ? 75  THR A CG2  3  
ATOM 5594  H H    . THR A 1 75  ? -7.108  12.109  -7.724  1.00 0.00 ? 75  THR A H    3  
ATOM 5595  H HA   . THR A 1 75  ? -7.449  9.391   -6.824  1.00 0.00 ? 75  THR A HA   3  
ATOM 5596  H HB   . THR A 1 75  ? -9.786  9.984   -6.491  1.00 0.00 ? 75  THR A HB   3  
ATOM 5597  H HG1  . THR A 1 75  ? -10.462 11.108  -8.163  1.00 0.00 ? 75  THR A HG1  3  
ATOM 5598  H HG21 . THR A 1 75  ? -7.764  12.123  -5.859  1.00 0.00 ? 75  THR A HG21 3  
ATOM 5599  H HG22 . THR A 1 75  ? -9.432  12.231  -5.301  1.00 0.00 ? 75  THR A HG22 3  
ATOM 5600  H HG23 . THR A 1 75  ? -8.417  10.881  -4.793  1.00 0.00 ? 75  THR A HG23 3  
ATOM 5601  N N    . VAL A 1 76  ? -9.412  8.663   -8.707  1.00 0.00 ? 76  VAL A N    3  
ATOM 5602  C CA   . VAL A 1 76  ? -9.904  7.955   -9.918  1.00 0.00 ? 76  VAL A CA   3  
ATOM 5603  C C    . VAL A 1 76  ? -10.894 8.850   -10.667 1.00 0.00 ? 76  VAL A C    3  
ATOM 5604  O O    . VAL A 1 76  ? -10.900 8.899   -11.883 1.00 0.00 ? 76  VAL A O    3  
ATOM 5605  C CB   . VAL A 1 76  ? -10.595 6.656   -9.512  1.00 0.00 ? 76  VAL A CB   3  
ATOM 5606  C CG1  . VAL A 1 76  ? -10.951 5.852   -10.764 1.00 0.00 ? 76  VAL A CG1  3  
ATOM 5607  C CG2  . VAL A 1 76  ? -9.657  5.830   -8.628  1.00 0.00 ? 76  VAL A CG2  3  
ATOM 5608  H H    . VAL A 1 76  ? -9.890  8.566   -7.858  1.00 0.00 ? 76  VAL A H    3  
ATOM 5609  H HA   . VAL A 1 76  ? -9.071  7.732   -10.555 1.00 0.00 ? 76  VAL A HA   3  
ATOM 5610  H HB   . VAL A 1 76  ? -11.493 6.888   -8.968  1.00 0.00 ? 76  VAL A HB   3  
ATOM 5611  H HG11 . VAL A 1 76  ? -11.311 6.522   -11.531 1.00 0.00 ? 76  VAL A HG11 3  
ATOM 5612  H HG12 . VAL A 1 76  ? -10.073 5.335   -11.122 1.00 0.00 ? 76  VAL A HG12 3  
ATOM 5613  H HG13 . VAL A 1 76  ? -11.719 5.133   -10.524 1.00 0.00 ? 76  VAL A HG13 3  
ATOM 5614  H HG21 . VAL A 1 76  ? -9.226  6.466   -7.868  1.00 0.00 ? 76  VAL A HG21 3  
ATOM 5615  H HG22 . VAL A 1 76  ? -10.214 5.034   -8.157  1.00 0.00 ? 76  VAL A HG22 3  
ATOM 5616  H HG23 . VAL A 1 76  ? -8.869  5.409   -9.234  1.00 0.00 ? 76  VAL A HG23 3  
ATOM 5617  N N    . ASP A 1 77  ? -11.730 9.557   -9.949  1.00 0.00 ? 77  ASP A N    3  
ATOM 5618  C CA   . ASP A 1 77  ? -12.724 10.453  -10.612 1.00 0.00 ? 77  ASP A CA   3  
ATOM 5619  C C    . ASP A 1 77  ? -13.334 11.397  -9.574  1.00 0.00 ? 77  ASP A C    3  
ATOM 5620  O O    . ASP A 1 77  ? -14.312 11.072  -8.927  1.00 0.00 ? 77  ASP A O    3  
ATOM 5621  C CB   . ASP A 1 77  ? -13.831 9.607   -11.245 1.00 0.00 ? 77  ASP A CB   3  
ATOM 5622  C CG   . ASP A 1 77  ? -13.484 9.322   -12.707 1.00 0.00 ? 77  ASP A CG   3  
ATOM 5623  O OD1  . ASP A 1 77  ? -13.139 10.260  -13.407 1.00 0.00 ? 77  ASP A OD1  3  
ATOM 5624  O OD2  . ASP A 1 77  ? -13.567 8.170   -13.102 1.00 0.00 ? 77  ASP A OD2  3  
ATOM 5625  H H    . ASP A 1 77  ? -11.703 9.498   -8.971  1.00 0.00 ? 77  ASP A H    3  
ATOM 5626  H HA   . ASP A 1 77  ? -12.230 11.032  -11.379 1.00 0.00 ? 77  ASP A HA   3  
ATOM 5627  H HB2  . ASP A 1 77  ? -13.924 8.675   -10.707 1.00 0.00 ? 77  ASP A HB2  3  
ATOM 5628  H HB3  . ASP A 1 77  ? -14.766 10.145  -11.198 1.00 0.00 ? 77  ASP A HB3  3  
ATOM 5629  N N    . GLY A 1 78  ? -12.763 12.564  -9.413  1.00 0.00 ? 78  GLY A N    3  
ATOM 5630  C CA   . GLY A 1 78  ? -13.302 13.540  -8.420  1.00 0.00 ? 78  GLY A CA   3  
ATOM 5631  C C    . GLY A 1 78  ? -12.304 14.684  -8.237  1.00 0.00 ? 78  GLY A C    3  
ATOM 5632  O O    . GLY A 1 78  ? -12.282 15.629  -9.003  1.00 0.00 ? 78  GLY A O    3  
ATOM 5633  H H    . GLY A 1 78  ? -11.977 12.800  -9.949  1.00 0.00 ? 78  GLY A H    3  
ATOM 5634  H HA2  . GLY A 1 78  ? -14.243 13.934  -8.778  1.00 0.00 ? 78  GLY A HA2  3  
ATOM 5635  H HA3  . GLY A 1 78  ? -13.455 13.044  -7.474  1.00 0.00 ? 78  GLY A HA3  3  
ATOM 5636  N N    . ARG A 1 79  ? -11.475 14.601  -7.227  1.00 0.00 ? 79  ARG A N    3  
ATOM 5637  C CA   . ARG A 1 79  ? -10.469 15.677  -6.985  1.00 0.00 ? 79  ARG A CA   3  
ATOM 5638  C C    . ARG A 1 79  ? -9.063  15.051  -6.987  1.00 0.00 ? 79  ARG A C    3  
ATOM 5639  O O    . ARG A 1 79  ? -8.942  13.848  -7.078  1.00 0.00 ? 79  ARG A O    3  
ATOM 5640  C CB   . ARG A 1 79  ? -10.751 16.332  -5.624  1.00 0.00 ? 79  ARG A CB   3  
ATOM 5641  C CG   . ARG A 1 79  ? -11.168 17.794  -5.824  1.00 0.00 ? 79  ARG A CG   3  
ATOM 5642  C CD   . ARG A 1 79  ? -11.331 18.479  -4.462  1.00 0.00 ? 79  ARG A CD   3  
ATOM 5643  N NE   . ARG A 1 79  ? -10.617 19.786  -4.476  1.00 0.00 ? 79  ARG A NE   3  
ATOM 5644  C CZ   . ARG A 1 79  ? -11.248 20.878  -4.139  1.00 0.00 ? 79  ARG A CZ   3  
ATOM 5645  N NH1  . ARG A 1 79  ? -11.975 20.904  -3.055  1.00 0.00 ? 79  ARG A NH1  3  
ATOM 5646  N NH2  . ARG A 1 79  ? -11.152 21.944  -4.886  1.00 0.00 ? 79  ARG A NH2  3  
ATOM 5647  H H    . ARG A 1 79  ? -11.513 13.826  -6.626  1.00 0.00 ? 79  ARG A H    3  
ATOM 5648  H HA   . ARG A 1 79  ? -10.536 16.416  -7.770  1.00 0.00 ? 79  ARG A HA   3  
ATOM 5649  H HB2  . ARG A 1 79  ? -11.549 15.798  -5.129  1.00 0.00 ? 79  ARG A HB2  3  
ATOM 5650  H HB3  . ARG A 1 79  ? -9.863  16.296  -5.011  1.00 0.00 ? 79  ARG A HB3  3  
ATOM 5651  H HG2  . ARG A 1 79  ? -10.411 18.309  -6.398  1.00 0.00 ? 79  ARG A HG2  3  
ATOM 5652  H HG3  . ARG A 1 79  ? -12.107 17.830  -6.356  1.00 0.00 ? 79  ARG A HG3  3  
ATOM 5653  H HD2  . ARG A 1 79  ? -12.380 18.645  -4.267  1.00 0.00 ? 79  ARG A HD2  3  
ATOM 5654  H HD3  . ARG A 1 79  ? -10.917 17.851  -3.686  1.00 0.00 ? 79  ARG A HD3  3  
ATOM 5655  H HE   . ARG A 1 79  ? -9.673  19.827  -4.737  1.00 0.00 ? 79  ARG A HE   3  
ATOM 5656  H HH11 . ARG A 1 79  ? -12.048 20.087  -2.483  1.00 0.00 ? 79  ARG A HH11 3  
ATOM 5657  H HH12 . ARG A 1 79  ? -12.458 21.740  -2.798  1.00 0.00 ? 79  ARG A HH12 3  
ATOM 5658  H HH21 . ARG A 1 79  ? -10.595 21.924  -5.717  1.00 0.00 ? 79  ARG A HH21 3  
ATOM 5659  H HH22 . ARG A 1 79  ? -11.636 22.780  -4.629  1.00 0.00 ? 79  ARG A HH22 3  
ATOM 5660  N N    . PRO A 1 80  ? -8.031  15.868  -6.881  1.00 0.00 ? 80  PRO A N    3  
ATOM 5661  C CA   . PRO A 1 80  ? -6.649  15.362  -6.867  1.00 0.00 ? 80  PRO A CA   3  
ATOM 5662  C C    . PRO A 1 80  ? -6.335  14.750  -5.500  1.00 0.00 ? 80  PRO A C    3  
ATOM 5663  O O    . PRO A 1 80  ? -7.194  14.667  -4.642  1.00 0.00 ? 80  PRO A O    3  
ATOM 5664  C CB   . PRO A 1 80  ? -5.799  16.605  -7.135  1.00 0.00 ? 80  PRO A CB   3  
ATOM 5665  C CG   . PRO A 1 80  ? -6.666  17.822  -6.736  1.00 0.00 ? 80  PRO A CG   3  
ATOM 5666  C CD   . PRO A 1 80  ? -8.130  17.345  -6.762  1.00 0.00 ? 80  PRO A CD   3  
ATOM 5667  H HA   . PRO A 1 80  ? -6.500  14.638  -7.651  1.00 0.00 ? 80  PRO A HA   3  
ATOM 5668  H HB2  . PRO A 1 80  ? -4.900  16.571  -6.536  1.00 0.00 ? 80  PRO A HB2  3  
ATOM 5669  H HB3  . PRO A 1 80  ? -5.548  16.665  -8.182  1.00 0.00 ? 80  PRO A HB3  3  
ATOM 5670  H HG2  . PRO A 1 80  ? -6.399  18.155  -5.743  1.00 0.00 ? 80  PRO A HG2  3  
ATOM 5671  H HG3  . PRO A 1 80  ? -6.530  18.622  -7.446  1.00 0.00 ? 80  PRO A HG3  3  
ATOM 5672  H HD2  . PRO A 1 80  ? -8.630  17.622  -5.845  1.00 0.00 ? 80  PRO A HD2  3  
ATOM 5673  H HD3  . PRO A 1 80  ? -8.647  17.754  -7.616  1.00 0.00 ? 80  PRO A HD3  3  
ATOM 5674  N N    . CYS A 1 81  ? -5.117  14.317  -5.291  1.00 0.00 ? 81  CYS A N    3  
ATOM 5675  C CA   . CYS A 1 81  ? -4.760  13.706  -3.976  1.00 0.00 ? 81  CYS A CA   3  
ATOM 5676  C C    . CYS A 1 81  ? -3.254  13.481  -3.881  1.00 0.00 ? 81  CYS A C    3  
ATOM 5677  O O    . CYS A 1 81  ? -2.610  13.056  -4.818  1.00 0.00 ? 81  CYS A O    3  
ATOM 5678  C CB   . CYS A 1 81  ? -5.487  12.364  -3.817  1.00 0.00 ? 81  CYS A CB   3  
ATOM 5679  S SG   . CYS A 1 81  ? -5.070  11.264  -5.193  1.00 0.00 ? 81  CYS A SG   3  
ATOM 5680  H H    . CYS A 1 81  ? -4.444  14.393  -5.995  1.00 0.00 ? 81  CYS A H    3  
ATOM 5681  H HA   . CYS A 1 81  ? -5.062  14.373  -3.180  1.00 0.00 ? 81  CYS A HA   3  
ATOM 5682  H HB2  . CYS A 1 81  ? -5.188  11.902  -2.889  1.00 0.00 ? 81  CYS A HB2  3  
ATOM 5683  H HB3  . CYS A 1 81  ? -6.554  12.533  -3.805  1.00 0.00 ? 81  CYS A HB3  3  
ATOM 5684  H HG   . CYS A 1 81  ? -5.780  10.625  -5.288  1.00 0.00 ? 81  CYS A HG   3  
ATOM 5685  N N    . LYS A 1 82  ? -2.708  13.752  -2.733  1.00 0.00 ? 82  LYS A N    3  
ATOM 5686  C CA   . LYS A 1 82  ? -1.254  13.559  -2.506  1.00 0.00 ? 82  LYS A CA   3  
ATOM 5687  C C    . LYS A 1 82  ? -1.070  12.533  -1.393  1.00 0.00 ? 82  LYS A C    3  
ATOM 5688  O O    . LYS A 1 82  ? -2.017  11.911  -0.947  1.00 0.00 ? 82  LYS A O    3  
ATOM 5689  C CB   . LYS A 1 82  ? -0.632  14.886  -2.084  1.00 0.00 ? 82  LYS A CB   3  
ATOM 5690  C CG   . LYS A 1 82  ? -1.361  15.445  -0.848  1.00 0.00 ? 82  LYS A CG   3  
ATOM 5691  C CD   . LYS A 1 82  ? -0.822  16.843  -0.491  1.00 0.00 ? 82  LYS A CD   3  
ATOM 5692  C CE   . LYS A 1 82  ? 0.712   16.856  -0.525  1.00 0.00 ? 82  LYS A CE   3  
ATOM 5693  N NZ   . LYS A 1 82  ? 1.233   17.771  0.531   1.00 0.00 ? 82  LYS A NZ   3  
ATOM 5694  H H    . LYS A 1 82  ? -3.269  14.077  -2.003  1.00 0.00 ? 82  LYS A H    3  
ATOM 5695  H HA   . LYS A 1 82  ? -0.770  13.207  -3.408  1.00 0.00 ? 82  LYS A HA   3  
ATOM 5696  H HB2  . LYS A 1 82  ? 0.408   14.730  -1.843  1.00 0.00 ? 82  LYS A HB2  3  
ATOM 5697  H HB3  . LYS A 1 82  ? -0.710  15.592  -2.895  1.00 0.00 ? 82  LYS A HB3  3  
ATOM 5698  H HG2  . LYS A 1 82  ? -2.415  15.519  -1.060  1.00 0.00 ? 82  LYS A HG2  3  
ATOM 5699  H HG3  . LYS A 1 82  ? -1.212  14.776  -0.011  1.00 0.00 ? 82  LYS A HG3  3  
ATOM 5700  H HD2  . LYS A 1 82  ? -1.200  17.562  -1.203  1.00 0.00 ? 82  LYS A HD2  3  
ATOM 5701  H HD3  . LYS A 1 82  ? -1.158  17.112  0.499   1.00 0.00 ? 82  LYS A HD3  3  
ATOM 5702  H HE2  . LYS A 1 82  ? 1.079   15.854  -0.355  1.00 0.00 ? 82  LYS A HE2  3  
ATOM 5703  H HE3  . LYS A 1 82  ? 1.042   17.196  -1.498  1.00 0.00 ? 82  LYS A HE3  3  
ATOM 5704  H HZ1  . LYS A 1 82  ? 0.578   17.776  1.340   1.00 0.00 ? 82  LYS A HZ1  3  
ATOM 5705  H HZ2  . LYS A 1 82  ? 2.167   17.442  0.845   1.00 0.00 ? 82  LYS A HZ2  3  
ATOM 5706  H HZ3  . LYS A 1 82  ? 1.318   18.732  0.147   1.00 0.00 ? 82  LYS A HZ3  3  
ATOM 5707  N N    . SER A 1 83  ? 0.138   12.352  -0.948  1.00 0.00 ? 83  SER A N    3  
ATOM 5708  C CA   . SER A 1 83  ? 0.397   11.361  0.136   1.00 0.00 ? 83  SER A CA   3  
ATOM 5709  C C    . SER A 1 83  ? 1.503   11.854  1.059   1.00 0.00 ? 83  SER A C    3  
ATOM 5710  O O    . SER A 1 83  ? 2.073   12.902  0.851   1.00 0.00 ? 83  SER A O    3  
ATOM 5711  C CB   . SER A 1 83  ? 0.834   10.044  -0.494  1.00 0.00 ? 83  SER A CB   3  
ATOM 5712  O OG   . SER A 1 83  ? 1.905   10.301  -1.396  1.00 0.00 ? 83  SER A OG   3  
ATOM 5713  H H    . SER A 1 83  ? 0.874   12.863  -1.337  1.00 0.00 ? 83  SER A H    3  
ATOM 5714  H HA   . SER A 1 83  ? -0.495  11.211  0.708   1.00 0.00 ? 83  SER A HA   3  
ATOM 5715  H HB2  . SER A 1 83  ? 1.170   9.367   0.274   1.00 0.00 ? 83  SER A HB2  3  
ATOM 5716  H HB3  . SER A 1 83  ? 0.000   9.603   -1.023  1.00 0.00 ? 83  SER A HB3  3  
ATOM 5717  H HG   . SER A 1 83  ? 2.545   10.873  -0.954  1.00 0.00 ? 83  SER A HG   3  
ATOM 5718  N N    . LEU A 1 84  ? 1.812   11.089  2.073   1.00 0.00 ? 84  LEU A N    3  
ATOM 5719  C CA   . LEU A 1 84  ? 2.902   11.500  3.011   1.00 0.00 ? 84  LEU A CA   3  
ATOM 5720  C C    . LEU A 1 84  ? 3.272   10.340  3.930   1.00 0.00 ? 84  LEU A C    3  
ATOM 5721  O O    . LEU A 1 84  ? 2.461   9.863   4.695   1.00 0.00 ? 84  LEU A O    3  
ATOM 5722  C CB   . LEU A 1 84  ? 2.447   12.697  3.840   1.00 0.00 ? 84  LEU A CB   3  
ATOM 5723  C CG   . LEU A 1 84  ? 3.600   13.692  3.955   1.00 0.00 ? 84  LEU A CG   3  
ATOM 5724  C CD1  . LEU A 1 84  ? 3.040   15.091  4.186   1.00 0.00 ? 84  LEU A CD1  3  
ATOM 5725  C CD2  . LEU A 1 84  ? 4.504   13.297  5.121   1.00 0.00 ? 84  LEU A CD2  3  
ATOM 5726  H H    . LEU A 1 84  ? 1.329   10.239  2.209   1.00 0.00 ? 84  LEU A H    3  
ATOM 5727  H HA   . LEU A 1 84  ? 3.769   11.774  2.436   1.00 0.00 ? 84  LEU A HA   3  
ATOM 5728  H HB2  . LEU A 1 84  ? 1.608   13.171  3.352   1.00 0.00 ? 84  LEU A HB2  3  
ATOM 5729  H HB3  . LEU A 1 84  ? 2.153   12.369  4.825   1.00 0.00 ? 84  LEU A HB3  3  
ATOM 5730  H HG   . LEU A 1 84  ? 4.172   13.680  3.040   1.00 0.00 ? 84  LEU A HG   3  
ATOM 5731  H HD11 . LEU A 1 84  ? 2.130   15.210  3.616   1.00 0.00 ? 84  LEU A HD11 3  
ATOM 5732  H HD12 . LEU A 1 84  ? 2.830   15.226  5.234   1.00 0.00 ? 84  LEU A HD12 3  
ATOM 5733  H HD13 . LEU A 1 84  ? 3.765   15.824  3.863   1.00 0.00 ? 84  LEU A HD13 3  
ATOM 5734  H HD21 . LEU A 1 84  ? 4.553   12.221  5.188   1.00 0.00 ? 84  LEU A HD21 3  
ATOM 5735  H HD22 . LEU A 1 84  ? 5.496   13.693  4.954   1.00 0.00 ? 84  LEU A HD22 3  
ATOM 5736  H HD23 . LEU A 1 84  ? 4.104   13.699  6.038   1.00 0.00 ? 84  LEU A HD23 3  
ATOM 5737  N N    . VAL A 1 85  ? 4.499   9.886   3.846   1.00 0.00 ? 85  VAL A N    3  
ATOM 5738  C CA   . VAL A 1 85  ? 4.945   8.739   4.692   1.00 0.00 ? 85  VAL A CA   3  
ATOM 5739  C C    . VAL A 1 85  ? 5.534   9.233   6.024   1.00 0.00 ? 85  VAL A C    3  
ATOM 5740  O O    . VAL A 1 85  ? 6.170   10.264  6.102   1.00 0.00 ? 85  VAL A O    3  
ATOM 5741  C CB   . VAL A 1 85  ? 5.996   7.928   3.908   1.00 0.00 ? 85  VAL A CB   3  
ATOM 5742  C CG1  . VAL A 1 85  ? 6.671   6.878   4.810   1.00 0.00 ? 85  VAL A CG1  3  
ATOM 5743  C CG2  . VAL A 1 85  ? 5.306   7.216   2.744   1.00 0.00 ? 85  VAL A CG2  3  
ATOM 5744  H H    . VAL A 1 85  ? 5.127   10.297  3.213   1.00 0.00 ? 85  VAL A H    3  
ATOM 5745  H HA   . VAL A 1 85  ? 4.101   8.107   4.897   1.00 0.00 ? 85  VAL A HA   3  
ATOM 5746  H HB   . VAL A 1 85  ? 6.744   8.600   3.518   1.00 0.00 ? 85  VAL A HB   3  
ATOM 5747  H HG11 . VAL A 1 85  ? 7.116   7.369   5.664   1.00 0.00 ? 85  VAL A HG11 3  
ATOM 5748  H HG12 . VAL A 1 85  ? 5.934   6.166   5.150   1.00 0.00 ? 85  VAL A HG12 3  
ATOM 5749  H HG13 . VAL A 1 85  ? 7.439   6.363   4.253   1.00 0.00 ? 85  VAL A HG13 3  
ATOM 5750  H HG21 . VAL A 1 85  ? 4.779   7.940   2.140   1.00 0.00 ? 85  VAL A HG21 3  
ATOM 5751  H HG22 . VAL A 1 85  ? 6.046   6.713   2.140   1.00 0.00 ? 85  VAL A HG22 3  
ATOM 5752  H HG23 . VAL A 1 85  ? 4.604   6.492   3.131   1.00 0.00 ? 85  VAL A HG23 3  
ATOM 5753  N N    . LYS A 1 86  ? 5.333   8.459   7.059   1.00 0.00 ? 86  LYS A N    3  
ATOM 5754  C CA   . LYS A 1 86  ? 5.872   8.797   8.400   1.00 0.00 ? 86  LYS A CA   3  
ATOM 5755  C C    . LYS A 1 86  ? 6.166   7.492   9.146   1.00 0.00 ? 86  LYS A C    3  
ATOM 5756  O O    . LYS A 1 86  ? 6.288   6.440   8.546   1.00 0.00 ? 86  LYS A O    3  
ATOM 5757  C CB   . LYS A 1 86  ? 4.841   9.624   9.172   1.00 0.00 ? 86  LYS A CB   3  
ATOM 5758  C CG   . LYS A 1 86  ? 5.534   10.762  9.931   1.00 0.00 ? 86  LYS A CG   3  
ATOM 5759  C CD   . LYS A 1 86  ? 6.251   11.701  8.949   1.00 0.00 ? 86  LYS A CD   3  
ATOM 5760  C CE   . LYS A 1 86  ? 7.771   11.500  9.039   1.00 0.00 ? 86  LYS A CE   3  
ATOM 5761  N NZ   . LYS A 1 86  ? 8.404   12.739  9.574   1.00 0.00 ? 86  LYS A NZ   3  
ATOM 5762  H H    . LYS A 1 86  ? 4.832   7.632   6.948   1.00 0.00 ? 86  LYS A H    3  
ATOM 5763  H HA   . LYS A 1 86  ? 6.783   9.358   8.295   1.00 0.00 ? 86  LYS A HA   3  
ATOM 5764  H HB2  . LYS A 1 86  ? 4.132   10.040  8.478   1.00 0.00 ? 86  LYS A HB2  3  
ATOM 5765  H HB3  . LYS A 1 86  ? 4.323   8.990   9.876   1.00 0.00 ? 86  LYS A HB3  3  
ATOM 5766  H HG2  . LYS A 1 86  ? 4.791   11.319  10.477  1.00 0.00 ? 86  LYS A HG2  3  
ATOM 5767  H HG3  . LYS A 1 86  ? 6.252   10.351  10.624  1.00 0.00 ? 86  LYS A HG3  3  
ATOM 5768  H HD2  . LYS A 1 86  ? 5.920   11.490  7.943   1.00 0.00 ? 86  LYS A HD2  3  
ATOM 5769  H HD3  . LYS A 1 86  ? 6.012   12.724  9.196   1.00 0.00 ? 86  LYS A HD3  3  
ATOM 5770  H HE2  . LYS A 1 86  ? 7.993   10.671  9.696   1.00 0.00 ? 86  LYS A HE2  3  
ATOM 5771  H HE3  . LYS A 1 86  ? 8.166   11.292  8.055   1.00 0.00 ? 86  LYS A HE3  3  
ATOM 5772  H HZ1  . LYS A 1 86  ? 7.973   13.571  9.121   1.00 0.00 ? 86  LYS A HZ1  3  
ATOM 5773  H HZ2  . LYS A 1 86  ? 8.256   12.788  10.601  1.00 0.00 ? 86  LYS A HZ2  3  
ATOM 5774  H HZ3  . LYS A 1 86  ? 9.423   12.723  9.373   1.00 0.00 ? 86  LYS A HZ3  3  
ATOM 5775  N N    . TRP A 1 87  ? 6.304   7.559   10.439  1.00 0.00 ? 87  TRP A N    3  
ATOM 5776  C CA   . TRP A 1 87  ? 6.617   6.336   11.236  1.00 0.00 ? 87  TRP A CA   3  
ATOM 5777  C C    . TRP A 1 87  ? 5.551   6.062   12.288  1.00 0.00 ? 87  TRP A C    3  
ATOM 5778  O O    . TRP A 1 87  ? 4.556   6.751   12.403  1.00 0.00 ? 87  TRP A O    3  
ATOM 5779  C CB   . TRP A 1 87  ? 7.944   6.541   11.936  1.00 0.00 ? 87  TRP A CB   3  
ATOM 5780  C CG   . TRP A 1 87  ? 8.977   6.644   10.898  1.00 0.00 ? 87  TRP A CG   3  
ATOM 5781  C CD1  . TRP A 1 87  ? 9.501   7.793   10.454  1.00 0.00 ? 87  TRP A CD1  3  
ATOM 5782  C CD2  . TRP A 1 87  ? 9.586   5.577   10.132  1.00 0.00 ? 87  TRP A CD2  3  
ATOM 5783  N NE1  . TRP A 1 87  ? 10.434  7.502   9.489   1.00 0.00 ? 87  TRP A NE1  3  
ATOM 5784  C CE2  . TRP A 1 87  ? 10.516  6.148   9.246   1.00 0.00 ? 87  TRP A CE2  3  
ATOM 5785  C CE3  . TRP A 1 87  ? 9.431   4.181   10.130  1.00 0.00 ? 87  TRP A CE3  3  
ATOM 5786  C CZ2  . TRP A 1 87  ? 11.269  5.368   8.380   1.00 0.00 ? 87  TRP A CZ2  3  
ATOM 5787  C CZ3  . TRP A 1 87  ? 10.185  3.388   9.254   1.00 0.00 ? 87  TRP A CZ3  3  
ATOM 5788  C CH2  . TRP A 1 87  ? 11.104  3.983   8.380   1.00 0.00 ? 87  TRP A CH2  3  
ATOM 5789  H H    . TRP A 1 87  ? 6.226   8.422   10.882  1.00 0.00 ? 87  TRP A H    3  
ATOM 5790  H HA   . TRP A 1 87  ? 6.703   5.479   10.579  1.00 0.00 ? 87  TRP A HA   3  
ATOM 5791  H HB2  . TRP A 1 87  ? 7.917   7.448   12.520  1.00 0.00 ? 87  TRP A HB2  3  
ATOM 5792  H HB3  . TRP A 1 87  ? 8.161   5.701   12.571  1.00 0.00 ? 87  TRP A HB3  3  
ATOM 5793  H HD1  . TRP A 1 87  ? 9.242   8.777   10.808  1.00 0.00 ? 87  TRP A HD1  3  
ATOM 5794  H HE1  . TRP A 1 87  ? 10.968  8.159   9.016   1.00 0.00 ? 87  TRP A HE1  3  
ATOM 5795  H HE3  . TRP A 1 87  ? 8.721   3.718   10.801  1.00 0.00 ? 87  TRP A HE3  3  
ATOM 5796  H HZ2  . TRP A 1 87  ? 11.969  5.831   7.711   1.00 0.00 ? 87  TRP A HZ2  3  
ATOM 5797  H HZ3  . TRP A 1 87  ? 10.058  2.317   9.254   1.00 0.00 ? 87  TRP A HZ3  3  
ATOM 5798  H HH2  . TRP A 1 87  ? 11.679  3.373   7.702   1.00 0.00 ? 87  TRP A HH2  3  
ATOM 5799  N N    . GLU A 1 88  ? 5.783   5.041   13.055  1.00 0.00 ? 88  GLU A N    3  
ATOM 5800  C CA   . GLU A 1 88  ? 4.846   4.641   14.132  1.00 0.00 ? 88  GLU A CA   3  
ATOM 5801  C C    . GLU A 1 88  ? 5.685   4.353   15.381  1.00 0.00 ? 88  GLU A C    3  
ATOM 5802  O O    . GLU A 1 88  ? 5.430   4.860   16.457  1.00 0.00 ? 88  GLU A O    3  
ATOM 5803  C CB   . GLU A 1 88  ? 4.104   3.376   13.653  1.00 0.00 ? 88  GLU A CB   3  
ATOM 5804  C CG   . GLU A 1 88  ? 3.514   2.573   14.823  1.00 0.00 ? 88  GLU A CG   3  
ATOM 5805  C CD   . GLU A 1 88  ? 2.492   3.429   15.572  1.00 0.00 ? 88  GLU A CD   3  
ATOM 5806  O OE1  . GLU A 1 88  ? 2.910   4.281   16.339  1.00 0.00 ? 88  GLU A OE1  3  
ATOM 5807  O OE2  . GLU A 1 88  ? 1.308   3.219   15.367  1.00 0.00 ? 88  GLU A OE2  3  
ATOM 5808  H H    . GLU A 1 88  ? 6.599   4.520   12.917  1.00 0.00 ? 88  GLU A H    3  
ATOM 5809  H HA   . GLU A 1 88  ? 4.144   5.435   14.328  1.00 0.00 ? 88  GLU A HA   3  
ATOM 5810  H HB2  . GLU A 1 88  ? 3.309   3.668   12.992  1.00 0.00 ? 88  GLU A HB2  3  
ATOM 5811  H HB3  . GLU A 1 88  ? 4.796   2.753   13.111  1.00 0.00 ? 88  GLU A HB3  3  
ATOM 5812  H HG2  . GLU A 1 88  ? 3.034   1.685   14.438  1.00 0.00 ? 88  GLU A HG2  3  
ATOM 5813  H HG3  . GLU A 1 88  ? 4.309   2.287   15.497  1.00 0.00 ? 88  GLU A HG3  3  
ATOM 5814  N N    . SER A 1 89  ? 6.678   3.529   15.221  1.00 0.00 ? 89  SER A N    3  
ATOM 5815  C CA   . SER A 1 89  ? 7.562   3.163   16.359  1.00 0.00 ? 89  SER A CA   3  
ATOM 5816  C C    . SER A 1 89  ? 9.024   3.287   15.929  1.00 0.00 ? 89  SER A C    3  
ATOM 5817  O O    . SER A 1 89  ? 9.834   3.913   16.582  1.00 0.00 ? 89  SER A O    3  
ATOM 5818  C CB   . SER A 1 89  ? 7.283   1.711   16.743  1.00 0.00 ? 89  SER A CB   3  
ATOM 5819  O OG   . SER A 1 89  ? 7.315   0.906   15.565  1.00 0.00 ? 89  SER A OG   3  
ATOM 5820  H H    . SER A 1 89  ? 6.838   3.141   14.340  1.00 0.00 ? 89  SER A H    3  
ATOM 5821  H HA   . SER A 1 89  ? 7.368   3.806   17.196  1.00 0.00 ? 89  SER A HA   3  
ATOM 5822  H HB2  . SER A 1 89  ? 8.036   1.365   17.431  1.00 0.00 ? 89  SER A HB2  3  
ATOM 5823  H HB3  . SER A 1 89  ? 6.310   1.643   17.212  1.00 0.00 ? 89  SER A HB3  3  
ATOM 5824  H HG   . SER A 1 89  ? 7.374   -0.013  15.835  1.00 0.00 ? 89  SER A HG   3  
ATOM 5825  N N    . GLU A 1 90  ? 9.346   2.676   14.827  1.00 0.00 ? 90  GLU A N    3  
ATOM 5826  C CA   . GLU A 1 90  ? 10.738  2.692   14.280  1.00 0.00 ? 90  GLU A CA   3  
ATOM 5827  C C    . GLU A 1 90  ? 10.780  1.690   13.129  1.00 0.00 ? 90  GLU A C    3  
ATOM 5828  O O    . GLU A 1 90  ? 11.386  1.919   12.104  1.00 0.00 ? 90  GLU A O    3  
ATOM 5829  C CB   . GLU A 1 90  ? 11.756  2.277   15.353  1.00 0.00 ? 90  GLU A CB   3  
ATOM 5830  C CG   . GLU A 1 90  ? 11.332  0.947   15.983  1.00 0.00 ? 90  GLU A CG   3  
ATOM 5831  C CD   . GLU A 1 90  ? 11.802  0.900   17.438  1.00 0.00 ? 90  GLU A CD   3  
ATOM 5832  O OE1  . GLU A 1 90  ? 11.592  1.876   18.140  1.00 0.00 ? 90  GLU A OE1  3  
ATOM 5833  O OE2  . GLU A 1 90  ? 12.363  -0.111  17.826  1.00 0.00 ? 90  GLU A OE2  3  
ATOM 5834  H H    . GLU A 1 90  ? 8.654   2.186   14.341  1.00 0.00 ? 90  GLU A H    3  
ATOM 5835  H HA   . GLU A 1 90  ? 10.970  3.678   13.910  1.00 0.00 ? 90  GLU A HA   3  
ATOM 5836  H HB2  . GLU A 1 90  ? 12.728  2.162   14.896  1.00 0.00 ? 90  GLU A HB2  3  
ATOM 5837  H HB3  . GLU A 1 90  ? 11.808  3.036   16.117  1.00 0.00 ? 90  GLU A HB3  3  
ATOM 5838  H HG2  . GLU A 1 90  ? 10.257  0.855   15.948  1.00 0.00 ? 90  GLU A HG2  3  
ATOM 5839  H HG3  . GLU A 1 90  ? 11.780  0.132   15.437  1.00 0.00 ? 90  GLU A HG3  3  
ATOM 5840  N N    . ASN A 1 91  ? 10.082  0.599   13.292  1.00 0.00 ? 91  ASN A N    3  
ATOM 5841  C CA   . ASN A 1 91  ? 9.995   -0.431  12.217  1.00 0.00 ? 91  ASN A CA   3  
ATOM 5842  C C    . ASN A 1 91  ? 8.574   -0.427  11.650  1.00 0.00 ? 91  ASN A C    3  
ATOM 5843  O O    . ASN A 1 91  ? 8.248   -1.221  10.790  1.00 0.00 ? 91  ASN A O    3  
ATOM 5844  C CB   . ASN A 1 91  ? 10.305  -1.810  12.781  1.00 0.00 ? 91  ASN A CB   3  
ATOM 5845  C CG   . ASN A 1 91  ? 11.730  -1.848  13.340  1.00 0.00 ? 91  ASN A CG   3  
ATOM 5846  O OD1  . ASN A 1 91  ? 12.361  -0.825  13.515  1.00 0.00 ? 91  ASN A OD1  3  
ATOM 5847  N ND2  . ASN A 1 91  ? 12.268  -3.003  13.621  1.00 0.00 ? 91  ASN A ND2  3  
ATOM 5848  H H    . ASN A 1 91  ? 9.569   0.476   14.118  1.00 0.00 ? 91  ASN A H    3  
ATOM 5849  H HA   . ASN A 1 91  ? 10.690  -0.203  11.418  1.00 0.00 ? 91  ASN A HA   3  
ATOM 5850  H HB2  . ASN A 1 91  ? 9.599   -2.042  13.559  1.00 0.00 ? 91  ASN A HB2  3  
ATOM 5851  H HB3  . ASN A 1 91  ? 10.221  -2.534  11.994  1.00 0.00 ? 91  ASN A HB3  3  
ATOM 5852  H HD21 . ASN A 1 91  ? 11.759  -3.828  13.474  1.00 0.00 ? 91  ASN A HD21 3  
ATOM 5853  H HD22 . ASN A 1 91  ? 13.180  -3.047  13.971  1.00 0.00 ? 91  ASN A HD22 3  
ATOM 5854  N N    . LYS A 1 92  ? 7.730   0.473   12.111  1.00 0.00 ? 92  LYS A N    3  
ATOM 5855  C CA   . LYS A 1 92  ? 6.360   0.557   11.574  1.00 0.00 ? 92  LYS A CA   3  
ATOM 5856  C C    . LYS A 1 92  ? 6.237   1.945   10.964  1.00 0.00 ? 92  LYS A C    3  
ATOM 5857  O O    . LYS A 1 92  ? 6.774   2.895   11.490  1.00 0.00 ? 92  LYS A O    3  
ATOM 5858  C CB   . LYS A 1 92  ? 5.345   0.387   12.704  1.00 0.00 ? 92  LYS A CB   3  
ATOM 5859  C CG   . LYS A 1 92  ? 5.189   -1.095  13.028  1.00 0.00 ? 92  LYS A CG   3  
ATOM 5860  C CD   . LYS A 1 92  ? 6.503   -1.637  13.598  1.00 0.00 ? 92  LYS A CD   3  
ATOM 5861  C CE   . LYS A 1 92  ? 6.203   -2.697  14.660  1.00 0.00 ? 92  LYS A CE   3  
ATOM 5862  N NZ   . LYS A 1 92  ? 7.451   -3.015  15.410  1.00 0.00 ? 92  LYS A NZ   3  
ATOM 5863  H H    . LYS A 1 92  ? 8.006   1.117   12.802  1.00 0.00 ? 92  LYS A H    3  
ATOM 5864  H HA   . LYS A 1 92  ? 6.214   -0.201  10.815  1.00 0.00 ? 92  LYS A HA   3  
ATOM 5865  H HB2  . LYS A 1 92  ? 5.691   0.914   13.582  1.00 0.00 ? 92  LYS A HB2  3  
ATOM 5866  H HB3  . LYS A 1 92  ? 4.391   0.788   12.396  1.00 0.00 ? 92  LYS A HB3  3  
ATOM 5867  H HG2  . LYS A 1 92  ? 4.399   -1.224  13.752  1.00 0.00 ? 92  LYS A HG2  3  
ATOM 5868  H HG3  . LYS A 1 92  ? 4.943   -1.630  12.128  1.00 0.00 ? 92  LYS A HG3  3  
ATOM 5869  H HD2  . LYS A 1 92  ? 7.085   -2.079  12.801  1.00 0.00 ? 92  LYS A HD2  3  
ATOM 5870  H HD3  . LYS A 1 92  ? 7.062   -0.829  14.046  1.00 0.00 ? 92  LYS A HD3  3  
ATOM 5871  H HE2  . LYS A 1 92  ? 5.458   -2.320  15.345  1.00 0.00 ? 92  LYS A HE2  3  
ATOM 5872  H HE3  . LYS A 1 92  ? 5.833   -3.591  14.182  1.00 0.00 ? 92  LYS A HE3  3  
ATOM 5873  H HZ1  . LYS A 1 92  ? 7.899   -2.133  15.730  1.00 0.00 ? 92  LYS A HZ1  3  
ATOM 5874  H HZ2  . LYS A 1 92  ? 7.218   -3.606  16.235  1.00 0.00 ? 92  LYS A HZ2  3  
ATOM 5875  H HZ3  . LYS A 1 92  ? 8.108   -3.529  14.789  1.00 0.00 ? 92  LYS A HZ3  3  
ATOM 5876  N N    . MET A 1 93  ? 5.556   2.076   9.868   1.00 0.00 ? 93  MET A N    3  
ATOM 5877  C CA   . MET A 1 93  ? 5.423   3.422   9.239   1.00 0.00 ? 93  MET A CA   3  
ATOM 5878  C C    . MET A 1 93  ? 4.077   3.537   8.552   1.00 0.00 ? 93  MET A C    3  
ATOM 5879  O O    . MET A 1 93  ? 3.398   2.559   8.307   1.00 0.00 ? 93  MET A O    3  
ATOM 5880  C CB   . MET A 1 93  ? 6.544   3.719   8.216   1.00 0.00 ? 93  MET A CB   3  
ATOM 5881  C CG   . MET A 1 93  ? 7.204   2.436   7.689   1.00 0.00 ? 93  MET A CG   3  
ATOM 5882  S SD   . MET A 1 93  ? 7.625   2.632   5.937   1.00 0.00 ? 93  MET A SD   3  
ATOM 5883  C CE   . MET A 1 93  ? 8.577   4.163   6.101   1.00 0.00 ? 93  MET A CE   3  
ATOM 5884  H H    . MET A 1 93  ? 5.133   1.301   9.464   1.00 0.00 ? 93  MET A H    3  
ATOM 5885  H HA   . MET A 1 93  ? 5.471   4.161   10.017  1.00 0.00 ? 93  MET A HA   3  
ATOM 5886  H HB2  . MET A 1 93  ? 6.126   4.268   7.384   1.00 0.00 ? 93  MET A HB2  3  
ATOM 5887  H HB3  . MET A 1 93  ? 7.296   4.330   8.692   1.00 0.00 ? 93  MET A HB3  3  
ATOM 5888  H HG2  . MET A 1 93  ? 8.105   2.247   8.251   1.00 0.00 ? 93  MET A HG2  3  
ATOM 5889  H HG3  . MET A 1 93  ? 6.526   1.608   7.804   1.00 0.00 ? 93  MET A HG3  3  
ATOM 5890  H HE1  . MET A 1 93  ? 8.945   4.251   7.111   1.00 0.00 ? 93  MET A HE1  3  
ATOM 5891  H HE2  . MET A 1 93  ? 9.411   4.143   5.415   1.00 0.00 ? 93  MET A HE2  3  
ATOM 5892  H HE3  . MET A 1 93  ? 7.938   5.007   5.878   1.00 0.00 ? 93  MET A HE3  3  
ATOM 5893  N N    . VAL A 1 94  ? 3.691   4.740   8.261   1.00 0.00 ? 94  VAL A N    3  
ATOM 5894  C CA   . VAL A 1 94  ? 2.380   4.979   7.603   1.00 0.00 ? 94  VAL A CA   3  
ATOM 5895  C C    . VAL A 1 94  ? 2.574   5.774   6.322   1.00 0.00 ? 94  VAL A C    3  
ATOM 5896  O O    . VAL A 1 94  ? 3.676   6.087   5.918   1.00 0.00 ? 94  VAL A O    3  
ATOM 5897  C CB   . VAL A 1 94  ? 1.480   5.790   8.540   1.00 0.00 ? 94  VAL A CB   3  
ATOM 5898  C CG1  . VAL A 1 94  ? 0.955   4.895   9.661   1.00 0.00 ? 94  VAL A CG1  3  
ATOM 5899  C CG2  . VAL A 1 94  ? 2.286   6.946   9.134   1.00 0.00 ? 94  VAL A CG2  3  
ATOM 5900  H H    . VAL A 1 94  ? 4.265   5.501   8.493   1.00 0.00 ? 94  VAL A H    3  
ATOM 5901  H HA   . VAL A 1 94  ? 1.906   4.043   7.378   1.00 0.00 ? 94  VAL A HA   3  
ATOM 5902  H HB   . VAL A 1 94  ? 0.645   6.186   7.983   1.00 0.00 ? 94  VAL A HB   3  
ATOM 5903  H HG11 . VAL A 1 94  ? 1.171   3.863   9.431   1.00 0.00 ? 94  VAL A HG11 3  
ATOM 5904  H HG12 . VAL A 1 94  ? 1.430   5.164   10.593  1.00 0.00 ? 94  VAL A HG12 3  
ATOM 5905  H HG13 . VAL A 1 94  ? -0.112  5.028   9.749   1.00 0.00 ? 94  VAL A HG13 3  
ATOM 5906  H HG21 . VAL A 1 94  ? 2.719   7.527   8.333   1.00 0.00 ? 94  VAL A HG21 3  
ATOM 5907  H HG22 . VAL A 1 94  ? 1.638   7.569   9.727   1.00 0.00 ? 94  VAL A HG22 3  
ATOM 5908  H HG23 . VAL A 1 94  ? 3.075   6.546   9.755   1.00 0.00 ? 94  VAL A HG23 3  
ATOM 5909  N N    . CYS A 1 95  ? 1.490   6.111   5.700   1.00 0.00 ? 95  CYS A N    3  
ATOM 5910  C CA   . CYS A 1 95  ? 1.534   6.913   4.455   1.00 0.00 ? 95  CYS A CA   3  
ATOM 5911  C C    . CYS A 1 95  ? 0.134   7.444   4.219   1.00 0.00 ? 95  CYS A C    3  
ATOM 5912  O O    . CYS A 1 95  ? -0.601  6.939   3.397   1.00 0.00 ? 95  CYS A O    3  
ATOM 5913  C CB   . CYS A 1 95  ? 1.969   6.048   3.283   1.00 0.00 ? 95  CYS A CB   3  
ATOM 5914  S SG   . CYS A 1 95  ? 2.203   7.092   1.823   1.00 0.00 ? 95  CYS A SG   3  
ATOM 5915  H H    . CYS A 1 95  ? 0.623   5.841   6.069   1.00 0.00 ? 95  CYS A H    3  
ATOM 5916  H HA   . CYS A 1 95  ? 2.218   7.730   4.580   1.00 0.00 ? 95  CYS A HA   3  
ATOM 5917  H HB2  . CYS A 1 95  ? 2.893   5.557   3.528   1.00 0.00 ? 95  CYS A HB2  3  
ATOM 5918  H HB3  . CYS A 1 95  ? 1.219   5.304   3.079   1.00 0.00 ? 95  CYS A HB3  3  
ATOM 5919  H HG   . CYS A 1 95  ? 1.531   7.778   1.838   1.00 0.00 ? 95  CYS A HG   3  
ATOM 5920  N N    . GLU A 1 96  ? -0.253  8.435   4.974   1.00 0.00 ? 96  GLU A N    3  
ATOM 5921  C CA   . GLU A 1 96  ? -1.633  8.972   4.839   1.00 0.00 ? 96  GLU A CA   3  
ATOM 5922  C C    . GLU A 1 96  ? -1.825  9.654   3.487   1.00 0.00 ? 96  GLU A C    3  
ATOM 5923  O O    . GLU A 1 96  ? -1.285  10.714  3.229   1.00 0.00 ? 96  GLU A O    3  
ATOM 5924  C CB   . GLU A 1 96  ? -1.921  9.974   5.953   1.00 0.00 ? 96  GLU A CB   3  
ATOM 5925  C CG   . GLU A 1 96  ? -3.410  10.320  5.928   1.00 0.00 ? 96  GLU A CG   3  
ATOM 5926  C CD   . GLU A 1 96  ? -3.686  11.479  6.888   1.00 0.00 ? 96  GLU A CD   3  
ATOM 5927  O OE1  . GLU A 1 96  ? -3.584  11.267  8.085   1.00 0.00 ? 96  GLU A OE1  3  
ATOM 5928  O OE2  . GLU A 1 96  ? -3.995  12.558  6.410   1.00 0.00 ? 96  GLU A OE2  3  
ATOM 5929  H H    . GLU A 1 96  ? 0.357   8.802   5.651   1.00 0.00 ? 96  GLU A H    3  
ATOM 5930  H HA   . GLU A 1 96  ? -2.328  8.149   4.920   1.00 0.00 ? 96  GLU A HA   3  
ATOM 5931  H HB2  . GLU A 1 96  ? -1.663  9.538   6.908   1.00 0.00 ? 96  GLU A HB2  3  
ATOM 5932  H HB3  . GLU A 1 96  ? -1.341  10.871  5.795   1.00 0.00 ? 96  GLU A HB3  3  
ATOM 5933  H HG2  . GLU A 1 96  ? -3.693  10.604  4.923   1.00 0.00 ? 96  GLU A HG2  3  
ATOM 5934  H HG3  . GLU A 1 96  ? -3.984  9.457   6.230   1.00 0.00 ? 96  GLU A HG3  3  
ATOM 5935  N N    . GLN A 1 97  ? -2.618  9.059   2.638   1.00 0.00 ? 97  GLN A N    3  
ATOM 5936  C CA   . GLN A 1 97  ? -2.893  9.658   1.312   1.00 0.00 ? 97  GLN A CA   3  
ATOM 5937  C C    . GLN A 1 97  ? -4.251  10.364  1.375   1.00 0.00 ? 97  GLN A C    3  
ATOM 5938  O O    . GLN A 1 97  ? -5.244  9.764   1.741   1.00 0.00 ? 97  GLN A O    3  
ATOM 5939  C CB   . GLN A 1 97  ? -2.941  8.545   0.267   1.00 0.00 ? 97  GLN A CB   3  
ATOM 5940  C CG   . GLN A 1 97  ? -1.584  7.842   0.199   1.00 0.00 ? 97  GLN A CG   3  
ATOM 5941  C CD   . GLN A 1 97  ? -1.267  7.463   -1.251  1.00 0.00 ? 97  GLN A CD   3  
ATOM 5942  O OE1  . GLN A 1 97  ? -2.146  7.420   -2.090  1.00 0.00 ? 97  GLN A OE1  3  
ATOM 5943  N NE2  . GLN A 1 97  ? -0.036  7.183   -1.584  1.00 0.00 ? 97  GLN A NE2  3  
ATOM 5944  H H    . GLN A 1 97  ? -3.049  8.219   2.881   1.00 0.00 ? 97  GLN A H    3  
ATOM 5945  H HA   . GLN A 1 97  ? -2.118  10.363  1.065   1.00 0.00 ? 97  GLN A HA   3  
ATOM 5946  H HB2  . GLN A 1 97  ? -3.700  7.829   0.541   1.00 0.00 ? 97  GLN A HB2  3  
ATOM 5947  H HB3  . GLN A 1 97  ? -3.176  8.967   -0.691  1.00 0.00 ? 97  GLN A HB3  3  
ATOM 5948  H HG2  . GLN A 1 97  ? -0.818  8.503   0.574   1.00 0.00 ? 97  GLN A HG2  3  
ATOM 5949  H HG3  . GLN A 1 97  ? -1.616  6.948   0.802   1.00 0.00 ? 97  GLN A HG3  3  
ATOM 5950  H HE21 . GLN A 1 97  ? 0.674   7.217   -0.909  1.00 0.00 ? 97  GLN A HE21 3  
ATOM 5951  H HE22 . GLN A 1 97  ? 0.179   6.940   -2.508  1.00 0.00 ? 97  GLN A HE22 3  
ATOM 5952  N N    . LYS A 1 98  ? -4.306  11.632  1.043   1.00 0.00 ? 98  LYS A N    3  
ATOM 5953  C CA   . LYS A 1 98  ? -5.616  12.359  1.109   1.00 0.00 ? 98  LYS A CA   3  
ATOM 5954  C C    . LYS A 1 98  ? -5.916  13.039  -0.229  1.00 0.00 ? 98  LYS A C    3  
ATOM 5955  O O    . LYS A 1 98  ? -5.050  13.183  -1.066  1.00 0.00 ? 98  LYS A O    3  
ATOM 5956  C CB   . LYS A 1 98  ? -5.558  13.415  2.217   1.00 0.00 ? 98  LYS A CB   3  
ATOM 5957  C CG   . LYS A 1 98  ? -4.374  14.355  1.977   1.00 0.00 ? 98  LYS A CG   3  
ATOM 5958  C CD   . LYS A 1 98  ? -4.195  15.272  3.189   1.00 0.00 ? 98  LYS A CD   3  
ATOM 5959  C CE   . LYS A 1 98  ? -3.046  16.248  2.928   1.00 0.00 ? 98  LYS A CE   3  
ATOM 5960  N NZ   . LYS A 1 98  ? -2.323  16.517  4.203   1.00 0.00 ? 98  LYS A NZ   3  
ATOM 5961  H H    . LYS A 1 98  ? -3.488  12.105  0.762   1.00 0.00 ? 98  LYS A H    3  
ATOM 5962  H HA   . LYS A 1 98  ? -6.402  11.653  1.332   1.00 0.00 ? 98  LYS A HA   3  
ATOM 5963  H HB2  . LYS A 1 98  ? -6.476  13.985  2.218   1.00 0.00 ? 98  LYS A HB2  3  
ATOM 5964  H HB3  . LYS A 1 98  ? -5.438  12.927  3.173   1.00 0.00 ? 98  LYS A HB3  3  
ATOM 5965  H HG2  . LYS A 1 98  ? -3.476  13.773  1.830   1.00 0.00 ? 98  LYS A HG2  3  
ATOM 5966  H HG3  . LYS A 1 98  ? -4.562  14.955  1.099   1.00 0.00 ? 98  LYS A HG3  3  
ATOM 5967  H HD2  . LYS A 1 98  ? -5.107  15.825  3.359   1.00 0.00 ? 98  LYS A HD2  3  
ATOM 5968  H HD3  . LYS A 1 98  ? -3.967  14.676  4.060   1.00 0.00 ? 98  LYS A HD3  3  
ATOM 5969  H HE2  . LYS A 1 98  ? -2.363  15.818  2.210   1.00 0.00 ? 98  LYS A HE2  3  
ATOM 5970  H HE3  . LYS A 1 98  ? -3.443  17.174  2.537   1.00 0.00 ? 98  LYS A HE3  3  
ATOM 5971  H HZ1  . LYS A 1 98  ? -3.002  16.526  4.991   1.00 0.00 ? 98  LYS A HZ1  3  
ATOM 5972  H HZ2  . LYS A 1 98  ? -1.614  15.773  4.363   1.00 0.00 ? 98  LYS A HZ2  3  
ATOM 5973  H HZ3  . LYS A 1 98  ? -1.847  17.439  4.144   1.00 0.00 ? 98  LYS A HZ3  3  
ATOM 5974  N N    . LEU A 1 99  ? -7.142  13.467  -0.428  1.00 0.00 ? 99  LEU A N    3  
ATOM 5975  C CA   . LEU A 1 99  ? -7.499  14.155  -1.714  1.00 0.00 ? 99  LEU A CA   3  
ATOM 5976  C C    . LEU A 1 99  ? -7.568  15.664  -1.487  1.00 0.00 ? 99  LEU A C    3  
ATOM 5977  O O    . LEU A 1 99  ? -8.387  16.355  -2.063  1.00 0.00 ? 99  LEU A O    3  
ATOM 5978  C CB   . LEU A 1 99  ? -8.835  13.651  -2.308  1.00 0.00 ? 99  LEU A CB   3  
ATOM 5979  C CG   . LEU A 1 99  ? -9.788  13.171  -1.217  1.00 0.00 ? 99  LEU A CG   3  
ATOM 5980  C CD1  . LEU A 1 99  ? -11.235 13.395  -1.663  1.00 0.00 ? 99  LEU A CD1  3  
ATOM 5981  C CD2  . LEU A 1 99  ? -9.560  11.678  -0.973  1.00 0.00 ? 99  LEU A CD2  3  
ATOM 5982  H H    . LEU A 1 99  ? -7.815  13.346  0.271   1.00 0.00 ? 99  LEU A H    3  
ATOM 5983  H HA   . LEU A 1 99  ? -6.722  13.960  -2.420  1.00 0.00 ? 99  LEU A HA   3  
ATOM 5984  H HB2  . LEU A 1 99  ? -9.303  14.456  -2.854  1.00 0.00 ? 99  LEU A HB2  3  
ATOM 5985  H HB3  . LEU A 1 99  ? -8.633  12.835  -2.986  1.00 0.00 ? 99  LEU A HB3  3  
ATOM 5986  H HG   . LEU A 1 99  ? -9.597  13.724  -0.314  1.00 0.00 ? 99  LEU A HG   3  
ATOM 5987  H HD11 . LEU A 1 99  ? -11.341 13.110  -2.699  1.00 0.00 ? 99  LEU A HD11 3  
ATOM 5988  H HD12 . LEU A 1 99  ? -11.896 12.792  -1.057  1.00 0.00 ? 99  LEU A HD12 3  
ATOM 5989  H HD13 . LEU A 1 99  ? -11.492 14.437  -1.548  1.00 0.00 ? 99  LEU A HD13 3  
ATOM 5990  H HD21 . LEU A 1 99  ? -8.500  11.481  -0.910  1.00 0.00 ? 99  LEU A HD21 3  
ATOM 5991  H HD22 . LEU A 1 99  ? -10.037 11.386  -0.051  1.00 0.00 ? 99  LEU A HD22 3  
ATOM 5992  H HD23 . LEU A 1 99  ? -9.982  11.112  -1.792  1.00 0.00 ? 99  LEU A HD23 3  
ATOM 5993  N N    . LEU A 1 100 ? -6.693  16.181  -0.660  1.00 0.00 ? 100 LEU A N    3  
ATOM 5994  C CA   . LEU A 1 100 ? -6.668  17.652  -0.391  1.00 0.00 ? 100 LEU A CA   3  
ATOM 5995  C C    . LEU A 1 100 ? -8.021  18.138  0.140   1.00 0.00 ? 100 LEU A C    3  
ATOM 5996  O O    . LEU A 1 100 ? -8.329  19.314  0.083   1.00 0.00 ? 100 LEU A O    3  
ATOM 5997  C CB   . LEU A 1 100 ? -6.353  18.386  -1.687  1.00 0.00 ? 100 LEU A CB   3  
ATOM 5998  C CG   . LEU A 1 100 ? -5.018  17.885  -2.244  1.00 0.00 ? 100 LEU A CG   3  
ATOM 5999  C CD1  . LEU A 1 100 ? -4.909  18.249  -3.727  1.00 0.00 ? 100 LEU A CD1  3  
ATOM 6000  C CD2  . LEU A 1 100 ? -3.867  18.535  -1.473  1.00 0.00 ? 100 LEU A CD2  3  
ATOM 6001  H H    . LEU A 1 100 ? -6.037  15.598  -0.223  1.00 0.00 ? 100 LEU A H    3  
ATOM 6002  H HA   . LEU A 1 100 ? -5.899  17.868  0.334   1.00 0.00 ? 100 LEU A HA   3  
ATOM 6003  H HB2  . LEU A 1 100 ? -7.140  18.193  -2.402  1.00 0.00 ? 100 LEU A HB2  3  
ATOM 6004  H HB3  . LEU A 1 100 ? -6.290  19.443  -1.492  1.00 0.00 ? 100 LEU A HB3  3  
ATOM 6005  H HG   . LEU A 1 100 ? -4.964  16.812  -2.135  1.00 0.00 ? 100 LEU A HG   3  
ATOM 6006  H HD11 . LEU A 1 100 ? -5.543  19.098  -3.937  1.00 0.00 ? 100 LEU A HD11 3  
ATOM 6007  H HD12 . LEU A 1 100 ? -3.885  18.498  -3.964  1.00 0.00 ? 100 LEU A HD12 3  
ATOM 6008  H HD13 . LEU A 1 100 ? -5.222  17.408  -4.326  1.00 0.00 ? 100 LEU A HD13 3  
ATOM 6009  H HD21 . LEU A 1 100 ? -4.159  19.525  -1.156  1.00 0.00 ? 100 LEU A HD21 3  
ATOM 6010  H HD22 . LEU A 1 100 ? -3.630  17.935  -0.607  1.00 0.00 ? 100 LEU A HD22 3  
ATOM 6011  H HD23 . LEU A 1 100 ? -2.998  18.603  -2.112  1.00 0.00 ? 100 LEU A HD23 3  
ATOM 6012  N N    . LYS A 1 101 ? -8.825  17.248  0.654   1.00 0.00 ? 101 LYS A N    3  
ATOM 6013  C CA   . LYS A 1 101 ? -10.158 17.649  1.192   1.00 0.00 ? 101 LYS A CA   3  
ATOM 6014  C C    . LYS A 1 101 ? -10.852 16.422  1.776   1.00 0.00 ? 101 LYS A C    3  
ATOM 6015  O O    . LYS A 1 101 ? -11.101 16.340  2.964   1.00 0.00 ? 101 LYS A O    3  
ATOM 6016  C CB   . LYS A 1 101 ? -11.015 18.230  0.068   1.00 0.00 ? 101 LYS A CB   3  
ATOM 6017  C CG   . LYS A 1 101 ? -12.047 19.193  0.658   1.00 0.00 ? 101 LYS A CG   3  
ATOM 6018  C CD   . LYS A 1 101 ? -13.271 18.404  1.129   1.00 0.00 ? 101 LYS A CD   3  
ATOM 6019  C CE   . LYS A 1 101 ? -14.520 19.278  1.009   1.00 0.00 ? 101 LYS A CE   3  
ATOM 6020  N NZ   . LYS A 1 101 ? -14.558 20.248  2.139   1.00 0.00 ? 101 LYS A NZ   3  
ATOM 6021  H H    . LYS A 1 101 ? -8.551  16.315  0.687   1.00 0.00 ? 101 LYS A H    3  
ATOM 6022  H HA   . LYS A 1 101 ? -10.030 18.387  1.962   1.00 0.00 ? 101 LYS A HA   3  
ATOM 6023  H HB2  . LYS A 1 101 ? -10.383 18.759  -0.631  1.00 0.00 ? 101 LYS A HB2  3  
ATOM 6024  H HB3  . LYS A 1 101 ? -11.523 17.429  -0.440  1.00 0.00 ? 101 LYS A HB3  3  
ATOM 6025  H HG2  . LYS A 1 101 ? -11.611 19.718  1.496   1.00 0.00 ? 101 LYS A HG2  3  
ATOM 6026  H HG3  . LYS A 1 101 ? -12.348 19.904  -0.096  1.00 0.00 ? 101 LYS A HG3  3  
ATOM 6027  H HD2  . LYS A 1 101 ? -13.387 17.521  0.516   1.00 0.00 ? 101 LYS A HD2  3  
ATOM 6028  H HD3  . LYS A 1 101 ? -13.136 18.112  2.159   1.00 0.00 ? 101 LYS A HD3  3  
ATOM 6029  H HE2  . LYS A 1 101 ? -14.495 19.816  0.073   1.00 0.00 ? 101 LYS A HE2  3  
ATOM 6030  H HE3  . LYS A 1 101 ? -15.401 18.653  1.041   1.00 0.00 ? 101 LYS A HE3  3  
ATOM 6031  H HZ1  . LYS A 1 101 ? -14.390 19.746  3.034   1.00 0.00 ? 101 LYS A HZ1  3  
ATOM 6032  H HZ2  . LYS A 1 101 ? -13.821 20.969  2.001   1.00 0.00 ? 101 LYS A HZ2  3  
ATOM 6033  H HZ3  . LYS A 1 101 ? -15.491 20.706  2.172   1.00 0.00 ? 101 LYS A HZ3  3  
ATOM 6034  N N    . GLY A 1 102 ? -11.158 15.467  0.942   1.00 0.00 ? 102 GLY A N    3  
ATOM 6035  C CA   . GLY A 1 102 ? -11.831 14.227  1.425   1.00 0.00 ? 102 GLY A CA   3  
ATOM 6036  C C    . GLY A 1 102 ? -13.347 14.397  1.356   1.00 0.00 ? 102 GLY A C    3  
ATOM 6037  O O    . GLY A 1 102 ? -13.887 15.427  1.714   1.00 0.00 ? 102 GLY A O    3  
ATOM 6038  H H    . GLY A 1 102 ? -10.938 15.565  -0.006  1.00 0.00 ? 102 GLY A H    3  
ATOM 6039  H HA2  . GLY A 1 102 ? -11.534 13.394  0.806   1.00 0.00 ? 102 GLY A HA2  3  
ATOM 6040  H HA3  . GLY A 1 102 ? -11.544 14.033  2.444   1.00 0.00 ? 102 GLY A HA3  3  
ATOM 6041  N N    . GLU A 1 103 ? -14.032 13.380  0.911   1.00 0.00 ? 103 GLU A N    3  
ATOM 6042  C CA   . GLU A 1 103 ? -15.518 13.444  0.825   1.00 0.00 ? 103 GLU A CA   3  
ATOM 6043  C C    . GLU A 1 103 ? -16.103 12.455  1.832   1.00 0.00 ? 103 GLU A C    3  
ATOM 6044  O O    . GLU A 1 103 ? -17.086 12.730  2.493   1.00 0.00 ? 103 GLU A O    3  
ATOM 6045  C CB   . GLU A 1 103 ? -15.981 13.086  -0.593  1.00 0.00 ? 103 GLU A CB   3  
ATOM 6046  C CG   . GLU A 1 103 ? -15.335 11.772  -1.043  1.00 0.00 ? 103 GLU A CG   3  
ATOM 6047  C CD   . GLU A 1 103 ? -15.848 11.403  -2.436  1.00 0.00 ? 103 GLU A CD   3  
ATOM 6048  O OE1  . GLU A 1 103 ? -15.815 12.259  -3.304  1.00 0.00 ? 103 GLU A OE1  3  
ATOM 6049  O OE2  . GLU A 1 103 ? -16.266 10.270  -2.610  1.00 0.00 ? 103 GLU A OE2  3  
ATOM 6050  H H    . GLU A 1 103 ? -13.565 12.567  0.646   1.00 0.00 ? 103 GLU A H    3  
ATOM 6051  H HA   . GLU A 1 103 ? -15.843 14.439  1.071   1.00 0.00 ? 103 GLU A HA   3  
ATOM 6052  H HB2  . GLU A 1 103 ? -17.056 12.978  -0.602  1.00 0.00 ? 103 GLU A HB2  3  
ATOM 6053  H HB3  . GLU A 1 103 ? -15.695 13.875  -1.273  1.00 0.00 ? 103 GLU A HB3  3  
ATOM 6054  H HG2  . GLU A 1 103 ? -14.262 11.890  -1.075  1.00 0.00 ? 103 GLU A HG2  3  
ATOM 6055  H HG3  . GLU A 1 103 ? -15.591 10.987  -0.349  1.00 0.00 ? 103 GLU A HG3  3  
ATOM 6056  N N    . GLY A 1 104 ? -15.485 11.312  1.961   1.00 0.00 ? 104 GLY A N    3  
ATOM 6057  C CA   . GLY A 1 104 ? -15.963 10.291  2.930   1.00 0.00 ? 104 GLY A CA   3  
ATOM 6058  C C    . GLY A 1 104 ? -14.744 9.512   3.453   1.00 0.00 ? 104 GLY A C    3  
ATOM 6059  O O    . GLY A 1 104 ? -14.169 9.893   4.454   1.00 0.00 ? 104 GLY A O    3  
ATOM 6060  H H    . GLY A 1 104 ? -14.690 11.128  1.424   1.00 0.00 ? 104 GLY A H    3  
ATOM 6061  H HA2  . GLY A 1 104 ? -16.462 10.784  3.752   1.00 0.00 ? 104 GLY A HA2  3  
ATOM 6062  H HA3  . GLY A 1 104 ? -16.645 9.614   2.444   1.00 0.00 ? 104 GLY A HA3  3  
ATOM 6063  N N    . PRO A 1 105 ? -14.363 8.450   2.764   1.00 0.00 ? 105 PRO A N    3  
ATOM 6064  C CA   . PRO A 1 105 ? -13.201 7.642   3.164   1.00 0.00 ? 105 PRO A CA   3  
ATOM 6065  C C    . PRO A 1 105 ? -11.908 8.285   2.641   1.00 0.00 ? 105 PRO A C    3  
ATOM 6066  O O    . PRO A 1 105 ? -11.882 9.459   2.323   1.00 0.00 ? 105 PRO A O    3  
ATOM 6067  C CB   . PRO A 1 105 ? -13.457 6.291   2.499   1.00 0.00 ? 105 PRO A CB   3  
ATOM 6068  C CG   . PRO A 1 105 ? -14.416 6.554   1.312   1.00 0.00 ? 105 PRO A CG   3  
ATOM 6069  C CD   . PRO A 1 105 ? -15.043 7.943   1.546   1.00 0.00 ? 105 PRO A CD   3  
ATOM 6070  H HA   . PRO A 1 105 ? -13.164 7.528   4.233   1.00 0.00 ? 105 PRO A HA   3  
ATOM 6071  H HB2  . PRO A 1 105 ? -12.528 5.880   2.144   1.00 0.00 ? 105 PRO A HB2  3  
ATOM 6072  H HB3  . PRO A 1 105 ? -13.921 5.616   3.199   1.00 0.00 ? 105 PRO A HB3  3  
ATOM 6073  H HG2  . PRO A 1 105 ? -13.863 6.543   0.385   1.00 0.00 ? 105 PRO A HG2  3  
ATOM 6074  H HG3  . PRO A 1 105 ? -15.192 5.801   1.289   1.00 0.00 ? 105 PRO A HG3  3  
ATOM 6075  H HD2  . PRO A 1 105 ? -14.846 8.591   0.702   1.00 0.00 ? 105 PRO A HD2  3  
ATOM 6076  H HD3  . PRO A 1 105 ? -16.103 7.859   1.719   1.00 0.00 ? 105 PRO A HD3  3  
ATOM 6077  N N    . LYS A 1 106 ? -10.835 7.532   2.560   1.00 0.00 ? 106 LYS A N    3  
ATOM 6078  C CA   . LYS A 1 106 ? -9.550  8.108   2.073   1.00 0.00 ? 106 LYS A CA   3  
ATOM 6079  C C    . LYS A 1 106 ? -8.540  6.988   1.810   1.00 0.00 ? 106 LYS A C    3  
ATOM 6080  O O    . LYS A 1 106 ? -8.776  5.838   2.128   1.00 0.00 ? 106 LYS A O    3  
ATOM 6081  C CB   . LYS A 1 106 ? -9.009  9.045   3.147   1.00 0.00 ? 106 LYS A CB   3  
ATOM 6082  C CG   . LYS A 1 106 ? -8.586  10.381  2.522   1.00 0.00 ? 106 LYS A CG   3  
ATOM 6083  C CD   . LYS A 1 106 ? -9.039  11.537  3.418   1.00 0.00 ? 106 LYS A CD   3  
ATOM 6084  C CE   . LYS A 1 106 ? -8.287  11.477  4.748   1.00 0.00 ? 106 LYS A CE   3  
ATOM 6085  N NZ   . LYS A 1 106 ? -8.912  12.425  5.714   1.00 0.00 ? 106 LYS A NZ   3  
ATOM 6086  H H    . LYS A 1 106 ? -10.872 6.597   2.831   1.00 0.00 ? 106 LYS A H    3  
ATOM 6087  H HA   . LYS A 1 106 ? -9.724  8.660   1.165   1.00 0.00 ? 106 LYS A HA   3  
ATOM 6088  H HB2  . LYS A 1 106 ? -9.786  9.212   3.873   1.00 0.00 ? 106 LYS A HB2  3  
ATOM 6089  H HB3  . LYS A 1 106 ? -8.157  8.590   3.632   1.00 0.00 ? 106 LYS A HB3  3  
ATOM 6090  H HG2  . LYS A 1 106 ? -7.511  10.405  2.422   1.00 0.00 ? 106 LYS A HG2  3  
ATOM 6091  H HG3  . LYS A 1 106 ? -9.040  10.485  1.548   1.00 0.00 ? 106 LYS A HG3  3  
ATOM 6092  H HD2  . LYS A 1 106 ? -8.830  12.476  2.926   1.00 0.00 ? 106 LYS A HD2  3  
ATOM 6093  H HD3  . LYS A 1 106 ? -10.100 11.455  3.602   1.00 0.00 ? 106 LYS A HD3  3  
ATOM 6094  H HE2  . LYS A 1 106 ? -8.337  10.474  5.145   1.00 0.00 ? 106 LYS A HE2  3  
ATOM 6095  H HE3  . LYS A 1 106 ? -7.255  11.752  4.591   1.00 0.00 ? 106 LYS A HE3  3  
ATOM 6096  H HZ1  . LYS A 1 106 ? -9.019  13.357  5.264   1.00 0.00 ? 106 LYS A HZ1  3  
ATOM 6097  H HZ2  . LYS A 1 106 ? -9.845  12.067  5.998   1.00 0.00 ? 106 LYS A HZ2  3  
ATOM 6098  H HZ3  . LYS A 1 106 ? -8.307  12.513  6.555   1.00 0.00 ? 106 LYS A HZ3  3  
ATOM 6099  N N    . THR A 1 107 ? -7.413  7.326   1.237   1.00 0.00 ? 107 THR A N    3  
ATOM 6100  C CA   . THR A 1 107 ? -6.375  6.302   0.945   1.00 0.00 ? 107 THR A CA   3  
ATOM 6101  C C    . THR A 1 107 ? -5.224  6.446   1.939   1.00 0.00 ? 107 THR A C    3  
ATOM 6102  O O    . THR A 1 107 ? -5.108  7.439   2.629   1.00 0.00 ? 107 THR A O    3  
ATOM 6103  C CB   . THR A 1 107 ? -5.850  6.527   -0.478  1.00 0.00 ? 107 THR A CB   3  
ATOM 6104  O OG1  . THR A 1 107 ? -5.822  7.920   -0.766  1.00 0.00 ? 107 THR A OG1  3  
ATOM 6105  C CG2  . THR A 1 107 ? -6.760  5.831   -1.486  1.00 0.00 ? 107 THR A CG2  3  
ATOM 6106  H H    . THR A 1 107 ? -7.248  8.261   0.996   1.00 0.00 ? 107 THR A H    3  
ATOM 6107  H HA   . THR A 1 107 ? -6.799  5.314   1.029   1.00 0.00 ? 107 THR A HA   3  
ATOM 6108  H HB   . THR A 1 107 ? -4.860  6.123   -0.559  1.00 0.00 ? 107 THR A HB   3  
ATOM 6109  H HG1  . THR A 1 107 ? -5.509  8.382   0.012   1.00 0.00 ? 107 THR A HG1  3  
ATOM 6110  H HG21 . THR A 1 107 ? -7.789  5.940   -1.176  1.00 0.00 ? 107 THR A HG21 3  
ATOM 6111  H HG22 . THR A 1 107 ? -6.627  6.274   -2.460  1.00 0.00 ? 107 THR A HG22 3  
ATOM 6112  H HG23 . THR A 1 107 ? -6.509  4.781   -1.529  1.00 0.00 ? 107 THR A HG23 3  
ATOM 6113  N N    . SER A 1 108 ? -4.372  5.453   2.016   1.00 0.00 ? 108 SER A N    3  
ATOM 6114  C CA   . SER A 1 108 ? -3.211  5.502   2.961   1.00 0.00 ? 108 SER A CA   3  
ATOM 6115  C C    . SER A 1 108 ? -2.531  4.130   2.973   1.00 0.00 ? 108 SER A C    3  
ATOM 6116  O O    . SER A 1 108 ? -3.062  3.172   2.445   1.00 0.00 ? 108 SER A O    3  
ATOM 6117  C CB   . SER A 1 108 ? -3.699  5.819   4.379   1.00 0.00 ? 108 SER A CB   3  
ATOM 6118  O OG   . SER A 1 108 ? -4.956  5.189   4.595   1.00 0.00 ? 108 SER A OG   3  
ATOM 6119  H H    . SER A 1 108 ? -4.498  4.664   1.447   1.00 0.00 ? 108 SER A H    3  
ATOM 6120  H HA   . SER A 1 108 ? -2.514  6.259   2.642   1.00 0.00 ? 108 SER A HA   3  
ATOM 6121  H HB2  . SER A 1 108 ? -2.989  5.448   5.098   1.00 0.00 ? 108 SER A HB2  3  
ATOM 6122  H HB3  . SER A 1 108 ? -3.797  6.889   4.493   1.00 0.00 ? 108 SER A HB3  3  
ATOM 6123  H HG   . SER A 1 108 ? -5.096  5.124   5.542   1.00 0.00 ? 108 SER A HG   3  
ATOM 6124  N N    . TRP A 1 109 ? -1.389  4.012   3.608   1.00 0.00 ? 109 TRP A N    3  
ATOM 6125  C CA   . TRP A 1 109 ? -0.722  2.676   3.693   1.00 0.00 ? 109 TRP A CA   3  
ATOM 6126  C C    . TRP A 1 109 ? 0.290   2.672   4.810   1.00 0.00 ? 109 TRP A C    3  
ATOM 6127  O O    . TRP A 1 109 ? 0.965   3.653   5.060   1.00 0.00 ? 109 TRP A O    3  
ATOM 6128  C CB   . TRP A 1 109 ? -0.067  2.232   2.366   1.00 0.00 ? 109 TRP A CB   3  
ATOM 6129  C CG   . TRP A 1 109 ? 1.124   3.034   1.933   1.00 0.00 ? 109 TRP A CG   3  
ATOM 6130  C CD1  . TRP A 1 109 ? 1.156   3.762   0.797   1.00 0.00 ? 109 TRP A CD1  3  
ATOM 6131  C CD2  . TRP A 1 109 ? 2.467   3.141   2.525   1.00 0.00 ? 109 TRP A CD2  3  
ATOM 6132  N NE1  . TRP A 1 109 ? 2.412   4.319   0.648   1.00 0.00 ? 109 TRP A NE1  3  
ATOM 6133  C CE2  . TRP A 1 109 ? 3.255   3.974   1.684   1.00 0.00 ? 109 TRP A CE2  3  
ATOM 6134  C CE3  . TRP A 1 109 ? 3.078   2.621   3.693   1.00 0.00 ? 109 TRP A CE3  3  
ATOM 6135  C CZ2  . TRP A 1 109 ? 4.586   4.274   1.986   1.00 0.00 ? 109 TRP A CZ2  3  
ATOM 6136  C CZ3  . TRP A 1 109 ? 4.414   2.929   3.991   1.00 0.00 ? 109 TRP A CZ3  3  
ATOM 6137  C CH2  . TRP A 1 109 ? 5.162   3.750   3.141   1.00 0.00 ? 109 TRP A CH2  3  
ATOM 6138  H H    . TRP A 1 109 ? -0.995  4.790   4.064   1.00 0.00 ? 109 TRP A H    3  
ATOM 6139  H HA   . TRP A 1 109 ? -1.482  1.951   3.946   1.00 0.00 ? 109 TRP A HA   3  
ATOM 6140  H HB2  . TRP A 1 109 ? 0.263   1.224   2.475   1.00 0.00 ? 109 TRP A HB2  3  
ATOM 6141  H HB3  . TRP A 1 109 ? -0.810  2.265   1.588   1.00 0.00 ? 109 TRP A HB3  3  
ATOM 6142  H HD1  . TRP A 1 109 ? 0.328   3.885   0.115   1.00 0.00 ? 109 TRP A HD1  3  
ATOM 6143  H HE1  . TRP A 1 109 ? 2.689   4.897   -0.094  1.00 0.00 ? 109 TRP A HE1  3  
ATOM 6144  H HE3  . TRP A 1 109 ? 2.523   1.987   4.367   1.00 0.00 ? 109 TRP A HE3  3  
ATOM 6145  H HZ2  . TRP A 1 109 ? 5.172   4.905   1.329   1.00 0.00 ? 109 TRP A HZ2  3  
ATOM 6146  H HZ3  . TRP A 1 109 ? 4.869   2.527   4.884   1.00 0.00 ? 109 TRP A HZ3  3  
ATOM 6147  H HH2  . TRP A 1 109 ? 6.181   3.983   3.381   1.00 0.00 ? 109 TRP A HH2  3  
ATOM 6148  N N    . THR A 1 110 ? 0.393   1.563   5.495   1.00 0.00 ? 110 THR A N    3  
ATOM 6149  C CA   . THR A 1 110 ? 1.365   1.476   6.617   1.00 0.00 ? 110 THR A CA   3  
ATOM 6150  C C    . THR A 1 110 ? 2.205   0.210   6.488   1.00 0.00 ? 110 THR A C    3  
ATOM 6151  O O    . THR A 1 110 ? 1.721   -0.894  6.612   1.00 0.00 ? 110 THR A O    3  
ATOM 6152  C CB   . THR A 1 110 ? 0.626   1.471   7.951   1.00 0.00 ? 110 THR A CB   3  
ATOM 6153  O OG1  . THR A 1 110 ? -0.025  0.222   8.130   1.00 0.00 ? 110 THR A OG1  3  
ATOM 6154  C CG2  . THR A 1 110 ? -0.406  2.600   7.977   1.00 0.00 ? 110 THR A CG2  3  
ATOM 6155  H H    . THR A 1 110 ? -0.180  0.792   5.272   1.00 0.00 ? 110 THR A H    3  
ATOM 6156  H HA   . THR A 1 110 ? 2.019   2.328   6.576   1.00 0.00 ? 110 THR A HA   3  
ATOM 6157  H HB   . THR A 1 110 ? 1.337   1.626   8.742   1.00 0.00 ? 110 THR A HB   3  
ATOM 6158  H HG1  . THR A 1 110 ? -0.701  0.140   7.453   1.00 0.00 ? 110 THR A HG1  3  
ATOM 6159  H HG21 . THR A 1 110 ? -0.011  3.459   7.453   1.00 0.00 ? 110 THR A HG21 3  
ATOM 6160  H HG22 . THR A 1 110 ? -1.312  2.269   7.492   1.00 0.00 ? 110 THR A HG22 3  
ATOM 6161  H HG23 . THR A 1 110 ? -0.621  2.869   8.999   1.00 0.00 ? 110 THR A HG23 3  
ATOM 6162  N N    . ARG A 1 111 ? 3.471   0.385   6.252   1.00 0.00 ? 111 ARG A N    3  
ATOM 6163  C CA   . ARG A 1 111 ? 4.396   -0.781  6.113   1.00 0.00 ? 111 ARG A CA   3  
ATOM 6164  C C    . ARG A 1 111 ? 4.943   -1.140  7.490   1.00 0.00 ? 111 ARG A C    3  
ATOM 6165  O O    . ARG A 1 111 ? 5.452   -0.297  8.187   1.00 0.00 ? 111 ARG A O    3  
ATOM 6166  C CB   . ARG A 1 111 ? 5.540   -0.395  5.172   1.00 0.00 ? 111 ARG A CB   3  
ATOM 6167  C CG   . ARG A 1 111 ? 5.031   -0.404  3.733   1.00 0.00 ? 111 ARG A CG   3  
ATOM 6168  C CD   . ARG A 1 111 ? 6.102   0.163   2.803   1.00 0.00 ? 111 ARG A CD   3  
ATOM 6169  N NE   . ARG A 1 111 ? 5.456   0.633   1.546   1.00 0.00 ? 111 ARG A NE   3  
ATOM 6170  C CZ   . ARG A 1 111 ? 5.029   -0.232  0.666   1.00 0.00 ? 111 ARG A CZ   3  
ATOM 6171  N NH1  . ARG A 1 111 ? 5.774   -1.249  0.331   1.00 0.00 ? 111 ARG A NH1  3  
ATOM 6172  N NH2  . ARG A 1 111 ? 3.853   -0.079  0.121   1.00 0.00 ? 111 ARG A NH2  3  
ATOM 6173  H H    . ARG A 1 111 ? 3.819   1.299   6.177   1.00 0.00 ? 111 ARG A H    3  
ATOM 6174  H HA   . ARG A 1 111 ? 3.862   -1.627  5.711   1.00 0.00 ? 111 ARG A HA   3  
ATOM 6175  H HB2  . ARG A 1 111 ? 5.893   0.597   5.420   1.00 0.00 ? 111 ARG A HB2  3  
ATOM 6176  H HB3  . ARG A 1 111 ? 6.348   -1.101  5.270   1.00 0.00 ? 111 ARG A HB3  3  
ATOM 6177  H HG2  . ARG A 1 111 ? 4.798   -1.418  3.440   1.00 0.00 ? 111 ARG A HG2  3  
ATOM 6178  H HG3  . ARG A 1 111 ? 4.142   0.204   3.665   1.00 0.00 ? 111 ARG A HG3  3  
ATOM 6179  H HD2  . ARG A 1 111 ? 6.597   0.992   3.287   1.00 0.00 ? 111 ARG A HD2  3  
ATOM 6180  H HD3  . ARG A 1 111 ? 6.825   -0.605  2.573   1.00 0.00 ? 111 ARG A HD3  3  
ATOM 6181  H HE   . ARG A 1 111 ? 5.344   1.593   1.384   1.00 0.00 ? 111 ARG A HE   3  
ATOM 6182  H HH11 . ARG A 1 111 ? 6.675   -1.368  0.748   1.00 0.00 ? 111 ARG A HH11 3  
ATOM 6183  H HH12 . ARG A 1 111 ? 5.445   -1.910  -0.343  1.00 0.00 ? 111 ARG A HH12 3  
ATOM 6184  H HH21 . ARG A 1 111 ? 3.281   0.701   0.377   1.00 0.00 ? 111 ARG A HH21 3  
ATOM 6185  H HH22 . ARG A 1 111 ? 3.524   -0.740  -0.553  1.00 0.00 ? 111 ARG A HH22 3  
ATOM 6186  N N    . GLU A 1 112 ? 4.835   -2.379  7.897   1.00 0.00 ? 112 GLU A N    3  
ATOM 6187  C CA   . GLU A 1 112 ? 5.341   -2.758  9.247   1.00 0.00 ? 112 GLU A CA   3  
ATOM 6188  C C    . GLU A 1 112 ? 6.269   -3.968  9.129   1.00 0.00 ? 112 GLU A C    3  
ATOM 6189  O O    . GLU A 1 112 ? 6.108   -4.804  8.273   1.00 0.00 ? 112 GLU A O    3  
ATOM 6190  C CB   . GLU A 1 112 ? 4.125   -3.060  10.157  1.00 0.00 ? 112 GLU A CB   3  
ATOM 6191  C CG   . GLU A 1 112 ? 4.512   -3.925  11.371  1.00 0.00 ? 112 GLU A CG   3  
ATOM 6192  C CD   . GLU A 1 112 ? 3.384   -3.889  12.404  1.00 0.00 ? 112 GLU A CD   3  
ATOM 6193  O OE1  . GLU A 1 112 ? 2.245   -4.086  12.015  1.00 0.00 ? 112 GLU A OE1  3  
ATOM 6194  O OE2  . GLU A 1 112 ? 3.678   -3.663  13.566  1.00 0.00 ? 112 GLU A OE2  3  
ATOM 6195  H H    . GLU A 1 112 ? 4.418   -3.054  7.322   1.00 0.00 ? 112 GLU A H    3  
ATOM 6196  H HA   . GLU A 1 112 ? 5.899   -1.929  9.657   1.00 0.00 ? 112 GLU A HA   3  
ATOM 6197  H HB2  . GLU A 1 112 ? 3.714   -2.127  10.511  1.00 0.00 ? 112 GLU A HB2  3  
ATOM 6198  H HB3  . GLU A 1 112 ? 3.375   -3.574  9.579   1.00 0.00 ? 112 GLU A HB3  3  
ATOM 6199  H HG2  . GLU A 1 112 ? 4.673   -4.944  11.050  1.00 0.00 ? 112 GLU A HG2  3  
ATOM 6200  H HG3  . GLU A 1 112 ? 5.418   -3.540  11.815  1.00 0.00 ? 112 GLU A HG3  3  
ATOM 6201  N N    . LEU A 1 113 ? 7.238   -4.043  9.996   1.00 0.00 ? 113 LEU A N    3  
ATOM 6202  C CA   . LEU A 1 113 ? 8.204   -5.176  9.977   1.00 0.00 ? 113 LEU A CA   3  
ATOM 6203  C C    . LEU A 1 113 ? 7.919   -6.098  11.165  1.00 0.00 ? 113 LEU A C    3  
ATOM 6204  O O    . LEU A 1 113 ? 7.187   -5.742  12.070  1.00 0.00 ? 113 LEU A O    3  
ATOM 6205  C CB   . LEU A 1 113 ? 9.617   -4.595  10.103  1.00 0.00 ? 113 LEU A CB   3  
ATOM 6206  C CG   . LEU A 1 113 ? 10.181  -4.152  8.743   1.00 0.00 ? 113 LEU A CG   3  
ATOM 6207  C CD1  . LEU A 1 113 ? 10.741  -5.358  7.997   1.00 0.00 ? 113 LEU A CD1  3  
ATOM 6208  C CD2  . LEU A 1 113 ? 9.116   -3.461  7.896   1.00 0.00 ? 113 LEU A CD2  3  
ATOM 6209  H H    . LEU A 1 113 ? 7.336   -3.339  10.669  1.00 0.00 ? 113 LEU A H    3  
ATOM 6210  H HA   . LEU A 1 113 ? 8.113   -5.725  9.052   1.00 0.00 ? 113 LEU A HA   3  
ATOM 6211  H HB2  . LEU A 1 113 ? 9.580   -3.740  10.748  1.00 0.00 ? 113 LEU A HB2  3  
ATOM 6212  H HB3  . LEU A 1 113 ? 10.271  -5.339  10.535  1.00 0.00 ? 113 LEU A HB3  3  
ATOM 6213  H HG   . LEU A 1 113 ? 10.973  -3.453  8.913   1.00 0.00 ? 113 LEU A HG   3  
ATOM 6214  H HD11 . LEU A 1 113 ? 10.007  -6.148  7.988   1.00 0.00 ? 113 LEU A HD11 3  
ATOM 6215  H HD12 . LEU A 1 113 ? 10.982  -5.075  6.985   1.00 0.00 ? 113 LEU A HD12 3  
ATOM 6216  H HD13 . LEU A 1 113 ? 11.635  -5.703  8.497   1.00 0.00 ? 113 LEU A HD13 3  
ATOM 6217  H HD21 . LEU A 1 113 ? 8.750   -2.593  8.425   1.00 0.00 ? 113 LEU A HD21 3  
ATOM 6218  H HD22 . LEU A 1 113 ? 9.552   -3.159  6.963   1.00 0.00 ? 113 LEU A HD22 3  
ATOM 6219  H HD23 . LEU A 1 113 ? 8.305   -4.142  7.715   1.00 0.00 ? 113 LEU A HD23 3  
ATOM 6220  N N    . THR A 1 114 ? 8.492   -7.275  11.172  1.00 0.00 ? 114 THR A N    3  
ATOM 6221  C CA   . THR A 1 114 ? 8.254   -8.217  12.306  1.00 0.00 ? 114 THR A CA   3  
ATOM 6222  C C    . THR A 1 114 ? 9.400   -9.229  12.389  1.00 0.00 ? 114 THR A C    3  
ATOM 6223  O O    . THR A 1 114 ? 9.753   -9.862  11.414  1.00 0.00 ? 114 THR A O    3  
ATOM 6224  C CB   . THR A 1 114 ? 6.933   -8.957  12.087  1.00 0.00 ? 114 THR A CB   3  
ATOM 6225  O OG1  . THR A 1 114 ? 5.900   -8.014  11.840  1.00 0.00 ? 114 THR A OG1  3  
ATOM 6226  C CG2  . THR A 1 114 ? 6.592   -9.776  13.333  1.00 0.00 ? 114 THR A CG2  3  
ATOM 6227  H H    . THR A 1 114 ? 9.078   -7.538  10.432  1.00 0.00 ? 114 THR A H    3  
ATOM 6228  H HA   . THR A 1 114 ? 8.203   -7.659  13.229  1.00 0.00 ? 114 THR A HA   3  
ATOM 6229  H HB   . THR A 1 114 ? 7.026   -9.619  11.242  1.00 0.00 ? 114 THR A HB   3  
ATOM 6230  H HG1  . THR A 1 114 ? 5.246   -8.431  11.274  1.00 0.00 ? 114 THR A HG1  3  
ATOM 6231  H HG21 . THR A 1 114 ? 7.048   -9.319  14.199  1.00 0.00 ? 114 THR A HG21 3  
ATOM 6232  H HG22 . THR A 1 114 ? 5.520   -9.804  13.463  1.00 0.00 ? 114 THR A HG22 3  
ATOM 6233  H HG23 . THR A 1 114 ? 6.968   -10.782 13.217  1.00 0.00 ? 114 THR A HG23 3  
ATOM 6234  N N    . ASN A 1 115 ? 9.976   -9.381  13.555  1.00 0.00 ? 115 ASN A N    3  
ATOM 6235  C CA   . ASN A 1 115 ? 11.101  -10.348 13.735  1.00 0.00 ? 115 ASN A CA   3  
ATOM 6236  C C    . ASN A 1 115 ? 12.269  -9.974  12.806  1.00 0.00 ? 115 ASN A C    3  
ATOM 6237  O O    . ASN A 1 115 ? 13.142  -9.215  13.186  1.00 0.00 ? 115 ASN A O    3  
ATOM 6238  C CB   . ASN A 1 115 ? 10.608  -11.772 13.444  1.00 0.00 ? 115 ASN A CB   3  
ATOM 6239  C CG   . ASN A 1 115 ? 9.843   -12.304 14.658  1.00 0.00 ? 115 ASN A CG   3  
ATOM 6240  O OD1  . ASN A 1 115 ? 10.313  -12.212 15.774  1.00 0.00 ? 115 ASN A OD1  3  
ATOM 6241  N ND2  . ASN A 1 115 ? 8.676   -12.861 14.485  1.00 0.00 ? 115 ASN A ND2  3  
ATOM 6242  H H    . ASN A 1 115 ? 9.665   -8.855  14.319  1.00 0.00 ? 115 ASN A H    3  
ATOM 6243  H HA   . ASN A 1 115 ? 11.443  -10.298 14.757  1.00 0.00 ? 115 ASN A HA   3  
ATOM 6244  H HB2  . ASN A 1 115 ? 9.954   -11.758 12.584  1.00 0.00 ? 115 ASN A HB2  3  
ATOM 6245  H HB3  . ASN A 1 115 ? 11.453  -12.412 13.245  1.00 0.00 ? 115 ASN A HB3  3  
ATOM 6246  H HD21 . ASN A 1 115 ? 8.296   -12.935 13.585  1.00 0.00 ? 115 ASN A HD21 3  
ATOM 6247  H HD22 . ASN A 1 115 ? 8.178   -13.204 15.257  1.00 0.00 ? 115 ASN A HD22 3  
ATOM 6248  N N    . ASP A 1 116 ? 12.300  -10.493 11.600  1.00 0.00 ? 116 ASP A N    3  
ATOM 6249  C CA   . ASP A 1 116 ? 13.414  -10.160 10.666  1.00 0.00 ? 116 ASP A CA   3  
ATOM 6250  C C    . ASP A 1 116 ? 13.079  -10.679 9.268   1.00 0.00 ? 116 ASP A C    3  
ATOM 6251  O O    . ASP A 1 116 ? 13.951  -11.083 8.522   1.00 0.00 ? 116 ASP A O    3  
ATOM 6252  C CB   . ASP A 1 116 ? 14.703  -10.822 11.155  1.00 0.00 ? 116 ASP A CB   3  
ATOM 6253  C CG   . ASP A 1 116 ? 15.903  -9.963  10.755  1.00 0.00 ? 116 ASP A CG   3  
ATOM 6254  O OD1  . ASP A 1 116 ? 15.862  -9.386  9.680   1.00 0.00 ? 116 ASP A OD1  3  
ATOM 6255  O OD2  . ASP A 1 116 ? 16.844  -9.896  11.529  1.00 0.00 ? 116 ASP A OD2  3  
ATOM 6256  H H    . ASP A 1 116 ? 11.592  -11.103 11.311  1.00 0.00 ? 116 ASP A H    3  
ATOM 6257  H HA   . ASP A 1 116 ? 13.549  -9.089  10.631  1.00 0.00 ? 116 ASP A HA   3  
ATOM 6258  H HB2  . ASP A 1 116 ? 14.671  -10.920 12.231  1.00 0.00 ? 116 ASP A HB2  3  
ATOM 6259  H HB3  . ASP A 1 116 ? 14.795  -11.799 10.706  1.00 0.00 ? 116 ASP A HB3  3  
ATOM 6260  N N    . GLY A 1 117 ? 11.821  -10.670 8.910   1.00 0.00 ? 117 GLY A N    3  
ATOM 6261  C CA   . GLY A 1 117 ? 11.420  -11.163 7.558   1.00 0.00 ? 117 GLY A CA   3  
ATOM 6262  C C    . GLY A 1 117 ? 9.908   -11.382 7.512   1.00 0.00 ? 117 GLY A C    3  
ATOM 6263  O O    . GLY A 1 117 ? 9.426   -12.349 6.956   1.00 0.00 ? 117 GLY A O    3  
ATOM 6264  H H    . GLY A 1 117 ? 11.140  -10.338 9.532   1.00 0.00 ? 117 GLY A H    3  
ATOM 6265  H HA2  . GLY A 1 117 ? 11.699  -10.430 6.814   1.00 0.00 ? 117 GLY A HA2  3  
ATOM 6266  H HA3  . GLY A 1 117 ? 11.920  -12.090 7.349   1.00 0.00 ? 117 GLY A HA3  3  
ATOM 6267  N N    . GLU A 1 118 ? 9.163   -10.481 8.082   1.00 0.00 ? 118 GLU A N    3  
ATOM 6268  C CA   . GLU A 1 118 ? 7.678   -10.602 8.070   1.00 0.00 ? 118 GLU A CA   3  
ATOM 6269  C C    . GLU A 1 118 ? 7.099   -9.194  7.939   1.00 0.00 ? 118 GLU A C    3  
ATOM 6270  O O    . GLU A 1 118 ? 6.563   -8.633  8.877   1.00 0.00 ? 118 GLU A O    3  
ATOM 6271  C CB   . GLU A 1 118 ? 7.198   -11.251 9.370   1.00 0.00 ? 118 GLU A CB   3  
ATOM 6272  C CG   . GLU A 1 118 ? 7.044   -12.759 9.162   1.00 0.00 ? 118 GLU A CG   3  
ATOM 6273  C CD   . GLU A 1 118 ? 5.945   -13.291 10.083  1.00 0.00 ? 118 GLU A CD   3  
ATOM 6274  O OE1  . GLU A 1 118 ? 6.072   -13.121 11.284  1.00 0.00 ? 118 GLU A OE1  3  
ATOM 6275  O OE2  . GLU A 1 118 ? 4.995   -13.861 9.571   1.00 0.00 ? 118 GLU A OE2  3  
ATOM 6276  H H    . GLU A 1 118 ? 9.584   -9.709  8.510   1.00 0.00 ? 118 GLU A H    3  
ATOM 6277  H HA   . GLU A 1 118 ? 7.376   -11.204 7.223   1.00 0.00 ? 118 GLU A HA   3  
ATOM 6278  H HB2  . GLU A 1 118 ? 7.920   -11.066 10.152  1.00 0.00 ? 118 GLU A HB2  3  
ATOM 6279  H HB3  . GLU A 1 118 ? 6.245   -10.829 9.652   1.00 0.00 ? 118 GLU A HB3  3  
ATOM 6280  H HG2  . GLU A 1 118 ? 6.779   -12.955 8.133   1.00 0.00 ? 118 GLU A HG2  3  
ATOM 6281  H HG3  . GLU A 1 118 ? 7.976   -13.252 9.394   1.00 0.00 ? 118 GLU A HG3  3  
ATOM 6282  N N    . LEU A 1 119 ? 7.249   -8.610  6.783   1.00 0.00 ? 119 LEU A N    3  
ATOM 6283  C CA   . LEU A 1 119 ? 6.767   -7.219  6.555   1.00 0.00 ? 119 LEU A CA   3  
ATOM 6284  C C    . LEU A 1 119 ? 5.264   -7.197  6.237   1.00 0.00 ? 119 LEU A C    3  
ATOM 6285  O O    . LEU A 1 119 ? 4.858   -7.511  5.140   1.00 0.00 ? 119 LEU A O    3  
ATOM 6286  C CB   . LEU A 1 119 ? 7.552   -6.644  5.372   1.00 0.00 ? 119 LEU A CB   3  
ATOM 6287  C CG   . LEU A 1 119 ? 7.438   -5.117  5.342   1.00 0.00 ? 119 LEU A CG   3  
ATOM 6288  C CD1  . LEU A 1 119 ? 8.797   -4.499  4.998   1.00 0.00 ? 119 LEU A CD1  3  
ATOM 6289  C CD2  . LEU A 1 119 ? 6.415   -4.706  4.285   1.00 0.00 ? 119 LEU A CD2  3  
ATOM 6290  H H    . LEU A 1 119 ? 7.714   -9.083  6.062   1.00 0.00 ? 119 LEU A H    3  
ATOM 6291  H HA   . LEU A 1 119 ? 6.962   -6.627  7.432   1.00 0.00 ? 119 LEU A HA   3  
ATOM 6292  H HB2  . LEU A 1 119 ? 8.589   -6.926  5.468   1.00 0.00 ? 119 LEU A HB2  3  
ATOM 6293  H HB3  . LEU A 1 119 ? 7.159   -7.051  4.454   1.00 0.00 ? 119 LEU A HB3  3  
ATOM 6294  H HG   . LEU A 1 119 ? 7.121   -4.763  6.305   1.00 0.00 ? 119 LEU A HG   3  
ATOM 6295  H HD11 . LEU A 1 119 ? 9.564   -4.948  5.612   1.00 0.00 ? 119 LEU A HD11 3  
ATOM 6296  H HD12 . LEU A 1 119 ? 9.020   -4.676  3.958   1.00 0.00 ? 119 LEU A HD12 3  
ATOM 6297  H HD13 . LEU A 1 119 ? 8.766   -3.435  5.181   1.00 0.00 ? 119 LEU A HD13 3  
ATOM 6298  H HD21 . LEU A 1 119 ? 6.434   -5.420  3.474   1.00 0.00 ? 119 LEU A HD21 3  
ATOM 6299  H HD22 . LEU A 1 119 ? 5.431   -4.688  4.727   1.00 0.00 ? 119 LEU A HD22 3  
ATOM 6300  H HD23 . LEU A 1 119 ? 6.662   -3.726  3.909   1.00 0.00 ? 119 LEU A HD23 3  
ATOM 6301  N N    . ILE A 1 120 ? 4.435   -6.800  7.178   1.00 0.00 ? 120 ILE A N    3  
ATOM 6302  C CA   . ILE A 1 120 ? 2.965   -6.732  6.897   1.00 0.00 ? 120 ILE A CA   3  
ATOM 6303  C C    . ILE A 1 120 ? 2.644   -5.327  6.387   1.00 0.00 ? 120 ILE A C    3  
ATOM 6304  O O    . ILE A 1 120 ? 2.734   -4.357  7.109   1.00 0.00 ? 120 ILE A O    3  
ATOM 6305  C CB   . ILE A 1 120 ? 2.169   -7.065  8.166   1.00 0.00 ? 120 ILE A CB   3  
ATOM 6306  C CG1  . ILE A 1 120 ? 2.394   -5.999  9.247   1.00 0.00 ? 120 ILE A CG1  3  
ATOM 6307  C CG2  . ILE A 1 120 ? 2.640   -8.417  8.689   1.00 0.00 ? 120 ILE A CG2  3  
ATOM 6308  C CD1  . ILE A 1 120 ? 1.199   -5.043  9.272   1.00 0.00 ? 120 ILE A CD1  3  
ATOM 6309  H H    . ILE A 1 120 ? 4.782   -6.526  8.054   1.00 0.00 ? 120 ILE A H    3  
ATOM 6310  H HA   . ILE A 1 120 ? 2.721   -7.445  6.122   1.00 0.00 ? 120 ILE A HA   3  
ATOM 6311  H HB   . ILE A 1 120 ? 1.117   -7.124  7.923   1.00 0.00 ? 120 ILE A HB   3  
ATOM 6312  H HG12 . ILE A 1 120 ? 2.495   -6.475  10.213  1.00 0.00 ? 120 ILE A HG12 3  
ATOM 6313  H HG13 . ILE A 1 120 ? 3.292   -5.447  9.023   1.00 0.00 ? 120 ILE A HG13 3  
ATOM 6314  H HG21 . ILE A 1 120 ? 2.900   -9.051  7.855   1.00 0.00 ? 120 ILE A HG21 3  
ATOM 6315  H HG22 . ILE A 1 120 ? 3.507   -8.273  9.317   1.00 0.00 ? 120 ILE A HG22 3  
ATOM 6316  H HG23 . ILE A 1 120 ? 1.850   -8.875  9.261   1.00 0.00 ? 120 ILE A HG23 3  
ATOM 6317  H HD11 . ILE A 1 120 ? 0.881   -4.838  8.260   1.00 0.00 ? 120 ILE A HD11 3  
ATOM 6318  H HD12 . ILE A 1 120 ? 0.386   -5.498  9.818   1.00 0.00 ? 120 ILE A HD12 3  
ATOM 6319  H HD13 . ILE A 1 120 ? 1.484   -4.120  9.754   1.00 0.00 ? 120 ILE A HD13 3  
ATOM 6320  N N    . LEU A 1 121 ? 2.320   -5.214  5.130   1.00 0.00 ? 121 LEU A N    3  
ATOM 6321  C CA   . LEU A 1 121 ? 2.057   -3.878  4.537   1.00 0.00 ? 121 LEU A CA   3  
ATOM 6322  C C    . LEU A 1 121 ? 0.567   -3.717  4.176   1.00 0.00 ? 121 LEU A C    3  
ATOM 6323  O O    . LEU A 1 121 ? 0.005   -4.469  3.402   1.00 0.00 ? 121 LEU A O    3  
ATOM 6324  C CB   . LEU A 1 121 ? 2.987   -3.740  3.305   1.00 0.00 ? 121 LEU A CB   3  
ATOM 6325  C CG   . LEU A 1 121 ? 2.642   -2.539  2.405   1.00 0.00 ? 121 LEU A CG   3  
ATOM 6326  C CD1  . LEU A 1 121 ? 1.503   -2.916  1.461   1.00 0.00 ? 121 LEU A CD1  3  
ATOM 6327  C CD2  . LEU A 1 121 ? 2.228   -1.326  3.234   1.00 0.00 ? 121 LEU A CD2  3  
ATOM 6328  H H    . LEU A 1 121 ? 2.287   -6.009  4.566   1.00 0.00 ? 121 LEU A H    3  
ATOM 6329  H HA   . LEU A 1 121 ? 2.324   -3.119  5.256   1.00 0.00 ? 121 LEU A HA   3  
ATOM 6330  H HB2  . LEU A 1 121 ? 4.004   -3.623  3.653   1.00 0.00 ? 121 LEU A HB2  3  
ATOM 6331  H HB3  . LEU A 1 121 ? 2.927   -4.645  2.720   1.00 0.00 ? 121 LEU A HB3  3  
ATOM 6332  H HG   . LEU A 1 121 ? 3.517   -2.284  1.822   1.00 0.00 ? 121 LEU A HG   3  
ATOM 6333  H HD11 . LEU A 1 121 ? 1.524   -3.981  1.282   1.00 0.00 ? 121 LEU A HD11 3  
ATOM 6334  H HD12 . LEU A 1 121 ? 0.560   -2.644  1.911   1.00 0.00 ? 121 LEU A HD12 3  
ATOM 6335  H HD13 . LEU A 1 121 ? 1.622   -2.391  0.526   1.00 0.00 ? 121 LEU A HD13 3  
ATOM 6336  H HD21 . LEU A 1 121 ? 2.716   -1.363  4.192   1.00 0.00 ? 121 LEU A HD21 3  
ATOM 6337  H HD22 . LEU A 1 121 ? 2.509   -0.423  2.718   1.00 0.00 ? 121 LEU A HD22 3  
ATOM 6338  H HD23 . LEU A 1 121 ? 1.169   -1.345  3.373   1.00 0.00 ? 121 LEU A HD23 3  
ATOM 6339  N N    . THR A 1 122 ? -0.057  -2.716  4.752   1.00 0.00 ? 122 THR A N    3  
ATOM 6340  C CA   . THR A 1 122 ? -1.501  -2.423  4.499   1.00 0.00 ? 122 THR A CA   3  
ATOM 6341  C C    . THR A 1 122 ? -1.610  -1.206  3.580   1.00 0.00 ? 122 THR A C    3  
ATOM 6342  O O    . THR A 1 122 ? -0.709  -0.408  3.496   1.00 0.00 ? 122 THR A O    3  
ATOM 6343  C CB   . THR A 1 122 ? -2.167  -2.068  5.822   1.00 0.00 ? 122 THR A CB   3  
ATOM 6344  O OG1  . THR A 1 122 ? -1.946  -3.107  6.765   1.00 0.00 ? 122 THR A OG1  3  
ATOM 6345  C CG2  . THR A 1 122 ? -3.666  -1.866  5.613   1.00 0.00 ? 122 THR A CG2  3  
ATOM 6346  H H    . THR A 1 122 ? 0.440   -2.142  5.364   1.00 0.00 ? 122 THR A H    3  
ATOM 6347  H HA   . THR A 1 122 ? -1.996  -3.273  4.061   1.00 0.00 ? 122 THR A HA   3  
ATOM 6348  H HB   . THR A 1 122 ? -1.740  -1.152  6.183   1.00 0.00 ? 122 THR A HB   3  
ATOM 6349  H HG1  . THR A 1 122 ? -2.284  -2.813  7.614   1.00 0.00 ? 122 THR A HG1  3  
ATOM 6350  H HG21 . THR A 1 122 ? -4.049  -2.647  4.975   1.00 0.00 ? 122 THR A HG21 3  
ATOM 6351  H HG22 . THR A 1 122 ? -4.169  -1.897  6.568   1.00 0.00 ? 122 THR A HG22 3  
ATOM 6352  H HG23 . THR A 1 122 ? -3.834  -0.904  5.149   1.00 0.00 ? 122 THR A HG23 3  
ATOM 6353  N N    . MET A 1 123 ? -2.721  -1.037  2.927   1.00 0.00 ? 123 MET A N    3  
ATOM 6354  C CA   . MET A 1 123 ? -2.896  0.155   2.042   1.00 0.00 ? 123 MET A CA   3  
ATOM 6355  C C    . MET A 1 123 ? -4.382  0.412   1.836   1.00 0.00 ? 123 MET A C    3  
ATOM 6356  O O    . MET A 1 123 ? -5.007  -0.151  0.958   1.00 0.00 ? 123 MET A O    3  
ATOM 6357  C CB   . MET A 1 123 ? -2.219  -0.079  0.700   1.00 0.00 ? 123 MET A CB   3  
ATOM 6358  C CG   . MET A 1 123 ? -2.258  1.223   -0.115  1.00 0.00 ? 123 MET A CG   3  
ATOM 6359  S SD   . MET A 1 123 ? -3.556  1.133   -1.373  1.00 0.00 ? 123 MET A SD   3  
ATOM 6360  C CE   . MET A 1 123 ? -2.934  -0.340  -2.210  1.00 0.00 ? 123 MET A CE   3  
ATOM 6361  H H    . MET A 1 123 ? -3.451  -1.679  3.038   1.00 0.00 ? 123 MET A H    3  
ATOM 6362  H HA   . MET A 1 123 ? -2.449  1.013   2.511   1.00 0.00 ? 123 MET A HA   3  
ATOM 6363  H HB2  . MET A 1 123 ? -1.190  -0.366  0.867   1.00 0.00 ? 123 MET A HB2  3  
ATOM 6364  H HB3  . MET A 1 123 ? -2.733  -0.863  0.170   1.00 0.00 ? 123 MET A HB3  3  
ATOM 6365  H HG2  . MET A 1 123 ? -2.457  2.058   0.544   1.00 0.00 ? 123 MET A HG2  3  
ATOM 6366  H HG3  . MET A 1 123 ? -1.304  1.370   -0.591  1.00 0.00 ? 123 MET A HG3  3  
ATOM 6367  H HE1  . MET A 1 123 ? -1.860  -0.389  -2.092  1.00 0.00 ? 123 MET A HE1  3  
ATOM 6368  H HE2  . MET A 1 123 ? -3.381  -1.218  -1.770  1.00 0.00 ? 123 MET A HE2  3  
ATOM 6369  H HE3  . MET A 1 123 ? -3.188  -0.293  -3.257  1.00 0.00 ? 123 MET A HE3  3  
ATOM 6370  N N    . THR A 1 124 ? -4.949  1.251   2.656   1.00 0.00 ? 124 THR A N    3  
ATOM 6371  C CA   . THR A 1 124 ? -6.410  1.542   2.545   1.00 0.00 ? 124 THR A CA   3  
ATOM 6372  C C    . THR A 1 124 ? -6.700  2.346   1.294   1.00 0.00 ? 124 THR A C    3  
ATOM 6373  O O    . THR A 1 124 ? -5.807  2.834   0.626   1.00 0.00 ? 124 THR A O    3  
ATOM 6374  C CB   . THR A 1 124 ? -6.935  2.313   3.779   1.00 0.00 ? 124 THR A CB   3  
ATOM 6375  O OG1  . THR A 1 124 ? -6.835  3.718   3.568   1.00 0.00 ? 124 THR A OG1  3  
ATOM 6376  C CG2  . THR A 1 124 ? -6.152  1.946   5.043   1.00 0.00 ? 124 THR A CG2  3  
ATOM 6377  H H    . THR A 1 124 ? -4.415  1.676   3.356   1.00 0.00 ? 124 THR A H    3  
ATOM 6378  H HA   . THR A 1 124 ? -6.940  0.612   2.462   1.00 0.00 ? 124 THR A HA   3  
ATOM 6379  H HB   . THR A 1 124 ? -7.968  2.046   3.925   1.00 0.00 ? 124 THR A HB   3  
ATOM 6380  H HG1  . THR A 1 124 ? -7.580  3.990   3.027   1.00 0.00 ? 124 THR A HG1  3  
ATOM 6381  H HG21 . THR A 1 124 ? -5.655  1.000   4.894   1.00 0.00 ? 124 THR A HG21 3  
ATOM 6382  H HG22 . THR A 1 124 ? -5.417  2.713   5.243   1.00 0.00 ? 124 THR A HG22 3  
ATOM 6383  H HG23 . THR A 1 124 ? -6.832  1.871   5.877   1.00 0.00 ? 124 THR A HG23 3  
ATOM 6384  N N    . ALA A 1 125 ? -7.961  2.485   0.982   1.00 0.00 ? 125 ALA A N    3  
ATOM 6385  C CA   . ALA A 1 125 ? -8.338  3.266   -0.230  1.00 0.00 ? 125 ALA A CA   3  
ATOM 6386  C C    . ALA A 1 125 ? -9.852  3.410   -0.374  1.00 0.00 ? 125 ALA A C    3  
ATOM 6387  O O    . ALA A 1 125 ? -10.538 2.503   -0.799  1.00 0.00 ? 125 ALA A O    3  
ATOM 6388  C CB   . ALA A 1 125 ? -7.789  2.574   -1.473  1.00 0.00 ? 125 ALA A CB   3  
ATOM 6389  H H    . ALA A 1 125 ? -8.651  2.075   1.553   1.00 0.00 ? 125 ALA A H    3  
ATOM 6390  H HA   . ALA A 1 125 ? -7.907  4.234   -0.146  1.00 0.00 ? 125 ALA A HA   3  
ATOM 6391  H HB1  . ALA A 1 125 ? -6.857  2.088   -1.231  1.00 0.00 ? 125 ALA A HB1  3  
ATOM 6392  H HB2  . ALA A 1 125 ? -8.501  1.839   -1.816  1.00 0.00 ? 125 ALA A HB2  3  
ATOM 6393  H HB3  . ALA A 1 125 ? -7.626  3.306   -2.249  1.00 0.00 ? 125 ALA A HB3  3  
ATOM 6394  N N    . ASP A 1 126 ? -10.381 4.565   -0.066  1.00 0.00 ? 126 ASP A N    3  
ATOM 6395  C CA   . ASP A 1 126 ? -11.854 4.778   -0.212  1.00 0.00 ? 126 ASP A CA   3  
ATOM 6396  C C    . ASP A 1 126 ? -12.599 3.860   0.764   1.00 0.00 ? 126 ASP A C    3  
ATOM 6397  O O    . ASP A 1 126 ? -13.689 3.403   0.484   1.00 0.00 ? 126 ASP A O    3  
ATOM 6398  C CB   . ASP A 1 126 ? -12.282 4.460   -1.651  1.00 0.00 ? 126 ASP A CB   3  
ATOM 6399  C CG   . ASP A 1 126 ? -12.824 5.723   -2.329  1.00 0.00 ? 126 ASP A CG   3  
ATOM 6400  O OD1  . ASP A 1 126 ? -12.033 6.441   -2.917  1.00 0.00 ? 126 ASP A OD1  3  
ATOM 6401  O OD2  . ASP A 1 126 ? -14.021 5.948   -2.247  1.00 0.00 ? 126 ASP A OD2  3  
ATOM 6402  H H    . ASP A 1 126 ? -9.807  5.300   0.242   1.00 0.00 ? 126 ASP A H    3  
ATOM 6403  H HA   . ASP A 1 126 ? -12.085 5.806   0.018   1.00 0.00 ? 126 ASP A HA   3  
ATOM 6404  H HB2  . ASP A 1 126 ? -11.426 4.097   -2.199  1.00 0.00 ? 126 ASP A HB2  3  
ATOM 6405  H HB3  . ASP A 1 126 ? -13.049 3.701   -1.641  1.00 0.00 ? 126 ASP A HB3  3  
ATOM 6406  N N    . ASP A 1 127 ? -11.994 3.610   1.906   1.00 0.00 ? 127 ASP A N    3  
ATOM 6407  C CA   . ASP A 1 127 ? -12.587 2.740   2.990   1.00 0.00 ? 127 ASP A CA   3  
ATOM 6408  C C    . ASP A 1 127 ? -12.134 1.288   2.832   1.00 0.00 ? 127 ASP A C    3  
ATOM 6409  O O    . ASP A 1 127 ? -12.406 0.464   3.687   1.00 0.00 ? 127 ASP A O    3  
ATOM 6410  C CB   . ASP A 1 127 ? -14.122 2.799   3.007   1.00 0.00 ? 127 ASP A CB   3  
ATOM 6411  C CG   . ASP A 1 127 ? -14.630 2.550   4.428   1.00 0.00 ? 127 ASP A CG   3  
ATOM 6412  O OD1  . ASP A 1 127 ? -14.711 1.395   4.813   1.00 0.00 ? 127 ASP A OD1  3  
ATOM 6413  O OD2  . ASP A 1 127 ? -14.927 3.518   5.108   1.00 0.00 ? 127 ASP A OD2  3  
ATOM 6414  H H    . ASP A 1 127 ? -11.118 4.006   2.057   1.00 0.00 ? 127 ASP A H    3  
ATOM 6415  H HA   . ASP A 1 127 ? -12.221 3.101   3.942   1.00 0.00 ? 127 ASP A HA   3  
ATOM 6416  H HB2  . ASP A 1 127 ? -14.447 3.774   2.673   1.00 0.00 ? 127 ASP A HB2  3  
ATOM 6417  H HB3  . ASP A 1 127 ? -14.517 2.042   2.347   1.00 0.00 ? 127 ASP A HB3  3  
ATOM 6418  N N    . VAL A 1 128 ? -11.433 0.960   1.773   1.00 0.00 ? 128 VAL A N    3  
ATOM 6419  C CA   . VAL A 1 128 ? -10.960 -0.433  1.606   1.00 0.00 ? 128 VAL A CA   3  
ATOM 6420  C C    . VAL A 1 128 ? -9.639  -0.580  2.359   1.00 0.00 ? 128 VAL A C    3  
ATOM 6421  O O    . VAL A 1 128 ? -9.109  0.381   2.875   1.00 0.00 ? 128 VAL A O    3  
ATOM 6422  C CB   . VAL A 1 128 ? -10.753 -0.735  0.110   1.00 0.00 ? 128 VAL A CB   3  
ATOM 6423  C CG1  . VAL A 1 128 ? -12.005 -0.342  -0.681  1.00 0.00 ? 128 VAL A CG1  3  
ATOM 6424  C CG2  . VAL A 1 128 ? -9.556  0.044   -0.440  1.00 0.00 ? 128 VAL A CG2  3  
ATOM 6425  H H    . VAL A 1 128 ? -11.203 1.626   1.098   1.00 0.00 ? 128 VAL A H    3  
ATOM 6426  H HA   . VAL A 1 128 ? -11.686 -1.116  2.018   1.00 0.00 ? 128 VAL A HA   3  
ATOM 6427  H HB   . VAL A 1 128 ? -10.571 -1.782  -0.008  1.00 0.00 ? 128 VAL A HB   3  
ATOM 6428  H HG11 . VAL A 1 128 ? -12.869 -0.397  -0.040  1.00 0.00 ? 128 VAL A HG11 3  
ATOM 6429  H HG12 . VAL A 1 128 ? -11.895 0.668   -1.048  1.00 0.00 ? 128 VAL A HG12 3  
ATOM 6430  H HG13 . VAL A 1 128 ? -12.130 -1.014  -1.515  1.00 0.00 ? 128 VAL A HG13 3  
ATOM 6431  H HG21 . VAL A 1 128 ? -9.386  0.902   0.180   1.00 0.00 ? 128 VAL A HG21 3  
ATOM 6432  H HG22 . VAL A 1 128 ? -8.680  -0.586  -0.431  1.00 0.00 ? 128 VAL A HG22 3  
ATOM 6433  H HG23 . VAL A 1 128 ? -9.762  0.364   -1.450  1.00 0.00 ? 128 VAL A HG23 3  
ATOM 6434  N N    . VAL A 1 129 ? -9.106  -1.762  2.401   1.00 0.00 ? 129 VAL A N    3  
ATOM 6435  C CA   . VAL A 1 129 ? -7.806  -1.972  3.087   1.00 0.00 ? 129 VAL A CA   3  
ATOM 6436  C C    . VAL A 1 129 ? -7.125  -3.214  2.512   1.00 0.00 ? 129 VAL A C    3  
ATOM 6437  O O    . VAL A 1 129 ? -7.583  -4.326  2.670   1.00 0.00 ? 129 VAL A O    3  
ATOM 6438  C CB   . VAL A 1 129 ? -8.038  -2.049  4.615   1.00 0.00 ? 129 VAL A CB   3  
ATOM 6439  C CG1  . VAL A 1 129 ? -7.135  -3.105  5.292   1.00 0.00 ? 129 VAL A CG1  3  
ATOM 6440  C CG2  . VAL A 1 129 ? -7.743  -0.665  5.220   1.00 0.00 ? 129 VAL A CG2  3  
ATOM 6441  H H    . VAL A 1 129 ? -9.556  -2.508  1.970   1.00 0.00 ? 129 VAL A H    3  
ATOM 6442  H HA   . VAL A 1 129 ? -7.177  -1.129  2.875   1.00 0.00 ? 129 VAL A HA   3  
ATOM 6443  H HB   . VAL A 1 129 ? -9.071  -2.290  4.792   1.00 0.00 ? 129 VAL A HB   3  
ATOM 6444  H HG11 . VAL A 1 129 ? -6.142  -3.055  4.867   1.00 0.00 ? 129 VAL A HG11 3  
ATOM 6445  H HG12 . VAL A 1 129 ? -7.082  -2.912  6.352   1.00 0.00 ? 129 VAL A HG12 3  
ATOM 6446  H HG13 . VAL A 1 129 ? -7.547  -4.091  5.125   1.00 0.00 ? 129 VAL A HG13 3  
ATOM 6447  H HG21 . VAL A 1 129 ? -7.593  0.048   4.427   1.00 0.00 ? 129 VAL A HG21 3  
ATOM 6448  H HG22 . VAL A 1 129 ? -8.577  -0.350  5.826   1.00 0.00 ? 129 VAL A HG22 3  
ATOM 6449  H HG23 . VAL A 1 129 ? -6.851  -0.711  5.826   1.00 0.00 ? 129 VAL A HG23 3  
ATOM 6450  N N    . CYS A 1 130 ? -6.020  -3.002  1.857   1.00 0.00 ? 130 CYS A N    3  
ATOM 6451  C CA   . CYS A 1 130 ? -5.259  -4.136  1.261   1.00 0.00 ? 130 CYS A CA   3  
ATOM 6452  C C    . CYS A 1 130 ? -4.187  -4.584  2.254   1.00 0.00 ? 130 CYS A C    3  
ATOM 6453  O O    . CYS A 1 130 ? -3.091  -4.056  2.277   1.00 0.00 ? 130 CYS A O    3  
ATOM 6454  C CB   . CYS A 1 130 ? -4.593  -3.678  -0.039  1.00 0.00 ? 130 CYS A CB   3  
ATOM 6455  S SG   . CYS A 1 130 ? -4.311  -5.109  -1.110  1.00 0.00 ? 130 CYS A SG   3  
ATOM 6456  H H    . CYS A 1 130 ? -5.685  -2.082  1.769   1.00 0.00 ? 130 CYS A H    3  
ATOM 6457  H HA   . CYS A 1 130 ? -5.931  -4.957  1.055   1.00 0.00 ? 130 CYS A HA   3  
ATOM 6458  H HB2  . CYS A 1 130 ? -5.236  -2.972  -0.543  1.00 0.00 ? 130 CYS A HB2  3  
ATOM 6459  H HB3  . CYS A 1 130 ? -3.648  -3.206  0.188   1.00 0.00 ? 130 CYS A HB3  3  
ATOM 6460  H HG   . CYS A 1 130 ? -3.901  -4.798  -1.919  1.00 0.00 ? 130 CYS A HG   3  
ATOM 6461  N N    . THR A 1 131 ? -4.505  -5.543  3.084   1.00 0.00 ? 131 THR A N    3  
ATOM 6462  C CA   . THR A 1 131 ? -3.520  -6.025  4.095   1.00 0.00 ? 131 THR A CA   3  
ATOM 6463  C C    . THR A 1 131 ? -2.961  -7.380  3.674   1.00 0.00 ? 131 THR A C    3  
ATOM 6464  O O    . THR A 1 131 ? -3.699  -8.311  3.413   1.00 0.00 ? 131 THR A O    3  
ATOM 6465  C CB   . THR A 1 131 ? -4.219  -6.186  5.444   1.00 0.00 ? 131 THR A CB   3  
ATOM 6466  O OG1  . THR A 1 131 ? -5.274  -5.239  5.546   1.00 0.00 ? 131 THR A OG1  3  
ATOM 6467  C CG2  . THR A 1 131 ? -3.214  -5.960  6.575   1.00 0.00 ? 131 THR A CG2  3  
ATOM 6468  H H    . THR A 1 131 ? -5.400  -5.940  3.049   1.00 0.00 ? 131 THR A H    3  
ATOM 6469  H HA   . THR A 1 131 ? -2.711  -5.313  4.189   1.00 0.00 ? 131 THR A HA   3  
ATOM 6470  H HB   . THR A 1 131 ? -4.621  -7.187  5.519   1.00 0.00 ? 131 THR A HB   3  
ATOM 6471  H HG1  . THR A 1 131 ? -5.711  -5.372  6.390   1.00 0.00 ? 131 THR A HG1  3  
ATOM 6472  H HG21 . THR A 1 131 ? -2.220  -6.193  6.224   1.00 0.00 ? 131 THR A HG21 3  
ATOM 6473  H HG22 . THR A 1 131 ? -3.253  -4.928  6.890   1.00 0.00 ? 131 THR A HG22 3  
ATOM 6474  H HG23 . THR A 1 131 ? -3.461  -6.601  7.408   1.00 0.00 ? 131 THR A HG23 3  
ATOM 6475  N N    . ARG A 1 132 ? -1.662  -7.500  3.626   1.00 0.00 ? 132 ARG A N    3  
ATOM 6476  C CA   . ARG A 1 132 ? -1.046  -8.806  3.243   1.00 0.00 ? 132 ARG A CA   3  
ATOM 6477  C C    . ARG A 1 132 ? 0.354   -8.894  3.837   1.00 0.00 ? 132 ARG A C    3  
ATOM 6478  O O    . ARG A 1 132 ? 1.150   -7.982  3.719   1.00 0.00 ? 132 ARG A O    3  
ATOM 6479  C CB   . ARG A 1 132 ? -0.975  -8.966  1.715   1.00 0.00 ? 132 ARG A CB   3  
ATOM 6480  C CG   . ARG A 1 132 ? -0.764  -7.617  1.022   1.00 0.00 ? 132 ARG A CG   3  
ATOM 6481  C CD   . ARG A 1 132 ? -0.410  -7.857  -0.445  1.00 0.00 ? 132 ARG A CD   3  
ATOM 6482  N NE   . ARG A 1 132 ? -0.510  -6.576  -1.199  1.00 0.00 ? 132 ARG A NE   3  
ATOM 6483  C CZ   . ARG A 1 132 ? -0.497  -6.584  -2.504  1.00 0.00 ? 132 ARG A CZ   3  
ATOM 6484  N NH1  . ARG A 1 132 ? -1.393  -7.267  -3.161  1.00 0.00 ? 132 ARG A NH1  3  
ATOM 6485  N NH2  . ARG A 1 132 ? 0.413   -5.908  -3.151  1.00 0.00 ? 132 ARG A NH2  3  
ATOM 6486  H H    . ARG A 1 132 ? -1.088  -6.733  3.854   1.00 0.00 ? 132 ARG A H    3  
ATOM 6487  H HA   . ARG A 1 132 ? -1.646  -9.606  3.653   1.00 0.00 ? 132 ARG A HA   3  
ATOM 6488  H HB2  . ARG A 1 132 ? -0.156  -9.622  1.465   1.00 0.00 ? 132 ARG A HB2  3  
ATOM 6489  H HB3  . ARG A 1 132 ? -1.896  -9.400  1.366   1.00 0.00 ? 132 ARG A HB3  3  
ATOM 6490  H HG2  . ARG A 1 132 ? -1.671  -7.035  1.085   1.00 0.00 ? 132 ARG A HG2  3  
ATOM 6491  H HG3  . ARG A 1 132 ? 0.038   -7.086  1.503   1.00 0.00 ? 132 ARG A HG3  3  
ATOM 6492  H HD2  . ARG A 1 132 ? 0.596   -8.240  -0.513  1.00 0.00 ? 132 ARG A HD2  3  
ATOM 6493  H HD3  . ARG A 1 132 ? -1.096  -8.577  -0.865  1.00 0.00 ? 132 ARG A HD3  3  
ATOM 6494  H HE   . ARG A 1 132 ? -0.586  -5.727  -0.714  1.00 0.00 ? 132 ARG A HE   3  
ATOM 6495  H HH11 . ARG A 1 132 ? -2.090  -7.785  -2.665  1.00 0.00 ? 132 ARG A HH11 3  
ATOM 6496  H HH12 . ARG A 1 132 ? -1.383  -7.273  -4.161  1.00 0.00 ? 132 ARG A HH12 3  
ATOM 6497  H HH21 . ARG A 1 132 ? 1.100   -5.384  -2.647  1.00 0.00 ? 132 ARG A HH21 3  
ATOM 6498  H HH22 . ARG A 1 132 ? 0.423   -5.914  -4.151  1.00 0.00 ? 132 ARG A HH22 3  
ATOM 6499  N N    . VAL A 1 133 ? 0.655   -9.992  4.481   1.00 0.00 ? 133 VAL A N    3  
ATOM 6500  C CA   . VAL A 1 133 ? 1.999   -10.158 5.095   1.00 0.00 ? 133 VAL A CA   3  
ATOM 6501  C C    . VAL A 1 133 ? 3.022   -10.405 3.993   1.00 0.00 ? 133 VAL A C    3  
ATOM 6502  O O    . VAL A 1 133 ? 2.701   -10.883 2.929   1.00 0.00 ? 133 VAL A O    3  
ATOM 6503  C CB   . VAL A 1 133 ? 1.967   -11.350 6.068   1.00 0.00 ? 133 VAL A CB   3  
ATOM 6504  C CG1  . VAL A 1 133 ? 3.383   -11.680 6.559   1.00 0.00 ? 133 VAL A CG1  3  
ATOM 6505  C CG2  . VAL A 1 133 ? 1.088   -10.995 7.268   1.00 0.00 ? 133 VAL A CG2  3  
ATOM 6506  H H    . VAL A 1 133 ? -0.009  -10.711 4.559   1.00 0.00 ? 133 VAL A H    3  
ATOM 6507  H HA   . VAL A 1 133 ? 2.266   -9.262  5.633   1.00 0.00 ? 133 VAL A HA   3  
ATOM 6508  H HB   . VAL A 1 133 ? 1.555   -12.212 5.566   1.00 0.00 ? 133 VAL A HB   3  
ATOM 6509  H HG11 . VAL A 1 133 ? 3.884   -10.769 6.847   1.00 0.00 ? 133 VAL A HG11 3  
ATOM 6510  H HG12 . VAL A 1 133 ? 3.324   -12.345 7.406   1.00 0.00 ? 133 VAL A HG12 3  
ATOM 6511  H HG13 . VAL A 1 133 ? 3.935   -12.158 5.761   1.00 0.00 ? 133 VAL A HG13 3  
ATOM 6512  H HG21 . VAL A 1 133 ? 1.099   -9.925  7.418   1.00 0.00 ? 133 VAL A HG21 3  
ATOM 6513  H HG22 . VAL A 1 133 ? 0.076   -11.322 7.082   1.00 0.00 ? 133 VAL A HG22 3  
ATOM 6514  H HG23 . VAL A 1 133 ? 1.469   -11.486 8.151   1.00 0.00 ? 133 VAL A HG23 3  
ATOM 6515  N N    . TYR A 1 134 ? 4.255   -10.094 4.262   1.00 0.00 ? 134 TYR A N    3  
ATOM 6516  C CA   . TYR A 1 134 ? 5.324   -10.322 3.262   1.00 0.00 ? 134 TYR A CA   3  
ATOM 6517  C C    . TYR A 1 134 ? 6.506   -10.988 3.949   1.00 0.00 ? 134 TYR A C    3  
ATOM 6518  O O    . TYR A 1 134 ? 6.556   -11.093 5.159   1.00 0.00 ? 134 TYR A O    3  
ATOM 6519  C CB   . TYR A 1 134 ? 5.833   -9.003  2.711   1.00 0.00 ? 134 TYR A CB   3  
ATOM 6520  C CG   . TYR A 1 134 ? 4.818   -8.368  1.807   1.00 0.00 ? 134 TYR A CG   3  
ATOM 6521  C CD1  . TYR A 1 134 ? 3.675   -7.783  2.351   1.00 0.00 ? 134 TYR A CD1  3  
ATOM 6522  C CD2  . TYR A 1 134 ? 5.034   -8.340  0.427   1.00 0.00 ? 134 TYR A CD2  3  
ATOM 6523  C CE1  . TYR A 1 134 ? 2.744   -7.169  1.518   1.00 0.00 ? 134 TYR A CE1  3  
ATOM 6524  C CE2  . TYR A 1 134 ? 4.102   -7.729  -0.411  1.00 0.00 ? 134 TYR A CE2  3  
ATOM 6525  C CZ   . TYR A 1 134 ? 2.953   -7.140  0.133   1.00 0.00 ? 134 TYR A CZ   3  
ATOM 6526  O OH   . TYR A 1 134 ? 2.032   -6.530  -0.693  1.00 0.00 ? 134 TYR A OH   3  
ATOM 6527  H H    . TYR A 1 134 ? 4.480   -9.719  5.136   1.00 0.00 ? 134 TYR A H    3  
ATOM 6528  H HA   . TYR A 1 134 ? 4.952   -10.936 2.456   1.00 0.00 ? 134 TYR A HA   3  
ATOM 6529  H HB2  . TYR A 1 134 ? 6.051   -8.339  3.524   1.00 0.00 ? 134 TYR A HB2  3  
ATOM 6530  H HB3  . TYR A 1 134 ? 6.734   -9.191  2.160   1.00 0.00 ? 134 TYR A HB3  3  
ATOM 6531  H HD1  . TYR A 1 134 ? 3.509   -7.809  3.416   1.00 0.00 ? 134 TYR A HD1  3  
ATOM 6532  H HD2  . TYR A 1 134 ? 5.918   -8.794  0.008   1.00 0.00 ? 134 TYR A HD2  3  
ATOM 6533  H HE1  . TYR A 1 134 ? 1.867   -6.717  1.945   1.00 0.00 ? 134 TYR A HE1  3  
ATOM 6534  H HE2  . TYR A 1 134 ? 4.272   -7.710  -1.475  1.00 0.00 ? 134 TYR A HE2  3  
ATOM 6535  H HH   . TYR A 1 134 ? 2.272   -5.604  -0.772  1.00 0.00 ? 134 TYR A HH   3  
ATOM 6536  N N    . VAL A 1 135 ? 7.477   -11.382 3.184   1.00 0.00 ? 135 VAL A N    3  
ATOM 6537  C CA   . VAL A 1 135 ? 8.700   -11.982 3.760   1.00 0.00 ? 135 VAL A CA   3  
ATOM 6538  C C    . VAL A 1 135 ? 9.863   -11.523 2.899   1.00 0.00 ? 135 VAL A C    3  
ATOM 6539  O O    . VAL A 1 135 ? 9.658   -11.063 1.799   1.00 0.00 ? 135 VAL A O    3  
ATOM 6540  C CB   . VAL A 1 135 ? 8.606   -13.490 3.748   1.00 0.00 ? 135 VAL A CB   3  
ATOM 6541  C CG1  . VAL A 1 135 ? 9.859   -14.066 4.388   1.00 0.00 ? 135 VAL A CG1  3  
ATOM 6542  C CG2  . VAL A 1 135 ? 7.384   -13.914 4.551   1.00 0.00 ? 135 VAL A CG2  3  
ATOM 6543  H H    . VAL A 1 135 ? 7.418   -11.248 2.216   1.00 0.00 ? 135 VAL A H    3  
ATOM 6544  H HA   . VAL A 1 135 ? 8.830   -11.634 4.770   1.00 0.00 ? 135 VAL A HA   3  
ATOM 6545  H HB   . VAL A 1 135 ? 8.525   -13.835 2.737   1.00 0.00 ? 135 VAL A HB   3  
ATOM 6546  H HG11 . VAL A 1 135 ? 10.192  -13.404 5.171   1.00 0.00 ? 135 VAL A HG11 3  
ATOM 6547  H HG12 . VAL A 1 135 ? 9.637   -15.034 4.801   1.00 0.00 ? 135 VAL A HG12 3  
ATOM 6548  H HG13 . VAL A 1 135 ? 10.630  -14.154 3.639   1.00 0.00 ? 135 VAL A HG13 3  
ATOM 6549  H HG21 . VAL A 1 135 ? 6.500   -13.473 4.117   1.00 0.00 ? 135 VAL A HG21 3  
ATOM 6550  H HG22 . VAL A 1 135 ? 7.299   -14.988 4.535   1.00 0.00 ? 135 VAL A HG22 3  
ATOM 6551  H HG23 . VAL A 1 135 ? 7.492   -13.573 5.570   1.00 0.00 ? 135 VAL A HG23 3  
ATOM 6552  N N    . ARG A 1 136 ? 11.069  -11.618 3.370   1.00 0.00 ? 136 ARG A N    3  
ATOM 6553  C CA   . ARG A 1 136 ? 12.194  -11.143 2.518   1.00 0.00 ? 136 ARG A CA   3  
ATOM 6554  C C    . ARG A 1 136 ? 12.605  -12.243 1.548   1.00 0.00 ? 136 ARG A C    3  
ATOM 6555  O O    . ARG A 1 136 ? 13.055  -13.304 1.934   1.00 0.00 ? 136 ARG A O    3  
ATOM 6556  C CB   . ARG A 1 136 ? 13.395  -10.704 3.355   1.00 0.00 ? 136 ARG A CB   3  
ATOM 6557  C CG   . ARG A 1 136 ? 13.425  -9.176  3.437   1.00 0.00 ? 136 ARG A CG   3  
ATOM 6558  C CD   . ARG A 1 136 ? 13.933  -8.744  4.814   1.00 0.00 ? 136 ARG A CD   3  
ATOM 6559  N NE   . ARG A 1 136 ? 15.313  -9.267  5.020   1.00 0.00 ? 136 ARG A NE   3  
ATOM 6560  C CZ   . ARG A 1 136 ? 16.208  -8.530  5.619   1.00 0.00 ? 136 ARG A CZ   3  
ATOM 6561  N NH1  . ARG A 1 136 ? 16.783  -7.551  4.977   1.00 0.00 ? 136 ARG A NH1  3  
ATOM 6562  N NH2  . ARG A 1 136 ? 16.528  -8.773  6.861   1.00 0.00 ? 136 ARG A NH2  3  
ATOM 6563  H H    . ARG A 1 136 ? 11.225  -11.985 4.263   1.00 0.00 ? 136 ARG A H    3  
ATOM 6564  H HA   . ARG A 1 136 ? 11.835  -10.298 1.945   1.00 0.00 ? 136 ARG A HA   3  
ATOM 6565  H HB2  . ARG A 1 136 ? 13.324  -11.121 4.346   1.00 0.00 ? 136 ARG A HB2  3  
ATOM 6566  H HB3  . ARG A 1 136 ? 14.300  -11.046 2.877   1.00 0.00 ? 136 ARG A HB3  3  
ATOM 6567  H HG2  . ARG A 1 136 ? 14.081  -8.791  2.670   1.00 0.00 ? 136 ARG A HG2  3  
ATOM 6568  H HG3  . ARG A 1 136 ? 12.430  -8.789  3.283   1.00 0.00 ? 136 ARG A HG3  3  
ATOM 6569  H HD2  . ARG A 1 136 ? 13.945  -7.665  4.871   1.00 0.00 ? 136 ARG A HD2  3  
ATOM 6570  H HD3  . ARG A 1 136 ? 13.280  -9.137  5.579   1.00 0.00 ? 136 ARG A HD3  3  
ATOM 6571  H HE   . ARG A 1 136 ? 15.548  -10.166 4.706   1.00 0.00 ? 136 ARG A HE   3  
ATOM 6572  H HH11 . ARG A 1 136 ? 16.538  -7.365  4.025   1.00 0.00 ? 136 ARG A HH11 3  
ATOM 6573  H HH12 . ARG A 1 136 ? 17.469  -6.986  5.436   1.00 0.00 ? 136 ARG A HH12 3  
ATOM 6574  H HH21 . ARG A 1 136 ? 16.087  -9.524  7.353   1.00 0.00 ? 136 ARG A HH21 3  
ATOM 6575  H HH22 . ARG A 1 136 ? 17.214  -8.209  7.320   1.00 0.00 ? 136 ARG A HH22 3  
ATOM 6576  N N    . GLU A 1 137 ? 12.441  -11.980 0.284   1.00 0.00 ? 137 GLU A N    3  
ATOM 6577  C CA   . GLU A 1 137 ? 12.800  -12.977 -0.765  1.00 0.00 ? 137 GLU A CA   3  
ATOM 6578  C C    . GLU A 1 137 ? 14.272  -13.382 -0.626  1.00 0.00 ? 137 GLU A C    3  
ATOM 6579  O O    . GLU A 1 137 ? 15.121  -12.591 -1.002  1.00 0.00 ? 137 GLU A O    3  
ATOM 6580  C CB   . GLU A 1 137 ? 12.573  -12.362 -2.148  1.00 0.00 ? 137 GLU A CB   3  
ATOM 6581  C CG   . GLU A 1 137 ? 12.470  -13.476 -3.191  1.00 0.00 ? 137 GLU A CG   3  
ATOM 6582  C CD   . GLU A 1 137 ? 12.474  -12.865 -4.593  1.00 0.00 ? 137 GLU A CD   3  
ATOM 6583  O OE1  . GLU A 1 137 ? 11.839  -11.838 -4.773  1.00 0.00 ? 137 GLU A OE1  3  
ATOM 6584  O OE2  . GLU A 1 137 ? 13.111  -13.434 -5.464  1.00 0.00 ? 137 GLU A OE2  3  
ATOM 6585  O OXT  . GLU A 1 137 ? 14.523  -14.475 -0.146  1.00 0.00 ? 137 GLU A OXT  3  
ATOM 6586  H H    . GLU A 1 137 ? 12.069  -11.117 0.027   1.00 0.00 ? 137 GLU A H    3  
ATOM 6587  H HA   . GLU A 1 137 ? 12.174  -13.846 -0.656  1.00 0.00 ? 137 GLU A HA   3  
ATOM 6588  H HB2  . GLU A 1 137 ? 11.657  -11.789 -2.139  1.00 0.00 ? 137 GLU A HB2  3  
ATOM 6589  H HB3  . GLU A 1 137 ? 13.401  -11.715 -2.395  1.00 0.00 ? 137 GLU A HB3  3  
ATOM 6590  H HG2  . GLU A 1 137 ? 13.311  -14.145 -3.087  1.00 0.00 ? 137 GLU A HG2  3  
ATOM 6591  H HG3  . GLU A 1 137 ? 11.552  -14.025 -3.042  1.00 0.00 ? 137 GLU A HG3  3  
ATOM 6592  N N    . PRO A 1 1   ? -16.715 -0.394  8.444   1.00 0.00 ? 1   PRO A N    4  
ATOM 6593  C CA   . PRO A 1 1   ? -15.395 0.227   8.801   1.00 0.00 ? 1   PRO A CA   4  
ATOM 6594  C C    . PRO A 1 1   ? -15.374 1.709   8.374   1.00 0.00 ? 1   PRO A C    4  
ATOM 6595  O O    . PRO A 1 1   ? -16.416 2.331   8.266   1.00 0.00 ? 1   PRO A O    4  
ATOM 6596  C CB   . PRO A 1 1   ? -14.293 -0.574  8.102   1.00 0.00 ? 1   PRO A CB   4  
ATOM 6597  C CG   . PRO A 1 1   ? -14.970 -1.691  7.317   1.00 0.00 ? 1   PRO A CG   4  
ATOM 6598  C CD   . PRO A 1 1   ? -16.472 -1.578  7.565   1.00 0.00 ? 1   PRO A CD   4  
ATOM 6599  H H2   . PRO A 1 1   ? -17.310 0.293   7.939   1.00 0.00 ? 1   PRO A H2   4  
ATOM 6600  H H3   . PRO A 1 1   ? -17.200 -0.700  9.313   1.00 0.00 ? 1   PRO A H3   4  
ATOM 6601  H HA   . PRO A 1 1   ? -15.254 0.166   9.871   1.00 0.00 ? 1   PRO A HA   4  
ATOM 6602  H HB2  . PRO A 1 1   ? -13.738 0.058   7.437   1.00 0.00 ? 1   PRO A HB2  4  
ATOM 6603  H HB3  . PRO A 1 1   ? -13.630 -1.004  8.837   1.00 0.00 ? 1   PRO A HB3  4  
ATOM 6604  H HG2  . PRO A 1 1   ? -14.760 -1.577  6.262   1.00 0.00 ? 1   PRO A HG2  4  
ATOM 6605  H HG3  . PRO A 1 1   ? -14.617 -2.650  7.662   1.00 0.00 ? 1   PRO A HG3  4  
ATOM 6606  H HD2  . PRO A 1 1   ? -16.988 -1.447  6.625   1.00 0.00 ? 1   PRO A HD2  4  
ATOM 6607  H HD3  . PRO A 1 1   ? -16.828 -2.472  8.055   1.00 0.00 ? 1   PRO A HD3  4  
ATOM 6608  N N    . ASN A 1 2   ? -14.213 2.293   8.165   1.00 0.00 ? 2   ASN A N    4  
ATOM 6609  C CA   . ASN A 1 2   ? -14.166 3.746   7.788   1.00 0.00 ? 2   ASN A CA   4  
ATOM 6610  C C    . ASN A 1 2   ? -13.210 3.999   6.631   1.00 0.00 ? 2   ASN A C    4  
ATOM 6611  O O    . ASN A 1 2   ? -12.685 5.082   6.486   1.00 0.00 ? 2   ASN A O    4  
ATOM 6612  C CB   . ASN A 1 2   ? -13.679 4.542   8.991   1.00 0.00 ? 2   ASN A CB   4  
ATOM 6613  C CG   . ASN A 1 2   ? -14.753 4.542   10.079  1.00 0.00 ? 2   ASN A CG   4  
ATOM 6614  O OD1  . ASN A 1 2   ? -14.561 3.978   11.138  1.00 0.00 ? 2   ASN A OD1  4  
ATOM 6615  N ND2  . ASN A 1 2   ? -15.885 5.155   9.863   1.00 0.00 ? 2   ASN A ND2  4  
ATOM 6616  H H    . ASN A 1 2   ? -13.381 1.791   8.283   1.00 0.00 ? 2   ASN A H    4  
ATOM 6617  H HA   . ASN A 1 2   ? -15.141 4.079   7.509   1.00 0.00 ? 2   ASN A HA   4  
ATOM 6618  H HB2  . ASN A 1 2   ? -12.774 4.084   9.369   1.00 0.00 ? 2   ASN A HB2  4  
ATOM 6619  H HB3  . ASN A 1 2   ? -13.470 5.554   8.689   1.00 0.00 ? 2   ASN A HB3  4  
ATOM 6620  H HD21 . ASN A 1 2   ? -16.040 5.610   9.009   1.00 0.00 ? 2   ASN A HD21 4  
ATOM 6621  H HD22 . ASN A 1 2   ? -16.579 5.161   10.554  1.00 0.00 ? 2   ASN A HD22 4  
ATOM 6622  N N    . PHE A 1 3   ? -12.998 3.029   5.806   1.00 0.00 ? 3   PHE A N    4  
ATOM 6623  C CA   . PHE A 1 3   ? -12.071 3.209   4.655   1.00 0.00 ? 3   PHE A CA   4  
ATOM 6624  C C    . PHE A 1 3   ? -12.841 3.664   3.410   1.00 0.00 ? 3   PHE A C    4  
ATOM 6625  O O    . PHE A 1 3   ? -12.253 4.142   2.457   1.00 0.00 ? 3   PHE A O    4  
ATOM 6626  C CB   . PHE A 1 3   ? -11.398 1.881   4.338   1.00 0.00 ? 3   PHE A CB   4  
ATOM 6627  C CG   . PHE A 1 3   ? -10.638 1.341   5.531   1.00 0.00 ? 3   PHE A CG   4  
ATOM 6628  C CD1  . PHE A 1 3   ? -11.311 0.886   6.678   1.00 0.00 ? 3   PHE A CD1  4  
ATOM 6629  C CD2  . PHE A 1 3   ? -9.252  1.219   5.451   1.00 0.00 ? 3   PHE A CD2  4  
ATOM 6630  C CE1  . PHE A 1 3   ? -10.602 0.308   7.723   1.00 0.00 ? 3   PHE A CE1  4  
ATOM 6631  C CE2  . PHE A 1 3   ? -8.538  0.656   6.511   1.00 0.00 ? 3   PHE A CE2  4  
ATOM 6632  C CZ   . PHE A 1 3   ? -9.222  0.190   7.648   1.00 0.00 ? 3   PHE A CZ   4  
ATOM 6633  H H    . PHE A 1 3   ? -13.454 2.183   5.938   1.00 0.00 ? 3   PHE A H    4  
ATOM 6634  H HA   . PHE A 1 3   ? -11.320 3.942   4.905   1.00 0.00 ? 3   PHE A HA   4  
ATOM 6635  H HB2  . PHE A 1 3   ? -12.152 1.165   4.048   1.00 0.00 ? 3   PHE A HB2  4  
ATOM 6636  H HB3  . PHE A 1 3   ? -10.712 2.022   3.515   1.00 0.00 ? 3   PHE A HB3  4  
ATOM 6637  H HD1  . PHE A 1 3   ? -12.368 0.989   6.768   1.00 0.00 ? 3   PHE A HD1  4  
ATOM 6638  H HD2  . PHE A 1 3   ? -8.728  1.594   4.586   1.00 0.00 ? 3   PHE A HD2  4  
ATOM 6639  H HE1  . PHE A 1 3   ? -11.125 -0.041  8.597   1.00 0.00 ? 3   PHE A HE1  4  
ATOM 6640  H HE2  . PHE A 1 3   ? -7.467  0.573   6.443   1.00 0.00 ? 3   PHE A HE2  4  
ATOM 6641  H HZ   . PHE A 1 3   ? -8.688  -0.273  8.466   1.00 0.00 ? 3   PHE A HZ   4  
ATOM 6642  N N    . SER A 1 4   ? -14.142 3.506   3.397   1.00 0.00 ? 4   SER A N    4  
ATOM 6643  C CA   . SER A 1 4   ? -14.935 3.913   2.197   1.00 0.00 ? 4   SER A CA   4  
ATOM 6644  C C    . SER A 1 4   ? -14.777 5.418   1.958   1.00 0.00 ? 4   SER A C    4  
ATOM 6645  O O    . SER A 1 4   ? -15.285 6.228   2.712   1.00 0.00 ? 4   SER A O    4  
ATOM 6646  C CB   . SER A 1 4   ? -16.413 3.587   2.421   1.00 0.00 ? 4   SER A CB   4  
ATOM 6647  O OG   . SER A 1 4   ? -16.973 4.523   3.333   1.00 0.00 ? 4   SER A OG   4  
ATOM 6648  H H    . SER A 1 4   ? -14.594 3.109   4.169   1.00 0.00 ? 4   SER A H    4  
ATOM 6649  H HA   . SER A 1 4   ? -14.576 3.368   1.334   1.00 0.00 ? 4   SER A HA   4  
ATOM 6650  H HB2  . SER A 1 4   ? -16.940 3.646   1.483   1.00 0.00 ? 4   SER A HB2  4  
ATOM 6651  H HB3  . SER A 1 4   ? -16.502 2.586   2.818   1.00 0.00 ? 4   SER A HB3  4  
ATOM 6652  H HG   . SER A 1 4   ? -16.781 4.220   4.224   1.00 0.00 ? 4   SER A HG   4  
ATOM 6653  N N    . GLY A 1 5   ? -14.078 5.801   0.917   1.00 0.00 ? 5   GLY A N    4  
ATOM 6654  C CA   . GLY A 1 5   ? -13.893 7.255   0.635   1.00 0.00 ? 5   GLY A CA   4  
ATOM 6655  C C    . GLY A 1 5   ? -12.647 7.466   -0.211  1.00 0.00 ? 5   GLY A C    4  
ATOM 6656  O O    . GLY A 1 5   ? -11.707 6.697   -0.160  1.00 0.00 ? 5   GLY A O    4  
ATOM 6657  H H    . GLY A 1 5   ? -13.674 5.131   0.320   1.00 0.00 ? 5   GLY A H    4  
ATOM 6658  H HA2  . GLY A 1 5   ? -14.754 7.638   0.110   1.00 0.00 ? 5   GLY A HA2  4  
ATOM 6659  H HA3  . GLY A 1 5   ? -13.779 7.793   1.559   1.00 0.00 ? 5   GLY A HA3  4  
ATOM 6660  N N    . ASN A 1 6   ? -12.631 8.527   -0.959  1.00 0.00 ? 6   ASN A N    4  
ATOM 6661  C CA   . ASN A 1 6   ? -11.453 8.849   -1.796  1.00 0.00 ? 6   ASN A CA   4  
ATOM 6662  C C    . ASN A 1 6   ? -10.409 9.443   -0.866  1.00 0.00 ? 6   ASN A C    4  
ATOM 6663  O O    . ASN A 1 6   ? -10.761 10.008  0.155   1.00 0.00 ? 6   ASN A O    4  
ATOM 6664  C CB   . ASN A 1 6   ? -11.867 9.861   -2.867  1.00 0.00 ? 6   ASN A CB   4  
ATOM 6665  C CG   . ASN A 1 6   ? -11.280 9.461   -4.223  1.00 0.00 ? 6   ASN A CG   4  
ATOM 6666  O OD1  . ASN A 1 6   ? -11.960 8.877   -5.043  1.00 0.00 ? 6   ASN A OD1  4  
ATOM 6667  N ND2  . ASN A 1 6   ? -10.039 9.751   -4.496  1.00 0.00 ? 6   ASN A ND2  4  
ATOM 6668  H H    . ASN A 1 6   ? -13.390 9.133   -0.946  1.00 0.00 ? 6   ASN A H    4  
ATOM 6669  H HA   . ASN A 1 6   ? -11.070 7.951   -2.250  1.00 0.00 ? 6   ASN A HA   4  
ATOM 6670  H HB2  . ASN A 1 6   ? -12.945 9.881   -2.938  1.00 0.00 ? 6   ASN A HB2  4  
ATOM 6671  H HB3  . ASN A 1 6   ? -11.512 10.839  -2.593  1.00 0.00 ? 6   ASN A HB3  4  
ATOM 6672  H HD21 . ASN A 1 6   ? -9.489  10.219  -3.836  1.00 0.00 ? 6   ASN A HD21 4  
ATOM 6673  H HD22 . ASN A 1 6   ? -9.657  9.499   -5.363  1.00 0.00 ? 6   ASN A HD22 4  
ATOM 6674  N N    . TRP A 1 7   ? -9.139  9.289   -1.155  1.00 0.00 ? 7   TRP A N    4  
ATOM 6675  C CA   . TRP A 1 7   ? -8.125  9.825   -0.200  1.00 0.00 ? 7   TRP A CA   4  
ATOM 6676  C C    . TRP A 1 7   ? -7.080  10.696  -0.867  1.00 0.00 ? 7   TRP A C    4  
ATOM 6677  O O    . TRP A 1 7   ? -6.523  10.363  -1.896  1.00 0.00 ? 7   TRP A O    4  
ATOM 6678  C CB   . TRP A 1 7   ? -7.424  8.658   0.465   1.00 0.00 ? 7   TRP A CB   4  
ATOM 6679  C CG   . TRP A 1 7   ? -8.425  7.804   1.153   1.00 0.00 ? 7   TRP A CG   4  
ATOM 6680  C CD1  . TRP A 1 7   ? -8.998  6.697   0.640   1.00 0.00 ? 7   TRP A CD1  4  
ATOM 6681  C CD2  . TRP A 1 7   ? -8.997  7.998   2.461   1.00 0.00 ? 7   TRP A CD2  4  
ATOM 6682  N NE1  . TRP A 1 7   ? -9.850  6.161   1.589   1.00 0.00 ? 7   TRP A NE1  4  
ATOM 6683  C CE2  . TRP A 1 7   ? -9.891  6.941   2.731   1.00 0.00 ? 7   TRP A CE2  4  
ATOM 6684  C CE3  . TRP A 1 7   ? -8.807  8.980   3.432   1.00 0.00 ? 7   TRP A CE3  4  
ATOM 6685  C CZ2  . TRP A 1 7   ? -10.580 6.866   3.943   1.00 0.00 ? 7   TRP A CZ2  4  
ATOM 6686  C CZ3  . TRP A 1 7   ? -9.498  8.930   4.641   1.00 0.00 ? 7   TRP A CZ3  4  
ATOM 6687  C CH2  . TRP A 1 7   ? -10.387 7.872   4.905   1.00 0.00 ? 7   TRP A CH2  4  
ATOM 6688  H H    . TRP A 1 7   ? -8.857  8.790   -1.962  1.00 0.00 ? 7   TRP A H    4  
ATOM 6689  H HA   . TRP A 1 7   ? -8.620  10.409  0.560   1.00 0.00 ? 7   TRP A HA   4  
ATOM 6690  H HB2  . TRP A 1 7   ? -6.902  8.082   -0.270  1.00 0.00 ? 7   TRP A HB2  4  
ATOM 6691  H HB3  . TRP A 1 7   ? -6.723  9.031   1.183   1.00 0.00 ? 7   TRP A HB3  4  
ATOM 6692  H HD1  . TRP A 1 7   ? -8.807  6.290   -0.340  1.00 0.00 ? 7   TRP A HD1  4  
ATOM 6693  H HE1  . TRP A 1 7   ? -10.374 5.342   1.477   1.00 0.00 ? 7   TRP A HE1  4  
ATOM 6694  H HE3  . TRP A 1 7   ? -8.118  9.783   3.242   1.00 0.00 ? 7   TRP A HE3  4  
ATOM 6695  H HZ2  . TRP A 1 7   ? -11.250 6.040   4.139   1.00 0.00 ? 7   TRP A HZ2  4  
ATOM 6696  H HZ3  . TRP A 1 7   ? -9.359  9.724   5.360   1.00 0.00 ? 7   TRP A HZ3  4  
ATOM 6697  H HH2  . TRP A 1 7   ? -10.921 7.834   5.842   1.00 0.00 ? 7   TRP A HH2  4  
ATOM 6698  N N    . LYS A 1 8   ? -6.792  11.805  -0.242  1.00 0.00 ? 8   LYS A N    4  
ATOM 6699  C CA   . LYS A 1 8   ? -5.755  12.719  -0.771  1.00 0.00 ? 8   LYS A CA   4  
ATOM 6700  C C    . LYS A 1 8   ? -4.444  12.405  -0.049  1.00 0.00 ? 8   LYS A C    4  
ATOM 6701  O O    . LYS A 1 8   ? -4.455  11.861  1.042   1.00 0.00 ? 8   LYS A O    4  
ATOM 6702  C CB   . LYS A 1 8   ? -6.152  14.179  -0.508  1.00 0.00 ? 8   LYS A CB   4  
ATOM 6703  C CG   . LYS A 1 8   ? -7.649  14.372  -0.775  1.00 0.00 ? 8   LYS A CG   4  
ATOM 6704  C CD   . LYS A 1 8   ? -7.949  14.076  -2.245  1.00 0.00 ? 8   LYS A CD   4  
ATOM 6705  C CE   . LYS A 1 8   ? -7.359  15.182  -3.122  1.00 0.00 ? 8   LYS A CE   4  
ATOM 6706  N NZ   . LYS A 1 8   ? -7.804  14.991  -4.531  1.00 0.00 ? 8   LYS A NZ   4  
ATOM 6707  H H    . LYS A 1 8   ? -7.252  12.027  0.597   1.00 0.00 ? 8   LYS A H    4  
ATOM 6708  H HA   . LYS A 1 8   ? -5.643  12.551  -1.827  1.00 0.00 ? 8   LYS A HA   4  
ATOM 6709  H HB2  . LYS A 1 8   ? -5.936  14.428  0.521   1.00 0.00 ? 8   LYS A HB2  4  
ATOM 6710  H HB3  . LYS A 1 8   ? -5.586  14.827  -1.159  1.00 0.00 ? 8   LYS A HB3  4  
ATOM 6711  H HG2  . LYS A 1 8   ? -8.214  13.697  -0.149  1.00 0.00 ? 8   LYS A HG2  4  
ATOM 6712  H HG3  . LYS A 1 8   ? -7.926  15.386  -0.548  1.00 0.00 ? 8   LYS A HG3  4  
ATOM 6713  H HD2  . LYS A 1 8   ? -7.508  13.126  -2.514  1.00 0.00 ? 8   LYS A HD2  4  
ATOM 6714  H HD3  . LYS A 1 8   ? -9.014  14.031  -2.392  1.00 0.00 ? 8   LYS A HD3  4  
ATOM 6715  H HE2  . LYS A 1 8   ? -7.698  16.143  -2.764  1.00 0.00 ? 8   LYS A HE2  4  
ATOM 6716  H HE3  . LYS A 1 8   ? -6.281  15.141  -3.076  1.00 0.00 ? 8   LYS A HE3  4  
ATOM 6717  H HZ1  . LYS A 1 8   ? -7.812  13.976  -4.758  1.00 0.00 ? 8   LYS A HZ1  4  
ATOM 6718  H HZ2  . LYS A 1 8   ? -8.762  15.377  -4.648  1.00 0.00 ? 8   LYS A HZ2  4  
ATOM 6719  H HZ3  . LYS A 1 8   ? -7.149  15.485  -5.171  1.00 0.00 ? 8   LYS A HZ3  4  
ATOM 6720  N N    . ILE A 1 9   ? -3.320  12.729  -0.639  1.00 0.00 ? 9   ILE A N    4  
ATOM 6721  C CA   . ILE A 1 9   ? -2.018  12.431  0.028   1.00 0.00 ? 9   ILE A CA   4  
ATOM 6722  C C    . ILE A 1 9   ? -1.760  13.471  1.129   1.00 0.00 ? 9   ILE A C    4  
ATOM 6723  O O    . ILE A 1 9   ? -2.064  14.639  0.986   1.00 0.00 ? 9   ILE A O    4  
ATOM 6724  C CB   . ILE A 1 9   ? -0.887  12.387  -1.040  1.00 0.00 ? 9   ILE A CB   4  
ATOM 6725  C CG1  . ILE A 1 9   ? 0.055   11.212  -0.737  1.00 0.00 ? 9   ILE A CG1  4  
ATOM 6726  C CG2  . ILE A 1 9   ? -0.071  13.691  -1.096  1.00 0.00 ? 9   ILE A CG2  4  
ATOM 6727  C CD1  . ILE A 1 9   ? 0.717   11.399  0.632   1.00 0.00 ? 9   ILE A CD1  4  
ATOM 6728  H H    . ILE A 1 9   ? -3.333  13.159  -1.519  1.00 0.00 ? 9   ILE A H    4  
ATOM 6729  H HA   . ILE A 1 9   ? -2.091  11.459  0.503   1.00 0.00 ? 9   ILE A HA   4  
ATOM 6730  H HB   . ILE A 1 9   ? -1.338  12.225  -2.009  1.00 0.00 ? 9   ILE A HB   4  
ATOM 6731  H HG12 . ILE A 1 9   ? -0.510  10.291  -0.738  1.00 0.00 ? 9   ILE A HG12 4  
ATOM 6732  H HG13 . ILE A 1 9   ? 0.820   11.162  -1.498  1.00 0.00 ? 9   ILE A HG13 4  
ATOM 6733  H HG21 . ILE A 1 9   ? -0.727  14.518  -1.318  1.00 0.00 ? 9   ILE A HG21 4  
ATOM 6734  H HG22 . ILE A 1 9   ? 0.405   13.856  -0.139  1.00 0.00 ? 9   ILE A HG22 4  
ATOM 6735  H HG23 . ILE A 1 9   ? 0.684   13.611  -1.863  1.00 0.00 ? 9   ILE A HG23 4  
ATOM 6736  H HD11 . ILE A 1 9   ? 0.656   12.437  0.926   1.00 0.00 ? 9   ILE A HD11 4  
ATOM 6737  H HD12 . ILE A 1 9   ? 0.210   10.788  1.364   1.00 0.00 ? 9   ILE A HD12 4  
ATOM 6738  H HD13 . ILE A 1 9   ? 1.752   11.104  0.573   1.00 0.00 ? 9   ILE A HD13 4  
ATOM 6739  N N    . ILE A 1 10  ? -1.207  13.031  2.219   1.00 0.00 ? 10  ILE A N    4  
ATOM 6740  C CA   . ILE A 1 10  ? -0.920  13.935  3.359   1.00 0.00 ? 10  ILE A CA   4  
ATOM 6741  C C    . ILE A 1 10  ? 0.287   13.361  4.119   1.00 0.00 ? 10  ILE A C    4  
ATOM 6742  O O    . ILE A 1 10  ? 0.210   12.309  4.717   1.00 0.00 ? 10  ILE A O    4  
ATOM 6743  C CB   . ILE A 1 10  ? -2.182  14.005  4.246   1.00 0.00 ? 10  ILE A CB   4  
ATOM 6744  C CG1  . ILE A 1 10  ? -3.229  14.896  3.560   1.00 0.00 ? 10  ILE A CG1  4  
ATOM 6745  C CG2  . ILE A 1 10  ? -1.870  14.585  5.632   1.00 0.00 ? 10  ILE A CG2  4  
ATOM 6746  C CD1  . ILE A 1 10  ? -4.209  14.033  2.756   1.00 0.00 ? 10  ILE A CD1  4  
ATOM 6747  H H    . ILE A 1 10  ? -0.977  12.089  2.291   1.00 0.00 ? 10  ILE A H    4  
ATOM 6748  H HA   . ILE A 1 10  ? -0.683  14.918  2.990   1.00 0.00 ? 10  ILE A HA   4  
ATOM 6749  H HB   . ILE A 1 10  ? -2.582  13.014  4.359   1.00 0.00 ? 10  ILE A HB   4  
ATOM 6750  H HG12 . ILE A 1 10  ? -3.775  15.452  4.308   1.00 0.00 ? 10  ILE A HG12 4  
ATOM 6751  H HG13 . ILE A 1 10  ? -2.733  15.586  2.894   1.00 0.00 ? 10  ILE A HG13 4  
ATOM 6752  H HG21 . ILE A 1 10  ? -1.319  15.505  5.522   1.00 0.00 ? 10  ILE A HG21 4  
ATOM 6753  H HG22 . ILE A 1 10  ? -2.797  14.779  6.154   1.00 0.00 ? 10  ILE A HG22 4  
ATOM 6754  H HG23 . ILE A 1 10  ? -1.283  13.875  6.195   1.00 0.00 ? 10  ILE A HG23 4  
ATOM 6755  H HD11 . ILE A 1 10  ? -3.982  12.989  2.906   1.00 0.00 ? 10  ILE A HD11 4  
ATOM 6756  H HD12 . ILE A 1 10  ? -5.215  14.232  3.087   1.00 0.00 ? 10  ILE A HD12 4  
ATOM 6757  H HD13 . ILE A 1 10  ? -4.125  14.272  1.707   1.00 0.00 ? 10  ILE A HD13 4  
ATOM 6758  N N    . ARG A 1 11  ? 1.399   14.044  4.064   1.00 0.00 ? 11  ARG A N    4  
ATOM 6759  C CA   . ARG A 1 11  ? 2.643   13.571  4.751   1.00 0.00 ? 11  ARG A CA   4  
ATOM 6760  C C    . ARG A 1 11  ? 3.097   12.241  4.146   1.00 0.00 ? 11  ARG A C    4  
ATOM 6761  O O    . ARG A 1 11  ? 2.392   11.251  4.197   1.00 0.00 ? 11  ARG A O    4  
ATOM 6762  C CB   . ARG A 1 11  ? 2.388   13.399  6.254   1.00 0.00 ? 11  ARG A CB   4  
ATOM 6763  C CG   . ARG A 1 11  ? 2.488   14.761  6.945   1.00 0.00 ? 11  ARG A CG   4  
ATOM 6764  C CD   . ARG A 1 11  ? 1.366   15.671  6.442   1.00 0.00 ? 11  ARG A CD   4  
ATOM 6765  N NE   . ARG A 1 11  ? 1.149   16.778  7.415   1.00 0.00 ? 11  ARG A NE   4  
ATOM 6766  C CZ   . ARG A 1 11  ? 0.312   17.739  7.135   1.00 0.00 ? 11  ARG A CZ   4  
ATOM 6767  N NH1  . ARG A 1 11  ? -0.970  17.555  7.300   1.00 0.00 ? 11  ARG A NH1  4  
ATOM 6768  N NH2  . ARG A 1 11  ? 0.756   18.883  6.691   1.00 0.00 ? 11  ARG A NH2  4  
ATOM 6769  H H    . ARG A 1 11  ? 1.421   14.872  3.552   1.00 0.00 ? 11  ARG A H    4  
ATOM 6770  H HA   . ARG A 1 11  ? 3.423   14.305  4.607   1.00 0.00 ? 11  ARG A HA   4  
ATOM 6771  H HB2  . ARG A 1 11  ? 1.404   12.988  6.414   1.00 0.00 ? 11  ARG A HB2  4  
ATOM 6772  H HB3  . ARG A 1 11  ? 3.128   12.733  6.671   1.00 0.00 ? 11  ARG A HB3  4  
ATOM 6773  H HG2  . ARG A 1 11  ? 2.395   14.630  8.014   1.00 0.00 ? 11  ARG A HG2  4  
ATOM 6774  H HG3  . ARG A 1 11  ? 3.443   15.211  6.719   1.00 0.00 ? 11  ARG A HG3  4  
ATOM 6775  H HD2  . ARG A 1 11  ? 1.640   16.082  5.481   1.00 0.00 ? 11  ARG A HD2  4  
ATOM 6776  H HD3  . ARG A 1 11  ? 0.458   15.097  6.340   1.00 0.00 ? 11  ARG A HD3  4  
ATOM 6777  H HE   . ARG A 1 11  ? 1.636   16.785  8.266   1.00 0.00 ? 11  ARG A HE   4  
ATOM 6778  H HH11 . ARG A 1 11  ? -1.310  16.679  7.640   1.00 0.00 ? 11  ARG A HH11 4  
ATOM 6779  H HH12 . ARG A 1 11  ? -1.612  18.292  7.085   1.00 0.00 ? 11  ARG A HH12 4  
ATOM 6780  H HH21 . ARG A 1 11  ? 1.738   19.023  6.566   1.00 0.00 ? 11  ARG A HH21 4  
ATOM 6781  H HH22 . ARG A 1 11  ? 0.114   19.619  6.477   1.00 0.00 ? 11  ARG A HH22 4  
ATOM 6782  N N    . SER A 1 12  ? 4.275   12.215  3.570   1.00 0.00 ? 12  SER A N    4  
ATOM 6783  C CA   . SER A 1 12  ? 4.782   10.954  2.955   1.00 0.00 ? 12  SER A CA   4  
ATOM 6784  C C    . SER A 1 12  ? 6.247   10.718  3.374   1.00 0.00 ? 12  SER A C    4  
ATOM 6785  O O    . SER A 1 12  ? 6.503   10.113  4.398   1.00 0.00 ? 12  SER A O    4  
ATOM 6786  C CB   . SER A 1 12  ? 4.658   11.050  1.429   1.00 0.00 ? 12  SER A CB   4  
ATOM 6787  O OG   . SER A 1 12  ? 5.224   9.889   0.837   1.00 0.00 ? 12  SER A OG   4  
ATOM 6788  H H    . SER A 1 12  ? 4.823   13.027  3.541   1.00 0.00 ? 12  SER A H    4  
ATOM 6789  H HA   . SER A 1 12  ? 4.183   10.128  3.308   1.00 0.00 ? 12  SER A HA   4  
ATOM 6790  H HB2  . SER A 1 12  ? 3.619   11.118  1.154   1.00 0.00 ? 12  SER A HB2  4  
ATOM 6791  H HB3  . SER A 1 12  ? 5.175   11.934  1.082   1.00 0.00 ? 12  SER A HB3  4  
ATOM 6792  H HG   . SER A 1 12  ? 5.163   9.982   -0.117  1.00 0.00 ? 12  SER A HG   4  
ATOM 6793  N N    . GLU A 1 13  ? 7.213   11.179  2.601   1.00 0.00 ? 13  GLU A N    4  
ATOM 6794  C CA   . GLU A 1 13  ? 8.651   10.966  2.971   1.00 0.00 ? 13  GLU A CA   4  
ATOM 6795  C C    . GLU A 1 13  ? 8.915   9.474   3.211   1.00 0.00 ? 13  GLU A C    4  
ATOM 6796  O O    . GLU A 1 13  ? 8.817   8.996   4.325   1.00 0.00 ? 13  GLU A O    4  
ATOM 6797  C CB   . GLU A 1 13  ? 8.968   11.750  4.246   1.00 0.00 ? 13  GLU A CB   4  
ATOM 6798  C CG   . GLU A 1 13  ? 10.460  12.088  4.280   1.00 0.00 ? 13  GLU A CG   4  
ATOM 6799  C CD   . GLU A 1 13  ? 10.727  13.109  5.387   1.00 0.00 ? 13  GLU A CD   4  
ATOM 6800  O OE1  . GLU A 1 13  ? 10.600  14.292  5.118   1.00 0.00 ? 13  GLU A OE1  4  
ATOM 6801  O OE2  . GLU A 1 13  ? 11.055  12.691  6.485   1.00 0.00 ? 13  GLU A OE2  4  
ATOM 6802  H H    . GLU A 1 13  ? 6.996   11.663  1.780   1.00 0.00 ? 13  GLU A H    4  
ATOM 6803  H HA   . GLU A 1 13  ? 9.283   11.317  2.168   1.00 0.00 ? 13  GLU A HA   4  
ATOM 6804  H HB2  . GLU A 1 13  ? 8.391   12.663  4.261   1.00 0.00 ? 13  GLU A HB2  4  
ATOM 6805  H HB3  . GLU A 1 13  ? 8.718   11.151  5.109   1.00 0.00 ? 13  GLU A HB3  4  
ATOM 6806  H HG2  . GLU A 1 13  ? 11.028  11.189  4.473   1.00 0.00 ? 13  GLU A HG2  4  
ATOM 6807  H HG3  . GLU A 1 13  ? 10.756  12.505  3.329   1.00 0.00 ? 13  GLU A HG3  4  
ATOM 6808  N N    . ASN A 1 14  ? 9.243   8.740   2.176   1.00 0.00 ? 14  ASN A N    4  
ATOM 6809  C CA   . ASN A 1 14  ? 9.506   7.277   2.345   1.00 0.00 ? 14  ASN A CA   4  
ATOM 6810  C C    . ASN A 1 14  ? 10.051  6.670   1.046   1.00 0.00 ? 14  ASN A C    4  
ATOM 6811  O O    . ASN A 1 14  ? 10.858  5.767   1.088   1.00 0.00 ? 14  ASN A O    4  
ATOM 6812  C CB   . ASN A 1 14  ? 8.203   6.564   2.726   1.00 0.00 ? 14  ASN A CB   4  
ATOM 6813  C CG   . ASN A 1 14  ? 8.153   6.347   4.241   1.00 0.00 ? 14  ASN A CG   4  
ATOM 6814  O OD1  . ASN A 1 14  ? 7.244   6.808   4.902   1.00 0.00 ? 14  ASN A OD1  4  
ATOM 6815  N ND2  . ASN A 1 14  ? 9.099   5.660   4.821   1.00 0.00 ? 14  ASN A ND2  4  
ATOM 6816  H H    . ASN A 1 14  ? 9.313   9.152   1.291   1.00 0.00 ? 14  ASN A H    4  
ATOM 6817  H HA   . ASN A 1 14  ? 10.228  7.131   3.133   1.00 0.00 ? 14  ASN A HA   4  
ATOM 6818  H HB2  . ASN A 1 14  ? 7.365   7.169   2.421   1.00 0.00 ? 14  ASN A HB2  4  
ATOM 6819  H HB3  . ASN A 1 14  ? 8.157   5.607   2.228   1.00 0.00 ? 14  ASN A HB3  4  
ATOM 6820  H HD21 . ASN A 1 14  ? 9.832   5.289   4.287   1.00 0.00 ? 14  ASN A HD21 4  
ATOM 6821  H HD22 . ASN A 1 14  ? 9.076   5.515   5.790   1.00 0.00 ? 14  ASN A HD22 4  
ATOM 6822  N N    . PHE A 1 15  ? 9.603   7.140   -0.103  1.00 0.00 ? 15  PHE A N    4  
ATOM 6823  C CA   . PHE A 1 15  ? 10.076  6.569   -1.417  1.00 0.00 ? 15  PHE A CA   4  
ATOM 6824  C C    . PHE A 1 15  ? 11.600  6.397   -1.439  1.00 0.00 ? 15  PHE A C    4  
ATOM 6825  O O    . PHE A 1 15  ? 12.096  5.358   -1.826  1.00 0.00 ? 15  PHE A O    4  
ATOM 6826  C CB   . PHE A 1 15  ? 9.661   7.482   -2.576  1.00 0.00 ? 15  PHE A CB   4  
ATOM 6827  C CG   . PHE A 1 15  ? 9.669   6.683   -3.865  1.00 0.00 ? 15  PHE A CG   4  
ATOM 6828  C CD1  . PHE A 1 15  ? 10.879  6.210   -4.393  1.00 0.00 ? 15  PHE A CD1  4  
ATOM 6829  C CD2  . PHE A 1 15  ? 8.467   6.403   -4.527  1.00 0.00 ? 15  PHE A CD2  4  
ATOM 6830  C CE1  . PHE A 1 15  ? 10.883  5.463   -5.578  1.00 0.00 ? 15  PHE A CE1  4  
ATOM 6831  C CE2  . PHE A 1 15  ? 8.474   5.653   -5.711  1.00 0.00 ? 15  PHE A CE2  4  
ATOM 6832  C CZ   . PHE A 1 15  ? 9.683   5.183   -6.235  1.00 0.00 ? 15  PHE A CZ   4  
ATOM 6833  H H    . PHE A 1 15  ? 8.938   7.856   -0.103  1.00 0.00 ? 15  PHE A H    4  
ATOM 6834  H HA   . PHE A 1 15  ? 9.619   5.599   -1.559  1.00 0.00 ? 15  PHE A HA   4  
ATOM 6835  H HB2  . PHE A 1 15  ? 8.668   7.866   -2.395  1.00 0.00 ? 15  PHE A HB2  4  
ATOM 6836  H HB3  . PHE A 1 15  ? 10.358  8.302   -2.657  1.00 0.00 ? 15  PHE A HB3  4  
ATOM 6837  H HD1  . PHE A 1 15  ? 11.809  6.425   -3.892  1.00 0.00 ? 15  PHE A HD1  4  
ATOM 6838  H HD2  . PHE A 1 15  ? 7.535   6.767   -4.128  1.00 0.00 ? 15  PHE A HD2  4  
ATOM 6839  H HE1  . PHE A 1 15  ? 11.815  5.103   -5.985  1.00 0.00 ? 15  PHE A HE1  4  
ATOM 6840  H HE2  . PHE A 1 15  ? 7.546   5.439   -6.219  1.00 0.00 ? 15  PHE A HE2  4  
ATOM 6841  H HZ   . PHE A 1 15  ? 9.690   4.604   -7.147  1.00 0.00 ? 15  PHE A HZ   4  
ATOM 6842  N N    . GLU A 1 16  ? 12.341  7.387   -1.028  1.00 0.00 ? 16  GLU A N    4  
ATOM 6843  C CA   . GLU A 1 16  ? 13.826  7.246   -1.032  1.00 0.00 ? 16  GLU A CA   4  
ATOM 6844  C C    . GLU A 1 16  ? 14.219  6.263   0.056   1.00 0.00 ? 16  GLU A C    4  
ATOM 6845  O O    . GLU A 1 16  ? 15.121  5.463   -0.112  1.00 0.00 ? 16  GLU A O    4  
ATOM 6846  C CB   . GLU A 1 16  ? 14.490  8.601   -0.776  1.00 0.00 ? 16  GLU A CB   4  
ATOM 6847  C CG   . GLU A 1 16  ? 13.950  9.642   -1.765  1.00 0.00 ? 16  GLU A CG   4  
ATOM 6848  C CD   . GLU A 1 16  ? 13.636  10.945  -1.023  1.00 0.00 ? 16  GLU A CD   4  
ATOM 6849  O OE1  . GLU A 1 16  ? 14.570  11.667  -0.714  1.00 0.00 ? 16  GLU A OE1  4  
ATOM 6850  O OE2  . GLU A 1 16  ? 12.468  11.197  -0.778  1.00 0.00 ? 16  GLU A OE2  4  
ATOM 6851  H H    . GLU A 1 16  ? 11.925  8.210   -0.714  1.00 0.00 ? 16  GLU A H    4  
ATOM 6852  H HA   . GLU A 1 16  ? 14.138  6.849   -1.986  1.00 0.00 ? 16  GLU A HA   4  
ATOM 6853  H HB2  . GLU A 1 16  ? 14.279  8.917   0.236   1.00 0.00 ? 16  GLU A HB2  4  
ATOM 6854  H HB3  . GLU A 1 16  ? 15.558  8.507   -0.907  1.00 0.00 ? 16  GLU A HB3  4  
ATOM 6855  H HG2  . GLU A 1 16  ? 14.693  9.832   -2.524  1.00 0.00 ? 16  GLU A HG2  4  
ATOM 6856  H HG3  . GLU A 1 16  ? 13.049  9.271   -2.230  1.00 0.00 ? 16  GLU A HG3  4  
ATOM 6857  N N    . GLU A 1 17  ? 13.519  6.288   1.158   1.00 0.00 ? 17  GLU A N    4  
ATOM 6858  C CA   . GLU A 1 17  ? 13.809  5.324   2.255   1.00 0.00 ? 17  GLU A CA   4  
ATOM 6859  C C    . GLU A 1 17  ? 13.627  3.895   1.719   1.00 0.00 ? 17  GLU A C    4  
ATOM 6860  O O    . GLU A 1 17  ? 14.155  2.949   2.266   1.00 0.00 ? 17  GLU A O    4  
ATOM 6861  C CB   . GLU A 1 17  ? 12.833  5.567   3.403   1.00 0.00 ? 17  GLU A CB   4  
ATOM 6862  C CG   . GLU A 1 17  ? 13.237  4.722   4.609   1.00 0.00 ? 17  GLU A CG   4  
ATOM 6863  C CD   . GLU A 1 17  ? 12.818  5.435   5.896   1.00 0.00 ? 17  GLU A CD   4  
ATOM 6864  O OE1  . GLU A 1 17  ? 11.626  5.560   6.120   1.00 0.00 ? 17  GLU A OE1  4  
ATOM 6865  O OE2  . GLU A 1 17  ? 13.698  5.843   6.637   1.00 0.00 ? 17  GLU A OE2  4  
ATOM 6866  H H    . GLU A 1 17  ? 12.778  6.924   1.251   1.00 0.00 ? 17  GLU A H    4  
ATOM 6867  H HA   . GLU A 1 17  ? 14.822  5.456   2.602   1.00 0.00 ? 17  GLU A HA   4  
ATOM 6868  H HB2  . GLU A 1 17  ? 12.843  6.613   3.672   1.00 0.00 ? 17  GLU A HB2  4  
ATOM 6869  H HB3  . GLU A 1 17  ? 11.844  5.288   3.088   1.00 0.00 ? 17  GLU A HB3  4  
ATOM 6870  H HG2  . GLU A 1 17  ? 12.749  3.760   4.553   1.00 0.00 ? 17  GLU A HG2  4  
ATOM 6871  H HG3  . GLU A 1 17  ? 14.306  4.584   4.608   1.00 0.00 ? 17  GLU A HG3  4  
ATOM 6872  N N    . LEU A 1 18  ? 12.884  3.743   0.643   1.00 0.00 ? 18  LEU A N    4  
ATOM 6873  C CA   . LEU A 1 18  ? 12.659  2.400   0.054   1.00 0.00 ? 18  LEU A CA   4  
ATOM 6874  C C    . LEU A 1 18  ? 13.887  1.980   -0.717  1.00 0.00 ? 18  LEU A C    4  
ATOM 6875  O O    . LEU A 1 18  ? 14.367  0.877   -0.572  1.00 0.00 ? 18  LEU A O    4  
ATOM 6876  C CB   . LEU A 1 18  ? 11.479  2.438   -0.925  1.00 0.00 ? 18  LEU A CB   4  
ATOM 6877  C CG   . LEU A 1 18  ? 10.335  3.333   -0.440  1.00 0.00 ? 18  LEU A CG   4  
ATOM 6878  C CD1  . LEU A 1 18  ? 9.117   3.065   -1.312  1.00 0.00 ? 18  LEU A CD1  4  
ATOM 6879  C CD2  . LEU A 1 18  ? 9.965   3.059   1.014   1.00 0.00 ? 18  LEU A CD2  4  
ATOM 6880  H H    . LEU A 1 18  ? 12.474  4.514   0.220   1.00 0.00 ? 18  LEU A H    4  
ATOM 6881  H HA   . LEU A 1 18  ? 12.472  1.691   0.834   1.00 0.00 ? 18  LEU A HA   4  
ATOM 6882  H HB2  . LEU A 1 18  ? 11.828  2.826   -1.871  1.00 0.00 ? 18  LEU A HB2  4  
ATOM 6883  H HB3  . LEU A 1 18  ? 11.112  1.444   -1.071  1.00 0.00 ? 18  LEU A HB3  4  
ATOM 6884  H HG   . LEU A 1 18  ? 10.628  4.349   -0.545  1.00 0.00 ? 18  LEU A HG   4  
ATOM 6885  H HD11 . LEU A 1 18  ? 9.068   2.010   -1.539  1.00 0.00 ? 18  LEU A HD11 4  
ATOM 6886  H HD12 . LEU A 1 18  ? 8.226   3.362   -0.784  1.00 0.00 ? 18  LEU A HD12 4  
ATOM 6887  H HD13 . LEU A 1 18  ? 9.203   3.628   -2.228  1.00 0.00 ? 18  LEU A HD13 4  
ATOM 6888  H HD21 . LEU A 1 18  ? 10.861  2.982   1.612   1.00 0.00 ? 18  LEU A HD21 4  
ATOM 6889  H HD22 . LEU A 1 18  ? 9.356   3.870   1.385   1.00 0.00 ? 18  LEU A HD22 4  
ATOM 6890  H HD23 . LEU A 1 18  ? 9.410   2.139   1.070   1.00 0.00 ? 18  LEU A HD23 4  
ATOM 6891  N N    . LEU A 1 19  ? 14.397  2.850   -1.540  1.00 0.00 ? 19  LEU A N    4  
ATOM 6892  C CA   . LEU A 1 19  ? 15.604  2.492   -2.319  1.00 0.00 ? 19  LEU A CA   4  
ATOM 6893  C C    . LEU A 1 19  ? 16.862  2.674   -1.445  1.00 0.00 ? 19  LEU A C    4  
ATOM 6894  O O    . LEU A 1 19  ? 17.972  2.443   -1.885  1.00 0.00 ? 19  LEU A O    4  
ATOM 6895  C CB   . LEU A 1 19  ? 15.691  3.370   -3.576  1.00 0.00 ? 19  LEU A CB   4  
ATOM 6896  C CG   . LEU A 1 19  ? 14.371  3.337   -4.397  1.00 0.00 ? 19  LEU A CG   4  
ATOM 6897  C CD1  . LEU A 1 19  ? 13.596  2.017   -4.209  1.00 0.00 ? 19  LEU A CD1  4  
ATOM 6898  C CD2  . LEU A 1 19  ? 13.481  4.514   -3.977  1.00 0.00 ? 19  LEU A CD2  4  
ATOM 6899  H H    . LEU A 1 19  ? 13.989  3.734   -1.639  1.00 0.00 ? 19  LEU A H    4  
ATOM 6900  H HA   . LEU A 1 19  ? 15.511  1.459   -2.617  1.00 0.00 ? 19  LEU A HA   4  
ATOM 6901  H HB2  . LEU A 1 19  ? 15.895  4.388   -3.281  1.00 0.00 ? 19  LEU A HB2  4  
ATOM 6902  H HB3  . LEU A 1 19  ? 16.499  3.015   -4.195  1.00 0.00 ? 19  LEU A HB3  4  
ATOM 6903  H HG   . LEU A 1 19  ? 14.614  3.443   -5.442  1.00 0.00 ? 19  LEU A HG   4  
ATOM 6904  H HD11 . LEU A 1 19  ? 14.292  1.192   -4.176  1.00 0.00 ? 19  LEU A HD11 4  
ATOM 6905  H HD12 . LEU A 1 19  ? 13.041  2.056   -3.282  1.00 0.00 ? 19  LEU A HD12 4  
ATOM 6906  H HD13 . LEU A 1 19  ? 12.912  1.879   -5.032  1.00 0.00 ? 19  LEU A HD13 4  
ATOM 6907  H HD21 . LEU A 1 19  ? 13.919  5.021   -3.130  1.00 0.00 ? 19  LEU A HD21 4  
ATOM 6908  H HD22 . LEU A 1 19  ? 13.393  5.206   -4.800  1.00 0.00 ? 19  LEU A HD22 4  
ATOM 6909  H HD23 . LEU A 1 19  ? 12.498  4.152   -3.707  1.00 0.00 ? 19  LEU A HD23 4  
ATOM 6910  N N    . LYS A 1 20  ? 16.691  3.082   -0.205  1.00 0.00 ? 20  LYS A N    4  
ATOM 6911  C CA   . LYS A 1 20  ? 17.844  3.274   0.712   1.00 0.00 ? 20  LYS A CA   4  
ATOM 6912  C C    . LYS A 1 20  ? 17.930  2.082   1.675   1.00 0.00 ? 20  LYS A C    4  
ATOM 6913  O O    . LYS A 1 20  ? 18.983  1.756   2.188   1.00 0.00 ? 20  LYS A O    4  
ATOM 6914  C CB   . LYS A 1 20  ? 17.611  4.553   1.515   1.00 0.00 ? 20  LYS A CB   4  
ATOM 6915  C CG   . LYS A 1 20  ? 18.259  5.731   0.793   1.00 0.00 ? 20  LYS A CG   4  
ATOM 6916  C CD   . LYS A 1 20  ? 18.500  6.871   1.784   1.00 0.00 ? 20  LYS A CD   4  
ATOM 6917  C CE   . LYS A 1 20  ? 19.760  6.580   2.602   1.00 0.00 ? 20  LYS A CE   4  
ATOM 6918  N NZ   . LYS A 1 20  ? 19.728  7.374   3.863   1.00 0.00 ? 20  LYS A NZ   4  
ATOM 6919  H H    . LYS A 1 20  ? 15.797  3.261   0.132   1.00 0.00 ? 20  LYS A H    4  
ATOM 6920  H HA   . LYS A 1 20  ? 18.754  3.358   0.143   1.00 0.00 ? 20  LYS A HA   4  
ATOM 6921  H HB2  . LYS A 1 20  ? 16.548  4.728   1.605   1.00 0.00 ? 20  LYS A HB2  4  
ATOM 6922  H HB3  . LYS A 1 20  ? 18.040  4.448   2.497   1.00 0.00 ? 20  LYS A HB3  4  
ATOM 6923  H HG2  . LYS A 1 20  ? 19.200  5.416   0.367   1.00 0.00 ? 20  LYS A HG2  4  
ATOM 6924  H HG3  . LYS A 1 20  ? 17.603  6.070   0.007   1.00 0.00 ? 20  LYS A HG3  4  
ATOM 6925  H HD2  . LYS A 1 20  ? 18.628  7.797   1.242   1.00 0.00 ? 20  LYS A HD2  4  
ATOM 6926  H HD3  . LYS A 1 20  ? 17.654  6.956   2.448   1.00 0.00 ? 20  LYS A HD3  4  
ATOM 6927  H HE2  . LYS A 1 20  ? 19.799  5.527   2.841   1.00 0.00 ? 20  LYS A HE2  4  
ATOM 6928  H HE3  . LYS A 1 20  ? 20.633  6.851   2.027   1.00 0.00 ? 20  LYS A HE3  4  
ATOM 6929  H HZ1  . LYS A 1 20  ? 19.361  8.326   3.664   1.00 0.00 ? 20  LYS A HZ1  4  
ATOM 6930  H HZ2  . LYS A 1 20  ? 19.111  6.904   4.554   1.00 0.00 ? 20  LYS A HZ2  4  
ATOM 6931  H HZ3  . LYS A 1 20  ? 20.692  7.447   4.250   1.00 0.00 ? 20  LYS A HZ3  4  
ATOM 6932  N N    . VAL A 1 21  ? 16.818  1.439   1.921   1.00 0.00 ? 21  VAL A N    4  
ATOM 6933  C CA   . VAL A 1 21  ? 16.786  0.276   2.844   1.00 0.00 ? 21  VAL A CA   4  
ATOM 6934  C C    . VAL A 1 21  ? 16.859  -1.015  2.030   1.00 0.00 ? 21  VAL A C    4  
ATOM 6935  O O    . VAL A 1 21  ? 17.403  -2.010  2.472   1.00 0.00 ? 21  VAL A O    4  
ATOM 6936  C CB   . VAL A 1 21  ? 15.486  0.325   3.645   1.00 0.00 ? 21  VAL A CB   4  
ATOM 6937  C CG1  . VAL A 1 21  ? 15.436  1.629   4.435   1.00 0.00 ? 21  VAL A CG1  4  
ATOM 6938  C CG2  . VAL A 1 21  ? 14.277  0.258   2.705   1.00 0.00 ? 21  VAL A CG2  4  
ATOM 6939  H H    . VAL A 1 21  ? 15.995  1.727   1.497   1.00 0.00 ? 21  VAL A H    4  
ATOM 6940  H HA   . VAL A 1 21  ? 17.629  0.325   3.516   1.00 0.00 ? 21  VAL A HA   4  
ATOM 6941  H HB   . VAL A 1 21  ? 15.456  -0.505  4.322   1.00 0.00 ? 21  VAL A HB   4  
ATOM 6942  H HG11 . VAL A 1 21  ? 15.784  2.439   3.811   1.00 0.00 ? 21  VAL A HG11 4  
ATOM 6943  H HG12 . VAL A 1 21  ? 14.420  1.822   4.744   1.00 0.00 ? 21  VAL A HG12 4  
ATOM 6944  H HG13 . VAL A 1 21  ? 16.070  1.546   5.305   1.00 0.00 ? 21  VAL A HG13 4  
ATOM 6945  H HG21 . VAL A 1 21  ? 14.577  0.510   1.702   1.00 0.00 ? 21  VAL A HG21 4  
ATOM 6946  H HG22 . VAL A 1 21  ? 13.874  -0.742  2.713   1.00 0.00 ? 21  VAL A HG22 4  
ATOM 6947  H HG23 . VAL A 1 21  ? 13.520  0.952   3.037   1.00 0.00 ? 21  VAL A HG23 4  
ATOM 6948  N N    . LEU A 1 22  ? 16.341  -0.990  0.827   1.00 0.00 ? 22  LEU A N    4  
ATOM 6949  C CA   . LEU A 1 22  ? 16.405  -2.193  -0.046  1.00 0.00 ? 22  LEU A CA   4  
ATOM 6950  C C    . LEU A 1 22  ? 17.885  -2.497  -0.349  1.00 0.00 ? 22  LEU A C    4  
ATOM 6951  O O    . LEU A 1 22  ? 18.228  -3.577  -0.791  1.00 0.00 ? 22  LEU A O    4  
ATOM 6952  C CB   . LEU A 1 22  ? 15.551  -1.940  -1.329  1.00 0.00 ? 22  LEU A CB   4  
ATOM 6953  C CG   . LEU A 1 22  ? 16.334  -1.356  -2.537  1.00 0.00 ? 22  LEU A CG   4  
ATOM 6954  C CD1  . LEU A 1 22  ? 17.273  -0.218  -2.121  1.00 0.00 ? 22  LEU A CD1  4  
ATOM 6955  C CD2  . LEU A 1 22  ? 17.140  -2.463  -3.217  1.00 0.00 ? 22  LEU A CD2  4  
ATOM 6956  H H    . LEU A 1 22  ? 15.938  -0.171  0.491   1.00 0.00 ? 22  LEU A H    4  
ATOM 6957  H HA   . LEU A 1 22  ? 15.984  -3.038  0.493   1.00 0.00 ? 22  LEU A HA   4  
ATOM 6958  H HB2  . LEU A 1 22  ? 15.110  -2.873  -1.636  1.00 0.00 ? 22  LEU A HB2  4  
ATOM 6959  H HB3  . LEU A 1 22  ? 14.754  -1.255  -1.075  1.00 0.00 ? 22  LEU A HB3  4  
ATOM 6960  H HG   . LEU A 1 22  ? 15.620  -0.965  -3.247  1.00 0.00 ? 22  LEU A HG   4  
ATOM 6961  H HD11 . LEU A 1 22  ? 17.004  0.137   -1.139  1.00 0.00 ? 22  LEU A HD11 4  
ATOM 6962  H HD12 . LEU A 1 22  ? 18.289  -0.573  -2.114  1.00 0.00 ? 22  LEU A HD12 4  
ATOM 6963  H HD13 . LEU A 1 22  ? 17.191  0.588   -2.832  1.00 0.00 ? 22  LEU A HD13 4  
ATOM 6964  H HD21 . LEU A 1 22  ? 16.701  -3.421  -2.985  1.00 0.00 ? 22  LEU A HD21 4  
ATOM 6965  H HD22 . LEU A 1 22  ? 17.128  -2.308  -4.286  1.00 0.00 ? 22  LEU A HD22 4  
ATOM 6966  H HD23 . LEU A 1 22  ? 18.159  -2.435  -2.860  1.00 0.00 ? 22  LEU A HD23 4  
ATOM 6967  N N    . GLY A 1 23  ? 18.760  -1.539  -0.110  1.00 0.00 ? 23  GLY A N    4  
ATOM 6968  C CA   . GLY A 1 23  ? 20.195  -1.744  -0.372  1.00 0.00 ? 23  GLY A CA   4  
ATOM 6969  C C    . GLY A 1 23  ? 20.661  -0.730  -1.398  1.00 0.00 ? 23  GLY A C    4  
ATOM 6970  O O    . GLY A 1 23  ? 20.859  -1.054  -2.552  1.00 0.00 ? 23  GLY A O    4  
ATOM 6971  H H    . GLY A 1 23  ? 18.465  -0.676  0.237   1.00 0.00 ? 23  GLY A H    4  
ATOM 6972  H HA2  . GLY A 1 23  ? 20.748  -1.609  0.547   1.00 0.00 ? 23  GLY A HA2  4  
ATOM 6973  H HA3  . GLY A 1 23  ? 20.349  -2.729  -0.755  1.00 0.00 ? 23  GLY A HA3  4  
ATOM 6974  N N    . VAL A 1 24  ? 20.819  0.505   -0.985  1.00 0.00 ? 24  VAL A N    4  
ATOM 6975  C CA   . VAL A 1 24  ? 21.266  1.585   -1.927  1.00 0.00 ? 24  VAL A CA   4  
ATOM 6976  C C    . VAL A 1 24  ? 22.441  1.088   -2.800  1.00 0.00 ? 24  VAL A C    4  
ATOM 6977  O O    . VAL A 1 24  ? 23.316  0.378   -2.343  1.00 0.00 ? 24  VAL A O    4  
ATOM 6978  C CB   . VAL A 1 24  ? 21.631  2.851   -1.095  1.00 0.00 ? 24  VAL A CB   4  
ATOM 6979  C CG1  . VAL A 1 24  ? 23.134  3.195   -1.146  1.00 0.00 ? 24  VAL A CG1  4  
ATOM 6980  C CG2  . VAL A 1 24  ? 20.841  4.050   -1.628  1.00 0.00 ? 24  VAL A CG2  4  
ATOM 6981  H H    . VAL A 1 24  ? 20.624  0.726   -0.044  1.00 0.00 ? 24  VAL A H    4  
ATOM 6982  H HA   . VAL A 1 24  ? 20.439  1.824   -2.581  1.00 0.00 ? 24  VAL A HA   4  
ATOM 6983  H HB   . VAL A 1 24  ? 21.348  2.674   -0.067  1.00 0.00 ? 24  VAL A HB   4  
ATOM 6984  H HG11 . VAL A 1 24  ? 23.714  2.297   -0.997  1.00 0.00 ? 24  VAL A HG11 4  
ATOM 6985  H HG12 . VAL A 1 24  ? 23.371  3.621   -2.111  1.00 0.00 ? 24  VAL A HG12 4  
ATOM 6986  H HG13 . VAL A 1 24  ? 23.367  3.909   -0.371  1.00 0.00 ? 24  VAL A HG13 4  
ATOM 6987  H HG21 . VAL A 1 24  ? 19.803  3.775   -1.745  1.00 0.00 ? 24  VAL A HG21 4  
ATOM 6988  H HG22 . VAL A 1 24  ? 20.920  4.872   -0.933  1.00 0.00 ? 24  VAL A HG22 4  
ATOM 6989  H HG23 . VAL A 1 24  ? 21.243  4.348   -2.586  1.00 0.00 ? 24  VAL A HG23 4  
ATOM 6990  N N    . ASN A 1 25  ? 22.437  1.460   -4.045  1.00 0.00 ? 25  ASN A N    4  
ATOM 6991  C CA   . ASN A 1 25  ? 23.511  1.028   -4.984  1.00 0.00 ? 25  ASN A CA   4  
ATOM 6992  C C    . ASN A 1 25  ? 23.193  1.655   -6.331  1.00 0.00 ? 25  ASN A C    4  
ATOM 6993  O O    . ASN A 1 25  ? 22.741  0.999   -7.246  1.00 0.00 ? 25  ASN A O    4  
ATOM 6994  C CB   . ASN A 1 25  ? 23.520  -0.500  -5.105  1.00 0.00 ? 25  ASN A CB   4  
ATOM 6995  C CG   . ASN A 1 25  ? 24.750  -0.941  -5.900  1.00 0.00 ? 25  ASN A CG   4  
ATOM 6996  O OD1  . ASN A 1 25  ? 25.851  -0.946  -5.386  1.00 0.00 ? 25  ASN A OD1  4  
ATOM 6997  N ND2  . ASN A 1 25  ? 24.608  -1.316  -7.142  1.00 0.00 ? 25  ASN A ND2  4  
ATOM 6998  H H    . ASN A 1 25  ? 21.708  2.035   -4.376  1.00 0.00 ? 25  ASN A H    4  
ATOM 6999  H HA   . ASN A 1 25  ? 24.470  1.381   -4.633  1.00 0.00 ? 25  ASN A HA   4  
ATOM 7000  H HB2  . ASN A 1 25  ? 23.551  -0.940  -4.120  1.00 0.00 ? 25  ASN A HB2  4  
ATOM 7001  H HB3  . ASN A 1 25  ? 22.628  -0.825  -5.617  1.00 0.00 ? 25  ASN A HB3  4  
ATOM 7002  H HD21 . ASN A 1 25  ? 23.720  -1.313  -7.557  1.00 0.00 ? 25  ASN A HD21 4  
ATOM 7003  H HD22 . ASN A 1 25  ? 25.390  -1.601  -7.660  1.00 0.00 ? 25  ASN A HD22 4  
ATOM 7004  N N    . VAL A 1 26  ? 23.381  2.948   -6.414  1.00 0.00 ? 26  VAL A N    4  
ATOM 7005  C CA   . VAL A 1 26  ? 23.062  3.732   -7.648  1.00 0.00 ? 26  VAL A CA   4  
ATOM 7006  C C    . VAL A 1 26  ? 21.567  4.066   -7.680  1.00 0.00 ? 26  VAL A C    4  
ATOM 7007  O O    . VAL A 1 26  ? 21.133  4.852   -8.502  1.00 0.00 ? 26  VAL A O    4  
ATOM 7008  C CB   . VAL A 1 26  ? 23.458  2.995   -8.938  1.00 0.00 ? 26  VAL A CB   4  
ATOM 7009  C CG1  . VAL A 1 26  ? 23.268  3.934   -10.127 1.00 0.00 ? 26  VAL A CG1  4  
ATOM 7010  C CG2  . VAL A 1 26  ? 24.924  2.563   -8.853  1.00 0.00 ? 26  VAL A CG2  4  
ATOM 7011  H H    . VAL A 1 26  ? 23.707  3.428   -5.624  1.00 0.00 ? 26  VAL A H    4  
ATOM 7012  H HA   . VAL A 1 26  ? 23.606  4.665   -7.591  1.00 0.00 ? 26  VAL A HA   4  
ATOM 7013  H HB   . VAL A 1 26  ? 22.829  2.129   -9.072  1.00 0.00 ? 26  VAL A HB   4  
ATOM 7014  H HG11 . VAL A 1 26  ? 23.441  4.952   -9.812  1.00 0.00 ? 26  VAL A HG11 4  
ATOM 7015  H HG12 . VAL A 1 26  ? 23.965  3.673   -10.908 1.00 0.00 ? 26  VAL A HG12 4  
ATOM 7016  H HG13 . VAL A 1 26  ? 22.257  3.841   -10.499 1.00 0.00 ? 26  VAL A HG13 4  
ATOM 7017  H HG21 . VAL A 1 26  ? 25.462  3.242   -8.209  1.00 0.00 ? 26  VAL A HG21 4  
ATOM 7018  H HG22 . VAL A 1 26  ? 24.982  1.563   -8.451  1.00 0.00 ? 26  VAL A HG22 4  
ATOM 7019  H HG23 . VAL A 1 26  ? 25.362  2.581   -9.840  1.00 0.00 ? 26  VAL A HG23 4  
ATOM 7020  N N    . MET A 1 27  ? 20.776  3.531   -6.767  1.00 0.00 ? 27  MET A N    4  
ATOM 7021  C CA   . MET A 1 27  ? 19.337  3.888   -6.735  1.00 0.00 ? 27  MET A CA   4  
ATOM 7022  C C    . MET A 1 27  ? 19.308  5.347   -6.303  1.00 0.00 ? 27  MET A C    4  
ATOM 7023  O O    . MET A 1 27  ? 18.981  6.223   -7.080  1.00 0.00 ? 27  MET A O    4  
ATOM 7024  C CB   . MET A 1 27  ? 18.591  3.016   -5.712  1.00 0.00 ? 27  MET A CB   4  
ATOM 7025  C CG   . MET A 1 27  ? 18.984  1.533   -5.861  1.00 0.00 ? 27  MET A CG   4  
ATOM 7026  S SD   . MET A 1 27  ? 17.643  0.612   -6.662  1.00 0.00 ? 27  MET A SD   4  
ATOM 7027  C CE   . MET A 1 27  ? 18.610  -0.850  -7.113  1.00 0.00 ? 27  MET A CE   4  
ATOM 7028  H H    . MET A 1 27  ? 21.132  2.940   -6.082  1.00 0.00 ? 27  MET A H    4  
ATOM 7029  H HA   . MET A 1 27  ? 18.894  3.783   -7.721  1.00 0.00 ? 27  MET A HA   4  
ATOM 7030  H HB2  . MET A 1 27  ? 18.834  3.348   -4.714  1.00 0.00 ? 27  MET A HB2  4  
ATOM 7031  H HB3  . MET A 1 27  ? 17.534  3.124   -5.870  1.00 0.00 ? 27  MET A HB3  4  
ATOM 7032  H HG2  . MET A 1 27  ? 19.877  1.446   -6.457  1.00 0.00 ? 27  MET A HG2  4  
ATOM 7033  H HG3  . MET A 1 27  ? 19.169  1.113   -4.882  1.00 0.00 ? 27  MET A HG3  4  
ATOM 7034  H HE1  . MET A 1 27  ? 19.585  -0.794  -6.656  1.00 0.00 ? 27  MET A HE1  4  
ATOM 7035  H HE2  . MET A 1 27  ? 18.102  -1.738  -6.763  1.00 0.00 ? 27  MET A HE2  4  
ATOM 7036  H HE3  . MET A 1 27  ? 18.719  -0.892  -8.188  1.00 0.00 ? 27  MET A HE3  4  
ATOM 7037  N N    . LEU A 1 28  ? 19.739  5.614   -5.083  1.00 0.00 ? 28  LEU A N    4  
ATOM 7038  C CA   . LEU A 1 28  ? 19.835  7.021   -4.581  1.00 0.00 ? 28  LEU A CA   4  
ATOM 7039  C C    . LEU A 1 28  ? 18.598  7.827   -4.980  1.00 0.00 ? 28  LEU A C    4  
ATOM 7040  O O    . LEU A 1 28  ? 18.644  8.629   -5.892  1.00 0.00 ? 28  LEU A O    4  
ATOM 7041  C CB   . LEU A 1 28  ? 21.089  7.621   -5.205  1.00 0.00 ? 28  LEU A CB   4  
ATOM 7042  C CG   . LEU A 1 28  ? 22.317  7.102   -4.463  1.00 0.00 ? 28  LEU A CG   4  
ATOM 7043  C CD1  . LEU A 1 28  ? 22.682  5.716   -4.995  1.00 0.00 ? 28  LEU A CD1  4  
ATOM 7044  C CD2  . LEU A 1 28  ? 23.484  8.061   -4.690  1.00 0.00 ? 28  LEU A CD2  4  
ATOM 7045  H H    . LEU A 1 28  ? 20.057  4.883   -4.515  1.00 0.00 ? 28  LEU A H    4  
ATOM 7046  H HA   . LEU A 1 28  ? 19.936  7.021   -3.513  1.00 0.00 ? 28  LEU A HA   4  
ATOM 7047  H HB2  . LEU A 1 28  ? 21.149  7.316   -6.243  1.00 0.00 ? 28  LEU A HB2  4  
ATOM 7048  H HB3  . LEU A 1 28  ? 21.054  8.691   -5.141  1.00 0.00 ? 28  LEU A HB3  4  
ATOM 7049  H HG   . LEU A 1 28  ? 22.100  7.036   -3.408  1.00 0.00 ? 28  LEU A HG   4  
ATOM 7050  H HD11 . LEU A 1 28  ? 22.544  5.695   -6.066  1.00 0.00 ? 28  LEU A HD11 4  
ATOM 7051  H HD12 . LEU A 1 28  ? 23.713  5.500   -4.760  1.00 0.00 ? 28  LEU A HD12 4  
ATOM 7052  H HD13 . LEU A 1 28  ? 22.045  4.975   -4.536  1.00 0.00 ? 28  LEU A HD13 4  
ATOM 7053  H HD21 . LEU A 1 28  ? 23.484  8.387   -5.719  1.00 0.00 ? 28  LEU A HD21 4  
ATOM 7054  H HD22 . LEU A 1 28  ? 23.376  8.916   -4.040  1.00 0.00 ? 28  LEU A HD22 4  
ATOM 7055  H HD23 . LEU A 1 28  ? 24.411  7.555   -4.471  1.00 0.00 ? 28  LEU A HD23 4  
ATOM 7056  N N    . ARG A 1 29  ? 17.476  7.574   -4.345  1.00 0.00 ? 29  ARG A N    4  
ATOM 7057  C CA   . ARG A 1 29  ? 16.216  8.277   -4.742  1.00 0.00 ? 29  ARG A CA   4  
ATOM 7058  C C    . ARG A 1 29  ? 15.930  7.935   -6.216  1.00 0.00 ? 29  ARG A C    4  
ATOM 7059  O O    . ARG A 1 29  ? 15.274  8.670   -6.921  1.00 0.00 ? 29  ARG A O    4  
ATOM 7060  C CB   . ARG A 1 29  ? 16.386  9.794   -4.582  1.00 0.00 ? 29  ARG A CB   4  
ATOM 7061  C CG   . ARG A 1 29  ? 15.063  10.499  -4.890  1.00 0.00 ? 29  ARG A CG   4  
ATOM 7062  C CD   . ARG A 1 29  ? 15.027  11.851  -4.174  1.00 0.00 ? 29  ARG A CD   4  
ATOM 7063  N NE   . ARG A 1 29  ? 14.137  12.785  -4.920  1.00 0.00 ? 29  ARG A NE   4  
ATOM 7064  C CZ   . ARG A 1 29  ? 13.397  13.640  -4.269  1.00 0.00 ? 29  ARG A CZ   4  
ATOM 7065  N NH1  . ARG A 1 29  ? 12.323  13.234  -3.648  1.00 0.00 ? 29  ARG A NH1  4  
ATOM 7066  N NH2  . ARG A 1 29  ? 13.730  14.901  -4.239  1.00 0.00 ? 29  ARG A NH2  4  
ATOM 7067  H H    . ARG A 1 29  ? 17.454  6.889   -3.645  1.00 0.00 ? 29  ARG A H    4  
ATOM 7068  H HA   . ARG A 1 29  ? 15.398  7.930   -4.125  1.00 0.00 ? 29  ARG A HA   4  
ATOM 7069  H HB2  . ARG A 1 29  ? 16.684  10.016  -3.568  1.00 0.00 ? 29  ARG A HB2  4  
ATOM 7070  H HB3  . ARG A 1 29  ? 17.144  10.146  -5.265  1.00 0.00 ? 29  ARG A HB3  4  
ATOM 7071  H HG2  . ARG A 1 29  ? 14.977  10.655  -5.956  1.00 0.00 ? 29  ARG A HG2  4  
ATOM 7072  H HG3  . ARG A 1 29  ? 14.240  9.890   -4.547  1.00 0.00 ? 29  ARG A HG3  4  
ATOM 7073  H HD2  . ARG A 1 29  ? 14.649  11.718  -3.172  1.00 0.00 ? 29  ARG A HD2  4  
ATOM 7074  H HD3  . ARG A 1 29  ? 16.025  12.262  -4.132  1.00 0.00 ? 29  ARG A HD3  4  
ATOM 7075  H HE   . ARG A 1 29  ? 14.107  12.756  -5.899  1.00 0.00 ? 29  ARG A HE   4  
ATOM 7076  H HH11 . ARG A 1 29  ? 12.067  12.268  -3.672  1.00 0.00 ? 29  ARG A HH11 4  
ATOM 7077  H HH12 . ARG A 1 29  ? 11.756  13.889  -3.149  1.00 0.00 ? 29  ARG A HH12 4  
ATOM 7078  H HH21 . ARG A 1 29  ? 14.553  15.212  -4.715  1.00 0.00 ? 29  ARG A HH21 4  
ATOM 7079  H HH22 . ARG A 1 29  ? 13.164  15.557  -3.740  1.00 0.00 ? 29  ARG A HH22 4  
ATOM 7080  N N    . LYS A 1 30  ? 16.465  6.818   -6.683  1.00 0.00 ? 30  LYS A N    4  
ATOM 7081  C CA   . LYS A 1 30  ? 16.290  6.375   -8.104  1.00 0.00 ? 30  LYS A CA   4  
ATOM 7082  C C    . LYS A 1 30  ? 16.436  7.539   -9.091  1.00 0.00 ? 30  LYS A C    4  
ATOM 7083  O O    . LYS A 1 30  ? 15.920  7.488   -10.189 1.00 0.00 ? 30  LYS A O    4  
ATOM 7084  C CB   . LYS A 1 30  ? 14.930  5.702   -8.268  1.00 0.00 ? 30  LYS A CB   4  
ATOM 7085  C CG   . LYS A 1 30  ? 15.103  4.186   -8.112  1.00 0.00 ? 30  LYS A CG   4  
ATOM 7086  C CD   . LYS A 1 30  ? 13.735  3.503   -8.174  1.00 0.00 ? 30  LYS A CD   4  
ATOM 7087  C CE   . LYS A 1 30  ? 13.904  2.000   -7.945  1.00 0.00 ? 30  LYS A CE   4  
ATOM 7088  N NZ   . LYS A 1 30  ? 14.460  1.369   -9.175  1.00 0.00 ? 30  LYS A NZ   4  
ATOM 7089  H H    . LYS A 1 30  ? 17.006  6.262   -6.086  1.00 0.00 ? 30  LYS A H    4  
ATOM 7090  H HA   . LYS A 1 30  ? 17.051  5.656   -8.327  1.00 0.00 ? 30  LYS A HA   4  
ATOM 7091  H HB2  . LYS A 1 30  ? 14.255  6.070   -7.511  1.00 0.00 ? 30  LYS A HB2  4  
ATOM 7092  H HB3  . LYS A 1 30  ? 14.534  5.919   -9.247  1.00 0.00 ? 30  LYS A HB3  4  
ATOM 7093  H HG2  . LYS A 1 30  ? 15.734  3.814   -8.907  1.00 0.00 ? 30  LYS A HG2  4  
ATOM 7094  H HG3  . LYS A 1 30  ? 15.570  3.974   -7.160  1.00 0.00 ? 30  LYS A HG3  4  
ATOM 7095  H HD2  . LYS A 1 30  ? 13.092  3.915   -7.410  1.00 0.00 ? 30  LYS A HD2  4  
ATOM 7096  H HD3  . LYS A 1 30  ? 13.294  3.670   -9.145  1.00 0.00 ? 30  LYS A HD3  4  
ATOM 7097  H HE2  . LYS A 1 30  ? 14.580  1.835   -7.119  1.00 0.00 ? 30  LYS A HE2  4  
ATOM 7098  H HE3  . LYS A 1 30  ? 12.944  1.561   -7.717  1.00 0.00 ? 30  LYS A HE3  4  
ATOM 7099  H HZ1  . LYS A 1 30  ? 15.320  1.877   -9.466  1.00 0.00 ? 30  LYS A HZ1  4  
ATOM 7100  H HZ2  . LYS A 1 30  ? 14.692  0.374   -8.980  1.00 0.00 ? 30  LYS A HZ2  4  
ATOM 7101  H HZ3  . LYS A 1 30  ? 13.754  1.414   -9.937  1.00 0.00 ? 30  LYS A HZ3  4  
ATOM 7102  N N    . ILE A 1 31  ? 17.167  8.569   -8.704  1.00 0.00 ? 31  ILE A N    4  
ATOM 7103  C CA   . ILE A 1 31  ? 17.413  9.764   -9.583  1.00 0.00 ? 31  ILE A CA   4  
ATOM 7104  C C    . ILE A 1 31  ? 16.176  10.111  -10.428 1.00 0.00 ? 31  ILE A C    4  
ATOM 7105  O O    . ILE A 1 31  ? 16.283  10.562  -11.552 1.00 0.00 ? 31  ILE A O    4  
ATOM 7106  C CB   . ILE A 1 31  ? 18.613  9.474   -10.486 1.00 0.00 ? 31  ILE A CB   4  
ATOM 7107  C CG1  . ILE A 1 31  ? 19.767  8.883   -9.644  1.00 0.00 ? 31  ILE A CG1  4  
ATOM 7108  C CG2  . ILE A 1 31  ? 19.071  10.776  -11.140 1.00 0.00 ? 31  ILE A CG2  4  
ATOM 7109  C CD1  . ILE A 1 31  ? 19.927  7.394   -9.960  1.00 0.00 ? 31  ILE A CD1  4  
ATOM 7110  H H    . ILE A 1 31  ? 17.589  8.549   -7.829  1.00 0.00 ? 31  ILE A H    4  
ATOM 7111  H HA   . ILE A 1 31  ? 17.652  10.607  -8.960  1.00 0.00 ? 31  ILE A HA   4  
ATOM 7112  H HB   . ILE A 1 31  ? 18.320  8.773   -11.248 1.00 0.00 ? 31  ILE A HB   4  
ATOM 7113  H HG12 . ILE A 1 31  ? 20.688  9.398   -9.871  1.00 0.00 ? 31  ILE A HG12 4  
ATOM 7114  H HG13 . ILE A 1 31  ? 19.545  8.999   -8.590  1.00 0.00 ? 31  ILE A HG13 4  
ATOM 7115  H HG21 . ILE A 1 31  ? 18.915  11.596  -10.454 1.00 0.00 ? 31  ILE A HG21 4  
ATOM 7116  H HG22 . ILE A 1 31  ? 20.120  10.705  -11.384 1.00 0.00 ? 31  ILE A HG22 4  
ATOM 7117  H HG23 . ILE A 1 31  ? 18.501  10.945  -12.041 1.00 0.00 ? 31  ILE A HG23 4  
ATOM 7118  H HD11 . ILE A 1 31  ? 18.972  6.900   -9.857  1.00 0.00 ? 31  ILE A HD11 4  
ATOM 7119  H HD12 . ILE A 1 31  ? 20.286  7.277   -10.971 1.00 0.00 ? 31  ILE A HD12 4  
ATOM 7120  H HD13 . ILE A 1 31  ? 20.636  6.955   -9.273  1.00 0.00 ? 31  ILE A HD13 4  
ATOM 7121  N N    . ALA A 1 32  ? 15.007  9.892   -9.880  1.00 0.00 ? 32  ALA A N    4  
ATOM 7122  C CA   . ALA A 1 32  ? 13.751  10.190  -10.624 1.00 0.00 ? 32  ALA A CA   4  
ATOM 7123  C C    . ALA A 1 32  ? 12.553  9.937   -9.706  1.00 0.00 ? 32  ALA A C    4  
ATOM 7124  O O    . ALA A 1 32  ? 11.928  10.863  -9.226  1.00 0.00 ? 32  ALA A O    4  
ATOM 7125  C CB   . ALA A 1 32  ? 13.656  9.283   -11.852 1.00 0.00 ? 32  ALA A CB   4  
ATOM 7126  H H    . ALA A 1 32  ? 14.956  9.525   -8.974  1.00 0.00 ? 32  ALA A H    4  
ATOM 7127  H HA   . ALA A 1 32  ? 13.754  11.224  -10.937 1.00 0.00 ? 32  ALA A HA   4  
ATOM 7128  H HB1  . ALA A 1 32  ? 14.170  8.354   -11.654 1.00 0.00 ? 32  ALA A HB1  4  
ATOM 7129  H HB2  . ALA A 1 32  ? 12.617  9.080   -12.070 1.00 0.00 ? 32  ALA A HB2  4  
ATOM 7130  H HB3  . ALA A 1 32  ? 14.112  9.774   -12.699 1.00 0.00 ? 32  ALA A HB3  4  
ATOM 7131  N N    . VAL A 1 33  ? 12.236  8.686   -9.448  1.00 0.00 ? 33  VAL A N    4  
ATOM 7132  C CA   . VAL A 1 33  ? 11.081  8.361   -8.550  1.00 0.00 ? 33  VAL A CA   4  
ATOM 7133  C C    . VAL A 1 33  ? 9.790   8.976   -9.116  1.00 0.00 ? 33  VAL A C    4  
ATOM 7134  O O    . VAL A 1 33  ? 9.824   9.844   -9.968  1.00 0.00 ? 33  VAL A O    4  
ATOM 7135  C CB   . VAL A 1 33  ? 11.378  8.916   -7.150  1.00 0.00 ? 33  VAL A CB   4  
ATOM 7136  C CG1  . VAL A 1 33  ? 10.207  8.638   -6.202  1.00 0.00 ? 33  VAL A CG1  4  
ATOM 7137  C CG2  . VAL A 1 33  ? 12.641  8.239   -6.609  1.00 0.00 ? 33  VAL A CG2  4  
ATOM 7138  H H    . VAL A 1 33  ? 12.769  7.959   -9.838  1.00 0.00 ? 33  VAL A H    4  
ATOM 7139  H HA   . VAL A 1 33  ? 10.963  7.288   -8.488  1.00 0.00 ? 33  VAL A HA   4  
ATOM 7140  H HB   . VAL A 1 33  ? 11.542  9.979   -7.214  1.00 0.00 ? 33  VAL A HB   4  
ATOM 7141  H HG11 . VAL A 1 33  ? 9.824   7.648   -6.384  1.00 0.00 ? 33  VAL A HG11 4  
ATOM 7142  H HG12 . VAL A 1 33  ? 10.547  8.710   -5.179  1.00 0.00 ? 33  VAL A HG12 4  
ATOM 7143  H HG13 . VAL A 1 33  ? 9.425   9.363   -6.373  1.00 0.00 ? 33  VAL A HG13 4  
ATOM 7144  H HG21 . VAL A 1 33  ? 13.240  7.877   -7.433  1.00 0.00 ? 33  VAL A HG21 4  
ATOM 7145  H HG22 . VAL A 1 33  ? 13.216  8.953   -6.038  1.00 0.00 ? 33  VAL A HG22 4  
ATOM 7146  H HG23 . VAL A 1 33  ? 12.368  7.411   -5.977  1.00 0.00 ? 33  VAL A HG23 4  
ATOM 7147  N N    . ALA A 1 34  ? 8.652   8.521   -8.652  1.00 0.00 ? 34  ALA A N    4  
ATOM 7148  C CA   . ALA A 1 34  ? 7.359   9.066   -9.158  1.00 0.00 ? 34  ALA A CA   4  
ATOM 7149  C C    . ALA A 1 34  ? 7.220   10.530  -8.734  1.00 0.00 ? 34  ALA A C    4  
ATOM 7150  O O    . ALA A 1 34  ? 7.774   10.949  -7.735  1.00 0.00 ? 34  ALA A O    4  
ATOM 7151  C CB   . ALA A 1 34  ? 6.200   8.254   -8.576  1.00 0.00 ? 34  ALA A CB   4  
ATOM 7152  H H    . ALA A 1 34  ? 8.650   7.816   -7.972  1.00 0.00 ? 34  ALA A H    4  
ATOM 7153  H HA   . ALA A 1 34  ? 7.338   9.001   -10.236 1.00 0.00 ? 34  ALA A HA   4  
ATOM 7154  H HB1  . ALA A 1 34  ? 6.385   7.201   -8.729  1.00 0.00 ? 34  ALA A HB1  4  
ATOM 7155  H HB2  . ALA A 1 34  ? 6.115   8.455   -7.518  1.00 0.00 ? 34  ALA A HB2  4  
ATOM 7156  H HB3  . ALA A 1 34  ? 5.281   8.533   -9.070  1.00 0.00 ? 34  ALA A HB3  4  
ATOM 7157  N N    . ALA A 1 35  ? 6.484   11.307  -9.487  1.00 0.00 ? 35  ALA A N    4  
ATOM 7158  C CA   . ALA A 1 35  ? 6.303   12.746  -9.137  1.00 0.00 ? 35  ALA A CA   4  
ATOM 7159  C C    . ALA A 1 35  ? 4.931   13.221  -9.619  1.00 0.00 ? 35  ALA A C    4  
ATOM 7160  O O    . ALA A 1 35  ? 4.584   13.068  -10.775 1.00 0.00 ? 35  ALA A O    4  
ATOM 7161  C CB   . ALA A 1 35  ? 7.397   13.577  -9.811  1.00 0.00 ? 35  ALA A CB   4  
ATOM 7162  H H    . ALA A 1 35  ? 6.051   10.942  -10.286 1.00 0.00 ? 35  ALA A H    4  
ATOM 7163  H HA   . ALA A 1 35  ? 6.369   12.866  -8.065  1.00 0.00 ? 35  ALA A HA   4  
ATOM 7164  H HB1  . ALA A 1 35  ? 7.399   13.376  -10.872 1.00 0.00 ? 35  ALA A HB1  4  
ATOM 7165  H HB2  . ALA A 1 35  ? 7.205   14.627  -9.644  1.00 0.00 ? 35  ALA A HB2  4  
ATOM 7166  H HB3  . ALA A 1 35  ? 8.357   13.315  -9.393  1.00 0.00 ? 35  ALA A HB3  4  
ATOM 7167  N N    . ALA A 1 36  ? 4.151   13.796  -8.739  1.00 0.00 ? 36  ALA A N    4  
ATOM 7168  C CA   . ALA A 1 36  ? 2.798   14.285  -9.135  1.00 0.00 ? 36  ALA A CA   4  
ATOM 7169  C C    . ALA A 1 36  ? 2.189   15.084  -7.980  1.00 0.00 ? 36  ALA A C    4  
ATOM 7170  O O    . ALA A 1 36  ? 2.708   15.090  -6.880  1.00 0.00 ? 36  ALA A O    4  
ATOM 7171  C CB   . ALA A 1 36  ? 1.898   13.091  -9.460  1.00 0.00 ? 36  ALA A CB   4  
ATOM 7172  H H    . ALA A 1 36  ? 4.457   13.905  -7.815  1.00 0.00 ? 36  ALA A H    4  
ATOM 7173  H HA   . ALA A 1 36  ? 2.884   14.919  -10.005 1.00 0.00 ? 36  ALA A HA   4  
ATOM 7174  H HB1  . ALA A 1 36  ? 2.161   12.259  -8.824  1.00 0.00 ? 36  ALA A HB1  4  
ATOM 7175  H HB2  . ALA A 1 36  ? 0.866   13.362  -9.290  1.00 0.00 ? 36  ALA A HB2  4  
ATOM 7176  H HB3  . ALA A 1 36  ? 2.031   12.811  -10.494 1.00 0.00 ? 36  ALA A HB3  4  
ATOM 7177  N N    . SER A 1 37  ? 1.093   15.757  -8.225  1.00 0.00 ? 37  SER A N    4  
ATOM 7178  C CA   . SER A 1 37  ? 0.446   16.558  -7.144  1.00 0.00 ? 37  SER A CA   4  
ATOM 7179  C C    . SER A 1 37  ? -0.982  16.928  -7.561  1.00 0.00 ? 37  SER A C    4  
ATOM 7180  O O    . SER A 1 37  ? -1.254  18.048  -7.952  1.00 0.00 ? 37  SER A O    4  
ATOM 7181  C CB   . SER A 1 37  ? 1.257   17.832  -6.901  1.00 0.00 ? 37  SER A CB   4  
ATOM 7182  O OG   . SER A 1 37  ? 0.830   18.436  -5.687  1.00 0.00 ? 37  SER A OG   4  
ATOM 7183  H H    . SER A 1 37  ? 0.696   15.735  -9.120  1.00 0.00 ? 37  SER A H    4  
ATOM 7184  H HA   . SER A 1 37  ? 0.413   15.975  -6.236  1.00 0.00 ? 37  SER A HA   4  
ATOM 7185  H HB2  . SER A 1 37  ? 2.303   17.586  -6.826  1.00 0.00 ? 37  SER A HB2  4  
ATOM 7186  H HB3  . SER A 1 37  ? 1.108   18.516  -7.727  1.00 0.00 ? 37  SER A HB3  4  
ATOM 7187  H HG   . SER A 1 37  ? -0.124  18.537  -5.725  1.00 0.00 ? 37  SER A HG   4  
ATOM 7188  N N    . LYS A 1 38  ? -1.896  15.993  -7.472  1.00 0.00 ? 38  LYS A N    4  
ATOM 7189  C CA   . LYS A 1 38  ? -3.316  16.274  -7.850  1.00 0.00 ? 38  LYS A CA   4  
ATOM 7190  C C    . LYS A 1 38  ? -4.144  14.979  -7.728  1.00 0.00 ? 38  LYS A C    4  
ATOM 7191  O O    . LYS A 1 38  ? -5.111  14.954  -6.993  1.00 0.00 ? 38  LYS A O    4  
ATOM 7192  C CB   . LYS A 1 38  ? -3.390  16.810  -9.290  1.00 0.00 ? 38  LYS A CB   4  
ATOM 7193  C CG   . LYS A 1 38  ? -3.646  18.322  -9.270  1.00 0.00 ? 38  LYS A CG   4  
ATOM 7194  C CD   . LYS A 1 38  ? -2.821  18.998  -10.368 1.00 0.00 ? 38  LYS A CD   4  
ATOM 7195  C CE   . LYS A 1 38  ? -2.618  20.474  -10.020 1.00 0.00 ? 38  LYS A CE   4  
ATOM 7196  N NZ   . LYS A 1 38  ? -3.736  21.277  -10.591 1.00 0.00 ? 38  LYS A NZ   4  
ATOM 7197  H H    . LYS A 1 38  ? -1.647  15.104  -7.145  1.00 0.00 ? 38  LYS A H    4  
ATOM 7198  H HA   . LYS A 1 38  ? -3.720  17.012  -7.172  1.00 0.00 ? 38  LYS A HA   4  
ATOM 7199  H HB2  . LYS A 1 38  ? -2.457  16.608  -9.794  1.00 0.00 ? 38  LYS A HB2  4  
ATOM 7200  H HB3  . LYS A 1 38  ? -4.196  16.320  -9.817  1.00 0.00 ? 38  LYS A HB3  4  
ATOM 7201  H HG2  . LYS A 1 38  ? -4.696  18.511  -9.441  1.00 0.00 ? 38  LYS A HG2  4  
ATOM 7202  H HG3  . LYS A 1 38  ? -3.360  18.724  -8.309  1.00 0.00 ? 38  LYS A HG3  4  
ATOM 7203  H HD2  . LYS A 1 38  ? -1.859  18.510  -10.447 1.00 0.00 ? 38  LYS A HD2  4  
ATOM 7204  H HD3  . LYS A 1 38  ? -3.342  18.921  -11.310 1.00 0.00 ? 38  LYS A HD3  4  
ATOM 7205  H HE2  . LYS A 1 38  ? -2.602  20.591  -8.946  1.00 0.00 ? 38  LYS A HE2  4  
ATOM 7206  H HE3  . LYS A 1 38  ? -1.681  20.816  -10.434 1.00 0.00 ? 38  LYS A HE3  4  
ATOM 7207  H HZ1  . LYS A 1 38  ? -4.644  20.854  -10.310 1.00 0.00 ? 38  LYS A HZ1  4  
ATOM 7208  H HZ2  . LYS A 1 38  ? -3.680  22.251  -10.234 1.00 0.00 ? 38  LYS A HZ2  4  
ATOM 7209  H HZ3  . LYS A 1 38  ? -3.663  21.285  -11.628 1.00 0.00 ? 38  LYS A HZ3  4  
ATOM 7210  N N    . PRO A 1 39  ? -3.755  13.927  -8.436  1.00 0.00 ? 39  PRO A N    4  
ATOM 7211  C CA   . PRO A 1 39  ? -4.484  12.645  -8.372  1.00 0.00 ? 39  PRO A CA   4  
ATOM 7212  C C    . PRO A 1 39  ? -4.131  11.902  -7.080  1.00 0.00 ? 39  PRO A C    4  
ATOM 7213  O O    . PRO A 1 39  ? -3.154  12.214  -6.425  1.00 0.00 ? 39  PRO A O    4  
ATOM 7214  C CB   . PRO A 1 39  ? -3.979  11.873  -9.593  1.00 0.00 ? 39  PRO A CB   4  
ATOM 7215  C CG   . PRO A 1 39  ? -2.607  12.484  -9.956  1.00 0.00 ? 39  PRO A CG   4  
ATOM 7216  C CD   . PRO A 1 39  ? -2.581  13.898  -9.350  1.00 0.00 ? 39  PRO A CD   4  
ATOM 7217  H HA   . PRO A 1 39  ? -5.547  12.804  -8.446  1.00 0.00 ? 39  PRO A HA   4  
ATOM 7218  H HB2  . PRO A 1 39  ? -3.870  10.825  -9.350  1.00 0.00 ? 39  PRO A HB2  4  
ATOM 7219  H HB3  . PRO A 1 39  ? -4.662  11.996  -10.419 1.00 0.00 ? 39  PRO A HB3  4  
ATOM 7220  H HG2  . PRO A 1 39  ? -1.814  11.883  -9.535  1.00 0.00 ? 39  PRO A HG2  4  
ATOM 7221  H HG3  . PRO A 1 39  ? -2.499  12.545  -11.028 1.00 0.00 ? 39  PRO A HG3  4  
ATOM 7222  H HD2  . PRO A 1 39  ? -1.662  14.055  -8.803  1.00 0.00 ? 39  PRO A HD2  4  
ATOM 7223  H HD3  . PRO A 1 39  ? -2.693  14.635  -10.126 1.00 0.00 ? 39  PRO A HD3  4  
ATOM 7224  N N    . ALA A 1 40  ? -4.917  10.921  -6.713  1.00 0.00 ? 40  ALA A N    4  
ATOM 7225  C CA   . ALA A 1 40  ? -4.629  10.153  -5.466  1.00 0.00 ? 40  ALA A CA   4  
ATOM 7226  C C    . ALA A 1 40  ? -5.355  8.807   -5.510  1.00 0.00 ? 40  ALA A C    4  
ATOM 7227  O O    . ALA A 1 40  ? -5.810  8.371   -6.549  1.00 0.00 ? 40  ALA A O    4  
ATOM 7228  C CB   . ALA A 1 40  ? -5.106  10.953  -4.255  1.00 0.00 ? 40  ALA A CB   4  
ATOM 7229  H H    . ALA A 1 40  ? -5.696  10.689  -7.260  1.00 0.00 ? 40  ALA A H    4  
ATOM 7230  H HA   . ALA A 1 40  ? -3.565  9.984   -5.388  1.00 0.00 ? 40  ALA A HA   4  
ATOM 7231  H HB1  . ALA A 1 40  ? -4.859  11.994  -4.393  1.00 0.00 ? 40  ALA A HB1  4  
ATOM 7232  H HB2  . ALA A 1 40  ? -6.175  10.845  -4.152  1.00 0.00 ? 40  ALA A HB2  4  
ATOM 7233  H HB3  . ALA A 1 40  ? -4.618  10.581  -3.366  1.00 0.00 ? 40  ALA A HB3  4  
ATOM 7234  N N    . VAL A 1 41  ? -5.458  8.142   -4.387  1.00 0.00 ? 41  VAL A N    4  
ATOM 7235  C CA   . VAL A 1 41  ? -6.142  6.818   -4.355  1.00 0.00 ? 41  VAL A CA   4  
ATOM 7236  C C    . VAL A 1 41  ? -7.654  7.013   -4.201  1.00 0.00 ? 41  VAL A C    4  
ATOM 7237  O O    . VAL A 1 41  ? -8.127  8.108   -3.972  1.00 0.00 ? 41  VAL A O    4  
ATOM 7238  C CB   . VAL A 1 41  ? -5.565  5.982   -3.184  1.00 0.00 ? 41  VAL A CB   4  
ATOM 7239  C CG1  . VAL A 1 41  ? -6.263  6.300   -1.853  1.00 0.00 ? 41  VAL A CG1  4  
ATOM 7240  C CG2  . VAL A 1 41  ? -5.714  4.487   -3.496  1.00 0.00 ? 41  VAL A CG2  4  
ATOM 7241  H H    . VAL A 1 41  ? -5.077  8.514   -3.564  1.00 0.00 ? 41  VAL A H    4  
ATOM 7242  H HA   . VAL A 1 41  ? -5.951  6.301   -5.280  1.00 0.00 ? 41  VAL A HA   4  
ATOM 7243  H HB   . VAL A 1 41  ? -4.521  6.218   -3.081  1.00 0.00 ? 41  VAL A HB   4  
ATOM 7244  H HG11 . VAL A 1 41  ? -6.757  7.254   -1.933  1.00 0.00 ? 41  VAL A HG11 4  
ATOM 7245  H HG12 . VAL A 1 41  ? -6.994  5.534   -1.636  1.00 0.00 ? 41  VAL A HG12 4  
ATOM 7246  H HG13 . VAL A 1 41  ? -5.532  6.337   -1.060  1.00 0.00 ? 41  VAL A HG13 4  
ATOM 7247  H HG21 . VAL A 1 41  ? -6.142  4.364   -4.476  1.00 0.00 ? 41  VAL A HG21 4  
ATOM 7248  H HG22 . VAL A 1 41  ? -4.743  4.018   -3.471  1.00 0.00 ? 41  VAL A HG22 4  
ATOM 7249  H HG23 . VAL A 1 41  ? -6.358  4.023   -2.765  1.00 0.00 ? 41  VAL A HG23 4  
ATOM 7250  N N    . GLU A 1 42  ? -8.397  5.945   -4.283  1.00 0.00 ? 42  GLU A N    4  
ATOM 7251  C CA   . GLU A 1 42  ? -9.866  6.038   -4.099  1.00 0.00 ? 42  GLU A CA   4  
ATOM 7252  C C    . GLU A 1 42  ? -10.378 4.698   -3.581  1.00 0.00 ? 42  GLU A C    4  
ATOM 7253  O O    . GLU A 1 42  ? -10.324 3.694   -4.267  1.00 0.00 ? 42  GLU A O    4  
ATOM 7254  C CB   . GLU A 1 42  ? -10.554 6.394   -5.418  1.00 0.00 ? 42  GLU A CB   4  
ATOM 7255  C CG   . GLU A 1 42  ? -10.192 5.363   -6.484  1.00 0.00 ? 42  GLU A CG   4  
ATOM 7256  C CD   . GLU A 1 42  ? -10.223 6.020   -7.865  1.00 0.00 ? 42  GLU A CD   4  
ATOM 7257  O OE1  . GLU A 1 42  ? -9.572  7.038   -8.030  1.00 0.00 ? 42  GLU A OE1  4  
ATOM 7258  O OE2  . GLU A 1 42  ? -10.899 5.493   -8.734  1.00 0.00 ? 42  GLU A OE2  4  
ATOM 7259  H H    . GLU A 1 42  ? -7.981  5.073   -4.438  1.00 0.00 ? 42  GLU A H    4  
ATOM 7260  H HA   . GLU A 1 42  ? -10.072 6.797   -3.370  1.00 0.00 ? 42  GLU A HA   4  
ATOM 7261  H HB2  . GLU A 1 42  ? -11.624 6.401   -5.273  1.00 0.00 ? 42  GLU A HB2  4  
ATOM 7262  H HB3  . GLU A 1 42  ? -10.227 7.371   -5.740  1.00 0.00 ? 42  GLU A HB3  4  
ATOM 7263  H HG2  . GLU A 1 42  ? -9.203  4.980   -6.287  1.00 0.00 ? 42  GLU A HG2  4  
ATOM 7264  H HG3  . GLU A 1 42  ? -10.904 4.553   -6.455  1.00 0.00 ? 42  GLU A HG3  4  
ATOM 7265  N N    . ILE A 1 43  ? -10.861 4.677   -2.368  1.00 0.00 ? 43  ILE A N    4  
ATOM 7266  C CA   . ILE A 1 43  ? -11.363 3.406   -1.786  1.00 0.00 ? 43  ILE A CA   4  
ATOM 7267  C C    . ILE A 1 43  ? -12.865 3.293   -2.014  1.00 0.00 ? 43  ILE A C    4  
ATOM 7268  O O    . ILE A 1 43  ? -13.586 4.272   -2.056  1.00 0.00 ? 43  ILE A O    4  
ATOM 7269  C CB   . ILE A 1 43  ? -11.061 3.361   -0.285  1.00 0.00 ? 43  ILE A CB   4  
ATOM 7270  C CG1  . ILE A 1 43  ? -9.546  3.488   -0.061  1.00 0.00 ? 43  ILE A CG1  4  
ATOM 7271  C CG2  . ILE A 1 43  ? -11.562 2.039   0.313   1.00 0.00 ? 43  ILE A CG2  4  
ATOM 7272  C CD1  . ILE A 1 43  ? -8.810  2.313   -0.713  1.00 0.00 ? 43  ILE A CD1  4  
ATOM 7273  H H    . ILE A 1 43  ? -10.884 5.498   -1.839  1.00 0.00 ? 43  ILE A H    4  
ATOM 7274  H HA   . ILE A 1 43  ? -10.871 2.581   -2.270  1.00 0.00 ? 43  ILE A HA   4  
ATOM 7275  H HB   . ILE A 1 43  ? -11.564 4.181   0.196   1.00 0.00 ? 43  ILE A HB   4  
ATOM 7276  H HG12 . ILE A 1 43  ? -9.199  4.408   -0.500  1.00 0.00 ? 43  ILE A HG12 4  
ATOM 7277  H HG13 . ILE A 1 43  ? -9.340  3.495   0.998   1.00 0.00 ? 43  ILE A HG13 4  
ATOM 7278  H HG21 . ILE A 1 43  ? -11.476 1.255   -0.426  1.00 0.00 ? 43  ILE A HG21 4  
ATOM 7279  H HG22 . ILE A 1 43  ? -10.967 1.786   1.178   1.00 0.00 ? 43  ILE A HG22 4  
ATOM 7280  H HG23 . ILE A 1 43  ? -12.596 2.145   0.605   1.00 0.00 ? 43  ILE A HG23 4  
ATOM 7281  H HD11 . ILE A 1 43  ? -9.224  1.384   -0.350  1.00 0.00 ? 43  ILE A HD11 4  
ATOM 7282  H HD12 . ILE A 1 43  ? -8.928  2.365   -1.785  1.00 0.00 ? 43  ILE A HD12 4  
ATOM 7283  H HD13 . ILE A 1 43  ? -7.761  2.362   -0.463  1.00 0.00 ? 43  ILE A HD13 4  
ATOM 7284  N N    . LYS A 1 44  ? -13.322 2.088   -2.158  1.00 0.00 ? 44  LYS A N    4  
ATOM 7285  C CA   . LYS A 1 44  ? -14.764 1.831   -2.390  1.00 0.00 ? 44  LYS A CA   4  
ATOM 7286  C C    . LYS A 1 44  ? -15.087 0.515   -1.693  1.00 0.00 ? 44  LYS A C    4  
ATOM 7287  O O    . LYS A 1 44  ? -14.653 -0.533  -2.119  1.00 0.00 ? 44  LYS A O    4  
ATOM 7288  C CB   . LYS A 1 44  ? -14.994 1.716   -3.900  1.00 0.00 ? 44  LYS A CB   4  
ATOM 7289  C CG   . LYS A 1 44  ? -14.411 2.949   -4.597  1.00 0.00 ? 44  LYS A CG   4  
ATOM 7290  C CD   . LYS A 1 44  ? -15.062 3.124   -5.964  1.00 0.00 ? 44  LYS A CD   4  
ATOM 7291  C CE   . LYS A 1 44  ? -14.728 1.930   -6.863  1.00 0.00 ? 44  LYS A CE   4  
ATOM 7292  N NZ   . LYS A 1 44  ? -15.930 1.564   -7.664  1.00 0.00 ? 44  LYS A NZ   4  
ATOM 7293  H H    . LYS A 1 44  ? -12.703 1.332   -2.115  1.00 0.00 ? 44  LYS A H    4  
ATOM 7294  H HA   . LYS A 1 44  ? -15.361 2.632   -1.973  1.00 0.00 ? 44  LYS A HA   4  
ATOM 7295  H HB2  . LYS A 1 44  ? -14.495 0.832   -4.274  1.00 0.00 ? 44  LYS A HB2  4  
ATOM 7296  H HB3  . LYS A 1 44  ? -16.050 1.652   -4.105  1.00 0.00 ? 44  LYS A HB3  4  
ATOM 7297  H HG2  . LYS A 1 44  ? -14.598 3.820   -3.996  1.00 0.00 ? 44  LYS A HG2  4  
ATOM 7298  H HG3  . LYS A 1 44  ? -13.349 2.829   -4.720  1.00 0.00 ? 44  LYS A HG3  4  
ATOM 7299  H HD2  . LYS A 1 44  ? -16.130 3.193   -5.841  1.00 0.00 ? 44  LYS A HD2  4  
ATOM 7300  H HD3  . LYS A 1 44  ? -14.689 4.027   -6.418  1.00 0.00 ? 44  LYS A HD3  4  
ATOM 7301  H HE2  . LYS A 1 44  ? -13.921 2.196   -7.529  1.00 0.00 ? 44  LYS A HE2  4  
ATOM 7302  H HE3  . LYS A 1 44  ? -14.432 1.090   -6.254  1.00 0.00 ? 44  LYS A HE3  4  
ATOM 7303  H HZ1  . LYS A 1 44  ? -16.418 2.428   -7.973  1.00 0.00 ? 44  LYS A HZ1  4  
ATOM 7304  H HZ2  . LYS A 1 44  ? -15.638 1.016   -8.497  1.00 0.00 ? 44  LYS A HZ2  4  
ATOM 7305  H HZ3  . LYS A 1 44  ? -16.574 0.992   -7.079  1.00 0.00 ? 44  LYS A HZ3  4  
ATOM 7306  N N    . GLN A 1 45  ? -15.785 0.555   -0.590  1.00 0.00 ? 45  GLN A N    4  
ATOM 7307  C CA   . GLN A 1 45  ? -16.039 -0.720  0.144   1.00 0.00 ? 45  GLN A CA   4  
ATOM 7308  C C    . GLN A 1 45  ? -17.453 -0.814  0.704   1.00 0.00 ? 45  GLN A C    4  
ATOM 7309  O O    . GLN A 1 45  ? -18.089 0.169   1.031   1.00 0.00 ? 45  GLN A O    4  
ATOM 7310  C CB   . GLN A 1 45  ? -15.041 -0.823  1.299   1.00 0.00 ? 45  GLN A CB   4  
ATOM 7311  C CG   . GLN A 1 45  ? -15.025 0.482   2.113   1.00 0.00 ? 45  GLN A CG   4  
ATOM 7312  C CD   . GLN A 1 45  ? -15.382 0.192   3.575   1.00 0.00 ? 45  GLN A CD   4  
ATOM 7313  O OE1  . GLN A 1 45  ? -14.766 0.722   4.479   1.00 0.00 ? 45  GLN A OE1  4  
ATOM 7314  N NE2  . GLN A 1 45  ? -16.358 -0.631  3.845   1.00 0.00 ? 45  GLN A NE2  4  
ATOM 7315  H H    . GLN A 1 45  ? -16.091 1.411   -0.227  1.00 0.00 ? 45  GLN A H    4  
ATOM 7316  H HA   . GLN A 1 45  ? -15.873 -1.549  -0.527  1.00 0.00 ? 45  GLN A HA   4  
ATOM 7317  H HB2  . GLN A 1 45  ? -15.321 -1.642  1.939   1.00 0.00 ? 45  GLN A HB2  4  
ATOM 7318  H HB3  . GLN A 1 45  ? -14.055 -1.003  0.900   1.00 0.00 ? 45  GLN A HB3  4  
ATOM 7319  H HG2  . GLN A 1 45  ? -14.039 0.920   2.066   1.00 0.00 ? 45  GLN A HG2  4  
ATOM 7320  H HG3  . GLN A 1 45  ? -15.743 1.172   1.701   1.00 0.00 ? 45  GLN A HG3  4  
ATOM 7321  H HE21 . GLN A 1 45  ? -16.854 -1.058  3.117   1.00 0.00 ? 45  GLN A HE21 4  
ATOM 7322  H HE22 . GLN A 1 45  ? -16.594 -0.821  4.776   1.00 0.00 ? 45  GLN A HE22 4  
ATOM 7323  N N    . GLU A 1 46  ? -17.924 -2.025  0.833   1.00 0.00 ? 46  GLU A N    4  
ATOM 7324  C CA   . GLU A 1 46  ? -19.273 -2.278  1.391   1.00 0.00 ? 46  GLU A CA   4  
ATOM 7325  C C    . GLU A 1 46  ? -19.156 -3.402  2.427   1.00 0.00 ? 46  GLU A C    4  
ATOM 7326  O O    . GLU A 1 46  ? -19.276 -4.569  2.103   1.00 0.00 ? 46  GLU A O    4  
ATOM 7327  C CB   . GLU A 1 46  ? -20.208 -2.713  0.266   1.00 0.00 ? 46  GLU A CB   4  
ATOM 7328  C CG   . GLU A 1 46  ? -21.654 -2.447  0.677   1.00 0.00 ? 46  GLU A CG   4  
ATOM 7329  C CD   . GLU A 1 46  ? -22.551 -2.468  -0.562  1.00 0.00 ? 46  GLU A CD   4  
ATOM 7330  O OE1  . GLU A 1 46  ? -22.515 -3.454  -1.279  1.00 0.00 ? 46  GLU A OE1  4  
ATOM 7331  O OE2  . GLU A 1 46  ? -23.259 -1.496  -0.773  1.00 0.00 ? 46  GLU A OE2  4  
ATOM 7332  H H    . GLU A 1 46  ? -17.368 -2.785  0.568   1.00 0.00 ? 46  GLU A H    4  
ATOM 7333  H HA   . GLU A 1 46  ? -19.652 -1.381  1.860   1.00 0.00 ? 46  GLU A HA   4  
ATOM 7334  H HB2  . GLU A 1 46  ? -19.975 -2.155  -0.629  1.00 0.00 ? 46  GLU A HB2  4  
ATOM 7335  H HB3  . GLU A 1 46  ? -20.076 -3.768  0.077   1.00 0.00 ? 46  GLU A HB3  4  
ATOM 7336  H HG2  . GLU A 1 46  ? -21.975 -3.211  1.369   1.00 0.00 ? 46  GLU A HG2  4  
ATOM 7337  H HG3  . GLU A 1 46  ? -21.718 -1.480  1.151   1.00 0.00 ? 46  GLU A HG3  4  
ATOM 7338  N N    . GLY A 1 47  ? -18.900 -3.059  3.664   1.00 0.00 ? 47  GLY A N    4  
ATOM 7339  C CA   . GLY A 1 47  ? -18.754 -4.105  4.722   1.00 0.00 ? 47  GLY A CA   4  
ATOM 7340  C C    . GLY A 1 47  ? -17.352 -4.716  4.637   1.00 0.00 ? 47  GLY A C    4  
ATOM 7341  O O    . GLY A 1 47  ? -16.365 -4.008  4.564   1.00 0.00 ? 47  GLY A O    4  
ATOM 7342  H H    . GLY A 1 47  ? -18.792 -2.113  3.896   1.00 0.00 ? 47  GLY A H    4  
ATOM 7343  H HA2  . GLY A 1 47  ? -18.895 -3.655  5.695   1.00 0.00 ? 47  GLY A HA2  4  
ATOM 7344  H HA3  . GLY A 1 47  ? -19.490 -4.878  4.570   1.00 0.00 ? 47  GLY A HA3  4  
ATOM 7345  N N    . ASP A 1 48  ? -17.257 -6.024  4.641   1.00 0.00 ? 48  ASP A N    4  
ATOM 7346  C CA   . ASP A 1 48  ? -15.923 -6.682  4.556   1.00 0.00 ? 48  ASP A CA   4  
ATOM 7347  C C    . ASP A 1 48  ? -15.408 -6.678  3.112   1.00 0.00 ? 48  ASP A C    4  
ATOM 7348  O O    . ASP A 1 48  ? -14.314 -7.138  2.849   1.00 0.00 ? 48  ASP A O    4  
ATOM 7349  C CB   . ASP A 1 48  ? -16.037 -8.117  5.049   1.00 0.00 ? 48  ASP A CB   4  
ATOM 7350  C CG   . ASP A 1 48  ? -17.118 -8.854  4.256   1.00 0.00 ? 48  ASP A CG   4  
ATOM 7351  O OD1  . ASP A 1 48  ? -16.979 -8.947  3.047   1.00 0.00 ? 48  ASP A OD1  4  
ATOM 7352  O OD2  . ASP A 1 48  ? -18.067 -9.312  4.870   1.00 0.00 ? 48  ASP A OD2  4  
ATOM 7353  H H    . ASP A 1 48  ? -18.064 -6.574  4.697   1.00 0.00 ? 48  ASP A H    4  
ATOM 7354  H HA   . ASP A 1 48  ? -15.220 -6.153  5.180   1.00 0.00 ? 48  ASP A HA   4  
ATOM 7355  H HB2  . ASP A 1 48  ? -15.091 -8.607  4.914   1.00 0.00 ? 48  ASP A HB2  4  
ATOM 7356  H HB3  . ASP A 1 48  ? -16.295 -8.116  6.095   1.00 0.00 ? 48  ASP A HB3  4  
ATOM 7357  N N    . THR A 1 49  ? -16.164 -6.149  2.178   1.00 0.00 ? 49  THR A N    4  
ATOM 7358  C CA   . THR A 1 49  ? -15.683 -6.104  0.771   1.00 0.00 ? 49  THR A CA   4  
ATOM 7359  C C    . THR A 1 49  ? -14.979 -4.766  0.555   1.00 0.00 ? 49  THR A C    4  
ATOM 7360  O O    . THR A 1 49  ? -15.444 -3.741  1.014   1.00 0.00 ? 49  THR A O    4  
ATOM 7361  C CB   . THR A 1 49  ? -16.879 -6.220  -0.176  1.00 0.00 ? 49  THR A CB   4  
ATOM 7362  O OG1  . THR A 1 49  ? -17.584 -7.422  0.099   1.00 0.00 ? 49  THR A OG1  4  
ATOM 7363  C CG2  . THR A 1 49  ? -16.396 -6.231  -1.627  1.00 0.00 ? 49  THR A CG2  4  
ATOM 7364  H H    . THR A 1 49  ? -17.036 -5.766  2.401   1.00 0.00 ? 49  THR A H    4  
ATOM 7365  H HA   . THR A 1 49  ? -14.992 -6.915  0.593   1.00 0.00 ? 49  THR A HA   4  
ATOM 7366  H HB   . THR A 1 49  ? -17.533 -5.377  -0.027  1.00 0.00 ? 49  THR A HB   4  
ATOM 7367  H HG1  . THR A 1 49  ? -18.396 -7.414  -0.414  1.00 0.00 ? 49  THR A HG1  4  
ATOM 7368  H HG21 . THR A 1 49  ? -15.354 -6.512  -1.658  1.00 0.00 ? 49  THR A HG21 4  
ATOM 7369  H HG22 . THR A 1 49  ? -16.978 -6.940  -2.193  1.00 0.00 ? 49  THR A HG22 4  
ATOM 7370  H HG23 . THR A 1 49  ? -16.515 -5.245  -2.051  1.00 0.00 ? 49  THR A HG23 4  
ATOM 7371  N N    . PHE A 1 50  ? -13.858 -4.760  -0.120  1.00 0.00 ? 50  PHE A N    4  
ATOM 7372  C CA   . PHE A 1 50  ? -13.141 -3.470  -0.336  1.00 0.00 ? 50  PHE A CA   4  
ATOM 7373  C C    . PHE A 1 50  ? -12.559 -3.385  -1.747  1.00 0.00 ? 50  PHE A C    4  
ATOM 7374  O O    . PHE A 1 50  ? -12.215 -4.372  -2.367  1.00 0.00 ? 50  PHE A O    4  
ATOM 7375  C CB   . PHE A 1 50  ? -11.997 -3.334  0.673   1.00 0.00 ? 50  PHE A CB   4  
ATOM 7376  C CG   . PHE A 1 50  ? -12.557 -3.413  2.065   1.00 0.00 ? 50  PHE A CG   4  
ATOM 7377  C CD1  . PHE A 1 50  ? -12.774 -4.656  2.649   1.00 0.00 ? 50  PHE A CD1  4  
ATOM 7378  C CD2  . PHE A 1 50  ? -12.885 -2.245  2.759   1.00 0.00 ? 50  PHE A CD2  4  
ATOM 7379  C CE1  . PHE A 1 50  ? -13.322 -4.741  3.924   1.00 0.00 ? 50  PHE A CE1  4  
ATOM 7380  C CE2  . PHE A 1 50  ? -13.431 -2.327  4.044   1.00 0.00 ? 50  PHE A CE2  4  
ATOM 7381  C CZ   . PHE A 1 50  ? -13.653 -3.580  4.625   1.00 0.00 ? 50  PHE A CZ   4  
ATOM 7382  H H    . PHE A 1 50  ? -13.490 -5.595  -0.468  1.00 0.00 ? 50  PHE A H    4  
ATOM 7383  H HA   . PHE A 1 50  ? -13.840 -2.657  -0.190  1.00 0.00 ? 50  PHE A HA   4  
ATOM 7384  H HB2  . PHE A 1 50  ? -11.286 -4.134  0.524   1.00 0.00 ? 50  PHE A HB2  4  
ATOM 7385  H HB3  . PHE A 1 50  ? -11.505 -2.383  0.536   1.00 0.00 ? 50  PHE A HB3  4  
ATOM 7386  H HD1  . PHE A 1 50  ? -12.511 -5.554  2.117   1.00 0.00 ? 50  PHE A HD1  4  
ATOM 7387  H HD2  . PHE A 1 50  ? -12.706 -1.282  2.308   1.00 0.00 ? 50  PHE A HD2  4  
ATOM 7388  H HE1  . PHE A 1 50  ? -13.486 -5.707  4.375   1.00 0.00 ? 50  PHE A HE1  4  
ATOM 7389  H HE2  . PHE A 1 50  ? -13.685 -1.427  4.584   1.00 0.00 ? 50  PHE A HE2  4  
ATOM 7390  H HZ   . PHE A 1 50  ? -14.079 -3.651  5.615   1.00 0.00 ? 50  PHE A HZ   4  
ATOM 7391  N N    . TYR A 1 51  ? -12.414 -2.183  -2.219  1.00 0.00 ? 51  TYR A N    4  
ATOM 7392  C CA   . TYR A 1 51  ? -11.818 -1.928  -3.554  1.00 0.00 ? 51  TYR A CA   4  
ATOM 7393  C C    . TYR A 1 51  ? -10.758 -0.851  -3.301  1.00 0.00 ? 51  TYR A C    4  
ATOM 7394  O O    . TYR A 1 51  ? -10.941 0.004   -2.453  1.00 0.00 ? 51  TYR A O    4  
ATOM 7395  C CB   . TYR A 1 51  ? -12.940 -1.477  -4.528  1.00 0.00 ? 51  TYR A CB   4  
ATOM 7396  C CG   . TYR A 1 51  ? -12.451 -0.531  -5.610  1.00 0.00 ? 51  TYR A CG   4  
ATOM 7397  C CD1  . TYR A 1 51  ? -12.149 0.794   -5.294  1.00 0.00 ? 51  TYR A CD1  4  
ATOM 7398  C CD2  . TYR A 1 51  ? -12.343 -0.973  -6.928  1.00 0.00 ? 51  TYR A CD2  4  
ATOM 7399  C CE1  . TYR A 1 51  ? -11.739 1.678   -6.282  1.00 0.00 ? 51  TYR A CE1  4  
ATOM 7400  C CE2  . TYR A 1 51  ? -11.921 -0.086  -7.929  1.00 0.00 ? 51  TYR A CE2  4  
ATOM 7401  C CZ   . TYR A 1 51  ? -11.620 1.242   -7.604  1.00 0.00 ? 51  TYR A CZ   4  
ATOM 7402  O OH   . TYR A 1 51  ? -11.216 2.120   -8.589  1.00 0.00 ? 51  TYR A OH   4  
ATOM 7403  H H    . TYR A 1 51  ? -12.675 -1.420  -1.663  1.00 0.00 ? 51  TYR A H    4  
ATOM 7404  H HA   . TYR A 1 51  ? -11.345 -2.828  -3.924  1.00 0.00 ? 51  TYR A HA   4  
ATOM 7405  H HB2  . TYR A 1 51  ? -13.358 -2.350  -5.002  1.00 0.00 ? 51  TYR A HB2  4  
ATOM 7406  H HB3  . TYR A 1 51  ? -13.715 -0.989  -3.967  1.00 0.00 ? 51  TYR A HB3  4  
ATOM 7407  H HD1  . TYR A 1 51  ? -12.227 1.135   -4.280  1.00 0.00 ? 51  TYR A HD1  4  
ATOM 7408  H HD2  . TYR A 1 51  ? -12.582 -1.997  -7.170  1.00 0.00 ? 51  TYR A HD2  4  
ATOM 7409  H HE1  . TYR A 1 51  ? -11.515 2.698   -6.019  1.00 0.00 ? 51  TYR A HE1  4  
ATOM 7410  H HE2  . TYR A 1 51  ? -11.826 -0.423  -8.948  1.00 0.00 ? 51  TYR A HE2  4  
ATOM 7411  H HH   . TYR A 1 51  ? -12.002 2.484   -9.002  1.00 0.00 ? 51  TYR A HH   4  
ATOM 7412  N N    . ILE A 1 52  ? -9.648  -0.900  -3.981  1.00 0.00 ? 52  ILE A N    4  
ATOM 7413  C CA   . ILE A 1 52  ? -8.581  0.116   -3.713  1.00 0.00 ? 52  ILE A CA   4  
ATOM 7414  C C    . ILE A 1 52  ? -7.872  0.484   -5.012  1.00 0.00 ? 52  ILE A C    4  
ATOM 7415  O O    . ILE A 1 52  ? -7.081  -0.281  -5.518  1.00 0.00 ? 52  ILE A O    4  
ATOM 7416  C CB   . ILE A 1 52  ? -7.552  -0.465  -2.722  1.00 0.00 ? 52  ILE A CB   4  
ATOM 7417  C CG1  . ILE A 1 52  ? -8.281  -1.249  -1.609  1.00 0.00 ? 52  ILE A CG1  4  
ATOM 7418  C CG2  . ILE A 1 52  ? -6.728  0.677   -2.106  1.00 0.00 ? 52  ILE A CG2  4  
ATOM 7419  C CD1  . ILE A 1 52  ? -7.273  -1.780  -0.582  1.00 0.00 ? 52  ILE A CD1  4  
ATOM 7420  H H    . ILE A 1 52  ? -9.505  -1.611  -4.639  1.00 0.00 ? 52  ILE A H    4  
ATOM 7421  H HA   . ILE A 1 52  ? -9.031  0.997   -3.284  1.00 0.00 ? 52  ILE A HA   4  
ATOM 7422  H HB   . ILE A 1 52  ? -6.888  -1.133  -3.253  1.00 0.00 ? 52  ILE A HB   4  
ATOM 7423  H HG12 . ILE A 1 52  ? -8.986  -0.599  -1.116  1.00 0.00 ? 52  ILE A HG12 4  
ATOM 7424  H HG13 . ILE A 1 52  ? -8.810  -2.082  -2.050  1.00 0.00 ? 52  ILE A HG13 4  
ATOM 7425  H HG21 . ILE A 1 52  ? -7.118  1.628   -2.435  1.00 0.00 ? 52  ILE A HG21 4  
ATOM 7426  H HG22 . ILE A 1 52  ? -6.779  0.621   -1.028  1.00 0.00 ? 52  ILE A HG22 4  
ATOM 7427  H HG23 . ILE A 1 52  ? -5.699  0.582   -2.420  1.00 0.00 ? 52  ILE A HG23 4  
ATOM 7428  H HD11 . ILE A 1 52  ? -6.388  -2.124  -1.093  1.00 0.00 ? 52  ILE A HD11 4  
ATOM 7429  H HD12 . ILE A 1 52  ? -7.007  -0.988  0.101   1.00 0.00 ? 52  ILE A HD12 4  
ATOM 7430  H HD13 . ILE A 1 52  ? -7.713  -2.596  -0.030  1.00 0.00 ? 52  ILE A HD13 4  
ATOM 7431  N N    . LYS A 1 53  ? -8.147  1.647   -5.559  1.00 0.00 ? 53  LYS A N    4  
ATOM 7432  C CA   . LYS A 1 53  ? -7.478  2.040   -6.839  1.00 0.00 ? 53  LYS A CA   4  
ATOM 7433  C C    . LYS A 1 53  ? -6.601  3.278   -6.646  1.00 0.00 ? 53  LYS A C    4  
ATOM 7434  O O    . LYS A 1 53  ? -7.084  4.379   -6.476  1.00 0.00 ? 53  LYS A O    4  
ATOM 7435  C CB   . LYS A 1 53  ? -8.536  2.314   -7.910  1.00 0.00 ? 53  LYS A CB   4  
ATOM 7436  C CG   . LYS A 1 53  ? -7.856  2.570   -9.260  1.00 0.00 ? 53  LYS A CG   4  
ATOM 7437  C CD   . LYS A 1 53  ? -8.608  3.672   -10.014 1.00 0.00 ? 53  LYS A CD   4  
ATOM 7438  C CE   . LYS A 1 53  ? -9.751  3.060   -10.834 1.00 0.00 ? 53  LYS A CE   4  
ATOM 7439  N NZ   . LYS A 1 53  ? -9.545  3.370   -12.278 1.00 0.00 ? 53  LYS A NZ   4  
ATOM 7440  H H    . LYS A 1 53  ? -8.791  2.252   -5.131  1.00 0.00 ? 53  LYS A H    4  
ATOM 7441  H HA   . LYS A 1 53  ? -6.856  1.229   -7.160  1.00 0.00 ? 53  LYS A HA   4  
ATOM 7442  H HB2  . LYS A 1 53  ? -9.182  1.454   -7.994  1.00 0.00 ? 53  LYS A HB2  4  
ATOM 7443  H HB3  . LYS A 1 53  ? -9.118  3.178   -7.629  1.00 0.00 ? 53  LYS A HB3  4  
ATOM 7444  H HG2  . LYS A 1 53  ? -6.834  2.879   -9.097  1.00 0.00 ? 53  LYS A HG2  4  
ATOM 7445  H HG3  . LYS A 1 53  ? -7.869  1.664   -9.847  1.00 0.00 ? 53  LYS A HG3  4  
ATOM 7446  H HD2  . LYS A 1 53  ? -9.013  4.379   -9.305  1.00 0.00 ? 53  LYS A HD2  4  
ATOM 7447  H HD3  . LYS A 1 53  ? -7.926  4.181   -10.678 1.00 0.00 ? 53  LYS A HD3  4  
ATOM 7448  H HE2  . LYS A 1 53  ? -9.769  1.988   -10.696 1.00 0.00 ? 53  LYS A HE2  4  
ATOM 7449  H HE3  . LYS A 1 53  ? -10.691 3.480   -10.508 1.00 0.00 ? 53  LYS A HE3  4  
ATOM 7450  H HZ1  . LYS A 1 53  ? -9.420  4.396   -12.397 1.00 0.00 ? 53  LYS A HZ1  4  
ATOM 7451  H HZ2  . LYS A 1 53  ? -8.699  2.874   -12.622 1.00 0.00 ? 53  LYS A HZ2  4  
ATOM 7452  H HZ3  . LYS A 1 53  ? -10.374 3.056   -12.821 1.00 0.00 ? 53  LYS A HZ3  4  
ATOM 7453  N N    . THR A 1 54  ? -5.306  3.094   -6.690  1.00 0.00 ? 54  THR A N    4  
ATOM 7454  C CA   . THR A 1 54  ? -4.364  4.239   -6.526  1.00 0.00 ? 54  THR A CA   4  
ATOM 7455  C C    . THR A 1 54  ? -4.349  5.087   -7.791  1.00 0.00 ? 54  THR A C    4  
ATOM 7456  O O    . THR A 1 54  ? -4.597  4.601   -8.879  1.00 0.00 ? 54  THR A O    4  
ATOM 7457  C CB   . THR A 1 54  ? -2.955  3.704   -6.287  1.00 0.00 ? 54  THR A CB   4  
ATOM 7458  O OG1  . THR A 1 54  ? -3.030  2.455   -5.613  1.00 0.00 ? 54  THR A OG1  4  
ATOM 7459  C CG2  . THR A 1 54  ? -2.162  4.701   -5.441  1.00 0.00 ? 54  THR A CG2  4  
ATOM 7460  H H    . THR A 1 54  ? -4.951  2.194   -6.841  1.00 0.00 ? 54  THR A H    4  
ATOM 7461  H HA   . THR A 1 54  ? -4.661  4.848   -5.692  1.00 0.00 ? 54  THR A HA   4  
ATOM 7462  H HB   . THR A 1 54  ? -2.461  3.574   -7.238  1.00 0.00 ? 54  THR A HB   4  
ATOM 7463  H HG1  . THR A 1 54  ? -2.419  1.850   -6.040  1.00 0.00 ? 54  THR A HG1  4  
ATOM 7464  H HG21 . THR A 1 54  ? -2.565  5.693   -5.583  1.00 0.00 ? 54  THR A HG21 4  
ATOM 7465  H HG22 . THR A 1 54  ? -2.236  4.428   -4.399  1.00 0.00 ? 54  THR A HG22 4  
ATOM 7466  H HG23 . THR A 1 54  ? -1.126  4.687   -5.745  1.00 0.00 ? 54  THR A HG23 4  
ATOM 7467  N N    . SER A 1 55  ? -4.030  6.346   -7.655  1.00 0.00 ? 55  SER A N    4  
ATOM 7468  C CA   . SER A 1 55  ? -3.961  7.229   -8.845  1.00 0.00 ? 55  SER A CA   4  
ATOM 7469  C C    . SER A 1 55  ? -2.959  8.358   -8.570  1.00 0.00 ? 55  SER A C    4  
ATOM 7470  O O    . SER A 1 55  ? -3.239  9.289   -7.837  1.00 0.00 ? 55  SER A O    4  
ATOM 7471  C CB   . SER A 1 55  ? -5.365  7.769   -9.179  1.00 0.00 ? 55  SER A CB   4  
ATOM 7472  O OG   . SER A 1 55  ? -5.466  9.158   -8.877  1.00 0.00 ? 55  SER A OG   4  
ATOM 7473  H H    . SER A 1 55  ? -3.815  6.703   -6.768  1.00 0.00 ? 55  SER A H    4  
ATOM 7474  H HA   . SER A 1 55  ? -3.607  6.644   -9.670  1.00 0.00 ? 55  SER A HA   4  
ATOM 7475  H HB2  . SER A 1 55  ? -5.559  7.626   -10.228 1.00 0.00 ? 55  SER A HB2  4  
ATOM 7476  H HB3  . SER A 1 55  ? -6.096  7.214   -8.609  1.00 0.00 ? 55  SER A HB3  4  
ATOM 7477  H HG   . SER A 1 55  ? -5.815  9.605   -9.652  1.00 0.00 ? 55  SER A HG   4  
ATOM 7478  N N    . THR A 1 56  ? -1.784  8.265   -9.140  1.00 0.00 ? 56  THR A N    4  
ATOM 7479  C CA   . THR A 1 56  ? -0.747  9.313   -8.904  1.00 0.00 ? 56  THR A CA   4  
ATOM 7480  C C    . THR A 1 56  ? -0.212  9.842   -10.237 1.00 0.00 ? 56  THR A C    4  
ATOM 7481  O O    . THR A 1 56  ? 0.069   11.018  -10.371 1.00 0.00 ? 56  THR A O    4  
ATOM 7482  C CB   . THR A 1 56  ? 0.406   8.713   -8.098  1.00 0.00 ? 56  THR A CB   4  
ATOM 7483  O OG1  . THR A 1 56  ? 1.451   9.669   -7.986  1.00 0.00 ? 56  THR A OG1  4  
ATOM 7484  C CG2  . THR A 1 56  ? 0.927   7.464   -8.806  1.00 0.00 ? 56  THR A CG2  4  
ATOM 7485  H H    . THR A 1 56  ? -1.580  7.496   -9.711  1.00 0.00 ? 56  THR A H    4  
ATOM 7486  H HA   . THR A 1 56  ? -1.181  10.125  -8.349  1.00 0.00 ? 56  THR A HA   4  
ATOM 7487  H HB   . THR A 1 56  ? 0.056   8.444   -7.113  1.00 0.00 ? 56  THR A HB   4  
ATOM 7488  H HG1  . THR A 1 56  ? 1.390   10.076  -7.119  1.00 0.00 ? 56  THR A HG1  4  
ATOM 7489  H HG21 . THR A 1 56  ? 0.121   6.754   -8.921  1.00 0.00 ? 56  THR A HG21 4  
ATOM 7490  H HG22 . THR A 1 56  ? 1.309   7.736   -9.779  1.00 0.00 ? 56  THR A HG22 4  
ATOM 7491  H HG23 . THR A 1 56  ? 1.717   7.021   -8.219  1.00 0.00 ? 56  THR A HG23 4  
ATOM 7492  N N    . THR A 1 57  ? -0.058  8.988   -11.220 1.00 0.00 ? 57  THR A N    4  
ATOM 7493  C CA   . THR A 1 57  ? 0.470   9.457   -12.536 1.00 0.00 ? 57  THR A CA   4  
ATOM 7494  C C    . THR A 1 57  ? 0.216   8.411   -13.609 1.00 0.00 ? 57  THR A C    4  
ATOM 7495  O O    . THR A 1 57  ? -0.150  8.735   -14.724 1.00 0.00 ? 57  THR A O    4  
ATOM 7496  C CB   . THR A 1 57  ? 1.988   9.695   -12.440 1.00 0.00 ? 57  THR A CB   4  
ATOM 7497  O OG1  . THR A 1 57  ? 2.409   9.613   -11.084 1.00 0.00 ? 57  THR A OG1  4  
ATOM 7498  C CG2  . THR A 1 57  ? 2.334   11.080  -12.996 1.00 0.00 ? 57  THR A CG2  4  
ATOM 7499  H H    . THR A 1 57  ? -0.281  8.044   -11.090 1.00 0.00 ? 57  THR A H    4  
ATOM 7500  H HA   . THR A 1 57  ? -0.019  10.369  -12.816 1.00 0.00 ? 57  THR A HA   4  
ATOM 7501  H HB   . THR A 1 57  ? 2.505   8.942   -13.024 1.00 0.00 ? 57  THR A HB   4  
ATOM 7502  H HG1  . THR A 1 57  ? 3.184   9.049   -11.048 1.00 0.00 ? 57  THR A HG1  4  
ATOM 7503  H HG21 . THR A 1 57  ? 1.504   11.751  -12.831 1.00 0.00 ? 57  THR A HG21 4  
ATOM 7504  H HG22 . THR A 1 57  ? 3.211   11.460  -12.493 1.00 0.00 ? 57  THR A HG22 4  
ATOM 7505  H HG23 . THR A 1 57  ? 2.531   11.004  -14.055 1.00 0.00 ? 57  THR A HG23 4  
ATOM 7506  N N    . VAL A 1 58  ? 0.456   7.168   -13.299 1.00 0.00 ? 58  VAL A N    4  
ATOM 7507  C CA   . VAL A 1 58  ? 0.282   6.117   -14.326 1.00 0.00 ? 58  VAL A CA   4  
ATOM 7508  C C    . VAL A 1 58  ? -0.001  4.760   -13.650 1.00 0.00 ? 58  VAL A C    4  
ATOM 7509  O O    . VAL A 1 58  ? -0.957  4.085   -13.982 1.00 0.00 ? 58  VAL A O    4  
ATOM 7510  C CB   . VAL A 1 58  ? 1.577   6.136   -15.186 1.00 0.00 ? 58  VAL A CB   4  
ATOM 7511  C CG1  . VAL A 1 58  ? 2.473   4.913   -14.957 1.00 0.00 ? 58  VAL A CG1  4  
ATOM 7512  C CG2  . VAL A 1 58  ? 1.207   6.226   -16.661 1.00 0.00 ? 58  VAL A CG2  4  
ATOM 7513  H H    . VAL A 1 58  ? 0.787   6.936   -12.406 1.00 0.00 ? 58  VAL A H    4  
ATOM 7514  H HA   . VAL A 1 58  ? -0.561  6.377   -14.950 1.00 0.00 ? 58  VAL A HA   4  
ATOM 7515  H HB   . VAL A 1 58  ? 2.142   7.019   -14.924 1.00 0.00 ? 58  VAL A HB   4  
ATOM 7516  H HG11 . VAL A 1 58  ? 1.891   4.013   -15.082 1.00 0.00 ? 58  VAL A HG11 4  
ATOM 7517  H HG12 . VAL A 1 58  ? 3.281   4.924   -15.670 1.00 0.00 ? 58  VAL A HG12 4  
ATOM 7518  H HG13 . VAL A 1 58  ? 2.875   4.948   -13.956 1.00 0.00 ? 58  VAL A HG13 4  
ATOM 7519  H HG21 . VAL A 1 58  ? 0.255   6.726   -16.760 1.00 0.00 ? 58  VAL A HG21 4  
ATOM 7520  H HG22 . VAL A 1 58  ? 1.965   6.791   -17.184 1.00 0.00 ? 58  VAL A HG22 4  
ATOM 7521  H HG23 . VAL A 1 58  ? 1.142   5.235   -17.077 1.00 0.00 ? 58  VAL A HG23 4  
ATOM 7522  N N    . ARG A 1 59  ? 0.819   4.366   -12.707 1.00 0.00 ? 59  ARG A N    4  
ATOM 7523  C CA   . ARG A 1 59  ? 0.595   3.064   -12.012 1.00 0.00 ? 59  ARG A CA   4  
ATOM 7524  C C    . ARG A 1 59  ? -0.694  3.156   -11.197 1.00 0.00 ? 59  ARG A C    4  
ATOM 7525  O O    . ARG A 1 59  ? -0.686  3.585   -10.058 1.00 0.00 ? 59  ARG A O    4  
ATOM 7526  C CB   . ARG A 1 59  ? 1.772   2.770   -11.080 1.00 0.00 ? 59  ARG A CB   4  
ATOM 7527  C CG   . ARG A 1 59  ? 1.881   1.260   -10.856 1.00 0.00 ? 59  ARG A CG   4  
ATOM 7528  C CD   . ARG A 1 59  ? 2.604   0.617   -12.041 1.00 0.00 ? 59  ARG A CD   4  
ATOM 7529  N NE   . ARG A 1 59  ? 2.034   -0.736  -12.295 1.00 0.00 ? 59  ARG A NE   4  
ATOM 7530  C CZ   . ARG A 1 59  ? 2.474   -1.452  -13.294 1.00 0.00 ? 59  ARG A CZ   4  
ATOM 7531  N NH1  . ARG A 1 59  ? 2.615   -0.909  -14.473 1.00 0.00 ? 59  ARG A NH1  4  
ATOM 7532  N NH2  . ARG A 1 59  ? 2.774   -2.709  -13.114 1.00 0.00 ? 59  ARG A NH2  4  
ATOM 7533  H H    . ARG A 1 59  ? 1.580   4.930   -12.454 1.00 0.00 ? 59  ARG A H    4  
ATOM 7534  H HA   . ARG A 1 59  ? 0.505   2.274   -12.744 1.00 0.00 ? 59  ARG A HA   4  
ATOM 7535  H HB2  . ARG A 1 59  ? 2.685   3.135   -11.528 1.00 0.00 ? 59  ARG A HB2  4  
ATOM 7536  H HB3  . ARG A 1 59  ? 1.613   3.262   -10.133 1.00 0.00 ? 59  ARG A HB3  4  
ATOM 7537  H HG2  . ARG A 1 59  ? 2.436   1.071   -9.948  1.00 0.00 ? 59  ARG A HG2  4  
ATOM 7538  H HG3  . ARG A 1 59  ? 0.891   0.837   -10.768 1.00 0.00 ? 59  ARG A HG3  4  
ATOM 7539  H HD2  . ARG A 1 59  ? 2.475   1.233   -12.919 1.00 0.00 ? 59  ARG A HD2  4  
ATOM 7540  H HD3  . ARG A 1 59  ? 3.656   0.528   -11.815 1.00 0.00 ? 59  ARG A HD3  4  
ATOM 7541  H HE   . ARG A 1 59  ? 1.329   -1.089  -11.713 1.00 0.00 ? 59  ARG A HE   4  
ATOM 7542  H HH11 . ARG A 1 59  ? 2.385   0.054   -14.611 1.00 0.00 ? 59  ARG A HH11 4  
ATOM 7543  H HH12 . ARG A 1 59  ? 2.952   -1.458  -15.238 1.00 0.00 ? 59  ARG A HH12 4  
ATOM 7544  H HH21 . ARG A 1 59  ? 2.666   -3.125  -12.211 1.00 0.00 ? 59  ARG A HH21 4  
ATOM 7545  H HH22 . ARG A 1 59  ? 3.111   -3.257  -13.880 1.00 0.00 ? 59  ARG A HH22 4  
ATOM 7546  N N    . THR A 1 60  ? -1.804  2.772   -11.777 1.00 0.00 ? 60  THR A N    4  
ATOM 7547  C CA   . THR A 1 60  ? -3.097  2.854   -11.050 1.00 0.00 ? 60  THR A CA   4  
ATOM 7548  C C    . THR A 1 60  ? -3.670  1.453   -10.820 1.00 0.00 ? 60  THR A C    4  
ATOM 7549  O O    . THR A 1 60  ? -4.866  1.244   -10.913 1.00 0.00 ? 60  THR A O    4  
ATOM 7550  C CB   . THR A 1 60  ? -4.077  3.676   -11.882 1.00 0.00 ? 60  THR A CB   4  
ATOM 7551  O OG1  . THR A 1 60  ? -3.856  3.422   -13.262 1.00 0.00 ? 60  THR A OG1  4  
ATOM 7552  C CG2  . THR A 1 60  ? -3.872  5.162   -11.596 1.00 0.00 ? 60  THR A CG2  4  
ATOM 7553  H H    . THR A 1 60  ? -1.787  2.444   -12.699 1.00 0.00 ? 60  THR A H    4  
ATOM 7554  H HA   . THR A 1 60  ? -2.944  3.340   -10.098 1.00 0.00 ? 60  THR A HA   4  
ATOM 7555  H HB   . THR A 1 60  ? -5.082  3.402   -11.623 1.00 0.00 ? 60  THR A HB   4  
ATOM 7556  H HG1  . THR A 1 60  ? -4.685  3.560   -13.726 1.00 0.00 ? 60  THR A HG1  4  
ATOM 7557  H HG21 . THR A 1 60  ? -2.907  5.314   -11.132 1.00 0.00 ? 60  THR A HG21 4  
ATOM 7558  H HG22 . THR A 1 60  ? -3.919  5.716   -12.520 1.00 0.00 ? 60  THR A HG22 4  
ATOM 7559  H HG23 . THR A 1 60  ? -4.648  5.507   -10.929 1.00 0.00 ? 60  THR A HG23 4  
ATOM 7560  N N    . THR A 1 61  ? -2.833  0.495   -10.502 1.00 0.00 ? 61  THR A N    4  
ATOM 7561  C CA   . THR A 1 61  ? -3.340  -0.888  -10.245 1.00 0.00 ? 61  THR A CA   4  
ATOM 7562  C C    . THR A 1 61  ? -4.295  -0.843  -9.051  1.00 0.00 ? 61  THR A C    4  
ATOM 7563  O O    . THR A 1 61  ? -4.099  -0.069  -8.131  1.00 0.00 ? 61  THR A O    4  
ATOM 7564  C CB   . THR A 1 61  ? -2.168  -1.814  -9.931  1.00 0.00 ? 61  THR A CB   4  
ATOM 7565  O OG1  . THR A 1 61  ? -1.214  -1.745  -10.982 1.00 0.00 ? 61  THR A OG1  4  
ATOM 7566  C CG2  . THR A 1 61  ? -2.672  -3.251  -9.788  1.00 0.00 ? 61  THR A CG2  4  
ATOM 7567  H H    . THR A 1 61  ? -1.876  0.689   -10.419 1.00 0.00 ? 61  THR A H    4  
ATOM 7568  H HA   . THR A 1 61  ? -3.862  -1.250  -11.113 1.00 0.00 ? 61  THR A HA   4  
ATOM 7569  H HB   . THR A 1 61  ? -1.711  -1.505  -9.009  1.00 0.00 ? 61  THR A HB   4  
ATOM 7570  H HG1  . THR A 1 61  ? -0.618  -1.017  -10.794 1.00 0.00 ? 61  THR A HG1  4  
ATOM 7571  H HG21 . THR A 1 61  ? -3.464  -3.427  -10.501 1.00 0.00 ? 61  THR A HG21 4  
ATOM 7572  H HG22 . THR A 1 61  ? -1.860  -3.938  -9.974  1.00 0.00 ? 61  THR A HG22 4  
ATOM 7573  H HG23 . THR A 1 61  ? -3.049  -3.402  -8.787  1.00 0.00 ? 61  THR A HG23 4  
ATOM 7574  N N    . GLU A 1 62  ? -5.330  -1.647  -9.056  1.00 0.00 ? 62  GLU A N    4  
ATOM 7575  C CA   . GLU A 1 62  ? -6.288  -1.614  -7.914  1.00 0.00 ? 62  GLU A CA   4  
ATOM 7576  C C    . GLU A 1 62  ? -6.676  -3.035  -7.489  1.00 0.00 ? 62  GLU A C    4  
ATOM 7577  O O    . GLU A 1 62  ? -6.779  -3.931  -8.305  1.00 0.00 ? 62  GLU A O    4  
ATOM 7578  C CB   . GLU A 1 62  ? -7.537  -0.799  -8.313  1.00 0.00 ? 62  GLU A CB   4  
ATOM 7579  C CG   . GLU A 1 62  ? -8.394  -1.536  -9.345  1.00 0.00 ? 62  GLU A CG   4  
ATOM 7580  C CD   . GLU A 1 62  ? -7.682  -1.548  -10.699 1.00 0.00 ? 62  GLU A CD   4  
ATOM 7581  O OE1  . GLU A 1 62  ? -7.563  -0.489  -11.293 1.00 0.00 ? 62  GLU A OE1  4  
ATOM 7582  O OE2  . GLU A 1 62  ? -7.266  -2.616  -11.118 1.00 0.00 ? 62  GLU A OE2  4  
ATOM 7583  H H    . GLU A 1 62  ? -5.477  -2.258  -9.808  1.00 0.00 ? 62  GLU A H    4  
ATOM 7584  H HA   . GLU A 1 62  ? -5.805  -1.127  -7.082  1.00 0.00 ? 62  GLU A HA   4  
ATOM 7585  H HB2  . GLU A 1 62  ? -8.134  -0.610  -7.435  1.00 0.00 ? 62  GLU A HB2  4  
ATOM 7586  H HB3  . GLU A 1 62  ? -7.219  0.143   -8.733  1.00 0.00 ? 62  GLU A HB3  4  
ATOM 7587  H HG2  . GLU A 1 62  ? -8.566  -2.547  -9.013  1.00 0.00 ? 62  GLU A HG2  4  
ATOM 7588  H HG3  . GLU A 1 62  ? -9.344  -1.026  -9.444  1.00 0.00 ? 62  GLU A HG3  4  
ATOM 7589  N N    . ILE A 1 63  ? -6.903  -3.236  -6.212  1.00 0.00 ? 63  ILE A N    4  
ATOM 7590  C CA   . ILE A 1 63  ? -7.298  -4.589  -5.726  1.00 0.00 ? 63  ILE A CA   4  
ATOM 7591  C C    . ILE A 1 63  ? -8.789  -4.610  -5.428  1.00 0.00 ? 63  ILE A C    4  
ATOM 7592  O O    . ILE A 1 63  ? -9.246  -4.058  -4.444  1.00 0.00 ? 63  ILE A O    4  
ATOM 7593  C CB   . ILE A 1 63  ? -6.522  -4.984  -4.458  1.00 0.00 ? 63  ILE A CB   4  
ATOM 7594  C CG1  . ILE A 1 63  ? -6.428  -3.801  -3.481  1.00 0.00 ? 63  ILE A CG1  4  
ATOM 7595  C CG2  . ILE A 1 63  ? -5.122  -5.438  -4.853  1.00 0.00 ? 63  ILE A CG2  4  
ATOM 7596  C CD1  . ILE A 1 63  ? -5.693  -4.231  -2.205  1.00 0.00 ? 63  ILE A CD1  4  
ATOM 7597  H H    . ILE A 1 63  ? -6.823  -2.494  -5.581  1.00 0.00 ? 63  ILE A H    4  
ATOM 7598  H HA   . ILE A 1 63  ? -7.091  -5.311  -6.497  1.00 0.00 ? 63  ILE A HA   4  
ATOM 7599  H HB   . ILE A 1 63  ? -7.030  -5.807  -3.975  1.00 0.00 ? 63  ILE A HB   4  
ATOM 7600  H HG12 . ILE A 1 63  ? -5.887  -2.994  -3.945  1.00 0.00 ? 63  ILE A HG12 4  
ATOM 7601  H HG13 . ILE A 1 63  ? -7.422  -3.471  -3.223  1.00 0.00 ? 63  ILE A HG13 4  
ATOM 7602  H HG21 . ILE A 1 63  ? -5.194  -6.167  -5.646  1.00 0.00 ? 63  ILE A HG21 4  
ATOM 7603  H HG22 . ILE A 1 63  ? -4.551  -4.588  -5.192  1.00 0.00 ? 63  ILE A HG22 4  
ATOM 7604  H HG23 . ILE A 1 63  ? -4.637  -5.883  -3.997  1.00 0.00 ? 63  ILE A HG23 4  
ATOM 7605  H HD11 . ILE A 1 63  ? -5.427  -5.273  -2.273  1.00 0.00 ? 63  ILE A HD11 4  
ATOM 7606  H HD12 . ILE A 1 63  ? -4.797  -3.639  -2.090  1.00 0.00 ? 63  ILE A HD12 4  
ATOM 7607  H HD13 . ILE A 1 63  ? -6.333  -4.081  -1.351  1.00 0.00 ? 63  ILE A HD13 4  
ATOM 7608  N N    . ASN A 1 64  ? -9.545  -5.277  -6.256  1.00 0.00 ? 64  ASN A N    4  
ATOM 7609  C CA   . ASN A 1 64  ? -11.003 -5.390  -6.011  1.00 0.00 ? 64  ASN A CA   4  
ATOM 7610  C C    . ASN A 1 64  ? -11.183 -6.716  -5.304  1.00 0.00 ? 64  ASN A C    4  
ATOM 7611  O O    . ASN A 1 64  ? -11.411 -7.742  -5.918  1.00 0.00 ? 64  ASN A O    4  
ATOM 7612  C CB   . ASN A 1 64  ? -11.787 -5.386  -7.331  1.00 0.00 ? 64  ASN A CB   4  
ATOM 7613  C CG   . ASN A 1 64  ? -11.261 -4.290  -8.266  1.00 0.00 ? 64  ASN A CG   4  
ATOM 7614  O OD1  . ASN A 1 64  ? -11.319 -4.430  -9.472  1.00 0.00 ? 64  ASN A OD1  4  
ATOM 7615  N ND2  . ASN A 1 64  ? -10.746 -3.200  -7.765  1.00 0.00 ? 64  ASN A ND2  4  
ATOM 7616  H H    . ASN A 1 64  ? -9.143  -5.733  -7.019  1.00 0.00 ? 64  ASN A H    4  
ATOM 7617  H HA   . ASN A 1 64  ? -11.321 -4.579  -5.369  1.00 0.00 ? 64  ASN A HA   4  
ATOM 7618  H HB2  . ASN A 1 64  ? -11.680 -6.347  -7.812  1.00 0.00 ? 64  ASN A HB2  4  
ATOM 7619  H HB3  . ASN A 1 64  ? -12.832 -5.205  -7.125  1.00 0.00 ? 64  ASN A HB3  4  
ATOM 7620  H HD21 . ASN A 1 64  ? -10.692 -3.081  -6.794  1.00 0.00 ? 64  ASN A HD21 4  
ATOM 7621  H HD22 . ASN A 1 64  ? -10.430 -2.495  -8.359  1.00 0.00 ? 64  ASN A HD22 4  
ATOM 7622  N N    . PHE A 1 65  ? -10.991 -6.704  -4.024  1.00 0.00 ? 65  PHE A N    4  
ATOM 7623  C CA   . PHE A 1 65  ? -11.044 -7.970  -3.248  1.00 0.00 ? 65  PHE A CA   4  
ATOM 7624  C C    . PHE A 1 65  ? -12.042 -7.887  -2.083  1.00 0.00 ? 65  PHE A C    4  
ATOM 7625  O O    . PHE A 1 65  ? -12.859 -6.998  -1.997  1.00 0.00 ? 65  PHE A O    4  
ATOM 7626  C CB   . PHE A 1 65  ? -9.623  -8.211  -2.694  1.00 0.00 ? 65  PHE A CB   4  
ATOM 7627  C CG   . PHE A 1 65  ? -9.306  -7.172  -1.620  1.00 0.00 ? 65  PHE A CG   4  
ATOM 7628  C CD1  . PHE A 1 65  ? -8.886  -5.886  -1.982  1.00 0.00 ? 65  PHE A CD1  4  
ATOM 7629  C CD2  . PHE A 1 65  ? -9.487  -7.485  -0.266  1.00 0.00 ? 65  PHE A CD2  4  
ATOM 7630  C CE1  . PHE A 1 65  ? -8.644  -4.922  -1.005  1.00 0.00 ? 65  PHE A CE1  4  
ATOM 7631  C CE2  . PHE A 1 65  ? -9.254  -6.515  0.715   1.00 0.00 ? 65  PHE A CE2  4  
ATOM 7632  C CZ   . PHE A 1 65  ? -8.832  -5.232  0.347   1.00 0.00 ? 65  PHE A CZ   4  
ATOM 7633  H H    . PHE A 1 65  ? -10.749 -5.863  -3.581  1.00 0.00 ? 65  PHE A H    4  
ATOM 7634  H HA   . PHE A 1 65  ? -11.313 -8.786  -3.900  1.00 0.00 ? 65  PHE A HA   4  
ATOM 7635  H HB2  . PHE A 1 65  ? -9.568  -9.201  -2.272  1.00 0.00 ? 65  PHE A HB2  4  
ATOM 7636  H HB3  . PHE A 1 65  ? -8.906  -8.125  -3.497  1.00 0.00 ? 65  PHE A HB3  4  
ATOM 7637  H HD1  . PHE A 1 65  ? -8.734  -5.639  -3.015  1.00 0.00 ? 65  PHE A HD1  4  
ATOM 7638  H HD2  . PHE A 1 65  ? -9.804  -8.472  0.022   1.00 0.00 ? 65  PHE A HD2  4  
ATOM 7639  H HE1  . PHE A 1 65  ? -8.320  -3.934  -1.297  1.00 0.00 ? 65  PHE A HE1  4  
ATOM 7640  H HE2  . PHE A 1 65  ? -9.396  -6.760  1.758   1.00 0.00 ? 65  PHE A HE2  4  
ATOM 7641  H HZ   . PHE A 1 65  ? -8.659  -4.481  1.103   1.00 0.00 ? 65  PHE A HZ   4  
ATOM 7642  N N    . LYS A 1 66  ? -11.913 -8.813  -1.174  1.00 0.00 ? 66  LYS A N    4  
ATOM 7643  C CA   . LYS A 1 66  ? -12.748 -8.856  0.044   1.00 0.00 ? 66  LYS A CA   4  
ATOM 7644  C C    . LYS A 1 66  ? -11.793 -9.264  1.160   1.00 0.00 ? 66  LYS A C    4  
ATOM 7645  O O    . LYS A 1 66  ? -11.097 -10.253 1.040   1.00 0.00 ? 66  LYS A O    4  
ATOM 7646  C CB   . LYS A 1 66  ? -13.848 -9.901  -0.115  1.00 0.00 ? 66  LYS A CB   4  
ATOM 7647  C CG   . LYS A 1 66  ? -15.169 -9.210  -0.461  1.00 0.00 ? 66  LYS A CG   4  
ATOM 7648  C CD   . LYS A 1 66  ? -16.128 -10.224 -1.090  1.00 0.00 ? 66  LYS A CD   4  
ATOM 7649  C CE   . LYS A 1 66  ? -16.968 -9.535  -2.167  1.00 0.00 ? 66  LYS A CE   4  
ATOM 7650  N NZ   . LYS A 1 66  ? -17.517 -10.558 -3.102  1.00 0.00 ? 66  LYS A NZ   4  
ATOM 7651  H H    . LYS A 1 66  ? -11.218 -9.490  -1.281  1.00 0.00 ? 66  LYS A H    4  
ATOM 7652  H HA   . LYS A 1 66  ? -13.170 -7.882  0.253   1.00 0.00 ? 66  LYS A HA   4  
ATOM 7653  H HB2  . LYS A 1 66  ? -13.580 -10.584 -0.907  1.00 0.00 ? 66  LYS A HB2  4  
ATOM 7654  H HB3  . LYS A 1 66  ? -13.958 -10.445 0.807   1.00 0.00 ? 66  LYS A HB3  4  
ATOM 7655  H HG2  . LYS A 1 66  ? -15.610 -8.807  0.440   1.00 0.00 ? 66  LYS A HG2  4  
ATOM 7656  H HG3  . LYS A 1 66  ? -14.984 -8.410  -1.161  1.00 0.00 ? 66  LYS A HG3  4  
ATOM 7657  H HD2  . LYS A 1 66  ? -15.561 -11.029 -1.536  1.00 0.00 ? 66  LYS A HD2  4  
ATOM 7658  H HD3  . LYS A 1 66  ? -16.781 -10.623 -0.328  1.00 0.00 ? 66  LYS A HD3  4  
ATOM 7659  H HE2  . LYS A 1 66  ? -17.783 -9.000  -1.701  1.00 0.00 ? 66  LYS A HE2  4  
ATOM 7660  H HE3  . LYS A 1 66  ? -16.350 -8.841  -2.716  1.00 0.00 ? 66  LYS A HE3  4  
ATOM 7661  H HZ1  . LYS A 1 66  ? -16.823 -11.325 -3.222  1.00 0.00 ? 66  LYS A HZ1  4  
ATOM 7662  H HZ2  . LYS A 1 66  ? -18.399 -10.945 -2.713  1.00 0.00 ? 66  LYS A HZ2  4  
ATOM 7663  H HZ3  . LYS A 1 66  ? -17.710 -10.118 -4.024  1.00 0.00 ? 66  LYS A HZ3  4  
ATOM 7664  N N    . VAL A 1 67  ? -11.698 -8.490  2.208   1.00 0.00 ? 67  VAL A N    4  
ATOM 7665  C CA   . VAL A 1 67  ? -10.728 -8.798  3.311   1.00 0.00 ? 67  VAL A CA   4  
ATOM 7666  C C    . VAL A 1 67  ? -10.728 -10.289 3.703   1.00 0.00 ? 67  VAL A C    4  
ATOM 7667  O O    . VAL A 1 67  ? -9.755  -10.774 4.251   1.00 0.00 ? 67  VAL A O    4  
ATOM 7668  C CB   . VAL A 1 67  ? -11.053 -7.919  4.520   1.00 0.00 ? 67  VAL A CB   4  
ATOM 7669  C CG1  . VAL A 1 67  ? -10.205 -8.341  5.725   1.00 0.00 ? 67  VAL A CG1  4  
ATOM 7670  C CG2  . VAL A 1 67  ? -10.716 -6.478  4.164   1.00 0.00 ? 67  VAL A CG2  4  
ATOM 7671  H H    . VAL A 1 67  ? -12.236 -7.674  2.256   1.00 0.00 ? 67  VAL A H    4  
ATOM 7672  H HA   . VAL A 1 67  ? -9.736  -8.543  2.967   1.00 0.00 ? 67  VAL A HA   4  
ATOM 7673  H HB   . VAL A 1 67  ? -12.107 -7.996  4.757   1.00 0.00 ? 67  VAL A HB   4  
ATOM 7674  H HG11 . VAL A 1 67  ? -9.332  -8.873  5.377   1.00 0.00 ? 67  VAL A HG11 4  
ATOM 7675  H HG12 . VAL A 1 67  ? -9.899  -7.466  6.277   1.00 0.00 ? 67  VAL A HG12 4  
ATOM 7676  H HG13 . VAL A 1 67  ? -10.789 -8.986  6.363   1.00 0.00 ? 67  VAL A HG13 4  
ATOM 7677  H HG21 . VAL A 1 67  ? -10.966 -6.298  3.132   1.00 0.00 ? 67  VAL A HG21 4  
ATOM 7678  H HG22 . VAL A 1 67  ? -11.276 -5.814  4.797   1.00 0.00 ? 67  VAL A HG22 4  
ATOM 7679  H HG23 . VAL A 1 67  ? -9.661  -6.313  4.314   1.00 0.00 ? 67  VAL A HG23 4  
ATOM 7680  N N    . GLY A 1 68  ? -11.779 -11.017 3.431   1.00 0.00 ? 68  GLY A N    4  
ATOM 7681  C CA   . GLY A 1 68  ? -11.790 -12.463 3.794   1.00 0.00 ? 68  GLY A CA   4  
ATOM 7682  C C    . GLY A 1 68  ? -11.129 -13.298 2.687   1.00 0.00 ? 68  GLY A C    4  
ATOM 7683  O O    . GLY A 1 68  ? -11.598 -14.376 2.368   1.00 0.00 ? 68  GLY A O    4  
ATOM 7684  H H    . GLY A 1 68  ? -12.557 -10.620 2.993   1.00 0.00 ? 68  GLY A H    4  
ATOM 7685  H HA2  . GLY A 1 68  ? -11.252 -12.603 4.720   1.00 0.00 ? 68  GLY A HA2  4  
ATOM 7686  H HA3  . GLY A 1 68  ? -12.807 -12.789 3.919   1.00 0.00 ? 68  GLY A HA3  4  
ATOM 7687  N N    . GLU A 1 69  ? -10.045 -12.827 2.100   1.00 0.00 ? 69  GLU A N    4  
ATOM 7688  C CA   . GLU A 1 69  ? -9.383  -13.633 1.023   1.00 0.00 ? 69  GLU A CA   4  
ATOM 7689  C C    . GLU A 1 69  ? -8.014  -13.047 0.626   1.00 0.00 ? 69  GLU A C    4  
ATOM 7690  O O    . GLU A 1 69  ? -7.601  -11.990 1.080   1.00 0.00 ? 69  GLU A O    4  
ATOM 7691  C CB   . GLU A 1 69  ? -10.292 -13.682 -0.211  1.00 0.00 ? 69  GLU A CB   4  
ATOM 7692  C CG   . GLU A 1 69  ? -10.553 -12.263 -0.728  1.00 0.00 ? 69  GLU A CG   4  
ATOM 7693  C CD   . GLU A 1 69  ? -10.524 -12.259 -2.259  1.00 0.00 ? 69  GLU A CD   4  
ATOM 7694  O OE1  . GLU A 1 69  ? -11.292 -13.002 -2.848  1.00 0.00 ? 69  GLU A OE1  4  
ATOM 7695  O OE2  . GLU A 1 69  ? -9.736  -11.512 -2.815  1.00 0.00 ? 69  GLU A OE2  4  
ATOM 7696  H H    . GLU A 1 69  ? -9.675  -11.960 2.368   1.00 0.00 ? 69  GLU A H    4  
ATOM 7697  H HA   . GLU A 1 69  ? -9.236  -14.640 1.385   1.00 0.00 ? 69  GLU A HA   4  
ATOM 7698  H HB2  . GLU A 1 69  ? -9.813  -14.266 -0.984  1.00 0.00 ? 69  GLU A HB2  4  
ATOM 7699  H HB3  . GLU A 1 69  ? -11.231 -14.143 0.056   1.00 0.00 ? 69  GLU A HB3  4  
ATOM 7700  H HG2  . GLU A 1 69  ? -11.521 -11.929 -0.386  1.00 0.00 ? 69  GLU A HG2  4  
ATOM 7701  H HG3  . GLU A 1 69  ? -9.790  -11.596 -0.355  1.00 0.00 ? 69  GLU A HG3  4  
ATOM 7702  N N    . GLU A 1 70  ? -7.314  -13.760 -0.223  1.00 0.00 ? 70  GLU A N    4  
ATOM 7703  C CA   . GLU A 1 70  ? -5.962  -13.313 -0.690  1.00 0.00 ? 70  GLU A CA   4  
ATOM 7704  C C    . GLU A 1 70  ? -5.991  -12.922 -2.166  1.00 0.00 ? 70  GLU A C    4  
ATOM 7705  O O    . GLU A 1 70  ? -6.977  -13.084 -2.858  1.00 0.00 ? 70  GLU A O    4  
ATOM 7706  C CB   . GLU A 1 70  ? -4.922  -14.452 -0.563  1.00 0.00 ? 70  GLU A CB   4  
ATOM 7707  C CG   . GLU A 1 70  ? -5.552  -15.822 -0.804  1.00 0.00 ? 70  GLU A CG   4  
ATOM 7708  C CD   . GLU A 1 70  ? -6.146  -15.890 -2.213  1.00 0.00 ? 70  GLU A CD   4  
ATOM 7709  O OE1  . GLU A 1 70  ? -5.385  -15.782 -3.161  1.00 0.00 ? 70  GLU A OE1  4  
ATOM 7710  O OE2  . GLU A 1 70  ? -7.350  -16.049 -2.321  1.00 0.00 ? 70  GLU A OE2  4  
ATOM 7711  H H    . GLU A 1 70  ? -7.680  -14.602 -0.546  1.00 0.00 ? 70  GLU A H    4  
ATOM 7712  H HA   . GLU A 1 70  ? -5.642  -12.470 -0.104  1.00 0.00 ? 70  GLU A HA   4  
ATOM 7713  H HB2  . GLU A 1 70  ? -4.143  -14.300 -1.296  1.00 0.00 ? 70  GLU A HB2  4  
ATOM 7714  H HB3  . GLU A 1 70  ? -4.481  -14.434 0.412   1.00 0.00 ? 70  GLU A HB3  4  
ATOM 7715  H HG2  . GLU A 1 70  ? -4.792  -16.580 -0.699  1.00 0.00 ? 70  GLU A HG2  4  
ATOM 7716  H HG3  . GLU A 1 70  ? -6.330  -15.986 -0.079  1.00 0.00 ? 70  GLU A HG3  4  
ATOM 7717  N N    . PHE A 1 71  ? -4.864  -12.474 -2.652  1.00 0.00 ? 71  PHE A N    4  
ATOM 7718  C CA   . PHE A 1 71  ? -4.720  -12.131 -4.093  1.00 0.00 ? 71  PHE A CA   4  
ATOM 7719  C C    . PHE A 1 71  ? -3.516  -12.914 -4.598  1.00 0.00 ? 71  PHE A C    4  
ATOM 7720  O O    . PHE A 1 71  ? -2.879  -13.630 -3.848  1.00 0.00 ? 71  PHE A O    4  
ATOM 7721  C CB   . PHE A 1 71  ? -4.431  -10.632 -4.338  1.00 0.00 ? 71  PHE A CB   4  
ATOM 7722  C CG   . PHE A 1 71  ? -5.058  -9.719  -3.305  1.00 0.00 ? 71  PHE A CG   4  
ATOM 7723  C CD1  . PHE A 1 71  ? -6.324  -9.982  -2.776  1.00 0.00 ? 71  PHE A CD1  4  
ATOM 7724  C CD2  . PHE A 1 71  ? -4.360  -8.572  -2.904  1.00 0.00 ? 71  PHE A CD2  4  
ATOM 7725  C CE1  . PHE A 1 71  ? -6.884  -9.100  -1.842  1.00 0.00 ? 71  PHE A CE1  4  
ATOM 7726  C CE2  . PHE A 1 71  ? -4.926  -7.691  -1.983  1.00 0.00 ? 71  PHE A CE2  4  
ATOM 7727  C CZ   . PHE A 1 71  ? -6.183  -7.954  -1.451  1.00 0.00 ? 71  PHE A CZ   4  
ATOM 7728  H H    . PHE A 1 71  ? -4.081  -12.421 -2.069  1.00 0.00 ? 71  PHE A H    4  
ATOM 7729  H HA   . PHE A 1 71  ? -5.601  -12.434 -4.637  1.00 0.00 ? 71  PHE A HA   4  
ATOM 7730  H HB2  . PHE A 1 71  ? -3.363  -10.473 -4.327  1.00 0.00 ? 71  PHE A HB2  4  
ATOM 7731  H HB3  . PHE A 1 71  ? -4.808  -10.364 -5.315  1.00 0.00 ? 71  PHE A HB3  4  
ATOM 7732  H HD1  . PHE A 1 71  ? -6.867  -10.859 -3.083  1.00 0.00 ? 71  PHE A HD1  4  
ATOM 7733  H HD2  . PHE A 1 71  ? -3.381  -8.368  -3.312  1.00 0.00 ? 71  PHE A HD2  4  
ATOM 7734  H HE1  . PHE A 1 71  ? -7.850  -9.308  -1.418  1.00 0.00 ? 71  PHE A HE1  4  
ATOM 7735  H HE2  . PHE A 1 71  ? -4.385  -6.814  -1.669  1.00 0.00 ? 71  PHE A HE2  4  
ATOM 7736  H HZ   . PHE A 1 71  ? -6.621  -7.258  -0.757  1.00 0.00 ? 71  PHE A HZ   4  
ATOM 7737  N N    . GLU A 1 72  ? -3.179  -12.759 -5.842  1.00 0.00 ? 72  GLU A N    4  
ATOM 7738  C CA   . GLU A 1 72  ? -1.986  -13.467 -6.381  1.00 0.00 ? 72  GLU A CA   4  
ATOM 7739  C C    . GLU A 1 72  ? -1.213  -12.517 -7.274  1.00 0.00 ? 72  GLU A C    4  
ATOM 7740  O O    . GLU A 1 72  ? -1.763  -11.592 -7.843  1.00 0.00 ? 72  GLU A O    4  
ATOM 7741  C CB   . GLU A 1 72  ? -2.391  -14.686 -7.197  1.00 0.00 ? 72  GLU A CB   4  
ATOM 7742  C CG   . GLU A 1 72  ? -3.374  -15.534 -6.399  1.00 0.00 ? 72  GLU A CG   4  
ATOM 7743  C CD   . GLU A 1 72  ? -4.034  -16.561 -7.321  1.00 0.00 ? 72  GLU A CD   4  
ATOM 7744  O OE1  . GLU A 1 72  ? -4.383  -16.193 -8.431  1.00 0.00 ? 72  GLU A OE1  4  
ATOM 7745  O OE2  . GLU A 1 72  ? -4.181  -17.697 -6.902  1.00 0.00 ? 72  GLU A OE2  4  
ATOM 7746  H H    . GLU A 1 72  ? -3.695  -12.160 -6.414  1.00 0.00 ? 72  GLU A H    4  
ATOM 7747  H HA   . GLU A 1 72  ? -1.359  -13.776 -5.561  1.00 0.00 ? 72  GLU A HA   4  
ATOM 7748  H HB2  . GLU A 1 72  ? -2.845  -14.359 -8.112  1.00 0.00 ? 72  GLU A HB2  4  
ATOM 7749  H HB3  . GLU A 1 72  ? -1.513  -15.274 -7.422  1.00 0.00 ? 72  GLU A HB3  4  
ATOM 7750  H HG2  . GLU A 1 72  ? -2.841  -16.044 -5.610  1.00 0.00 ? 72  GLU A HG2  4  
ATOM 7751  H HG3  . GLU A 1 72  ? -4.129  -14.896 -5.972  1.00 0.00 ? 72  GLU A HG3  4  
ATOM 7752  N N    . GLU A 1 73  ? 0.057   -12.744 -7.398  1.00 0.00 ? 73  GLU A N    4  
ATOM 7753  C CA   . GLU A 1 73  ? 0.891   -11.855 -8.261  1.00 0.00 ? 73  GLU A CA   4  
ATOM 7754  C C    . GLU A 1 73  ? 2.314   -12.395 -8.369  1.00 0.00 ? 73  GLU A C    4  
ATOM 7755  O O    . GLU A 1 73  ? 2.629   -13.456 -7.873  1.00 0.00 ? 73  GLU A O    4  
ATOM 7756  C CB   . GLU A 1 73  ? 0.922   -10.448 -7.656  1.00 0.00 ? 73  GLU A CB   4  
ATOM 7757  C CG   . GLU A 1 73  ? 0.913   -9.404  -8.776  1.00 0.00 ? 73  GLU A CG   4  
ATOM 7758  C CD   . GLU A 1 73  ? 0.078   -8.196  -8.346  1.00 0.00 ? 73  GLU A CD   4  
ATOM 7759  O OE1  . GLU A 1 73  ? 0.573   -7.410  -7.556  1.00 0.00 ? 73  GLU A OE1  4  
ATOM 7760  O OE2  . GLU A 1 73  ? -1.043  -8.079  -8.814  1.00 0.00 ? 73  GLU A OE2  4  
ATOM 7761  H H    . GLU A 1 73  ? 0.459   -13.503 -6.918  1.00 0.00 ? 73  GLU A H    4  
ATOM 7762  H HA   . GLU A 1 73  ? 0.457   -11.808 -9.246  1.00 0.00 ? 73  GLU A HA   4  
ATOM 7763  H HB2  . GLU A 1 73  ? 0.055   -10.310 -7.026  1.00 0.00 ? 73  GLU A HB2  4  
ATOM 7764  H HB3  . GLU A 1 73  ? 1.818   -10.330 -7.064  1.00 0.00 ? 73  GLU A HB3  4  
ATOM 7765  H HG2  . GLU A 1 73  ? 1.926   -9.087  -8.980  1.00 0.00 ? 73  GLU A HG2  4  
ATOM 7766  H HG3  . GLU A 1 73  ? 0.484   -9.836  -9.668  1.00 0.00 ? 73  GLU A HG3  4  
ATOM 7767  N N    . GLN A 1 74  ? 3.170   -11.658 -9.023  1.00 0.00 ? 74  GLN A N    4  
ATOM 7768  C CA   . GLN A 1 74  ? 4.590   -12.093 -9.182  1.00 0.00 ? 74  GLN A CA   4  
ATOM 7769  C C    . GLN A 1 74  ? 5.508   -11.037 -8.561  1.00 0.00 ? 74  GLN A C    4  
ATOM 7770  O O    . GLN A 1 74  ? 5.248   -9.851  -8.654  1.00 0.00 ? 74  GLN A O    4  
ATOM 7771  C CB   . GLN A 1 74  ? 4.918   -12.240 -10.669 1.00 0.00 ? 74  GLN A CB   4  
ATOM 7772  C CG   . GLN A 1 74  ? 4.233   -13.490 -11.224 1.00 0.00 ? 74  GLN A CG   4  
ATOM 7773  C CD   . GLN A 1 74  ? 3.979   -13.311 -12.722 1.00 0.00 ? 74  GLN A CD   4  
ATOM 7774  O OE1  . GLN A 1 74  ? 3.816   -12.204 -13.194 1.00 0.00 ? 74  GLN A OE1  4  
ATOM 7775  N NE2  . GLN A 1 74  ? 3.938   -14.362 -13.495 1.00 0.00 ? 74  GLN A NE2  4  
ATOM 7776  H H    . GLN A 1 74  ? 2.873   -10.810 -9.413  1.00 0.00 ? 74  GLN A H    4  
ATOM 7777  H HA   . GLN A 1 74  ? 4.737   -13.039 -8.682  1.00 0.00 ? 74  GLN A HA   4  
ATOM 7778  H HB2  . GLN A 1 74  ? 4.567   -11.368 -11.202 1.00 0.00 ? 74  GLN A HB2  4  
ATOM 7779  H HB3  . GLN A 1 74  ? 5.987   -12.332 -10.793 1.00 0.00 ? 74  GLN A HB3  4  
ATOM 7780  H HG2  . GLN A 1 74  ? 4.869   -14.349 -11.066 1.00 0.00 ? 74  GLN A HG2  4  
ATOM 7781  H HG3  . GLN A 1 74  ? 3.292   -13.641 -10.716 1.00 0.00 ? 74  GLN A HG3  4  
ATOM 7782  H HE21 . GLN A 1 74  ? 4.069   -15.256 -13.114 1.00 0.00 ? 74  GLN A HE21 4  
ATOM 7783  H HE22 . GLN A 1 74  ? 3.776   -14.257 -14.455 1.00 0.00 ? 74  GLN A HE22 4  
ATOM 7784  N N    . THR A 1 75  ? 6.573   -11.456 -7.923  1.00 0.00 ? 75  THR A N    4  
ATOM 7785  C CA   . THR A 1 75  ? 7.503   -10.474 -7.288  1.00 0.00 ? 75  THR A CA   4  
ATOM 7786  C C    . THR A 1 75  ? 8.333   -9.782  -8.375  1.00 0.00 ? 75  THR A C    4  
ATOM 7787  O O    . THR A 1 75  ? 7.975   -9.791  -9.538  1.00 0.00 ? 75  THR A O    4  
ATOM 7788  C CB   . THR A 1 75  ? 8.432   -11.197 -6.303  1.00 0.00 ? 75  THR A CB   4  
ATOM 7789  O OG1  . THR A 1 75  ? 7.830   -12.415 -5.887  1.00 0.00 ? 75  THR A OG1  4  
ATOM 7790  C CG2  . THR A 1 75  ? 8.678   -10.310 -5.081  1.00 0.00 ? 75  THR A CG2  4  
ATOM 7791  H H    . THR A 1 75  ? 6.757   -12.416 -7.858  1.00 0.00 ? 75  THR A H    4  
ATOM 7792  H HA   . THR A 1 75  ? 6.925   -9.733  -6.754  1.00 0.00 ? 75  THR A HA   4  
ATOM 7793  H HB   . THR A 1 75  ? 9.375   -11.404 -6.785  1.00 0.00 ? 75  THR A HB   4  
ATOM 7794  H HG1  . THR A 1 75  ? 8.493   -12.929 -5.419  1.00 0.00 ? 75  THR A HG1  4  
ATOM 7795  H HG21 . THR A 1 75  ? 8.530   -9.274  -5.352  1.00 0.00 ? 75  THR A HG21 4  
ATOM 7796  H HG22 . THR A 1 75  ? 7.986   -10.578 -4.297  1.00 0.00 ? 75  THR A HG22 4  
ATOM 7797  H HG23 . THR A 1 75  ? 9.690   -10.449 -4.733  1.00 0.00 ? 75  THR A HG23 4  
ATOM 7798  N N    . VAL A 1 76  ? 9.434   -9.178  -8.003  1.00 0.00 ? 76  VAL A N    4  
ATOM 7799  C CA   . VAL A 1 76  ? 10.290  -8.476  -9.005  1.00 0.00 ? 76  VAL A CA   4  
ATOM 7800  C C    . VAL A 1 76  ? 11.186  -9.492  -9.717  1.00 0.00 ? 76  VAL A C    4  
ATOM 7801  O O    . VAL A 1 76  ? 11.056  -9.720  -10.905 1.00 0.00 ? 76  VAL A O    4  
ATOM 7802  C CB   . VAL A 1 76  ? 11.164  -7.436  -8.303  1.00 0.00 ? 76  VAL A CB   4  
ATOM 7803  C CG1  . VAL A 1 76  ? 11.791  -6.509  -9.345  1.00 0.00 ? 76  VAL A CG1  4  
ATOM 7804  C CG2  . VAL A 1 76  ? 10.313  -6.608  -7.334  1.00 0.00 ? 76  VAL A CG2  4  
ATOM 7805  H H    . VAL A 1 76  ? 9.696   -9.182  -7.059  1.00 0.00 ? 76  VAL A H    4  
ATOM 7806  H HA   . VAL A 1 76  ? 9.664   -7.984  -9.728  1.00 0.00 ? 76  VAL A HA   4  
ATOM 7807  H HB   . VAL A 1 76  ? 11.943  -7.940  -7.759  1.00 0.00 ? 76  VAL A HB   4  
ATOM 7808  H HG11 . VAL A 1 76  ? 12.037  -7.077  -10.230 1.00 0.00 ? 76  VAL A HG11 4  
ATOM 7809  H HG12 . VAL A 1 76  ? 11.090  -5.728  -9.601  1.00 0.00 ? 76  VAL A HG12 4  
ATOM 7810  H HG13 . VAL A 1 76  ? 12.689  -6.067  -8.940  1.00 0.00 ? 76  VAL A HG13 4  
ATOM 7811  H HG21 . VAL A 1 76  ? 9.461   -6.202  -7.860  1.00 0.00 ? 76  VAL A HG21 4  
ATOM 7812  H HG22 . VAL A 1 76  ? 9.970   -7.240  -6.528  1.00 0.00 ? 76  VAL A HG22 4  
ATOM 7813  H HG23 . VAL A 1 76  ? 10.906  -5.801  -6.932  1.00 0.00 ? 76  VAL A HG23 4  
ATOM 7814  N N    . ASP A 1 77  ? 12.094  -10.101 -8.997  1.00 0.00 ? 77  ASP A N    4  
ATOM 7815  C CA   . ASP A 1 77  ? 13.005  -11.103 -9.623  1.00 0.00 ? 77  ASP A CA   4  
ATOM 7816  C C    . ASP A 1 77  ? 13.362  -12.181 -8.597  1.00 0.00 ? 77  ASP A C    4  
ATOM 7817  O O    . ASP A 1 77  ? 13.911  -11.895 -7.550  1.00 0.00 ? 77  ASP A O    4  
ATOM 7818  C CB   . ASP A 1 77  ? 14.283  -10.405 -10.093 1.00 0.00 ? 77  ASP A CB   4  
ATOM 7819  C CG   . ASP A 1 77  ? 13.965  -9.509  -11.292 1.00 0.00 ? 77  ASP A CG   4  
ATOM 7820  O OD1  . ASP A 1 77  ? 13.788  -10.043 -12.375 1.00 0.00 ? 77  ASP A OD1  4  
ATOM 7821  O OD2  . ASP A 1 77  ? 13.902  -8.305  -11.107 1.00 0.00 ? 77  ASP A OD2  4  
ATOM 7822  H H    . ASP A 1 77  ? 12.177  -9.898  -8.042  1.00 0.00 ? 77  ASP A H    4  
ATOM 7823  H HA   . ASP A 1 77  ? 12.513  -11.560 -10.469 1.00 0.00 ? 77  ASP A HA   4  
ATOM 7824  H HB2  . ASP A 1 77  ? 14.681  -9.804  -9.289  1.00 0.00 ? 77  ASP A HB2  4  
ATOM 7825  H HB3  . ASP A 1 77  ? 15.012  -11.146 -10.384 1.00 0.00 ? 77  ASP A HB3  4  
ATOM 7826  N N    . GLY A 1 78  ? 13.052  -13.417 -8.894  1.00 0.00 ? 78  GLY A N    4  
ATOM 7827  C CA   . GLY A 1 78  ? 13.367  -14.524 -7.944  1.00 0.00 ? 78  GLY A CA   4  
ATOM 7828  C C    . GLY A 1 78  ? 12.228  -15.544 -7.956  1.00 0.00 ? 78  GLY A C    4  
ATOM 7829  O O    . GLY A 1 78  ? 12.292  -16.549 -8.639  1.00 0.00 ? 78  GLY A O    4  
ATOM 7830  H H    . GLY A 1 78  ? 12.609  -13.617 -9.745  1.00 0.00 ? 78  GLY A H    4  
ATOM 7831  H HA2  . GLY A 1 78  ? 14.287  -15.005 -8.244  1.00 0.00 ? 78  GLY A HA2  4  
ATOM 7832  H HA3  . GLY A 1 78  ? 13.477  -14.124 -6.948  1.00 0.00 ? 78  GLY A HA3  4  
ATOM 7833  N N    . ARG A 1 79  ? 11.187  -15.290 -7.205  1.00 0.00 ? 79  ARG A N    4  
ATOM 7834  C CA   . ARG A 1 79  ? 10.035  -16.238 -7.166  1.00 0.00 ? 79  ARG A CA   4  
ATOM 7835  C C    . ARG A 1 79  ? 8.725   -15.435 -7.260  1.00 0.00 ? 79  ARG A C    4  
ATOM 7836  O O    . ARG A 1 79  ? 8.766   -14.222 -7.290  1.00 0.00 ? 79  ARG A O    4  
ATOM 7837  C CB   . ARG A 1 79  ? 10.080  -17.023 -5.846  1.00 0.00 ? 79  ARG A CB   4  
ATOM 7838  C CG   . ARG A 1 79  ? 10.279  -18.514 -6.135  1.00 0.00 ? 79  ARG A CG   4  
ATOM 7839  C CD   . ARG A 1 79  ? 9.668   -19.340 -5.002  1.00 0.00 ? 79  ARG A CD   4  
ATOM 7840  N NE   . ARG A 1 79  ? 9.137   -20.619 -5.552  1.00 0.00 ? 79  ARG A NE   4  
ATOM 7841  C CZ   . ARG A 1 79  ? 8.016   -21.109 -5.098  1.00 0.00 ? 79  ARG A CZ   4  
ATOM 7842  N NH1  . ARG A 1 79  ? 7.850   -21.276 -3.814  1.00 0.00 ? 79  ARG A NH1  4  
ATOM 7843  N NH2  . ARG A 1 79  ? 7.062   -21.432 -5.927  1.00 0.00 ? 79  ARG A NH2  4  
ATOM 7844  H H    . ARG A 1 79  ? 11.162  -14.471 -6.664  1.00 0.00 ? 79  ARG A H    4  
ATOM 7845  H HA   . ARG A 1 79  ? 10.101  -16.919 -8.002  1.00 0.00 ? 79  ARG A HA   4  
ATOM 7846  H HB2  . ARG A 1 79  ? 10.901  -16.662 -5.244  1.00 0.00 ? 79  ARG A HB2  4  
ATOM 7847  H HB3  . ARG A 1 79  ? 9.154   -16.884 -5.307  1.00 0.00 ? 79  ARG A HB3  4  
ATOM 7848  H HG2  . ARG A 1 79  ? 9.796   -18.768 -7.067  1.00 0.00 ? 79  ARG A HG2  4  
ATOM 7849  H HG3  . ARG A 1 79  ? 11.335  -18.729 -6.205  1.00 0.00 ? 79  ARG A HG3  4  
ATOM 7850  H HD2  . ARG A 1 79  ? 10.426  -19.553 -4.262  1.00 0.00 ? 79  ARG A HD2  4  
ATOM 7851  H HD3  . ARG A 1 79  ? 8.864   -18.784 -4.543  1.00 0.00 ? 79  ARG A HD3  4  
ATOM 7852  H HE   . ARG A 1 79  ? 9.629   -21.092 -6.255  1.00 0.00 ? 79  ARG A HE   4  
ATOM 7853  H HH11 . ARG A 1 79  ? 8.581   -21.028 -3.179  1.00 0.00 ? 79  ARG A HH11 4  
ATOM 7854  H HH12 . ARG A 1 79  ? 6.991   -21.651 -3.466  1.00 0.00 ? 79  ARG A HH12 4  
ATOM 7855  H HH21 . ARG A 1 79  ? 7.189   -21.304 -6.911  1.00 0.00 ? 79  ARG A HH21 4  
ATOM 7856  H HH22 . ARG A 1 79  ? 6.202   -21.807 -5.579  1.00 0.00 ? 79  ARG A HH22 4  
ATOM 7857  N N    . PRO A 1 80  ? 7.592   -16.117 -7.302  1.00 0.00 ? 80  PRO A N    4  
ATOM 7858  C CA   . PRO A 1 80  ? 6.286   -15.440 -7.385  1.00 0.00 ? 80  PRO A CA   4  
ATOM 7859  C C    . PRO A 1 80  ? 5.898   -14.884 -6.013  1.00 0.00 ? 80  PRO A C    4  
ATOM 7860  O O    . PRO A 1 80  ? 6.717   -14.818 -5.115  1.00 0.00 ? 80  PRO A O    4  
ATOM 7861  C CB   . PRO A 1 80  ? 5.327   -16.546 -7.830  1.00 0.00 ? 80  PRO A CB   4  
ATOM 7862  C CG   . PRO A 1 80  ? 5.991   -17.886 -7.438  1.00 0.00 ? 80  PRO A CG   4  
ATOM 7863  C CD   . PRO A 1 80  ? 7.495   -17.600 -7.270  1.00 0.00 ? 80  PRO A CD   4  
ATOM 7864  H HA   . PRO A 1 80  ? 6.309   -14.655 -8.122  1.00 0.00 ? 80  PRO A HA   4  
ATOM 7865  H HB2  . PRO A 1 80  ? 4.379   -16.434 -7.324  1.00 0.00 ? 80  PRO A HB2  4  
ATOM 7866  H HB3  . PRO A 1 80  ? 5.186   -16.509 -8.898  1.00 0.00 ? 80  PRO A HB3  4  
ATOM 7867  H HG2  . PRO A 1 80  ? 5.574   -18.247 -6.508  1.00 0.00 ? 80  PRO A HG2  4  
ATOM 7868  H HG3  . PRO A 1 80  ? 5.845   -18.615 -8.219  1.00 0.00 ? 80  PRO A HG3  4  
ATOM 7869  H HD2  . PRO A 1 80  ? 7.845   -17.987 -6.324  1.00 0.00 ? 80  PRO A HD2  4  
ATOM 7870  H HD3  . PRO A 1 80  ? 8.056   -18.028 -8.087  1.00 0.00 ? 80  PRO A HD3  4  
ATOM 7871  N N    . CYS A 1 81  ? 4.662   -14.485 -5.841  1.00 0.00 ? 81  CYS A N    4  
ATOM 7872  C CA   . CYS A 1 81  ? 4.233   -13.934 -4.520  1.00 0.00 ? 81  CYS A CA   4  
ATOM 7873  C C    . CYS A 1 81  ? 2.744   -13.600 -4.527  1.00 0.00 ? 81  CYS A C    4  
ATOM 7874  O O    . CYS A 1 81  ? 2.215   -13.045 -5.469  1.00 0.00 ? 81  CYS A O    4  
ATOM 7875  C CB   . CYS A 1 81  ? 5.034   -12.661 -4.202  1.00 0.00 ? 81  CYS A CB   4  
ATOM 7876  S SG   . CYS A 1 81  ? 4.782   -11.420 -5.498  1.00 0.00 ? 81  CYS A SG   4  
ATOM 7877  H H    . CYS A 1 81  ? 4.021   -14.550 -6.575  1.00 0.00 ? 81  CYS A H    4  
ATOM 7878  H HA   . CYS A 1 81  ? 4.415   -14.672 -3.751  1.00 0.00 ? 81  CYS A HA   4  
ATOM 7879  H HB2  . CYS A 1 81  ? 4.705   -12.258 -3.257  1.00 0.00 ? 81  CYS A HB2  4  
ATOM 7880  H HB3  . CYS A 1 81  ? 6.085   -12.905 -4.139  1.00 0.00 ? 81  CYS A HB3  4  
ATOM 7881  H HG   . CYS A 1 81  ? 5.353   -10.672 -5.308  1.00 0.00 ? 81  CYS A HG   4  
ATOM 7882  N N    . LYS A 1 82  ? 2.086   -13.918 -3.454  1.00 0.00 ? 82  LYS A N    4  
ATOM 7883  C CA   . LYS A 1 82  ? 0.640   -13.619 -3.325  1.00 0.00 ? 82  LYS A CA   4  
ATOM 7884  C C    . LYS A 1 82  ? 0.458   -12.636 -2.175  1.00 0.00 ? 82  LYS A C    4  
ATOM 7885  O O    . LYS A 1 82  ? 1.414   -12.114 -1.633  1.00 0.00 ? 82  LYS A O    4  
ATOM 7886  C CB   . LYS A 1 82  ? -0.124  -14.905 -3.028  1.00 0.00 ? 82  LYS A CB   4  
ATOM 7887  C CG   . LYS A 1 82  ? 0.444   -15.581 -1.766  1.00 0.00 ? 82  LYS A CG   4  
ATOM 7888  C CD   . LYS A 1 82  ? -0.246  -16.937 -1.518  1.00 0.00 ? 82  LYS A CD   4  
ATOM 7889  C CE   . LYS A 1 82  ? -1.762  -16.821 -1.721  1.00 0.00 ? 82  LYS A CE   4  
ATOM 7890  N NZ   . LYS A 1 82  ? -2.467  -17.762 -0.806  1.00 0.00 ? 82  LYS A NZ   4  
ATOM 7891  H H    . LYS A 1 82  ? 2.557   -14.345 -2.712  1.00 0.00 ? 82  LYS A H    4  
ATOM 7892  H HA   . LYS A 1 82  ? 0.262   -13.179 -4.239  1.00 0.00 ? 82  LYS A HA   4  
ATOM 7893  H HB2  . LYS A 1 82  ? -1.167  -14.670 -2.868  1.00 0.00 ? 82  LYS A HB2  4  
ATOM 7894  H HB3  . LYS A 1 82  ? -0.034  -15.577 -3.866  1.00 0.00 ? 82  LYS A HB3  4  
ATOM 7895  H HG2  . LYS A 1 82  ? 1.502   -15.745 -1.897  1.00 0.00 ? 82  LYS A HG2  4  
ATOM 7896  H HG3  . LYS A 1 82  ? 0.289   -14.935 -0.912  1.00 0.00 ? 82  LYS A HG3  4  
ATOM 7897  H HD2  . LYS A 1 82  ? 0.150   -17.669 -2.207  1.00 0.00 ? 82  LYS A HD2  4  
ATOM 7898  H HD3  . LYS A 1 82  ? -0.046  -17.258 -0.506  1.00 0.00 ? 82  LYS A HD3  4  
ATOM 7899  H HE2  . LYS A 1 82  ? -2.071  -15.807 -1.511  1.00 0.00 ? 82  LYS A HE2  4  
ATOM 7900  H HE3  . LYS A 1 82  ? -2.001  -17.062 -2.748  1.00 0.00 ? 82  LYS A HE3  4  
ATOM 7901  H HZ1  . LYS A 1 82  ? -1.932  -18.653 -0.745  1.00 0.00 ? 82  LYS A HZ1  4  
ATOM 7902  H HZ2  . LYS A 1 82  ? -2.541  -17.337 0.140   1.00 0.00 ? 82  LYS A HZ2  4  
ATOM 7903  H HZ3  . LYS A 1 82  ? -3.420  -17.954 -1.172  1.00 0.00 ? 82  LYS A HZ3  4  
ATOM 7904  N N    . SER A 1 83  ? -0.759  -12.377 -1.813  1.00 0.00 ? 83  SER A N    4  
ATOM 7905  C CA   . SER A 1 83  ? -1.027  -11.417 -0.704  1.00 0.00 ? 83  SER A CA   4  
ATOM 7906  C C    . SER A 1 83  ? -2.235  -11.861 0.097   1.00 0.00 ? 83  SER A C    4  
ATOM 7907  O O    . SER A 1 83  ? -2.842  -12.859 -0.199  1.00 0.00 ? 83  SER A O    4  
ATOM 7908  C CB   . SER A 1 83  ? -1.328  -10.055 -1.312  1.00 0.00 ? 83  SER A CB   4  
ATOM 7909  O OG   . SER A 1 83  ? -2.298  -10.227 -2.344  1.00 0.00 ? 83  SER A OG   4  
ATOM 7910  H H    . SER A 1 83  ? -1.500  -12.805 -2.283  1.00 0.00 ? 83  SER A H    4  
ATOM 7911  H HA   . SER A 1 83  ? -0.178  -11.353 -0.060  1.00 0.00 ? 83  SER A HA   4  
ATOM 7912  H HB2  . SER A 1 83  ? -1.723  -9.397  -0.556  1.00 0.00 ? 83  SER A HB2  4  
ATOM 7913  H HB3  . SER A 1 83  ? -0.421  -9.633  -1.722  1.00 0.00 ? 83  SER A HB3  4  
ATOM 7914  H HG   . SER A 1 83  ? -2.981  -10.838 -2.028  1.00 0.00 ? 83  SER A HG   4  
ATOM 7915  N N    . LEU A 1 84  ? -2.597  -11.102 1.097   1.00 0.00 ? 84  LEU A N    4  
ATOM 7916  C CA   . LEU A 1 84  ? -3.803  -11.462 1.909   1.00 0.00 ? 84  LEU A CA   4  
ATOM 7917  C C    . LEU A 1 84  ? -4.151  -10.328 2.858   1.00 0.00 ? 84  LEU A C    4  
ATOM 7918  O O    . LEU A 1 84  ? -3.359  -9.947  3.694   1.00 0.00 ? 84  LEU A O    4  
ATOM 7919  C CB   . LEU A 1 84  ? -3.553  -12.742 2.703   1.00 0.00 ? 84  LEU A CB   4  
ATOM 7920  C CG   . LEU A 1 84  ? -4.825  -13.591 2.684   1.00 0.00 ? 84  LEU A CG   4  
ATOM 7921  C CD1  . LEU A 1 84  ? -4.456  -15.064 2.829   1.00 0.00 ? 84  LEU A CD1  4  
ATOM 7922  C CD2  . LEU A 1 84  ? -5.748  -13.174 3.824   1.00 0.00 ? 84  LEU A CD2  4  
ATOM 7923  H H    . LEU A 1 84  ? -2.080  -10.284 1.302   1.00 0.00 ? 84  LEU A H    4  
ATOM 7924  H HA   . LEU A 1 84  ? -4.631  -11.615 1.242   1.00 0.00 ? 84  LEU A HA   4  
ATOM 7925  H HB2  . LEU A 1 84  ? -2.743  -13.293 2.248   1.00 0.00 ? 84  LEU A HB2  4  
ATOM 7926  H HB3  . LEU A 1 84  ? -3.297  -12.496 3.722   1.00 0.00 ? 84  LEU A HB3  4  
ATOM 7927  H HG   . LEU A 1 84  ? -5.338  -13.439 1.747   1.00 0.00 ? 84  LEU A HG   4  
ATOM 7928  H HD11 . LEU A 1 84  ? -3.707  -15.319 2.093   1.00 0.00 ? 84  LEU A HD11 4  
ATOM 7929  H HD12 . LEU A 1 84  ? -4.063  -15.240 3.819   1.00 0.00 ? 84  LEU A HD12 4  
ATOM 7930  H HD13 . LEU A 1 84  ? -5.334  -15.671 2.675   1.00 0.00 ? 84  LEU A HD13 4  
ATOM 7931  H HD21 . LEU A 1 84  ? -5.158  -12.854 4.667   1.00 0.00 ? 84  LEU A HD21 4  
ATOM 7932  H HD22 . LEU A 1 84  ? -6.379  -12.362 3.492   1.00 0.00 ? 84  LEU A HD22 4  
ATOM 7933  H HD23 . LEU A 1 84  ? -6.365  -14.013 4.109   1.00 0.00 ? 84  LEU A HD23 4  
ATOM 7934  N N    . VAL A 1 85  ? -5.337  -9.786  2.725   1.00 0.00 ? 85  VAL A N    4  
ATOM 7935  C CA   . VAL A 1 85  ? -5.749  -8.654  3.605   1.00 0.00 ? 85  VAL A CA   4  
ATOM 7936  C C    . VAL A 1 85  ? -6.535  -9.170  4.820   1.00 0.00 ? 85  VAL A C    4  
ATOM 7937  O O    . VAL A 1 85  ? -7.308  -10.104 4.734   1.00 0.00 ? 85  VAL A O    4  
ATOM 7938  C CB   . VAL A 1 85  ? -6.603  -7.670  2.781   1.00 0.00 ? 85  VAL A CB   4  
ATOM 7939  C CG1  . VAL A 1 85  ? -7.271  -6.621  3.688   1.00 0.00 ? 85  VAL A CG1  4  
ATOM 7940  C CG2  . VAL A 1 85  ? -5.704  -6.955  1.771   1.00 0.00 ? 85  VAL A CG2  4  
ATOM 7941  H H    . VAL A 1 85  ? -5.957  -10.124 2.035   1.00 0.00 ? 85  VAL A H    4  
ATOM 7942  H HA   . VAL A 1 85  ? -4.869  -8.143  3.951   1.00 0.00 ? 85  VAL A HA   4  
ATOM 7943  H HB   . VAL A 1 85  ? -7.358  -8.220  2.248   1.00 0.00 ? 85  VAL A HB   4  
ATOM 7944  H HG11 . VAL A 1 85  ? -7.867  -7.122  4.439   1.00 0.00 ? 85  VAL A HG11 4  
ATOM 7945  H HG12 . VAL A 1 85  ? -6.512  -6.026  4.172   1.00 0.00 ? 85  VAL A HG12 4  
ATOM 7946  H HG13 . VAL A 1 85  ? -7.907  -5.982  3.094   1.00 0.00 ? 85  VAL A HG13 4  
ATOM 7947  H HG21 . VAL A 1 85  ? -5.136  -7.685  1.215   1.00 0.00 ? 85  VAL A HG21 4  
ATOM 7948  H HG22 . VAL A 1 85  ? -6.315  -6.380  1.091   1.00 0.00 ? 85  VAL A HG22 4  
ATOM 7949  H HG23 . VAL A 1 85  ? -5.030  -6.295  2.295   1.00 0.00 ? 85  VAL A HG23 4  
ATOM 7950  N N    . LYS A 1 86  ? -6.337  -8.534  5.946   1.00 0.00 ? 86  LYS A N    4  
ATOM 7951  C CA   . LYS A 1 86  ? -7.051  -8.922  7.190   1.00 0.00 ? 86  LYS A CA   4  
ATOM 7952  C C    . LYS A 1 86  ? -7.295  -7.664  8.029   1.00 0.00 ? 86  LYS A C    4  
ATOM 7953  O O    . LYS A 1 86  ? -7.258  -6.557  7.528   1.00 0.00 ? 86  LYS A O    4  
ATOM 7954  C CB   . LYS A 1 86  ? -6.195  -9.923  7.972   1.00 0.00 ? 86  LYS A CB   4  
ATOM 7955  C CG   . LYS A 1 86  ? -7.072  -11.043 8.550   1.00 0.00 ? 86  LYS A CG   4  
ATOM 7956  C CD   . LYS A 1 86  ? -7.797  -11.792 7.421   1.00 0.00 ? 86  LYS A CD   4  
ATOM 7957  C CE   . LYS A 1 86  ? -9.292  -11.441 7.431   1.00 0.00 ? 86  LYS A CE   4  
ATOM 7958  N NZ   . LYS A 1 86  ? -10.083 -12.656 7.775   1.00 0.00 ? 86  LYS A NZ   4  
ATOM 7959  H H    . LYS A 1 86  ? -5.715  -7.784  5.970   1.00 0.00 ? 86  LYS A H    4  
ATOM 7960  H HA   . LYS A 1 86  ? -7.998  -9.369  6.941   1.00 0.00 ? 86  LYS A HA   4  
ATOM 7961  H HB2  . LYS A 1 86  ? -5.463  -10.351 7.311   1.00 0.00 ? 86  LYS A HB2  4  
ATOM 7962  H HB3  . LYS A 1 86  ? -5.692  -9.412  8.780   1.00 0.00 ? 86  LYS A HB3  4  
ATOM 7963  H HG2  . LYS A 1 86  ? -6.443  -11.733 9.087   1.00 0.00 ? 86  LYS A HG2  4  
ATOM 7964  H HG3  . LYS A 1 86  ? -7.798  -10.622 9.226   1.00 0.00 ? 86  LYS A HG3  4  
ATOM 7965  H HD2  . LYS A 1 86  ? -7.369  -11.511 6.469   1.00 0.00 ? 86  LYS A HD2  4  
ATOM 7966  H HD3  . LYS A 1 86  ? -7.680  -12.855 7.566   1.00 0.00 ? 86  LYS A HD3  4  
ATOM 7967  H HE2  . LYS A 1 86  ? -9.483  -10.669 8.163   1.00 0.00 ? 86  LYS A HE2  4  
ATOM 7968  H HE3  . LYS A 1 86  ? -9.585  -11.087 6.454   1.00 0.00 ? 86  LYS A HE3  4  
ATOM 7969  H HZ1  . LYS A 1 86  ? -9.663  -13.486 7.311   1.00 0.00 ? 86  LYS A HZ1  4  
ATOM 7970  H HZ2  . LYS A 1 86  ? -10.074 -12.797 8.805   1.00 0.00 ? 86  LYS A HZ2  4  
ATOM 7971  H HZ3  . LYS A 1 86  ? -11.064 -12.535 7.449   1.00 0.00 ? 86  LYS A HZ3  4  
ATOM 7972  N N    . TRP A 1 87  ? -7.566  -7.833  9.292   1.00 0.00 ? 87  TRP A N    4  
ATOM 7973  C CA   . TRP A 1 87  ? -7.840  -6.662  10.178  1.00 0.00 ? 87  TRP A CA   4  
ATOM 7974  C C    . TRP A 1 87  ? -6.917  -6.646  11.388  1.00 0.00 ? 87  TRP A C    4  
ATOM 7975  O O    . TRP A 1 87  ? -6.089  -7.513  11.586  1.00 0.00 ? 87  TRP A O    4  
ATOM 7976  C CB   . TRP A 1 87  ? -9.260  -6.766  10.692  1.00 0.00 ? 87  TRP A CB   4  
ATOM 7977  C CG   . TRP A 1 87  ? -10.173 -6.673  9.548   1.00 0.00 ? 87  TRP A CG   4  
ATOM 7978  C CD1  . TRP A 1 87  ? -10.740 -7.721  8.938   1.00 0.00 ? 87  TRP A CD1  4  
ATOM 7979  C CD2  . TRP A 1 87  ? -10.612 -5.486  8.847   1.00 0.00 ? 87  TRP A CD2  4  
ATOM 7980  N NE1  . TRP A 1 87  ? -11.542 -7.254  7.927   1.00 0.00 ? 87  TRP A NE1  4  
ATOM 7981  C CE2  . TRP A 1 87  ? -11.490 -5.880  7.824   1.00 0.00 ? 87  TRP A CE2  4  
ATOM 7982  C CE3  . TRP A 1 87  ? -10.344 -4.116  9.007   1.00 0.00 ? 87  TRP A CE3  4  
ATOM 7983  C CZ2  . TRP A 1 87  ? -12.087 -4.955  6.983   1.00 0.00 ? 87  TRP A CZ2  4  
ATOM 7984  C CZ3  . TRP A 1 87  ? -10.940 -3.175  8.156   1.00 0.00 ? 87  TRP A CZ3  4  
ATOM 7985  C CH2  . TRP A 1 87  ? -11.814 -3.596  7.146   1.00 0.00 ? 87  TRP A CH2  4  
ATOM 7986  H H    . TRP A 1 87  ? -7.612  -8.735  9.652   1.00 0.00 ? 87  TRP A H    4  
ATOM 7987  H HA   . TRP A 1 87  ? -7.738  -5.740  9.621   1.00 0.00 ? 87  TRP A HA   4  
ATOM 7988  H HB2  . TRP A 1 87  ? -9.399  -7.713  11.193  1.00 0.00 ? 87  TRP A HB2  4  
ATOM 7989  H HB3  . TRP A 1 87  ? -9.462  -5.960  11.375  1.00 0.00 ? 87  TRP A HB3  4  
ATOM 7990  H HD1  . TRP A 1 87  ? -10.599 -8.755  9.208   1.00 0.00 ? 87  TRP A HD1  4  
ATOM 7991  H HE1  . TRP A 1 87  ? -12.075 -7.811  7.339   1.00 0.00 ? 87  TRP A HE1  4  
ATOM 7992  H HE3  . TRP A 1 87  ? -9.665  -3.789  9.780   1.00 0.00 ? 87  TRP A HE3  4  
ATOM 7993  H HZ2  . TRP A 1 87  ? -12.756 -5.287  6.214   1.00 0.00 ? 87  TRP A HZ2  4  
ATOM 7994  H HZ3  . TRP A 1 87  ? -10.728 -2.124  8.282   1.00 0.00 ? 87  TRP A HZ3  4  
ATOM 7995  H HH2  . TRP A 1 87  ? -12.266 -2.873  6.488   1.00 0.00 ? 87  TRP A HH2  4  
ATOM 7996  N N    . GLU A 1 88  ? -7.097  -5.653  12.207  1.00 0.00 ? 88  GLU A N    4  
ATOM 7997  C CA   . GLU A 1 88  ? -6.298  -5.513  13.448  1.00 0.00 ? 88  GLU A CA   4  
ATOM 7998  C C    . GLU A 1 88  ? -7.284  -5.209  14.582  1.00 0.00 ? 88  GLU A C    4  
ATOM 7999  O O    . GLU A 1 88  ? -7.342  -5.898  15.583  1.00 0.00 ? 88  GLU A O    4  
ATOM 8000  C CB   . GLU A 1 88  ? -5.285  -4.362  13.239  1.00 0.00 ? 88  GLU A CB   4  
ATOM 8001  C CG   . GLU A 1 88  ? -4.995  -3.589  14.541  1.00 0.00 ? 88  GLU A CG   4  
ATOM 8002  C CD   . GLU A 1 88  ? -4.433  -4.548  15.592  1.00 0.00 ? 88  GLU A CD   4  
ATOM 8003  O OE1  . GLU A 1 88  ? -3.624  -5.386  15.228  1.00 0.00 ? 88  GLU A OE1  4  
ATOM 8004  O OE2  . GLU A 1 88  ? -4.821  -4.428  16.742  1.00 0.00 ? 88  GLU A OE2  4  
ATOM 8005  H H    . GLU A 1 88  ? -7.789  -4.989  12.006  1.00 0.00 ? 88  GLU A H    4  
ATOM 8006  H HA   . GLU A 1 88  ? -5.775  -6.433  13.653  1.00 0.00 ? 88  GLU A HA   4  
ATOM 8007  H HB2  . GLU A 1 88  ? -4.366  -4.774  12.868  1.00 0.00 ? 88  GLU A HB2  4  
ATOM 8008  H HB3  . GLU A 1 88  ? -5.681  -3.680  12.504  1.00 0.00 ? 88  GLU A HB3  4  
ATOM 8009  H HG2  . GLU A 1 88  ? -4.278  -2.807  14.344  1.00 0.00 ? 88  GLU A HG2  4  
ATOM 8010  H HG3  . GLU A 1 88  ? -5.912  -3.151  14.908  1.00 0.00 ? 88  GLU A HG3  4  
ATOM 8011  N N    . SER A 1 89  ? -8.048  -4.169  14.412  1.00 0.00 ? 89  SER A N    4  
ATOM 8012  C CA   . SER A 1 89  ? -9.040  -3.770  15.445  1.00 0.00 ? 89  SER A CA   4  
ATOM 8013  C C    . SER A 1 89  ? -10.442 -3.753  14.834  1.00 0.00 ? 89  SER A C    4  
ATOM 8014  O O    . SER A 1 89  ? -11.368 -4.349  15.345  1.00 0.00 ? 89  SER A O    4  
ATOM 8015  C CB   . SER A 1 89  ? -8.696  -2.363  15.932  1.00 0.00 ? 89  SER A CB   4  
ATOM 8016  O OG   . SER A 1 89  ? -8.489  -1.517  14.801  1.00 0.00 ? 89  SER A OG   4  
ATOM 8017  H H    . SER A 1 89  ? -7.960  -3.641  13.594  1.00 0.00 ? 89  SER A H    4  
ATOM 8018  H HA   . SER A 1 89  ? -9.006  -4.459  16.267  1.00 0.00 ? 89  SER A HA   4  
ATOM 8019  H HB2  . SER A 1 89  ? -9.508  -1.974  16.523  1.00 0.00 ? 89  SER A HB2  4  
ATOM 8020  H HB3  . SER A 1 89  ? -7.798  -2.400  16.536  1.00 0.00 ? 89  SER A HB3  4  
ATOM 8021  H HG   . SER A 1 89  ? -7.602  -1.676  14.470  1.00 0.00 ? 89  SER A HG   4  
ATOM 8022  N N    . GLU A 1 90  ? -10.584 -3.053  13.744  1.00 0.00 ? 90  GLU A N    4  
ATOM 8023  C CA   . GLU A 1 90  ? -11.900 -2.927  13.037  1.00 0.00 ? 90  GLU A CA   4  
ATOM 8024  C C    . GLU A 1 90  ? -11.749 -1.822  11.992  1.00 0.00 ? 90  GLU A C    4  
ATOM 8025  O O    . GLU A 1 90  ? -12.267 -1.903  10.895  1.00 0.00 ? 90  GLU A O    4  
ATOM 8026  C CB   . GLU A 1 90  ? -13.021 -2.542  14.015  1.00 0.00 ? 90  GLU A CB   4  
ATOM 8027  C CG   . GLU A 1 90  ? -12.602 -1.315  14.829  1.00 0.00 ? 90  GLU A CG   4  
ATOM 8028  C CD   . GLU A 1 90  ? -13.212 -1.399  16.230  1.00 0.00 ? 90  GLU A CD   4  
ATOM 8029  O OE1  . GLU A 1 90  ? -14.424 -1.503  16.322  1.00 0.00 ? 90  GLU A OE1  4  
ATOM 8030  O OE2  . GLU A 1 90  ? -12.456 -1.359  17.187  1.00 0.00 ? 90  GLU A OE2  4  
ATOM 8031  H H    . GLU A 1 90  ? -9.805  -2.591  13.377  1.00 0.00 ? 90  GLU A H    4  
ATOM 8032  H HA   . GLU A 1 90  ? -12.138 -3.858  12.547  1.00 0.00 ? 90  GLU A HA   4  
ATOM 8033  H HB2  . GLU A 1 90  ? -13.916 -2.312  13.456  1.00 0.00 ? 90  GLU A HB2  4  
ATOM 8034  H HB3  . GLU A 1 90  ? -13.221 -3.365  14.683  1.00 0.00 ? 90  GLU A HB3  4  
ATOM 8035  H HG2  . GLU A 1 90  ? -11.526 -1.278  14.905  1.00 0.00 ? 90  GLU A HG2  4  
ATOM 8036  H HG3  . GLU A 1 90  ? -12.958 -0.422  14.340  1.00 0.00 ? 90  GLU A HG3  4  
ATOM 8037  N N    . ASN A 1 91  ? -10.994 -0.811  12.328  1.00 0.00 ? 91  ASN A N    4  
ATOM 8038  C CA   . ASN A 1 91  ? -10.728 0.304   11.375  1.00 0.00 ? 91  ASN A CA   4  
ATOM 8039  C C    . ASN A 1 91  ? -9.264  0.228   10.930  1.00 0.00 ? 91  ASN A C    4  
ATOM 8040  O O    . ASN A 1 91  ? -8.803  1.059   10.174  1.00 0.00 ? 91  ASN A O    4  
ATOM 8041  C CB   . ASN A 1 91  ? -10.975 1.646   12.049  1.00 0.00 ? 91  ASN A CB   4  
ATOM 8042  C CG   . ASN A 1 91  ? -12.435 1.760   12.493  1.00 0.00 ? 91  ASN A CG   4  
ATOM 8043  O OD1  . ASN A 1 91  ? -13.168 0.791   12.490  1.00 0.00 ? 91  ASN A OD1  4  
ATOM 8044  N ND2  . ASN A 1 91  ? -12.890 2.924   12.869  1.00 0.00 ? 91  ASN A ND2  4  
ATOM 8045  H H    . ASN A 1 91  ? -10.560 -0.806  13.207  1.00 0.00 ? 91  ASN A H    4  
ATOM 8046  H HA   . ASN A 1 91  ? -11.365 0.214   10.503  1.00 0.00 ? 91  ASN A HA   4  
ATOM 8047  H HB2  . ASN A 1 91  ? -10.324 1.741   12.900  1.00 0.00 ? 91  ASN A HB2  4  
ATOM 8048  H HB3  . ASN A 1 91  ? -10.764 2.430   11.349  1.00 0.00 ? 91  ASN A HB3  4  
ATOM 8049  H HD21 . ASN A 1 91  ? -12.299 3.705   12.865  1.00 0.00 ? 91  ASN A HD21 4  
ATOM 8050  H HD22 . ASN A 1 91  ? -13.822 3.019   13.147  1.00 0.00 ? 91  ASN A HD22 4  
ATOM 8051  N N    . LYS A 1 92  ? -8.534  -0.772  11.381  1.00 0.00 ? 92  LYS A N    4  
ATOM 8052  C CA   . LYS A 1 92  ? -7.134  -0.929  10.956  1.00 0.00 ? 92  LYS A CA   4  
ATOM 8053  C C    . LYS A 1 92  ? -7.057  -2.287  10.267  1.00 0.00 ? 92  LYS A C    4  
ATOM 8054  O O    . LYS A 1 92  ? -7.703  -3.227  10.687  1.00 0.00 ? 92  LYS A O    4  
ATOM 8055  C CB   . LYS A 1 92  ? -6.212  -0.895  12.175  1.00 0.00 ? 92  LYS A CB   4  
ATOM 8056  C CG   . LYS A 1 92  ? -4.782  -0.626  11.716  1.00 0.00 ? 92  LYS A CG   4  
ATOM 8057  C CD   . LYS A 1 92  ? -4.045  -1.949  11.499  1.00 0.00 ? 92  LYS A CD   4  
ATOM 8058  C CE   . LYS A 1 92  ? -2.676  -1.676  10.874  1.00 0.00 ? 92  LYS A CE   4  
ATOM 8059  N NZ   . LYS A 1 92  ? -1.760  -1.121  11.910  1.00 0.00 ? 92  LYS A NZ   4  
ATOM 8060  H H    . LYS A 1 92  ? -8.917  -1.441  11.990  1.00 0.00 ? 92  LYS A H    4  
ATOM 8061  H HA   . LYS A 1 92  ? -6.870  -0.143  10.261  1.00 0.00 ? 92  LYS A HA   4  
ATOM 8062  H HB2  . LYS A 1 92  ? -6.530  -0.107  12.843  1.00 0.00 ? 92  LYS A HB2  4  
ATOM 8063  H HB3  . LYS A 1 92  ? -6.255  -1.839  12.689  1.00 0.00 ? 92  LYS A HB3  4  
ATOM 8064  H HG2  . LYS A 1 92  ? -4.806  -0.074  10.790  1.00 0.00 ? 92  LYS A HG2  4  
ATOM 8065  H HG3  . LYS A 1 92  ? -4.269  -0.049  12.468  1.00 0.00 ? 92  LYS A HG3  4  
ATOM 8066  H HD2  . LYS A 1 92  ? -3.913  -2.446  12.447  1.00 0.00 ? 92  LYS A HD2  4  
ATOM 8067  H HD3  . LYS A 1 92  ? -4.621  -2.579  10.839  1.00 0.00 ? 92  LYS A HD3  4  
ATOM 8068  H HE2  . LYS A 1 92  ? -2.267  -2.597  10.488  1.00 0.00 ? 92  LYS A HE2  4  
ATOM 8069  H HE3  . LYS A 1 92  ? -2.784  -0.964  10.069  1.00 0.00 ? 92  LYS A HE3  4  
ATOM 8070  H HZ1  . LYS A 1 92  ? -1.888  -1.641  12.801  1.00 0.00 ? 92  LYS A HZ1  4  
ATOM 8071  H HZ2  . LYS A 1 92  ? -0.776  -1.219  11.592  1.00 0.00 ? 92  LYS A HZ2  4  
ATOM 8072  H HZ3  . LYS A 1 92  ? -1.978  -0.114  12.061  1.00 0.00 ? 92  LYS A HZ3  4  
ATOM 8073  N N    . MET A 1 93  ? -6.303  -2.402  9.215   1.00 0.00 ? 93  MET A N    4  
ATOM 8074  C CA   . MET A 1 93  ? -6.216  -3.706  8.502   1.00 0.00 ? 93  MET A CA   4  
ATOM 8075  C C    . MET A 1 93  ? -4.822  -3.889  7.934   1.00 0.00 ? 93  MET A C    4  
ATOM 8076  O O    . MET A 1 93  ? -4.046  -2.959  7.827   1.00 0.00 ? 93  MET A O    4  
ATOM 8077  C CB   . MET A 1 93  ? -7.246  -3.822  7.356   1.00 0.00 ? 93  MET A CB   4  
ATOM 8078  C CG   . MET A 1 93  ? -7.697  -2.446  6.842   1.00 0.00 ? 93  MET A CG   4  
ATOM 8079  S SD   . MET A 1 93  ? -7.908  -2.499  5.042   1.00 0.00 ? 93  MET A SD   4  
ATOM 8080  C CE   . MET A 1 93  ? -9.043  -3.907  4.991   1.00 0.00 ? 93  MET A CE   4  
ATOM 8081  H H    . MET A 1 93  ? -5.799  -1.641  8.894   1.00 0.00 ? 93  MET A H    4  
ATOM 8082  H HA   . MET A 1 93  ? -6.405  -4.491  9.209   1.00 0.00 ? 93  MET A HA   4  
ATOM 8083  H HB2  . MET A 1 93  ? -6.803  -4.376  6.541   1.00 0.00 ? 93  MET A HB2  4  
ATOM 8084  H HB3  . MET A 1 93  ? -8.108  -4.362  7.716   1.00 0.00 ? 93  MET A HB3  4  
ATOM 8085  H HG2  . MET A 1 93  ? -8.638  -2.188  7.302   1.00 0.00 ? 93  MET A HG2  4  
ATOM 8086  H HG3  . MET A 1 93  ? -6.958  -1.707  7.094   1.00 0.00 ? 93  MET A HG3  4  
ATOM 8087  H HE1  . MET A 1 93  ? -8.583  -4.757  5.477   1.00 0.00 ? 93  MET A HE1  4  
ATOM 8088  H HE2  . MET A 1 93  ? -9.957  -3.646  5.503   1.00 0.00 ? 93  MET A HE2  4  
ATOM 8089  H HE3  . MET A 1 93  ? -9.264  -4.157  3.968   1.00 0.00 ? 93  MET A HE3  4  
ATOM 8090  N N    . VAL A 1 94  ? -4.507  -5.097  7.586   1.00 0.00 ? 94  VAL A N    4  
ATOM 8091  C CA   . VAL A 1 94  ? -3.163  -5.403  7.031   1.00 0.00 ? 94  VAL A CA   4  
ATOM 8092  C C    . VAL A 1 94  ? -3.295  -6.063  5.667   1.00 0.00 ? 94  VAL A C    4  
ATOM 8093  O O    . VAL A 1 94  ? -4.375  -6.248  5.143   1.00 0.00 ? 94  VAL A O    4  
ATOM 8094  C CB   . VAL A 1 94  ? -2.437  -6.375  7.964   1.00 0.00 ? 94  VAL A CB   4  
ATOM 8095  C CG1  . VAL A 1 94  ? -1.956  -5.634  9.206   1.00 0.00 ? 94  VAL A CG1  4  
ATOM 8096  C CG2  . VAL A 1 94  ? -3.397  -7.491  8.373   1.00 0.00 ? 94  VAL A CG2  4  
ATOM 8097  H H    . VAL A 1 94  ? -5.161  -5.820  7.705   1.00 0.00 ? 94  VAL A H    4  
ATOM 8098  H HA   . VAL A 1 94  ? -2.589  -4.500  6.941   1.00 0.00 ? 94  VAL A HA   4  
ATOM 8099  H HB   . VAL A 1 94  ? -1.588  -6.801  7.452   1.00 0.00 ? 94  VAL A HB   4  
ATOM 8100  H HG11 . VAL A 1 94  ? -2.546  -4.740  9.343   1.00 0.00 ? 94  VAL A HG11 4  
ATOM 8101  H HG12 . VAL A 1 94  ? -2.062  -6.273  10.069  1.00 0.00 ? 94  VAL A HG12 4  
ATOM 8102  H HG13 . VAL A 1 94  ? -0.919  -5.367  9.081   1.00 0.00 ? 94  VAL A HG13 4  
ATOM 8103  H HG21 . VAL A 1 94  ? -3.955  -7.815  7.507   1.00 0.00 ? 94  VAL A HG21 4  
ATOM 8104  H HG22 . VAL A 1 94  ? -2.836  -8.317  8.776   1.00 0.00 ? 94  VAL A HG22 4  
ATOM 8105  H HG23 . VAL A 1 94  ? -4.081  -7.115  9.121   1.00 0.00 ? 94  VAL A HG23 4  
ATOM 8106  N N    . CYS A 1 95  ? -2.185  -6.435  5.111   1.00 0.00 ? 95  CYS A N    4  
ATOM 8107  C CA   . CYS A 1 95  ? -2.174  -7.119  3.797   1.00 0.00 ? 95  CYS A CA   4  
ATOM 8108  C C    . CYS A 1 95  ? -0.814  -7.776  3.648   1.00 0.00 ? 95  CYS A C    4  
ATOM 8109  O O    . CYS A 1 95  ? 0.032   -7.314  2.911   1.00 0.00 ? 95  CYS A O    4  
ATOM 8110  C CB   . CYS A 1 95  ? -2.393  -6.116  2.674   1.00 0.00 ? 95  CYS A CB   4  
ATOM 8111  S SG   . CYS A 1 95  ? -2.553  -7.000  1.103   1.00 0.00 ? 95  CYS A SG   4  
ATOM 8112  H H    . CYS A 1 95  ? -1.339  -6.274  5.578   1.00 0.00 ? 95  CYS A H    4  
ATOM 8113  H HA   . CYS A 1 95  ? -2.945  -7.863  3.775   1.00 0.00 ? 95  CYS A HA   4  
ATOM 8114  H HB2  . CYS A 1 95  ? -3.289  -5.557  2.867   1.00 0.00 ? 95  CYS A HB2  4  
ATOM 8115  H HB3  . CYS A 1 95  ? -1.560  -5.439  2.622   1.00 0.00 ? 95  CYS A HB3  4  
ATOM 8116  H HG   . CYS A 1 95  ? -2.159  -7.869  1.210   1.00 0.00 ? 95  CYS A HG   4  
ATOM 8117  N N    . GLU A 1 96  ? -0.585  -8.831  4.381   1.00 0.00 ? 96  GLU A N    4  
ATOM 8118  C CA   . GLU A 1 96  ? 0.744   -9.495  4.328   1.00 0.00 ? 96  GLU A CA   4  
ATOM 8119  C C    . GLU A 1 96  ? 0.995   -10.104 2.952   1.00 0.00 ? 96  GLU A C    4  
ATOM 8120  O O    . GLU A 1 96  ? 0.383   -11.083 2.570   1.00 0.00 ? 96  GLU A O    4  
ATOM 8121  C CB   . GLU A 1 96  ? 0.831   -10.590 5.386   1.00 0.00 ? 96  GLU A CB   4  
ATOM 8122  C CG   . GLU A 1 96  ? 2.276   -11.085 5.459   1.00 0.00 ? 96  GLU A CG   4  
ATOM 8123  C CD   . GLU A 1 96  ? 2.350   -12.333 6.341   1.00 0.00 ? 96  GLU A CD   4  
ATOM 8124  O OE1  . GLU A 1 96  ? 2.258   -12.187 7.549   1.00 0.00 ? 96  GLU A OE1  4  
ATOM 8125  O OE2  . GLU A 1 96  ? 2.498   -13.414 5.794   1.00 0.00 ? 96  GLU A OE2  4  
ATOM 8126  H H    . GLU A 1 96  ? -1.282  -9.167  4.989   1.00 0.00 ? 96  GLU A H    4  
ATOM 8127  H HA   . GLU A 1 96  ? 1.504   -8.754  4.528   1.00 0.00 ? 96  GLU A HA   4  
ATOM 8128  H HB2  . GLU A 1 96  ? 0.533   -10.192 6.346   1.00 0.00 ? 96  GLU A HB2  4  
ATOM 8129  H HB3  . GLU A 1 96  ? 0.183   -11.410 5.115   1.00 0.00 ? 96  GLU A HB3  4  
ATOM 8130  H HG2  . GLU A 1 96  ? 2.622   -11.323 4.462   1.00 0.00 ? 96  GLU A HG2  4  
ATOM 8131  H HG3  . GLU A 1 96  ? 2.900   -10.310 5.878   1.00 0.00 ? 96  GLU A HG3  4  
ATOM 8132  N N    . GLN A 1 97  ? 1.918   -9.539  2.222   1.00 0.00 ? 97  GLN A N    4  
ATOM 8133  C CA   . GLN A 1 97  ? 2.257   -10.073 0.885   1.00 0.00 ? 97  GLN A CA   4  
ATOM 8134  C C    . GLN A 1 97  ? 3.540   -10.901 1.009   1.00 0.00 ? 97  GLN A C    4  
ATOM 8135  O O    . GLN A 1 97  ? 4.541   -10.422 1.509   1.00 0.00 ? 97  GLN A O    4  
ATOM 8136  C CB   . GLN A 1 97  ? 2.488   -8.905  -0.070  1.00 0.00 ? 97  GLN A CB   4  
ATOM 8137  C CG   . GLN A 1 97  ? 1.212   -8.068  -0.179  1.00 0.00 ? 97  GLN A CG   4  
ATOM 8138  C CD   . GLN A 1 97  ? 1.039   -7.565  -1.616  1.00 0.00 ? 97  GLN A CD   4  
ATOM 8139  O OE1  . GLN A 1 97  ? 1.968   -7.588  -2.401  1.00 0.00 ? 97  GLN A OE1  4  
ATOM 8140  N NE2  . GLN A 1 97  ? -0.121  -7.105  -1.997  1.00 0.00 ? 97  GLN A NE2  4  
ATOM 8141  H H    . GLN A 1 97  ? 2.402   -8.764  2.563   1.00 0.00 ? 97  GLN A H    4  
ATOM 8142  H HA   . GLN A 1 97  ? 1.451   -10.689 0.526   1.00 0.00 ? 97  GLN A HA   4  
ATOM 8143  H HB2  . GLN A 1 97  ? 3.289   -8.287  0.306   1.00 0.00 ? 97  GLN A HB2  4  
ATOM 8144  H HB3  . GLN A 1 97  ? 2.752   -9.284  -1.038  1.00 0.00 ? 97  GLN A HB3  4  
ATOM 8145  H HG2  . GLN A 1 97  ? 0.361   -8.673  0.095   1.00 0.00 ? 97  GLN A HG2  4  
ATOM 8146  H HG3  . GLN A 1 97  ? 1.283   -7.222  0.488   1.00 0.00 ? 97  GLN A HG3  4  
ATOM 8147  H HE21 . GLN A 1 97  ? -0.871  -7.084  -1.365  1.00 0.00 ? 97  GLN A HE21 4  
ATOM 8148  H HE22 . GLN A 1 97  ? -0.244  -6.781  -2.913  1.00 0.00 ? 97  GLN A HE22 4  
ATOM 8149  N N    . LYS A 1 98  ? 3.522   -12.140 0.580   1.00 0.00 ? 98  LYS A N    4  
ATOM 8150  C CA   . LYS A 1 98  ? 4.756   -12.984 0.701   1.00 0.00 ? 98  LYS A CA   4  
ATOM 8151  C C    . LYS A 1 98  ? 5.114   -13.602 -0.654  1.00 0.00 ? 98  LYS A C    4  
ATOM 8152  O O    . LYS A 1 98  ? 4.302   -13.648 -1.554  1.00 0.00 ? 98  LYS A O    4  
ATOM 8153  C CB   . LYS A 1 98  ? 4.511   -14.100 1.720   1.00 0.00 ? 98  LYS A CB   4  
ATOM 8154  C CG   . LYS A 1 98  ? 3.263   -14.893 1.324   1.00 0.00 ? 98  LYS A CG   4  
ATOM 8155  C CD   . LYS A 1 98  ? 2.933   -15.906 2.422   1.00 0.00 ? 98  LYS A CD   4  
ATOM 8156  C CE   . LYS A 1 98  ? 3.844   -17.127 2.282   1.00 0.00 ? 98  LYS A CE   4  
ATOM 8157  N NZ   . LYS A 1 98  ? 3.223   -18.292 2.974   1.00 0.00 ? 98  LYS A NZ   4  
ATOM 8158  H H    . LYS A 1 98  ? 2.697   -12.517 0.192   1.00 0.00 ? 98  LYS A H    4  
ATOM 8159  H HA   . LYS A 1 98  ? 5.577   -12.368 1.039   1.00 0.00 ? 98  LYS A HA   4  
ATOM 8160  H HB2  . LYS A 1 98  ? 5.366   -14.761 1.742   1.00 0.00 ? 98  LYS A HB2  4  
ATOM 8161  H HB3  . LYS A 1 98  ? 4.365   -13.668 2.698   1.00 0.00 ? 98  LYS A HB3  4  
ATOM 8162  H HG2  . LYS A 1 98  ? 2.431   -14.215 1.197   1.00 0.00 ? 98  LYS A HG2  4  
ATOM 8163  H HG3  . LYS A 1 98  ? 3.447   -15.416 0.398   1.00 0.00 ? 98  LYS A HG3  4  
ATOM 8164  H HD2  . LYS A 1 98  ? 3.086   -15.451 3.390   1.00 0.00 ? 98  LYS A HD2  4  
ATOM 8165  H HD3  . LYS A 1 98  ? 1.903   -16.216 2.329   1.00 0.00 ? 98  LYS A HD3  4  
ATOM 8166  H HE2  . LYS A 1 98  ? 3.977   -17.359 1.236   1.00 0.00 ? 98  LYS A HE2  4  
ATOM 8167  H HE3  . LYS A 1 98  ? 4.804   -16.913 2.729   1.00 0.00 ? 98  LYS A HE3  4  
ATOM 8168  H HZ1  . LYS A 1 98  ? 2.972   -18.024 3.946   1.00 0.00 ? 98  LYS A HZ1  4  
ATOM 8169  H HZ2  . LYS A 1 98  ? 2.365   -18.581 2.464   1.00 0.00 ? 98  LYS A HZ2  4  
ATOM 8170  H HZ3  . LYS A 1 98  ? 3.899   -19.083 2.994   1.00 0.00 ? 98  LYS A HZ3  4  
ATOM 8171  N N    . LEU A 1 99  ? 6.326   -14.090 -0.797  1.00 0.00 ? 99  LEU A N    4  
ATOM 8172  C CA   . LEU A 1 99  ? 6.731   -14.723 -2.097  1.00 0.00 ? 99  LEU A CA   4  
ATOM 8173  C C    . LEU A 1 99  ? 6.668   -16.244 -1.970  1.00 0.00 ? 99  LEU A C    4  
ATOM 8174  O O    . LEU A 1 99  ? 7.460   -16.962 -2.550  1.00 0.00 ? 99  LEU A O    4  
ATOM 8175  C CB   . LEU A 1 99  ? 8.141   -14.292 -2.559  1.00 0.00 ? 99  LEU A CB   4  
ATOM 8176  C CG   . LEU A 1 99  ? 9.044   -13.959 -1.376  1.00 0.00 ? 99  LEU A CG   4  
ATOM 8177  C CD1  . LEU A 1 99  ? 10.497  -14.283 -1.734  1.00 0.00 ? 99  LEU A CD1  4  
ATOM 8178  C CD2  . LEU A 1 99  ? 8.924   -12.467 -1.056  1.00 0.00 ? 99  LEU A CD2  4  
ATOM 8179  H H    . LEU A 1 99  ? 6.955   -14.050 -0.049  1.00 0.00 ? 99  LEU A H    4  
ATOM 8180  H HA   . LEU A 1 99  ? 6.028   -14.424 -2.842  1.00 0.00 ? 99  LEU A HA   4  
ATOM 8181  H HB2  . LEU A 1 99  ? 8.587   -15.095 -3.126  1.00 0.00 ? 99  LEU A HB2  4  
ATOM 8182  H HB3  . LEU A 1 99  ? 8.053   -13.422 -3.193  1.00 0.00 ? 99  LEU A HB3  4  
ATOM 8183  H HG   . LEU A 1 99  ? 8.741   -14.543 -0.524  1.00 0.00 ? 99  LEU A HG   4  
ATOM 8184  H HD11 . LEU A 1 99  ? 10.704  -13.947 -2.739  1.00 0.00 ? 99  LEU A HD11 4  
ATOM 8185  H HD12 . LEU A 1 99  ? 11.159  -13.781 -1.043  1.00 0.00 ? 99  LEU A HD12 4  
ATOM 8186  H HD13 . LEU A 1 99  ? 10.655  -15.350 -1.672  1.00 0.00 ? 99  LEU A HD13 4  
ATOM 8187  H HD21 . LEU A 1 99  ? 7.913   -12.139 -1.249  1.00 0.00 ? 99  LEU A HD21 4  
ATOM 8188  H HD22 . LEU A 1 99  ? 9.166   -12.299 -0.018  1.00 0.00 ? 99  LEU A HD22 4  
ATOM 8189  H HD23 . LEU A 1 99  ? 9.608   -11.910 -1.681  1.00 0.00 ? 99  LEU A HD23 4  
ATOM 8190  N N    . LEU A 1 100 ? 5.707   -16.736 -1.228  1.00 0.00 ? 100 LEU A N    4  
ATOM 8191  C CA   . LEU A 1 100 ? 5.546   -18.214 -1.064  1.00 0.00 ? 100 LEU A CA   4  
ATOM 8192  C C    . LEU A 1 100 ? 6.827   -18.854 -0.517  1.00 0.00 ? 100 LEU A C    4  
ATOM 8193  O O    . LEU A 1 100 ? 7.037   -20.045 -0.653  1.00 0.00 ? 100 LEU A O    4  
ATOM 8194  C CB   . LEU A 1 100 ? 5.229   -18.827 -2.420  1.00 0.00 ? 100 LEU A CB   4  
ATOM 8195  C CG   . LEU A 1 100 ? 3.921   -18.238 -2.950  1.00 0.00 ? 100 LEU A CG   4  
ATOM 8196  C CD1  . LEU A 1 100 ? 3.693   -18.703 -4.389  1.00 0.00 ? 100 LEU A CD1  4  
ATOM 8197  C CD2  . LEU A 1 100 ? 2.758   -18.708 -2.073  1.00 0.00 ? 100 LEU A CD2  4  
ATOM 8198  H H    . LEU A 1 100 ? 5.076   -16.129 -0.789  1.00 0.00 ? 100 LEU A H    4  
ATOM 8199  H HA   . LEU A 1 100 ? 4.729   -18.409 -0.387  1.00 0.00 ? 100 LEU A HA   4  
ATOM 8200  H HB2  . LEU A 1 100 ? 6.033   -18.604 -3.106  1.00 0.00 ? 100 LEU A HB2  4  
ATOM 8201  H HB3  . LEU A 1 100 ? 5.128   -19.895 -2.314  1.00 0.00 ? 100 LEU A HB3  4  
ATOM 8202  H HG   . LEU A 1 100 ? 3.978   -17.159 -2.927  1.00 0.00 ? 100 LEU A HG   4  
ATOM 8203  H HD11 . LEU A 1 100 ? 4.077   -19.705 -4.508  1.00 0.00 ? 100 LEU A HD11 4  
ATOM 8204  H HD12 . LEU A 1 100 ? 2.635   -18.694 -4.607  1.00 0.00 ? 100 LEU A HD12 4  
ATOM 8205  H HD13 . LEU A 1 100 ? 4.206   -18.037 -5.067  1.00 0.00 ? 100 LEU A HD13 4  
ATOM 8206  H HD21 . LEU A 1 100 ? 2.926   -19.731 -1.771  1.00 0.00 ? 100 LEU A HD21 4  
ATOM 8207  H HD22 . LEU A 1 100 ? 2.691   -18.079 -1.197  1.00 0.00 ? 100 LEU A HD22 4  
ATOM 8208  H HD23 . LEU A 1 100 ? 1.837   -18.644 -2.633  1.00 0.00 ? 100 LEU A HD23 4  
ATOM 8209  N N    . LYS A 1 101 ? 7.678   -18.080 0.097   1.00 0.00 ? 101 LYS A N    4  
ATOM 8210  C CA   . LYS A 1 101 ? 8.945   -18.639 0.655   1.00 0.00 ? 101 LYS A CA   4  
ATOM 8211  C C    . LYS A 1 101 ? 9.712   -17.532 1.376   1.00 0.00 ? 101 LYS A C    4  
ATOM 8212  O O    . LYS A 1 101 ? 10.021  -17.637 2.547   1.00 0.00 ? 101 LYS A O    4  
ATOM 8213  C CB   . LYS A 1 101 ? 9.802   -19.200 -0.482  1.00 0.00 ? 101 LYS A CB   4  
ATOM 8214  C CG   . LYS A 1 101 ? 10.551  -20.443 0.004   1.00 0.00 ? 101 LYS A CG   4  
ATOM 8215  C CD   . LYS A 1 101 ? 9.561   -21.593 0.199   1.00 0.00 ? 101 LYS A CD   4  
ATOM 8216  C CE   . LYS A 1 101 ? 10.325  -22.916 0.280   1.00 0.00 ? 101 LYS A CE   4  
ATOM 8217  N NZ   . LYS A 1 101 ? 10.522  -23.459 -1.094  1.00 0.00 ? 101 LYS A NZ   4  
ATOM 8218  H H    . LYS A 1 101 ? 7.484   -17.130 0.192   1.00 0.00 ? 101 LYS A H    4  
ATOM 8219  H HA   . LYS A 1 101 ? 8.715   -19.425 1.351   1.00 0.00 ? 101 LYS A HA   4  
ATOM 8220  H HB2  . LYS A 1 101 ? 9.167   -19.463 -1.315  1.00 0.00 ? 101 LYS A HB2  4  
ATOM 8221  H HB3  . LYS A 1 101 ? 10.514  -18.454 -0.794  1.00 0.00 ? 101 LYS A HB3  4  
ATOM 8222  H HG2  . LYS A 1 101 ? 11.293  -20.725 -0.729  1.00 0.00 ? 101 LYS A HG2  4  
ATOM 8223  H HG3  . LYS A 1 101 ? 11.038  -20.226 0.943   1.00 0.00 ? 101 LYS A HG3  4  
ATOM 8224  H HD2  . LYS A 1 101 ? 9.008   -21.440 1.115   1.00 0.00 ? 101 LYS A HD2  4  
ATOM 8225  H HD3  . LYS A 1 101 ? 8.877   -21.625 -0.635  1.00 0.00 ? 101 LYS A HD3  4  
ATOM 8226  H HE2  . LYS A 1 101 ? 11.287  -22.748 0.742   1.00 0.00 ? 101 LYS A HE2  4  
ATOM 8227  H HE3  . LYS A 1 101 ? 9.761   -23.623 0.869   1.00 0.00 ? 101 LYS A HE3  4  
ATOM 8228  H HZ1  . LYS A 1 101 ? 10.934  -22.724 -1.703  1.00 0.00 ? 101 LYS A HZ1  4  
ATOM 8229  H HZ2  . LYS A 1 101 ? 11.165  -24.277 -1.054  1.00 0.00 ? 101 LYS A HZ2  4  
ATOM 8230  H HZ3  . LYS A 1 101 ? 9.606   -23.756 -1.484  1.00 0.00 ? 101 LYS A HZ3  4  
ATOM 8231  N N    . GLY A 1 102 ? 10.013  -16.472 0.678   1.00 0.00 ? 102 GLY A N    4  
ATOM 8232  C CA   . GLY A 1 102 ? 10.756  -15.340 1.303   1.00 0.00 ? 102 GLY A CA   4  
ATOM 8233  C C    . GLY A 1 102 ? 12.254  -15.639 1.303   1.00 0.00 ? 102 GLY A C    4  
ATOM 8234  O O    . GLY A 1 102 ? 12.679  -16.746 1.574   1.00 0.00 ? 102 GLY A O    4  
ATOM 8235  H H    . GLY A 1 102 ? 9.744   -16.420 -0.262  1.00 0.00 ? 102 GLY A H    4  
ATOM 8236  H HA2  . GLY A 1 102 ? 10.569  -14.436 0.745   1.00 0.00 ? 102 GLY A HA2  4  
ATOM 8237  H HA3  . GLY A 1 102 ? 10.423  -15.207 2.319   1.00 0.00 ? 102 GLY A HA3  4  
ATOM 8238  N N    . GLU A 1 103 ? 13.052  -14.647 1.016   1.00 0.00 ? 103 GLU A N    4  
ATOM 8239  C CA   . GLU A 1 103 ? 14.530  -14.838 1.008   1.00 0.00 ? 103 GLU A CA   4  
ATOM 8240  C C    . GLU A 1 103 ? 15.140  -13.956 2.097   1.00 0.00 ? 103 GLU A C    4  
ATOM 8241  O O    . GLU A 1 103 ? 16.036  -14.361 2.813   1.00 0.00 ? 103 GLU A O    4  
ATOM 8242  C CB   . GLU A 1 103 ? 15.105  -14.456 -0.361  1.00 0.00 ? 103 GLU A CB   4  
ATOM 8243  C CG   . GLU A 1 103 ? 14.613  -13.064 -0.768  1.00 0.00 ? 103 GLU A CG   4  
ATOM 8244  C CD   . GLU A 1 103 ? 15.177  -12.707 -2.144  1.00 0.00 ? 103 GLU A CD   4  
ATOM 8245  O OE1  . GLU A 1 103 ? 16.319  -13.049 -2.402  1.00 0.00 ? 103 GLU A OE1  4  
ATOM 8246  O OE2  . GLU A 1 103 ? 14.457  -12.098 -2.918  1.00 0.00 ? 103 GLU A OE2  4  
ATOM 8247  H H    . GLU A 1 103 ? 12.675  -13.771 0.817   1.00 0.00 ? 103 GLU A H    4  
ATOM 8248  H HA   . GLU A 1 103 ? 14.753  -15.870 1.218   1.00 0.00 ? 103 GLU A HA   4  
ATOM 8249  H HB2  . GLU A 1 103 ? 16.184  -14.453 -0.308  1.00 0.00 ? 103 GLU A HB2  4  
ATOM 8250  H HB3  . GLU A 1 103 ? 14.784  -15.177 -1.098  1.00 0.00 ? 103 GLU A HB3  4  
ATOM 8251  H HG2  . GLU A 1 103 ? 13.534  -13.060 -0.810  1.00 0.00 ? 103 GLU A HG2  4  
ATOM 8252  H HG3  . GLU A 1 103 ? 14.949  -12.336 -0.045  1.00 0.00 ? 103 GLU A HG3  4  
ATOM 8253  N N    . GLY A 1 104 ? 14.640  -12.758 2.233   1.00 0.00 ? 104 GLY A N    4  
ATOM 8254  C CA   . GLY A 1 104 ? 15.149  -11.832 3.278   1.00 0.00 ? 104 GLY A CA   4  
ATOM 8255  C C    . GLY A 1 104 ? 13.970  -10.986 3.787   1.00 0.00 ? 104 GLY A C    4  
ATOM 8256  O O    . GLY A 1 104 ? 13.319  -11.370 4.739   1.00 0.00 ? 104 GLY A O    4  
ATOM 8257  H H    . GLY A 1 104 ? 13.912  -12.469 1.651   1.00 0.00 ? 104 GLY A H    4  
ATOM 8258  H HA2  . GLY A 1 104 ? 15.567  -12.405 4.091   1.00 0.00 ? 104 GLY A HA2  4  
ATOM 8259  H HA3  . GLY A 1 104 ? 15.904  -11.187 2.860   1.00 0.00 ? 104 GLY A HA3  4  
ATOM 8260  N N    . PRO A 1 105 ? 13.706  -9.863  3.140   1.00 0.00 ? 105 PRO A N    4  
ATOM 8261  C CA   . PRO A 1 105 ? 12.590  -8.988  3.531   1.00 0.00 ? 105 PRO A CA   4  
ATOM 8262  C C    . PRO A 1 105 ? 11.275  -9.502  2.928   1.00 0.00 ? 105 PRO A C    4  
ATOM 8263  O O    . PRO A 1 105 ? 11.172  -10.655 2.550   1.00 0.00 ? 105 PRO A O    4  
ATOM 8264  C CB   . PRO A 1 105 ? 12.976  -7.632  2.945   1.00 0.00 ? 105 PRO A CB   4  
ATOM 8265  C CG   . PRO A 1 105 ? 13.968  -7.910  1.790   1.00 0.00 ? 105 PRO A CG   4  
ATOM 8266  C CD   . PRO A 1 105 ? 14.483  -9.351  1.984   1.00 0.00 ? 105 PRO A CD   4  
ATOM 8267  H HA   . PRO A 1 105 ? 12.516  -8.920  4.601   1.00 0.00 ? 105 PRO A HA   4  
ATOM 8268  H HB2  . PRO A 1 105 ? 12.098  -7.136  2.570   1.00 0.00 ? 105 PRO A HB2  4  
ATOM 8269  H HB3  . PRO A 1 105 ? 13.454  -7.026  3.697   1.00 0.00 ? 105 PRO A HB3  4  
ATOM 8270  H HG2  . PRO A 1 105 ? 13.461  -7.818  0.842   1.00 0.00 ? 105 PRO A HG2  4  
ATOM 8271  H HG3  . PRO A 1 105 ? 14.796  -7.216  1.837   1.00 0.00 ? 105 PRO A HG3  4  
ATOM 8272  H HD2  . PRO A 1 105 ? 14.286  -9.942  1.100   1.00 0.00 ? 105 PRO A HD2  4  
ATOM 8273  H HD3  . PRO A 1 105 ? 15.535  -9.352  2.213   1.00 0.00 ? 105 PRO A HD3  4  
ATOM 8274  N N    . LYS A 1 106 ? 10.266  -8.665  2.849   1.00 0.00 ? 106 LYS A N    4  
ATOM 8275  C CA   . LYS A 1 106 ? 8.960   -9.114  2.290   1.00 0.00 ? 106 LYS A CA   4  
ATOM 8276  C C    . LYS A 1 106 ? 8.068   -7.906  1.992   1.00 0.00 ? 106 LYS A C    4  
ATOM 8277  O O    . LYS A 1 106 ? 8.377   -6.787  2.355   1.00 0.00 ? 106 LYS A O    4  
ATOM 8278  C CB   . LYS A 1 106 ? 8.277   -9.997  3.325   1.00 0.00 ? 106 LYS A CB   4  
ATOM 8279  C CG   . LYS A 1 106 ? 7.629   -11.202 2.639   1.00 0.00 ? 106 LYS A CG   4  
ATOM 8280  C CD   . LYS A 1 106 ? 7.589   -12.384 3.610   1.00 0.00 ? 106 LYS A CD   4  
ATOM 8281  C CE   . LYS A 1 106 ? 8.977   -13.021 3.698   1.00 0.00 ? 106 LYS A CE   4  
ATOM 8282  N NZ   . LYS A 1 106 ? 8.965   -14.095 4.732   1.00 0.00 ? 106 LYS A NZ   4  
ATOM 8283  H H    . LYS A 1 106 ? 10.364  -7.752  3.170   1.00 0.00 ? 106 LYS A H    4  
ATOM 8284  H HA   . LYS A 1 106 ? 9.127   -9.677  1.385   1.00 0.00 ? 106 LYS A HA   4  
ATOM 8285  H HB2  . LYS A 1 106 ? 9.019   -10.332 4.030   1.00 0.00 ? 106 LYS A HB2  4  
ATOM 8286  H HB3  . LYS A 1 106 ? 7.519   -9.428  3.843   1.00 0.00 ? 106 LYS A HB3  4  
ATOM 8287  H HG2  . LYS A 1 106 ? 6.622   -10.947 2.340   1.00 0.00 ? 106 LYS A HG2  4  
ATOM 8288  H HG3  . LYS A 1 106 ? 8.205   -11.473 1.767   1.00 0.00 ? 106 LYS A HG3  4  
ATOM 8289  H HD2  . LYS A 1 106 ? 7.289   -12.036 4.587   1.00 0.00 ? 106 LYS A HD2  4  
ATOM 8290  H HD3  . LYS A 1 106 ? 6.881   -13.118 3.255   1.00 0.00 ? 106 LYS A HD3  4  
ATOM 8291  H HE2  . LYS A 1 106 ? 9.240   -13.446 2.741   1.00 0.00 ? 106 LYS A HE2  4  
ATOM 8292  H HE3  . LYS A 1 106 ? 9.702   -12.268 3.969   1.00 0.00 ? 106 LYS A HE3  4  
ATOM 8293  H HZ1  . LYS A 1 106 ? 8.104   -14.667 4.628   1.00 0.00 ? 106 LYS A HZ1  4  
ATOM 8294  H HZ2  . LYS A 1 106 ? 9.799   -14.703 4.610   1.00 0.00 ? 106 LYS A HZ2  4  
ATOM 8295  H HZ3  . LYS A 1 106 ? 8.984   -13.663 5.679   1.00 0.00 ? 106 LYS A HZ3  4  
ATOM 8296  N N    . THR A 1 107 ? 6.956   -8.136  1.342   1.00 0.00 ? 107 THR A N    4  
ATOM 8297  C CA   . THR A 1 107 ? 6.025   -7.024  1.017   1.00 0.00 ? 107 THR A CA   4  
ATOM 8298  C C    . THR A 1 107 ? 4.790   -7.123  1.913   1.00 0.00 ? 107 THR A C    4  
ATOM 8299  O O    . THR A 1 107 ? 4.530   -8.147  2.512   1.00 0.00 ? 107 THR A O    4  
ATOM 8300  C CB   . THR A 1 107 ? 5.602   -7.149  -0.452  1.00 0.00 ? 107 THR A CB   4  
ATOM 8301  O OG1  . THR A 1 107 ? 5.512   -8.521  -0.810  1.00 0.00 ? 107 THR A OG1  4  
ATOM 8302  C CG2  . THR A 1 107 ? 6.628   -6.469  -1.351  1.00 0.00 ? 107 THR A CG2  4  
ATOM 8303  H H    . THR A 1 107 ? 6.727   -9.050  1.072   1.00 0.00 ? 107 THR A H    4  
ATOM 8304  H HA   . THR A 1 107 ? 6.512   -6.076  1.182   1.00 0.00 ? 107 THR A HA   4  
ATOM 8305  H HB   . THR A 1 107 ? 4.646   -6.679  -0.588  1.00 0.00 ? 107 THR A HB   4  
ATOM 8306  H HG1  . THR A 1 107 ? 5.081   -8.988  -0.097  1.00 0.00 ? 107 THR A HG1  4  
ATOM 8307  H HG21 . THR A 1 107 ? 7.621   -6.650  -0.963  1.00 0.00 ? 107 THR A HG21 4  
ATOM 8308  H HG22 . THR A 1 107 ? 6.554   -6.866  -2.350  1.00 0.00 ? 107 THR A HG22 4  
ATOM 8309  H HG23 . THR A 1 107 ? 6.440   -5.408  -1.369  1.00 0.00 ? 107 THR A HG23 4  
ATOM 8310  N N    . SER A 1 108 ? 4.031   -6.060  2.010   1.00 0.00 ? 108 SER A N    4  
ATOM 8311  C CA   . SER A 1 108 ? 2.802   -6.066  2.866   1.00 0.00 ? 108 SER A CA   4  
ATOM 8312  C C    . SER A 1 108 ? 2.248   -4.642  2.940   1.00 0.00 ? 108 SER A C    4  
ATOM 8313  O O    . SER A 1 108 ? 2.903   -3.702  2.533   1.00 0.00 ? 108 SER A O    4  
ATOM 8314  C CB   . SER A 1 108 ? 3.150   -6.531  4.285   1.00 0.00 ? 108 SER A CB   4  
ATOM 8315  O OG   . SER A 1 108 ? 4.451   -6.067  4.625   1.00 0.00 ? 108 SER A OG   4  
ATOM 8316  H H    . SER A 1 108 ? 4.271   -5.248  1.518   1.00 0.00 ? 108 SER A H    4  
ATOM 8317  H HA   . SER A 1 108 ? 2.066   -6.729  2.442   1.00 0.00 ? 108 SER A HA   4  
ATOM 8318  H HB2  . SER A 1 108 ? 2.437   -6.127  4.984   1.00 0.00 ? 108 SER A HB2  4  
ATOM 8319  H HB3  . SER A 1 108 ? 3.120   -7.611  4.327   1.00 0.00 ? 108 SER A HB3  4  
ATOM 8320  H HG   . SER A 1 108 ? 4.614   -6.290  5.544   1.00 0.00 ? 108 SER A HG   4  
ATOM 8321  N N    . TRP A 1 109 ? 1.072   -4.464  3.495   1.00 0.00 ? 109 TRP A N    4  
ATOM 8322  C CA   . TRP A 1 109 ? 0.523   -3.081  3.640   1.00 0.00 ? 109 TRP A CA   4  
ATOM 8323  C C    . TRP A 1 109 ? -0.594  -3.071  4.651   1.00 0.00 ? 109 TRP A C    4  
ATOM 8324  O O    . TRP A 1 109 ? -1.376  -3.998  4.745   1.00 0.00 ? 109 TRP A O    4  
ATOM 8325  C CB   . TRP A 1 109 ? 0.054   -2.468  2.301   1.00 0.00 ? 109 TRP A CB   4  
ATOM 8326  C CG   . TRP A 1 109 ? -1.157  -3.106  1.683   1.00 0.00 ? 109 TRP A CG   4  
ATOM 8327  C CD1  . TRP A 1 109 ? -1.139  -3.720  0.481   1.00 0.00 ? 109 TRP A CD1  4  
ATOM 8328  C CD2  . TRP A 1 109 ? -2.559  -3.134  2.134   1.00 0.00 ? 109 TRP A CD2  4  
ATOM 8329  N NE1  . TRP A 1 109 ? -2.417  -4.134  0.159   1.00 0.00 ? 109 TRP A NE1  4  
ATOM 8330  C CE2  . TRP A 1 109 ? -3.328  -3.804  1.142   1.00 0.00 ? 109 TRP A CE2  4  
ATOM 8331  C CE3  . TRP A 1 109 ? -3.241  -2.668  3.287   1.00 0.00 ? 109 TRP A CE3  4  
ATOM 8332  C CZ2  . TRP A 1 109 ? -4.705  -3.996  1.285   1.00 0.00 ? 109 TRP A CZ2  4  
ATOM 8333  C CZ3  . TRP A 1 109 ? -4.621  -2.868  3.424   1.00 0.00 ? 109 TRP A CZ3  4  
ATOM 8334  C CH2  . TRP A 1 109 ? -5.347  -3.528  2.427   1.00 0.00 ? 109 TRP A CH2  4  
ATOM 8335  H H    . TRP A 1 109 ? 0.574   -5.232  3.855   1.00 0.00 ? 109 TRP A H    4  
ATOM 8336  H HA   . TRP A 1 109 ? 1.315   -2.458  4.028   1.00 0.00 ? 109 TRP A HA   4  
ATOM 8337  H HB2  . TRP A 1 109 ? -0.188  -1.442  2.468   1.00 0.00 ? 109 TRP A HB2  4  
ATOM 8338  H HB3  . TRP A 1 109 ? 0.869   -2.516  1.600   1.00 0.00 ? 109 TRP A HB3  4  
ATOM 8339  H HD1  . TRP A 1 109 ? -0.260  -3.863  -0.130  1.00 0.00 ? 109 TRP A HD1  4  
ATOM 8340  H HE1  . TRP A 1 109 ? -2.667  -4.610  -0.660  1.00 0.00 ? 109 TRP A HE1  4  
ATOM 8341  H HE3  . TRP A 1 109 ? -2.705  -2.158  4.072   1.00 0.00 ? 109 TRP A HE3  4  
ATOM 8342  H HZ2  . TRP A 1 109 ? -5.274  -4.501  0.512   1.00 0.00 ? 109 TRP A HZ2  4  
ATOM 8343  H HZ3  . TRP A 1 109 ? -5.129  -2.508  4.307   1.00 0.00 ? 109 TRP A HZ3  4  
ATOM 8344  H HH2  . TRP A 1 109 ? -6.403  -3.681  2.547   1.00 0.00 ? 109 TRP A HH2  4  
ATOM 8345  N N    . THR A 1 110 ? -0.665  -2.020  5.427   1.00 0.00 ? 110 THR A N    4  
ATOM 8346  C CA   . THR A 1 110 ? -1.734  -1.932  6.456   1.00 0.00 ? 110 THR A CA   4  
ATOM 8347  C C    . THR A 1 110 ? -2.448  -0.589  6.364   1.00 0.00 ? 110 THR A C    4  
ATOM 8348  O O    . THR A 1 110 ? -1.894  0.450   6.650   1.00 0.00 ? 110 THR A O    4  
ATOM 8349  C CB   . THR A 1 110 ? -1.136  -2.098  7.849   1.00 0.00 ? 110 THR A CB   4  
ATOM 8350  O OG1  . THR A 1 110 ? -0.411  -0.927  8.198   1.00 0.00 ? 110 THR A OG1  4  
ATOM 8351  C CG2  . THR A 1 110 ? -0.204  -3.309  7.874   1.00 0.00 ? 110 THR A CG2  4  
ATOM 8352  H H    . THR A 1 110 ? -0.003  -1.295  5.334   1.00 0.00 ? 110 THR A H    4  
ATOM 8353  H HA   . THR A 1 110 ? -2.450  -2.716  6.282   1.00 0.00 ? 110 THR A HA   4  
ATOM 8354  H HB   . THR A 1 110 ? -1.934  -2.252  8.552   1.00 0.00 ? 110 THR A HB   4  
ATOM 8355  H HG1  . THR A 1 110 ? -0.301  -0.920  9.152   1.00 0.00 ? 110 THR A HG1  4  
ATOM 8356  H HG21 . THR A 1 110 ? -0.670  -4.131  7.349   1.00 0.00 ? 110 THR A HG21 4  
ATOM 8357  H HG22 . THR A 1 110 ? 0.727   -3.055  7.390   1.00 0.00 ? 110 THR A HG22 4  
ATOM 8358  H HG23 . THR A 1 110 ? -0.014  -3.596  8.896   1.00 0.00 ? 110 THR A HG23 4  
ATOM 8359  N N    . ARG A 1 111 ? -3.689  -0.626  5.984   1.00 0.00 ? 111 ARG A N    4  
ATOM 8360  C CA   . ARG A 1 111 ? -4.495  0.629   5.873   1.00 0.00 ? 111 ARG A CA   4  
ATOM 8361  C C    . ARG A 1 111 ? -5.145  0.900   7.224   1.00 0.00 ? 111 ARG A C    4  
ATOM 8362  O O    . ARG A 1 111 ? -5.811  0.051   7.759   1.00 0.00 ? 111 ARG A O    4  
ATOM 8363  C CB   . ARG A 1 111 ? -5.579  0.437   4.804   1.00 0.00 ? 111 ARG A CB   4  
ATOM 8364  C CG   . ARG A 1 111 ? -4.969  0.594   3.410   1.00 0.00 ? 111 ARG A CG   4  
ATOM 8365  C CD   . ARG A 1 111 ? -6.060  0.438   2.347   1.00 0.00 ? 111 ARG A CD   4  
ATOM 8366  N NE   . ARG A 1 111 ? -5.838  1.430   1.258   1.00 0.00 ? 111 ARG A NE   4  
ATOM 8367  C CZ   . ARG A 1 111 ? -6.124  2.688   1.454   1.00 0.00 ? 111 ARG A CZ   4  
ATOM 8368  N NH1  . ARG A 1 111 ? -7.265  3.021   1.992   1.00 0.00 ? 111 ARG A NH1  4  
ATOM 8369  N NH2  . ARG A 1 111 ? -5.269  3.613   1.112   1.00 0.00 ? 111 ARG A NH2  4  
ATOM 8370  H H    . ARG A 1 111 ? -4.101  -1.494  5.786   1.00 0.00 ? 111 ARG A H    4  
ATOM 8371  H HA   . ARG A 1 111 ? -3.859  1.457   5.610   1.00 0.00 ? 111 ARG A HA   4  
ATOM 8372  H HB2  . ARG A 1 111 ? -6.006  -0.552  4.897   1.00 0.00 ? 111 ARG A HB2  4  
ATOM 8373  H HB3  . ARG A 1 111 ? -6.352  1.176   4.937   1.00 0.00 ? 111 ARG A HB3  4  
ATOM 8374  H HG2  . ARG A 1 111 ? -4.519  1.573   3.323   1.00 0.00 ? 111 ARG A HG2  4  
ATOM 8375  H HG3  . ARG A 1 111 ? -4.214  -0.163  3.261   1.00 0.00 ? 111 ARG A HG3  4  
ATOM 8376  H HD2  . ARG A 1 111 ? -6.023  -0.561  1.937   1.00 0.00 ? 111 ARG A HD2  4  
ATOM 8377  H HD3  . ARG A 1 111 ? -7.029  0.607   2.795   1.00 0.00 ? 111 ARG A HD3  4  
ATOM 8378  H HE   . ARG A 1 111 ? -5.477  1.138   0.395   1.00 0.00 ? 111 ARG A HE   4  
ATOM 8379  H HH11 . ARG A 1 111 ? -7.921  2.313   2.254   1.00 0.00 ? 111 ARG A HH11 4  
ATOM 8380  H HH12 . ARG A 1 111 ? -7.485  3.985   2.142   1.00 0.00 ? 111 ARG A HH12 4  
ATOM 8381  H HH21 . ARG A 1 111 ? -4.395  3.357   0.699   1.00 0.00 ? 111 ARG A HH21 4  
ATOM 8382  H HH22 . ARG A 1 111 ? -5.489  4.577   1.262   1.00 0.00 ? 111 ARG A HH22 4  
ATOM 8383  N N    . GLU A 1 112 ? -4.959  2.065   7.791   1.00 0.00 ? 112 GLU A N    4  
ATOM 8384  C CA   . GLU A 1 112 ? -5.581  2.336   9.122   1.00 0.00 ? 112 GLU A CA   4  
ATOM 8385  C C    . GLU A 1 112 ? -6.351  3.647   9.085   1.00 0.00 ? 112 GLU A C    4  
ATOM 8386  O O    . GLU A 1 112 ? -6.021  4.551   8.352   1.00 0.00 ? 112 GLU A O    4  
ATOM 8387  C CB   . GLU A 1 112 ? -4.496  2.404   10.199  1.00 0.00 ? 112 GLU A CB   4  
ATOM 8388  C CG   . GLU A 1 112 ? -5.152  2.487   11.579  1.00 0.00 ? 112 GLU A CG   4  
ATOM 8389  C CD   . GLU A 1 112 ? -4.072  2.473   12.664  1.00 0.00 ? 112 GLU A CD   4  
ATOM 8390  O OE1  . GLU A 1 112 ? -3.053  1.835   12.453  1.00 0.00 ? 112 GLU A OE1  4  
ATOM 8391  O OE2  . GLU A 1 112 ? -4.283  3.100   13.689  1.00 0.00 ? 112 GLU A OE2  4  
ATOM 8392  H H    . GLU A 1 112 ? -4.415  2.752   7.350   1.00 0.00 ? 112 GLU A H    4  
ATOM 8393  H HA   . GLU A 1 112 ? -6.267  1.536   9.359   1.00 0.00 ? 112 GLU A HA   4  
ATOM 8394  H HB2  . GLU A 1 112 ? -3.877  1.522   10.143  1.00 0.00 ? 112 GLU A HB2  4  
ATOM 8395  H HB3  . GLU A 1 112 ? -3.888  3.275   10.042  1.00 0.00 ? 112 GLU A HB3  4  
ATOM 8396  H HG2  . GLU A 1 112 ? -5.722  3.402   11.651  1.00 0.00 ? 112 GLU A HG2  4  
ATOM 8397  H HG3  . GLU A 1 112 ? -5.810  1.643   11.717  1.00 0.00 ? 112 GLU A HG3  4  
ATOM 8398  N N    . LEU A 1 113 ? -7.384  3.739   9.873   1.00 0.00 ? 113 LEU A N    4  
ATOM 8399  C CA   . LEU A 1 113 ? -8.216  4.972   9.914   1.00 0.00 ? 113 LEU A CA   4  
ATOM 8400  C C    . LEU A 1 113 ? -7.958  5.697   11.239  1.00 0.00 ? 113 LEU A C    4  
ATOM 8401  O O    . LEU A 1 113 ? -7.395  5.130   12.157  1.00 0.00 ? 113 LEU A O    4  
ATOM 8402  C CB   . LEU A 1 113 ? -9.688  4.548   9.834   1.00 0.00 ? 113 LEU A CB   4  
ATOM 8403  C CG   . LEU A 1 113 ? -10.152 4.344   8.382   1.00 0.00 ? 113 LEU A CG   4  
ATOM 8404  C CD1  . LEU A 1 113 ? -10.396 5.693   7.726   1.00 0.00 ? 113 LEU A CD1  4  
ATOM 8405  C CD2  . LEU A 1 113 ? -9.117  3.559   7.576   1.00 0.00 ? 113 LEU A CD2  4  
ATOM 8406  H H    . LEU A 1 113 ? -7.623  2.981   10.444  1.00 0.00 ? 113 LEU A H    4  
ATOM 8407  H HA   . LEU A 1 113 ? -7.971  5.615   9.083   1.00 0.00 ? 113 LEU A HA   4  
ATOM 8408  H HB2  . LEU A 1 113 ? -9.802  3.620   10.356  1.00 0.00 ? 113 LEU A HB2  4  
ATOM 8409  H HB3  . LEU A 1 113 ? -10.303 5.301   10.304  1.00 0.00 ? 113 LEU A HB3  4  
ATOM 8410  H HG   . LEU A 1 113 ? -11.074 3.791   8.387   1.00 0.00 ? 113 LEU A HG   4  
ATOM 8411  H HD11 . LEU A 1 113 ? -9.553  6.337   7.898   1.00 0.00 ? 113 LEU A HD11 4  
ATOM 8412  H HD12 . LEU A 1 113 ? -10.536 5.552   6.666   1.00 0.00 ? 113 LEU A HD12 4  
ATOM 8413  H HD13 . LEU A 1 113 ? -11.287 6.137   8.147   1.00 0.00 ? 113 LEU A HD13 4  
ATOM 8414  H HD21 . LEU A 1 113 ? -8.924  2.614   8.062   1.00 0.00 ? 113 LEU A HD21 4  
ATOM 8415  H HD22 . LEU A 1 113 ? -9.499  3.384   6.585   1.00 0.00 ? 113 LEU A HD22 4  
ATOM 8416  H HD23 . LEU A 1 113 ? -8.206  4.125   7.517   1.00 0.00 ? 113 LEU A HD23 4  
ATOM 8417  N N    . THR A 1 114 ? -8.362  6.938   11.350  1.00 0.00 ? 114 THR A N    4  
ATOM 8418  C CA   . THR A 1 114 ? -8.134  7.685   12.625  1.00 0.00 ? 114 THR A CA   4  
ATOM 8419  C C    . THR A 1 114 ? -9.112  8.859   12.726  1.00 0.00 ? 114 THR A C    4  
ATOM 8420  O O    . THR A 1 114 ? -9.298  9.608   11.788  1.00 0.00 ? 114 THR A O    4  
ATOM 8421  C CB   . THR A 1 114 ? -6.694  8.214   12.666  1.00 0.00 ? 114 THR A CB   4  
ATOM 8422  O OG1  . THR A 1 114 ? -5.879  7.453   11.785  1.00 0.00 ? 114 THR A OG1  4  
ATOM 8423  C CG2  . THR A 1 114 ? -6.146  8.103   14.090  1.00 0.00 ? 114 THR A CG2  4  
ATOM 8424  H H    . THR A 1 114 ? -8.814  7.376   10.598  1.00 0.00 ? 114 THR A H    4  
ATOM 8425  H HA   . THR A 1 114 ? -8.293  7.018   13.459  1.00 0.00 ? 114 THR A HA   4  
ATOM 8426  H HB   . THR A 1 114 ? -6.681  9.249   12.363  1.00 0.00 ? 114 THR A HB   4  
ATOM 8427  H HG1  . THR A 1 114 ? -5.204  8.034   11.427  1.00 0.00 ? 114 THR A HG1  4  
ATOM 8428  H HG21 . THR A 1 114 ? -6.183  7.072   14.410  1.00 0.00 ? 114 THR A HG21 4  
ATOM 8429  H HG22 . THR A 1 114 ? -5.124  8.450   14.112  1.00 0.00 ? 114 THR A HG22 4  
ATOM 8430  H HG23 . THR A 1 114 ? -6.746  8.707   14.755  1.00 0.00 ? 114 THR A HG23 4  
ATOM 8431  N N    . ASN A 1 115 ? -9.732  9.017   13.867  1.00 0.00 ? 115 ASN A N    4  
ATOM 8432  C CA   . ASN A 1 115 ? -10.702 10.135  14.068  1.00 0.00 ? 115 ASN A CA   4  
ATOM 8433  C C    . ASN A 1 115 ? -11.858 10.010  13.061  1.00 0.00 ? 115 ASN A C    4  
ATOM 8434  O O    . ASN A 1 115 ? -12.857 9.375   13.342  1.00 0.00 ? 115 ASN A O    4  
ATOM 8435  C CB   . ASN A 1 115 ? -9.979  11.479  13.905  1.00 0.00 ? 115 ASN A CB   4  
ATOM 8436  C CG   . ASN A 1 115 ? -9.356  11.888  15.241  1.00 0.00 ? 115 ASN A CG   4  
ATOM 8437  O OD1  . ASN A 1 115 ? -9.960  11.723  16.282  1.00 0.00 ? 115 ASN A OD1  4  
ATOM 8438  N ND2  . ASN A 1 115 ? -8.164  12.419  15.256  1.00 0.00 ? 115 ASN A ND2  4  
ATOM 8439  H H    . ASN A 1 115 ? -9.555  8.396   14.601  1.00 0.00 ? 115 ASN A H    4  
ATOM 8440  H HA   . ASN A 1 115 ? -11.105 10.072  15.067  1.00 0.00 ? 115 ASN A HA   4  
ATOM 8441  H HB2  . ASN A 1 115 ? -9.203  11.382  13.159  1.00 0.00 ? 115 ASN A HB2  4  
ATOM 8442  H HB3  . ASN A 1 115 ? -10.686 12.233  13.593  1.00 0.00 ? 115 ASN A HB3  4  
ATOM 8443  H HD21 . ASN A 1 115 ? -7.676  12.552  14.417  1.00 0.00 ? 115 ASN A HD21 4  
ATOM 8444  H HD22 . ASN A 1 115 ? -7.756  12.684  16.107  1.00 0.00 ? 115 ASN A HD22 4  
ATOM 8445  N N    . ASP A 1 116 ? -11.738 10.605  11.897  1.00 0.00 ? 116 ASP A N    4  
ATOM 8446  C CA   . ASP A 1 116 ? -12.833 10.514  10.889  1.00 0.00 ? 116 ASP A CA   4  
ATOM 8447  C C    . ASP A 1 116 ? -12.354 11.113  9.567   1.00 0.00 ? 116 ASP A C    4  
ATOM 8448  O O    . ASP A 1 116 ? -13.118 11.717  8.838   1.00 0.00 ? 116 ASP A O    4  
ATOM 8449  C CB   . ASP A 1 116 ? -14.048 11.295  11.386  1.00 0.00 ? 116 ASP A CB   4  
ATOM 8450  C CG   . ASP A 1 116 ? -15.323 10.685  10.802  1.00 0.00 ? 116 ASP A CG   4  
ATOM 8451  O OD1  . ASP A 1 116 ? -15.757 9.666   11.314  1.00 0.00 ? 116 ASP A OD1  4  
ATOM 8452  O OD2  . ASP A 1 116 ? -15.845 11.246  9.853   1.00 0.00 ? 116 ASP A OD2  4  
ATOM 8453  H H    . ASP A 1 116 ? -10.929 11.113  11.688  1.00 0.00 ? 116 ASP A H    4  
ATOM 8454  H HA   . ASP A 1 116 ? -13.103 9.479   10.740  1.00 0.00 ? 116 ASP A HA   4  
ATOM 8455  H HB2  . ASP A 1 116 ? -14.087 11.251  12.465  1.00 0.00 ? 116 ASP A HB2  4  
ATOM 8456  H HB3  . ASP A 1 116 ? -13.965 12.323  11.069  1.00 0.00 ? 116 ASP A HB3  4  
ATOM 8457  N N    . GLY A 1 117 ? -11.093 10.951  9.257   1.00 0.00 ? 117 GLY A N    4  
ATOM 8458  C CA   . GLY A 1 117 ? -10.557 11.511  7.981   1.00 0.00 ? 117 GLY A CA   4  
ATOM 8459  C C    . GLY A 1 117 ? -9.031  11.546  8.029   1.00 0.00 ? 117 GLY A C    4  
ATOM 8460  O O    . GLY A 1 117 ? -8.407  12.496  7.598   1.00 0.00 ? 117 GLY A O    4  
ATOM 8461  H H    . GLY A 1 117 ? -10.501 10.458  9.865   1.00 0.00 ? 117 GLY A H    4  
ATOM 8462  H HA2  . GLY A 1 117 ? -10.876 10.891  7.156   1.00 0.00 ? 117 GLY A HA2  4  
ATOM 8463  H HA3  . GLY A 1 117 ? -10.930 12.510  7.842   1.00 0.00 ? 117 GLY A HA3  4  
ATOM 8464  N N    . GLU A 1 118 ? -8.430  10.510  8.538   1.00 0.00 ? 118 GLU A N    4  
ATOM 8465  C CA   . GLU A 1 118 ? -6.943  10.455  8.606   1.00 0.00 ? 118 GLU A CA   4  
ATOM 8466  C C    . GLU A 1 118 ? -6.512  9.009   8.356   1.00 0.00 ? 118 GLU A C    4  
ATOM 8467  O O    . GLU A 1 118 ? -6.105  8.299   9.257   1.00 0.00 ? 118 GLU A O    4  
ATOM 8468  C CB   . GLU A 1 118 ? -6.467  10.918  9.986   1.00 0.00 ? 118 GLU A CB   4  
ATOM 8469  C CG   . GLU A 1 118 ? -5.183  11.738  9.838   1.00 0.00 ? 118 GLU A CG   4  
ATOM 8470  C CD   . GLU A 1 118 ? -5.103  12.769  10.964  1.00 0.00 ? 118 GLU A CD   4  
ATOM 8471  O OE1  . GLU A 1 118 ? -5.794  13.771  10.874  1.00 0.00 ? 118 GLU A OE1  4  
ATOM 8472  O OE2  . GLU A 1 118 ? -4.351  12.541  11.898  1.00 0.00 ? 118 GLU A OE2  4  
ATOM 8473  H H    . GLU A 1 118 ? -8.960  9.756   8.867   1.00 0.00 ? 118 GLU A H    4  
ATOM 8474  H HA   . GLU A 1 118 ? -6.529  11.097  7.840   1.00 0.00 ? 118 GLU A HA   4  
ATOM 8475  H HB2  . GLU A 1 118 ? -7.233  11.528  10.443  1.00 0.00 ? 118 GLU A HB2  4  
ATOM 8476  H HB3  . GLU A 1 118 ? -6.273  10.060  10.608  1.00 0.00 ? 118 GLU A HB3  4  
ATOM 8477  H HG2  . GLU A 1 118 ? -4.328  11.079  9.890   1.00 0.00 ? 118 GLU A HG2  4  
ATOM 8478  H HG3  . GLU A 1 118 ? -5.189  12.246  8.886   1.00 0.00 ? 118 GLU A HG3  4  
ATOM 8479  N N    . LEU A 1 119 ? -6.635  8.566   7.135   1.00 0.00 ? 119 LEU A N    4  
ATOM 8480  C CA   . LEU A 1 119 ? -6.281  7.161   6.794   1.00 0.00 ? 119 LEU A CA   4  
ATOM 8481  C C    . LEU A 1 119 ? -4.769  7.014   6.580   1.00 0.00 ? 119 LEU A C    4  
ATOM 8482  O O    . LEU A 1 119 ? -4.249  7.377   5.547   1.00 0.00 ? 119 LEU A O    4  
ATOM 8483  C CB   . LEU A 1 119 ? -7.018  6.779   5.508   1.00 0.00 ? 119 LEU A CB   4  
ATOM 8484  C CG   . LEU A 1 119 ? -7.029  5.258   5.336   1.00 0.00 ? 119 LEU A CG   4  
ATOM 8485  C CD1  . LEU A 1 119 ? -8.384  4.810   4.781   1.00 0.00 ? 119 LEU A CD1  4  
ATOM 8486  C CD2  . LEU A 1 119 ? -5.928  4.850   4.361   1.00 0.00 ? 119 LEU A CD2  4  
ATOM 8487  H H    . LEU A 1 119 ? -6.991  9.158   6.439   1.00 0.00 ? 119 LEU A H    4  
ATOM 8488  H HA   . LEU A 1 119 ? -6.598  6.512   7.591   1.00 0.00 ? 119 LEU A HA   4  
ATOM 8489  H HB2  . LEU A 1 119 ? -8.031  7.143   5.561   1.00 0.00 ? 119 LEU A HB2  4  
ATOM 8490  H HB3  . LEU A 1 119 ? -6.521  7.230   4.666   1.00 0.00 ? 119 LEU A HB3  4  
ATOM 8491  H HG   . LEU A 1 119 ? -6.859  4.787   6.289   1.00 0.00 ? 119 LEU A HG   4  
ATOM 8492  H HD11 . LEU A 1 119 ? -9.173  5.322   5.306   1.00 0.00 ? 119 LEU A HD11 4  
ATOM 8493  H HD12 . LEU A 1 119 ? -8.440  5.048   3.729   1.00 0.00 ? 119 LEU A HD12 4  
ATOM 8494  H HD13 . LEU A 1 119 ? -8.495  3.744   4.915   1.00 0.00 ? 119 LEU A HD13 4  
ATOM 8495  H HD21 . LEU A 1 119 ? -5.023  5.388   4.598   1.00 0.00 ? 119 LEU A HD21 4  
ATOM 8496  H HD22 . LEU A 1 119 ? -5.750  3.789   4.445   1.00 0.00 ? 119 LEU A HD22 4  
ATOM 8497  H HD23 . LEU A 1 119 ? -6.237  5.086   3.354   1.00 0.00 ? 119 LEU A HD23 4  
ATOM 8498  N N    . ILE A 1 120 ? -4.063  6.461   7.536   1.00 0.00 ? 120 ILE A N    4  
ATOM 8499  C CA   . ILE A 1 120 ? -2.588  6.271   7.356   1.00 0.00 ? 120 ILE A CA   4  
ATOM 8500  C C    . ILE A 1 120 ? -2.355  4.890   6.745   1.00 0.00 ? 120 ILE A C    4  
ATOM 8501  O O    . ILE A 1 120 ? -2.595  3.878   7.366   1.00 0.00 ? 120 ILE A O    4  
ATOM 8502  C CB   . ILE A 1 120 ? -1.870  6.412   8.703   1.00 0.00 ? 120 ILE A CB   4  
ATOM 8503  C CG1  . ILE A 1 120 ? -2.337  5.324   9.674   1.00 0.00 ? 120 ILE A CG1  4  
ATOM 8504  C CG2  . ILE A 1 120 ? -2.202  7.781   9.287   1.00 0.00 ? 120 ILE A CG2  4  
ATOM 8505  C CD1  . ILE A 1 120 ? -1.297  4.202   9.721   1.00 0.00 ? 120 ILE A CD1  4  
ATOM 8506  H H    . ILE A 1 120 ? -4.505  6.152   8.358   1.00 0.00 ? 120 ILE A H    4  
ATOM 8507  H HA   . ILE A 1 120 ? -2.218  7.020   6.671   1.00 0.00 ? 120 ILE A HA   4  
ATOM 8508  H HB   . ILE A 1 120 ? -0.803  6.336   8.551   1.00 0.00 ? 120 ILE A HB   4  
ATOM 8509  H HG12 . ILE A 1 120 ? -2.458  5.745   10.663  1.00 0.00 ? 120 ILE A HG12 4  
ATOM 8510  H HG13 . ILE A 1 120 ? -3.278  4.927   9.335   1.00 0.00 ? 120 ILE A HG13 4  
ATOM 8511  H HG21 . ILE A 1 120 ? -2.328  8.491   8.483   1.00 0.00 ? 120 ILE A HG21 4  
ATOM 8512  H HG22 . ILE A 1 120 ? -3.118  7.713   9.855   1.00 0.00 ? 120 ILE A HG22 4  
ATOM 8513  H HG23 . ILE A 1 120 ? -1.399  8.100   9.931   1.00 0.00 ? 120 ILE A HG23 4  
ATOM 8514  H HD11 . ILE A 1 120 ? -0.767  4.165   8.780   1.00 0.00 ? 120 ILE A HD11 4  
ATOM 8515  H HD12 . ILE A 1 120 ? -0.598  4.392   10.521  1.00 0.00 ? 120 ILE A HD12 4  
ATOM 8516  H HD13 . ILE A 1 120 ? -1.793  3.258   9.892   1.00 0.00 ? 120 ILE A HD13 4  
ATOM 8517  N N    . LEU A 1 121 ? -1.934  4.850   5.512   1.00 0.00 ? 121 LEU A N    4  
ATOM 8518  C CA   . LEU A 1 121 ? -1.741  3.547   4.824   1.00 0.00 ? 121 LEU A CA   4  
ATOM 8519  C C    . LEU A 1 121 ? -0.246  3.269   4.577   1.00 0.00 ? 121 LEU A C    4  
ATOM 8520  O O    . LEU A 1 121 ? 0.432   3.978   3.858   1.00 0.00 ? 121 LEU A O    4  
ATOM 8521  C CB   . LEU A 1 121 ? -2.551  3.599   3.505   1.00 0.00 ? 121 LEU A CB   4  
ATOM 8522  C CG   . LEU A 1 121 ? -2.245  2.426   2.551   1.00 0.00 ? 121 LEU A CG   4  
ATOM 8523  C CD1  . LEU A 1 121 ? -0.989  2.741   1.743   1.00 0.00 ? 121 LEU A CD1  4  
ATOM 8524  C CD2  . LEU A 1 121 ? -2.033  1.122   3.320   1.00 0.00 ? 121 LEU A CD2  4  
ATOM 8525  H H    . LEU A 1 121 ? -1.779  5.680   5.027   1.00 0.00 ? 121 LEU A H    4  
ATOM 8526  H HA   . LEU A 1 121 ? -2.142  2.761   5.445   1.00 0.00 ? 121 LEU A HA   4  
ATOM 8527  H HB2  . LEU A 1 121 ? -3.604  3.577   3.746   1.00 0.00 ? 121 LEU A HB2  4  
ATOM 8528  H HB3  . LEU A 1 121 ? -2.333  4.528   3.000   1.00 0.00 ? 121 LEU A HB3  4  
ATOM 8529  H HG   . LEU A 1 121 ? -3.080  2.305   1.874   1.00 0.00 ? 121 LEU A HG   4  
ATOM 8530  H HD11 . LEU A 1 121 ? -0.880  3.811   1.652   1.00 0.00 ? 121 LEU A HD11 4  
ATOM 8531  H HD12 . LEU A 1 121 ? -0.126  2.333   2.249   1.00 0.00 ? 121 LEU A HD12 4  
ATOM 8532  H HD13 . LEU A 1 121 ? -1.074  2.300   0.761   1.00 0.00 ? 121 LEU A HD13 4  
ATOM 8533  H HD21 . LEU A 1 121 ? -2.667  1.110   4.186   1.00 0.00 ? 121 LEU A HD21 4  
ATOM 8534  H HD22 . LEU A 1 121 ? -2.270  0.284   2.684   1.00 0.00 ? 121 LEU A HD22 4  
ATOM 8535  H HD23 . LEU A 1 121 ? -1.011  1.062   3.628   1.00 0.00 ? 121 LEU A HD23 4  
ATOM 8536  N N    . THR A 1 122 ? 0.248   2.213   5.177   1.00 0.00 ? 122 THR A N    4  
ATOM 8537  C CA   . THR A 1 122 ? 1.676   1.806   5.017   1.00 0.00 ? 122 THR A CA   4  
ATOM 8538  C C    . THR A 1 122 ? 1.754   0.685   3.982   1.00 0.00 ? 122 THR A C    4  
ATOM 8539  O O    . THR A 1 122 ? 0.795   -0.010  3.749   1.00 0.00 ? 122 THR A O    4  
ATOM 8540  C CB   . THR A 1 122 ? 2.181   1.246   6.339   1.00 0.00 ? 122 THR A CB   4  
ATOM 8541  O OG1  . THR A 1 122 ? 1.942   2.181   7.381   1.00 0.00 ? 122 THR A OG1  4  
ATOM 8542  C CG2  . THR A 1 122 ? 3.674   0.946   6.240   1.00 0.00 ? 122 THR A CG2  4  
ATOM 8543  H H    . THR A 1 122 ? -0.337  1.671   5.737   1.00 0.00 ? 122 THR A H    4  
ATOM 8544  H HA   . THR A 1 122 ? 2.285   2.641   4.718   1.00 0.00 ? 122 THR A HA   4  
ATOM 8545  H HB   . THR A 1 122 ? 1.659   0.331   6.544   1.00 0.00 ? 122 THR A HB   4  
ATOM 8546  H HG1  . THR A 1 122 ? 2.169   1.761   8.214   1.00 0.00 ? 122 THR A HG1  4  
ATOM 8547  H HG21 . THR A 1 122 ? 4.122   1.596   5.504   1.00 0.00 ? 122 THR A HG21 4  
ATOM 8548  H HG22 . THR A 1 122 ? 4.137   1.109   7.200   1.00 0.00 ? 122 THR A HG22 4  
ATOM 8549  H HG23 . THR A 1 122 ? 3.811   -0.084  5.942   1.00 0.00 ? 122 THR A HG23 4  
ATOM 8550  N N    . MET A 1 123 ? 2.892   0.477   3.392   1.00 0.00 ? 123 MET A N    4  
ATOM 8551  C CA   . MET A 1 123 ? 3.021   -0.633  2.400   1.00 0.00 ? 123 MET A CA   4  
ATOM 8552  C C    . MET A 1 123 ? 4.488   -1.012  2.255   1.00 0.00 ? 123 MET A C    4  
ATOM 8553  O O    . MET A 1 123 ? 5.216   -0.434  1.471   1.00 0.00 ? 123 MET A O    4  
ATOM 8554  C CB   . MET A 1 123 ? 2.456   -0.202  1.048   1.00 0.00 ? 123 MET A CB   4  
ATOM 8555  C CG   . MET A 1 123 ? 2.452   -1.401  0.089   1.00 0.00 ? 123 MET A CG   4  
ATOM 8556  S SD   . MET A 1 123 ? 3.769   -1.221  -1.144  1.00 0.00 ? 123 MET A SD   4  
ATOM 8557  C CE   . MET A 1 123 ? 3.930   -2.974  -1.562  1.00 0.00 ? 123 MET A CE   4  
ATOM 8558  H H    . MET A 1 123 ? 3.667   1.032   3.618   1.00 0.00 ? 123 MET A H    4  
ATOM 8559  H HA   . MET A 1 123 ? 2.467   -1.489  2.760   1.00 0.00 ? 123 MET A HA   4  
ATOM 8560  H HB2  . MET A 1 123 ? 1.442   0.149   1.184   1.00 0.00 ? 123 MET A HB2  4  
ATOM 8561  H HB3  . MET A 1 123 ? 3.061   0.593   0.639   1.00 0.00 ? 123 MET A HB3  4  
ATOM 8562  H HG2  . MET A 1 123 ? 2.607   -2.314  0.650   1.00 0.00 ? 123 MET A HG2  4  
ATOM 8563  H HG3  . MET A 1 123 ? 1.497   -1.451  -0.407  1.00 0.00 ? 123 MET A HG3  4  
ATOM 8564  H HE1  . MET A 1 123 ? 4.125   -3.541  -0.662  1.00 0.00 ? 123 MET A HE1  4  
ATOM 8565  H HE2  . MET A 1 123 ? 3.014   -3.319  -2.021  1.00 0.00 ? 123 MET A HE2  4  
ATOM 8566  H HE3  . MET A 1 123 ? 4.748   -3.107  -2.251  1.00 0.00 ? 123 MET A HE3  4  
ATOM 8567  N N    . THR A 1 124 ? 4.925   -1.974  3.021   1.00 0.00 ? 124 THR A N    4  
ATOM 8568  C CA   . THR A 1 124 ? 6.357   -2.391  2.958   1.00 0.00 ? 124 THR A CA   4  
ATOM 8569  C C    . THR A 1 124 ? 6.639   -3.128  1.666   1.00 0.00 ? 124 THR A C    4  
ATOM 8570  O O    . THR A 1 124 ? 5.742   -3.497  0.931   1.00 0.00 ? 124 THR A O    4  
ATOM 8571  C CB   . THR A 1 124 ? 6.747   -3.291  4.154   1.00 0.00 ? 124 THR A CB   4  
ATOM 8572  O OG1  . THR A 1 124 ? 6.551   -4.664  3.831   1.00 0.00 ? 124 THR A OG1  4  
ATOM 8573  C CG2  . THR A 1 124 ? 5.925   -2.955  5.401   1.00 0.00 ? 124 THR A CG2  4  
ATOM 8574  H H    . THR A 1 124 ? 4.313   -2.410  3.646   1.00 0.00 ? 124 THR A H    4  
ATOM 8575  H HA   . THR A 1 124 ? 6.971   -1.512  2.968   1.00 0.00 ? 124 THR A HA   4  
ATOM 8576  H HB   . THR A 1 124 ? 7.787   -3.121  4.373   1.00 0.00 ? 124 THR A HB   4  
ATOM 8577  H HG1  . THR A 1 124 ? 7.311   -4.961  3.325   1.00 0.00 ? 124 THR A HG1  4  
ATOM 8578  H HG21 . THR A 1 124 ? 5.612   -1.923  5.357   1.00 0.00 ? 124 THR A HG21 4  
ATOM 8579  H HG22 . THR A 1 124 ? 5.056   -3.595  5.439   1.00 0.00 ? 124 THR A HG22 4  
ATOM 8580  H HG23 . THR A 1 124 ? 6.529   -3.113  6.281   1.00 0.00 ? 124 THR A HG23 4  
ATOM 8581  N N    . ALA A 1 125 ? 7.898   -3.347  1.396   1.00 0.00 ? 125 ALA A N    4  
ATOM 8582  C CA   . ALA A 1 125 ? 8.268   -4.070  0.149   1.00 0.00 ? 125 ALA A CA   4  
ATOM 8583  C C    . ALA A 1 125 ? 9.772   -4.326  0.062   1.00 0.00 ? 125 ALA A C    4  
ATOM 8584  O O    . ALA A 1 125 ? 10.544  -3.454  -0.279  1.00 0.00 ? 125 ALA A O    4  
ATOM 8585  C CB   . ALA A 1 125 ? 7.833   -3.253  -1.063  1.00 0.00 ? 125 ALA A CB   4  
ATOM 8586  H H    . ALA A 1 125 ? 8.591   -3.033  2.023   1.00 0.00 ? 125 ALA A H    4  
ATOM 8587  H HA   . ALA A 1 125 ? 7.758   -5.004  0.146   1.00 0.00 ? 125 ALA A HA   4  
ATOM 8588  H HB1  . ALA A 1 125 ? 7.911   -2.203  -0.832  1.00 0.00 ? 125 ALA A HB1  4  
ATOM 8589  H HB2  . ALA A 1 125 ? 8.472   -3.487  -1.900  1.00 0.00 ? 125 ALA A HB2  4  
ATOM 8590  H HB3  . ALA A 1 125 ? 6.811   -3.490  -1.308  1.00 0.00 ? 125 ALA A HB3  4  
ATOM 8591  N N    . ASP A 1 126 ? 10.195  -5.535  0.326   1.00 0.00 ? 126 ASP A N    4  
ATOM 8592  C CA   . ASP A 1 126 ? 11.652  -5.857  0.232   1.00 0.00 ? 126 ASP A CA   4  
ATOM 8593  C C    . ASP A 1 126 ? 12.419  -5.062  1.294   1.00 0.00 ? 126 ASP A C    4  
ATOM 8594  O O    . ASP A 1 126 ? 13.553  -4.678  1.088   1.00 0.00 ? 126 ASP A O    4  
ATOM 8595  C CB   . ASP A 1 126 ? 12.175  -5.494  -1.165  1.00 0.00 ? 126 ASP A CB   4  
ATOM 8596  C CG   . ASP A 1 126 ? 12.740  -6.740  -1.854  1.00 0.00 ? 126 ASP A CG   4  
ATOM 8597  O OD1  . ASP A 1 126 ? 11.982  -7.673  -2.063  1.00 0.00 ? 126 ASP A OD1  4  
ATOM 8598  O OD2  . ASP A 1 126 ? 13.921  -6.739  -2.161  1.00 0.00 ? 126 ASP A OD2  4  
ATOM 8599  H H    . ASP A 1 126 ? 9.552   -6.239  0.569   1.00 0.00 ? 126 ASP A H    4  
ATOM 8600  H HA   . ASP A 1 126 ? 11.790  -6.912  0.409   1.00 0.00 ? 126 ASP A HA   4  
ATOM 8601  H HB2  . ASP A 1 126 ? 11.361  -5.097  -1.751  1.00 0.00 ? 126 ASP A HB2  4  
ATOM 8602  H HB3  . ASP A 1 126 ? 12.951  -4.749  -1.078  1.00 0.00 ? 126 ASP A HB3  4  
ATOM 8603  N N    . ASP A 1 127 ? 11.783  -4.832  2.423   1.00 0.00 ? 127 ASP A N    4  
ATOM 8604  C CA   . ASP A 1 127 ? 12.390  -4.079  3.584   1.00 0.00 ? 127 ASP A CA   4  
ATOM 8605  C C    . ASP A 1 127 ? 12.047  -2.592  3.509   1.00 0.00 ? 127 ASP A C    4  
ATOM 8606  O O    . ASP A 1 127 ? 12.301  -1.856  4.446   1.00 0.00 ? 127 ASP A O    4  
ATOM 8607  C CB   . ASP A 1 127 ? 13.915  -4.246  3.655   1.00 0.00 ? 127 ASP A CB   4  
ATOM 8608  C CG   . ASP A 1 127 ? 14.384  -4.077  5.102   1.00 0.00 ? 127 ASP A CG   4  
ATOM 8609  O OD1  . ASP A 1 127 ? 14.224  -5.012  5.869   1.00 0.00 ? 127 ASP A OD1  4  
ATOM 8610  O OD2  . ASP A 1 127 ? 14.894  -3.015  5.418   1.00 0.00 ? 127 ASP A OD2  4  
ATOM 8611  H H    . ASP A 1 127 ? 10.873  -5.166  2.512   1.00 0.00 ? 127 ASP A H    4  
ATOM 8612  H HA   . ASP A 1 127 ? 11.960  -4.473  4.496   1.00 0.00 ? 127 ASP A HA   4  
ATOM 8613  H HB2  . ASP A 1 127 ? 14.185  -5.230  3.300   1.00 0.00 ? 127 ASP A HB2  4  
ATOM 8614  H HB3  . ASP A 1 127 ? 14.386  -3.499  3.036   1.00 0.00 ? 127 ASP A HB3  4  
ATOM 8615  N N    . VAL A 1 128 ? 11.457  -2.135  2.429   1.00 0.00 ? 128 VAL A N    4  
ATOM 8616  C CA   . VAL A 1 128 ? 11.094  -0.704  2.344   1.00 0.00 ? 128 VAL A CA   4  
ATOM 8617  C C    . VAL A 1 128 ? 9.759   -0.513  3.058   1.00 0.00 ? 128 VAL A C    4  
ATOM 8618  O O    . VAL A 1 128 ? 9.134   -1.467  3.472   1.00 0.00 ? 128 VAL A O    4  
ATOM 8619  C CB   . VAL A 1 128 ? 10.969  -0.288  0.866   1.00 0.00 ? 128 VAL A CB   4  
ATOM 8620  C CG1  . VAL A 1 128 ? 12.225  -0.705  0.096   1.00 0.00 ? 128 VAL A CG1  4  
ATOM 8621  C CG2  . VAL A 1 128 ? 9.750   -0.950  0.224   1.00 0.00 ? 128 VAL A CG2  4  
ATOM 8622  H H    . VAL A 1 128 ? 11.239  -2.731  1.685   1.00 0.00 ? 128 VAL A H    4  
ATOM 8623  H HA   . VAL A 1 128 ? 11.849  -0.105  2.830   1.00 0.00 ? 128 VAL A HA   4  
ATOM 8624  H HB   . VAL A 1 128 ? 10.855  0.772   0.815   1.00 0.00 ? 128 VAL A HB   4  
ATOM 8625  H HG11 . VAL A 1 128 ? 13.099  -0.483  0.683   1.00 0.00 ? 128 VAL A HG11 4  
ATOM 8626  H HG12 . VAL A 1 128 ? 12.187  -1.765  -0.106  1.00 0.00 ? 128 VAL A HG12 4  
ATOM 8627  H HG13 . VAL A 1 128 ? 12.272  -0.162  -0.836  1.00 0.00 ? 128 VAL A HG13 4  
ATOM 8628  H HG21 . VAL A 1 128 ? 9.493   -1.827  0.787   1.00 0.00 ? 128 VAL A HG21 4  
ATOM 8629  H HG22 . VAL A 1 128 ? 8.920   -0.261  0.233   1.00 0.00 ? 128 VAL A HG22 4  
ATOM 8630  H HG23 . VAL A 1 128 ? 9.979   -1.229  -0.793  1.00 0.00 ? 128 VAL A HG23 4  
ATOM 8631  N N    . VAL A 1 129 ? 9.317   0.701   3.179   1.00 0.00 ? 129 VAL A N    4  
ATOM 8632  C CA   . VAL A 1 129 ? 8.009   0.958   3.830   1.00 0.00 ? 129 VAL A CA   4  
ATOM 8633  C C    . VAL A 1 129 ? 7.460   2.299   3.345   1.00 0.00 ? 129 VAL A C    4  
ATOM 8634  O O    . VAL A 1 129 ? 8.029   3.349   3.575   1.00 0.00 ? 129 VAL A O    4  
ATOM 8635  C CB   . VAL A 1 129 ? 8.168   0.880   5.370   1.00 0.00 ? 129 VAL A CB   4  
ATOM 8636  C CG1  . VAL A 1 129 ? 7.341   1.961   6.102   1.00 0.00 ? 129 VAL A CG1  4  
ATOM 8637  C CG2  . VAL A 1 129 ? 7.704   -0.510  5.838   1.00 0.00 ? 129 VAL A CG2  4  
ATOM 8638  H H    . VAL A 1 129 ? 9.840   1.440   2.825   1.00 0.00 ? 129 VAL A H    4  
ATOM 8639  H HA   . VAL A 1 129 ? 7.324   0.192   3.515   1.00 0.00 ? 129 VAL A HA   4  
ATOM 8640  H HB   . VAL A 1 129 ? 9.210   0.998   5.614   1.00 0.00 ? 129 VAL A HB   4  
ATOM 8641  H HG11 . VAL A 1 129 ? 6.355   2.018   5.662   1.00 0.00 ? 129 VAL A HG11 4  
ATOM 8642  H HG12 . VAL A 1 129 ? 7.254   1.707   7.146   1.00 0.00 ? 129 VAL A HG12 4  
ATOM 8643  H HG13 . VAL A 1 129 ? 7.831   2.919   6.002   1.00 0.00 ? 129 VAL A HG13 4  
ATOM 8644  H HG21 . VAL A 1 129 ? 7.565   -1.148  4.980   1.00 0.00 ? 129 VAL A HG21 4  
ATOM 8645  H HG22 . VAL A 1 129 ? 8.451   -0.943  6.483   1.00 0.00 ? 129 VAL A HG22 4  
ATOM 8646  H HG23 . VAL A 1 129 ? 6.770   -0.425  6.372   1.00 0.00 ? 129 VAL A HG23 4  
ATOM 8647  N N    . CYS A 1 130 ? 6.341   2.245   2.685   1.00 0.00 ? 130 CYS A N    4  
ATOM 8648  C CA   . CYS A 1 130 ? 5.699   3.487   2.175   1.00 0.00 ? 130 CYS A CA   4  
ATOM 8649  C C    . CYS A 1 130 ? 4.622   3.917   3.167   1.00 0.00 ? 130 CYS A C    4  
ATOM 8650  O O    . CYS A 1 130 ? 3.477   3.521   3.060   1.00 0.00 ? 130 CYS A O    4  
ATOM 8651  C CB   . CYS A 1 130 ? 5.061   3.213   0.811   1.00 0.00 ? 130 CYS A CB   4  
ATOM 8652  S SG   . CYS A 1 130 ? 4.507   4.774   0.081   1.00 0.00 ? 130 CYS A SG   4  
ATOM 8653  H H    . CYS A 1 130 ? 5.914   1.372   2.536   1.00 0.00 ? 130 CYS A H    4  
ATOM 8654  H HA   . CYS A 1 130 ? 6.441   4.267   2.080   1.00 0.00 ? 130 CYS A HA   4  
ATOM 8655  H HB2  . CYS A 1 130 ? 5.787   2.750   0.160   1.00 0.00 ? 130 CYS A HB2  4  
ATOM 8656  H HB3  . CYS A 1 130 ? 4.215   2.553   0.935   1.00 0.00 ? 130 CYS A HB3  4  
ATOM 8657  H HG   . CYS A 1 130 ? 3.886   4.569   -0.622  1.00 0.00 ? 130 CYS A HG   4  
ATOM 8658  N N    . THR A 1 131 ? 4.988   4.712   4.140   1.00 0.00 ? 131 THR A N    4  
ATOM 8659  C CA   . THR A 1 131 ? 3.996   5.165   5.157   1.00 0.00 ? 131 THR A CA   4  
ATOM 8660  C C    . THR A 1 131 ? 3.602   6.614   4.885   1.00 0.00 ? 131 THR A C    4  
ATOM 8661  O O    . THR A 1 131 ? 4.397   7.522   5.038   1.00 0.00 ? 131 THR A O    4  
ATOM 8662  C CB   . THR A 1 131 ? 4.616   5.068   6.552   1.00 0.00 ? 131 THR A CB   4  
ATOM 8663  O OG1  . THR A 1 131 ? 5.405   3.890   6.640   1.00 0.00 ? 131 THR A OG1  4  
ATOM 8664  C CG2  . THR A 1 131 ? 3.505   5.023   7.602   1.00 0.00 ? 131 THR A CG2  4  
ATOM 8665  H H    . THR A 1 131 ? 5.921   5.005   4.206   1.00 0.00 ? 131 THR A H    4  
ATOM 8666  H HA   . THR A 1 131 ? 3.117   4.537   5.110   1.00 0.00 ? 131 THR A HA   4  
ATOM 8667  H HB   . THR A 1 131 ? 5.237   5.933   6.730   1.00 0.00 ? 131 THR A HB   4  
ATOM 8668  H HG1  . THR A 1 131 ? 4.814   3.135   6.620   1.00 0.00 ? 131 THR A HG1  4  
ATOM 8669  H HG21 . THR A 1 131 ? 2.666   5.613   7.263   1.00 0.00 ? 131 THR A HG21 4  
ATOM 8670  H HG22 . THR A 1 131 ? 3.191   4.001   7.748   1.00 0.00 ? 131 THR A HG22 4  
ATOM 8671  H HG23 . THR A 1 131 ? 3.874   5.424   8.534   1.00 0.00 ? 131 THR A HG23 4  
ATOM 8672  N N    . ARG A 1 132 ? 2.376   6.833   4.494   1.00 0.00 ? 132 ARG A N    4  
ATOM 8673  C CA   . ARG A 1 132 ? 1.910   8.226   4.220   1.00 0.00 ? 132 ARG A CA   4  
ATOM 8674  C C    . ARG A 1 132 ? 0.493   8.387   4.757   1.00 0.00 ? 132 ARG A C    4  
ATOM 8675  O O    . ARG A 1 132 ? -0.341  7.513   4.605   1.00 0.00 ? 132 ARG A O    4  
ATOM 8676  C CB   . ARG A 1 132 ? 1.928   8.535   2.710   1.00 0.00 ? 132 ARG A CB   4  
ATOM 8677  C CG   . ARG A 1 132 ? 1.627   7.281   1.884   1.00 0.00 ? 132 ARG A CG   4  
ATOM 8678  C CD   . ARG A 1 132 ? 1.371   7.685   0.433   1.00 0.00 ? 132 ARG A CD   4  
ATOM 8679  N NE   . ARG A 1 132 ? 1.399   6.474   -0.434  1.00 0.00 ? 132 ARG A NE   4  
ATOM 8680  C CZ   . ARG A 1 132 ? 1.747   6.577   -1.688  1.00 0.00 ? 132 ARG A CZ   4  
ATOM 8681  N NH1  . ARG A 1 132 ? 2.955   6.961   -2.000  1.00 0.00 ? 132 ARG A NH1  4  
ATOM 8682  N NH2  . ARG A 1 132 ? 0.888   6.297   -2.629  1.00 0.00 ? 132 ARG A NH2  4  
ATOM 8683  H H    . ARG A 1 132 ? 1.755   6.079   4.388   1.00 0.00 ? 132 ARG A H    4  
ATOM 8684  H HA   . ARG A 1 132 ? 2.557   8.922   4.733   1.00 0.00 ? 132 ARG A HA   4  
ATOM 8685  H HB2  . ARG A 1 132 ? 1.184   9.286   2.493   1.00 0.00 ? 132 ARG A HB2  4  
ATOM 8686  H HB3  . ARG A 1 132 ? 2.900   8.911   2.436   1.00 0.00 ? 132 ARG A HB3  4  
ATOM 8687  H HG2  . ARG A 1 132 ? 2.470   6.610   1.929   1.00 0.00 ? 132 ARG A HG2  4  
ATOM 8688  H HG3  . ARG A 1 132 ? 0.755   6.791   2.279   1.00 0.00 ? 132 ARG A HG3  4  
ATOM 8689  H HD2  . ARG A 1 132 ? 0.406   8.162   0.358   1.00 0.00 ? 132 ARG A HD2  4  
ATOM 8690  H HD3  . ARG A 1 132 ? 2.137   8.375   0.113   1.00 0.00 ? 132 ARG A HD3  4  
ATOM 8691  H HE   . ARG A 1 132 ? 1.157   5.600   -0.064  1.00 0.00 ? 132 ARG A HE   4  
ATOM 8692  H HH11 . ARG A 1 132 ? 3.613   7.176   -1.278  1.00 0.00 ? 132 ARG A HH11 4  
ATOM 8693  H HH12 . ARG A 1 132 ? 3.222   7.041   -2.960  1.00 0.00 ? 132 ARG A HH12 4  
ATOM 8694  H HH21 . ARG A 1 132 ? -0.038  6.004   -2.390  1.00 0.00 ? 132 ARG A HH21 4  
ATOM 8695  H HH22 . ARG A 1 132 ? 1.154   6.377   -3.589  1.00 0.00 ? 132 ARG A HH22 4  
ATOM 8696  N N    . VAL A 1 133 ? 0.216   9.499   5.387   1.00 0.00 ? 133 VAL A N    4  
ATOM 8697  C CA   . VAL A 1 133 ? -1.146  9.724   5.941   1.00 0.00 ? 133 VAL A CA   4  
ATOM 8698  C C    . VAL A 1 133 ? -2.065  10.188  4.818   1.00 0.00 ? 133 VAL A C    4  
ATOM 8699  O O    . VAL A 1 133 ? -1.629  10.744  3.836   1.00 0.00 ? 133 VAL A O    4  
ATOM 8700  C CB   . VAL A 1 133 ? -1.078  10.790  7.049   1.00 0.00 ? 133 VAL A CB   4  
ATOM 8701  C CG1  . VAL A 1 133 ? -2.490  11.184  7.496   1.00 0.00 ? 133 VAL A CG1  4  
ATOM 8702  C CG2  . VAL A 1 133 ? -0.309  10.224  8.244   1.00 0.00 ? 133 VAL A CG2  4  
ATOM 8703  H H    . VAL A 1 133 ? 0.907   10.189  5.493   1.00 0.00 ? 133 VAL A H    4  
ATOM 8704  H HA   . VAL A 1 133 ? -1.528  8.803   6.351   1.00 0.00 ? 133 VAL A HA   4  
ATOM 8705  H HB   . VAL A 1 133 ? -0.567  11.663  6.676   1.00 0.00 ? 133 VAL A HB   4  
ATOM 8706  H HG11 . VAL A 1 133 ? -3.089  10.294  7.620   1.00 0.00 ? 133 VAL A HG11 4  
ATOM 8707  H HG12 . VAL A 1 133 ? -2.436  11.718  8.431   1.00 0.00 ? 133 VAL A HG12 4  
ATOM 8708  H HG13 . VAL A 1 133 ? -2.939  11.817  6.743   1.00 0.00 ? 133 VAL A HG13 4  
ATOM 8709  H HG21 . VAL A 1 133 ? -0.389  9.147   8.247   1.00 0.00 ? 133 VAL A HG21 4  
ATOM 8710  H HG22 . VAL A 1 133 ? 0.730   10.507  8.169   1.00 0.00 ? 133 VAL A HG22 4  
ATOM 8711  H HG23 . VAL A 1 133 ? -0.724  10.618  9.160   1.00 0.00 ? 133 VAL A HG23 4  
ATOM 8712  N N    . TYR A 1 134 ? -3.337  9.968   4.977   1.00 0.00 ? 134 TYR A N    4  
ATOM 8713  C CA   . TYR A 1 134 ? -4.309  10.402  3.946   1.00 0.00 ? 134 TYR A CA   4  
ATOM 8714  C C    . TYR A 1 134 ? -5.460  11.123  4.628   1.00 0.00 ? 134 TYR A C    4  
ATOM 8715  O O    . TYR A 1 134 ? -5.577  11.126  5.837   1.00 0.00 ? 134 TYR A O    4  
ATOM 8716  C CB   . TYR A 1 134 ? -4.911  9.201   3.238   1.00 0.00 ? 134 TYR A CB   4  
ATOM 8717  C CG   . TYR A 1 134 ? -3.911  8.552   2.329   1.00 0.00 ? 134 TYR A CG   4  
ATOM 8718  C CD1  . TYR A 1 134 ? -2.864  7.806   2.867   1.00 0.00 ? 134 TYR A CD1  4  
ATOM 8719  C CD2  . TYR A 1 134 ? -4.050  8.674   0.944   1.00 0.00 ? 134 TYR A CD2  4  
ATOM 8720  C CE1  . TYR A 1 134 ? -1.950  7.180   2.023   1.00 0.00 ? 134 TYR A CE1  4  
ATOM 8721  C CE2  . TYR A 1 134 ? -3.134  8.052   0.095   1.00 0.00 ? 134 TYR A CE2  4  
ATOM 8722  C CZ   . TYR A 1 134 ? -2.081  7.302   0.633   1.00 0.00 ? 134 TYR A CZ   4  
ATOM 8723  O OH   . TYR A 1 134 ? -1.177  6.680   -0.204  1.00 0.00 ? 134 TYR A OH   4  
ATOM 8724  H H    . TYR A 1 134 ? -3.655  9.525   5.786   1.00 0.00 ? 134 TYR A H    4  
ATOM 8725  H HA   . TYR A 1 134 ? -3.825  11.044  3.230   1.00 0.00 ? 134 TYR A HA   4  
ATOM 8726  H HB2  . TYR A 1 134 ? -5.242  8.489   3.968   1.00 0.00 ? 134 TYR A HB2  4  
ATOM 8727  H HB3  . TYR A 1 134 ? -5.755  9.531   2.663   1.00 0.00 ? 134 TYR A HB3  4  
ATOM 8728  H HD1  . TYR A 1 134 ? -2.758  7.716   3.937   1.00 0.00 ? 134 TYR A HD1  4  
ATOM 8729  H HD2  . TYR A 1 134 ? -4.862  9.253   0.531   1.00 0.00 ? 134 TYR A HD2  4  
ATOM 8730  H HE1  . TYR A 1 134 ? -1.147  6.604   2.445   1.00 0.00 ? 134 TYR A HE1  4  
ATOM 8731  H HE2  . TYR A 1 134 ? -3.243  8.149   -0.972  1.00 0.00 ? 134 TYR A HE2  4  
ATOM 8732  H HH   . TYR A 1 134 ? -1.416  5.752   -0.261  1.00 0.00 ? 134 TYR A HH   4  
ATOM 8733  N N    . VAL A 1 135 ? -6.337  11.681  3.850   1.00 0.00 ? 135 VAL A N    4  
ATOM 8734  C CA   . VAL A 1 135 ? -7.529  12.351  4.413   1.00 0.00 ? 135 VAL A CA   4  
ATOM 8735  C C    . VAL A 1 135 ? -8.676  12.089  3.458   1.00 0.00 ? 135 VAL A C    4  
ATOM 8736  O O    . VAL A 1 135 ? -8.452  11.749  2.318   1.00 0.00 ? 135 VAL A O    4  
ATOM 8737  C CB   . VAL A 1 135 ? -7.296  13.836  4.540   1.00 0.00 ? 135 VAL A CB   4  
ATOM 8738  C CG1  . VAL A 1 135 ? -8.518  14.469  5.186   1.00 0.00 ? 135 VAL A CG1  4  
ATOM 8739  C CG2  . VAL A 1 135 ? -6.074  14.068  5.417   1.00 0.00 ? 135 VAL A CG2  4  
ATOM 8740  H H    . VAL A 1 135 ? -6.231  11.627  2.880   1.00 0.00 ? 135 VAL A H    4  
ATOM 8741  H HA   . VAL A 1 135 ? -7.752  11.936  5.380   1.00 0.00 ? 135 VAL A HA   4  
ATOM 8742  H HB   . VAL A 1 135 ? -7.143  14.257  3.567   1.00 0.00 ? 135 VAL A HB   4  
ATOM 8743  H HG11 . VAL A 1 135 ? -8.961  13.764  5.872   1.00 0.00 ? 135 VAL A HG11 4  
ATOM 8744  H HG12 . VAL A 1 135 ? -8.221  15.356  5.717   1.00 0.00 ? 135 VAL A HG12 4  
ATOM 8745  H HG13 . VAL A 1 135 ? -9.232  14.721  4.419   1.00 0.00 ? 135 VAL A HG13 4  
ATOM 8746  H HG21 . VAL A 1 135 ? -5.221  13.574  4.978   1.00 0.00 ? 135 VAL A HG21 4  
ATOM 8747  H HG22 . VAL A 1 135 ? -5.882  15.125  5.492   1.00 0.00 ? 135 VAL A HG22 4  
ATOM 8748  H HG23 . VAL A 1 135 ? -6.259  13.661  6.399   1.00 0.00 ? 135 VAL A HG23 4  
ATOM 8749  N N    . ARG A 1 136 ? -9.890  12.222  3.891   1.00 0.00 ? 136 ARG A N    4  
ATOM 8750  C CA   . ARG A 1 136 ? -11.007 11.941  2.948   1.00 0.00 ? 136 ARG A CA   4  
ATOM 8751  C C    . ARG A 1 136 ? -11.305 13.185  2.121   1.00 0.00 ? 136 ARG A C    4  
ATOM 8752  O O    . ARG A 1 136 ? -11.700 14.213  2.635   1.00 0.00 ? 136 ARG A O    4  
ATOM 8753  C CB   . ARG A 1 136 ? -12.275 11.488  3.676   1.00 0.00 ? 136 ARG A CB   4  
ATOM 8754  C CG   . ARG A 1 136 ? -12.525 10.001  3.404   1.00 0.00 ? 136 ARG A CG   4  
ATOM 8755  C CD   . ARG A 1 136 ? -13.465 9.432   4.468   1.00 0.00 ? 136 ARG A CD   4  
ATOM 8756  N NE   . ARG A 1 136 ? -12.874 9.642   5.819   1.00 0.00 ? 136 ARG A NE   4  
ATOM 8757  C CZ   . ARG A 1 136 ? -13.652 9.734   6.863   1.00 0.00 ? 136 ARG A CZ   4  
ATOM 8758  N NH1  . ARG A 1 136 ? -14.650 10.575  6.861   1.00 0.00 ? 136 ARG A NH1  4  
ATOM 8759  N NH2  . ARG A 1 136 ? -13.432 8.984   7.908   1.00 0.00 ? 136 ARG A NH2  4  
ATOM 8760  H H    . ARG A 1 136 ? -10.058 12.493  4.816   1.00 0.00 ? 136 ARG A H    4  
ATOM 8761  H HA   . ARG A 1 136 ? -10.683 11.156  2.281   1.00 0.00 ? 136 ARG A HA   4  
ATOM 8762  H HB2  . ARG A 1 136 ? -12.168 11.650  4.736   1.00 0.00 ? 136 ARG A HB2  4  
ATOM 8763  H HB3  . ARG A 1 136 ? -13.112 12.053  3.302   1.00 0.00 ? 136 ARG A HB3  4  
ATOM 8764  H HG2  . ARG A 1 136 ? -12.976 9.887   2.429   1.00 0.00 ? 136 ARG A HG2  4  
ATOM 8765  H HG3  . ARG A 1 136 ? -11.589 9.469   3.429   1.00 0.00 ? 136 ARG A HG3  4  
ATOM 8766  H HD2  . ARG A 1 136 ? -14.419 9.934   4.411   1.00 0.00 ? 136 ARG A HD2  4  
ATOM 8767  H HD3  . ARG A 1 136 ? -13.604 8.374   4.297   1.00 0.00 ? 136 ARG A HD3  4  
ATOM 8768  H HE   . ARG A 1 136 ? -11.902 9.710   5.924   1.00 0.00 ? 136 ARG A HE   4  
ATOM 8769  H HH11 . ARG A 1 136 ? -14.819 11.148  6.060   1.00 0.00 ? 136 ARG A HH11 4  
ATOM 8770  H HH12 . ARG A 1 136 ? -15.246 10.645  7.661   1.00 0.00 ? 136 ARG A HH12 4  
ATOM 8771  H HH21 . ARG A 1 136 ? -12.668 8.339   7.909   1.00 0.00 ? 136 ARG A HH21 4  
ATOM 8772  H HH22 . ARG A 1 136 ? -14.028 9.055   8.708   1.00 0.00 ? 136 ARG A HH22 4  
ATOM 8773  N N    . GLU A 1 137 ? -11.114 13.079  0.836   1.00 0.00 ? 137 GLU A N    4  
ATOM 8774  C CA   . GLU A 1 137 ? -11.374 14.224  -0.096  1.00 0.00 ? 137 GLU A CA   4  
ATOM 8775  C C    . GLU A 1 137 ? -12.722 14.893  0.215   1.00 0.00 ? 137 GLU A C    4  
ATOM 8776  O O    . GLU A 1 137 ? -13.742 14.282  -0.058  1.00 0.00 ? 137 GLU A O    4  
ATOM 8777  C CB   . GLU A 1 137 ? -11.409 13.698  -1.531  1.00 0.00 ? 137 GLU A CB   4  
ATOM 8778  C CG   . GLU A 1 137 ? -11.346 14.874  -2.512  1.00 0.00 ? 137 GLU A CG   4  
ATOM 8779  C CD   . GLU A 1 137 ? -12.741 15.151  -3.080  1.00 0.00 ? 137 GLU A CD   4  
ATOM 8780  O OE1  . GLU A 1 137 ? -13.431 14.196  -3.396  1.00 0.00 ? 137 GLU A OE1  4  
ATOM 8781  O OE2  . GLU A 1 137 ? -13.095 16.313  -3.188  1.00 0.00 ? 137 GLU A OE2  4  
ATOM 8782  O OXT  . GLU A 1 137 ? -12.708 16.004  0.720   1.00 0.00 ? 137 GLU A OXT  4  
ATOM 8783  H H    . GLU A 1 137 ? -10.787 12.229  0.479   1.00 0.00 ? 137 GLU A H    4  
ATOM 8784  H HA   . GLU A 1 137 ? -10.581 14.947  -0.003  1.00 0.00 ? 137 GLU A HA   4  
ATOM 8785  H HB2  . GLU A 1 137 ? -10.565 13.044  -1.693  1.00 0.00 ? 137 GLU A HB2  4  
ATOM 8786  H HB3  . GLU A 1 137 ? -12.324 13.146  -1.688  1.00 0.00 ? 137 GLU A HB3  4  
ATOM 8787  H HG2  . GLU A 1 137 ? -10.985 15.755  -2.000  1.00 0.00 ? 137 GLU A HG2  4  
ATOM 8788  H HG3  . GLU A 1 137 ? -10.675 14.630  -3.320  1.00 0.00 ? 137 GLU A HG3  4  
ATOM 8789  N N    . PRO A 1 1   ? -15.234 -0.833  10.679  1.00 0.00 ? 1   PRO A N    5  
ATOM 8790  C CA   . PRO A 1 1   ? -13.820 -0.742  10.180  1.00 0.00 ? 1   PRO A CA   5  
ATOM 8791  C C    . PRO A 1 1   ? -13.583 0.580   9.430   1.00 0.00 ? 1   PRO A C    5  
ATOM 8792  O O    . PRO A 1 1   ? -12.476 1.074   9.403   1.00 0.00 ? 1   PRO A O    5  
ATOM 8793  C CB   . PRO A 1 1   ? -13.578 -1.911  9.220   1.00 0.00 ? 1   PRO A CB   5  
ATOM 8794  C CG   . PRO A 1 1   ? -14.885 -2.692  9.125   1.00 0.00 ? 1   PRO A CG   5  
ATOM 8795  C CD   . PRO A 1 1   ? -15.933 -1.919  9.927   1.00 0.00 ? 1   PRO A CD   5  
ATOM 8796  H H2   . PRO A 1 1   ? -15.730 0.066   10.541  1.00 0.00 ? 1   PRO A H2   5  
ATOM 8797  H H3   . PRO A 1 1   ? -15.223 -1.068  11.694  1.00 0.00 ? 1   PRO A H3   5  
ATOM 8798  H HA   . PRO A 1 1   ? -13.136 -0.815  11.012  1.00 0.00 ? 1   PRO A HA   5  
ATOM 8799  H HB2  . PRO A 1 1   ? -13.284 -1.543  8.244   1.00 0.00 ? 1   PRO A HB2  5  
ATOM 8800  H HB3  . PRO A 1 1   ? -12.804 -2.552  9.612   1.00 0.00 ? 1   PRO A HB3  5  
ATOM 8801  H HG2  . PRO A 1 1   ? -15.192 -2.770  8.091   1.00 0.00 ? 1   PRO A HG2  5  
ATOM 8802  H HG3  . PRO A 1 1   ? -14.758 -3.676  9.548   1.00 0.00 ? 1   PRO A HG3  5  
ATOM 8803  H HD2  . PRO A 1 1   ? -16.661 -1.488  9.255   1.00 0.00 ? 1   PRO A HD2  5  
ATOM 8804  H HD3  . PRO A 1 1   ? -16.424 -2.583  10.622  1.00 0.00 ? 1   PRO A HD3  5  
ATOM 8805  N N    . ASN A 1 2   ? -14.600 1.133   8.792   1.00 0.00 ? 2   ASN A N    5  
ATOM 8806  C CA   . ASN A 1 2   ? -14.426 2.402   8.013   1.00 0.00 ? 2   ASN A CA   5  
ATOM 8807  C C    . ASN A 1 2   ? -13.659 2.072   6.726   1.00 0.00 ? 2   ASN A C    5  
ATOM 8808  O O    . ASN A 1 2   ? -13.904 1.042   6.138   1.00 0.00 ? 2   ASN A O    5  
ATOM 8809  C CB   . ASN A 1 2   ? -13.745 3.484   8.876   1.00 0.00 ? 2   ASN A CB   5  
ATOM 8810  C CG   . ASN A 1 2   ? -14.608 3.763   10.108  1.00 0.00 ? 2   ASN A CG   5  
ATOM 8811  O OD1  . ASN A 1 2   ? -14.260 3.379   11.207  1.00 0.00 ? 2   ASN A OD1  5  
ATOM 8812  N ND2  . ASN A 1 2   ? -15.727 4.420   9.971   1.00 0.00 ? 2   ASN A ND2  5  
ATOM 8813  H H    . ASN A 1 2   ? -15.474 0.695   8.801   1.00 0.00 ? 2   ASN A H    5  
ATOM 8814  H HA   . ASN A 1 2   ? -15.386 2.768   7.716   1.00 0.00 ? 2   ASN A HA   5  
ATOM 8815  H HB2  . ASN A 1 2   ? -12.781 3.153   9.189   1.00 0.00 ? 2   ASN A HB2  5  
ATOM 8816  H HB3  . ASN A 1 2   ? -13.647 4.393   8.304   1.00 0.00 ? 2   ASN A HB3  5  
ATOM 8817  H HD21 . ASN A 1 2   ? -16.007 4.730   9.084   1.00 0.00 ? 2   ASN A HD21 5  
ATOM 8818  H HD22 . ASN A 1 2   ? -16.286 4.604   10.754  1.00 0.00 ? 2   ASN A HD22 5  
ATOM 8819  N N    . PHE A 1 3   ? -12.765 2.922   6.281   1.00 0.00 ? 3   PHE A N    5  
ATOM 8820  C CA   . PHE A 1 3   ? -11.978 2.690   5.008   1.00 0.00 ? 3   PHE A CA   5  
ATOM 8821  C C    . PHE A 1 3   ? -12.805 3.069   3.760   1.00 0.00 ? 3   PHE A C    5  
ATOM 8822  O O    . PHE A 1 3   ? -12.288 3.660   2.832   1.00 0.00 ? 3   PHE A O    5  
ATOM 8823  C CB   . PHE A 1 3   ? -11.520 1.230   4.838   1.00 0.00 ? 3   PHE A CB   5  
ATOM 8824  C CG   . PHE A 1 3   ? -10.606 0.790   5.959   1.00 0.00 ? 3   PHE A CG   5  
ATOM 8825  C CD1  . PHE A 1 3   ? -11.137 0.297   7.157   1.00 0.00 ? 3   PHE A CD1  5  
ATOM 8826  C CD2  . PHE A 1 3   ? -9.218  0.818   5.775   1.00 0.00 ? 3   PHE A CD2  5  
ATOM 8827  C CE1  . PHE A 1 3   ? -10.300 -0.169  8.153   1.00 0.00 ? 3   PHE A CE1  5  
ATOM 8828  C CE2  . PHE A 1 3   ? -8.371  0.360   6.791   1.00 0.00 ? 3   PHE A CE2  5  
ATOM 8829  C CZ   . PHE A 1 3   ? -8.920  -0.144  7.984   1.00 0.00 ? 3   PHE A CZ   5  
ATOM 8830  H H    . PHE A 1 3   ? -12.609 3.735   6.782   1.00 0.00 ? 3   PHE A H    5  
ATOM 8831  H HA   . PHE A 1 3   ? -11.105 3.323   5.039   1.00 0.00 ? 3   PHE A HA   5  
ATOM 8832  H HB2  . PHE A 1 3   ? -12.374 0.579   4.798   1.00 0.00 ? 3   PHE A HB2  5  
ATOM 8833  H HB3  . PHE A 1 3   ? -10.984 1.147   3.903   1.00 0.00 ? 3   PHE A HB3  5  
ATOM 8834  H HD1  . PHE A 1 3   ? -12.193 0.270   7.319   1.00 0.00 ? 3   PHE A HD1  5  
ATOM 8835  H HD2  . PHE A 1 3   ? -8.800  1.218   4.861   1.00 0.00 ? 3   PHE A HD2  5  
ATOM 8836  H HE1  . PHE A 1 3   ? -10.725 -0.537  9.063   1.00 0.00 ? 3   PHE A HE1  5  
ATOM 8837  H HE2  . PHE A 1 3   ? -7.301  0.390   6.650   1.00 0.00 ? 3   PHE A HE2  5  
ATOM 8838  H HZ   . PHE A 1 3   ? -8.283  -0.532  8.768   1.00 0.00 ? 3   PHE A HZ   5  
ATOM 8839  N N    . SER A 1 4   ? -14.070 2.708   3.707   1.00 0.00 ? 4   SER A N    5  
ATOM 8840  C CA   . SER A 1 4   ? -14.910 3.019   2.507   1.00 0.00 ? 4   SER A CA   5  
ATOM 8841  C C    . SER A 1 4   ? -14.864 4.519   2.183   1.00 0.00 ? 4   SER A C    5  
ATOM 8842  O O    . SER A 1 4   ? -15.212 5.345   3.005   1.00 0.00 ? 4   SER A O    5  
ATOM 8843  C CB   . SER A 1 4   ? -16.358 2.610   2.794   1.00 0.00 ? 4   SER A CB   5  
ATOM 8844  O OG   . SER A 1 4   ? -17.002 3.621   3.563   1.00 0.00 ? 4   SER A OG   5  
ATOM 8845  H H    . SER A 1 4   ? -14.466 2.216   4.442   1.00 0.00 ? 4   SER A H    5  
ATOM 8846  H HA   . SER A 1 4   ? -14.545 2.449   1.662   1.00 0.00 ? 4   SER A HA   5  
ATOM 8847  H HB2  . SER A 1 4   ? -16.887 2.480   1.864   1.00 0.00 ? 4   SER A HB2  5  
ATOM 8848  H HB3  . SER A 1 4   ? -16.361 1.678   3.339   1.00 0.00 ? 4   SER A HB3  5  
ATOM 8849  H HG   . SER A 1 4   ? -16.804 3.460   4.488   1.00 0.00 ? 4   SER A HG   5  
ATOM 8850  N N    . GLY A 1 5   ? -14.452 4.873   0.989   1.00 0.00 ? 5   GLY A N    5  
ATOM 8851  C CA   . GLY A 1 5   ? -14.403 6.316   0.614   1.00 0.00 ? 5   GLY A CA   5  
ATOM 8852  C C    . GLY A 1 5   ? -13.172 6.589   -0.235  1.00 0.00 ? 5   GLY A C    5  
ATOM 8853  O O    . GLY A 1 5   ? -12.173 5.903   -0.146  1.00 0.00 ? 5   GLY A O    5  
ATOM 8854  H H    . GLY A 1 5   ? -14.182 4.189   0.339   1.00 0.00 ? 5   GLY A H    5  
ATOM 8855  H HA2  . GLY A 1 5   ? -15.289 6.579   0.059   1.00 0.00 ? 5   GLY A HA2  5  
ATOM 8856  H HA3  . GLY A 1 5   ? -14.352 6.920   1.502   1.00 0.00 ? 5   GLY A HA3  5  
ATOM 8857  N N    . ASN A 1 6   ? -13.234 7.616   -1.031  1.00 0.00 ? 6   ASN A N    5  
ATOM 8858  C CA   . ASN A 1 6   ? -12.067 7.990   -1.868  1.00 0.00 ? 6   ASN A CA   5  
ATOM 8859  C C    . ASN A 1 6   ? -11.085 8.680   -0.946  1.00 0.00 ? 6   ASN A C    5  
ATOM 8860  O O    . ASN A 1 6   ? -11.486 9.225   0.068   1.00 0.00 ? 6   ASN A O    5  
ATOM 8861  C CB   . ASN A 1 6   ? -12.498 8.938   -2.989  1.00 0.00 ? 6   ASN A CB   5  
ATOM 8862  C CG   . ASN A 1 6   ? -11.306 9.221   -3.905  1.00 0.00 ? 6   ASN A CG   5  
ATOM 8863  O OD1  . ASN A 1 6   ? -10.394 9.932   -3.532  1.00 0.00 ? 6   ASN A OD1  5  
ATOM 8864  N ND2  . ASN A 1 6   ? -11.273 8.690   -5.096  1.00 0.00 ? 6   ASN A ND2  5  
ATOM 8865  H H    . ASN A 1 6   ? -14.039 8.158   -1.047  1.00 0.00 ? 6   ASN A H    5  
ATOM 8866  H HA   . ASN A 1 6   ? -11.615 7.103   -2.277  1.00 0.00 ? 6   ASN A HA   5  
ATOM 8867  H HB2  . ASN A 1 6   ? -13.293 8.482   -3.561  1.00 0.00 ? 6   ASN A HB2  5  
ATOM 8868  H HB3  . ASN A 1 6   ? -12.849 9.866   -2.562  1.00 0.00 ? 6   ASN A HB3  5  
ATOM 8869  H HD21 . ASN A 1 6   ? -12.009 8.116   -5.397  1.00 0.00 ? 6   ASN A HD21 5  
ATOM 8870  H HD22 . ASN A 1 6   ? -10.514 8.865   -5.690  1.00 0.00 ? 6   ASN A HD22 5  
ATOM 8871  N N    . TRP A 1 7   ? -9.811  8.630   -1.234  1.00 0.00 ? 7   TRP A N    5  
ATOM 8872  C CA   . TRP A 1 7   ? -8.845  9.259   -0.287  1.00 0.00 ? 7   TRP A CA   5  
ATOM 8873  C C    . TRP A 1 7   ? -7.889  10.217  -0.974  1.00 0.00 ? 7   TRP A C    5  
ATOM 8874  O O    . TRP A 1 7   ? -7.265  9.898   -1.969  1.00 0.00 ? 7   TRP A O    5  
ATOM 8875  C CB   . TRP A 1 7   ? -8.055  8.158   0.386   1.00 0.00 ? 7   TRP A CB   5  
ATOM 8876  C CG   . TRP A 1 7   ? -8.995  7.254   1.096   1.00 0.00 ? 7   TRP A CG   5  
ATOM 8877  C CD1  . TRP A 1 7   ? -9.470  6.084   0.622   1.00 0.00 ? 7   TRP A CD1  5  
ATOM 8878  C CD2  . TRP A 1 7   ? -9.607  7.455   2.387   1.00 0.00 ? 7   TRP A CD2  5  
ATOM 8879  N NE1  . TRP A 1 7   ? -10.292 5.522   1.579   1.00 0.00 ? 7   TRP A NE1  5  
ATOM 8880  C CE2  . TRP A 1 7   ? -10.416 6.339   2.686   1.00 0.00 ? 7   TRP A CE2  5  
ATOM 8881  C CE3  . TRP A 1 7   ? -9.520  8.487   3.323   1.00 0.00 ? 7   TRP A CE3  5  
ATOM 8882  C CZ2  . TRP A 1 7   ? -11.117 6.252   3.889   1.00 0.00 ? 7   TRP A CZ2  5  
ATOM 8883  C CZ3  . TRP A 1 7   ? -10.229 8.418   4.519   1.00 0.00 ? 7   TRP A CZ3  5  
ATOM 8884  C CH2  . TRP A 1 7   ? -11.027 7.301   4.811   1.00 0.00 ? 7   TRP A CH2  5  
ATOM 8885  H H    . TRP A 1 7   ? -9.491  8.143   -2.038  1.00 0.00 ? 7   TRP A H    5  
ATOM 8886  H HA   . TRP A 1 7   ? -9.389  9.801   0.471   1.00 0.00 ? 7   TRP A HA   5  
ATOM 8887  H HB2  . TRP A 1 7   ? -7.504  7.607   -0.347  1.00 0.00 ? 7   TRP A HB2  5  
ATOM 8888  H HB3  . TRP A 1 7   ? -7.376  8.587   1.092   1.00 0.00 ? 7   TRP A HB3  5  
ATOM 8889  H HD1  . TRP A 1 7   ? -9.232  5.651   -0.337  1.00 0.00 ? 7   TRP A HD1  5  
ATOM 8890  H HE1  . TRP A 1 7   ? -10.748 4.663   1.494   1.00 0.00 ? 7   TRP A HE1  5  
ATOM 8891  H HE3  . TRP A 1 7   ? -8.904  9.347   3.117   1.00 0.00 ? 7   TRP A HE3  5  
ATOM 8892  H HZ2  . TRP A 1 7   ? -11.715 5.380   4.111   1.00 0.00 ? 7   TRP A HZ2  5  
ATOM 8893  H HZ3  . TRP A 1 7   ? -10.171 9.237   5.208   1.00 0.00 ? 7   TRP A HZ3  5  
ATOM 8894  H HH2  . TRP A 1 7   ? -11.574 7.254   5.741   1.00 0.00 ? 7   TRP A HH2  5  
ATOM 8895  N N    . LYS A 1 8   ? -7.757  11.390  -0.414  1.00 0.00 ? 8   LYS A N    5  
ATOM 8896  C CA   . LYS A 1 8   ? -6.823  12.394  -0.980  1.00 0.00 ? 8   LYS A CA   5  
ATOM 8897  C C    . LYS A 1 8   ? -5.473  12.207  -0.287  1.00 0.00 ? 8   LYS A C    5  
ATOM 8898  O O    . LYS A 1 8   ? -5.411  11.675  0.809   1.00 0.00 ? 8   LYS A O    5  
ATOM 8899  C CB   . LYS A 1 8   ? -7.329  13.830  -0.720  1.00 0.00 ? 8   LYS A CB   5  
ATOM 8900  C CG   . LYS A 1 8   ? -8.859  13.869  -0.565  1.00 0.00 ? 8   LYS A CG   5  
ATOM 8901  C CD   . LYS A 1 8   ? -9.215  13.853  0.921   1.00 0.00 ? 8   LYS A CD   5  
ATOM 8902  C CE   . LYS A 1 8   ? -9.370  15.289  1.428   1.00 0.00 ? 8   LYS A CE   5  
ATOM 8903  N NZ   . LYS A 1 8   ? -8.084  16.021  1.252   1.00 0.00 ? 8   LYS A NZ   5  
ATOM 8904  H H    . LYS A 1 8   ? -8.266  11.606  0.399   1.00 0.00 ? 8   LYS A H    5  
ATOM 8905  H HA   . LYS A 1 8   ? -6.717  12.223  -2.037  1.00 0.00 ? 8   LYS A HA   5  
ATOM 8906  H HB2  . LYS A 1 8   ? -6.875  14.201  0.186   1.00 0.00 ? 8   LYS A HB2  5  
ATOM 8907  H HB3  . LYS A 1 8   ? -7.040  14.463  -1.543  1.00 0.00 ? 8   LYS A HB3  5  
ATOM 8908  H HG2  . LYS A 1 8   ? -9.245  14.766  -1.017  1.00 0.00 ? 8   LYS A HG2  5  
ATOM 8909  H HG3  . LYS A 1 8   ? -9.296  13.008  -1.048  1.00 0.00 ? 8   LYS A HG3  5  
ATOM 8910  H HD2  . LYS A 1 8   ? -10.139 13.319  1.064   1.00 0.00 ? 8   LYS A HD2  5  
ATOM 8911  H HD3  . LYS A 1 8   ? -8.428  13.362  1.471   1.00 0.00 ? 8   LYS A HD3  5  
ATOM 8912  H HE2  . LYS A 1 8   ? -10.147 15.786  0.866   1.00 0.00 ? 8   LYS A HE2  5  
ATOM 8913  H HE3  . LYS A 1 8   ? -9.636  15.274  2.474   1.00 0.00 ? 8   LYS A HE3  5  
ATOM 8914  H HZ1  . LYS A 1 8   ? -7.307  15.459  1.655   1.00 0.00 ? 8   LYS A HZ1  5  
ATOM 8915  H HZ2  . LYS A 1 8   ? -7.910  16.180  0.240   1.00 0.00 ? 8   LYS A HZ2  5  
ATOM 8916  H HZ3  . LYS A 1 8   ? -8.138  16.938  1.740   1.00 0.00 ? 8   LYS A HZ3  5  
ATOM 8917  N N    . ILE A 1 9   ? -4.396  12.631  -0.901  1.00 0.00 ? 9   ILE A N    5  
ATOM 8918  C CA   . ILE A 1 9   ? -3.062  12.464  -0.255  1.00 0.00 ? 9   ILE A CA   5  
ATOM 8919  C C    . ILE A 1 9   ? -2.886  13.532  0.829   1.00 0.00 ? 9   ILE A C    5  
ATOM 8920  O O    . ILE A 1 9   ? -3.282  14.672  0.676   1.00 0.00 ? 9   ILE A O    5  
ATOM 8921  C CB   . ILE A 1 9   ? -1.945  12.530  -1.327  1.00 0.00 ? 9   ILE A CB   5  
ATOM 8922  C CG1  . ILE A 1 9   ? -0.729  11.706  -0.860  1.00 0.00 ? 9   ILE A CG1  5  
ATOM 8923  C CG2  . ILE A 1 9   ? -1.516  13.978  -1.624  1.00 0.00 ? 9   ILE A CG2  5  
ATOM 8924  C CD1  . ILE A 1 9   ? -0.046  12.356  0.355   1.00 0.00 ? 9   ILE A CD1  5  
ATOM 8925  H H    . ILE A 1 9   ? -4.468  13.056  -1.781  1.00 0.00 ? 9   ILE A H    5  
ATOM 8926  H HA   . ILE A 1 9   ? -3.031  11.494  0.226   1.00 0.00 ? 9   ILE A HA   5  
ATOM 8927  H HB   . ILE A 1 9   ? -2.325  12.095  -2.240  1.00 0.00 ? 9   ILE A HB   5  
ATOM 8928  H HG12 . ILE A 1 9   ? -1.057  10.713  -0.590  1.00 0.00 ? 9   ILE A HG12 5  
ATOM 8929  H HG13 . ILE A 1 9   ? -0.017  11.635  -1.669  1.00 0.00 ? 9   ILE A HG13 5  
ATOM 8930  H HG21 . ILE A 1 9   ? -2.376  14.553  -1.927  1.00 0.00 ? 9   ILE A HG21 5  
ATOM 8931  H HG22 . ILE A 1 9   ? -1.087  14.412  -0.732  1.00 0.00 ? 9   ILE A HG22 5  
ATOM 8932  H HG23 . ILE A 1 9   ? -0.781  13.980  -2.414  1.00 0.00 ? 9   ILE A HG23 5  
ATOM 8933  H HD11 . ILE A 1 9   ? -0.436  13.351  0.508   1.00 0.00 ? 9   ILE A HD11 5  
ATOM 8934  H HD12 . ILE A 1 9   ? -0.228  11.759  1.235   1.00 0.00 ? 9   ILE A HD12 5  
ATOM 8935  H HD13 . ILE A 1 9   ? 1.015   12.413  0.177   1.00 0.00 ? 9   ILE A HD13 5  
ATOM 8936  N N    . ILE A 1 10  ? -2.288  13.149  1.912   1.00 0.00 ? 10  ILE A N    5  
ATOM 8937  C CA   . ILE A 1 10  ? -2.058  14.080  3.037   1.00 0.00 ? 10  ILE A CA   5  
ATOM 8938  C C    . ILE A 1 10  ? -0.806  13.592  3.777   1.00 0.00 ? 10  ILE A C    5  
ATOM 8939  O O    . ILE A 1 10  ? -0.777  12.514  4.333   1.00 0.00 ? 10  ILE A O    5  
ATOM 8940  C CB   . ILE A 1 10  ? -3.311  14.073  3.938   1.00 0.00 ? 10  ILE A CB   5  
ATOM 8941  C CG1  . ILE A 1 10  ? -4.419  14.898  3.261   1.00 0.00 ? 10  ILE A CG1  5  
ATOM 8942  C CG2  . ILE A 1 10  ? -3.017  14.678  5.318   1.00 0.00 ? 10  ILE A CG2  5  
ATOM 8943  C CD1  . ILE A 1 10  ? -5.357  13.977  2.471   1.00 0.00 ? 10  ILE A CD1  5  
ATOM 8944  H H    . ILE A 1 10  ? -1.978  12.232  1.984   1.00 0.00 ? 10  ILE A H    5  
ATOM 8945  H HA   . ILE A 1 10  ? -1.892  15.072  2.656   1.00 0.00 ? 10  ILE A HA   5  
ATOM 8946  H HB   . ILE A 1 10  ? -3.648  13.060  4.059   1.00 0.00 ? 10  ILE A HB   5  
ATOM 8947  H HG12 . ILE A 1 10  ? -4.988  15.423  4.015   1.00 0.00 ? 10  ILE A HG12 5  
ATOM 8948  H HG13 . ILE A 1 10  ? -3.972  15.614  2.588   1.00 0.00 ? 10  ILE A HG13 5  
ATOM 8949  H HG21 . ILE A 1 10  ? -2.239  15.420  5.228   1.00 0.00 ? 10  ILE A HG21 5  
ATOM 8950  H HG22 . ILE A 1 10  ? -3.914  15.140  5.705   1.00 0.00 ? 10  ILE A HG22 5  
ATOM 8951  H HG23 . ILE A 1 10  ? -2.695  13.897  5.991   1.00 0.00 ? 10  ILE A HG23 5  
ATOM 8952  H HD11 . ILE A 1 10  ? -5.065  12.949  2.614   1.00 0.00 ? 10  ILE A HD11 5  
ATOM 8953  H HD12 . ILE A 1 10  ? -6.370  14.114  2.818   1.00 0.00 ? 10  ILE A HD12 5  
ATOM 8954  H HD13 . ILE A 1 10  ? -5.306  14.223  1.422   1.00 0.00 ? 10  ILE A HD13 5  
ATOM 8955  N N    . ARG A 1 11  ? 0.236   14.375  3.752   1.00 0.00 ? 11  ARG A N    5  
ATOM 8956  C CA   . ARG A 1 11  ? 1.522   13.987  4.417   1.00 0.00 ? 11  ARG A CA   5  
ATOM 8957  C C    . ARG A 1 11  ? 2.185   12.872  3.617   1.00 0.00 ? 11  ARG A C    5  
ATOM 8958  O O    . ARG A 1 11  ? 1.640   11.795  3.466   1.00 0.00 ? 11  ARG A O    5  
ATOM 8959  C CB   . ARG A 1 11  ? 1.284   13.503  5.860   1.00 0.00 ? 11  ARG A CB   5  
ATOM 8960  C CG   . ARG A 1 11  ? 0.271   14.404  6.583   1.00 0.00 ? 11  ARG A CG   5  
ATOM 8961  C CD   . ARG A 1 11  ? 0.678   15.880  6.471   1.00 0.00 ? 11  ARG A CD   5  
ATOM 8962  N NE   . ARG A 1 11  ? 0.740   16.484  7.832   1.00 0.00 ? 11  ARG A NE   5  
ATOM 8963  C CZ   . ARG A 1 11  ? 1.766   17.213  8.176   1.00 0.00 ? 11  ARG A CZ   5  
ATOM 8964  N NH1  . ARG A 1 11  ? 2.817   16.651  8.708   1.00 0.00 ? 11  ARG A NH1  5  
ATOM 8965  N NH2  . ARG A 1 11  ? 1.741   18.505  7.989   1.00 0.00 ? 11  ARG A NH2  5  
ATOM 8966  H H    . ARG A 1 11  ? 0.181   15.219  3.271   1.00 0.00 ? 11  ARG A H    5  
ATOM 8967  H HA   . ARG A 1 11  ? 2.180   14.845  4.435   1.00 0.00 ? 11  ARG A HA   5  
ATOM 8968  H HB2  . ARG A 1 11  ? 0.905   12.492  5.836   1.00 0.00 ? 11  ARG A HB2  5  
ATOM 8969  H HB3  . ARG A 1 11  ? 2.220   13.518  6.398   1.00 0.00 ? 11  ARG A HB3  5  
ATOM 8970  H HG2  . ARG A 1 11  ? -0.704  14.268  6.146   1.00 0.00 ? 11  ARG A HG2  5  
ATOM 8971  H HG3  . ARG A 1 11  ? 0.234   14.125  7.625   1.00 0.00 ? 11  ARG A HG3  5  
ATOM 8972  H HD2  . ARG A 1 11  ? 1.647   15.953  5.999   1.00 0.00 ? 11  ARG A HD2  5  
ATOM 8973  H HD3  . ARG A 1 11  ? -0.051  16.408  5.874   1.00 0.00 ? 11  ARG A HD3  5  
ATOM 8974  H HE   . ARG A 1 11  ? 0.010   16.334  8.468   1.00 0.00 ? 11  ARG A HE   5  
ATOM 8975  H HH11 . ARG A 1 11  ? 2.836   15.662  8.851   1.00 0.00 ? 11  ARG A HH11 5  
ATOM 8976  H HH12 . ARG A 1 11  ? 3.603   17.210  8.972   1.00 0.00 ? 11  ARG A HH12 5  
ATOM 8977  H HH21 . ARG A 1 11  ? 0.936   18.936  7.582   1.00 0.00 ? 11  ARG A HH21 5  
ATOM 8978  H HH22 . ARG A 1 11  ? 2.528   19.063  8.253   1.00 0.00 ? 11  ARG A HH22 5  
ATOM 8979  N N    . SER A 1 12  ? 3.360   13.126  3.102   1.00 0.00 ? 12  SER A N    5  
ATOM 8980  C CA   . SER A 1 12  ? 4.069   12.088  2.307   1.00 0.00 ? 12  SER A CA   5  
ATOM 8981  C C    . SER A 1 12  ? 5.574   12.382  2.310   1.00 0.00 ? 12  SER A C    5  
ATOM 8982  O O    . SER A 1 12  ? 5.996   13.501  2.084   1.00 0.00 ? 12  SER A O    5  
ATOM 8983  C CB   . SER A 1 12  ? 3.540   12.108  0.865   1.00 0.00 ? 12  SER A CB   5  
ATOM 8984  O OG   . SER A 1 12  ? 2.915   10.866  0.574   1.00 0.00 ? 12  SER A OG   5  
ATOM 8985  H H    . SER A 1 12  ? 3.774   14.004  3.240   1.00 0.00 ? 12  SER A H    5  
ATOM 8986  H HA   . SER A 1 12  ? 3.887   11.116  2.750   1.00 0.00 ? 12  SER A HA   5  
ATOM 8987  H HB2  . SER A 1 12  ? 2.817   12.901  0.755   1.00 0.00 ? 12  SER A HB2  5  
ATOM 8988  H HB3  . SER A 1 12  ? 4.360   12.278  0.178   1.00 0.00 ? 12  SER A HB3  5  
ATOM 8989  H HG   . SER A 1 12  ? 3.585   10.270  0.231   1.00 0.00 ? 12  SER A HG   5  
ATOM 8990  N N    . GLU A 1 13  ? 6.382   11.384  2.558   1.00 0.00 ? 13  GLU A N    5  
ATOM 8991  C CA   . GLU A 1 13  ? 7.861   11.590  2.571   1.00 0.00 ? 13  GLU A CA   5  
ATOM 8992  C C    . GLU A 1 13  ? 8.549   10.249  2.827   1.00 0.00 ? 13  GLU A C    5  
ATOM 8993  O O    . GLU A 1 13  ? 9.261   10.071  3.798   1.00 0.00 ? 13  GLU A O    5  
ATOM 8994  C CB   . GLU A 1 13  ? 8.234   12.589  3.671   1.00 0.00 ? 13  GLU A CB   5  
ATOM 8995  C CG   . GLU A 1 13  ? 9.452   13.403  3.232   1.00 0.00 ? 13  GLU A CG   5  
ATOM 8996  C CD   . GLU A 1 13  ? 9.808   14.419  4.319   1.00 0.00 ? 13  GLU A CD   5  
ATOM 8997  O OE1  . GLU A 1 13  ? 10.166  13.994  5.404   1.00 0.00 ? 13  GLU A OE1  5  
ATOM 8998  O OE2  . GLU A 1 13  ? 9.716   15.604  4.046   1.00 0.00 ? 13  GLU A OE2  5  
ATOM 8999  H H    . GLU A 1 13  ? 6.014   10.492  2.731   1.00 0.00 ? 13  GLU A H    5  
ATOM 9000  H HA   . GLU A 1 13  ? 8.177   11.972  1.612   1.00 0.00 ? 13  GLU A HA   5  
ATOM 9001  H HB2  . GLU A 1 13  ? 7.401   13.253  3.850   1.00 0.00 ? 13  GLU A HB2  5  
ATOM 9002  H HB3  . GLU A 1 13  ? 8.469   12.053  4.579   1.00 0.00 ? 13  GLU A HB3  5  
ATOM 9003  H HG2  . GLU A 1 13  ? 10.289  12.739  3.070   1.00 0.00 ? 13  GLU A HG2  5  
ATOM 9004  H HG3  . GLU A 1 13  ? 9.224   13.925  2.315   1.00 0.00 ? 13  GLU A HG3  5  
ATOM 9005  N N    . ASN A 1 14  ? 8.319   9.300   1.961   1.00 0.00 ? 14  ASN A N    5  
ATOM 9006  C CA   . ASN A 1 14  ? 8.933   7.949   2.139   1.00 0.00 ? 14  ASN A CA   5  
ATOM 9007  C C    . ASN A 1 14  ? 9.554   7.440   0.827   1.00 0.00 ? 14  ASN A C    5  
ATOM 9008  O O    . ASN A 1 14  ? 10.409  6.580   0.856   1.00 0.00 ? 14  ASN A O    5  
ATOM 9009  C CB   . ASN A 1 14  ? 7.850   6.969   2.589   1.00 0.00 ? 14  ASN A CB   5  
ATOM 9010  C CG   . ASN A 1 14  ? 7.854   6.859   4.115   1.00 0.00 ? 14  ASN A CG   5  
ATOM 9011  O OD1  . ASN A 1 14  ? 8.627   6.110   4.680   1.00 0.00 ? 14  ASN A OD1  5  
ATOM 9012  N ND2  . ASN A 1 14  ? 7.018   7.579   4.812   1.00 0.00 ? 14  ASN A ND2  5  
ATOM 9013  H H    . ASN A 1 14  ? 7.728   9.477   1.203   1.00 0.00 ? 14  ASN A H    5  
ATOM 9014  H HA   . ASN A 1 14  ? 9.697   7.997   2.899   1.00 0.00 ? 14  ASN A HA   5  
ATOM 9015  H HB2  . ASN A 1 14  ? 6.888   7.325   2.257   1.00 0.00 ? 14  ASN A HB2  5  
ATOM 9016  H HB3  . ASN A 1 14  ? 8.043   5.999   2.159   1.00 0.00 ? 14  ASN A HB3  5  
ATOM 9017  H HD21 . ASN A 1 14  ? 6.395   8.184   4.356   1.00 0.00 ? 14  ASN A HD21 5  
ATOM 9018  H HD22 . ASN A 1 14  ? 7.013   7.516   5.790   1.00 0.00 ? 14  ASN A HD22 5  
ATOM 9019  N N    . PHE A 1 15  ? 9.124   7.941   -0.318  1.00 0.00 ? 15  PHE A N    5  
ATOM 9020  C CA   . PHE A 1 15  ? 9.677   7.461   -1.636  1.00 0.00 ? 15  PHE A CA   5  
ATOM 9021  C C    . PHE A 1 15  ? 11.206  7.377   -1.606  1.00 0.00 ? 15  PHE A C    5  
ATOM 9022  O O    . PHE A 1 15  ? 11.778  6.390   -2.026  1.00 0.00 ? 15  PHE A O    5  
ATOM 9023  C CB   . PHE A 1 15  ? 9.252   8.418   -2.759  1.00 0.00 ? 15  PHE A CB   5  
ATOM 9024  C CG   . PHE A 1 15  ? 9.326   7.702   -4.094  1.00 0.00 ? 15  PHE A CG   5  
ATOM 9025  C CD1  . PHE A 1 15  ? 10.555  7.229   -4.574  1.00 0.00 ? 15  PHE A CD1  5  
ATOM 9026  C CD2  . PHE A 1 15  ? 8.163   7.501   -4.847  1.00 0.00 ? 15  PHE A CD2  5  
ATOM 9027  C CE1  . PHE A 1 15  ? 10.620  6.559   -5.800  1.00 0.00 ? 15  PHE A CE1  5  
ATOM 9028  C CE2  . PHE A 1 15  ? 8.230   6.827   -6.073  1.00 0.00 ? 15  PHE A CE2  5  
ATOM 9029  C CZ   . PHE A 1 15  ? 9.460   6.355   -6.548  1.00 0.00 ? 15  PHE A CZ   5  
ATOM 9030  H H    . PHE A 1 15  ? 8.424   8.620   -0.315  1.00 0.00 ? 15  PHE A H    5  
ATOM 9031  H HA   . PHE A 1 15  ? 9.281   6.476   -1.845  1.00 0.00 ? 15  PHE A HA   5  
ATOM 9032  H HB2  . PHE A 1 15  ? 8.239   8.751   -2.584  1.00 0.00 ? 15  PHE A HB2  5  
ATOM 9033  H HB3  . PHE A 1 15  ? 9.914   9.272   -2.773  1.00 0.00 ? 15  PHE A HB3  5  
ATOM 9034  H HD1  . PHE A 1 15  ? 11.454  7.391   -4.008  1.00 0.00 ? 15  PHE A HD1  5  
ATOM 9035  H HD2  . PHE A 1 15  ? 7.216   7.867   -4.485  1.00 0.00 ? 15  PHE A HD2  5  
ATOM 9036  H HE1  . PHE A 1 15  ? 11.567  6.195   -6.168  1.00 0.00 ? 15  PHE A HE1  5  
ATOM 9037  H HE2  . PHE A 1 15  ? 7.332   6.673   -6.654  1.00 0.00 ? 15  PHE A HE2  5  
ATOM 9038  H HZ   . PHE A 1 15  ? 9.516   5.834   -7.492  1.00 0.00 ? 15  PHE A HZ   5  
ATOM 9039  N N    . GLU A 1 16  ? 11.867  8.387   -1.127  1.00 0.00 ? 16  GLU A N    5  
ATOM 9040  C CA   . GLU A 1 16  ? 13.355  8.342   -1.090  1.00 0.00 ? 16  GLU A CA   5  
ATOM 9041  C C    . GLU A 1 16  ? 13.793  7.325   -0.050  1.00 0.00 ? 16  GLU A C    5  
ATOM 9042  O O    . GLU A 1 16  ? 14.739  6.587   -0.254  1.00 0.00 ? 16  GLU A O    5  
ATOM 9043  C CB   . GLU A 1 16  ? 13.911  9.723   -0.742  1.00 0.00 ? 16  GLU A CB   5  
ATOM 9044  C CG   . GLU A 1 16  ? 13.334  10.765  -1.704  1.00 0.00 ? 16  GLU A CG   5  
ATOM 9045  C CD   . GLU A 1 16  ? 13.829  12.157  -1.307  1.00 0.00 ? 16  GLU A CD   5  
ATOM 9046  O OE1  . GLU A 1 16  ? 14.959  12.257  -0.856  1.00 0.00 ? 16  GLU A OE1  5  
ATOM 9047  O OE2  . GLU A 1 16  ? 13.071  13.100  -1.461  1.00 0.00 ? 16  GLU A OE2  5  
ATOM 9048  H H    . GLU A 1 16  ? 11.389  9.169   -0.796  1.00 0.00 ? 16  GLU A H    5  
ATOM 9049  H HA   . GLU A 1 16  ? 13.719  8.023   -2.056  1.00 0.00 ? 16  GLU A HA   5  
ATOM 9050  H HB2  . GLU A 1 16  ? 13.635  9.977   0.271   1.00 0.00 ? 16  GLU A HB2  5  
ATOM 9051  H HB3  . GLU A 1 16  ? 14.986  9.711   -0.829  1.00 0.00 ? 16  GLU A HB3  5  
ATOM 9052  H HG2  . GLU A 1 16  ? 13.656  10.541  -2.712  1.00 0.00 ? 16  GLU A HG2  5  
ATOM 9053  H HG3  . GLU A 1 16  ? 12.256  10.742  -1.657  1.00 0.00 ? 16  GLU A HG3  5  
ATOM 9054  N N    . GLU A 1 17  ? 13.090  7.250   1.049   1.00 0.00 ? 17  GLU A N    5  
ATOM 9055  C CA   . GLU A 1 17  ? 13.437  6.243   2.091   1.00 0.00 ? 17  GLU A CA   5  
ATOM 9056  C C    . GLU A 1 17  ? 13.354  4.839   1.471   1.00 0.00 ? 17  GLU A C    5  
ATOM 9057  O O    . GLU A 1 17  ? 13.950  3.903   1.961   1.00 0.00 ? 17  GLU A O    5  
ATOM 9058  C CB   . GLU A 1 17  ? 12.442  6.351   3.245   1.00 0.00 ? 17  GLU A CB   5  
ATOM 9059  C CG   . GLU A 1 17  ? 13.030  5.698   4.494   1.00 0.00 ? 17  GLU A CG   5  
ATOM 9060  C CD   . GLU A 1 17  ? 12.121  5.974   5.693   1.00 0.00 ? 17  GLU A CD   5  
ATOM 9061  O OE1  . GLU A 1 17  ? 12.295  7.008   6.317   1.00 0.00 ? 17  GLU A OE1  5  
ATOM 9062  O OE2  . GLU A 1 17  ? 11.267  5.148   5.967   1.00 0.00 ? 17  GLU A OE2  5  
ATOM 9063  H H    . GLU A 1 17  ? 12.315  7.837   1.174   1.00 0.00 ? 17  GLU A H    5  
ATOM 9064  H HA   . GLU A 1 17  ? 14.437  6.421   2.454   1.00 0.00 ? 17  GLU A HA   5  
ATOM 9065  H HB2  . GLU A 1 17  ? 12.235  7.393   3.446   1.00 0.00 ? 17  GLU A HB2  5  
ATOM 9066  H HB3  . GLU A 1 17  ? 11.532  5.848   2.975   1.00 0.00 ? 17  GLU A HB3  5  
ATOM 9067  H HG2  . GLU A 1 17  ? 13.108  4.632   4.338   1.00 0.00 ? 17  GLU A HG2  5  
ATOM 9068  H HG3  . GLU A 1 17  ? 14.008  6.108   4.685   1.00 0.00 ? 17  GLU A HG3  5  
ATOM 9069  N N    . LEU A 1 18  ? 12.620  4.699   0.387   1.00 0.00 ? 18  LEU A N    5  
ATOM 9070  C CA   . LEU A 1 18  ? 12.489  3.379   -0.281  1.00 0.00 ? 18  LEU A CA   5  
ATOM 9071  C C    . LEU A 1 18  ? 13.751  3.080   -1.058  1.00 0.00 ? 18  LEU A C    5  
ATOM 9072  O O    . LEU A 1 18  ? 14.287  1.997   -0.982  1.00 0.00 ? 18  LEU A O    5  
ATOM 9073  C CB   . LEU A 1 18  ? 11.319  3.394   -1.270  1.00 0.00 ? 18  LEU A CB   5  
ATOM 9074  C CG   . LEU A 1 18  ? 10.116  4.195   -0.761  1.00 0.00 ? 18  LEU A CG   5  
ATOM 9075  C CD1  . LEU A 1 18  ? 8.923   3.860   -1.639  1.00 0.00 ? 18  LEU A CD1  5  
ATOM 9076  C CD2  . LEU A 1 18  ? 9.761   3.864   0.687   1.00 0.00 ? 18  LEU A CD2  5  
ATOM 9077  H H    . LEU A 1 18  ? 12.156  5.464   0.011   1.00 0.00 ? 18  LEU A H    5  
ATOM 9078  H HA   . LEU A 1 18  ? 12.337  2.614   0.454   1.00 0.00 ? 18  LEU A HA   5  
ATOM 9079  H HB2  . LEU A 1 18  ? 11.653  3.844   -2.193  1.00 0.00 ? 18  LEU A HB2  5  
ATOM 9080  H HB3  . LEU A 1 18  ? 11.013  2.387   -1.465  1.00 0.00 ? 18  LEU A HB3  5  
ATOM 9081  H HG   . LEU A 1 18  ? 10.334  5.233   -0.845  1.00 0.00 ? 18  LEU A HG   5  
ATOM 9082  H HD11 . LEU A 1 18  ? 8.830   2.786   -1.715  1.00 0.00 ? 18  LEU A HD11 5  
ATOM 9083  H HD12 . LEU A 1 18  ? 8.029   4.271   -1.200  1.00 0.00 ? 18  LEU A HD12 5  
ATOM 9084  H HD13 . LEU A 1 18  ? 9.074   4.279   -2.621  1.00 0.00 ? 18  LEU A HD13 5  
ATOM 9085  H HD21 . LEU A 1 18  ? 10.658  3.797   1.281   1.00 0.00 ? 18  LEU A HD21 5  
ATOM 9086  H HD22 . LEU A 1 18  ? 9.126   4.641   1.084   1.00 0.00 ? 18  LEU A HD22 5  
ATOM 9087  H HD23 . LEU A 1 18  ? 9.236   2.923   0.716   1.00 0.00 ? 18  LEU A HD23 5  
ATOM 9088  N N    . LEU A 1 19  ? 14.233  4.030   -1.807  1.00 0.00 ? 19  LEU A N    5  
ATOM 9089  C CA   . LEU A 1 19  ? 15.473  3.781   -2.580  1.00 0.00 ? 19  LEU A CA   5  
ATOM 9090  C C    . LEU A 1 19  ? 16.705  3.990   -1.674  1.00 0.00 ? 19  LEU A C    5  
ATOM 9091  O O    . LEU A 1 19  ? 17.833  3.896   -2.116  1.00 0.00 ? 19  LEU A O    5  
ATOM 9092  C CB   . LEU A 1 19  ? 15.526  4.719   -3.796  1.00 0.00 ? 19  LEU A CB   5  
ATOM 9093  C CG   . LEU A 1 19  ? 14.229  4.626   -4.648  1.00 0.00 ? 19  LEU A CG   5  
ATOM 9094  C CD1  . LEU A 1 19  ? 13.558  3.240   -4.545  1.00 0.00 ? 19  LEU A CD1  5  
ATOM 9095  C CD2  . LEU A 1 19  ? 13.244  5.705   -4.188  1.00 0.00 ? 19  LEU A CD2  5  
ATOM 9096  H H    . LEU A 1 19  ? 13.785  4.898   -1.852  1.00 0.00 ? 19  LEU A H    5  
ATOM 9097  H HA   . LEU A 1 19  ? 15.445  2.759   -2.927  1.00 0.00 ? 19  LEU A HA   5  
ATOM 9098  H HB2  . LEU A 1 19  ? 15.649  5.735   -3.451  1.00 0.00 ? 19  LEU A HB2  5  
ATOM 9099  H HB3  . LEU A 1 19  ? 16.371  4.452   -4.411  1.00 0.00 ? 19  LEU A HB3  5  
ATOM 9100  H HG   . LEU A 1 19  ? 14.481  4.808   -5.680  1.00 0.00 ? 19  LEU A HG   5  
ATOM 9101  H HD11 . LEU A 1 19  ? 14.316  2.470   -4.561  1.00 0.00 ? 19  LEU A HD11 5  
ATOM 9102  H HD12 . LEU A 1 19  ? 13.004  3.177   -3.619  1.00 0.00 ? 19  LEU A HD12 5  
ATOM 9103  H HD13 . LEU A 1 19  ? 12.885  3.101   -5.377  1.00 0.00 ? 19  LEU A HD13 5  
ATOM 9104  H HD21 . LEU A 1 19  ? 13.626  6.200   -3.308  1.00 0.00 ? 19  LEU A HD21 5  
ATOM 9105  H HD22 . LEU A 1 19  ? 13.116  6.430   -4.976  1.00 0.00 ? 19  LEU A HD22 5  
ATOM 9106  H HD23 . LEU A 1 19  ? 12.288  5.255   -3.957  1.00 0.00 ? 19  LEU A HD23 5  
ATOM 9107  N N    . LYS A 1 20  ? 16.489  4.266   -0.405  1.00 0.00 ? 20  LYS A N    5  
ATOM 9108  C CA   . LYS A 1 20  ? 17.610  4.471   0.545   1.00 0.00 ? 20  LYS A CA   5  
ATOM 9109  C C    . LYS A 1 20  ? 17.738  3.241   1.454   1.00 0.00 ? 20  LYS A C    5  
ATOM 9110  O O    . LYS A 1 20  ? 18.796  2.946   1.977   1.00 0.00 ? 20  LYS A O    5  
ATOM 9111  C CB   . LYS A 1 20  ? 17.290  5.697   1.400   1.00 0.00 ? 20  LYS A CB   5  
ATOM 9112  C CG   . LYS A 1 20  ? 17.865  6.947   0.738   1.00 0.00 ? 20  LYS A CG   5  
ATOM 9113  C CD   . LYS A 1 20  ? 17.962  8.075   1.767   1.00 0.00 ? 20  LYS A CD   5  
ATOM 9114  C CE   . LYS A 1 20  ? 19.208  7.876   2.632   1.00 0.00 ? 20  LYS A CE   5  
ATOM 9115  N NZ   . LYS A 1 20  ? 20.329  8.690   2.084   1.00 0.00 ? 20  LYS A NZ   5  
ATOM 9116  H H    . LYS A 1 20  ? 15.581  4.335   -0.068  1.00 0.00 ? 20  LYS A H    5  
ATOM 9117  H HA   . LYS A 1 20  ? 18.526  4.628   0.003   1.00 0.00 ? 20  LYS A HA   5  
ATOM 9118  H HB2  . LYS A 1 20  ? 16.217  5.799   1.485   1.00 0.00 ? 20  LYS A HB2  5  
ATOM 9119  H HB3  . LYS A 1 20  ? 17.715  5.577   2.381   1.00 0.00 ? 20  LYS A HB3  5  
ATOM 9120  H HG2  . LYS A 1 20  ? 18.846  6.726   0.347   1.00 0.00 ? 20  LYS A HG2  5  
ATOM 9121  H HG3  . LYS A 1 20  ? 17.216  7.252   -0.069  1.00 0.00 ? 20  LYS A HG3  5  
ATOM 9122  H HD2  . LYS A 1 20  ? 18.027  9.024   1.254   1.00 0.00 ? 20  LYS A HD2  5  
ATOM 9123  H HD3  . LYS A 1 20  ? 17.084  8.065   2.396   1.00 0.00 ? 20  LYS A HD3  5  
ATOM 9124  H HE2  . LYS A 1 20  ? 18.997  8.189   3.644   1.00 0.00 ? 20  LYS A HE2  5  
ATOM 9125  H HE3  . LYS A 1 20  ? 19.486  6.832   2.630   1.00 0.00 ? 20  LYS A HE3  5  
ATOM 9126  H HZ1  . LYS A 1 20  ? 20.314  8.645   1.044   1.00 0.00 ? 20  LYS A HZ1  5  
ATOM 9127  H HZ2  . LYS A 1 20  ? 20.224  9.677   2.390   1.00 0.00 ? 20  LYS A HZ2  5  
ATOM 9128  H HZ3  . LYS A 1 20  ? 21.234  8.316   2.434   1.00 0.00 ? 20  LYS A HZ3  5  
ATOM 9129  N N    . VAL A 1 21  ? 16.657  2.529   1.640   1.00 0.00 ? 21  VAL A N    5  
ATOM 9130  C CA   . VAL A 1 21  ? 16.668  1.321   2.503   1.00 0.00 ? 21  VAL A CA   5  
ATOM 9131  C C    . VAL A 1 21  ? 16.797  0.079   1.622   1.00 0.00 ? 21  VAL A C    5  
ATOM 9132  O O    . VAL A 1 21  ? 17.378  -0.915  2.015   1.00 0.00 ? 21  VAL A O    5  
ATOM 9133  C CB   . VAL A 1 21  ? 15.365  1.273   3.302   1.00 0.00 ? 21  VAL A CB   5  
ATOM 9134  C CG1  . VAL A 1 21  ? 15.267  2.522   4.176   1.00 0.00 ? 21  VAL A CG1  5  
ATOM 9135  C CG2  . VAL A 1 21  ? 14.159  1.215   2.357   1.00 0.00 ? 21  VAL A CG2  5  
ATOM 9136  H H    . VAL A 1 21  ? 15.832  2.791   1.209   1.00 0.00 ? 21  VAL A H    5  
ATOM 9137  H HA   . VAL A 1 21  ? 17.506  1.369   3.181   1.00 0.00 ? 21  VAL A HA   5  
ATOM 9138  H HB   . VAL A 1 21  ? 15.367  0.403   3.926   1.00 0.00 ? 21  VAL A HB   5  
ATOM 9139  H HG11 . VAL A 1 21  ? 15.532  3.391   3.590   1.00 0.00 ? 21  VAL A HG11 5  
ATOM 9140  H HG12 . VAL A 1 21  ? 14.256  2.628   4.539   1.00 0.00 ? 21  VAL A HG12 5  
ATOM 9141  H HG13 . VAL A 1 21  ? 15.943  2.430   5.011   1.00 0.00 ? 21  VAL A HG13 5  
ATOM 9142  H HG21 . VAL A 1 21  ? 14.456  1.511   1.365   1.00 0.00 ? 21  VAL A HG21 5  
ATOM 9143  H HG22 . VAL A 1 21  ? 13.777  0.206   2.327   1.00 0.00 ? 21  VAL A HG22 5  
ATOM 9144  H HG23 . VAL A 1 21  ? 13.387  1.880   2.711   1.00 0.00 ? 21  VAL A HG23 5  
ATOM 9145  N N    . LEU A 1 22  ? 16.288  0.148   0.414   1.00 0.00 ? 22  LEU A N    5  
ATOM 9146  C CA   . LEU A 1 22  ? 16.410  -1.004  -0.522  1.00 0.00 ? 22  LEU A CA   5  
ATOM 9147  C C    . LEU A 1 22  ? 17.905  -1.261  -0.788  1.00 0.00 ? 22  LEU A C    5  
ATOM 9148  O O    . LEU A 1 22  ? 18.289  -2.320  -1.246  1.00 0.00 ? 22  LEU A O    5  
ATOM 9149  C CB   . LEU A 1 22  ? 15.600  -0.705  -1.824  1.00 0.00 ? 22  LEU A CB   5  
ATOM 9150  C CG   . LEU A 1 22  ? 16.406  -0.007  -2.956  1.00 0.00 ? 22  LEU A CG   5  
ATOM 9151  C CD1  . LEU A 1 22  ? 17.282  1.135   -2.428  1.00 0.00 ? 22  LEU A CD1  5  
ATOM 9152  C CD2  . LEU A 1 22  ? 17.280  -1.034  -3.675  1.00 0.00 ? 22  LEU A CD2  5  
ATOM 9153  H H    . LEU A 1 22  ? 15.855  0.968   0.118   1.00 0.00 ? 22  LEU A H    5  
ATOM 9154  H HA   . LEU A 1 22  ? 15.990  -1.888  -0.044  1.00 0.00 ? 22  LEU A HA   5  
ATOM 9155  H HB2  . LEU A 1 22  ? 15.220  -1.635  -2.210  1.00 0.00 ? 22  LEU A HB2  5  
ATOM 9156  H HB3  . LEU A 1 22  ? 14.760  -0.078  -1.564  1.00 0.00 ? 22  LEU A HB3  5  
ATOM 9157  H HG   . LEU A 1 22  ? 15.704  0.404   -3.667  1.00 0.00 ? 22  LEU A HG   5  
ATOM 9158  H HD11 . LEU A 1 22  ? 16.971  1.406   -1.434  1.00 0.00 ? 22  LEU A HD11 5  
ATOM 9159  H HD12 . LEU A 1 22  ? 18.314  0.823   -2.414  1.00 0.00 ? 22  LEU A HD12 5  
ATOM 9160  H HD13 . LEU A 1 22  ? 17.186  1.987   -3.081  1.00 0.00 ? 22  LEU A HD13 5  
ATOM 9161  H HD21 . LEU A 1 22  ? 16.855  -2.017  -3.550  1.00 0.00 ? 22  LEU A HD21 5  
ATOM 9162  H HD22 . LEU A 1 22  ? 17.325  -0.790  -4.726  1.00 0.00 ? 22  LEU A HD22 5  
ATOM 9163  H HD23 . LEU A 1 22  ? 18.275  -1.012  -3.257  1.00 0.00 ? 22  LEU A HD23 5  
ATOM 9164  N N    . GLY A 1 23  ? 18.749  -0.291  -0.491  1.00 0.00 ? 23  GLY A N    5  
ATOM 9165  C CA   . GLY A 1 23  ? 20.195  -0.464  -0.709  1.00 0.00 ? 23  GLY A CA   5  
ATOM 9166  C C    . GLY A 1 23  ? 20.705  0.634   -1.619  1.00 0.00 ? 23  GLY A C    5  
ATOM 9167  O O    . GLY A 1 23  ? 20.976  0.408   -2.783  1.00 0.00 ? 23  GLY A O    5  
ATOM 9168  H H    . GLY A 1 23  ? 18.424  0.555   -0.126  1.00 0.00 ? 23  GLY A H    5  
ATOM 9169  H HA2  . GLY A 1 23  ? 20.706  -0.409  0.241   1.00 0.00 ? 23  GLY A HA2  5  
ATOM 9170  H HA3  . GLY A 1 23  ? 20.372  -1.410  -1.169  1.00 0.00 ? 23  GLY A HA3  5  
ATOM 9171  N N    . VAL A 1 24  ? 20.833  1.828   -1.098  1.00 0.00 ? 24  VAL A N    5  
ATOM 9172  C CA   . VAL A 1 24  ? 21.330  2.974   -1.924  1.00 0.00 ? 24  VAL A CA   5  
ATOM 9173  C C    . VAL A 1 24  ? 22.604  2.561   -2.699  1.00 0.00 ? 24  VAL A C    5  
ATOM 9174  O O    . VAL A 1 24  ? 23.441  1.830   -2.206  1.00 0.00 ? 24  VAL A O    5  
ATOM 9175  C CB   . VAL A 1 24  ? 21.568  4.196   -0.989  1.00 0.00 ? 24  VAL A CB   5  
ATOM 9176  C CG1  . VAL A 1 24  ? 23.057  4.576   -0.859  1.00 0.00 ? 24  VAL A CG1  5  
ATOM 9177  C CG2  . VAL A 1 24  ? 20.805  5.406   -1.537  1.00 0.00 ? 24  VAL A CG2  5  
ATOM 9178  H H    . VAL A 1 24  ? 20.588  1.972   -0.154  1.00 0.00 ? 24  VAL A H    5  
ATOM 9179  H HA   . VAL A 1 24  ? 20.565  3.228   -2.644  1.00 0.00 ? 24  VAL A HA   5  
ATOM 9180  H HB   . VAL A 1 24  ? 21.182  3.952   -0.009  1.00 0.00 ? 24  VAL A HB   5  
ATOM 9181  H HG11 . VAL A 1 24  ? 23.645  3.683   -0.706  1.00 0.00 ? 24  VAL A HG11 5  
ATOM 9182  H HG12 . VAL A 1 24  ? 23.381  5.069   -1.765  1.00 0.00 ? 24  VAL A HG12 5  
ATOM 9183  H HG13 . VAL A 1 24  ? 23.188  5.243   -0.021  1.00 0.00 ? 24  VAL A HG13 5  
ATOM 9184  H HG21 . VAL A 1 24  ? 19.838  5.089   -1.898  1.00 0.00 ? 24  VAL A HG21 5  
ATOM 9185  H HG22 . VAL A 1 24  ? 20.675  6.137   -0.753  1.00 0.00 ? 24  VAL A HG22 5  
ATOM 9186  H HG23 . VAL A 1 24  ? 21.365  5.846   -2.350  1.00 0.00 ? 24  VAL A HG23 5  
ATOM 9187  N N    . ASN A 1 25  ? 22.723  3.028   -3.904  1.00 0.00 ? 25  ASN A N    5  
ATOM 9188  C CA   . ASN A 1 25  ? 23.899  2.692   -4.756  1.00 0.00 ? 25  ASN A CA   5  
ATOM 9189  C C    . ASN A 1 25  ? 23.686  3.402   -6.081  1.00 0.00 ? 25  ASN A C    5  
ATOM 9190  O O    . ASN A 1 25  ? 23.346  2.795   -7.075  1.00 0.00 ? 25  ASN A O    5  
ATOM 9191  C CB   . ASN A 1 25  ? 23.975  1.177   -4.975  1.00 0.00 ? 25  ASN A CB   5  
ATOM 9192  C CG   . ASN A 1 25  ? 25.433  0.763   -5.184  1.00 0.00 ? 25  ASN A CG   5  
ATOM 9193  O OD1  . ASN A 1 25  ? 26.218  0.775   -4.257  1.00 0.00 ? 25  ASN A OD1  5  
ATOM 9194  N ND2  . ASN A 1 25  ? 25.830  0.395   -6.372  1.00 0.00 ? 25  ASN A ND2  5  
ATOM 9195  H H    . ASN A 1 25  ? 22.019  3.614   -4.263  1.00 0.00 ? 25  ASN A H    5  
ATOM 9196  H HA   . ASN A 1 25  ? 24.807  3.050   -4.293  1.00 0.00 ? 25  ASN A HA   5  
ATOM 9197  H HB2  . ASN A 1 25  ? 23.576  0.667   -4.111  1.00 0.00 ? 25  ASN A HB2  5  
ATOM 9198  H HB3  . ASN A 1 25  ? 23.399  0.910   -5.848  1.00 0.00 ? 25  ASN A HB3  5  
ATOM 9199  H HD21 . ASN A 1 25  ? 25.196  0.386   -7.119  1.00 0.00 ? 25  ASN A HD21 5  
ATOM 9200  H HD22 . ASN A 1 25  ? 26.761  0.129   -6.516  1.00 0.00 ? 25  ASN A HD22 5  
ATOM 9201  N N    . VAL A 1 26  ? 23.821  4.709   -6.050  1.00 0.00 ? 26  VAL A N    5  
ATOM 9202  C CA   . VAL A 1 26  ? 23.580  5.589   -7.240  1.00 0.00 ? 26  VAL A CA   5  
ATOM 9203  C C    . VAL A 1 26  ? 22.110  6.015   -7.251  1.00 0.00 ? 26  VAL A C    5  
ATOM 9204  O O    . VAL A 1 26  ? 21.752  6.985   -7.893  1.00 0.00 ? 26  VAL A O    5  
ATOM 9205  C CB   . VAL A 1 26  ? 23.935  4.919   -8.578  1.00 0.00 ? 26  VAL A CB   5  
ATOM 9206  C CG1  . VAL A 1 26  ? 23.833  5.955   -9.693  1.00 0.00 ? 26  VAL A CG1  5  
ATOM 9207  C CG2  . VAL A 1 26  ? 25.362  4.370   -8.516  1.00 0.00 ? 26  VAL A CG2  5  
ATOM 9208  H H    . VAL A 1 26  ? 24.047  5.135   -5.195  1.00 0.00 ? 26  VAL A H    5  
ATOM 9209  H HA   . VAL A 1 26  ? 24.180  6.480   -7.117  1.00 0.00 ? 26  VAL A HA   5  
ATOM 9210  H HB   . VAL A 1 26  ? 23.241  4.118   -8.780  1.00 0.00 ? 26  VAL A HB   5  
ATOM 9211  H HG11 . VAL A 1 26  ? 24.149  6.917   -9.318  1.00 0.00 ? 26  VAL A HG11 5  
ATOM 9212  H HG12 . VAL A 1 26  ? 24.464  5.661   -10.516 1.00 0.00 ? 26  VAL A HG12 5  
ATOM 9213  H HG13 . VAL A 1 26  ? 22.807  6.019   -10.028 1.00 0.00 ? 26  VAL A HG13 5  
ATOM 9214  H HG21 . VAL A 1 26  ? 25.982  5.041   -7.939  1.00 0.00 ? 26  VAL A HG21 5  
ATOM 9215  H HG22 . VAL A 1 26  ? 25.353  3.396   -8.048  1.00 0.00 ? 26  VAL A HG22 5  
ATOM 9216  H HG23 . VAL A 1 26  ? 25.759  4.284   -9.517  1.00 0.00 ? 26  VAL A HG23 5  
ATOM 9217  N N    . MET A 1 27  ? 21.256  5.339   -6.503  1.00 0.00 ? 27  MET A N    5  
ATOM 9218  C CA   . MET A 1 27  ? 19.833  5.753   -6.432  1.00 0.00 ? 27  MET A CA   5  
ATOM 9219  C C    . MET A 1 27  ? 19.831  7.128   -5.782  1.00 0.00 ? 27  MET A C    5  
ATOM 9220  O O    . MET A 1 27  ? 19.394  8.106   -6.358  1.00 0.00 ? 27  MET A O    5  
ATOM 9221  C CB   . MET A 1 27  ? 19.050  4.773   -5.546  1.00 0.00 ? 27  MET A CB   5  
ATOM 9222  C CG   . MET A 1 27  ? 19.335  3.315   -5.954  1.00 0.00 ? 27  MET A CG   5  
ATOM 9223  S SD   . MET A 1 27  ? 17.938  2.651   -6.900  1.00 0.00 ? 27  MET A SD   5  
ATOM 9224  C CE   . MET A 1 27  ? 18.904  1.904   -8.236  1.00 0.00 ? 27  MET A CE   5  
ATOM 9225  H H    . MET A 1 27  ? 21.556  4.592   -5.959  1.00 0.00 ? 27  MET A H    5  
ATOM 9226  H HA   . MET A 1 27  ? 19.395  5.806   -7.422  1.00 0.00 ? 27  MET A HA   5  
ATOM 9227  H HB2  . MET A 1 27  ? 19.343  4.916   -4.516  1.00 0.00 ? 27  MET A HB2  5  
ATOM 9228  H HB3  . MET A 1 27  ? 17.998  4.974   -5.644  1.00 0.00 ? 27  MET A HB3  5  
ATOM 9229  H HG2  . MET A 1 27  ? 20.226  3.270   -6.557  1.00 0.00 ? 27  MET A HG2  5  
ATOM 9230  H HG3  . MET A 1 27  ? 19.479  2.718   -5.063  1.00 0.00 ? 27  MET A HG3  5  
ATOM 9231  H HE1  . MET A 1 27  ? 19.635  2.617   -8.593  1.00 0.00 ? 27  MET A HE1  5  
ATOM 9232  H HE2  . MET A 1 27  ? 19.410  1.026   -7.869  1.00 0.00 ? 27  MET A HE2  5  
ATOM 9233  H HE3  . MET A 1 27  ? 18.242  1.624   -9.044  1.00 0.00 ? 27  MET A HE3  5  
ATOM 9234  N N    . LEU A 1 28  ? 20.369  7.209   -4.586  1.00 0.00 ? 28  LEU A N    5  
ATOM 9235  C CA   . LEU A 1 28  ? 20.456  8.518   -3.880  1.00 0.00 ? 28  LEU A CA   5  
ATOM 9236  C C    . LEU A 1 28  ? 19.069  9.159   -3.830  1.00 0.00 ? 28  LEU A C    5  
ATOM 9237  O O    . LEU A 1 28  ? 18.825  10.197  -4.415  1.00 0.00 ? 28  LEU A O    5  
ATOM 9238  C CB   . LEU A 1 28  ? 21.453  9.399   -4.641  1.00 0.00 ? 28  LEU A CB   5  
ATOM 9239  C CG   . LEU A 1 28  ? 22.675  9.717   -3.765  1.00 0.00 ? 28  LEU A CG   5  
ATOM 9240  C CD1  . LEU A 1 28  ? 22.233  10.434  -2.486  1.00 0.00 ? 28  LEU A CD1  5  
ATOM 9241  C CD2  . LEU A 1 28  ? 23.397  8.418   -3.396  1.00 0.00 ? 28  LEU A CD2  5  
ATOM 9242  H H    . LEU A 1 28  ? 20.742  6.406   -4.166  1.00 0.00 ? 28  LEU A H    5  
ATOM 9243  H HA   . LEU A 1 28  ? 20.806  8.366   -2.881  1.00 0.00 ? 28  LEU A HA   5  
ATOM 9244  H HB2  . LEU A 1 28  ? 21.783  8.869   -5.527  1.00 0.00 ? 28  LEU A HB2  5  
ATOM 9245  H HB3  . LEU A 1 28  ? 20.974  10.311  -4.930  1.00 0.00 ? 28  LEU A HB3  5  
ATOM 9246  H HG   . LEU A 1 28  ? 23.349  10.358  -4.315  1.00 0.00 ? 28  LEU A HG   5  
ATOM 9247  H HD11 . LEU A 1 28  ? 21.371  11.049  -2.698  1.00 0.00 ? 28  LEU A HD11 5  
ATOM 9248  H HD12 . LEU A 1 28  ? 21.976  9.702   -1.734  1.00 0.00 ? 28  LEU A HD12 5  
ATOM 9249  H HD13 . LEU A 1 28  ? 23.039  11.054  -2.124  1.00 0.00 ? 28  LEU A HD13 5  
ATOM 9250  H HD21 . LEU A 1 28  ? 23.345  7.729   -4.226  1.00 0.00 ? 28  LEU A HD21 5  
ATOM 9251  H HD22 . LEU A 1 28  ? 24.431  8.632   -3.171  1.00 0.00 ? 28  LEU A HD22 5  
ATOM 9252  H HD23 . LEU A 1 28  ? 22.924  7.976   -2.531  1.00 0.00 ? 28  LEU A HD23 5  
ATOM 9253  N N    . ARG A 1 29  ? 18.145  8.509   -3.161  1.00 0.00 ? 29  ARG A N    5  
ATOM 9254  C CA   . ARG A 1 29  ? 16.748  9.032   -3.096  1.00 0.00 ? 29  ARG A CA   5  
ATOM 9255  C C    . ARG A 1 29  ? 16.190  9.139   -4.523  1.00 0.00 ? 29  ARG A C    5  
ATOM 9256  O O    . ARG A 1 29  ? 15.248  9.867   -4.769  1.00 0.00 ? 29  ARG A O    5  
ATOM 9257  C CB   . ARG A 1 29  ? 16.747  10.418  -2.440  1.00 0.00 ? 29  ARG A CB   5  
ATOM 9258  C CG   . ARG A 1 29  ? 17.390  10.338  -1.046  1.00 0.00 ? 29  ARG A CG   5  
ATOM 9259  C CD   . ARG A 1 29  ? 18.703  11.126  -1.033  1.00 0.00 ? 29  ARG A CD   5  
ATOM 9260  N NE   . ARG A 1 29  ? 18.430  12.552  -1.365  1.00 0.00 ? 29  ARG A NE   5  
ATOM 9261  C CZ   . ARG A 1 29  ? 19.090  13.502  -0.760  1.00 0.00 ? 29  ARG A CZ   5  
ATOM 9262  N NH1  . ARG A 1 29  ? 20.394  13.483  -0.746  1.00 0.00 ? 29  ARG A NH1  5  
ATOM 9263  N NH2  . ARG A 1 29  ? 18.445  14.471  -0.170  1.00 0.00 ? 29  ARG A NH2  5  
ATOM 9264  H H    . ARG A 1 29  ? 18.366  7.659   -2.728  1.00 0.00 ? 29  ARG A H    5  
ATOM 9265  H HA   . ARG A 1 29  ? 16.135  8.354   -2.519  1.00 0.00 ? 29  ARG A HA   5  
ATOM 9266  H HB2  . ARG A 1 29  ? 17.302  11.108  -3.059  1.00 0.00 ? 29  ARG A HB2  5  
ATOM 9267  H HB3  . ARG A 1 29  ? 15.731  10.766  -2.344  1.00 0.00 ? 29  ARG A HB3  5  
ATOM 9268  H HG2  . ARG A 1 29  ? 16.713  10.759  -0.316  1.00 0.00 ? 29  ARG A HG2  5  
ATOM 9269  H HG3  . ARG A 1 29  ? 17.590  9.307   -0.795  1.00 0.00 ? 29  ARG A HG3  5  
ATOM 9270  H HD2  . ARG A 1 29  ? 19.150  11.065  -0.052  1.00 0.00 ? 29  ARG A HD2  5  
ATOM 9271  H HD3  . ARG A 1 29  ? 19.380  10.709  -1.764  1.00 0.00 ? 29  ARG A HD3  5  
ATOM 9272  H HE   . ARG A 1 29  ? 17.754  12.778  -2.039  1.00 0.00 ? 29  ARG A HE   5  
ATOM 9273  H HH11 . ARG A 1 29  ? 20.889  12.740  -1.198  1.00 0.00 ? 29  ARG A HH11 5  
ATOM 9274  H HH12 . ARG A 1 29  ? 20.900  14.211  -0.283  1.00 0.00 ? 29  ARG A HH12 5  
ATOM 9275  H HH21 . ARG A 1 29  ? 17.445  14.485  -0.181  1.00 0.00 ? 29  ARG A HH21 5  
ATOM 9276  H HH22 . ARG A 1 29  ? 18.950  15.198  0.294   1.00 0.00 ? 29  ARG A HH22 5  
ATOM 9277  N N    . LYS A 1 30  ? 16.784  8.413   -5.463  1.00 0.00 ? 30  LYS A N    5  
ATOM 9278  C CA   . LYS A 1 30  ? 16.349  8.439   -6.900  1.00 0.00 ? 30  LYS A CA   5  
ATOM 9279  C C    . LYS A 1 30  ? 15.974  9.864   -7.328  1.00 0.00 ? 30  LYS A C    5  
ATOM 9280  O O    . LYS A 1 30  ? 14.820  10.171  -7.527  1.00 0.00 ? 30  LYS A O    5  
ATOM 9281  C CB   . LYS A 1 30  ? 15.165  7.487   -7.091  1.00 0.00 ? 30  LYS A CB   5  
ATOM 9282  C CG   . LYS A 1 30  ? 15.636  6.214   -7.804  1.00 0.00 ? 30  LYS A CG   5  
ATOM 9283  C CD   . LYS A 1 30  ? 14.438  5.516   -8.449  1.00 0.00 ? 30  LYS A CD   5  
ATOM 9284  C CE   . LYS A 1 30  ? 14.935  4.465   -9.444  1.00 0.00 ? 30  LYS A CE   5  
ATOM 9285  N NZ   . LYS A 1 30  ? 13.771  3.721   -10.004 1.00 0.00 ? 30  LYS A NZ   5  
ATOM 9286  H H    . LYS A 1 30  ? 17.530  7.839   -5.218  1.00 0.00 ? 30  LYS A H    5  
ATOM 9287  H HA   . LYS A 1 30  ? 17.170  8.106   -7.514  1.00 0.00 ? 30  LYS A HA   5  
ATOM 9288  H HB2  . LYS A 1 30  ? 14.761  7.226   -6.127  1.00 0.00 ? 30  LYS A HB2  5  
ATOM 9289  H HB3  . LYS A 1 30  ? 14.407  7.968   -7.686  1.00 0.00 ? 30  LYS A HB3  5  
ATOM 9290  H HG2  . LYS A 1 30  ? 16.356  6.475   -8.566  1.00 0.00 ? 30  LYS A HG2  5  
ATOM 9291  H HG3  . LYS A 1 30  ? 16.096  5.550   -7.088  1.00 0.00 ? 30  LYS A HG3  5  
ATOM 9292  H HD2  . LYS A 1 30  ? 13.845  5.036   -7.683  1.00 0.00 ? 30  LYS A HD2  5  
ATOM 9293  H HD3  . LYS A 1 30  ? 13.834  6.243   -8.969  1.00 0.00 ? 30  LYS A HD3  5  
ATOM 9294  H HE2  . LYS A 1 30  ? 15.470  4.953   -10.245 1.00 0.00 ? 30  LYS A HE2  5  
ATOM 9295  H HE3  . LYS A 1 30  ? 15.594  3.775   -8.939  1.00 0.00 ? 30  LYS A HE3  5  
ATOM 9296  H HZ1  . LYS A 1 30  ? 13.161  3.396   -9.229  1.00 0.00 ? 30  LYS A HZ1  5  
ATOM 9297  H HZ2  . LYS A 1 30  ? 13.228  4.348   -10.631 1.00 0.00 ? 30  LYS A HZ2  5  
ATOM 9298  H HZ3  . LYS A 1 30  ? 14.114  2.901   -10.546 1.00 0.00 ? 30  LYS A HZ3  5  
ATOM 9299  N N    . ILE A 1 31  ? 16.958  10.732  -7.438  1.00 0.00 ? 31  ILE A N    5  
ATOM 9300  C CA   . ILE A 1 31  ? 16.702  12.166  -7.828  1.00 0.00 ? 31  ILE A CA   5  
ATOM 9301  C C    . ILE A 1 31  ? 15.741  12.252  -9.029  1.00 0.00 ? 31  ILE A C    5  
ATOM 9302  O O    . ILE A 1 31  ? 16.154  12.236  -10.172 1.00 0.00 ? 31  ILE A O    5  
ATOM 9303  C CB   . ILE A 1 31  ? 18.033  12.838  -8.183  1.00 0.00 ? 31  ILE A CB   5  
ATOM 9304  C CG1  . ILE A 1 31  ? 19.002  12.732  -6.993  1.00 0.00 ? 31  ILE A CG1  5  
ATOM 9305  C CG2  . ILE A 1 31  ? 17.800  14.317  -8.516  1.00 0.00 ? 31  ILE A CG2  5  
ATOM 9306  C CD1  . ILE A 1 31  ? 20.398  12.359  -7.498  1.00 0.00 ? 31  ILE A CD1  5  
ATOM 9307  H H    . ILE A 1 31  ? 17.878  10.440  -7.242  1.00 0.00 ? 31  ILE A H    5  
ATOM 9308  H HA   . ILE A 1 31  ? 16.265  12.683  -6.992  1.00 0.00 ? 31  ILE A HA   5  
ATOM 9309  H HB   . ILE A 1 31  ? 18.456  12.343  -9.039  1.00 0.00 ? 31  ILE A HB   5  
ATOM 9310  H HG12 . ILE A 1 31  ? 19.050  13.683  -6.480  1.00 0.00 ? 31  ILE A HG12 5  
ATOM 9311  H HG13 . ILE A 1 31  ? 18.657  11.975  -6.308  1.00 0.00 ? 31  ILE A HG13 5  
ATOM 9312  H HG21 . ILE A 1 31  ? 17.065  14.398  -9.302  1.00 0.00 ? 31  ILE A HG21 5  
ATOM 9313  H HG22 . ILE A 1 31  ? 17.444  14.832  -7.635  1.00 0.00 ? 31  ILE A HG22 5  
ATOM 9314  H HG23 . ILE A 1 31  ? 18.728  14.763  -8.843  1.00 0.00 ? 31  ILE A HG23 5  
ATOM 9315  H HD11 . ILE A 1 31  ? 20.310  11.793  -8.414  1.00 0.00 ? 31  ILE A HD11 5  
ATOM 9316  H HD12 . ILE A 1 31  ? 20.967  13.258  -7.684  1.00 0.00 ? 31  ILE A HD12 5  
ATOM 9317  H HD13 . ILE A 1 31  ? 20.902  11.761  -6.754  1.00 0.00 ? 31  ILE A HD13 5  
ATOM 9318  N N    . ALA A 1 32  ? 14.461  12.342  -8.753  1.00 0.00 ? 32  ALA A N    5  
ATOM 9319  C CA   . ALA A 1 32  ? 13.413  12.428  -9.823  1.00 0.00 ? 32  ALA A CA   5  
ATOM 9320  C C    . ALA A 1 32  ? 12.067  12.089  -9.183  1.00 0.00 ? 32  ALA A C    5  
ATOM 9321  O O    . ALA A 1 32  ? 11.112  12.837  -9.270  1.00 0.00 ? 32  ALA A O    5  
ATOM 9322  C CB   . ALA A 1 32  ? 13.690  11.421  -10.950 1.00 0.00 ? 32  ALA A CB   5  
ATOM 9323  H H    . ALA A 1 32  ? 14.179  12.351  -7.814  1.00 0.00 ? 32  ALA A H    5  
ATOM 9324  H HA   . ALA A 1 32  ? 13.383  13.431  -10.224 1.00 0.00 ? 32  ALA A HA   5  
ATOM 9325  H HB1  . ALA A 1 32  ? 14.214  10.567  -10.549 1.00 0.00 ? 32  ALA A HB1  5  
ATOM 9326  H HB2  . ALA A 1 32  ? 12.754  11.098  -11.382 1.00 0.00 ? 32  ALA A HB2  5  
ATOM 9327  H HB3  . ALA A 1 32  ? 14.295  11.890  -11.712 1.00 0.00 ? 32  ALA A HB3  5  
ATOM 9328  N N    . VAL A 1 33  ? 12.001  10.957  -8.532  1.00 0.00 ? 33  VAL A N    5  
ATOM 9329  C CA   . VAL A 1 33  ? 10.743  10.527  -7.861  1.00 0.00 ? 33  VAL A CA   5  
ATOM 9330  C C    . VAL A 1 33  ? 10.393  11.501  -6.732  1.00 0.00 ? 33  VAL A C    5  
ATOM 9331  O O    . VAL A 1 33  ? 11.011  12.536  -6.578  1.00 0.00 ? 33  VAL A O    5  
ATOM 9332  C CB   . VAL A 1 33  ? 10.954  9.129   -7.281  1.00 0.00 ? 33  VAL A CB   5  
ATOM 9333  C CG1  . VAL A 1 33  ? 11.203  8.139   -8.420  1.00 0.00 ? 33  VAL A CG1  5  
ATOM 9334  C CG2  . VAL A 1 33  ? 12.162  9.136   -6.335  1.00 0.00 ? 33  VAL A CG2  5  
ATOM 9335  H H    . VAL A 1 33  ? 12.792  10.383  -8.481  1.00 0.00 ? 33  VAL A H    5  
ATOM 9336  H HA   . VAL A 1 33  ? 9.938   10.498  -8.574  1.00 0.00 ? 33  VAL A HA   5  
ATOM 9337  H HB   . VAL A 1 33  ? 10.074  8.832   -6.738  1.00 0.00 ? 33  VAL A HB   5  
ATOM 9338  H HG11 . VAL A 1 33  ? 11.800  8.612   -9.185  1.00 0.00 ? 33  VAL A HG11 5  
ATOM 9339  H HG12 . VAL A 1 33  ? 11.727  7.275   -8.038  1.00 0.00 ? 33  VAL A HG12 5  
ATOM 9340  H HG13 . VAL A 1 33  ? 10.258  7.829   -8.841  1.00 0.00 ? 33  VAL A HG13 5  
ATOM 9341  H HG21 . VAL A 1 33  ? 12.805  9.970   -6.573  1.00 0.00 ? 33  VAL A HG21 5  
ATOM 9342  H HG22 . VAL A 1 33  ? 11.819  9.230   -5.317  1.00 0.00 ? 33  VAL A HG22 5  
ATOM 9343  H HG23 . VAL A 1 33  ? 12.714  8.215   -6.446  1.00 0.00 ? 33  VAL A HG23 5  
ATOM 9344  N N    . ALA A 1 34  ? 9.406   11.164  -5.938  1.00 0.00 ? 34  ALA A N    5  
ATOM 9345  C CA   . ALA A 1 34  ? 8.996   12.049  -4.804  1.00 0.00 ? 34  ALA A CA   5  
ATOM 9346  C C    . ALA A 1 34  ? 8.477   13.383  -5.344  1.00 0.00 ? 34  ALA A C    5  
ATOM 9347  O O    . ALA A 1 34  ? 9.188   14.117  -6.003  1.00 0.00 ? 34  ALA A O    5  
ATOM 9348  C CB   . ALA A 1 34  ? 10.194  12.302  -3.881  1.00 0.00 ? 34  ALA A CB   5  
ATOM 9349  H H    . ALA A 1 34  ? 8.931   10.320  -6.086  1.00 0.00 ? 34  ALA A H    5  
ATOM 9350  H HA   . ALA A 1 34  ? 8.211   11.563  -4.243  1.00 0.00 ? 34  ALA A HA   5  
ATOM 9351  H HB1  . ALA A 1 34  ? 10.753  11.386  -3.758  1.00 0.00 ? 34  ALA A HB1  5  
ATOM 9352  H HB2  . ALA A 1 34  ? 10.831  13.057  -4.317  1.00 0.00 ? 34  ALA A HB2  5  
ATOM 9353  H HB3  . ALA A 1 34  ? 9.841   12.641  -2.918  1.00 0.00 ? 34  ALA A HB3  5  
ATOM 9354  N N    . ALA A 1 35  ? 7.237   13.701  -5.062  1.00 0.00 ? 35  ALA A N    5  
ATOM 9355  C CA   . ALA A 1 35  ? 6.650   14.989  -5.545  1.00 0.00 ? 35  ALA A CA   5  
ATOM 9356  C C    . ALA A 1 35  ? 6.715   15.051  -7.074  1.00 0.00 ? 35  ALA A C    5  
ATOM 9357  O O    . ALA A 1 35  ? 6.829   16.115  -7.655  1.00 0.00 ? 35  ALA A O    5  
ATOM 9358  C CB   . ALA A 1 35  ? 7.432   16.163  -4.953  1.00 0.00 ? 35  ALA A CB   5  
ATOM 9359  H H    . ALA A 1 35  ? 6.690   13.090  -4.526  1.00 0.00 ? 35  ALA A H    5  
ATOM 9360  H HA   . ALA A 1 35  ? 5.619   15.051  -5.229  1.00 0.00 ? 35  ALA A HA   5  
ATOM 9361  H HB1  . ALA A 1 35  ? 8.467   16.098  -5.256  1.00 0.00 ? 35  ALA A HB1  5  
ATOM 9362  H HB2  . ALA A 1 35  ? 7.011   17.092  -5.308  1.00 0.00 ? 35  ALA A HB2  5  
ATOM 9363  H HB3  . ALA A 1 35  ? 7.370   16.130  -3.875  1.00 0.00 ? 35  ALA A HB3  5  
ATOM 9364  N N    . ALA A 1 36  ? 6.639   13.920  -7.727  1.00 0.00 ? 36  ALA A N    5  
ATOM 9365  C CA   . ALA A 1 36  ? 6.693   13.905  -9.219  1.00 0.00 ? 36  ALA A CA   5  
ATOM 9366  C C    . ALA A 1 36  ? 5.277   14.051  -9.780  1.00 0.00 ? 36  ALA A C    5  
ATOM 9367  O O    . ALA A 1 36  ? 5.078   14.600  -10.848 1.00 0.00 ? 36  ALA A O    5  
ATOM 9368  C CB   . ALA A 1 36  ? 7.297   12.583  -9.696  1.00 0.00 ? 36  ALA A CB   5  
ATOM 9369  H H    . ALA A 1 36  ? 6.546   13.078  -7.235  1.00 0.00 ? 36  ALA A H    5  
ATOM 9370  H HA   . ALA A 1 36  ? 7.303   14.726  -9.565  1.00 0.00 ? 36  ALA A HA   5  
ATOM 9371  H HB1  . ALA A 1 36  ? 6.825   11.763  -9.176  1.00 0.00 ? 36  ALA A HB1  5  
ATOM 9372  H HB2  . ALA A 1 36  ? 7.136   12.476  -10.758 1.00 0.00 ? 36  ALA A HB2  5  
ATOM 9373  H HB3  . ALA A 1 36  ? 8.358   12.577  -9.490  1.00 0.00 ? 36  ALA A HB3  5  
ATOM 9374  N N    . SER A 1 37  ? 4.294   13.562  -9.067  1.00 0.00 ? 37  SER A N    5  
ATOM 9375  C CA   . SER A 1 37  ? 2.887   13.667  -9.551  1.00 0.00 ? 37  SER A CA   5  
ATOM 9376  C C    . SER A 1 37  ? 1.931   13.620  -8.357  1.00 0.00 ? 37  SER A C    5  
ATOM 9377  O O    . SER A 1 37  ? 2.347   13.694  -7.215  1.00 0.00 ? 37  SER A O    5  
ATOM 9378  C CB   . SER A 1 37  ? 2.583   12.500  -10.491 1.00 0.00 ? 37  SER A CB   5  
ATOM 9379  O OG   . SER A 1 37  ? 3.524   12.500  -11.556 1.00 0.00 ? 37  SER A OG   5  
ATOM 9380  H H    . SER A 1 37  ? 4.484   13.124  -8.211  1.00 0.00 ? 37  SER A H    5  
ATOM 9381  H HA   . SER A 1 37  ? 2.757   14.599  -10.080 1.00 0.00 ? 37  SER A HA   5  
ATOM 9382  H HB2  . SER A 1 37  ? 2.659   11.571  -9.951  1.00 0.00 ? 37  SER A HB2  5  
ATOM 9383  H HB3  . SER A 1 37  ? 1.580   12.606  -10.882 1.00 0.00 ? 37  SER A HB3  5  
ATOM 9384  H HG   . SER A 1 37  ? 3.716   11.587  -11.783 1.00 0.00 ? 37  SER A HG   5  
ATOM 9385  N N    . LYS A 1 38  ? 0.654   13.498  -8.615  1.00 0.00 ? 38  LYS A N    5  
ATOM 9386  C CA   . LYS A 1 38  ? -0.340  13.446  -7.504  1.00 0.00 ? 38  LYS A CA   5  
ATOM 9387  C C    . LYS A 1 38  ? -1.035  12.072  -7.502  1.00 0.00 ? 38  LYS A C    5  
ATOM 9388  O O    . LYS A 1 38  ? -2.072  11.920  -8.117  1.00 0.00 ? 38  LYS A O    5  
ATOM 9389  C CB   . LYS A 1 38  ? -1.385  14.545  -7.706  1.00 0.00 ? 38  LYS A CB   5  
ATOM 9390  C CG   . LYS A 1 38  ? -0.778  15.901  -7.342  1.00 0.00 ? 38  LYS A CG   5  
ATOM 9391  C CD   . LYS A 1 38  ? -1.636  17.021  -7.935  1.00 0.00 ? 38  LYS A CD   5  
ATOM 9392  C CE   . LYS A 1 38  ? -2.803  17.329  -6.994  1.00 0.00 ? 38  LYS A CE   5  
ATOM 9393  N NZ   . LYS A 1 38  ? -4.030  17.598  -7.796  1.00 0.00 ? 38  LYS A NZ   5  
ATOM 9394  H H    . LYS A 1 38  ? 0.349   13.441  -9.544  1.00 0.00 ? 38  LYS A H    5  
ATOM 9395  H HA   . LYS A 1 38  ? 0.165   13.598  -6.561  1.00 0.00 ? 38  LYS A HA   5  
ATOM 9396  H HB2  . LYS A 1 38  ? -1.700  14.556  -8.739  1.00 0.00 ? 38  LYS A HB2  5  
ATOM 9397  H HB3  . LYS A 1 38  ? -2.237  14.353  -7.071  1.00 0.00 ? 38  LYS A HB3  5  
ATOM 9398  H HG2  . LYS A 1 38  ? -0.744  16.004  -6.267  1.00 0.00 ? 38  LYS A HG2  5  
ATOM 9399  H HG3  . LYS A 1 38  ? 0.223   15.967  -7.742  1.00 0.00 ? 38  LYS A HG3  5  
ATOM 9400  H HD2  . LYS A 1 38  ? -1.032  17.907  -8.063  1.00 0.00 ? 38  LYS A HD2  5  
ATOM 9401  H HD3  . LYS A 1 38  ? -2.023  16.708  -8.894  1.00 0.00 ? 38  LYS A HD3  5  
ATOM 9402  H HE2  . LYS A 1 38  ? -2.977  16.484  -6.343  1.00 0.00 ? 38  LYS A HE2  5  
ATOM 9403  H HE3  . LYS A 1 38  ? -2.565  18.198  -6.398  1.00 0.00 ? 38  LYS A HE3  5  
ATOM 9404  H HZ1  . LYS A 1 38  ? -3.803  18.262  -8.564  1.00 0.00 ? 38  LYS A HZ1  5  
ATOM 9405  H HZ2  . LYS A 1 38  ? -4.383  16.707  -8.199  1.00 0.00 ? 38  LYS A HZ2  5  
ATOM 9406  H HZ3  . LYS A 1 38  ? -4.761  18.012  -7.184  1.00 0.00 ? 38  LYS A HZ3  5  
ATOM 9407  N N    . PRO A 1 39  ? -0.455  11.102  -6.814  1.00 0.00 ? 39  PRO A N    5  
ATOM 9408  C CA   . PRO A 1 39  ? -1.033  9.748   -6.743  1.00 0.00 ? 39  PRO A CA   5  
ATOM 9409  C C    . PRO A 1 39  ? -2.206  9.717   -5.760  1.00 0.00 ? 39  PRO A C    5  
ATOM 9410  O O    . PRO A 1 39  ? -2.068  10.074  -4.605  1.00 0.00 ? 39  PRO A O    5  
ATOM 9411  C CB   . PRO A 1 39  ? 0.126   8.882   -6.240  1.00 0.00 ? 39  PRO A CB   5  
ATOM 9412  C CG   . PRO A 1 39  ? 1.105   9.837   -5.519  1.00 0.00 ? 39  PRO A CG   5  
ATOM 9413  C CD   . PRO A 1 39  ? 0.810   11.252  -6.050  1.00 0.00 ? 39  PRO A CD   5  
ATOM 9414  H HA   . PRO A 1 39  ? -1.345  9.415   -7.720  1.00 0.00 ? 39  PRO A HA   5  
ATOM 9415  H HB2  . PRO A 1 39  ? -0.244  8.134   -5.551  1.00 0.00 ? 39  PRO A HB2  5  
ATOM 9416  H HB3  . PRO A 1 39  ? 0.625   8.409   -7.071  1.00 0.00 ? 39  PRO A HB3  5  
ATOM 9417  H HG2  . PRO A 1 39  ? 0.939   9.797   -4.450  1.00 0.00 ? 39  PRO A HG2  5  
ATOM 9418  H HG3  . PRO A 1 39  ? 2.123   9.567   -5.748  1.00 0.00 ? 39  PRO A HG3  5  
ATOM 9419  H HD2  . PRO A 1 39  ? 0.680   11.943  -5.228  1.00 0.00 ? 39  PRO A HD2  5  
ATOM 9420  H HD3  . PRO A 1 39  ? 1.602   11.584  -6.703  1.00 0.00 ? 39  PRO A HD3  5  
ATOM 9421  N N    . ALA A 1 40  ? -3.358  9.294   -6.213  1.00 0.00 ? 40  ALA A N    5  
ATOM 9422  C CA   . ALA A 1 40  ? -4.548  9.237   -5.315  1.00 0.00 ? 40  ALA A CA   5  
ATOM 9423  C C    . ALA A 1 40  ? -5.049  7.795   -5.219  1.00 0.00 ? 40  ALA A C    5  
ATOM 9424  O O    . ALA A 1 40  ? -4.424  6.878   -5.718  1.00 0.00 ? 40  ALA A O    5  
ATOM 9425  C CB   . ALA A 1 40  ? -5.658  10.122  -5.885  1.00 0.00 ? 40  ALA A CB   5  
ATOM 9426  H H    . ALA A 1 40  ? -3.440  9.014   -7.149  1.00 0.00 ? 40  ALA A H    5  
ATOM 9427  H HA   . ALA A 1 40  ? -4.275  9.591   -4.332  1.00 0.00 ? 40  ALA A HA   5  
ATOM 9428  H HB1  . ALA A 1 40  ? -5.232  11.046  -6.248  1.00 0.00 ? 40  ALA A HB1  5  
ATOM 9429  H HB2  . ALA A 1 40  ? -6.147  9.607   -6.699  1.00 0.00 ? 40  ALA A HB2  5  
ATOM 9430  H HB3  . ALA A 1 40  ? -6.380  10.338  -5.111  1.00 0.00 ? 40  ALA A HB3  5  
ATOM 9431  N N    . VAL A 1 41  ? -6.174  7.592   -4.581  1.00 0.00 ? 41  VAL A N    5  
ATOM 9432  C CA   . VAL A 1 41  ? -6.727  6.213   -4.447  1.00 0.00 ? 41  VAL A CA   5  
ATOM 9433  C C    . VAL A 1 41  ? -8.245  6.291   -4.269  1.00 0.00 ? 41  VAL A C    5  
ATOM 9434  O O    . VAL A 1 41  ? -8.809  7.360   -4.116  1.00 0.00 ? 41  VAL A O    5  
ATOM 9435  C CB   . VAL A 1 41  ? -6.064  5.510   -3.232  1.00 0.00 ? 41  VAL A CB   5  
ATOM 9436  C CG1  . VAL A 1 41  ? -6.756  5.883   -1.914  1.00 0.00 ? 41  VAL A CG1  5  
ATOM 9437  C CG2  . VAL A 1 41  ? -6.117  3.986   -3.416  1.00 0.00 ? 41  VAL A CG2  5  
ATOM 9438  H H    . VAL A 1 41  ? -6.656  8.350   -4.190  1.00 0.00 ? 41  VAL A H    5  
ATOM 9439  H HA   . VAL A 1 41  ? -6.507  5.653   -5.341  1.00 0.00 ? 41  VAL A HA   5  
ATOM 9440  H HB   . VAL A 1 41  ? -5.036  5.823   -3.176  1.00 0.00 ? 41  VAL A HB   5  
ATOM 9441  H HG11 . VAL A 1 41  ? -7.295  6.805   -2.049  1.00 0.00 ? 41  VAL A HG11 5  
ATOM 9442  H HG12 . VAL A 1 41  ? -7.447  5.100   -1.635  1.00 0.00 ? 41  VAL A HG12 5  
ATOM 9443  H HG13 . VAL A 1 41  ? -6.016  6.004   -1.139  1.00 0.00 ? 41  VAL A HG13 5  
ATOM 9444  H HG21 . VAL A 1 41  ? -6.513  3.751   -4.390  1.00 0.00 ? 41  VAL A HG21 5  
ATOM 9445  H HG22 . VAL A 1 41  ? -5.120  3.581   -3.329  1.00 0.00 ? 41  VAL A HG22 5  
ATOM 9446  H HG23 . VAL A 1 41  ? -6.750  3.546   -2.660  1.00 0.00 ? 41  VAL A HG23 5  
ATOM 9447  N N    . GLU A 1 42  ? -8.894  5.164   -4.250  1.00 0.00 ? 42  GLU A N    5  
ATOM 9448  C CA   . GLU A 1 42  ? -10.361 5.150   -4.038  1.00 0.00 ? 42  GLU A CA   5  
ATOM 9449  C C    . GLU A 1 42  ? -10.756 3.794   -3.473  1.00 0.00 ? 42  GLU A C    5  
ATOM 9450  O O    . GLU A 1 42  ? -10.630 2.777   -4.128  1.00 0.00 ? 42  GLU A O    5  
ATOM 9451  C CB   . GLU A 1 42  ? -11.090 5.416   -5.354  1.00 0.00 ? 42  GLU A CB   5  
ATOM 9452  C CG   . GLU A 1 42  ? -10.653 4.389   -6.397  1.00 0.00 ? 42  GLU A CG   5  
ATOM 9453  C CD   . GLU A 1 42  ? -10.865 4.962   -7.800  1.00 0.00 ? 42  GLU A CD   5  
ATOM 9454  O OE1  . GLU A 1 42  ? -9.960  5.614   -8.295  1.00 0.00 ? 42  GLU A OE1  5  
ATOM 9455  O OE2  . GLU A 1 42  ? -11.928 4.740   -8.355  1.00 0.00 ? 42  GLU A OE2  5  
ATOM 9456  H H    . GLU A 1 42  ? -8.406  4.320   -4.351  1.00 0.00 ? 42  GLU A H    5  
ATOM 9457  H HA   . GLU A 1 42  ? -10.613 5.911   -3.325  1.00 0.00 ? 42  GLU A HA   5  
ATOM 9458  H HB2  . GLU A 1 42  ? -12.155 5.341   -5.194  1.00 0.00 ? 42  GLU A HB2  5  
ATOM 9459  H HB3  . GLU A 1 42  ? -10.846 6.408   -5.703  1.00 0.00 ? 42  GLU A HB3  5  
ATOM 9460  H HG2  . GLU A 1 42  ? -9.608  4.157   -6.254  1.00 0.00 ? 42  GLU A HG2  5  
ATOM 9461  H HG3  . GLU A 1 42  ? -11.240 3.490   -6.284  1.00 0.00 ? 42  GLU A HG3  5  
ATOM 9462  N N    . ILE A 1 43  ? -11.214 3.774   -2.251  1.00 0.00 ? 43  ILE A N    5  
ATOM 9463  C CA   . ILE A 1 43  ? -11.597 2.489   -1.624  1.00 0.00 ? 43  ILE A CA   5  
ATOM 9464  C C    . ILE A 1 43  ? -13.106 2.300   -1.717  1.00 0.00 ? 43  ILE A C    5  
ATOM 9465  O O    . ILE A 1 43  ? -13.875 3.240   -1.660  1.00 0.00 ? 43  ILE A O    5  
ATOM 9466  C CB   . ILE A 1 43  ? -11.137 2.478   -0.169  1.00 0.00 ? 43  ILE A CB   5  
ATOM 9467  C CG1  . ILE A 1 43  ? -9.623  2.715   -0.133  1.00 0.00 ? 43  ILE A CG1  5  
ATOM 9468  C CG2  . ILE A 1 43  ? -11.459 1.123   0.469   1.00 0.00 ? 43  ILE A CG2  5  
ATOM 9469  C CD1  . ILE A 1 43  ? -9.134  2.801   1.314   1.00 0.00 ? 43  ILE A CD1  5  
ATOM 9470  H H    . ILE A 1 43  ? -11.296 4.608   -1.743  1.00 0.00 ? 43  ILE A H    5  
ATOM 9471  H HA   . ILE A 1 43  ? -11.112 1.686   -2.149  1.00 0.00 ? 43  ILE A HA   5  
ATOM 9472  H HB   . ILE A 1 43  ? -11.640 3.260   0.370   1.00 0.00 ? 43  ILE A HB   5  
ATOM 9473  H HG12 . ILE A 1 43  ? -9.121  1.899   -0.633  1.00 0.00 ? 43  ILE A HG12 5  
ATOM 9474  H HG13 . ILE A 1 43  ? -9.393  3.640   -0.642  1.00 0.00 ? 43  ILE A HG13 5  
ATOM 9475  H HG21 . ILE A 1 43  ? -12.478 0.848   0.236   1.00 0.00 ? 43  ILE A HG21 5  
ATOM 9476  H HG22 . ILE A 1 43  ? -10.786 0.373   0.079   1.00 0.00 ? 43  ILE A HG22 5  
ATOM 9477  H HG23 . ILE A 1 43  ? -11.340 1.191   1.540   1.00 0.00 ? 43  ILE A HG23 5  
ATOM 9478  H HD11 . ILE A 1 43  ? -9.980  2.890   1.979   1.00 0.00 ? 43  ILE A HD11 5  
ATOM 9479  H HD12 . ILE A 1 43  ? -8.577  1.909   1.558   1.00 0.00 ? 43  ILE A HD12 5  
ATOM 9480  H HD13 . ILE A 1 43  ? -8.496  3.665   1.426   1.00 0.00 ? 43  ILE A HD13 5  
ATOM 9481  N N    . LYS A 1 44  ? -13.515 1.081   -1.880  1.00 0.00 ? 44  LYS A N    5  
ATOM 9482  C CA   . LYS A 1 44  ? -14.958 0.762   -2.006  1.00 0.00 ? 44  LYS A CA   5  
ATOM 9483  C C    . LYS A 1 44  ? -15.190 -0.537  -1.242  1.00 0.00 ? 44  LYS A C    5  
ATOM 9484  O O    . LYS A 1 44  ? -14.684 -1.573  -1.619  1.00 0.00 ? 44  LYS A O    5  
ATOM 9485  C CB   . LYS A 1 44  ? -15.275 0.582   -3.494  1.00 0.00 ? 44  LYS A CB   5  
ATOM 9486  C CG   . LYS A 1 44  ? -14.794 1.814   -4.267  1.00 0.00 ? 44  LYS A CG   5  
ATOM 9487  C CD   . LYS A 1 44  ? -15.496 1.886   -5.621  1.00 0.00 ? 44  LYS A CD   5  
ATOM 9488  C CE   . LYS A 1 44  ? -15.117 0.675   -6.478  1.00 0.00 ? 44  LYS A CE   5  
ATOM 9489  N NZ   . LYS A 1 44  ? -16.318 0.195   -7.219  1.00 0.00 ? 44  LYS A NZ   5  
ATOM 9490  H H    . LYS A 1 44  ? -12.859 0.358   -1.934  1.00 0.00 ? 44  LYS A H    5  
ATOM 9491  H HA   . LYS A 1 44  ? -15.557 1.557   -1.583  1.00 0.00 ? 44  LYS A HA   5  
ATOM 9492  H HB2  . LYS A 1 44  ? -14.759 -0.291  -3.868  1.00 0.00 ? 44  LYS A HB2  5  
ATOM 9493  H HB3  . LYS A 1 44  ? -16.338 0.465   -3.631  1.00 0.00 ? 44  LYS A HB3  5  
ATOM 9494  H HG2  . LYS A 1 44  ? -15.015 2.700   -3.699  1.00 0.00 ? 44  LYS A HG2  5  
ATOM 9495  H HG3  . LYS A 1 44  ? -13.730 1.753   -4.421  1.00 0.00 ? 44  LYS A HG3  5  
ATOM 9496  H HD2  . LYS A 1 44  ? -16.563 1.896   -5.466  1.00 0.00 ? 44  LYS A HD2  5  
ATOM 9497  H HD3  . LYS A 1 44  ? -15.195 2.789   -6.128  1.00 0.00 ? 44  LYS A HD3  5  
ATOM 9498  H HE2  . LYS A 1 44  ? -14.351 0.960   -7.183  1.00 0.00 ? 44  LYS A HE2  5  
ATOM 9499  H HE3  . LYS A 1 44  ? -14.747 -0.117  -5.844  1.00 0.00 ? 44  LYS A HE3  5  
ATOM 9500  H HZ1  . LYS A 1 44  ? -16.780 0.999   -7.688  1.00 0.00 ? 44  LYS A HZ1  5  
ATOM 9501  H HZ2  . LYS A 1 44  ? -16.028 -0.504  -7.933  1.00 0.00 ? 44  LYS A HZ2  5  
ATOM 9502  H HZ3  . LYS A 1 44  ? -16.985 -0.244  -6.553  1.00 0.00 ? 44  LYS A HZ3  5  
ATOM 9503  N N    . GLN A 1 45  ? -15.894 -0.492  -0.140  1.00 0.00 ? 45  GLN A N    5  
ATOM 9504  C CA   . GLN A 1 45  ? -16.065 -1.743  0.653   1.00 0.00 ? 45  GLN A CA   5  
ATOM 9505  C C    . GLN A 1 45  ? -17.473 -1.898  1.224   1.00 0.00 ? 45  GLN A C    5  
ATOM 9506  O O    . GLN A 1 45  ? -18.158 -0.942  1.528   1.00 0.00 ? 45  GLN A O    5  
ATOM 9507  C CB   . GLN A 1 45  ? -15.057 -1.714  1.804   1.00 0.00 ? 45  GLN A CB   5  
ATOM 9508  C CG   . GLN A 1 45  ? -15.285 -0.469  2.667   1.00 0.00 ? 45  GLN A CG   5  
ATOM 9509  C CD   . GLN A 1 45  ? -16.105 -0.845  3.906   1.00 0.00 ? 45  GLN A CD   5  
ATOM 9510  O OE1  . GLN A 1 45  ? -15.641 -1.580  4.754   1.00 0.00 ? 45  GLN A OE1  5  
ATOM 9511  N NE2  . GLN A 1 45  ? -17.313 -0.369  4.049   1.00 0.00 ? 45  GLN A NE2  5  
ATOM 9512  H H    . GLN A 1 45  ? -16.262 0.357   0.181   1.00 0.00 ? 45  GLN A H    5  
ATOM 9513  H HA   . GLN A 1 45  ? -15.845 -2.591  0.024   1.00 0.00 ? 45  GLN A HA   5  
ATOM 9514  H HB2  . GLN A 1 45  ? -15.176 -2.594  2.409   1.00 0.00 ? 45  GLN A HB2  5  
ATOM 9515  H HB3  . GLN A 1 45  ? -14.057 -1.688  1.400   1.00 0.00 ? 45  GLN A HB3  5  
ATOM 9516  H HG2  . GLN A 1 45  ? -14.331 -0.066  2.975   1.00 0.00 ? 45  GLN A HG2  5  
ATOM 9517  H HG3  . GLN A 1 45  ? -15.820 0.271   2.095   1.00 0.00 ? 45  GLN A HG3  5  
ATOM 9518  H HE21 . GLN A 1 45  ? -17.691 0.224   3.367   1.00 0.00 ? 45  GLN A HE21 5  
ATOM 9519  H HE22 . GLN A 1 45  ? -17.841 -0.606  4.839   1.00 0.00 ? 45  GLN A HE22 5  
ATOM 9520  N N    . GLU A 1 46  ? -17.879 -3.126  1.393   1.00 0.00 ? 46  GLU A N    5  
ATOM 9521  C CA   . GLU A 1 46  ? -19.208 -3.434  1.972   1.00 0.00 ? 46  GLU A CA   5  
ATOM 9522  C C    . GLU A 1 46  ? -19.007 -4.491  3.064   1.00 0.00 ? 46  GLU A C    5  
ATOM 9523  O O    . GLU A 1 46  ? -19.089 -5.680  2.812   1.00 0.00 ? 46  GLU A O    5  
ATOM 9524  C CB   . GLU A 1 46  ? -20.121 -3.989  0.881   1.00 0.00 ? 46  GLU A CB   5  
ATOM 9525  C CG   . GLU A 1 46  ? -21.579 -3.807  1.299   1.00 0.00 ? 46  GLU A CG   5  
ATOM 9526  C CD   . GLU A 1 46  ? -22.488 -3.982  0.081   1.00 0.00 ? 46  GLU A CD   5  
ATOM 9527  O OE1  . GLU A 1 46  ? -22.732 -5.117  -0.293  1.00 0.00 ? 46  GLU A OE1  5  
ATOM 9528  O OE2  . GLU A 1 46  ? -22.925 -2.977  -0.456  1.00 0.00 ? 46  GLU A OE2  5  
ATOM 9529  H H    . GLU A 1 46  ? -17.287 -3.862  1.148   1.00 0.00 ? 46  GLU A H    5  
ATOM 9530  H HA   . GLU A 1 46  ? -19.641 -2.541  2.399   1.00 0.00 ? 46  GLU A HA   5  
ATOM 9531  H HB2  . GLU A 1 46  ? -19.939 -3.460  -0.043  1.00 0.00 ? 46  GLU A HB2  5  
ATOM 9532  H HB3  . GLU A 1 46  ? -19.917 -5.040  0.741   1.00 0.00 ? 46  GLU A HB3  5  
ATOM 9533  H HG2  . GLU A 1 46  ? -21.831 -4.544  2.048   1.00 0.00 ? 46  GLU A HG2  5  
ATOM 9534  H HG3  . GLU A 1 46  ? -21.713 -2.817  1.708   1.00 0.00 ? 46  GLU A HG3  5  
ATOM 9535  N N    . GLY A 1 47  ? -18.715 -4.067  4.268   1.00 0.00 ? 47  GLY A N    5  
ATOM 9536  C CA   . GLY A 1 47  ? -18.481 -5.043  5.376   1.00 0.00 ? 47  GLY A CA   5  
ATOM 9537  C C    . GLY A 1 47  ? -17.053 -5.587  5.271   1.00 0.00 ? 47  GLY A C    5  
ATOM 9538  O O    . GLY A 1 47  ? -16.107 -4.835  5.131   1.00 0.00 ? 47  GLY A O    5  
ATOM 9539  H H    . GLY A 1 47  ? -18.634 -3.106  4.440   1.00 0.00 ? 47  GLY A H    5  
ATOM 9540  H HA2  . GLY A 1 47  ? -18.610 -4.545  6.328   1.00 0.00 ? 47  GLY A HA2  5  
ATOM 9541  H HA3  . GLY A 1 47  ? -19.181 -5.858  5.296   1.00 0.00 ? 47  GLY A HA3  5  
ATOM 9542  N N    . ASP A 1 48  ? -16.890 -6.887  5.332   1.00 0.00 ? 48  ASP A N    5  
ATOM 9543  C CA   . ASP A 1 48  ? -15.526 -7.479  5.230   1.00 0.00 ? 48  ASP A CA   5  
ATOM 9544  C C    . ASP A 1 48  ? -15.052 -7.495  3.771   1.00 0.00 ? 48  ASP A C    5  
ATOM 9545  O O    . ASP A 1 48  ? -13.930 -7.875  3.491   1.00 0.00 ? 48  ASP A O    5  
ATOM 9546  C CB   . ASP A 1 48  ? -15.553 -8.903  5.769   1.00 0.00 ? 48  ASP A CB   5  
ATOM 9547  C CG   . ASP A 1 48  ? -16.621 -9.714  5.033   1.00 0.00 ? 48  ASP A CG   5  
ATOM 9548  O OD1  . ASP A 1 48  ? -16.292 -10.306 4.019   1.00 0.00 ? 48  ASP A OD1  5  
ATOM 9549  O OD2  . ASP A 1 48  ? -17.750 -9.728  5.496   1.00 0.00 ? 48  ASP A OD2  5  
ATOM 9550  H H    . ASP A 1 48  ? -17.664 -7.474  5.442   1.00 0.00 ? 48  ASP A H    5  
ATOM 9551  H HA   . ASP A 1 48  ? -14.835 -6.893  5.816   1.00 0.00 ? 48  ASP A HA   5  
ATOM 9552  H HB2  . ASP A 1 48  ? -14.589 -9.351  5.619   1.00 0.00 ? 48  ASP A HB2  5  
ATOM 9553  H HB3  . ASP A 1 48  ? -15.780 -8.882  6.823   1.00 0.00 ? 48  ASP A HB3  5  
ATOM 9554  N N    . THR A 1 49  ? -15.875 -7.070  2.842   1.00 0.00 ? 49  THR A N    5  
ATOM 9555  C CA   . THR A 1 49  ? -15.443 -7.045  1.419   1.00 0.00 ? 49  THR A CA   5  
ATOM 9556  C C    . THR A 1 49  ? -14.815 -5.679  1.141   1.00 0.00 ? 49  THR A C    5  
ATOM 9557  O O    . THR A 1 49  ? -15.328 -4.665  1.568   1.00 0.00 ? 49  THR A O    5  
ATOM 9558  C CB   . THR A 1 49  ? -16.661 -7.245  0.516   1.00 0.00 ? 49  THR A CB   5  
ATOM 9559  O OG1  . THR A 1 49  ? -17.317 -8.455  0.869   1.00 0.00 ? 49  THR A OG1  5  
ATOM 9560  C CG2  . THR A 1 49  ? -16.212 -7.315  -0.942  1.00 0.00 ? 49  THR A CG2  5  
ATOM 9561  H H    . THR A 1 49  ? -16.770 -6.750  3.080   1.00 0.00 ? 49  THR A H    5  
ATOM 9562  H HA   . THR A 1 49  ? -14.719 -7.829  1.240   1.00 0.00 ? 49  THR A HA   5  
ATOM 9563  H HB   . THR A 1 49  ? -17.341 -6.416  0.639   1.00 0.00 ? 49  THR A HB   5  
ATOM 9564  H HG1  . THR A 1 49  ? -17.809 -8.300  1.679   1.00 0.00 ? 49  THR A HG1  5  
ATOM 9565  H HG21 . THR A 1 49  ? -15.448 -8.072  -1.047  1.00 0.00 ? 49  THR A HG21 5  
ATOM 9566  H HG22 . THR A 1 49  ? -17.056 -7.565  -1.567  1.00 0.00 ? 49  THR A HG22 5  
ATOM 9567  H HG23 . THR A 1 49  ? -15.813 -6.357  -1.241  1.00 0.00 ? 49  THR A HG23 5  
ATOM 9568  N N    . PHE A 1 50  ? -13.708 -5.636  0.448   1.00 0.00 ? 50  PHE A N    5  
ATOM 9569  C CA   . PHE A 1 50  ? -13.066 -4.321  0.166   1.00 0.00 ? 50  PHE A CA   5  
ATOM 9570  C C    . PHE A 1 50  ? -12.530 -4.269  -1.266  1.00 0.00 ? 50  PHE A C    5  
ATOM 9571  O O    . PHE A 1 50  ? -12.217 -5.272  -1.876  1.00 0.00 ? 50  PHE A O    5  
ATOM 9572  C CB   . PHE A 1 50  ? -11.899 -4.089  1.132   1.00 0.00 ? 50  PHE A CB   5  
ATOM 9573  C CG   . PHE A 1 50  ? -12.400 -4.154  2.550   1.00 0.00 ? 50  PHE A CG   5  
ATOM 9574  C CD1  . PHE A 1 50  ? -12.524 -5.390  3.180   1.00 0.00 ? 50  PHE A CD1  5  
ATOM 9575  C CD2  . PHE A 1 50  ? -12.754 -2.983  3.227   1.00 0.00 ? 50  PHE A CD2  5  
ATOM 9576  C CE1  . PHE A 1 50  ? -13.004 -5.463  4.486   1.00 0.00 ? 50  PHE A CE1  5  
ATOM 9577  C CE2  . PHE A 1 50  ? -13.232 -3.053  4.542   1.00 0.00 ? 50  PHE A CE2  5  
ATOM 9578  C CZ   . PHE A 1 50  ? -13.358 -4.299  5.170   1.00 0.00 ? 50  PHE A CZ   5  
ATOM 9579  H H    . PHE A 1 50  ? -13.301 -6.459  0.129   1.00 0.00 ? 50  PHE A H    5  
ATOM 9580  H HA   . PHE A 1 50  ? -13.800 -3.537  0.302   1.00 0.00 ? 50  PHE A HA   5  
ATOM 9581  H HB2  . PHE A 1 50  ? -11.149 -4.851  0.980   1.00 0.00 ? 50  PHE A HB2  5  
ATOM 9582  H HB3  . PHE A 1 50  ? -11.468 -3.117  0.948   1.00 0.00 ? 50  PHE A HB3  5  
ATOM 9583  H HD1  . PHE A 1 50  ? -12.243 -6.288  2.658   1.00 0.00 ? 50  PHE A HD1  5  
ATOM 9584  H HD2  . PHE A 1 50  ? -12.651 -2.026  2.737   1.00 0.00 ? 50  PHE A HD2  5  
ATOM 9585  H HE1  . PHE A 1 50  ? -13.097 -6.422  4.972   1.00 0.00 ? 50  PHE A HE1  5  
ATOM 9586  H HE2  . PHE A 1 50  ? -13.501 -2.149  5.071   1.00 0.00 ? 50  PHE A HE2  5  
ATOM 9587  H HZ   . PHE A 1 50  ? -13.732 -4.364  6.181   1.00 0.00 ? 50  PHE A HZ   5  
ATOM 9588  N N    . TYR A 1 51  ? -12.395 -3.081  -1.773  1.00 0.00 ? 51  TYR A N    5  
ATOM 9589  C CA   . TYR A 1 51  ? -11.847 -2.861  -3.136  1.00 0.00 ? 51  TYR A CA   5  
ATOM 9590  C C    . TYR A 1 51  ? -10.839 -1.725  -2.966  1.00 0.00 ? 51  TYR A C    5  
ATOM 9591  O O    . TYR A 1 51  ? -11.022 -0.866  -2.122  1.00 0.00 ? 51  TYR A O    5  
ATOM 9592  C CB   . TYR A 1 51  ? -13.015 -2.516  -4.096  1.00 0.00 ? 51  TYR A CB   5  
ATOM 9593  C CG   . TYR A 1 51  ? -12.617 -1.581  -5.226  1.00 0.00 ? 51  TYR A CG   5  
ATOM 9594  C CD1  . TYR A 1 51  ? -12.414 -0.223  -4.970  1.00 0.00 ? 51  TYR A CD1  5  
ATOM 9595  C CD2  . TYR A 1 51  ? -12.511 -2.065  -6.532  1.00 0.00 ? 51  TYR A CD2  5  
ATOM 9596  C CE1  . TYR A 1 51  ? -12.108 0.651   -6.008  1.00 0.00 ? 51  TYR A CE1  5  
ATOM 9597  C CE2  . TYR A 1 51  ? -12.191 -1.186  -7.578  1.00 0.00 ? 51  TYR A CE2  5  
ATOM 9598  C CZ   . TYR A 1 51  ? -11.993 0.173   -7.315  1.00 0.00 ? 51  TYR A CZ   5  
ATOM 9599  O OH   . TYR A 1 51  ? -11.701 1.041   -8.347  1.00 0.00 ? 51  TYR A OH   5  
ATOM 9600  H H    . TYR A 1 51  ? -12.633 -2.303  -1.227  1.00 0.00 ? 51  TYR A H    5  
ATOM 9601  H HA   . TYR A 1 51  ? -11.338 -3.754  -3.477  1.00 0.00 ? 51  TYR A HA   5  
ATOM 9602  H HB2  . TYR A 1 51  ? -13.388 -3.431  -4.527  1.00 0.00 ? 51  TYR A HB2  5  
ATOM 9603  H HB3  . TYR A 1 51  ? -13.806 -2.058  -3.530  1.00 0.00 ? 51  TYR A HB3  5  
ATOM 9604  H HD1  . TYR A 1 51  ? -12.489 0.153   -3.968  1.00 0.00 ? 51  TYR A HD1  5  
ATOM 9605  H HD2  . TYR A 1 51  ? -12.661 -3.116  -6.730  1.00 0.00 ? 51  TYR A HD2  5  
ATOM 9606  H HE1  . TYR A 1 51  ? -11.959 1.696   -5.794  1.00 0.00 ? 51  TYR A HE1  5  
ATOM 9607  H HE2  . TYR A 1 51  ? -12.103 -1.554  -8.586  1.00 0.00 ? 51  TYR A HE2  5  
ATOM 9608  H HH   . TYR A 1 51  ? -12.329 0.882   -9.056  1.00 0.00 ? 51  TYR A HH   5  
ATOM 9609  N N    . ILE A 1 52  ? -9.763  -1.727  -3.701  1.00 0.00 ? 52  ILE A N    5  
ATOM 9610  C CA   . ILE A 1 52  ? -8.745  -0.649  -3.498  1.00 0.00 ? 52  ILE A CA   5  
ATOM 9611  C C    . ILE A 1 52  ? -8.074  -0.297  -4.823  1.00 0.00 ? 52  ILE A C    5  
ATOM 9612  O O    . ILE A 1 52  ? -7.268  -1.049  -5.334  1.00 0.00 ? 52  ILE A O    5  
ATOM 9613  C CB   . ILE A 1 52  ? -7.678  -1.128  -2.493  1.00 0.00 ? 52  ILE A CB   5  
ATOM 9614  C CG1  . ILE A 1 52  ? -8.345  -1.914  -1.344  1.00 0.00 ? 52  ILE A CG1  5  
ATOM 9615  C CG2  . ILE A 1 52  ? -6.946  0.087   -1.922  1.00 0.00 ? 52  ILE A CG2  5  
ATOM 9616  C CD1  . ILE A 1 52  ? -7.299  -2.355  -0.315  1.00 0.00 ? 52  ILE A CD1  5  
ATOM 9617  H H    . ILE A 1 52  ? -9.610  -2.442  -4.350  1.00 0.00 ? 52  ILE A H    5  
ATOM 9618  H HA   . ILE A 1 52  ? -9.237  0.225   -3.102  1.00 0.00 ? 52  ILE A HA   5  
ATOM 9619  H HB   . ILE A 1 52  ? -6.969  -1.765  -3.003  1.00 0.00 ? 52  ILE A HB   5  
ATOM 9620  H HG12 . ILE A 1 52  ? -9.079  -1.287  -0.863  1.00 0.00 ? 52  ILE A HG12 5  
ATOM 9621  H HG13 . ILE A 1 52  ? -8.834  -2.788  -1.750  1.00 0.00 ? 52  ILE A HG13 5  
ATOM 9622  H HG21 . ILE A 1 52  ? -6.950  0.884   -2.648  1.00 0.00 ? 52  ILE A HG21 5  
ATOM 9623  H HG22 . ILE A 1 52  ? -7.444  0.415   -1.022  1.00 0.00 ? 52  ILE A HG22 5  
ATOM 9624  H HG23 . ILE A 1 52  ? -5.927  -0.186  -1.689  1.00 0.00 ? 52  ILE A HG23 5  
ATOM 9625  H HD11 . ILE A 1 52  ? -6.427  -2.727  -0.826  1.00 0.00 ? 52  ILE A HD11 5  
ATOM 9626  H HD12 . ILE A 1 52  ? -7.024  -1.513  0.300   1.00 0.00 ? 52  ILE A HD12 5  
ATOM 9627  H HD13 . ILE A 1 52  ? -7.712  -3.135  0.308   1.00 0.00 ? 52  ILE A HD13 5  
ATOM 9628  N N    . LYS A 1 53  ? -8.394  0.844   -5.383  1.00 0.00 ? 53  LYS A N    5  
ATOM 9629  C CA   . LYS A 1 53  ? -7.765  1.234   -6.676  1.00 0.00 ? 53  LYS A CA   5  
ATOM 9630  C C    . LYS A 1 53  ? -6.807  2.409   -6.474  1.00 0.00 ? 53  LYS A C    5  
ATOM 9631  O O    . LYS A 1 53  ? -7.212  3.557   -6.470  1.00 0.00 ? 53  LYS A O    5  
ATOM 9632  C CB   . LYS A 1 53  ? -8.843  1.625   -7.683  1.00 0.00 ? 53  LYS A CB   5  
ATOM 9633  C CG   . LYS A 1 53  ? -8.213  1.736   -9.074  1.00 0.00 ? 53  LYS A CG   5  
ATOM 9634  C CD   . LYS A 1 53  ? -9.313  1.750   -10.136 1.00 0.00 ? 53  LYS A CD   5  
ATOM 9635  C CE   . LYS A 1 53  ? -9.954  3.138   -10.194 1.00 0.00 ? 53  LYS A CE   5  
ATOM 9636  N NZ   . LYS A 1 53  ? -10.387 3.430   -11.590 1.00 0.00 ? 53  LYS A NZ   5  
ATOM 9637  H H    . LYS A 1 53  ? -9.042  1.438   -4.952  1.00 0.00 ? 53  LYS A H    5  
ATOM 9638  H HA   . LYS A 1 53  ? -7.219  0.393   -7.058  1.00 0.00 ? 53  LYS A HA   5  
ATOM 9639  H HB2  . LYS A 1 53  ? -9.610  0.867   -7.693  1.00 0.00 ? 53  LYS A HB2  5  
ATOM 9640  H HB3  . LYS A 1 53  ? -9.272  2.574   -7.406  1.00 0.00 ? 53  LYS A HB3  5  
ATOM 9641  H HG2  . LYS A 1 53  ? -7.639  2.647   -9.134  1.00 0.00 ? 53  LYS A HG2  5  
ATOM 9642  H HG3  . LYS A 1 53  ? -7.562  0.893   -9.244  1.00 0.00 ? 53  LYS A HG3  5  
ATOM 9643  H HD2  . LYS A 1 53  ? -8.886  1.509   -11.099 1.00 0.00 ? 53  LYS A HD2  5  
ATOM 9644  H HD3  . LYS A 1 53  ? -10.066 1.019   -9.884  1.00 0.00 ? 53  LYS A HD3  5  
ATOM 9645  H HE2  . LYS A 1 53  ? -10.811 3.167   -9.538  1.00 0.00 ? 53  LYS A HE2  5  
ATOM 9646  H HE3  . LYS A 1 53  ? -9.234  3.879   -9.878  1.00 0.00 ? 53  LYS A HE3  5  
ATOM 9647  H HZ1  . LYS A 1 53  ? -10.691 2.549   -12.052 1.00 0.00 ? 53  LYS A HZ1  5  
ATOM 9648  H HZ2  . LYS A 1 53  ? -11.179 4.105   -11.573 1.00 0.00 ? 53  LYS A HZ2  5  
ATOM 9649  H HZ3  . LYS A 1 53  ? -9.593  3.840   -12.122 1.00 0.00 ? 53  LYS A HZ3  5  
ATOM 9650  N N    . THR A 1 54  ? -5.537  2.125   -6.324  1.00 0.00 ? 54  THR A N    5  
ATOM 9651  C CA   . THR A 1 54  ? -4.531  3.213   -6.139  1.00 0.00 ? 54  THR A CA   5  
ATOM 9652  C C    . THR A 1 54  ? -4.095  3.731   -7.505  1.00 0.00 ? 54  THR A C    5  
ATOM 9653  O O    . THR A 1 54  ? -3.124  3.264   -8.071  1.00 0.00 ? 54  THR A O    5  
ATOM 9654  C CB   . THR A 1 54  ? -3.316  2.665   -5.394  1.00 0.00 ? 54  THR A CB   5  
ATOM 9655  O OG1  . THR A 1 54  ? -3.737  2.048   -4.186  1.00 0.00 ? 54  THR A OG1  5  
ATOM 9656  C CG2  . THR A 1 54  ? -2.349  3.808   -5.079  1.00 0.00 ? 54  THR A CG2  5  
ATOM 9657  H H    . THR A 1 54  ? -5.243  1.191   -6.345  1.00 0.00 ? 54  THR A H    5  
ATOM 9658  H HA   . THR A 1 54  ? -4.963  4.018   -5.576  1.00 0.00 ? 54  THR A HA   5  
ATOM 9659  H HB   . THR A 1 54  ? -2.819  1.942   -6.013  1.00 0.00 ? 54  THR A HB   5  
ATOM 9660  H HG1  . THR A 1 54  ? -3.965  1.137   -4.382  1.00 0.00 ? 54  THR A HG1  5  
ATOM 9661  H HG21 . THR A 1 54  ? -2.243  4.439   -5.950  1.00 0.00 ? 54  THR A HG21 5  
ATOM 9662  H HG22 . THR A 1 54  ? -2.737  4.392   -4.258  1.00 0.00 ? 54  THR A HG22 5  
ATOM 9663  H HG23 . THR A 1 54  ? -1.386  3.401   -4.810  1.00 0.00 ? 54  THR A HG23 5  
ATOM 9664  N N    . SER A 1 55  ? -4.806  4.690   -8.040  1.00 0.00 ? 55  SER A N    5  
ATOM 9665  C CA   . SER A 1 55  ? -4.438  5.237   -9.373  1.00 0.00 ? 55  SER A CA   5  
ATOM 9666  C C    . SER A 1 55  ? -4.008  6.699   -9.238  1.00 0.00 ? 55  SER A C    5  
ATOM 9667  O O    . SER A 1 55  ? -4.444  7.405   -8.348  1.00 0.00 ? 55  SER A O    5  
ATOM 9668  C CB   . SER A 1 55  ? -5.642  5.141   -10.313 1.00 0.00 ? 55  SER A CB   5  
ATOM 9669  O OG   . SER A 1 55  ? -6.578  6.161   -9.989  1.00 0.00 ? 55  SER A OG   5  
ATOM 9670  H H    . SER A 1 55  ? -5.584  5.045   -7.563  1.00 0.00 ? 55  SER A H    5  
ATOM 9671  H HA   . SER A 1 55  ? -3.621  4.660   -9.775  1.00 0.00 ? 55  SER A HA   5  
ATOM 9672  H HB2  . SER A 1 55  ? -5.317  5.270   -11.332 1.00 0.00 ? 55  SER A HB2  5  
ATOM 9673  H HB3  . SER A 1 55  ? -6.103  4.168   -10.205 1.00 0.00 ? 55  SER A HB3  5  
ATOM 9674  H HG   . SER A 1 55  ? -6.831  6.602   -10.803 1.00 0.00 ? 55  SER A HG   5  
ATOM 9675  N N    . THR A 1 56  ? -3.158  7.155   -10.122 1.00 0.00 ? 56  THR A N    5  
ATOM 9676  C CA   . THR A 1 56  ? -2.691  8.571   -10.065 1.00 0.00 ? 56  THR A CA   5  
ATOM 9677  C C    . THR A 1 56  ? -3.258  9.341   -11.261 1.00 0.00 ? 56  THR A C    5  
ATOM 9678  O O    . THR A 1 56  ? -3.487  10.534  -11.188 1.00 0.00 ? 56  THR A O    5  
ATOM 9679  C CB   . THR A 1 56  ? -1.161  8.612   -10.107 1.00 0.00 ? 56  THR A CB   5  
ATOM 9680  O OG1  . THR A 1 56  ? -0.728  9.958   -10.244 1.00 0.00 ? 56  THR A OG1  5  
ATOM 9681  C CG2  . THR A 1 56  ? -0.657  7.789   -11.291 1.00 0.00 ? 56  THR A CG2  5  
ATOM 9682  H H    . THR A 1 56  ? -2.828  6.561   -10.828 1.00 0.00 ? 56  THR A H    5  
ATOM 9683  H HA   . THR A 1 56  ? -3.036  9.025   -9.151  1.00 0.00 ? 56  THR A HA   5  
ATOM 9684  H HB   . THR A 1 56  ? -0.765  8.197   -9.192  1.00 0.00 ? 56  THR A HB   5  
ATOM 9685  H HG1  . THR A 1 56  ? -0.258  10.201  -9.443  1.00 0.00 ? 56  THR A HG1  5  
ATOM 9686  H HG21 . THR A 1 56  ? -1.241  8.025   -12.168 1.00 0.00 ? 56  THR A HG21 5  
ATOM 9687  H HG22 . THR A 1 56  ? 0.381   8.024   -11.476 1.00 0.00 ? 56  THR A HG22 5  
ATOM 9688  H HG23 . THR A 1 56  ? -0.754  6.738   -11.065 1.00 0.00 ? 56  THR A HG23 5  
ATOM 9689  N N    . THR A 1 57  ? -3.489  8.665   -12.359 1.00 0.00 ? 57  THR A N    5  
ATOM 9690  C CA   . THR A 1 57  ? -4.045  9.347   -13.565 1.00 0.00 ? 57  THR A CA   5  
ATOM 9691  C C    . THR A 1 57  ? -4.696  8.307   -14.477 1.00 0.00 ? 57  THR A C    5  
ATOM 9692  O O    . THR A 1 57  ? -5.856  8.413   -14.827 1.00 0.00 ? 57  THR A O    5  
ATOM 9693  C CB   . THR A 1 57  ? -2.921  10.061  -14.321 1.00 0.00 ? 57  THR A CB   5  
ATOM 9694  O OG1  . THR A 1 57  ? -1.861  10.364  -13.425 1.00 0.00 ? 57  THR A OG1  5  
ATOM 9695  C CG2  . THR A 1 57  ? -3.459  11.354  -14.935 1.00 0.00 ? 57  THR A CG2  5  
ATOM 9696  H H    . THR A 1 57  ? -3.297  7.705   -12.390 1.00 0.00 ? 57  THR A H    5  
ATOM 9697  H HA   . THR A 1 57  ? -4.784  10.067  -13.260 1.00 0.00 ? 57  THR A HA   5  
ATOM 9698  H HB   . THR A 1 57  ? -2.557  9.421   -15.107 1.00 0.00 ? 57  THR A HB   5  
ATOM 9699  H HG1  . THR A 1 57  ? -1.267  9.609   -13.401 1.00 0.00 ? 57  THR A HG1  5  
ATOM 9700  H HG21 . THR A 1 57  ? -4.505  11.231  -15.176 1.00 0.00 ? 57  THR A HG21 5  
ATOM 9701  H HG22 . THR A 1 57  ? -3.345  12.163  -14.229 1.00 0.00 ? 57  THR A HG22 5  
ATOM 9702  H HG23 . THR A 1 57  ? -2.907  11.582  -15.836 1.00 0.00 ? 57  THR A HG23 5  
ATOM 9703  N N    . VAL A 1 58  ? -3.954  7.302   -14.860 1.00 0.00 ? 58  VAL A N    5  
ATOM 9704  C CA   . VAL A 1 58  ? -4.514  6.241   -15.748 1.00 0.00 ? 58  VAL A CA   5  
ATOM 9705  C C    . VAL A 1 58  ? -5.551  5.422   -14.974 1.00 0.00 ? 58  VAL A C    5  
ATOM 9706  O O    . VAL A 1 58  ? -5.900  5.748   -13.855 1.00 0.00 ? 58  VAL A O    5  
ATOM 9707  C CB   . VAL A 1 58  ? -3.386  5.322   -16.217 1.00 0.00 ? 58  VAL A CB   5  
ATOM 9708  C CG1  . VAL A 1 58  ? -2.446  6.097   -17.142 1.00 0.00 ? 58  VAL A CG1  5  
ATOM 9709  C CG2  . VAL A 1 58  ? -2.605  4.820   -15.002 1.00 0.00 ? 58  VAL A CG2  5  
ATOM 9710  H H    . VAL A 1 58  ? -3.023  7.243   -14.560 1.00 0.00 ? 58  VAL A H    5  
ATOM 9711  H HA   . VAL A 1 58  ? -4.983  6.699   -16.604 1.00 0.00 ? 58  VAL A HA   5  
ATOM 9712  H HB   . VAL A 1 58  ? -3.804  4.481   -16.752 1.00 0.00 ? 58  VAL A HB   5  
ATOM 9713  H HG11 . VAL A 1 58  ? -2.465  7.144   -16.879 1.00 0.00 ? 58  VAL A HG11 5  
ATOM 9714  H HG12 . VAL A 1 58  ? -1.440  5.716   -17.033 1.00 0.00 ? 58  VAL A HG12 5  
ATOM 9715  H HG13 . VAL A 1 58  ? -2.768  5.977   -18.165 1.00 0.00 ? 58  VAL A HG13 5  
ATOM 9716  H HG21 . VAL A 1 58  ? -3.288  4.652   -14.182 1.00 0.00 ? 58  VAL A HG21 5  
ATOM 9717  H HG22 . VAL A 1 58  ? -2.105  3.898   -15.252 1.00 0.00 ? 58  VAL A HG22 5  
ATOM 9718  H HG23 . VAL A 1 58  ? -1.875  5.562   -14.715 1.00 0.00 ? 58  VAL A HG23 5  
ATOM 9719  N N    . ARG A 1 59  ? -6.043  4.362   -15.565 1.00 0.00 ? 59  ARG A N    5  
ATOM 9720  C CA   . ARG A 1 59  ? -7.058  3.516   -14.871 1.00 0.00 ? 59  ARG A CA   5  
ATOM 9721  C C    . ARG A 1 59  ? -6.393  2.778   -13.706 1.00 0.00 ? 59  ARG A C    5  
ATOM 9722  O O    . ARG A 1 59  ? -6.933  2.709   -12.619 1.00 0.00 ? 59  ARG A O    5  
ATOM 9723  C CB   . ARG A 1 59  ? -7.638  2.501   -15.864 1.00 0.00 ? 59  ARG A CB   5  
ATOM 9724  C CG   . ARG A 1 59  ? -9.153  2.395   -15.668 1.00 0.00 ? 59  ARG A CG   5  
ATOM 9725  C CD   . ARG A 1 59  ? -9.823  3.673   -16.178 1.00 0.00 ? 59  ARG A CD   5  
ATOM 9726  N NE   . ARG A 1 59  ? -11.303 3.527   -16.091 1.00 0.00 ? 59  ARG A NE   5  
ATOM 9727  C CZ   . ARG A 1 59  ? -12.075 4.545   -16.361 1.00 0.00 ? 59  ARG A CZ   5  
ATOM 9728  N NH1  . ARG A 1 59  ? -12.107 5.571   -15.555 1.00 0.00 ? 59  ARG A NH1  5  
ATOM 9729  N NH2  . ARG A 1 59  ? -12.814 4.536   -17.436 1.00 0.00 ? 59  ARG A NH2  5  
ATOM 9730  H H    . ARG A 1 59  ? -5.744  4.123   -16.466 1.00 0.00 ? 59  ARG A H    5  
ATOM 9731  H HA   . ARG A 1 59  ? -7.850  4.145   -14.492 1.00 0.00 ? 59  ARG A HA   5  
ATOM 9732  H HB2  . ARG A 1 59  ? -7.429  2.827   -16.873 1.00 0.00 ? 59  ARG A HB2  5  
ATOM 9733  H HB3  . ARG A 1 59  ? -7.188  1.533   -15.699 1.00 0.00 ? 59  ARG A HB3  5  
ATOM 9734  H HG2  . ARG A 1 59  ? -9.529  1.546   -16.220 1.00 0.00 ? 59  ARG A HG2  5  
ATOM 9735  H HG3  . ARG A 1 59  ? -9.373  2.270   -14.619 1.00 0.00 ? 59  ARG A HG3  5  
ATOM 9736  H HD2  . ARG A 1 59  ? -9.508  4.510   -15.573 1.00 0.00 ? 59  ARG A HD2  5  
ATOM 9737  H HD3  . ARG A 1 59  ? -9.537  3.844   -17.205 1.00 0.00 ? 59  ARG A HD3  5  
ATOM 9738  H HE   . ARG A 1 59  ? -11.697 2.668   -15.832 1.00 0.00 ? 59  ARG A HE   5  
ATOM 9739  H HH11 . ARG A 1 59  ? -11.540 5.577   -14.731 1.00 0.00 ? 59  ARG A HH11 5  
ATOM 9740  H HH12 . ARG A 1 59  ? -12.699 6.350   -15.761 1.00 0.00 ? 59  ARG A HH12 5  
ATOM 9741  H HH21 . ARG A 1 59  ? -12.789 3.750   -18.054 1.00 0.00 ? 59  ARG A HH21 5  
ATOM 9742  H HH22 . ARG A 1 59  ? -13.406 5.316   -17.642 1.00 0.00 ? 59  ARG A HH22 5  
ATOM 9743  N N    . THR A 1 60  ? -5.220  2.235   -13.929 1.00 0.00 ? 60  THR A N    5  
ATOM 9744  C CA   . THR A 1 60  ? -4.493  1.502   -12.848 1.00 0.00 ? 60  THR A CA   5  
ATOM 9745  C C    . THR A 1 60  ? -5.326  0.302   -12.379 1.00 0.00 ? 60  THR A C    5  
ATOM 9746  O O    . THR A 1 60  ? -6.534  0.280   -12.514 1.00 0.00 ? 60  THR A O    5  
ATOM 9747  C CB   . THR A 1 60  ? -4.238  2.454   -11.677 1.00 0.00 ? 60  THR A CB   5  
ATOM 9748  O OG1  . THR A 1 60  ? -3.535  3.597   -12.145 1.00 0.00 ? 60  THR A OG1  5  
ATOM 9749  C CG2  . THR A 1 60  ? -3.408  1.751   -10.601 1.00 0.00 ? 60  THR A CG2  5  
ATOM 9750  H H    . THR A 1 60  ? -4.812  2.318   -14.811 1.00 0.00 ? 60  THR A H    5  
ATOM 9751  H HA   . THR A 1 60  ? -3.548  1.149   -13.233 1.00 0.00 ? 60  THR A HA   5  
ATOM 9752  H HB   . THR A 1 60  ? -5.179  2.761   -11.258 1.00 0.00 ? 60  THR A HB   5  
ATOM 9753  H HG1  . THR A 1 60  ? -2.720  3.297   -12.554 1.00 0.00 ? 60  THR A HG1  5  
ATOM 9754  H HG21 . THR A 1 60  ? -2.813  0.974   -11.055 1.00 0.00 ? 60  THR A HG21 5  
ATOM 9755  H HG22 . THR A 1 60  ? -2.758  2.469   -10.124 1.00 0.00 ? 60  THR A HG22 5  
ATOM 9756  H HG23 . THR A 1 60  ? -4.067  1.317   -9.864  1.00 0.00 ? 60  THR A HG23 5  
ATOM 9757  N N    . THR A 1 61  ? -4.681  -0.700  -11.834 1.00 0.00 ? 61  THR A N    5  
ATOM 9758  C CA   . THR A 1 61  ? -5.421  -1.906  -11.356 1.00 0.00 ? 61  THR A CA   5  
ATOM 9759  C C    . THR A 1 61  ? -5.840  -1.707  -9.897  1.00 0.00 ? 61  THR A C    5  
ATOM 9760  O O    . THR A 1 61  ? -5.432  -0.761  -9.249  1.00 0.00 ? 61  THR A O    5  
ATOM 9761  C CB   . THR A 1 61  ? -4.517  -3.136  -11.467 1.00 0.00 ? 61  THR A CB   5  
ATOM 9762  O OG1  . THR A 1 61  ? -5.175  -4.260  -10.898 1.00 0.00 ? 61  THR A OG1  5  
ATOM 9763  C CG2  . THR A 1 61  ? -3.209  -2.878  -10.722 1.00 0.00 ? 61  THR A CG2  5  
ATOM 9764  H H    . THR A 1 61  ? -3.706  -0.658  -11.742 1.00 0.00 ? 61  THR A H    5  
ATOM 9765  H HA   . THR A 1 61  ? -6.298  -2.051  -11.964 1.00 0.00 ? 61  THR A HA   5  
ATOM 9766  H HB   . THR A 1 61  ? -4.301  -3.332  -12.506 1.00 0.00 ? 61  THR A HB   5  
ATOM 9767  H HG1  . THR A 1 61  ? -5.311  -4.907  -11.594 1.00 0.00 ? 61  THR A HG1  5  
ATOM 9768  H HG21 . THR A 1 61  ? -3.399  -2.238  -9.873  1.00 0.00 ? 61  THR A HG21 5  
ATOM 9769  H HG22 . THR A 1 61  ? -2.799  -3.816  -10.381 1.00 0.00 ? 61  THR A HG22 5  
ATOM 9770  H HG23 . THR A 1 61  ? -2.506  -2.397  -11.386 1.00 0.00 ? 61  THR A HG23 5  
ATOM 9771  N N    . GLU A 1 62  ? -6.655  -2.592  -9.379  1.00 0.00 ? 62  GLU A N    5  
ATOM 9772  C CA   . GLU A 1 62  ? -7.110  -2.464  -7.964  1.00 0.00 ? 62  GLU A CA   5  
ATOM 9773  C C    . GLU A 1 62  ? -7.338  -3.859  -7.373  1.00 0.00 ? 62  GLU A C    5  
ATOM 9774  O O    . GLU A 1 62  ? -7.610  -4.801  -8.095  1.00 0.00 ? 62  GLU A O    5  
ATOM 9775  C CB   . GLU A 1 62  ? -8.425  -1.674  -7.922  1.00 0.00 ? 62  GLU A CB   5  
ATOM 9776  C CG   . GLU A 1 62  ? -9.496  -2.375  -8.769  1.00 0.00 ? 62  GLU A CG   5  
ATOM 9777  C CD   . GLU A 1 62  ? -10.238 -3.425  -7.930  1.00 0.00 ? 62  GLU A CD   5  
ATOM 9778  O OE1  . GLU A 1 62  ? -10.117 -3.392  -6.715  1.00 0.00 ? 62  GLU A OE1  5  
ATOM 9779  O OE2  . GLU A 1 62  ? -10.919 -4.246  -8.522  1.00 0.00 ? 62  GLU A OE2  5  
ATOM 9780  H H    . GLU A 1 62  ? -6.969  -3.342  -9.926  1.00 0.00 ? 62  GLU A H    5  
ATOM 9781  H HA   . GLU A 1 62  ? -6.360  -1.941  -7.389  1.00 0.00 ? 62  GLU A HA   5  
ATOM 9782  H HB2  . GLU A 1 62  ? -8.768  -1.598  -6.902  1.00 0.00 ? 62  GLU A HB2  5  
ATOM 9783  H HB3  . GLU A 1 62  ? -8.257  -0.689  -8.318  1.00 0.00 ? 62  GLU A HB3  5  
ATOM 9784  H HG2  . GLU A 1 62  ? -10.202 -1.640  -9.126  1.00 0.00 ? 62  GLU A HG2  5  
ATOM 9785  H HG3  . GLU A 1 62  ? -9.027  -2.858  -9.610  1.00 0.00 ? 62  GLU A HG3  5  
ATOM 9786  N N    . ILE A 1 63  ? -7.260  -3.996  -6.070  1.00 0.00 ? 63  ILE A N    5  
ATOM 9787  C CA   . ILE A 1 63  ? -7.509  -5.331  -5.455  1.00 0.00 ? 63  ILE A CA   5  
ATOM 9788  C C    . ILE A 1 63  ? -8.965  -5.415  -5.029  1.00 0.00 ? 63  ILE A C    5  
ATOM 9789  O O    . ILE A 1 63  ? -9.355  -4.910  -3.993  1.00 0.00 ? 63  ILE A O    5  
ATOM 9790  C CB   . ILE A 1 63  ? -6.599  -5.600  -4.243  1.00 0.00 ? 63  ILE A CB   5  
ATOM 9791  C CG1  . ILE A 1 63  ? -6.443  -4.342  -3.376  1.00 0.00 ? 63  ILE A CG1  5  
ATOM 9792  C CG2  . ILE A 1 63  ? -5.235  -6.063  -4.743  1.00 0.00 ? 63  ILE A CG2  5  
ATOM 9793  C CD1  . ILE A 1 63  ? -5.600  -4.661  -2.137  1.00 0.00 ? 63  ILE A CD1  5  
ATOM 9794  H H    . ILE A 1 63  ? -7.064  -3.224  -5.507  1.00 0.00 ? 63  ILE A H    5  
ATOM 9795  H HA   . ILE A 1 63  ? -7.327  -6.091  -6.198  1.00 0.00 ? 63  ILE A HA   5  
ATOM 9796  H HB   . ILE A 1 63  ? -7.035  -6.391  -3.649  1.00 0.00 ? 63  ILE A HB   5  
ATOM 9797  H HG12 . ILE A 1 63  ? -5.955  -3.570  -3.944  1.00 0.00 ? 63  ILE A HG12 5  
ATOM 9798  H HG13 . ILE A 1 63  ? -7.418  -4.002  -3.061  1.00 0.00 ? 63  ILE A HG13 5  
ATOM 9799  H HG21 . ILE A 1 63  ? -5.048  -5.637  -5.716  1.00 0.00 ? 63  ILE A HG21 5  
ATOM 9800  H HG22 . ILE A 1 63  ? -4.471  -5.743  -4.054  1.00 0.00 ? 63  ILE A HG22 5  
ATOM 9801  H HG23 . ILE A 1 63  ? -5.231  -7.141  -4.813  1.00 0.00 ? 63  ILE A HG23 5  
ATOM 9802  H HD11 . ILE A 1 63  ? -4.887  -5.432  -2.376  1.00 0.00 ? 63  ILE A HD11 5  
ATOM 9803  H HD12 . ILE A 1 63  ? -5.073  -3.773  -1.822  1.00 0.00 ? 63  ILE A HD12 5  
ATOM 9804  H HD13 . ILE A 1 63  ? -6.243  -5.000  -1.339  1.00 0.00 ? 63  ILE A HD13 5  
ATOM 9805  N N    . ASN A 1 64  ? -9.767  -6.068  -5.822  1.00 0.00 ? 64  ASN A N    5  
ATOM 9806  C CA   . ASN A 1 64  ? -11.206 -6.227  -5.462  1.00 0.00 ? 64  ASN A CA   5  
ATOM 9807  C C    . ASN A 1 64  ? -11.329 -7.539  -4.698  1.00 0.00 ? 64  ASN A C    5  
ATOM 9808  O O    . ASN A 1 64  ? -11.752 -8.555  -5.218  1.00 0.00 ? 64  ASN A O    5  
ATOM 9809  C CB   . ASN A 1 64  ? -12.125 -6.239  -6.703  1.00 0.00 ? 64  ASN A CB   5  
ATOM 9810  C CG   . ASN A 1 64  ? -11.469 -6.921  -7.924  1.00 0.00 ? 64  ASN A CG   5  
ATOM 9811  O OD1  . ASN A 1 64  ? -11.728 -6.534  -9.046  1.00 0.00 ? 64  ASN A OD1  5  
ATOM 9812  N ND2  . ASN A 1 64  ? -10.637 -7.919  -7.771  1.00 0.00 ? 64  ASN A ND2  5  
ATOM 9813  H H    . ASN A 1 64  ? -9.409  -6.466  -6.635  1.00 0.00 ? 64  ASN A H    5  
ATOM 9814  H HA   . ASN A 1 64  ? -11.480 -5.411  -4.805  1.00 0.00 ? 64  ASN A HA   5  
ATOM 9815  H HB2  . ASN A 1 64  ? -13.034 -6.766  -6.458  1.00 0.00 ? 64  ASN A HB2  5  
ATOM 9816  H HB3  . ASN A 1 64  ? -12.372 -5.220  -6.963  1.00 0.00 ? 64  ASN A HB3  5  
ATOM 9817  H HD21 . ASN A 1 64  ? -10.413 -8.244  -6.878  1.00 0.00 ? 64  ASN A HD21 5  
ATOM 9818  H HD22 . ASN A 1 64  ? -10.236 -8.344  -8.557  1.00 0.00 ? 64  ASN A HD22 5  
ATOM 9819  N N    . PHE A 1 65  ? -10.907 -7.518  -3.473  1.00 0.00 ? 65  PHE A N    5  
ATOM 9820  C CA   . PHE A 1 65  ? -10.910 -8.749  -2.643  1.00 0.00 ? 65  PHE A CA   5  
ATOM 9821  C C    . PHE A 1 65  ? -11.896 -8.610  -1.476  1.00 0.00 ? 65  PHE A C    5  
ATOM 9822  O O    . PHE A 1 65  ? -12.762 -7.765  -1.470  1.00 0.00 ? 65  PHE A O    5  
ATOM 9823  C CB   . PHE A 1 65  ? -9.471  -8.934  -2.098  1.00 0.00 ? 65  PHE A CB   5  
ATOM 9824  C CG   . PHE A 1 65  ? -9.162  -7.848  -1.070  1.00 0.00 ? 65  PHE A CG   5  
ATOM 9825  C CD1  . PHE A 1 65  ? -8.777  -6.571  -1.496  1.00 0.00 ? 65  PHE A CD1  5  
ATOM 9826  C CD2  . PHE A 1 65  ? -9.311  -8.106  0.301   1.00 0.00 ? 65  PHE A CD2  5  
ATOM 9827  C CE1  . PHE A 1 65  ? -8.540  -5.560  -0.569  1.00 0.00 ? 65  PHE A CE1  5  
ATOM 9828  C CE2  . PHE A 1 65  ? -9.078  -7.089  1.232   1.00 0.00 ? 65  PHE A CE2  5  
ATOM 9829  C CZ   . PHE A 1 65  ? -8.694  -5.814  0.798   1.00 0.00 ? 65  PHE A CZ   5  
ATOM 9830  H H    . PHE A 1 65  ? -10.552 -6.684  -3.103  1.00 0.00 ? 65  PHE A H    5  
ATOM 9831  H HA   . PHE A 1 65  ? -11.178 -9.600  -3.249  1.00 0.00 ? 65  PHE A HA   5  
ATOM 9832  H HB2  . PHE A 1 65  ? -9.380  -9.905  -1.636  1.00 0.00 ? 65  PHE A HB2  5  
ATOM 9833  H HB3  . PHE A 1 65  ? -8.768  -8.860  -2.915  1.00 0.00 ? 65  PHE A HB3  5  
ATOM 9834  H HD1  . PHE A 1 65  ? -8.652  -6.368  -2.542  1.00 0.00 ? 65  PHE A HD1  5  
ATOM 9835  H HD2  . PHE A 1 65  ? -9.604  -9.087  0.644   1.00 0.00 ? 65  PHE A HD2  5  
ATOM 9836  H HE1  . PHE A 1 65  ? -8.252  -4.577  -0.914  1.00 0.00 ? 65  PHE A HE1  5  
ATOM 9837  H HE2  . PHE A 1 65  ? -9.194  -7.290  2.285   1.00 0.00 ? 65  PHE A HE2  5  
ATOM 9838  H HZ   . PHE A 1 65  ? -8.520  -5.028  1.516   1.00 0.00 ? 65  PHE A HZ   5  
ATOM 9839  N N    . LYS A 1 66  ? -11.711 -9.428  -0.481  1.00 0.00 ? 66  LYS A N    5  
ATOM 9840  C CA   . LYS A 1 66  ? -12.537 -9.386  0.744   1.00 0.00 ? 66  LYS A CA   5  
ATOM 9841  C C    . LYS A 1 66  ? -11.627 -9.888  1.854   1.00 0.00 ? 66  LYS A C    5  
ATOM 9842  O O    . LYS A 1 66  ? -11.097 -10.979 1.773   1.00 0.00 ? 66  LYS A O    5  
ATOM 9843  C CB   . LYS A 1 66  ? -13.769 -10.284 0.609   1.00 0.00 ? 66  LYS A CB   5  
ATOM 9844  C CG   . LYS A 1 66  ? -13.388 -11.629 -0.025  1.00 0.00 ? 66  LYS A CG   5  
ATOM 9845  C CD   . LYS A 1 66  ? -13.883 -12.781 0.855   1.00 0.00 ? 66  LYS A CD   5  
ATOM 9846  C CE   . LYS A 1 66  ? -15.404 -12.900 0.734   1.00 0.00 ? 66  LYS A CE   5  
ATOM 9847  N NZ   . LYS A 1 66  ? -15.780 -13.021 -0.702  1.00 0.00 ? 66  LYS A NZ   5  
ATOM 9848  H H    . LYS A 1 66  ? -10.985 -10.075 -0.528  1.00 0.00 ? 66  LYS A H    5  
ATOM 9849  H HA   . LYS A 1 66  ? -12.833 -8.368  0.953   1.00 0.00 ? 66  LYS A HA   5  
ATOM 9850  H HB2  . LYS A 1 66  ? -14.190 -10.450 1.588   1.00 0.00 ? 66  LYS A HB2  5  
ATOM 9851  H HB3  . LYS A 1 66  ? -14.495 -9.790  -0.014  1.00 0.00 ? 66  LYS A HB3  5  
ATOM 9852  H HG2  . LYS A 1 66  ? -13.843 -11.702 -1.001  1.00 0.00 ? 66  LYS A HG2  5  
ATOM 9853  H HG3  . LYS A 1 66  ? -12.316 -11.690 -0.124  1.00 0.00 ? 66  LYS A HG3  5  
ATOM 9854  H HD2  . LYS A 1 66  ? -13.423 -13.704 0.532   1.00 0.00 ? 66  LYS A HD2  5  
ATOM 9855  H HD3  . LYS A 1 66  ? -13.620 -12.588 1.884   1.00 0.00 ? 66  LYS A HD3  5  
ATOM 9856  H HE2  . LYS A 1 66  ? -15.740 -13.775 1.270   1.00 0.00 ? 66  LYS A HE2  5  
ATOM 9857  H HE3  . LYS A 1 66  ? -15.868 -12.020 1.155   1.00 0.00 ? 66  LYS A HE3  5  
ATOM 9858  H HZ1  . LYS A 1 66  ? -15.081 -13.614 -1.195  1.00 0.00 ? 66  LYS A HZ1  5  
ATOM 9859  H HZ2  . LYS A 1 66  ? -16.721 -13.456 -0.779  1.00 0.00 ? 66  LYS A HZ2  5  
ATOM 9860  H HZ3  . LYS A 1 66  ? -15.802 -12.076 -1.136  1.00 0.00 ? 66  LYS A HZ3  5  
ATOM 9861  N N    . VAL A 1 67  ? -11.390 -9.080  2.856   1.00 0.00 ? 67  VAL A N    5  
ATOM 9862  C CA   . VAL A 1 67  ? -10.452 -9.468  3.961   1.00 0.00 ? 67  VAL A CA   5  
ATOM 9863  C C    . VAL A 1 67  ? -10.691 -10.918 4.410   1.00 0.00 ? 67  VAL A C    5  
ATOM 9864  O O    . VAL A 1 67  ? -11.799 -11.421 4.381   1.00 0.00 ? 67  VAL A O    5  
ATOM 9865  C CB   . VAL A 1 67  ? -10.633 -8.510  5.139   1.00 0.00 ? 67  VAL A CB   5  
ATOM 9866  C CG1  . VAL A 1 67  ? -9.677  -8.902  6.269   1.00 0.00 ? 67  VAL A CG1  5  
ATOM 9867  C CG2  . VAL A 1 67  ? -10.300 -7.088  4.690   1.00 0.00 ? 67  VAL A CG2  5  
ATOM 9868  H H    . VAL A 1 67  ? -11.801 -8.195  2.863   1.00 0.00 ? 67  VAL A H    5  
ATOM 9869  H HA   . VAL A 1 67  ? -9.434  -9.381  3.597   1.00 0.00 ? 67  VAL A HA   5  
ATOM 9870  H HB   . VAL A 1 67  ? -11.656 -8.551  5.486   1.00 0.00 ? 67  VAL A HB   5  
ATOM 9871  H HG11 . VAL A 1 67  ? -8.831  -9.430  5.856   1.00 0.00 ? 67  VAL A HG11 5  
ATOM 9872  H HG12 . VAL A 1 67  ? -9.334  -8.013  6.777   1.00 0.00 ? 67  VAL A HG12 5  
ATOM 9873  H HG13 . VAL A 1 67  ? -10.194 -9.541  6.969   1.00 0.00 ? 67  VAL A HG13 5  
ATOM 9874  H HG21 . VAL A 1 67  ? -10.563 -6.961  3.654   1.00 0.00 ? 67  VAL A HG21 5  
ATOM 9875  H HG22 . VAL A 1 67  ? -10.851 -6.386  5.289   1.00 0.00 ? 67  VAL A HG22 5  
ATOM 9876  H HG23 . VAL A 1 67  ? -9.244  -6.913  4.816   1.00 0.00 ? 67  VAL A HG23 5  
ATOM 9877  N N    . GLY A 1 68  ? -9.639  -11.587 4.790   1.00 0.00 ? 68  GLY A N    5  
ATOM 9878  C CA   . GLY A 1 68  ? -9.752  -13.010 5.207   1.00 0.00 ? 68  GLY A CA   5  
ATOM 9879  C C    . GLY A 1 68  ? -9.278  -13.915 4.057   1.00 0.00 ? 68  GLY A C    5  
ATOM 9880  O O    . GLY A 1 68  ? -9.477  -15.115 4.088   1.00 0.00 ? 68  GLY A O    5  
ATOM 9881  H H    . GLY A 1 68  ? -8.759  -11.155 4.776   1.00 0.00 ? 68  GLY A H    5  
ATOM 9882  H HA2  . GLY A 1 68  ? -9.137  -13.180 6.080   1.00 0.00 ? 68  GLY A HA2  5  
ATOM 9883  H HA3  . GLY A 1 68  ? -10.781 -13.238 5.439   1.00 0.00 ? 68  GLY A HA3  5  
ATOM 9884  N N    . GLU A 1 69  ? -8.652  -13.351 3.041   1.00 0.00 ? 69  GLU A N    5  
ATOM 9885  C CA   . GLU A 1 69  ? -8.171  -14.182 1.900   1.00 0.00 ? 69  GLU A CA   5  
ATOM 9886  C C    . GLU A 1 69  ? -6.894  -13.569 1.314   1.00 0.00 ? 69  GLU A C    5  
ATOM 9887  O O    . GLU A 1 69  ? -6.378  -12.582 1.812   1.00 0.00 ? 69  GLU A O    5  
ATOM 9888  C CB   . GLU A 1 69  ? -9.253  -14.246 0.819   1.00 0.00 ? 69  GLU A CB   5  
ATOM 9889  C CG   . GLU A 1 69  ? -9.627  -12.828 0.377   1.00 0.00 ? 69  GLU A CG   5  
ATOM 9890  C CD   . GLU A 1 69  ? -8.967  -12.514 -0.969  1.00 0.00 ? 69  GLU A CD   5  
ATOM 9891  O OE1  . GLU A 1 69  ? -7.813  -12.118 -0.962  1.00 0.00 ? 69  GLU A OE1  5  
ATOM 9892  O OE2  . GLU A 1 69  ? -9.627  -12.675 -1.982  1.00 0.00 ? 69  GLU A OE2  5  
ATOM 9893  H H    . GLU A 1 69  ? -8.498  -12.384 3.031   1.00 0.00 ? 69  GLU A H    5  
ATOM 9894  H HA   . GLU A 1 69  ? -7.960  -15.176 2.252   1.00 0.00 ? 69  GLU A HA   5  
ATOM 9895  H HB2  . GLU A 1 69  ? -8.881  -14.805 -0.028  1.00 0.00 ? 69  GLU A HB2  5  
ATOM 9896  H HB3  . GLU A 1 69  ? -10.128 -14.738 1.217   1.00 0.00 ? 69  GLU A HB3  5  
ATOM 9897  H HG2  . GLU A 1 69  ? -10.699 -12.758 0.278   1.00 0.00 ? 69  GLU A HG2  5  
ATOM 9898  H HG3  . GLU A 1 69  ? -9.287  -12.117 1.116   1.00 0.00 ? 69  GLU A HG3  5  
ATOM 9899  N N    . GLU A 1 70  ? -6.375  -14.162 0.268   1.00 0.00 ? 70  GLU A N    5  
ATOM 9900  C CA   . GLU A 1 70  ? -5.117  -13.639 -0.351  1.00 0.00 ? 70  GLU A CA   5  
ATOM 9901  C C    . GLU A 1 70  ? -5.302  -13.289 -1.823  1.00 0.00 ? 70  GLU A C    5  
ATOM 9902  O O    . GLU A 1 70  ? -6.310  -13.574 -2.440  1.00 0.00 ? 70  GLU A O    5  
ATOM 9903  C CB   . GLU A 1 70  ? -3.997  -14.695 -0.284  1.00 0.00 ? 70  GLU A CB   5  
ATOM 9904  C CG   . GLU A 1 70  ? -4.546  -16.102 -0.509  1.00 0.00 ? 70  GLU A CG   5  
ATOM 9905  C CD   . GLU A 1 70  ? -5.039  -16.251 -1.950  1.00 0.00 ? 70  GLU A CD   5  
ATOM 9906  O OE1  . GLU A 1 70  ? -4.342  -15.799 -2.843  1.00 0.00 ? 70  GLU A OE1  5  
ATOM 9907  O OE2  . GLU A 1 70  ? -6.105  -16.815 -2.135  1.00 0.00 ? 70  GLU A OE2  5  
ATOM 9908  H H    . GLU A 1 70  ? -6.801  -14.958 -0.095  1.00 0.00 ? 70  GLU A H    5  
ATOM 9909  H HA   . GLU A 1 70  ? -4.803  -12.759 0.181   1.00 0.00 ? 70  GLU A HA   5  
ATOM 9910  H HB2  . GLU A 1 70  ? -3.267  -14.481 -1.051  1.00 0.00 ? 70  GLU A HB2  5  
ATOM 9911  H HB3  . GLU A 1 70  ? -3.516  -14.650 0.672   1.00 0.00 ? 70  GLU A HB3  5  
ATOM 9912  H HG2  . GLU A 1 70  ? -3.760  -16.815 -0.324  1.00 0.00 ? 70  GLU A HG2  5  
ATOM 9913  H HG3  . GLU A 1 70  ? -5.361  -16.276 0.170   1.00 0.00 ? 70  GLU A HG3  5  
ATOM 9914  N N    . PHE A 1 71  ? -4.268  -12.729 -2.390  1.00 0.00 ? 71  PHE A N    5  
ATOM 9915  C CA   . PHE A 1 71  ? -4.254  -12.398 -3.836  1.00 0.00 ? 71  PHE A CA   5  
ATOM 9916  C C    . PHE A 1 71  ? -3.022  -13.084 -4.411  1.00 0.00 ? 71  PHE A C    5  
ATOM 9917  O O    . PHE A 1 71  ? -2.328  -13.806 -3.719  1.00 0.00 ? 71  PHE A O    5  
ATOM 9918  C CB   . PHE A 1 71  ? -4.112  -10.883 -4.107  1.00 0.00 ? 71  PHE A CB   5  
ATOM 9919  C CG   . PHE A 1 71  ? -4.763  -10.017 -3.045  1.00 0.00 ? 71  PHE A CG   5  
ATOM 9920  C CD1  . PHE A 1 71  ? -5.972  -10.386 -2.446  1.00 0.00 ? 71  PHE A CD1  5  
ATOM 9921  C CD2  . PHE A 1 71  ? -4.150  -8.808  -2.689  1.00 0.00 ? 71  PHE A CD2  5  
ATOM 9922  C CE1  . PHE A 1 71  ? -6.559  -9.545  -1.488  1.00 0.00 ? 71  PHE A CE1  5  
ATOM 9923  C CE2  . PHE A 1 71  ? -4.744  -7.969  -1.743  1.00 0.00 ? 71  PHE A CE2  5  
ATOM 9924  C CZ   . PHE A 1 71  ? -5.942  -8.334  -1.144  1.00 0.00 ? 71  PHE A CZ   5  
ATOM 9925  H H    . PHE A 1 71  ? -3.462  -12.576 -1.860  1.00 0.00 ? 71  PHE A H    5  
ATOM 9926  H HA   . PHE A 1 71  ? -5.136  -12.783 -4.318  1.00 0.00 ? 71  PHE A HA   5  
ATOM 9927  H HB2  . PHE A 1 71  ? -3.063  -10.631 -4.155  1.00 0.00 ? 71  PHE A HB2  5  
ATOM 9928  H HB3  . PHE A 1 71  ? -4.564  -10.660 -5.063  1.00 0.00 ? 71  PHE A HB3  5  
ATOM 9929  H HD1  . PHE A 1 71  ? -6.447  -11.316 -2.715  1.00 0.00 ? 71  PHE A HD1  5  
ATOM 9930  H HD2  . PHE A 1 71  ? -3.216  -8.521  -3.150  1.00 0.00 ? 71  PHE A HD2  5  
ATOM 9931  H HE1  . PHE A 1 71  ? -7.484  -9.831  -1.014  1.00 0.00 ? 71  PHE A HE1  5  
ATOM 9932  H HE2  . PHE A 1 71  ? -4.268  -7.045  -1.462  1.00 0.00 ? 71  PHE A HE2  5  
ATOM 9933  H HZ   . PHE A 1 71  ? -6.399  -7.670  -0.429  1.00 0.00 ? 71  PHE A HZ   5  
ATOM 9934  N N    . GLU A 1 72  ? -2.728  -12.839 -5.649  1.00 0.00 ? 72  GLU A N    5  
ATOM 9935  C CA   . GLU A 1 72  ? -1.515  -13.448 -6.258  1.00 0.00 ? 72  GLU A CA   5  
ATOM 9936  C C    . GLU A 1 72  ? -0.726  -12.367 -6.972  1.00 0.00 ? 72  GLU A C    5  
ATOM 9937  O O    . GLU A 1 72  ? -1.264  -11.350 -7.368  1.00 0.00 ? 72  GLU A O    5  
ATOM 9938  C CB   . GLU A 1 72  ? -1.893  -14.528 -7.258  1.00 0.00 ? 72  GLU A CB   5  
ATOM 9939  C CG   . GLU A 1 72  ? -2.837  -15.523 -6.594  1.00 0.00 ? 72  GLU A CG   5  
ATOM 9940  C CD   . GLU A 1 72  ? -3.603  -16.299 -7.667  1.00 0.00 ? 72  GLU A CD   5  
ATOM 9941  O OE1  . GLU A 1 72  ? -4.417  -15.691 -8.343  1.00 0.00 ? 72  GLU A OE1  5  
ATOM 9942  O OE2  . GLU A 1 72  ? -3.364  -17.489 -7.794  1.00 0.00 ? 72  GLU A OE2  5  
ATOM 9943  H H    . GLU A 1 72  ? -3.293  -12.238 -6.170  1.00 0.00 ? 72  GLU A H    5  
ATOM 9944  H HA   . GLU A 1 72  ? -0.908  -13.879 -5.479  1.00 0.00 ? 72  GLU A HA   5  
ATOM 9945  H HB2  . GLU A 1 72  ? -2.370  -14.071 -8.103  1.00 0.00 ? 72  GLU A HB2  5  
ATOM 9946  H HB3  . GLU A 1 72  ? -1.002  -15.043 -7.584  1.00 0.00 ? 72  GLU A HB3  5  
ATOM 9947  H HG2  . GLU A 1 72  ? -2.260  -16.208 -5.992  1.00 0.00 ? 72  GLU A HG2  5  
ATOM 9948  H HG3  . GLU A 1 72  ? -3.533  -14.992 -5.967  1.00 0.00 ? 72  GLU A HG3  5  
ATOM 9949  N N    . GLU A 1 73  ? 0.543   -12.584 -7.139  1.00 0.00 ? 73  GLU A N    5  
ATOM 9950  C CA   . GLU A 1 73  ? 1.389   -11.569 -7.831  1.00 0.00 ? 73  GLU A CA   5  
ATOM 9951  C C    . GLU A 1 73  ? 2.749   -12.165 -8.184  1.00 0.00 ? 73  GLU A C    5  
ATOM 9952  O O    . GLU A 1 73  ? 2.996   -13.339 -7.996  1.00 0.00 ? 73  GLU A O    5  
ATOM 9953  C CB   . GLU A 1 73  ? 1.588   -10.361 -6.910  1.00 0.00 ? 73  GLU A CB   5  
ATOM 9954  C CG   . GLU A 1 73  ? 0.537   -9.295  -7.226  1.00 0.00 ? 73  GLU A CG   5  
ATOM 9955  C CD   . GLU A 1 73  ? 1.120   -7.907  -6.954  1.00 0.00 ? 73  GLU A CD   5  
ATOM 9956  O OE1  . GLU A 1 73  ? 2.215   -7.645  -7.423  1.00 0.00 ? 73  GLU A OE1  5  
ATOM 9957  O OE2  . GLU A 1 73  ? 0.461   -7.131  -6.283  1.00 0.00 ? 73  GLU A OE2  5  
ATOM 9958  H H    . GLU A 1 73  ? 0.937   -13.418 -6.805  1.00 0.00 ? 73  GLU A H    5  
ATOM 9959  H HA   . GLU A 1 73  ? 0.899   -11.251 -8.735  1.00 0.00 ? 73  GLU A HA   5  
ATOM 9960  H HB2  . GLU A 1 73  ? 1.485   -10.674 -5.881  1.00 0.00 ? 73  GLU A HB2  5  
ATOM 9961  H HB3  . GLU A 1 73  ? 2.573   -9.948  -7.063  1.00 0.00 ? 73  GLU A HB3  5  
ATOM 9962  H HG2  . GLU A 1 73  ? 0.251   -9.369  -8.265  1.00 0.00 ? 73  GLU A HG2  5  
ATOM 9963  H HG3  . GLU A 1 73  ? -0.330  -9.447  -6.602  1.00 0.00 ? 73  GLU A HG3  5  
ATOM 9964  N N    . GLN A 1 74  ? 3.627   -11.347 -8.696  1.00 0.00 ? 74  GLN A N    5  
ATOM 9965  C CA   . GLN A 1 74  ? 4.992   -11.825 -9.072  1.00 0.00 ? 74  GLN A CA   5  
ATOM 9966  C C    . GLN A 1 74  ? 6.021   -10.766 -8.669  1.00 0.00 ? 74  GLN A C    5  
ATOM 9967  O O    . GLN A 1 74  ? 5.829   -9.587  -8.904  1.00 0.00 ? 74  GLN A O    5  
ATOM 9968  C CB   . GLN A 1 74  ? 5.061   -12.045 -10.583 1.00 0.00 ? 74  GLN A CB   5  
ATOM 9969  C CG   . GLN A 1 74  ? 4.254   -13.290 -10.957 1.00 0.00 ? 74  GLN A CG   5  
ATOM 9970  C CD   . GLN A 1 74  ? 3.777   -13.175 -12.406 1.00 0.00 ? 74  GLN A CD   5  
ATOM 9971  O OE1  . GLN A 1 74  ? 4.396   -13.707 -13.306 1.00 0.00 ? 74  GLN A OE1  5  
ATOM 9972  N NE2  . GLN A 1 74  ? 2.693   -12.498 -12.672 1.00 0.00 ? 74  GLN A NE2  5  
ATOM 9973  H H    . GLN A 1 74  ? 3.383   -10.409 -8.833  1.00 0.00 ? 74  GLN A H    5  
ATOM 9974  H HA   . GLN A 1 74  ? 5.206   -12.751 -8.560  1.00 0.00 ? 74  GLN A HA   5  
ATOM 9975  H HB2  . GLN A 1 74  ? 4.653   -11.183 -11.090 1.00 0.00 ? 74  GLN A HB2  5  
ATOM 9976  H HB3  . GLN A 1 74  ? 6.090   -12.183 -10.878 1.00 0.00 ? 74  GLN A HB3  5  
ATOM 9977  H HG2  . GLN A 1 74  ? 4.876   -14.167 -10.851 1.00 0.00 ? 74  GLN A HG2  5  
ATOM 9978  H HG3  . GLN A 1 74  ? 3.398   -13.374 -10.304 1.00 0.00 ? 74  GLN A HG3  5  
ATOM 9979  H HE21 . GLN A 1 74  ? 2.193   -12.069 -11.946 1.00 0.00 ? 74  GLN A HE21 5  
ATOM 9980  H HE22 . GLN A 1 74  ? 2.379   -12.418 -13.597 1.00 0.00 ? 74  GLN A HE22 5  
ATOM 9981  N N    . THR A 1 75  ? 7.108   -11.173 -8.060  1.00 0.00 ? 75  THR A N    5  
ATOM 9982  C CA   . THR A 1 75  ? 8.145   -10.184 -7.637  1.00 0.00 ? 75  THR A CA   5  
ATOM 9983  C C    . THR A 1 75  ? 8.866   -9.641  -8.878  1.00 0.00 ? 75  THR A C    5  
ATOM 9984  O O    . THR A 1 75  ? 8.357   -9.716  -9.980  1.00 0.00 ? 75  THR A O    5  
ATOM 9985  C CB   . THR A 1 75  ? 9.159   -10.852 -6.696  1.00 0.00 ? 75  THR A CB   5  
ATOM 9986  O OG1  . THR A 1 75  ? 8.571   -11.995 -6.094  1.00 0.00 ? 75  THR A OG1  5  
ATOM 9987  C CG2  . THR A 1 75  ? 9.579   -9.864  -5.604  1.00 0.00 ? 75  THR A CG2  5  
ATOM 9988  H H    . THR A 1 75  ? 7.239   -12.128 -7.879  1.00 0.00 ? 75  THR A H    5  
ATOM 9989  H HA   . THR A 1 75  ? 7.662   -9.369  -7.120  1.00 0.00 ? 75  THR A HA   5  
ATOM 9990  H HB   . THR A 1 75  ? 10.031  -11.144 -7.260  1.00 0.00 ? 75  THR A HB   5  
ATOM 9991  H HG1  . THR A 1 75  ? 7.872   -11.695 -5.510  1.00 0.00 ? 75  THR A HG1  5  
ATOM 9992  H HG21 . THR A 1 75  ? 8.845   -9.075  -5.527  1.00 0.00 ? 75  THR A HG21 5  
ATOM 9993  H HG22 . THR A 1 75  ? 9.650   -10.382 -4.659  1.00 0.00 ? 75  THR A HG22 5  
ATOM 9994  H HG23 . THR A 1 75  ? 10.540  -9.439  -5.854  1.00 0.00 ? 75  THR A HG23 5  
ATOM 9995  N N    . VAL A 1 76  ? 10.041  -9.086  -8.705  1.00 0.00 ? 76  VAL A N    5  
ATOM 9996  C CA   . VAL A 1 76  ? 10.795  -8.526  -9.867  1.00 0.00 ? 76  VAL A CA   5  
ATOM 9997  C C    . VAL A 1 76  ? 11.695  -9.606  -10.470 1.00 0.00 ? 76  VAL A C    5  
ATOM 9998  O O    . VAL A 1 76  ? 11.507  -10.024 -11.597 1.00 0.00 ? 76  VAL A O    5  
ATOM 9999  C CB   . VAL A 1 76  ? 11.659  -7.351  -9.406  1.00 0.00 ? 76  VAL A CB   5  
ATOM 10000 C CG1  . VAL A 1 76  ? 12.147  -6.568  -10.626 1.00 0.00 ? 76  VAL A CG1  5  
ATOM 10001 C CG2  . VAL A 1 76  ? 10.841  -6.424  -8.500  1.00 0.00 ? 76  VAL A CG2  5  
ATOM 10002 H H    . VAL A 1 76  ? 10.426  -9.031  -7.806  1.00 0.00 ? 76  VAL A H    5  
ATOM 10003 H HA   . VAL A 1 76  ? 10.100  -8.183  -10.613 1.00 0.00 ? 76  VAL A HA   5  
ATOM 10004 H HB   . VAL A 1 76  ? 12.508  -7.730  -8.863  1.00 0.00 ? 76  VAL A HB   5  
ATOM 10005 H HG11 . VAL A 1 76  ? 12.424  -7.258  -11.410 1.00 0.00 ? 76  VAL A HG11 5  
ATOM 10006 H HG12 . VAL A 1 76  ? 11.356  -5.922  -10.978 1.00 0.00 ? 76  VAL A HG12 5  
ATOM 10007 H HG13 . VAL A 1 76  ? 13.004  -5.972  -10.352 1.00 0.00 ? 76  VAL A HG13 5  
ATOM 10008 H HG21 . VAL A 1 76  ? 9.930   -6.140  -9.005  1.00 0.00 ? 76  VAL A HG21 5  
ATOM 10009 H HG22 . VAL A 1 76  ? 10.597  -6.943  -7.583  1.00 0.00 ? 76  VAL A HG22 5  
ATOM 10010 H HG23 . VAL A 1 76  ? 11.418  -5.542  -8.271  1.00 0.00 ? 76  VAL A HG23 5  
ATOM 10011 N N    . ASP A 1 77  ? 12.675  -10.056 -9.727  1.00 0.00 ? 77  ASP A N    5  
ATOM 10012 C CA   . ASP A 1 77  ? 13.599  -11.105 -10.250 1.00 0.00 ? 77  ASP A CA   5  
ATOM 10013 C C    . ASP A 1 77  ? 13.951  -12.083 -9.127  1.00 0.00 ? 77  ASP A C    5  
ATOM 10014 O O    . ASP A 1 77  ? 14.587  -11.722 -8.155  1.00 0.00 ? 77  ASP A O    5  
ATOM 10015 C CB   . ASP A 1 77  ? 14.877  -10.443 -10.771 1.00 0.00 ? 77  ASP A CB   5  
ATOM 10016 C CG   . ASP A 1 77  ? 15.477  -9.558  -9.677  1.00 0.00 ? 77  ASP A CG   5  
ATOM 10017 O OD1  . ASP A 1 77  ? 15.100  -8.400  -9.606  1.00 0.00 ? 77  ASP A OD1  5  
ATOM 10018 O OD2  . ASP A 1 77  ? 16.303  -10.053 -8.928  1.00 0.00 ? 77  ASP A OD2  5  
ATOM 10019 H H    . ASP A 1 77  ? 12.806  -9.699  -8.824  1.00 0.00 ? 77  ASP A H    5  
ATOM 10020 H HA   . ASP A 1 77  ? 13.117  -11.640 -11.055 1.00 0.00 ? 77  ASP A HA   5  
ATOM 10021 H HB2  . ASP A 1 77  ? 15.589  -11.207 -11.049 1.00 0.00 ? 77  ASP A HB2  5  
ATOM 10022 H HB3  . ASP A 1 77  ? 14.643  -9.837  -11.633 1.00 0.00 ? 77  ASP A HB3  5  
ATOM 10023 N N    . GLY A 1 78  ? 13.539  -13.318 -9.257  1.00 0.00 ? 78  GLY A N    5  
ATOM 10024 C CA   . GLY A 1 78  ? 13.840  -14.332 -8.205  1.00 0.00 ? 78  GLY A CA   5  
ATOM 10025 C C    . GLY A 1 78  ? 12.707  -15.357 -8.159  1.00 0.00 ? 78  GLY A C    5  
ATOM 10026 O O    . GLY A 1 78  ? 12.756  -16.378 -8.818  1.00 0.00 ? 78  GLY A O    5  
ATOM 10027 H H    . GLY A 1 78  ? 13.027  -13.578 -10.051 1.00 0.00 ? 78  GLY A H    5  
ATOM 10028 H HA2  . GLY A 1 78  ? 14.771  -14.829 -8.440  1.00 0.00 ? 78  GLY A HA2  5  
ATOM 10029 H HA3  . GLY A 1 78  ? 13.921  -13.845 -7.246  1.00 0.00 ? 78  GLY A HA3  5  
ATOM 10030 N N    . ARG A 1 79  ? 11.685  -15.085 -7.389  1.00 0.00 ? 79  ARG A N    5  
ATOM 10031 C CA   . ARG A 1 79  ? 10.537  -16.032 -7.298  1.00 0.00 ? 79  ARG A CA   5  
ATOM 10032 C C    . ARG A 1 79  ? 9.227   -15.228 -7.361  1.00 0.00 ? 79  ARG A C    5  
ATOM 10033 O O    . ARG A 1 79  ? 9.267   -14.016 -7.337  1.00 0.00 ? 79  ARG A O    5  
ATOM 10034 C CB   . ARG A 1 79  ? 10.616  -16.800 -5.970  1.00 0.00 ? 79  ARG A CB   5  
ATOM 10035 C CG   . ARG A 1 79  ? 10.983  -18.263 -6.237  1.00 0.00 ? 79  ARG A CG   5  
ATOM 10036 C CD   . ARG A 1 79  ? 11.468  -18.915 -4.941  1.00 0.00 ? 79  ARG A CD   5  
ATOM 10037 N NE   . ARG A 1 79  ? 12.747  -18.281 -4.514  1.00 0.00 ? 79  ARG A NE   5  
ATOM 10038 C CZ   . ARG A 1 79  ? 13.883  -18.875 -4.756  1.00 0.00 ? 79  ARG A CZ   5  
ATOM 10039 N NH1  . ARG A 1 79  ? 14.031  -20.141 -4.475  1.00 0.00 ? 79  ARG A NH1  5  
ATOM 10040 N NH2  . ARG A 1 79  ? 14.872  -18.203 -5.279  1.00 0.00 ? 79  ARG A NH2  5  
ATOM 10041 H H    . ARG A 1 79  ? 11.669  -14.250 -6.873  1.00 0.00 ? 79  ARG A H    5  
ATOM 10042 H HA   . ARG A 1 79  ? 10.574  -16.726 -8.126  1.00 0.00 ? 79  ARG A HA   5  
ATOM 10043 H HB2  . ARG A 1 79  ? 11.372  -16.350 -5.342  1.00 0.00 ? 79  ARG A HB2  5  
ATOM 10044 H HB3  . ARG A 1 79  ? 9.662   -16.758 -5.467  1.00 0.00 ? 79  ARG A HB3  5  
ATOM 10045 H HG2  . ARG A 1 79  ? 10.114  -18.791 -6.604  1.00 0.00 ? 79  ARG A HG2  5  
ATOM 10046 H HG3  . ARG A 1 79  ? 11.770  -18.307 -6.976  1.00 0.00 ? 79  ARG A HG3  5  
ATOM 10047 H HD2  . ARG A 1 79  ? 10.724  -18.781 -4.170  1.00 0.00 ? 79  ARG A HD2  5  
ATOM 10048 H HD3  . ARG A 1 79  ? 11.628  -19.970 -5.107  1.00 0.00 ? 79  ARG A HD3  5  
ATOM 10049 H HE   . ARG A 1 79  ? 12.734  -17.417 -4.050  1.00 0.00 ? 79  ARG A HE   5  
ATOM 10050 H HH11 . ARG A 1 79  ? 13.273  -20.655 -4.074  1.00 0.00 ? 79  ARG A HH11 5  
ATOM 10051 H HH12 . ARG A 1 79  ? 14.902  -20.596 -4.661  1.00 0.00 ? 79  ARG A HH12 5  
ATOM 10052 H HH21 . ARG A 1 79  ? 14.759  -17.233 -5.493  1.00 0.00 ? 79  ARG A HH21 5  
ATOM 10053 H HH22 . ARG A 1 79  ? 15.743  -18.658 -5.464  1.00 0.00 ? 79  ARG A HH22 5  
ATOM 10054 N N    . PRO A 1 80  ? 8.098   -15.909 -7.436  1.00 0.00 ? 80  PRO A N    5  
ATOM 10055 C CA   . PRO A 1 80  ? 6.793   -15.231 -7.494  1.00 0.00 ? 80  PRO A CA   5  
ATOM 10056 C C    . PRO A 1 80  ? 6.404   -14.728 -6.102  1.00 0.00 ? 80  PRO A C    5  
ATOM 10057 O O    . PRO A 1 80  ? 7.167   -14.849 -5.160  1.00 0.00 ? 80  PRO A O    5  
ATOM 10058 C CB   . PRO A 1 80  ? 5.835   -16.319 -7.980  1.00 0.00 ? 80  PRO A CB   5  
ATOM 10059 C CG   . PRO A 1 80  ? 6.501   -17.673 -7.640  1.00 0.00 ? 80  PRO A CG   5  
ATOM 10060 C CD   . PRO A 1 80  ? 8.006   -17.392 -7.469  1.00 0.00 ? 80  PRO A CD   5  
ATOM 10061 H HA   . PRO A 1 80  ? 6.815   -14.418 -8.200  1.00 0.00 ? 80  PRO A HA   5  
ATOM 10062 H HB2  . PRO A 1 80  ? 4.886   -16.228 -7.471  1.00 0.00 ? 80  PRO A HB2  5  
ATOM 10063 H HB3  . PRO A 1 80  ? 5.694   -16.241 -9.046  1.00 0.00 ? 80  PRO A HB3  5  
ATOM 10064 H HG2  . PRO A 1 80  ? 6.088   -18.067 -6.722  1.00 0.00 ? 80  PRO A HG2  5  
ATOM 10065 H HG3  . PRO A 1 80  ? 6.351   -18.373 -8.446  1.00 0.00 ? 80  PRO A HG3  5  
ATOM 10066 H HD2  . PRO A 1 80  ? 8.364   -17.818 -6.542  1.00 0.00 ? 80  PRO A HD2  5  
ATOM 10067 H HD3  . PRO A 1 80  ? 8.562   -17.781 -8.307  1.00 0.00 ? 80  PRO A HD3  5  
ATOM 10068 N N    . CYS A 1 81  ? 5.231   -14.163 -5.963  1.00 0.00 ? 81  CYS A N    5  
ATOM 10069 C CA   . CYS A 1 81  ? 4.805   -13.651 -4.628  1.00 0.00 ? 81  CYS A CA   5  
ATOM 10070 C C    . CYS A 1 81  ? 3.301   -13.392 -4.598  1.00 0.00 ? 81  CYS A C    5  
ATOM 10071 O O    . CYS A 1 81  ? 2.710   -12.930 -5.552  1.00 0.00 ? 81  CYS A O    5  
ATOM 10072 C CB   . CYS A 1 81  ? 5.548   -12.347 -4.312  1.00 0.00 ? 81  CYS A CB   5  
ATOM 10073 S SG   . CYS A 1 81  ? 5.254   -11.131 -5.621  1.00 0.00 ? 81  CYS A SG   5  
ATOM 10074 H H    . CYS A 1 81  ? 4.638   -14.076 -6.734  1.00 0.00 ? 81  CYS A H    5  
ATOM 10075 H HA   . CYS A 1 81  ? 5.042   -14.388 -3.873  1.00 0.00 ? 81  CYS A HA   5  
ATOM 10076 H HB2  . CYS A 1 81  ? 5.194   -11.952 -3.372  1.00 0.00 ? 81  CYS A HB2  5  
ATOM 10077 H HB3  . CYS A 1 81  ? 6.607   -12.547 -4.239  1.00 0.00 ? 81  CYS A HB3  5  
ATOM 10078 H HG   . CYS A 1 81  ? 5.141   -10.272 -5.208  1.00 0.00 ? 81  CYS A HG   5  
ATOM 10079 N N    . LYS A 1 82  ? 2.700   -13.678 -3.482  1.00 0.00 ? 82  LYS A N    5  
ATOM 10080 C CA   . LYS A 1 82  ? 1.242   -13.456 -3.308  1.00 0.00 ? 82  LYS A CA   5  
ATOM 10081 C C    . LYS A 1 82  ? 1.042   -12.448 -2.179  1.00 0.00 ? 82  LYS A C    5  
ATOM 10082 O O    . LYS A 1 82  ? 1.981   -11.830 -1.712  1.00 0.00 ? 82  LYS A O    5  
ATOM 10083 C CB   . LYS A 1 82  ? 0.575   -14.780 -2.943  1.00 0.00 ? 82  LYS A CB   5  
ATOM 10084 C CG   . LYS A 1 82  ? 1.231   -15.372 -1.682  1.00 0.00 ? 82  LYS A CG   5  
ATOM 10085 C CD   . LYS A 1 82  ? 0.658   -16.770 -1.376  1.00 0.00 ? 82  LYS A CD   5  
ATOM 10086 C CE   . LYS A 1 82  ? -0.872  -16.772 -1.498  1.00 0.00 ? 82  LYS A CE   5  
ATOM 10087 N NZ   . LYS A 1 82  ? -1.459  -17.709 -0.497  1.00 0.00 ? 82  LYS A NZ   5  
ATOM 10088 H H    . LYS A 1 82  ? 3.222   -14.034 -2.738  1.00 0.00 ? 82  LYS A H    5  
ATOM 10089 H HA   . LYS A 1 82  ? 0.801   -13.072 -4.219  1.00 0.00 ? 82  LYS A HA   5  
ATOM 10090 H HB2  . LYS A 1 82  ? -0.476  -14.612 -2.755  1.00 0.00 ? 82  LYS A HB2  5  
ATOM 10091 H HB3  . LYS A 1 82  ? 0.685   -15.474 -3.762  1.00 0.00 ? 82  LYS A HB3  5  
ATOM 10092 H HG2  . LYS A 1 82  ? 2.294   -15.459 -1.843  1.00 0.00 ? 82  LYS A HG2  5  
ATOM 10093 H HG3  . LYS A 1 82  ? 1.052   -14.716 -0.841  1.00 0.00 ? 82  LYS A HG3  5  
ATOM 10094 H HD2  . LYS A 1 82  ? 1.071   -17.483 -2.073  1.00 0.00 ? 82  LYS A HD2  5  
ATOM 10095 H HD3  . LYS A 1 82  ? 0.934   -17.054 -0.371  1.00 0.00 ? 82  LYS A HD3  5  
ATOM 10096 H HE2  . LYS A 1 82  ? -1.244  -15.772 -1.324  1.00 0.00 ? 82  LYS A HE2  5  
ATOM 10097 H HE3  . LYS A 1 82  ? -1.147  -17.085 -2.496  1.00 0.00 ? 82  LYS A HE3  5  
ATOM 10098 H HZ1  . LYS A 1 82  ? -0.790  -18.482 -0.307  1.00 0.00 ? 82  LYS A HZ1  5  
ATOM 10099 H HZ2  . LYS A 1 82  ? -1.653  -17.196 0.386   1.00 0.00 ? 82  LYS A HZ2  5  
ATOM 10100 H HZ3  . LYS A 1 82  ? -2.346  -18.104 -0.872  1.00 0.00 ? 82  LYS A HZ3  5  
ATOM 10101 N N    . SER A 1 83  ? -0.170  -12.275 -1.749  1.00 0.00 ? 83  SER A N    5  
ATOM 10102 C CA   . SER A 1 83  ? -0.455  -11.301 -0.654  1.00 0.00 ? 83  SER A CA   5  
ATOM 10103 C C    . SER A 1 83  ? -1.578  -11.820 0.226   1.00 0.00 ? 83  SER A C    5  
ATOM 10104 O O    . SER A 1 83  ? -2.114  -12.871 -0.016  1.00 0.00 ? 83  SER A O    5  
ATOM 10105 C CB   . SER A 1 83  ? -0.899  -9.987  -1.280  1.00 0.00 ? 83  SER A CB   5  
ATOM 10106 O OG   . SER A 1 83  ? -1.908  -10.264 -2.249  1.00 0.00 ? 83  SER A OG   5  
ATOM 10107 H H    . SER A 1 83  ? -0.898  -12.780 -2.158  1.00 0.00 ? 83  SER A H    5  
ATOM 10108 H HA   . SER A 1 83  ? 0.420   -11.149 -0.059  1.00 0.00 ? 83  SER A HA   5  
ATOM 10109 H HB2  . SER A 1 83  ? -1.301  -9.338  -0.520  1.00 0.00 ? 83  SER A HB2  5  
ATOM 10110 H HB3  . SER A 1 83  ? -0.052  -9.508  -1.752  1.00 0.00 ? 83  SER A HB3  5  
ATOM 10111 H HG   . SER A 1 83  ? -2.518  -10.919 -1.880  1.00 0.00 ? 83  SER A HG   5  
ATOM 10112 N N    . LEU A 1 84  ? -1.947  -11.074 1.235   1.00 0.00 ? 84  LEU A N    5  
ATOM 10113 C CA   . LEU A 1 84  ? -3.071  -11.521 2.119   1.00 0.00 ? 84  LEU A CA   5  
ATOM 10114 C C    . LEU A 1 84  ? -3.466  -10.410 3.085   1.00 0.00 ? 84  LEU A C    5  
ATOM 10115 O O    . LEU A 1 84  ? -2.686  -9.990  3.913   1.00 0.00 ? 84  LEU A O    5  
ATOM 10116 C CB   . LEU A 1 84  ? -2.666  -12.770 2.899   1.00 0.00 ? 84  LEU A CB   5  
ATOM 10117 C CG   . LEU A 1 84  ? -3.855  -13.733 2.948   1.00 0.00 ? 84  LEU A CG   5  
ATOM 10118 C CD1  . LEU A 1 84  ? -3.350  -15.165 3.102   1.00 0.00 ? 84  LEU A CD1  5  
ATOM 10119 C CD2  . LEU A 1 84  ? -4.763  -13.378 4.120   1.00 0.00 ? 84  LEU A CD2  5  
ATOM 10120 H H    . LEU A 1 84  ? -1.492  -10.214 1.400   1.00 0.00 ? 84  LEU A H    5  
ATOM 10121 H HA   . LEU A 1 84  ? -3.920  -11.750 1.503   1.00 0.00 ? 84  LEU A HA   5  
ATOM 10122 H HB2  . LEU A 1 84  ? -1.834  -13.248 2.404   1.00 0.00 ? 84  LEU A HB2  5  
ATOM 10123 H HB3  . LEU A 1 84  ? -2.381  -12.497 3.903   1.00 0.00 ? 84  LEU A HB3  5  
ATOM 10124 H HG   . LEU A 1 84  ? -4.415  -13.648 2.031   1.00 0.00 ? 84  LEU A HG   5  
ATOM 10125 H HD11 . LEU A 1 84  ? -2.375  -15.253 2.646   1.00 0.00 ? 84  LEU A HD11 5  
ATOM 10126 H HD12 . LEU A 1 84  ? -3.283  -15.412 4.150   1.00 0.00 ? 84  LEU A HD12 5  
ATOM 10127 H HD13 . LEU A 1 84  ? -4.037  -15.841 2.614   1.00 0.00 ? 84  LEU A HD13 5  
ATOM 10128 H HD21 . LEU A 1 84  ? -4.205  -13.436 5.040   1.00 0.00 ? 84  LEU A HD21 5  
ATOM 10129 H HD22 . LEU A 1 84  ? -5.141  -12.374 3.988   1.00 0.00 ? 84  LEU A HD22 5  
ATOM 10130 H HD23 . LEU A 1 84  ? -5.591  -14.071 4.153   1.00 0.00 ? 84  LEU A HD23 5  
ATOM 10131 N N    . VAL A 1 85  ? -4.684  -9.938  2.974   1.00 0.00 ? 85  VAL A N    5  
ATOM 10132 C CA   . VAL A 1 85  ? -5.159  -8.841  3.867   1.00 0.00 ? 85  VAL A CA   5  
ATOM 10133 C C    . VAL A 1 85  ? -5.781  -9.417  5.147   1.00 0.00 ? 85  VAL A C    5  
ATOM 10134 O O    . VAL A 1 85  ? -6.316  -10.508 5.166   1.00 0.00 ? 85  VAL A O    5  
ATOM 10135 C CB   . VAL A 1 85  ? -6.183  -7.980  3.099   1.00 0.00 ? 85  VAL A CB   5  
ATOM 10136 C CG1  . VAL A 1 85  ? -6.888  -6.991  4.044   1.00 0.00 ? 85  VAL A CG1  5  
ATOM 10137 C CG2  . VAL A 1 85  ? -5.446  -7.193  2.014   1.00 0.00 ? 85  VAL A CG2  5  
ATOM 10138 H H    . VAL A 1 85  ? -5.288  -10.308 2.293   1.00 0.00 ? 85  VAL A H    5  
ATOM 10139 H HA   . VAL A 1 85  ? -4.322  -8.225  4.136   1.00 0.00 ? 85  VAL A HA   5  
ATOM 10140 H HB   . VAL A 1 85  ? -6.917  -8.622  2.635   1.00 0.00 ? 85  VAL A HB   5  
ATOM 10141 H HG11 . VAL A 1 85  ? -7.370  -7.537  4.843   1.00 0.00 ? 85  VAL A HG11 5  
ATOM 10142 H HG12 . VAL A 1 85  ? -6.162  -6.311  4.463   1.00 0.00 ? 85  VAL A HG12 5  
ATOM 10143 H HG13 . VAL A 1 85  ? -7.630  -6.432  3.494   1.00 0.00 ? 85  VAL A HG13 5  
ATOM 10144 H HG21 . VAL A 1 85  ? -4.952  -7.880  1.343   1.00 0.00 ? 85  VAL A HG21 5  
ATOM 10145 H HG22 . VAL A 1 85  ? -6.153  -6.594  1.460   1.00 0.00 ? 85  VAL A HG22 5  
ATOM 10146 H HG23 . VAL A 1 85  ? -4.711  -6.549  2.474   1.00 0.00 ? 85  VAL A HG23 5  
ATOM 10147 N N    . LYS A 1 86  ? -5.708  -8.660  6.212   1.00 0.00 ? 86  LYS A N    5  
ATOM 10148 C CA   . LYS A 1 86  ? -6.280  -9.102  7.511   1.00 0.00 ? 86  LYS A CA   5  
ATOM 10149 C C    . LYS A 1 86  ? -6.582  -7.866  8.368   1.00 0.00 ? 86  LYS A C    5  
ATOM 10150 O O    . LYS A 1 86  ? -6.621  -6.759  7.875   1.00 0.00 ? 86  LYS A O    5  
ATOM 10151 C CB   . LYS A 1 86  ? -5.259  -9.989  8.220   1.00 0.00 ? 86  LYS A CB   5  
ATOM 10152 C CG   . LYS A 1 86  ? -5.768  -11.429 8.277   1.00 0.00 ? 86  LYS A CG   5  
ATOM 10153 C CD   . LYS A 1 86  ? -6.717  -11.595 9.464   1.00 0.00 ? 86  LYS A CD   5  
ATOM 10154 C CE   . LYS A 1 86  ? -8.131  -11.187 9.049   1.00 0.00 ? 86  LYS A CE   5  
ATOM 10155 N NZ   . LYS A 1 86  ? -9.125  -11.921 9.883   1.00 0.00 ? 86  LYS A NZ   5  
ATOM 10156 H H    . LYS A 1 86  ? -5.270  -7.790  6.153   1.00 0.00 ? 86  LYS A H    5  
ATOM 10157 H HA   . LYS A 1 86  ? -7.183  -9.653  7.341   1.00 0.00 ? 86  LYS A HA   5  
ATOM 10158 H HB2  . LYS A 1 86  ? -4.339  -9.962  7.667   1.00 0.00 ? 86  LYS A HB2  5  
ATOM 10159 H HB3  . LYS A 1 86  ? -5.087  -9.626  9.219   1.00 0.00 ? 86  LYS A HB3  5  
ATOM 10160 H HG2  . LYS A 1 86  ? -6.293  -11.657 7.361   1.00 0.00 ? 86  LYS A HG2  5  
ATOM 10161 H HG3  . LYS A 1 86  ? -4.931  -12.100 8.389   1.00 0.00 ? 86  LYS A HG3  5  
ATOM 10162 H HD2  . LYS A 1 86  ? -6.718  -12.629 9.782   1.00 0.00 ? 86  LYS A HD2  5  
ATOM 10163 H HD3  . LYS A 1 86  ? -6.388  -10.968 10.279  1.00 0.00 ? 86  LYS A HD3  5  
ATOM 10164 H HE2  . LYS A 1 86  ? -8.254  -10.124 9.192   1.00 0.00 ? 86  LYS A HE2  5  
ATOM 10165 H HE3  . LYS A 1 86  ? -8.287  -11.428 8.008   1.00 0.00 ? 86  LYS A HE3  5  
ATOM 10166 H HZ1  . LYS A 1 86  ? -8.829  -11.895 10.879  1.00 0.00 ? 86  LYS A HZ1  5  
ATOM 10167 H HZ2  . LYS A 1 86  ? -10.058 -11.470 9.786   1.00 0.00 ? 86  LYS A HZ2  5  
ATOM 10168 H HZ3  . LYS A 1 86  ? -9.182  -12.909 9.566   1.00 0.00 ? 86  LYS A HZ3  5  
ATOM 10169 N N    . TRP A 1 87  ? -6.801  -8.055  9.641   1.00 0.00 ? 87  TRP A N    5  
ATOM 10170 C CA   . TRP A 1 87  ? -7.101  -6.901  10.546  1.00 0.00 ? 87  TRP A CA   5  
ATOM 10171 C C    . TRP A 1 87  ? -6.117  -6.865  11.708  1.00 0.00 ? 87  TRP A C    5  
ATOM 10172 O O    . TRP A 1 87  ? -5.269  -7.723  11.860  1.00 0.00 ? 87  TRP A O    5  
ATOM 10173 C CB   . TRP A 1 87  ? -8.489  -7.062  11.127  1.00 0.00 ? 87  TRP A CB   5  
ATOM 10174 C CG   . TRP A 1 87  ? -9.458  -7.045  10.025  1.00 0.00 ? 87  TRP A CG   5  
ATOM 10175 C CD1  . TRP A 1 87  ? -10.021 -8.134  9.492   1.00 0.00 ? 87  TRP A CD1  5  
ATOM 10176 C CD2  . TRP A 1 87  ? -9.968  -5.905  9.296   1.00 0.00 ? 87  TRP A CD2  5  
ATOM 10177 N NE1  . TRP A 1 87  ? -10.886 -7.740  8.503   1.00 0.00 ? 87  TRP A NE1  5  
ATOM 10178 C CE2  . TRP A 1 87  ? -10.881 -6.372  8.336   1.00 0.00 ? 87  TRP A CE2  5  
ATOM 10179 C CE3  . TRP A 1 87  ? -9.737  -4.522  9.379   1.00 0.00 ? 87  TRP A CE3  5  
ATOM 10180 C CZ2  . TRP A 1 87  ? -11.548 -5.505  7.484   1.00 0.00 ? 87  TRP A CZ2  5  
ATOM 10181 C CZ3  . TRP A 1 87  ? -10.404 -3.642  8.516   1.00 0.00 ? 87  TRP A CZ3  5  
ATOM 10182 C CH2  . TRP A 1 87  ? -11.311 -4.135  7.570   1.00 0.00 ? 87  TRP A CH2  5  
ATOM 10183 H H    . TRP A 1 87  ? -6.779  -8.959  10.000  1.00 0.00 ? 87  TRP A H    5  
ATOM 10184 H HA   . TRP A 1 87  ? -7.055  -5.971  9.993   1.00 0.00 ? 87  TRP A HA   5  
ATOM 10185 H HB2  . TRP A 1 87  ? -8.558  -7.998  11.659  1.00 0.00 ? 87  TRP A HB2  5  
ATOM 10186 H HB3  . TRP A 1 87  ? -8.701  -6.246  11.796  1.00 0.00 ? 87  TRP A HB3  5  
ATOM 10187 H HD1  . TRP A 1 87  ? -9.835  -9.148  9.802   1.00 0.00 ? 87  TRP A HD1  5  
ATOM 10188 H HE1  . TRP A 1 87  ? -11.429 -8.338  7.969   1.00 0.00 ? 87  TRP A HE1  5  
ATOM 10189 H HE3  . TRP A 1 87  ? -9.029  -4.136  10.100  1.00 0.00 ? 87  TRP A HE3  5  
ATOM 10190 H HZ2  . TRP A 1 87  ? -12.238 -5.890  6.762   1.00 0.00 ? 87  TRP A HZ2  5  
ATOM 10191 H HZ3  . TRP A 1 87  ? -10.220 -2.584  8.584   1.00 0.00 ? 87  TRP A HZ3  5  
ATOM 10192 H HH2  . TRP A 1 87  ? -11.820 -3.459  6.902   1.00 0.00 ? 87  TRP A HH2  5  
ATOM 10193 N N    . GLU A 1 88  ? -6.259  -5.876  12.543  1.00 0.00 ? 88  GLU A N    5  
ATOM 10194 C CA   . GLU A 1 88  ? -5.381  -5.741  13.739  1.00 0.00 ? 88  GLU A CA   5  
ATOM 10195 C C    . GLU A 1 88  ? -6.273  -5.439  14.936  1.00 0.00 ? 88  GLU A C    5  
ATOM 10196 O O    . GLU A 1 88  ? -6.213  -6.086  15.964  1.00 0.00 ? 88  GLU A O    5  
ATOM 10197 C CB   . GLU A 1 88  ? -4.403  -4.575  13.563  1.00 0.00 ? 88  GLU A CB   5  
ATOM 10198 C CG   . GLU A 1 88  ? -3.786  -4.582  12.156  1.00 0.00 ? 88  GLU A CG   5  
ATOM 10199 C CD   . GLU A 1 88  ? -2.259  -4.647  12.254  1.00 0.00 ? 88  GLU A CD   5  
ATOM 10200 O OE1  . GLU A 1 88  ? -1.763  -5.568  12.882  1.00 0.00 ? 88  GLU A OE1  5  
ATOM 10201 O OE2  . GLU A 1 88  ? -1.612  -3.774  11.698  1.00 0.00 ? 88  GLU A OE2  5  
ATOM 10202 H H    . GLU A 1 88  ? -6.970  -5.221  12.389  1.00 0.00 ? 88  GLU A H    5  
ATOM 10203 H HA   . GLU A 1 88  ? -4.838  -6.653  13.905  1.00 0.00 ? 88  GLU A HA   5  
ATOM 10204 H HB2  . GLU A 1 88  ? -4.936  -3.654  13.712  1.00 0.00 ? 88  GLU A HB2  5  
ATOM 10205 H HB3  . GLU A 1 88  ? -3.624  -4.655  14.301  1.00 0.00 ? 88  GLU A HB3  5  
ATOM 10206 H HG2  . GLU A 1 88  ? -4.146  -5.434  11.606  1.00 0.00 ? 88  GLU A HG2  5  
ATOM 10207 H HG3  . GLU A 1 88  ? -4.071  -3.681  11.640  1.00 0.00 ? 88  GLU A HG3  5  
ATOM 10208 N N    . SER A 1 89  ? -7.102  -4.445  14.790  1.00 0.00 ? 89  SER A N    5  
ATOM 10209 C CA   . SER A 1 89  ? -8.026  -4.044  15.880  1.00 0.00 ? 89  SER A CA   5  
ATOM 10210 C C    . SER A 1 89  ? -9.464  -4.112  15.368  1.00 0.00 ? 89  SER A C    5  
ATOM 10211 O O    . SER A 1 89  ? -10.327 -4.726  15.961  1.00 0.00 ? 89  SER A O    5  
ATOM 10212 C CB   . SER A 1 89  ? -7.710  -2.603  16.278  1.00 0.00 ? 89  SER A CB   5  
ATOM 10213 O OG   . SER A 1 89  ? -7.600  -1.811  15.095  1.00 0.00 ? 89  SER A OG   5  
ATOM 10214 H H    . SER A 1 89  ? -7.113  -3.951  13.948  1.00 0.00 ? 89  SER A H    5  
ATOM 10215 H HA   . SER A 1 89  ? -7.902  -4.695  16.725  1.00 0.00 ? 89  SER A HA   5  
ATOM 10216 H HB2  . SER A 1 89  ? -8.503  -2.215  16.895  1.00 0.00 ? 89  SER A HB2  5  
ATOM 10217 H HB3  . SER A 1 89  ? -6.780  -2.578  16.830  1.00 0.00 ? 89  SER A HB3  5  
ATOM 10218 H HG   . SER A 1 89  ? -7.645  -0.887  15.353  1.00 0.00 ? 89  SER A HG   5  
ATOM 10219 N N    . GLU A 1 90  ? -9.706  -3.466  14.261  1.00 0.00 ? 90  GLU A N    5  
ATOM 10220 C CA   . GLU A 1 90  ? -11.064 -3.426  13.636  1.00 0.00 ? 90  GLU A CA   5  
ATOM 10221 C C    . GLU A 1 90  ? -11.029 -2.359  12.544  1.00 0.00 ? 90  GLU A C    5  
ATOM 10222 O O    . GLU A 1 90  ? -11.607 -2.507  11.487  1.00 0.00 ? 90  GLU A O    5  
ATOM 10223 C CB   . GLU A 1 90  ? -12.141 -3.053  14.668  1.00 0.00 ? 90  GLU A CB   5  
ATOM 10224 C CG   . GLU A 1 90  ? -11.731 -1.776  15.408  1.00 0.00 ? 90  GLU A CG   5  
ATOM 10225 C CD   . GLU A 1 90  ? -12.234 -1.838  16.851  1.00 0.00 ? 90  GLU A CD   5  
ATOM 10226 O OE1  . GLU A 1 90  ? -13.439 -1.853  17.038  1.00 0.00 ? 90  GLU A OE1  5  
ATOM 10227 O OE2  . GLU A 1 90  ? -11.404 -1.868  17.745  1.00 0.00 ? 90  GLU A OE2  5  
ATOM 10228 H H    . GLU A 1 90  ? -8.972  -2.989  13.825  1.00 0.00 ? 90  GLU A H    5  
ATOM 10229 H HA   . GLU A 1 90  ? -11.288 -4.385  13.196  1.00 0.00 ? 90  GLU A HA   5  
ATOM 10230 H HB2  . GLU A 1 90  ? -13.079 -2.886  14.159  1.00 0.00 ? 90  GLU A HB2  5  
ATOM 10231 H HB3  . GLU A 1 90  ? -12.259 -3.856  15.378  1.00 0.00 ? 90  GLU A HB3  5  
ATOM 10232 H HG2  . GLU A 1 90  ? -10.656 -1.683  15.405  1.00 0.00 ? 90  GLU A HG2  5  
ATOM 10233 H HG3  . GLU A 1 90  ? -12.167 -0.920  14.915  1.00 0.00 ? 90  GLU A HG3  5  
ATOM 10234 N N    . ASN A 1 91  ? -10.313 -1.298  12.798  1.00 0.00 ? 91  ASN A N    5  
ATOM 10235 C CA   . ASN A 1 91  ? -10.168 -0.206  11.796  1.00 0.00 ? 91  ASN A CA   5  
ATOM 10236 C C    . ASN A 1 91  ? -8.723  -0.184  11.288  1.00 0.00 ? 91  ASN A C    5  
ATOM 10237 O O    . ASN A 1 91  ? -8.344  0.700   10.544  1.00 0.00 ? 91  ASN A O    5  
ATOM 10238 C CB   . ASN A 1 91  ? -10.489 1.134   12.448  1.00 0.00 ? 91  ASN A CB   5  
ATOM 10239 C CG   . ASN A 1 91  ? -11.932 1.143   12.961  1.00 0.00 ? 91  ASN A CG   5  
ATOM 10240 O OD1  . ASN A 1 91  ? -12.592 0.122   12.990  1.00 0.00 ? 91  ASN A OD1  5  
ATOM 10241 N ND2  . ASN A 1 91  ? -12.452 2.269   13.365  1.00 0.00 ? 91  ASN A ND2  5  
ATOM 10242 H H    . ASN A 1 91  ? -9.835  -1.232  13.652  1.00 0.00 ? 91  ASN A H    5  
ATOM 10243 H HA   . ASN A 1 91  ? -10.835 -0.367  10.960  1.00 0.00 ? 91  ASN A HA   5  
ATOM 10244 H HB2  . ASN A 1 91  ? -9.810  1.304   13.266  1.00 0.00 ? 91  ASN A HB2  5  
ATOM 10245 H HB3  . ASN A 1 91  ? -10.373 1.913   11.720  1.00 0.00 ? 91  ASN A HB3  5  
ATOM 10246 H HD21 . ASN A 1 91  ? -11.921 3.091   13.339  1.00 0.00 ? 91  ASN A HD21 5  
ATOM 10247 H HD22 . ASN A 1 91  ? -13.375 2.293   13.691  1.00 0.00 ? 91  ASN A HD22 5  
ATOM 10248 N N    . LYS A 1 92  ? -7.909  -1.149  11.679  1.00 0.00 ? 92  LYS A N    5  
ATOM 10249 C CA   . LYS A 1 92  ? -6.512  -1.180  11.201  1.00 0.00 ? 92  LYS A CA   5  
ATOM 10250 C C    . LYS A 1 92  ? -6.264  -2.540  10.553  1.00 0.00 ? 92  LYS A C    5  
ATOM 10251 O O    . LYS A 1 92  ? -6.209  -3.547  11.223  1.00 0.00 ? 92  LYS A O    5  
ATOM 10252 C CB   . LYS A 1 92  ? -5.566  -0.993  12.382  1.00 0.00 ? 92  LYS A CB   5  
ATOM 10253 C CG   . LYS A 1 92  ? -4.302  -0.305  11.892  1.00 0.00 ? 92  LYS A CG   5  
ATOM 10254 C CD   . LYS A 1 92  ? -3.342  -1.348  11.328  1.00 0.00 ? 92  LYS A CD   5  
ATOM 10255 C CE   . LYS A 1 92  ? -2.083  -0.656  10.802  1.00 0.00 ? 92  LYS A CE   5  
ATOM 10256 N NZ   . LYS A 1 92  ? -1.415  0.074   11.916  1.00 0.00 ? 92  LYS A NZ   5  
ATOM 10257 H H    . LYS A 1 92  ? -8.218  -1.857  12.286  1.00 0.00 ? 92  LYS A H    5  
ATOM 10258 H HA   . LYS A 1 92  ? -6.359  -0.391  10.476  1.00 0.00 ? 92  LYS A HA   5  
ATOM 10259 H HB2  . LYS A 1 92  ? -6.043  -0.384  13.136  1.00 0.00 ? 92  LYS A HB2  5  
ATOM 10260 H HB3  . LYS A 1 92  ? -5.313  -1.954  12.798  1.00 0.00 ? 92  LYS A HB3  5  
ATOM 10261 H HG2  . LYS A 1 92  ? -4.565  0.393   11.118  1.00 0.00 ? 92  LYS A HG2  5  
ATOM 10262 H HG3  . LYS A 1 92  ? -3.833  0.215   12.710  1.00 0.00 ? 92  LYS A HG3  5  
ATOM 10263 H HD2  . LYS A 1 92  ? -3.073  -2.045  12.108  1.00 0.00 ? 92  LYS A HD2  5  
ATOM 10264 H HD3  . LYS A 1 92  ? -3.825  -1.881  10.520  1.00 0.00 ? 92  LYS A HD3  5  
ATOM 10265 H HE2  . LYS A 1 92  ? -1.407  -1.396  10.400  1.00 0.00 ? 92  LYS A HE2  5  
ATOM 10266 H HE3  . LYS A 1 92  ? -2.354  0.043   10.025  1.00 0.00 ? 92  LYS A HE3  5  
ATOM 10267 H HZ1  . LYS A 1 92  ? -1.412  -0.520  12.768  1.00 0.00 ? 92  LYS A HZ1  5  
ATOM 10268 H HZ2  . LYS A 1 92  ? -0.435  0.298   11.645  1.00 0.00 ? 92  LYS A HZ2  5  
ATOM 10269 H HZ3  . LYS A 1 92  ? -1.930  0.955   12.112  1.00 0.00 ? 92  LYS A HZ3  5  
ATOM 10270 N N    . MET A 1 93  ? -6.134  -2.576  9.256   1.00 0.00 ? 93  MET A N    5  
ATOM 10271 C CA   . MET A 1 93  ? -5.904  -3.866  8.557   1.00 0.00 ? 93  MET A CA   5  
ATOM 10272 C C    . MET A 1 93  ? -4.510  -3.910  7.964   1.00 0.00 ? 93  MET A C    5  
ATOM 10273 O O    . MET A 1 93  ? -3.860  -2.903  7.761   1.00 0.00 ? 93  MET A O    5  
ATOM 10274 C CB   . MET A 1 93  ? -6.920  -4.091  7.428   1.00 0.00 ? 93  MET A CB   5  
ATOM 10275 C CG   . MET A 1 93  ? -7.308  -2.774  6.745   1.00 0.00 ? 93  MET A CG   5  
ATOM 10276 S SD   . MET A 1 93  ? -7.606  -3.064  4.982   1.00 0.00 ? 93  MET A SD   5  
ATOM 10277 C CE   . MET A 1 93  ? -8.807  -4.401  5.182   1.00 0.00 ? 93  MET A CE   5  
ATOM 10278 H H    . MET A 1 93  ? -6.196  -1.764  8.746   1.00 0.00 ? 93  MET A H    5  
ATOM 10279 H HA   . MET A 1 93  ? -5.995  -4.662  9.267   1.00 0.00 ? 93  MET A HA   5  
ATOM 10280 H HB2  . MET A 1 93  ? -6.481  -4.752  6.693   1.00 0.00 ? 93  MET A HB2  5  
ATOM 10281 H HB3  . MET A 1 93  ? -7.802  -4.554  7.833   1.00 0.00 ? 93  MET A HB3  5  
ATOM 10282 H HG2  . MET A 1 93  ? -8.209  -2.390  7.199   1.00 0.00 ? 93  MET A HG2  5  
ATOM 10283 H HG3  . MET A 1 93  ? -6.512  -2.060  6.861   1.00 0.00 ? 93  MET A HG3  5  
ATOM 10284 H HE1  . MET A 1 93  ? -8.351  -5.212  5.736   1.00 0.00 ? 93  MET A HE1  5  
ATOM 10285 H HE2  . MET A 1 93  ? -9.660  -4.035  5.727   1.00 0.00 ? 93  MET A HE2  5  
ATOM 10286 H HE3  . MET A 1 93  ? -9.121  -4.751  4.212   1.00 0.00 ? 93  MET A HE3  5  
ATOM 10287 N N    . VAL A 1 94  ? -4.061  -5.094  7.693   1.00 0.00 ? 94  VAL A N    5  
ATOM 10288 C CA   . VAL A 1 94  ? -2.711  -5.293  7.109   1.00 0.00 ? 94  VAL A CA   5  
ATOM 10289 C C    . VAL A 1 94  ? -2.842  -6.002  5.774   1.00 0.00 ? 94  VAL A C    5  
ATOM 10290 O O    . VAL A 1 94  ? -3.926  -6.271  5.295   1.00 0.00 ? 94  VAL A O    5  
ATOM 10291 C CB   . VAL A 1 94  ? -1.878  -6.177  8.040   1.00 0.00 ? 94  VAL A CB   5  
ATOM 10292 C CG1  . VAL A 1 94  ? -1.410  -5.370  9.245   1.00 0.00 ? 94  VAL A CG1  5  
ATOM 10293 C CG2  . VAL A 1 94  ? -2.736  -7.348  8.509   1.00 0.00 ? 94  VAL A CG2  5  
ATOM 10294 H H    . VAL A 1 94  ? -4.624  -5.877  7.882   1.00 0.00 ? 94  VAL A H    5  
ATOM 10295 H HA   . VAL A 1 94  ? -2.221  -4.349  6.975   1.00 0.00 ? 94  VAL A HA   5  
ATOM 10296 H HB   . VAL A 1 94  ? -1.018  -6.554  7.508   1.00 0.00 ? 94  VAL A HB   5  
ATOM 10297 H HG11 . VAL A 1 94  ? -2.016  -4.481  9.340   1.00 0.00 ? 94  VAL A HG11 5  
ATOM 10298 H HG12 . VAL A 1 94  ? -1.503  -5.968  10.138  1.00 0.00 ? 94  VAL A HG12 5  
ATOM 10299 H HG13 . VAL A 1 94  ? -0.378  -5.091  9.104   1.00 0.00 ? 94  VAL A HG13 5  
ATOM 10300 H HG21 . VAL A 1 94  ? -3.423  -7.620  7.720   1.00 0.00 ? 94  VAL A HG21 5  
ATOM 10301 H HG22 . VAL A 1 94  ? -2.104  -8.184  8.748   1.00 0.00 ? 94  VAL A HG22 5  
ATOM 10302 H HG23 . VAL A 1 94  ? -3.295  -7.048  9.383   1.00 0.00 ? 94  VAL A HG23 5  
ATOM 10303 N N    . CYS A 1 95  ? -1.733  -6.323  5.192   1.00 0.00 ? 95  CYS A N    5  
ATOM 10304 C CA   . CYS A 1 95  ? -1.732  -7.048  3.903   1.00 0.00 ? 95  CYS A CA   5  
ATOM 10305 C C    . CYS A 1 95  ? -0.334  -7.598  3.700   1.00 0.00 ? 95  CYS A C    5  
ATOM 10306 O O    . CYS A 1 95  ? 0.441   -7.081  2.922   1.00 0.00 ? 95  CYS A O    5  
ATOM 10307 C CB   . CYS A 1 95  ? -2.094  -6.106  2.768   1.00 0.00 ? 95  CYS A CB   5  
ATOM 10308 S SG   . CYS A 1 95  ? -2.276  -7.055  1.237   1.00 0.00 ? 95  CYS A SG   5  
ATOM 10309 H H    . CYS A 1 95  ? -0.883  -6.096  5.621   1.00 0.00 ? 95  CYS A H    5  
ATOM 10310 H HA   . CYS A 1 95  ? -2.440  -7.854  3.948   1.00 0.00 ? 95  CYS A HA   5  
ATOM 10311 H HB2  . CYS A 1 95  ? -3.020  -5.612  2.998   1.00 0.00 ? 95  CYS A HB2  5  
ATOM 10312 H HB3  . CYS A 1 95  ? -1.322  -5.367  2.645   1.00 0.00 ? 95  CYS A HB3  5  
ATOM 10313 H HG   . CYS A 1 95  ? -2.987  -6.661  0.726   1.00 0.00 ? 95  CYS A HG   5  
ATOM 10314 N N    . GLU A 1 96  ? 0.002   -8.621  4.432   1.00 0.00 ? 96  GLU A N    5  
ATOM 10315 C CA   . GLU A 1 96  ? 1.373   -9.185  4.328   1.00 0.00 ? 96  GLU A CA   5  
ATOM 10316 C C    . GLU A 1 96  ? 1.607   -9.798  2.949   1.00 0.00 ? 96  GLU A C    5  
ATOM 10317 O O    . GLU A 1 96  ? 1.031   -10.810 2.598   1.00 0.00 ? 96  GLU A O    5  
ATOM 10318 C CB   . GLU A 1 96  ? 1.587   -10.255 5.397   1.00 0.00 ? 96  GLU A CB   5  
ATOM 10319 C CG   . GLU A 1 96  ? 3.059   -10.670 5.390   1.00 0.00 ? 96  GLU A CG   5  
ATOM 10320 C CD   . GLU A 1 96  ? 3.255   -11.890 6.291   1.00 0.00 ? 96  GLU A CD   5  
ATOM 10321 O OE1  . GLU A 1 96  ? 2.539   -12.860 6.105   1.00 0.00 ? 96  GLU A OE1  5  
ATOM 10322 O OE2  . GLU A 1 96  ? 4.117   -11.834 7.153   1.00 0.00 ? 96  GLU A OE2  5  
ATOM 10323 H H    . GLU A 1 96  ? -0.642  -8.999  5.071   1.00 0.00 ? 96  GLU A H    5  
ATOM 10324 H HA   . GLU A 1 96  ? 2.082   -8.386  4.486   1.00 0.00 ? 96  GLU A HA   5  
ATOM 10325 H HB2  . GLU A 1 96  ? 1.325   -9.855  6.367   1.00 0.00 ? 96  GLU A HB2  5  
ATOM 10326 H HB3  . GLU A 1 96  ? 0.970   -11.114 5.180   1.00 0.00 ? 96  GLU A HB3  5  
ATOM 10327 H HG2  . GLU A 1 96  ? 3.355   -10.913 4.378   1.00 0.00 ? 96  GLU A HG2  5  
ATOM 10328 H HG3  . GLU A 1 96  ? 3.664   -9.852  5.752   1.00 0.00 ? 96  GLU A HG3  5  
ATOM 10329 N N    . GLN A 1 97  ? 2.474   -9.196  2.181   1.00 0.00 ? 97  GLN A N    5  
ATOM 10330 C CA   . GLN A 1 97  ? 2.794   -9.729  0.838   1.00 0.00 ? 97  GLN A CA   5  
ATOM 10331 C C    . GLN A 1 97  ? 4.136   -10.464 0.916   1.00 0.00 ? 97  GLN A C    5  
ATOM 10332 O O    . GLN A 1 97  ? 5.133   -9.894  1.320   1.00 0.00 ? 97  GLN A O    5  
ATOM 10333 C CB   . GLN A 1 97  ? 2.902   -8.564  -0.143  1.00 0.00 ? 97  GLN A CB   5  
ATOM 10334 C CG   . GLN A 1 97  ? 1.553   -7.850  -0.248  1.00 0.00 ? 97  GLN A CG   5  
ATOM 10335 C CD   . GLN A 1 97  ? 1.308   -7.405  -1.694  1.00 0.00 ? 97  GLN A CD   5  
ATOM 10336 O OE1  . GLN A 1 97  ? 2.216   -7.386  -2.503  1.00 0.00 ? 97  GLN A OE1  5  
ATOM 10337 N NE2  . GLN A 1 97  ? 0.108   -7.040  -2.055  1.00 0.00 ? 97  GLN A NE2  5  
ATOM 10338 H H    . GLN A 1 97  ? 2.930   -8.395  2.498   1.00 0.00 ? 97  GLN A H    5  
ATOM 10339 H HA   . GLN A 1 97  ? 2.019   -10.405 0.523   1.00 0.00 ? 97  GLN A HA   5  
ATOM 10340 H HB2  . GLN A 1 97  ? 3.646   -7.868  0.209   1.00 0.00 ? 97  GLN A HB2  5  
ATOM 10341 H HB3  . GLN A 1 97  ? 3.187   -8.936  -1.107  1.00 0.00 ? 97  GLN A HB3  5  
ATOM 10342 H HG2  . GLN A 1 97  ? 0.766   -8.522  0.060   1.00 0.00 ? 97  GLN A HG2  5  
ATOM 10343 H HG3  . GLN A 1 97  ? 1.558   -6.983  0.396   1.00 0.00 ? 97  GLN A HG3  5  
ATOM 10344 H HE21 . GLN A 1 97  ? -0.624  -7.053  -1.404  1.00 0.00 ? 97  GLN A HE21 5  
ATOM 10345 H HE22 . GLN A 1 97  ? -0.060  -6.754  -2.977  1.00 0.00 ? 97  GLN A HE22 5  
ATOM 10346 N N    . LYS A 1 98  ? 4.173   -11.725 0.556   1.00 0.00 ? 98  LYS A N    5  
ATOM 10347 C CA   . LYS A 1 98  ? 5.465   -12.483 0.636   1.00 0.00 ? 98  LYS A CA   5  
ATOM 10348 C C    . LYS A 1 98  ? 5.773   -13.145 -0.709  1.00 0.00 ? 98  LYS A C    5  
ATOM 10349 O O    . LYS A 1 98  ? 4.918   -13.253 -1.563  1.00 0.00 ? 98  LYS A O    5  
ATOM 10350 C CB   . LYS A 1 98  ? 5.358   -13.560 1.720   1.00 0.00 ? 98  LYS A CB   5  
ATOM 10351 C CG   . LYS A 1 98  ? 4.081   -14.381 1.511   1.00 0.00 ? 98  LYS A CG   5  
ATOM 10352 C CD   . LYS A 1 98  ? 4.343   -15.841 1.883   1.00 0.00 ? 98  LYS A CD   5  
ATOM 10353 C CE   . LYS A 1 98  ? 3.073   -16.453 2.478   1.00 0.00 ? 98  LYS A CE   5  
ATOM 10354 N NZ   . LYS A 1 98  ? 3.248   -17.927 2.610   1.00 0.00 ? 98  LYS A NZ   5  
ATOM 10355 H H    . LYS A 1 98  ? 3.353   -12.176 0.248   1.00 0.00 ? 98  LYS A H    5  
ATOM 10356 H HA   . LYS A 1 98  ? 6.263   -11.800 0.889   1.00 0.00 ? 98  LYS A HA   5  
ATOM 10357 H HB2  . LYS A 1 98  ? 6.219   -14.212 1.665   1.00 0.00 ? 98  LYS A HB2  5  
ATOM 10358 H HB3  . LYS A 1 98  ? 5.325   -13.091 2.692   1.00 0.00 ? 98  LYS A HB3  5  
ATOM 10359 H HG2  . LYS A 1 98  ? 3.293   -13.985 2.136   1.00 0.00 ? 98  LYS A HG2  5  
ATOM 10360 H HG3  . LYS A 1 98  ? 3.782   -14.324 0.475   1.00 0.00 ? 98  LYS A HG3  5  
ATOM 10361 H HD2  . LYS A 1 98  ? 4.628   -16.391 0.998   1.00 0.00 ? 98  LYS A HD2  5  
ATOM 10362 H HD3  . LYS A 1 98  ? 5.138   -15.889 2.610   1.00 0.00 ? 98  LYS A HD3  5  
ATOM 10363 H HE2  . LYS A 1 98  ? 2.888   -16.024 3.452   1.00 0.00 ? 98  LYS A HE2  5  
ATOM 10364 H HE3  . LYS A 1 98  ? 2.235   -16.246 1.829   1.00 0.00 ? 98  LYS A HE3  5  
ATOM 10365 H HZ1  . LYS A 1 98  ? 4.145   -18.127 3.098   1.00 0.00 ? 98  LYS A HZ1  5  
ATOM 10366 H HZ2  . LYS A 1 98  ? 2.458   -18.322 3.159   1.00 0.00 ? 98  LYS A HZ2  5  
ATOM 10367 H HZ3  . LYS A 1 98  ? 3.262   -18.361 1.666   1.00 0.00 ? 98  LYS A HZ3  5  
ATOM 10368 N N    . LEU A 1 99  ? 6.992   -13.600 -0.895  1.00 0.00 ? 99  LEU A N    5  
ATOM 10369 C CA   . LEU A 1 99  ? 7.350   -14.274 -2.187  1.00 0.00 ? 99  LEU A CA   5  
ATOM 10370 C C    . LEU A 1 99  ? 7.361   -15.788 -1.986  1.00 0.00 ? 99  LEU A C    5  
ATOM 10371 O O    . LEU A 1 99  ? 8.209   -16.490 -2.502  1.00 0.00 ? 99  LEU A O    5  
ATOM 10372 C CB   . LEU A 1 99  ? 8.713   -13.805 -2.742  1.00 0.00 ? 99  LEU A CB   5  
ATOM 10373 C CG   . LEU A 1 99  ? 9.682   -13.451 -1.616  1.00 0.00 ? 99  LEU A CG   5  
ATOM 10374 C CD1  . LEU A 1 99  ? 11.113  -13.791 -2.043  1.00 0.00 ? 99  LEU A CD1  5  
ATOM 10375 C CD2  . LEU A 1 99  ? 9.587   -11.953 -1.322  1.00 0.00 ? 99  LEU A CD2  5  
ATOM 10376 H H    . LEU A 1 99  ? 7.657   -13.508 -0.184  1.00 0.00 ? 99  LEU A H    5  
ATOM 10377 H HA   . LEU A 1 99  ? 6.594   -14.039 -2.903  1.00 0.00 ? 99  LEU A HA   5  
ATOM 10378 H HB2  . LEU A 1 99  ? 9.140   -14.596 -3.340  1.00 0.00 ? 99  LEU A HB2  5  
ATOM 10379 H HB3  . LEU A 1 99  ? 8.560   -12.936 -3.366  1.00 0.00 ? 99  LEU A HB3  5  
ATOM 10380 H HG   . LEU A 1 99  ? 9.423   -14.016 -0.737  1.00 0.00 ? 99  LEU A HG   5  
ATOM 10381 H HD11 . LEU A 1 99  ? 11.256  -13.509 -3.076  1.00 0.00 ? 99  LEU A HD11 5  
ATOM 10382 H HD12 . LEU A 1 99  ? 11.812  -13.249 -1.422  1.00 0.00 ? 99  LEU A HD12 5  
ATOM 10383 H HD13 . LEU A 1 99  ? 11.280  -14.851 -1.933  1.00 0.00 ? 99  LEU A HD13 5  
ATOM 10384 H HD21 . LEU A 1 99  ? 8.552   -11.646 -1.345  1.00 0.00 ? 99  LEU A HD21 5  
ATOM 10385 H HD22 . LEU A 1 99  ? 10.002  -11.749 -0.346  1.00 0.00 ? 99  LEU A HD22 5  
ATOM 10386 H HD23 . LEU A 1 99  ? 10.141  -11.404 -2.070  1.00 0.00 ? 99  LEU A HD23 5  
ATOM 10387 N N    . LEU A 1 100 ? 6.405   -16.292 -1.246  1.00 0.00 ? 100 LEU A N    5  
ATOM 10388 C CA   . LEU A 1 100 ? 6.318   -17.765 -1.005  1.00 0.00 ? 100 LEU A CA   5  
ATOM 10389 C C    . LEU A 1 100 ? 7.604   -18.291 -0.355  1.00 0.00 ? 100 LEU A C    5  
ATOM 10390 O O    . LEU A 1 100 ? 7.881   -19.475 -0.387  1.00 0.00 ? 100 LEU A O    5  
ATOM 10391 C CB   . LEU A 1 100 ? 6.109   -18.474 -2.337  1.00 0.00 ? 100 LEU A CB   5  
ATOM 10392 C CG   . LEU A 1 100 ? 4.852   -17.924 -3.016  1.00 0.00 ? 100 LEU A CG   5  
ATOM 10393 C CD1  . LEU A 1 100 ? 4.925   -18.184 -4.520  1.00 0.00 ? 100 LEU A CD1  5  
ATOM 10394 C CD2  . LEU A 1 100 ? 3.614   -18.615 -2.441  1.00 0.00 ? 100 LEU A CD2  5  
ATOM 10395 H H    . LEU A 1 100 ? 5.731   -15.698 -0.856  1.00 0.00 ? 100 LEU A H    5  
ATOM 10396 H HA   . LEU A 1 100 ? 5.479   -17.970 -0.359  1.00 0.00 ? 100 LEU A HA   5  
ATOM 10397 H HB2  . LEU A 1 100 ? 6.969   -18.300 -2.968  1.00 0.00 ? 100 LEU A HB2  5  
ATOM 10398 H HB3  . LEU A 1 100 ? 5.994   -19.531 -2.164  1.00 0.00 ? 100 LEU A HB3  5  
ATOM 10399 H HG   . LEU A 1 100 ? 4.785   -16.860 -2.840  1.00 0.00 ? 100 LEU A HG   5  
ATOM 10400 H HD11 . LEU A 1 100 ? 5.524   -19.063 -4.705  1.00 0.00 ? 100 LEU A HD11 5  
ATOM 10401 H HD12 . LEU A 1 100 ? 3.928   -18.339 -4.907  1.00 0.00 ? 100 LEU A HD12 5  
ATOM 10402 H HD13 . LEU A 1 100 ? 5.373   -17.333 -5.011  1.00 0.00 ? 100 LEU A HD13 5  
ATOM 10403 H HD21 . LEU A 1 100 ? 3.566   -18.440 -1.376  1.00 0.00 ? 100 LEU A HD21 5  
ATOM 10404 H HD22 . LEU A 1 100 ? 2.728   -18.216 -2.912  1.00 0.00 ? 100 LEU A HD22 5  
ATOM 10405 H HD23 . LEU A 1 100 ? 3.675   -19.677 -2.629  1.00 0.00 ? 100 LEU A HD23 5  
ATOM 10406 N N    . LYS A 1 101 ? 8.385   -17.425 0.233   1.00 0.00 ? 101 LYS A N    5  
ATOM 10407 C CA   . LYS A 1 101 ? 9.654   -17.863 0.892   1.00 0.00 ? 101 LYS A CA   5  
ATOM 10408 C C    . LYS A 1 101 ? 10.370  -16.636 1.454   1.00 0.00 ? 101 LYS A C    5  
ATOM 10409 O O    . LYS A 1 101 ? 10.468  -16.454 2.653   1.00 0.00 ? 101 LYS A O    5  
ATOM 10410 C CB   . LYS A 1 101 ? 10.559  -18.562 -0.132  1.00 0.00 ? 101 LYS A CB   5  
ATOM 10411 C CG   . LYS A 1 101 ? 11.226  -19.780 0.516   1.00 0.00 ? 101 LYS A CG   5  
ATOM 10412 C CD   . LYS A 1 101 ? 12.163  -19.319 1.640   1.00 0.00 ? 101 LYS A CD   5  
ATOM 10413 C CE   . LYS A 1 101 ? 13.449  -20.152 1.619   1.00 0.00 ? 101 LYS A CE   5  
ATOM 10414 N NZ   . LYS A 1 101 ? 14.543  -19.357 0.992   1.00 0.00 ? 101 LYS A NZ   5  
ATOM 10415 H H    . LYS A 1 101 ? 8.137   -16.484 0.246   1.00 0.00 ? 101 LYS A H    5  
ATOM 10416 H HA   . LYS A 1 101 ? 9.426   -18.541 1.695   1.00 0.00 ? 101 LYS A HA   5  
ATOM 10417 H HB2  . LYS A 1 101 ? 9.965   -18.884 -0.975  1.00 0.00 ? 101 LYS A HB2  5  
ATOM 10418 H HB3  . LYS A 1 101 ? 11.319  -17.877 -0.468  1.00 0.00 ? 101 LYS A HB3  5  
ATOM 10419 H HG2  . LYS A 1 101 ? 10.465  -20.430 0.925   1.00 0.00 ? 101 LYS A HG2  5  
ATOM 10420 H HG3  . LYS A 1 101 ? 11.794  -20.316 -0.229  1.00 0.00 ? 101 LYS A HG3  5  
ATOM 10421 H HD2  . LYS A 1 101 ? 12.409  -18.276 1.500   1.00 0.00 ? 101 LYS A HD2  5  
ATOM 10422 H HD3  . LYS A 1 101 ? 11.671  -19.447 2.592   1.00 0.00 ? 101 LYS A HD3  5  
ATOM 10423 H HE2  . LYS A 1 101 ? 13.727  -20.409 2.630   1.00 0.00 ? 101 LYS A HE2  5  
ATOM 10424 H HE3  . LYS A 1 101 ? 13.288  -21.055 1.049   1.00 0.00 ? 101 LYS A HE3  5  
ATOM 10425 H HZ1  . LYS A 1 101 ? 14.172  -18.857 0.157   1.00 0.00 ? 101 LYS A HZ1  5  
ATOM 10426 H HZ2  . LYS A 1 101 ? 14.907  -18.666 1.677   1.00 0.00 ? 101 LYS A HZ2  5  
ATOM 10427 H HZ3  . LYS A 1 101 ? 15.312  -19.993 0.702   1.00 0.00 ? 101 LYS A HZ3  5  
ATOM 10428 N N    . GLY A 1 102 ? 10.863  -15.791 0.589   1.00 0.00 ? 102 GLY A N    5  
ATOM 10429 C CA   . GLY A 1 102 ? 11.571  -14.562 1.048   1.00 0.00 ? 102 GLY A CA   5  
ATOM 10430 C C    . GLY A 1 102 ? 13.082  -14.755 0.935   1.00 0.00 ? 102 GLY A C    5  
ATOM 10431 O O    . GLY A 1 102 ? 13.614  -15.799 1.265   1.00 0.00 ? 102 GLY A O    5  
ATOM 10432 H H    . GLY A 1 102 ? 10.761  -15.966 -0.368  1.00 0.00 ? 102 GLY A H    5  
ATOM 10433 H HA2  . GLY A 1 102 ? 11.269  -13.725 0.437   1.00 0.00 ? 102 GLY A HA2  5  
ATOM 10434 H HA3  . GLY A 1 102 ? 11.317  -14.361 2.076   1.00 0.00 ? 102 GLY A HA3  5  
ATOM 10435 N N    . GLU A 1 103 ? 13.773  -13.742 0.487   1.00 0.00 ? 103 GLU A N    5  
ATOM 10436 C CA   . GLU A 1 103 ? 15.255  -13.830 0.362   1.00 0.00 ? 103 GLU A CA   5  
ATOM 10437 C C    . GLU A 1 103 ? 15.881  -12.903 1.402   1.00 0.00 ? 103 GLU A C    5  
ATOM 10438 O O    . GLU A 1 103 ? 16.879  -13.224 2.020   1.00 0.00 ? 103 GLU A O    5  
ATOM 10439 C CB   . GLU A 1 103 ? 15.692  -13.412 -1.048  1.00 0.00 ? 103 GLU A CB   5  
ATOM 10440 C CG   . GLU A 1 103 ? 15.065  -12.064 -1.417  1.00 0.00 ? 103 GLU A CG   5  
ATOM 10441 C CD   . GLU A 1 103 ? 15.580  -11.622 -2.789  1.00 0.00 ? 103 GLU A CD   5  
ATOM 10442 O OE1  . GLU A 1 103 ? 16.787  -11.582 -2.961  1.00 0.00 ? 103 GLU A OE1  5  
ATOM 10443 O OE2  . GLU A 1 103 ? 14.759  -11.332 -3.643  1.00 0.00 ? 103 GLU A OE2  5  
ATOM 10444 H H    . GLU A 1 103 ? 13.314  -12.916 0.247   1.00 0.00 ? 103 GLU A H    5  
ATOM 10445 H HA   . GLU A 1 103 ? 15.566  -14.843 0.551   1.00 0.00 ? 103 GLU A HA   5  
ATOM 10446 H HB2  . GLU A 1 103 ? 16.768  -13.327 -1.079  1.00 0.00 ? 103 GLU A HB2  5  
ATOM 10447 H HB3  . GLU A 1 103 ? 15.372  -14.160 -1.759  1.00 0.00 ? 103 GLU A HB3  5  
ATOM 10448 H HG2  . GLU A 1 103 ? 13.990  -12.162 -1.452  1.00 0.00 ? 103 GLU A HG2  5  
ATOM 10449 H HG3  . GLU A 1 103 ? 15.337  -11.325 -0.680  1.00 0.00 ? 103 GLU A HG3  5  
ATOM 10450 N N    . GLY A 1 104 ? 15.281  -11.762 1.608   1.00 0.00 ? 104 GLY A N    5  
ATOM 10451 C CA   . GLY A 1 104 ? 15.795  -10.798 2.615   1.00 0.00 ? 104 GLY A CA   5  
ATOM 10452 C C    . GLY A 1 104 ? 14.599  -10.021 3.188   1.00 0.00 ? 104 GLY A C    5  
ATOM 10453 O O    . GLY A 1 104 ? 14.022  -10.443 4.171   1.00 0.00 ? 104 GLY A O    5  
ATOM 10454 H H    . GLY A 1 104 ? 14.474  -11.541 1.104   1.00 0.00 ? 104 GLY A H    5  
ATOM 10455 H HA2  . GLY A 1 104 ? 16.294  -11.339 3.406   1.00 0.00 ? 104 GLY A HA2  5  
ATOM 10456 H HA3  . GLY A 1 104 ? 16.485  -10.114 2.151   1.00 0.00 ? 104 GLY A HA3  5  
ATOM 10457 N N    . PRO A 1 105 ? 14.237  -8.914  2.561   1.00 0.00 ? 105 PRO A N    5  
ATOM 10458 C CA   . PRO A 1 105 ? 13.096  -8.106  3.014   1.00 0.00 ? 105 PRO A CA   5  
ATOM 10459 C C    . PRO A 1 105 ? 11.783  -8.681  2.462   1.00 0.00 ? 105 PRO A C    5  
ATOM 10460 O O    . PRO A 1 105 ? 11.723  -9.831  2.068   1.00 0.00 ? 105 PRO A O    5  
ATOM 10461 C CB   . PRO A 1 105 ? 13.383  -6.723  2.433   1.00 0.00 ? 105 PRO A CB   5  
ATOM 10462 C CG   . PRO A 1 105 ? 14.336  -6.933  1.231   1.00 0.00 ? 105 PRO A CG   5  
ATOM 10463 C CD   . PRO A 1 105 ? 14.920  -8.354  1.368   1.00 0.00 ? 105 PRO A CD   5  
ATOM 10464 H HA   . PRO A 1 105 ? 13.065  -8.058  4.087   1.00 0.00 ? 105 PRO A HA   5  
ATOM 10465 H HB2  . PRO A 1 105 ? 12.463  -6.271  2.106   1.00 0.00 ? 105 PRO A HB2  5  
ATOM 10466 H HB3  . PRO A 1 105 ? 13.861  -6.102  3.173   1.00 0.00 ? 105 PRO A HB3  5  
ATOM 10467 H HG2  . PRO A 1 105 ? 13.787  -6.841  0.307   1.00 0.00 ? 105 PRO A HG2  5  
ATOM 10468 H HG3  . PRO A 1 105 ? 15.136  -6.205  1.260   1.00 0.00 ? 105 PRO A HG3  5  
ATOM 10469 H HD2  . PRO A 1 105 ? 14.691  -8.941  0.489   1.00 0.00 ? 105 PRO A HD2  5  
ATOM 10470 H HD3  . PRO A 1 105 ? 15.983  -8.317  1.532   1.00 0.00 ? 105 PRO A HD3  5  
ATOM 10471 N N    . LYS A 1 106 ? 10.730  -7.897  2.444   1.00 0.00 ? 106 LYS A N    5  
ATOM 10472 C CA   . LYS A 1 106 ? 9.423   -8.404  1.937   1.00 0.00 ? 106 LYS A CA   5  
ATOM 10473 C C    . LYS A 1 106 ? 8.460   -7.238  1.699   1.00 0.00 ? 106 LYS A C    5  
ATOM 10474 O O    . LYS A 1 106 ? 8.713   -6.118  2.100   1.00 0.00 ? 106 LYS A O    5  
ATOM 10475 C CB   . LYS A 1 106 ? 8.835   -9.338  2.987   1.00 0.00 ? 106 LYS A CB   5  
ATOM 10476 C CG   . LYS A 1 106 ? 8.255   -10.585 2.313   1.00 0.00 ? 106 LYS A CG   5  
ATOM 10477 C CD   . LYS A 1 106 ? 8.440   -11.797 3.232   1.00 0.00 ? 106 LYS A CD   5  
ATOM 10478 C CE   . LYS A 1 106 ? 9.786   -12.472 2.945   1.00 0.00 ? 106 LYS A CE   5  
ATOM 10479 N NZ   . LYS A 1 106 ? 10.652  -12.383 4.155   1.00 0.00 ? 106 LYS A NZ   5  
ATOM 10480 H H    . LYS A 1 106 ? 10.796  -6.985  2.778   1.00 0.00 ? 106 LYS A H    5  
ATOM 10481 H HA   . LYS A 1 106 ? 9.578   -8.945  1.016   1.00 0.00 ? 106 LYS A HA   5  
ATOM 10482 H HB2  . LYS A 1 106 ? 9.618   -9.622  3.668   1.00 0.00 ? 106 LYS A HB2  5  
ATOM 10483 H HB3  . LYS A 1 106 ? 8.054   -8.826  3.530   1.00 0.00 ? 106 LYS A HB3  5  
ATOM 10484 H HG2  . LYS A 1 106 ? 7.202   -10.434 2.123   1.00 0.00 ? 106 LYS A HG2  5  
ATOM 10485 H HG3  . LYS A 1 106 ? 8.768   -10.762 1.380   1.00 0.00 ? 106 LYS A HG3  5  
ATOM 10486 H HD2  . LYS A 1 106 ? 8.413   -11.472 4.262   1.00 0.00 ? 106 LYS A HD2  5  
ATOM 10487 H HD3  . LYS A 1 106 ? 7.642   -12.503 3.058   1.00 0.00 ? 106 LYS A HD3  5  
ATOM 10488 H HE2  . LYS A 1 106 ? 9.621   -13.510 2.698   1.00 0.00 ? 106 LYS A HE2  5  
ATOM 10489 H HE3  . LYS A 1 106 ? 10.275  -11.979 2.117   1.00 0.00 ? 106 LYS A HE3  5  
ATOM 10490 H HZ1  . LYS A 1 106 ? 10.480  -11.480 4.640   1.00 0.00 ? 106 LYS A HZ1  5  
ATOM 10491 H HZ2  . LYS A 1 106 ? 10.429  -13.168 4.800   1.00 0.00 ? 106 LYS A HZ2  5  
ATOM 10492 H HZ3  . LYS A 1 106 ? 11.651  -12.440 3.871   1.00 0.00 ? 106 LYS A HZ3  5  
ATOM 10493 N N    . THR A 1 107 ? 7.350   -7.503  1.056   1.00 0.00 ? 107 THR A N    5  
ATOM 10494 C CA   . THR A 1 107 ? 6.355   -6.432  0.786   1.00 0.00 ? 107 THR A CA   5  
ATOM 10495 C C    . THR A 1 107 ? 5.158   -6.604  1.721   1.00 0.00 ? 107 THR A C    5  
ATOM 10496 O O    . THR A 1 107 ? 4.994   -7.630  2.348   1.00 0.00 ? 107 THR A O    5  
ATOM 10497 C CB   . THR A 1 107 ? 5.884   -6.552  -0.668  1.00 0.00 ? 107 THR A CB   5  
ATOM 10498 O OG1  . THR A 1 107 ? 5.823   -7.923  -1.042  1.00 0.00 ? 107 THR A OG1  5  
ATOM 10499 C CG2  . THR A 1 107 ? 6.858   -5.831  -1.594  1.00 0.00 ? 107 THR A CG2  5  
ATOM 10500 H H    . THR A 1 107 ? 7.167   -8.416  0.752   1.00 0.00 ? 107 THR A H    5  
ATOM 10501 H HA   . THR A 1 107 ? 6.802   -5.465  0.950   1.00 0.00 ? 107 THR A HA   5  
ATOM 10502 H HB   . THR A 1 107 ? 4.910   -6.110  -0.765  1.00 0.00 ? 107 THR A HB   5  
ATOM 10503 H HG1  . THR A 1 107 ? 5.456   -8.416  -0.309  1.00 0.00 ? 107 THR A HG1  5  
ATOM 10504 H HG21 . THR A 1 107 ? 7.865   -5.953  -1.221  1.00 0.00 ? 107 THR A HG21 5  
ATOM 10505 H HG22 . THR A 1 107 ? 6.788   -6.245  -2.587  1.00 0.00 ? 107 THR A HG22 5  
ATOM 10506 H HG23 . THR A 1 107 ? 6.612   -4.781  -1.622  1.00 0.00 ? 107 THR A HG23 5  
ATOM 10507 N N    . SER A 1 108 ? 4.322   -5.598  1.819   1.00 0.00 ? 108 SER A N    5  
ATOM 10508 C CA   . SER A 1 108 ? 3.118   -5.676  2.709   1.00 0.00 ? 108 SER A CA   5  
ATOM 10509 C C    . SER A 1 108 ? 2.465   -4.293  2.772   1.00 0.00 ? 108 SER A C    5  
ATOM 10510 O O    . SER A 1 108 ? 3.028   -3.322  2.307   1.00 0.00 ? 108 SER A O    5  
ATOM 10511 C CB   . SER A 1 108 ? 3.536   -6.087  4.125   1.00 0.00 ? 108 SER A CB   5  
ATOM 10512 O OG   . SER A 1 108 ? 4.786   -5.487  4.439   1.00 0.00 ? 108 SER A OG   5  
ATOM 10513 H H    . SER A 1 108 ? 4.488   -4.782  1.302   1.00 0.00 ? 108 SER A H    5  
ATOM 10514 H HA   . SER A 1 108 ? 2.420   -6.398  2.316   1.00 0.00 ? 108 SER A HA   5  
ATOM 10515 H HB2  . SER A 1 108 ? 2.795   -5.754  4.832   1.00 0.00 ? 108 SER A HB2  5  
ATOM 10516 H HB3  . SER A 1 108 ? 3.618   -7.164  4.175   1.00 0.00 ? 108 SER A HB3  5  
ATOM 10517 H HG   . SER A 1 108 ? 4.752   -5.191  5.352   1.00 0.00 ? 108 SER A HG   5  
ATOM 10518 N N    . TRP A 1 109 ? 1.308   -4.183  3.382   1.00 0.00 ? 109 TRP A N    5  
ATOM 10519 C CA   . TRP A 1 109 ? 0.665   -2.839  3.520   1.00 0.00 ? 109 TRP A CA   5  
ATOM 10520 C C    . TRP A 1 109 ? -0.398  -2.880  4.586   1.00 0.00 ? 109 TRP A C    5  
ATOM 10521 O O    . TRP A 1 109 ? -1.115  -3.851  4.733   1.00 0.00 ? 109 TRP A O    5  
ATOM 10522 C CB   . TRP A 1 109 ? 0.080   -2.296  2.196   1.00 0.00 ? 109 TRP A CB   5  
ATOM 10523 C CG   . TRP A 1 109 ? -1.110  -3.038  1.660   1.00 0.00 ? 109 TRP A CG   5  
ATOM 10524 C CD1  . TRP A 1 109 ? -1.105  -3.692  0.480   1.00 0.00 ? 109 TRP A CD1  5  
ATOM 10525 C CD2  . TRP A 1 109 ? -2.482  -3.144  2.183   1.00 0.00 ? 109 TRP A CD2  5  
ATOM 10526 N NE1  . TRP A 1 109 ? -2.365  -4.206  0.240   1.00 0.00 ? 109 TRP A NE1  5  
ATOM 10527 C CE2  . TRP A 1 109 ? -3.248  -3.903  1.257   1.00 0.00 ? 109 TRP A CE2  5  
ATOM 10528 C CE3  . TRP A 1 109 ? -3.138  -2.682  3.352   1.00 0.00 ? 109 TRP A CE3  5  
ATOM 10529 C CZ2  . TRP A 1 109 ? -4.598  -4.186  1.478   1.00 0.00 ? 109 TRP A CZ2  5  
ATOM 10530 C CZ3  . TRP A 1 109 ? -4.492  -2.972  3.568   1.00 0.00 ? 109 TRP A CZ3  5  
ATOM 10531 C CH2  . TRP A 1 109 ? -5.217  -3.720  2.635   1.00 0.00 ? 109 TRP A CH2  5  
ATOM 10532 H H    . TRP A 1 109 ? 0.887   -4.975  3.788   1.00 0.00 ? 109 TRP A H    5  
ATOM 10533 H HA   . TRP A 1 109 ? 1.426   -2.149  3.852   1.00 0.00 ? 109 TRP A HA   5  
ATOM 10534 H HB2  . TRP A 1 109 ? -0.233  -1.289  2.355   1.00 0.00 ? 109 TRP A HB2  5  
ATOM 10535 H HB3  . TRP A 1 109 ? 0.856   -2.297  1.451   1.00 0.00 ? 109 TRP A HB3  5  
ATOM 10536 H HD1  . TRP A 1 109 ? -0.248  -3.795  -0.169  1.00 0.00 ? 109 TRP A HD1  5  
ATOM 10537 H HE1  . TRP A 1 109 ? -2.620  -4.730  -0.548  1.00 0.00 ? 109 TRP A HE1  5  
ATOM 10538 H HE3  . TRP A 1 109 ? -2.602  -2.107  4.090   1.00 0.00 ? 109 TRP A HE3  5  
ATOM 10539 H HZ2  . TRP A 1 109 ? -5.163  -4.761  0.756   1.00 0.00 ? 109 TRP A HZ2  5  
ATOM 10540 H HZ3  . TRP A 1 109 ? -4.980  -2.615  4.463   1.00 0.00 ? 109 TRP A HZ3  5  
ATOM 10541 H HH2  . TRP A 1 109 ? -6.253  -3.940  2.812   1.00 0.00 ? 109 TRP A HH2  5  
ATOM 10542 N N    . THR A 1 110 ? -0.497  -1.821  5.345   1.00 0.00 ? 110 THR A N    5  
ATOM 10543 C CA   . THR A 1 110 ? -1.516  -1.775  6.422   1.00 0.00 ? 110 THR A CA   5  
ATOM 10544 C C    . THR A 1 110 ? -2.302  -0.477  6.343   1.00 0.00 ? 110 THR A C    5  
ATOM 10545 O O    . THR A 1 110 ? -1.802  0.591   6.629   1.00 0.00 ? 110 THR A O    5  
ATOM 10546 C CB   . THR A 1 110 ? -0.849  -1.882  7.787   1.00 0.00 ? 110 THR A CB   5  
ATOM 10547 O OG1  . THR A 1 110 ? -0.169  -0.669  8.079   1.00 0.00 ? 110 THR A OG1  5  
ATOM 10548 C CG2  . THR A 1 110 ? 0.144   -3.044  7.789   1.00 0.00 ? 110 THR A CG2  5  
ATOM 10549 H H    . THR A 1 110 ? 0.110   -1.058  5.205   1.00 0.00 ? 110 THR A H    5  
ATOM 10550 H HA   . THR A 1 110 ? -2.197  -2.598  6.294   1.00 0.00 ? 110 THR A HA   5  
ATOM 10551 H HB   . THR A 1 110 ? -1.606  -2.061  8.527   1.00 0.00 ? 110 THR A HB   5  
ATOM 10552 H HG1  . THR A 1 110 ? -0.174  -0.549  9.032   1.00 0.00 ? 110 THR A HG1  5  
ATOM 10553 H HG21 . THR A 1 110 ? -0.311  -3.905  7.323   1.00 0.00 ? 110 THR A HG21 5  
ATOM 10554 H HG22 . THR A 1 110 ? 1.028   -2.761  7.237   1.00 0.00 ? 110 THR A HG22 5  
ATOM 10555 H HG23 . THR A 1 110 ? 0.414   -3.284  8.805   1.00 0.00 ? 110 THR A HG23 5  
ATOM 10556 N N    . ARG A 1 111 ? -3.543  -0.583  5.980   1.00 0.00 ? 111 ARG A N    5  
ATOM 10557 C CA   . ARG A 1 111 ? -4.416  0.623   5.890   1.00 0.00 ? 111 ARG A CA   5  
ATOM 10558 C C    . ARG A 1 111 ? -4.973  0.893   7.282   1.00 0.00 ? 111 ARG A C    5  
ATOM 10559 O O    . ARG A 1 111 ? -5.416  -0.014  7.944   1.00 0.00 ? 111 ARG A O    5  
ATOM 10560 C CB   . ARG A 1 111 ? -5.552  0.342   4.896   1.00 0.00 ? 111 ARG A CB   5  
ATOM 10561 C CG   . ARG A 1 111 ? -5.027  0.480   3.466   1.00 0.00 ? 111 ARG A CG   5  
ATOM 10562 C CD   . ARG A 1 111 ? -6.158  0.192   2.477   1.00 0.00 ? 111 ARG A CD   5  
ATOM 10563 N NE   . ARG A 1 111 ? -5.790  0.716   1.130   1.00 0.00 ? 111 ARG A NE   5  
ATOM 10564 C CZ   . ARG A 1 111 ? -4.759  0.225   0.495   1.00 0.00 ? 111 ARG A CZ   5  
ATOM 10565 N NH1  . ARG A 1 111 ? -4.539  -1.061  0.501   1.00 0.00 ? 111 ARG A NH1  5  
ATOM 10566 N NH2  . ARG A 1 111 ? -3.948  1.022   -0.145  1.00 0.00 ? 111 ARG A NH2  5  
ATOM 10567 H H    . ARG A 1 111 ? -3.911  -1.474  5.787   1.00 0.00 ? 111 ARG A H    5  
ATOM 10568 H HA   . ARG A 1 111 ? -3.842  1.476   5.564   1.00 0.00 ? 111 ARG A HA   5  
ATOM 10569 H HB2  . ARG A 1 111 ? -5.920  -0.664  5.045   1.00 0.00 ? 111 ARG A HB2  5  
ATOM 10570 H HB3  . ARG A 1 111 ? -6.353  1.046   5.050   1.00 0.00 ? 111 ARG A HB3  5  
ATOM 10571 H HG2  . ARG A 1 111 ? -4.660  1.485   3.313   1.00 0.00 ? 111 ARG A HG2  5  
ATOM 10572 H HG3  . ARG A 1 111 ? -4.226  -0.225  3.308   1.00 0.00 ? 111 ARG A HG3  5  
ATOM 10573 H HD2  . ARG A 1 111 ? -6.320  -0.874  2.416   1.00 0.00 ? 111 ARG A HD2  5  
ATOM 10574 H HD3  . ARG A 1 111 ? -7.064  0.674   2.815   1.00 0.00 ? 111 ARG A HD3  5  
ATOM 10575 H HE   . ARG A 1 111 ? -6.323  1.429   0.720   1.00 0.00 ? 111 ARG A HE   5  
ATOM 10576 H HH11 . ARG A 1 111 ? -5.159  -1.672  0.992   1.00 0.00 ? 111 ARG A HH11 5  
ATOM 10577 H HH12 . ARG A 1 111 ? -3.749  -1.435  0.014   1.00 0.00 ? 111 ARG A HH12 5  
ATOM 10578 H HH21 . ARG A 1 111 ? -4.117  2.008   -0.150  1.00 0.00 ? 111 ARG A HH21 5  
ATOM 10579 H HH22 . ARG A 1 111 ? -3.159  0.648   -0.631  1.00 0.00 ? 111 ARG A HH22 5  
ATOM 10580 N N    . GLU A 1 112 ? -4.938  2.116   7.749   1.00 0.00 ? 112 GLU A N    5  
ATOM 10581 C CA   . GLU A 1 112 ? -5.456  2.384   9.122   1.00 0.00 ? 112 GLU A CA   5  
ATOM 10582 C C    . GLU A 1 112 ? -6.364  3.609   9.108   1.00 0.00 ? 112 GLU A C    5  
ATOM 10583 O O    . GLU A 1 112 ? -6.192  4.510   8.320   1.00 0.00 ? 112 GLU A O    5  
ATOM 10584 C CB   . GLU A 1 112 ? -4.272  2.607   10.071  1.00 0.00 ? 112 GLU A CB   5  
ATOM 10585 C CG   . GLU A 1 112 ? -4.774  2.834   11.504  1.00 0.00 ? 112 GLU A CG   5  
ATOM 10586 C CD   . GLU A 1 112 ? -4.715  4.325   11.842  1.00 0.00 ? 112 GLU A CD   5  
ATOM 10587 O OE1  . GLU A 1 112 ? -4.975  5.124   10.957  1.00 0.00 ? 112 GLU A OE1  5  
ATOM 10588 O OE2  . GLU A 1 112 ? -4.412  4.643   12.980  1.00 0.00 ? 112 GLU A OE2  5  
ATOM 10589 H H    . GLU A 1 112 ? -4.563  2.847   7.211   1.00 0.00 ? 112 GLU A H    5  
ATOM 10590 H HA   . GLU A 1 112 ? -6.026  1.529   9.455   1.00 0.00 ? 112 GLU A HA   5  
ATOM 10591 H HB2  . GLU A 1 112 ? -3.631  1.738   10.050  1.00 0.00 ? 112 GLU A HB2  5  
ATOM 10592 H HB3  . GLU A 1 112 ? -3.712  3.461   9.749   1.00 0.00 ? 112 GLU A HB3  5  
ATOM 10593 H HG2  . GLU A 1 112 ? -5.792  2.484   11.589  1.00 0.00 ? 112 GLU A HG2  5  
ATOM 10594 H HG3  . GLU A 1 112 ? -4.149  2.287   12.194  1.00 0.00 ? 112 GLU A HG3  5  
ATOM 10595 N N    . LEU A 1 113 ? -7.341  3.624   9.970   1.00 0.00 ? 113 LEU A N    5  
ATOM 10596 C CA   . LEU A 1 113 ? -8.297  4.762   10.031  1.00 0.00 ? 113 LEU A CA   5  
ATOM 10597 C C    . LEU A 1 113 ? -8.017  5.591   11.286  1.00 0.00 ? 113 LEU A C    5  
ATOM 10598 O O    . LEU A 1 113 ? -7.306  5.155   12.173  1.00 0.00 ? 113 LEU A O    5  
ATOM 10599 C CB   . LEU A 1 113 ? -9.709  4.170   10.094  1.00 0.00 ? 113 LEU A CB   5  
ATOM 10600 C CG   . LEU A 1 113 ? -10.250 3.824   8.698   1.00 0.00 ? 113 LEU A CG   5  
ATOM 10601 C CD1  . LEU A 1 113 ? -10.815 5.077   8.037   1.00 0.00 ? 113 LEU A CD1  5  
ATOM 10602 C CD2  . LEU A 1 113 ? -9.165  3.212   7.813   1.00 0.00 ? 113 LEU A CD2  5  
ATOM 10603 H H    . LEU A 1 113 ? -7.458  2.868   10.579  1.00 0.00 ? 113 LEU A H    5  
ATOM 10604 H HA   . LEU A 1 113 ? -8.197  5.378   9.150   1.00 0.00 ? 113 LEU A HA   5  
ATOM 10605 H HB2  . LEU A 1 113 ? -9.677  3.268   10.674  1.00 0.00 ? 113 LEU A HB2  5  
ATOM 10606 H HB3  . LEU A 1 113 ? -10.372 4.876   10.569  1.00 0.00 ? 113 LEU A HB3  5  
ATOM 10607 H HG   . LEU A 1 113 ? -11.033 3.103   8.806   1.00 0.00 ? 113 LEU A HG   5  
ATOM 10608 H HD11 . LEU A 1 113 ? -10.124 5.896   8.167   1.00 0.00 ? 113 LEU A HD11 5  
ATOM 10609 H HD12 . LEU A 1 113 ? -10.965 4.893   6.985   1.00 0.00 ? 113 LEU A HD12 5  
ATOM 10610 H HD13 . LEU A 1 113 ? -11.761 5.328   8.497   1.00 0.00 ? 113 LEU A HD13 5  
ATOM 10611 H HD21 . LEU A 1 113 ? -8.785  2.316   8.283   1.00 0.00 ? 113 LEU A HD21 5  
ATOM 10612 H HD22 . LEU A 1 113 ? -9.591  2.966   6.858   1.00 0.00 ? 113 LEU A HD22 5  
ATOM 10613 H HD23 . LEU A 1 113 ? -8.368  3.918   7.685   1.00 0.00 ? 113 LEU A HD23 5  
ATOM 10614 N N    . THR A 1 114 ? -8.561  6.782   11.372  1.00 0.00 ? 114 THR A N    5  
ATOM 10615 C CA   . THR A 1 114 ? -8.308  7.627   12.577  1.00 0.00 ? 114 THR A CA   5  
ATOM 10616 C C    . THR A 1 114 ? -9.412  8.676   12.742  1.00 0.00 ? 114 THR A C    5  
ATOM 10617 O O    . THR A 1 114 ? -9.775  9.367   11.814  1.00 0.00 ? 114 THR A O    5  
ATOM 10618 C CB   . THR A 1 114 ? -6.958  8.333   12.427  1.00 0.00 ? 114 THR A CB   5  
ATOM 10619 O OG1  . THR A 1 114 ? -6.092  7.533   11.633  1.00 0.00 ? 114 THR A OG1  5  
ATOM 10620 C CG2  . THR A 1 114 ? -6.336  8.547   13.807  1.00 0.00 ? 114 THR A CG2  5  
ATOM 10621 H H    . THR A 1 114 ? -9.128  7.117   10.646  1.00 0.00 ? 114 THR A H    5  
ATOM 10622 H HA   . THR A 1 114 ? -8.282  6.997   13.454  1.00 0.00 ? 114 THR A HA   5  
ATOM 10623 H HB   . THR A 1 114 ? -7.102  9.290   11.950  1.00 0.00 ? 114 THR A HB   5  
ATOM 10624 H HG1  . THR A 1 114 ? -5.826  8.051   10.870  1.00 0.00 ? 114 THR A HG1  5  
ATOM 10625 H HG21 . THR A 1 114 ? -7.121  8.671   14.540  1.00 0.00 ? 114 THR A HG21 5  
ATOM 10626 H HG22 . THR A 1 114 ? -5.734  7.689   14.068  1.00 0.00 ? 114 THR A HG22 5  
ATOM 10627 H HG23 . THR A 1 114 ? -5.716  9.431   13.790  1.00 0.00 ? 114 THR A HG23 5  
ATOM 10628 N N    . ASN A 1 115 ? -9.931  8.798   13.934  1.00 0.00 ? 115 ASN A N    5  
ATOM 10629 C CA   . ASN A 1 115 ? -11.001 9.799   14.211  1.00 0.00 ? 115 ASN A CA   5  
ATOM 10630 C C    . ASN A 1 115 ? -12.234 9.517   13.336  1.00 0.00 ? 115 ASN A C    5  
ATOM 10631 O O    . ASN A 1 115 ? -13.072 8.711   13.698  1.00 0.00 ? 115 ASN A O    5  
ATOM 10632 C CB   . ASN A 1 115 ? -10.454 11.213  13.961  1.00 0.00 ? 115 ASN A CB   5  
ATOM 10633 C CG   . ASN A 1 115 ? -9.339  11.514  14.965  1.00 0.00 ? 115 ASN A CG   5  
ATOM 10634 O OD1  . ASN A 1 115 ? -9.552  11.466  16.160  1.00 0.00 ? 115 ASN A OD1  5  
ATOM 10635 N ND2  . ASN A 1 115 ? -8.151  11.826  14.526  1.00 0.00 ? 115 ASN A ND2  5  
ATOM 10636 H H    . ASN A 1 115 ? -9.606  8.230   14.658  1.00 0.00 ? 115 ASN A H    5  
ATOM 10637 H HA   . ASN A 1 115 ? -11.290 9.716   15.244  1.00 0.00 ? 115 ASN A HA   5  
ATOM 10638 H HB2  . ASN A 1 115 ? -10.060 11.275  12.957  1.00 0.00 ? 115 ASN A HB2  5  
ATOM 10639 H HB3  . ASN A 1 115 ? -11.249 11.933  14.082  1.00 0.00 ? 115 ASN A HB3  5  
ATOM 10640 H HD21 . ASN A 1 115 ? -7.979  11.865  13.562  1.00 0.00 ? 115 ASN A HD21 5  
ATOM 10641 H HD22 . ASN A 1 115 ? -7.430  12.021  15.160  1.00 0.00 ? 115 ASN A HD22 5  
ATOM 10642 N N    . ASP A 1 116 ? -12.369 10.169  12.204  1.00 0.00 ? 116 ASP A N    5  
ATOM 10643 C CA   . ASP A 1 116 ? -13.552 9.932   11.340  1.00 0.00 ? 116 ASP A CA   5  
ATOM 10644 C C    . ASP A 1 116 ? -13.244 10.420  9.926   1.00 0.00 ? 116 ASP A C    5  
ATOM 10645 O O    . ASP A 1 116 ? -13.998 11.173  9.334   1.00 0.00 ? 116 ASP A O    5  
ATOM 10646 C CB   . ASP A 1 116 ? -14.743 10.701  11.905  1.00 0.00 ? 116 ASP A CB   5  
ATOM 10647 C CG   . ASP A 1 116 ? -14.370 12.174  12.083  1.00 0.00 ? 116 ASP A CG   5  
ATOM 10648 O OD1  . ASP A 1 116 ? -13.636 12.471  13.011  1.00 0.00 ? 116 ASP A OD1  5  
ATOM 10649 O OD2  . ASP A 1 116 ? -14.825 12.980  11.288  1.00 0.00 ? 116 ASP A OD2  5  
ATOM 10650 H H    . ASP A 1 116 ? -11.700 10.818  11.926  1.00 0.00 ? 116 ASP A H    5  
ATOM 10651 H HA   . ASP A 1 116 ? -13.779 8.876   11.317  1.00 0.00 ? 116 ASP A HA   5  
ATOM 10652 H HB2  . ASP A 1 116 ? -15.570 10.620  11.223  1.00 0.00 ? 116 ASP A HB2  5  
ATOM 10653 H HB3  . ASP A 1 116 ? -15.017 10.283  12.859  1.00 0.00 ? 116 ASP A HB3  5  
ATOM 10654 N N    . GLY A 1 117 ? -12.140 9.989   9.383   1.00 0.00 ? 117 GLY A N    5  
ATOM 10655 C CA   . GLY A 1 117 ? -11.770 10.417  7.999   1.00 0.00 ? 117 GLY A CA   5  
ATOM 10656 C C    . GLY A 1 117 ? -10.247 10.449  7.806   1.00 0.00 ? 117 GLY A C    5  
ATOM 10657 O O    . GLY A 1 117 ? -9.780  10.697  6.721   1.00 0.00 ? 117 GLY A O    5  
ATOM 10658 H H    . GLY A 1 117 ? -11.562 9.378   9.886   1.00 0.00 ? 117 GLY A H    5  
ATOM 10659 H HA2  . GLY A 1 117 ? -12.200 9.725   7.290   1.00 0.00 ? 117 GLY A HA2  5  
ATOM 10660 H HA3  . GLY A 1 117 ? -12.166 11.400  7.815   1.00 0.00 ? 117 GLY A HA3  5  
ATOM 10661 N N    . GLU A 1 118 ? -9.469  10.203  8.828   1.00 0.00 ? 118 GLU A N    5  
ATOM 10662 C CA   . GLU A 1 118 ? -7.984  10.215  8.660   1.00 0.00 ? 118 GLU A CA   5  
ATOM 10663 C C    . GLU A 1 118 ? -7.519  8.784   8.390   1.00 0.00 ? 118 GLU A C    5  
ATOM 10664 O O    . GLU A 1 118 ? -7.470  7.959   9.283   1.00 0.00 ? 118 GLU A O    5  
ATOM 10665 C CB   . GLU A 1 118 ? -7.322  10.746  9.934   1.00 0.00 ? 118 GLU A CB   5  
ATOM 10666 C CG   . GLU A 1 118 ? -6.987  12.229  9.759   1.00 0.00 ? 118 GLU A CG   5  
ATOM 10667 C CD   . GLU A 1 118 ? -5.735  12.568  10.570  1.00 0.00 ? 118 GLU A CD   5  
ATOM 10668 O OE1  . GLU A 1 118 ? -4.720  11.928  10.351  1.00 0.00 ? 118 GLU A OE1  5  
ATOM 10669 O OE2  . GLU A 1 118 ? -5.813  13.461  11.398  1.00 0.00 ? 118 GLU A OE2  5  
ATOM 10670 H H    . GLU A 1 118 ? -9.852  10.006  9.696   1.00 0.00 ? 118 GLU A H    5  
ATOM 10671 H HA   . GLU A 1 118 ? -7.722  10.843  7.819   1.00 0.00 ? 118 GLU A HA   5  
ATOM 10672 H HB2  . GLU A 1 118 ? -7.999  10.626  10.767  1.00 0.00 ? 118 GLU A HB2  5  
ATOM 10673 H HB3  . GLU A 1 118 ? -6.414  10.195  10.125  1.00 0.00 ? 118 GLU A HB3  5  
ATOM 10674 H HG2  . GLU A 1 118 ? -6.807  12.437  8.714   1.00 0.00 ? 118 GLU A HG2  5  
ATOM 10675 H HG3  . GLU A 1 118 ? -7.813  12.829  10.110  1.00 0.00 ? 118 GLU A HG3  5  
ATOM 10676 N N    . LEU A 1 119 ? -7.205  8.481   7.158   1.00 0.00 ? 119 LEU A N    5  
ATOM 10677 C CA   . LEU A 1 119 ? -6.774  7.099   6.805   1.00 0.00 ? 119 LEU A CA   5  
ATOM 10678 C C    . LEU A 1 119 ? -5.272  7.064   6.493   1.00 0.00 ? 119 LEU A C    5  
ATOM 10679 O O    . LEU A 1 119 ? -4.849  7.470   5.433   1.00 0.00 ? 119 LEU A O    5  
ATOM 10680 C CB   . LEU A 1 119 ? -7.558  6.651   5.567   1.00 0.00 ? 119 LEU A CB   5  
ATOM 10681 C CG   . LEU A 1 119 ? -7.475  5.129   5.411   1.00 0.00 ? 119 LEU A CG   5  
ATOM 10682 C CD1  . LEU A 1 119 ? -8.828  4.576   4.956   1.00 0.00 ? 119 LEU A CD1  5  
ATOM 10683 C CD2  . LEU A 1 119 ? -6.414  4.781   4.368   1.00 0.00 ? 119 LEU A CD2  5  
ATOM 10684 H H    . LEU A 1 119 ? -7.276  9.161   6.458   1.00 0.00 ? 119 LEU A H    5  
ATOM 10685 H HA   . LEU A 1 119 ? -6.991  6.436   7.625   1.00 0.00 ? 119 LEU A HA   5  
ATOM 10686 H HB2  . LEU A 1 119 ? -8.589  6.946   5.677   1.00 0.00 ? 119 LEU A HB2  5  
ATOM 10687 H HB3  . LEU A 1 119 ? -7.140  7.125   4.692   1.00 0.00 ? 119 LEU A HB3  5  
ATOM 10688 H HG   . LEU A 1 119 ? -7.210  4.687   6.352   1.00 0.00 ? 119 LEU A HG   5  
ATOM 10689 H HD11 . LEU A 1 119 ? -9.621  5.054   5.512   1.00 0.00 ? 119 LEU A HD11 5  
ATOM 10690 H HD12 . LEU A 1 119 ? -8.959  4.768   3.904   1.00 0.00 ? 119 LEU A HD12 5  
ATOM 10691 H HD13 . LEU A 1 119 ? -8.858  3.511   5.130   1.00 0.00 ? 119 LEU A HD13 5  
ATOM 10692 H HD21 . LEU A 1 119 ? -5.467  5.207   4.665   1.00 0.00 ? 119 LEU A HD21 5  
ATOM 10693 H HD22 . LEU A 1 119 ? -6.320  3.708   4.296   1.00 0.00 ? 119 LEU A HD22 5  
ATOM 10694 H HD23 . LEU A 1 119 ? -6.707  5.183   3.410   1.00 0.00 ? 119 LEU A HD23 5  
ATOM 10695 N N    . ILE A 1 120 ? -4.465  6.561   7.396   1.00 0.00 ? 120 ILE A N    5  
ATOM 10696 C CA   . ILE A 1 120 ? -2.996  6.486   7.119   1.00 0.00 ? 120 ILE A CA   5  
ATOM 10697 C C    . ILE A 1 120 ? -2.687  5.105   6.545   1.00 0.00 ? 120 ILE A C    5  
ATOM 10698 O O    . ILE A 1 120 ? -2.806  4.101   7.214   1.00 0.00 ? 120 ILE A O    5  
ATOM 10699 C CB   . ILE A 1 120 ? -2.205  6.750   8.404   1.00 0.00 ? 120 ILE A CB   5  
ATOM 10700 C CG1  . ILE A 1 120 ? -2.497  5.669   9.446   1.00 0.00 ? 120 ILE A CG1  5  
ATOM 10701 C CG2  . ILE A 1 120 ? -2.631  8.102   8.960   1.00 0.00 ? 120 ILE A CG2  5  
ATOM 10702 C CD1  . ILE A 1 120 ? -1.364  4.640   9.449   1.00 0.00 ? 120 ILE A CD1  5  
ATOM 10703 H H    . ILE A 1 120 ? -4.826  6.219   8.242   1.00 0.00 ? 120 ILE A H    5  
ATOM 10704 H HA   . ILE A 1 120 ? -2.741  7.231   6.381   1.00 0.00 ? 120 ILE A HA   5  
ATOM 10705 H HB   . ILE A 1 120 ? -1.148  6.769   8.180   1.00 0.00 ? 120 ILE A HB   5  
ATOM 10706 H HG12 . ILE A 1 120 ? -2.576  6.120   10.426  1.00 0.00 ? 120 ILE A HG12 5  
ATOM 10707 H HG13 . ILE A 1 120 ? -3.425  5.186   9.199   1.00 0.00 ? 120 ILE A HG13 5  
ATOM 10708 H HG21 . ILE A 1 120 ? -2.786  8.791   8.143   1.00 0.00 ? 120 ILE A HG21 5  
ATOM 10709 H HG22 . ILE A 1 120 ? -3.551  7.985   9.513   1.00 0.00 ? 120 ILE A HG22 5  
ATOM 10710 H HG23 . ILE A 1 120 ? -1.862  8.480   9.613   1.00 0.00 ? 120 ILE A HG23 5  
ATOM 10711 H HD11 . ILE A 1 120 ? -0.981  4.525   8.445   1.00 0.00 ? 120 ILE A HD11 5  
ATOM 10712 H HD12 . ILE A 1 120 ? -0.572  4.980   10.099  1.00 0.00 ? 120 ILE A HD12 5  
ATOM 10713 H HD13 . ILE A 1 120 ? -1.739  3.691   9.802   1.00 0.00 ? 120 ILE A HD13 5  
ATOM 10714 N N    . LEU A 1 121 ? -2.338  5.055   5.290   1.00 0.00 ? 121 LEU A N    5  
ATOM 10715 C CA   . LEU A 1 121 ? -2.075  3.752   4.628   1.00 0.00 ? 121 LEU A CA   5  
ATOM 10716 C C    . LEU A 1 121 ? -0.569  3.575   4.347   1.00 0.00 ? 121 LEU A C    5  
ATOM 10717 O O    . LEU A 1 121 ? 0.061   4.378   3.685   1.00 0.00 ? 121 LEU A O    5  
ATOM 10718 C CB   . LEU A 1 121 ? -2.927  3.725   3.335   1.00 0.00 ? 121 LEU A CB   5  
ATOM 10719 C CG   . LEU A 1 121 ? -2.543  2.590   2.367   1.00 0.00 ? 121 LEU A CG   5  
ATOM 10720 C CD1  . LEU A 1 121 ? -1.357  3.032   1.510   1.00 0.00 ? 121 LEU A CD1  5  
ATOM 10721 C CD2  . LEU A 1 121 ? -2.174  1.313   3.123   1.00 0.00 ? 121 LEU A CD2  5  
ATOM 10722 H H    . LEU A 1 121 ? -2.282  5.879   4.771   1.00 0.00 ? 121 LEU A H    5  
ATOM 10723 H HA   . LEU A 1 121 ? -2.406  2.955   5.277   1.00 0.00 ? 121 LEU A HA   5  
ATOM 10724 H HB2  . LEU A 1 121 ? -3.965  3.603   3.608   1.00 0.00 ? 121 LEU A HB2  5  
ATOM 10725 H HB3  . LEU A 1 121 ? -2.815  4.671   2.826   1.00 0.00 ? 121 LEU A HB3  5  
ATOM 10726 H HG   . LEU A 1 121 ? -3.389  2.386   1.725   1.00 0.00 ? 121 LEU A HG   5  
ATOM 10727 H HD11 . LEU A 1 121 ? -1.334  4.111   1.457   1.00 0.00 ? 121 LEU A HD11 5  
ATOM 10728 H HD12 . LEU A 1 121 ? -0.440  2.674   1.953   1.00 0.00 ? 121 LEU A HD12 5  
ATOM 10729 H HD13 . LEU A 1 121 ? -1.461  2.625   0.516   1.00 0.00 ? 121 LEU A HD13 5  
ATOM 10730 H HD21 . LEU A 1 121 ? -2.642  1.322   4.091   1.00 0.00 ? 121 LEU A HD21 5  
ATOM 10731 H HD22 . LEU A 1 121 ? -2.509  0.454   2.566   1.00 0.00 ? 121 LEU A HD22 5  
ATOM 10732 H HD23 . LEU A 1 121 ? -1.111  1.273   3.241   1.00 0.00 ? 121 LEU A HD23 5  
ATOM 10733 N N    . THR A 1 122 ? -0.008  2.508   4.866   1.00 0.00 ? 122 THR A N    5  
ATOM 10734 C CA   . THR A 1 122 ? 1.445   2.202   4.676   1.00 0.00 ? 122 THR A CA   5  
ATOM 10735 C C    . THR A 1 122 ? 1.586   1.038   3.698   1.00 0.00 ? 122 THR A C    5  
ATOM 10736 O O    . THR A 1 122 ? 0.690   0.245   3.543   1.00 0.00 ? 122 THR A O    5  
ATOM 10737 C CB   . THR A 1 122 ? 2.039   1.766   6.008   1.00 0.00 ? 122 THR A CB   5  
ATOM 10738 O OG1  . THR A 1 122 ? 1.758   2.740   7.003   1.00 0.00 ? 122 THR A OG1  5  
ATOM 10739 C CG2  . THR A 1 122 ? 3.548   1.586   5.868   1.00 0.00 ? 122 THR A CG2  5  
ATOM 10740 H H    . THR A 1 122 ? -0.555  1.894   5.391   1.00 0.00 ? 122 THR A H    5  
ATOM 10741 H HA   . THR A 1 122 ? 1.974   3.065   4.310   1.00 0.00 ? 122 THR A HA   5  
ATOM 10742 H HB   . THR A 1 122 ? 1.603   0.825   6.285   1.00 0.00 ? 122 THR A HB   5  
ATOM 10743 H HG1  . THR A 1 122 ? 1.593   2.280   7.830   1.00 0.00 ? 122 THR A HG1  5  
ATOM 10744 H HG21 . THR A 1 122 ? 3.937   2.330   5.190   1.00 0.00 ? 122 THR A HG21 5  
ATOM 10745 H HG22 . THR A 1 122 ? 4.014   1.696   6.835   1.00 0.00 ? 122 THR A HG22 5  
ATOM 10746 H HG23 . THR A 1 122 ? 3.755   0.600   5.478   1.00 0.00 ? 122 THR A HG23 5  
ATOM 10747 N N    . MET A 1 123 ? 2.716   0.907   3.070   1.00 0.00 ? 123 MET A N    5  
ATOM 10748 C CA   . MET A 1 123 ? 2.918   -0.233  2.125   1.00 0.00 ? 123 MET A CA   5  
ATOM 10749 C C    . MET A 1 123 ? 4.408   -0.505  1.975   1.00 0.00 ? 123 MET A C    5  
ATOM 10750 O O    . MET A 1 123 ? 5.091   0.121   1.187   1.00 0.00 ? 123 MET A O    5  
ATOM 10751 C CB   . MET A 1 123 ? 2.308   0.095   0.771   1.00 0.00 ? 123 MET A CB   5  
ATOM 10752 C CG   . MET A 1 123 ? 2.373   -1.149  -0.127  1.00 0.00 ? 123 MET A CG   5  
ATOM 10753 S SD   . MET A 1 123 ? 3.733   -0.993  -1.311  1.00 0.00 ? 123 MET A SD   5  
ATOM 10754 C CE   . MET A 1 123 ? 3.167   0.541   -2.077  1.00 0.00 ? 123 MET A CE   5  
ATOM 10755 H H    . MET A 1 123 ? 3.441   1.543   3.238   1.00 0.00 ? 123 MET A H    5  
ATOM 10756 H HA   . MET A 1 123 ? 2.438   -1.110  2.518   1.00 0.00 ? 123 MET A HA   5  
ATOM 10757 H HB2  . MET A 1 123 ? 1.275   0.383   0.911   1.00 0.00 ? 123 MET A HB2  5  
ATOM 10758 H HB3  . MET A 1 123 ? 2.853   0.907   0.320   1.00 0.00 ? 123 MET A HB3  5  
ATOM 10759 H HG2  . MET A 1 123 ? 2.530   -2.029  0.482   1.00 0.00 ? 123 MET A HG2  5  
ATOM 10760 H HG3  . MET A 1 123 ? 1.441   -1.250  -0.658  1.00 0.00 ? 123 MET A HG3  5  
ATOM 10761 H HE1  . MET A 1 123 ? 2.119   0.686   -1.849  1.00 0.00 ? 123 MET A HE1  5  
ATOM 10762 H HE2  . MET A 1 123 ? 3.735   1.368   -1.683  1.00 0.00 ? 123 MET A HE2  5  
ATOM 10763 H HE3  . MET A 1 123 ? 3.306   0.482   -3.145  1.00 0.00 ? 123 MET A HE3  5  
ATOM 10764 N N    . THR A 1 124 ? 4.912   -1.428  2.743   1.00 0.00 ? 124 THR A N    5  
ATOM 10765 C CA   . THR A 1 124 ? 6.370   -1.744  2.683   1.00 0.00 ? 124 THR A CA   5  
ATOM 10766 C C    . THR A 1 124 ? 6.696   -2.483  1.399   1.00 0.00 ? 124 THR A C    5  
ATOM 10767 O O    . THR A 1 124 ? 5.822   -2.917  0.672   1.00 0.00 ? 124 THR A O    5  
ATOM 10768 C CB   . THR A 1 124 ? 6.832   -2.591  3.899   1.00 0.00 ? 124 THR A CB   5  
ATOM 10769 O OG1  . THR A 1 124 ? 6.822   -3.977  3.575   1.00 0.00 ? 124 THR A OG1  5  
ATOM 10770 C CG2  . THR A 1 124 ? 5.936   -2.371  5.124   1.00 0.00 ? 124 THR A CG2  5  
ATOM 10771 H H    . THR A 1 124 ? 4.333   -1.902  3.372   1.00 0.00 ? 124 THR A H    5  
ATOM 10772 H HA   . THR A 1 124 ? 6.919   -0.822  2.670   1.00 0.00 ? 124 THR A HA   5  
ATOM 10773 H HB   . THR A 1 124 ? 7.835   -2.295  4.150   1.00 0.00 ? 124 THR A HB   5  
ATOM 10774 H HG1  . THR A 1 124 ? 7.560   -4.393  4.025   1.00 0.00 ? 124 THR A HG1  5  
ATOM 10775 H HG21 . THR A 1 124 ? 5.389   -1.448  5.011   1.00 0.00 ? 124 THR A HG21 5  
ATOM 10776 H HG22 . THR A 1 124 ? 5.242   -3.193  5.211   1.00 0.00 ? 124 THR A HG22 5  
ATOM 10777 H HG23 . THR A 1 124 ? 6.549   -2.320  6.011   1.00 0.00 ? 124 THR A HG23 5  
ATOM 10778 N N    . ALA A 1 125 ? 7.965   -2.624  1.126   1.00 0.00 ? 125 ALA A N    5  
ATOM 10779 C CA   . ALA A 1 125 ? 8.377   -3.338  -0.115  1.00 0.00 ? 125 ALA A CA   5  
ATOM 10780 C C    . ALA A 1 125 ? 9.894   -3.499  -0.201  1.00 0.00 ? 125 ALA A C    5  
ATOM 10781 O O    . ALA A 1 125 ? 10.610  -2.580  -0.540  1.00 0.00 ? 125 ALA A O    5  
ATOM 10782 C CB   . ALA A 1 125 ? 7.894   -2.558  -1.333  1.00 0.00 ? 125 ALA A CB   5  
ATOM 10783 H H    . ALA A 1 125 ? 8.639   -2.256  1.745   1.00 0.00 ? 125 ALA A H    5  
ATOM 10784 H HA   . ALA A 1 125 ? 7.927   -4.302  -0.110  1.00 0.00 ? 125 ALA A HA   5  
ATOM 10785 H HB1  . ALA A 1 125 ? 7.936   -1.502  -1.122  1.00 0.00 ? 125 ALA A HB1  5  
ATOM 10786 H HB2  . ALA A 1 125 ? 8.529   -2.783  -2.176  1.00 0.00 ? 125 ALA A HB2  5  
ATOM 10787 H HB3  . ALA A 1 125 ? 6.878   -2.838  -1.558  1.00 0.00 ? 125 ALA A HB3  5  
ATOM 10788 N N    . ASP A 1 126 ? 10.394  -4.677  0.065   1.00 0.00 ? 126 ASP A N    5  
ATOM 10789 C CA   . ASP A 1 126 ? 11.871  -4.902  -0.025  1.00 0.00 ? 126 ASP A CA   5  
ATOM 10790 C C    . ASP A 1 126 ? 12.575  -4.076  1.054   1.00 0.00 ? 126 ASP A C    5  
ATOM 10791 O O    . ASP A 1 126 ? 13.680  -3.609  0.864   1.00 0.00 ? 126 ASP A O    5  
ATOM 10792 C CB   . ASP A 1 126 ? 12.382  -4.483  -1.408  1.00 0.00 ? 126 ASP A CB   5  
ATOM 10793 C CG   . ASP A 1 126 ? 13.318  -5.558  -1.968  1.00 0.00 ? 126 ASP A CG   5  
ATOM 10794 O OD1  . ASP A 1 126 ? 12.816  -6.513  -2.538  1.00 0.00 ? 126 ASP A OD1  5  
ATOM 10795 O OD2  . ASP A 1 126 ? 14.519  -5.407  -1.818  1.00 0.00 ? 126 ASP A OD2  5  
ATOM 10796 H H    . ASP A 1 126 ? 9.798   -5.421  0.309   1.00 0.00 ? 126 ASP A H    5  
ATOM 10797 H HA   . ASP A 1 126 ? 12.075  -5.949  0.136   1.00 0.00 ? 126 ASP A HA   5  
ATOM 10798 H HB2  . ASP A 1 126 ? 11.540  -4.356  -2.071  1.00 0.00 ? 126 ASP A HB2  5  
ATOM 10799 H HB3  . ASP A 1 126 ? 12.918  -3.548  -1.325  1.00 0.00 ? 126 ASP A HB3  5  
ATOM 10800 N N    . ASP A 1 127 ? 11.916  -3.909  2.179   1.00 0.00 ? 127 ASP A N    5  
ATOM 10801 C CA   . ASP A 1 127 ? 12.461  -3.134  3.353   1.00 0.00 ? 127 ASP A CA   5  
ATOM 10802 C C    . ASP A 1 127 ? 12.057  -1.662  3.263   1.00 0.00 ? 127 ASP A C    5  
ATOM 10803 O O    . ASP A 1 127 ? 12.310  -0.900  4.179   1.00 0.00 ? 127 ASP A O    5  
ATOM 10804 C CB   . ASP A 1 127 ? 13.991  -3.240  3.457   1.00 0.00 ? 127 ASP A CB   5  
ATOM 10805 C CG   . ASP A 1 127 ? 14.411  -3.185  4.927   1.00 0.00 ? 127 ASP A CG   5  
ATOM 10806 O OD1  . ASP A 1 127 ? 13.725  -3.780  5.741   1.00 0.00 ? 127 ASP A OD1  5  
ATOM 10807 O OD2  . ASP A 1 127 ? 15.411  -2.548  5.213   1.00 0.00 ? 127 ASP A OD2  5  
ATOM 10808 H H    . ASP A 1 127 ? 11.030  -4.303  2.254   1.00 0.00 ? 127 ASP A H    5  
ATOM 10809 H HA   . ASP A 1 127 ? 12.028  -3.545  4.255   1.00 0.00 ? 127 ASP A HA   5  
ATOM 10810 H HB2  . ASP A 1 127 ? 14.315  -4.175  3.023   1.00 0.00 ? 127 ASP A HB2  5  
ATOM 10811 H HB3  . ASP A 1 127 ? 14.443  -2.419  2.923   1.00 0.00 ? 127 ASP A HB3  5  
ATOM 10812 N N    . VAL A 1 128 ? 11.418  -1.249  2.193   1.00 0.00 ? 128 VAL A N    5  
ATOM 10813 C CA   . VAL A 1 128 ? 10.995  0.165   2.092   1.00 0.00 ? 128 VAL A CA   5  
ATOM 10814 C C    . VAL A 1 128 ? 9.643   0.309   2.786   1.00 0.00 ? 128 VAL A C    5  
ATOM 10815 O O    . VAL A 1 128 ? 9.060   -0.663  3.225   1.00 0.00 ? 128 VAL A O    5  
ATOM 10816 C CB   . VAL A 1 128 ? 10.880  0.565   0.607   1.00 0.00 ? 128 VAL A CB   5  
ATOM 10817 C CG1  . VAL A 1 128 ? 12.156  0.171   -0.139  1.00 0.00 ? 128 VAL A CG1  5  
ATOM 10818 C CG2  . VAL A 1 128 ? 9.688   -0.130  -0.050  1.00 0.00 ? 128 VAL A CG2  5  
ATOM 10819 H H    . VAL A 1 128 ? 11.203  -1.866  1.466   1.00 0.00 ? 128 VAL A H    5  
ATOM 10820 H HA   . VAL A 1 128 ? 11.719  0.798   2.583   1.00 0.00 ? 128 VAL A HA   5  
ATOM 10821 H HB   . VAL A 1 128 ? 10.745  1.622   0.544   1.00 0.00 ? 128 VAL A HB   5  
ATOM 10822 H HG11 . VAL A 1 128 ? 12.333  -0.887  -0.016  1.00 0.00 ? 128 VAL A HG11 5  
ATOM 10823 H HG12 . VAL A 1 128 ? 12.043  0.397   -1.189  1.00 0.00 ? 128 VAL A HG12 5  
ATOM 10824 H HG13 . VAL A 1 128 ? 12.988  0.722   0.258   1.00 0.00 ? 128 VAL A HG13 5  
ATOM 10825 H HG21 . VAL A 1 128 ? 9.455   -1.018  0.505   1.00 0.00 ? 128 VAL A HG21 5  
ATOM 10826 H HG22 . VAL A 1 128 ? 8.836   0.530   -0.044  1.00 0.00 ? 128 VAL A HG22 5  
ATOM 10827 H HG23 . VAL A 1 128 ? 9.934   -0.397  -1.067  1.00 0.00 ? 128 VAL A HG23 5  
ATOM 10828 N N    . VAL A 1 129 ? 9.139   1.501   2.867   1.00 0.00 ? 129 VAL A N    5  
ATOM 10829 C CA   . VAL A 1 129 ? 7.815   1.706   3.501   1.00 0.00 ? 129 VAL A CA   5  
ATOM 10830 C C    . VAL A 1 129 ? 7.204   3.006   2.986   1.00 0.00 ? 129 VAL A C    5  
ATOM 10831 O O    . VAL A 1 129 ? 7.726   4.083   3.188   1.00 0.00 ? 129 VAL A O    5  
ATOM 10832 C CB   . VAL A 1 129 ? 7.974   1.667   5.037   1.00 0.00 ? 129 VAL A CB   5  
ATOM 10833 C CG1  . VAL A 1 129 ? 7.043   2.671   5.752   1.00 0.00 ? 129 VAL A CG1  5  
ATOM 10834 C CG2  . VAL A 1 129 ? 7.629   0.255   5.504   1.00 0.00 ? 129 VAL A CG2  5  
ATOM 10835 H H    . VAL A 1 129 ? 9.629   2.257   2.501   1.00 0.00 ? 129 VAL A H    5  
ATOM 10836 H HA   . VAL A 1 129 ? 7.172   0.902   3.198   1.00 0.00 ? 129 VAL A HA   5  
ATOM 10837 H HB   . VAL A 1 129 ? 8.999   1.876   5.286   1.00 0.00 ? 129 VAL A HB   5  
ATOM 10838 H HG11 . VAL A 1 129 ? 6.074   2.667   5.272   1.00 0.00 ? 129 VAL A HG11 5  
ATOM 10839 H HG12 . VAL A 1 129 ? 6.934   2.390   6.788   1.00 0.00 ? 129 VAL A HG12 5  
ATOM 10840 H HG13 . VAL A 1 129 ? 7.467   3.663   5.690   1.00 0.00 ? 129 VAL A HG13 5  
ATOM 10841 H HG21 . VAL A 1 129 ? 6.851   -0.139  4.870   1.00 0.00 ? 129 VAL A HG21 5  
ATOM 10842 H HG22 . VAL A 1 129 ? 8.503   -0.375  5.430   1.00 0.00 ? 129 VAL A HG22 5  
ATOM 10843 H HG23 . VAL A 1 129 ? 7.283   0.281   6.524   1.00 0.00 ? 129 VAL A HG23 5  
ATOM 10844 N N    . CYS A 1 130 ? 6.088   2.884   2.329   1.00 0.00 ? 130 CYS A N    5  
ATOM 10845 C CA   . CYS A 1 130 ? 5.391   4.083   1.783   1.00 0.00 ? 130 CYS A CA   5  
ATOM 10846 C C    . CYS A 1 130 ? 4.272   4.483   2.742   1.00 0.00 ? 130 CYS A C    5  
ATOM 10847 O O    . CYS A 1 130 ? 3.166   3.984   2.659   1.00 0.00 ? 130 CYS A O    5  
ATOM 10848 C CB   . CYS A 1 130 ? 4.797   3.751   0.412   1.00 0.00 ? 130 CYS A CB   5  
ATOM 10849 S SG   . CYS A 1 130 ? 4.691   5.260   -0.582  1.00 0.00 ? 130 CYS A SG   5  
ATOM 10850 H H    . CYS A 1 130 ? 5.701   1.988   2.203   1.00 0.00 ? 130 CYS A H    5  
ATOM 10851 H HA   . CYS A 1 130 ? 6.094   4.898   1.685   1.00 0.00 ? 130 CYS A HA   5  
ATOM 10852 H HB2  . CYS A 1 130 ? 5.430   3.033   -0.089  1.00 0.00 ? 130 CYS A HB2  5  
ATOM 10853 H HB3  . CYS A 1 130 ? 3.810   3.333   0.539   1.00 0.00 ? 130 CYS A HB3  5  
ATOM 10854 H HG   . CYS A 1 130 ? 4.555   5.999   0.015   1.00 0.00 ? 130 CYS A HG   5  
ATOM 10855 N N    . THR A 1 131 ? 4.559   5.369   3.659   1.00 0.00 ? 131 THR A N    5  
ATOM 10856 C CA   . THR A 1 131 ? 3.523   5.799   4.641   1.00 0.00 ? 131 THR A CA   5  
ATOM 10857 C C    . THR A 1 131 ? 3.036   7.205   4.305   1.00 0.00 ? 131 THR A C    5  
ATOM 10858 O O    . THR A 1 131 ? 3.818   8.127   4.171   1.00 0.00 ? 131 THR A O    5  
ATOM 10859 C CB   . THR A 1 131 ? 4.131   5.816   6.044   1.00 0.00 ? 131 THR A CB   5  
ATOM 10860 O OG1  . THR A 1 131 ? 5.156   4.836   6.127   1.00 0.00 ? 131 THR A OG1  5  
ATOM 10861 C CG2  . THR A 1 131 ? 3.045   5.514   7.079   1.00 0.00 ? 131 THR A CG2  5  
ATOM 10862 H H    . THR A 1 131 ? 5.462   5.746   3.707   1.00 0.00 ? 131 THR A H    5  
ATOM 10863 H HA   . THR A 1 131 ? 2.690   5.110   4.616   1.00 0.00 ? 131 THR A HA   5  
ATOM 10864 H HB   . THR A 1 131 ? 4.547   6.795   6.239   1.00 0.00 ? 131 THR A HB   5  
ATOM 10865 H HG1  . THR A 1 131 ? 4.743   3.970   6.088   1.00 0.00 ? 131 THR A HG1  5  
ATOM 10866 H HG21 . THR A 1 131 ? 2.251   4.950   6.615   1.00 0.00 ? 131 THR A HG21 5  
ATOM 10867 H HG22 . THR A 1 131 ? 3.470   4.939   7.889   1.00 0.00 ? 131 THR A HG22 5  
ATOM 10868 H HG23 . THR A 1 131 ? 2.649   6.442   7.466   1.00 0.00 ? 131 THR A HG23 5  
ATOM 10869 N N    . ARG A 1 132 ? 1.747   7.375   4.187   1.00 0.00 ? 132 ARG A N    5  
ATOM 10870 C CA   . ARG A 1 132 ? 1.193   8.729   3.882   1.00 0.00 ? 132 ARG A CA   5  
ATOM 10871 C C    . ARG A 1 132 ? -0.231  8.813   4.418   1.00 0.00 ? 132 ARG A C    5  
ATOM 10872 O O    . ARG A 1 132 ? -1.044  7.938   4.186   1.00 0.00 ? 132 ARG A O    5  
ATOM 10873 C CB   . ARG A 1 132 ? 1.203   9.008   2.366   1.00 0.00 ? 132 ARG A CB   5  
ATOM 10874 C CG   . ARG A 1 132 ? 0.992   7.722   1.562   1.00 0.00 ? 132 ARG A CG   5  
ATOM 10875 C CD   . ARG A 1 132 ? 0.707   8.081   0.104   1.00 0.00 ? 132 ARG A CD   5  
ATOM 10876 N NE   . ARG A 1 132 ? 0.811   6.858   -0.741  1.00 0.00 ? 132 ARG A NE   5  
ATOM 10877 C CZ   . ARG A 1 132 ? 0.436   6.895   -1.990  1.00 0.00 ? 132 ARG A CZ   5  
ATOM 10878 N NH1  . ARG A 1 132 ? 0.849   7.859   -2.767  1.00 0.00 ? 132 ARG A NH1  5  
ATOM 10879 N NH2  . ARG A 1 132 ? -0.353  5.969   -2.463  1.00 0.00 ? 132 ARG A NH2  5  
ATOM 10880 H H    . ARG A 1 132 ? 1.138   6.612   4.314   1.00 0.00 ? 132 ARG A H    5  
ATOM 10881 H HA   . ARG A 1 132 ? 1.796   9.474   4.382   1.00 0.00 ? 132 ARG A HA   5  
ATOM 10882 H HB2  . ARG A 1 132 ? 0.414   9.706   2.129   1.00 0.00 ? 132 ARG A HB2  5  
ATOM 10883 H HB3  . ARG A 1 132 ? 2.151   9.442   2.095   1.00 0.00 ? 132 ARG A HB3  5  
ATOM 10884 H HG2  . ARG A 1 132 ? 1.882   7.114   1.617   1.00 0.00 ? 132 ARG A HG2  5  
ATOM 10885 H HG3  . ARG A 1 132 ? 0.158   7.176   1.967   1.00 0.00 ? 132 ARG A HG3  5  
ATOM 10886 H HD2  . ARG A 1 132 ? -0.287  8.493   0.025   1.00 0.00 ? 132 ARG A HD2  5  
ATOM 10887 H HD3  . ARG A 1 132 ? 1.426   8.814   -0.231  1.00 0.00 ? 132 ARG A HD3  5  
ATOM 10888 H HE   . ARG A 1 132 ? 1.161   6.027   -0.358  1.00 0.00 ? 132 ARG A HE   5  
ATOM 10889 H HH11 . ARG A 1 132 ? 1.453   8.569   -2.405  1.00 0.00 ? 132 ARG A HH11 5  
ATOM 10890 H HH12 . ARG A 1 132 ? 0.562   7.887   -3.725  1.00 0.00 ? 132 ARG A HH12 5  
ATOM 10891 H HH21 . ARG A 1 132 ? -0.670  5.231   -1.868  1.00 0.00 ? 132 ARG A HH21 5  
ATOM 10892 H HH22 . ARG A 1 132 ? -0.640  5.998   -3.421  1.00 0.00 ? 132 ARG A HH22 5  
ATOM 10893 N N    . VAL A 1 133 ? -0.535  9.859   5.142   1.00 0.00 ? 133 VAL A N    5  
ATOM 10894 C CA   . VAL A 1 133 ? -1.904  10.006  5.706   1.00 0.00 ? 133 VAL A CA   5  
ATOM 10895 C C    . VAL A 1 133 ? -2.868  10.353  4.579   1.00 0.00 ? 133 VAL A C    5  
ATOM 10896 O O    . VAL A 1 133 ? -2.482  10.878  3.560   1.00 0.00 ? 133 VAL A O    5  
ATOM 10897 C CB   . VAL A 1 133 ? -1.903  11.122  6.768   1.00 0.00 ? 133 VAL A CB   5  
ATOM 10898 C CG1  . VAL A 1 133 ? -3.336  11.419  7.228   1.00 0.00 ? 133 VAL A CG1  5  
ATOM 10899 C CG2  . VAL A 1 133 ? -1.061  10.680  7.972   1.00 0.00 ? 133 VAL A CG2  5  
ATOM 10900 H H    . VAL A 1 133 ? 0.142   10.551  5.314   1.00 0.00 ? 133 VAL A H    5  
ATOM 10901 H HA   . VAL A 1 133 ? -2.211  9.078   6.161   1.00 0.00 ? 133 VAL A HA   5  
ATOM 10902 H HB   . VAL A 1 133 ? -1.477  12.018  6.346   1.00 0.00 ? 133 VAL A HB   5  
ATOM 10903 H HG11 . VAL A 1 133 ? -3.805  10.504  7.555   1.00 0.00 ? 133 VAL A HG11 5  
ATOM 10904 H HG12 . VAL A 1 133 ? -3.314  12.127  8.040   1.00 0.00 ? 133 VAL A HG12 5  
ATOM 10905 H HG13 . VAL A 1 133 ? -3.896  11.834  6.401   1.00 0.00 ? 133 VAL A HG13 5  
ATOM 10906 H HG21 . VAL A 1 133 ? -0.453  9.830   7.697   1.00 0.00 ? 133 VAL A HG21 5  
ATOM 10907 H HG22 . VAL A 1 133 ? -0.421  11.494  8.278   1.00 0.00 ? 133 VAL A HG22 5  
ATOM 10908 H HG23 . VAL A 1 133 ? -1.711  10.408  8.790   1.00 0.00 ? 133 VAL A HG23 5  
ATOM 10909 N N    . TYR A 1 134 ? -4.122  10.072  4.775   1.00 0.00 ? 134 TYR A N    5  
ATOM 10910 C CA   . TYR A 1 134 ? -5.136  10.396  3.742   1.00 0.00 ? 134 TYR A CA   5  
ATOM 10911 C C    . TYR A 1 134 ? -6.340  11.031  4.413   1.00 0.00 ? 134 TYR A C    5  
ATOM 10912 O O    . TYR A 1 134 ? -6.451  11.056  5.624   1.00 0.00 ? 134 TYR A O    5  
ATOM 10913 C CB   . TYR A 1 134 ? -5.650  9.134   3.069   1.00 0.00 ? 134 TYR A CB   5  
ATOM 10914 C CG   . TYR A 1 134 ? -4.604  8.530   2.181   1.00 0.00 ? 134 TYR A CG   5  
ATOM 10915 C CD1  . TYR A 1 134 ? -3.498  7.894   2.742   1.00 0.00 ? 134 TYR A CD1  5  
ATOM 10916 C CD2  . TYR A 1 134 ? -4.757  8.584   0.794   1.00 0.00 ? 134 TYR A CD2  5  
ATOM 10917 C CE1  . TYR A 1 134 ? -2.540  7.310   1.918   1.00 0.00 ? 134 TYR A CE1  5  
ATOM 10918 C CE2  . TYR A 1 134 ? -3.799  8.005   -0.035  1.00 0.00 ? 134 TYR A CE2  5  
ATOM 10919 C CZ   . TYR A 1 134 ? -2.686  7.364   0.525   1.00 0.00 ? 134 TYR A CZ   5  
ATOM 10920 O OH   . TYR A 1 134 ? -1.739  6.784   -0.294  1.00 0.00 ? 134 TYR A OH   5  
ATOM 10921 H H    . TYR A 1 134 ? -4.400  9.656   5.614   1.00 0.00 ? 134 TYR A H    5  
ATOM 10922 H HA   . TYR A 1 134 ? -4.713  11.057  3.003   1.00 0.00 ? 134 TYR A HA   5  
ATOM 10923 H HB2  . TYR A 1 134 ? -5.938  8.421   3.818   1.00 0.00 ? 134 TYR A HB2  5  
ATOM 10924 H HB3  . TYR A 1 134 ? -6.510  9.391   2.481   1.00 0.00 ? 134 TYR A HB3  5  
ATOM 10925 H HD1  . TYR A 1 134 ? -3.382  7.855   3.814   1.00 0.00 ? 134 TYR A HD1  5  
ATOM 10926 H HD2  . TYR A 1 134 ? -5.615  9.078   0.363   1.00 0.00 ? 134 TYR A HD2  5  
ATOM 10927 H HE1  . TYR A 1 134 ? -1.691  6.817   2.356   1.00 0.00 ? 134 TYR A HE1  5  
ATOM 10928 H HE2  . TYR A 1 134 ? -3.921  8.051   -1.105  1.00 0.00 ? 134 TYR A HE2  5  
ATOM 10929 H HH   . TYR A 1 134 ? -2.044  5.902   -0.521  1.00 0.00 ? 134 TYR A HH   5  
ATOM 10930 N N    . VAL A 1 135 ? -7.270  11.482  3.627   1.00 0.00 ? 135 VAL A N    5  
ATOM 10931 C CA   . VAL A 1 135 ? -8.515  12.044  4.182   1.00 0.00 ? 135 VAL A CA   5  
ATOM 10932 C C    . VAL A 1 135 ? -9.641  11.645  3.245   1.00 0.00 ? 135 VAL A C    5  
ATOM 10933 O O    . VAL A 1 135 ? -9.391  11.267  2.126   1.00 0.00 ? 135 VAL A O    5  
ATOM 10934 C CB   . VAL A 1 135 ? -8.437  13.547  4.298   1.00 0.00 ? 135 VAL A CB   5  
ATOM 10935 C CG1  . VAL A 1 135 ? -9.701  14.028  4.990   1.00 0.00 ? 135 VAL A CG1  5  
ATOM 10936 C CG2  . VAL A 1 135 ? -7.227  13.918  5.144   1.00 0.00 ? 135 VAL A CG2  5  
ATOM 10937 H H    . VAL A 1 135 ? -7.168  11.405  2.658   1.00 0.00 ? 135 VAL A H    5  
ATOM 10938 H HA   . VAL A 1 135 ? -8.682  11.623  5.150   1.00 0.00 ? 135 VAL A HA   5  
ATOM 10939 H HB   . VAL A 1 135 ? -8.361  13.985  3.321   1.00 0.00 ? 135 VAL A HB   5  
ATOM 10940 H HG11 . VAL A 1 135 ? -9.943  13.344  5.793   1.00 0.00 ? 135 VAL A HG11 5  
ATOM 10941 H HG12 . VAL A 1 135 ? -9.541  15.013  5.387   1.00 0.00 ? 135 VAL A HG12 5  
ATOM 10942 H HG13 . VAL A 1 135 ? -10.511 14.043  4.277   1.00 0.00 ? 135 VAL A HG13 5  
ATOM 10943 H HG21 . VAL A 1 135 ? -6.339  13.492  4.705   1.00 0.00 ? 135 VAL A HG21 5  
ATOM 10944 H HG22 . VAL A 1 135 ? -7.134  14.991  5.184   1.00 0.00 ? 135 VAL A HG22 5  
ATOM 10945 H HG23 . VAL A 1 135 ? -7.359  13.528  6.142   1.00 0.00 ? 135 VAL A HG23 5  
ATOM 10946 N N    . ARG A 1 136 ? -10.868 11.699  3.674   1.00 0.00 ? 136 ARG A N    5  
ATOM 10947 C CA   . ARG A 1 136 ? -11.958 11.282  2.744   1.00 0.00 ? 136 ARG A CA   5  
ATOM 10948 C C    . ARG A 1 136 ? -12.340 12.452  1.847   1.00 0.00 ? 136 ARG A C    5  
ATOM 10949 O O    . ARG A 1 136 ? -12.797 13.484  2.298   1.00 0.00 ? 136 ARG A O    5  
ATOM 10950 C CB   . ARG A 1 136 ? -13.188 10.778  3.501   1.00 0.00 ? 136 ARG A CB   5  
ATOM 10951 C CG   . ARG A 1 136 ? -13.240 9.247   3.432   1.00 0.00 ? 136 ARG A CG   5  
ATOM 10952 C CD   . ARG A 1 136 ? -13.685 8.683   4.783   1.00 0.00 ? 136 ARG A CD   5  
ATOM 10953 N NE   . ARG A 1 136 ? -14.972 9.317   5.187   1.00 0.00 ? 136 ARG A NE   5  
ATOM 10954 C CZ   . ARG A 1 136 ? -15.922 8.589   5.706   1.00 0.00 ? 136 ARG A CZ   5  
ATOM 10955 N NH1  . ARG A 1 136 ? -16.737 7.929   4.930   1.00 0.00 ? 136 ARG A NH1  5  
ATOM 10956 N NH2  . ARG A 1 136 ? -16.058 8.522   7.003   1.00 0.00 ? 136 ARG A NH2  5  
ATOM 10957 H H    . ARG A 1 136 ? -11.062 11.996  4.586   1.00 0.00 ? 136 ARG A H    5  
ATOM 10958 H HA   . ARG A 1 136 ? -11.575 10.485  2.122   1.00 0.00 ? 136 ARG A HA   5  
ATOM 10959 H HB2  . ARG A 1 136 ? -13.141 11.096  4.530   1.00 0.00 ? 136 ARG A HB2  5  
ATOM 10960 H HB3  . ARG A 1 136 ? -14.075 11.178  3.035   1.00 0.00 ? 136 ARG A HB3  5  
ATOM 10961 H HG2  . ARG A 1 136 ? -13.941 8.949   2.666   1.00 0.00 ? 136 ARG A HG2  5  
ATOM 10962 H HG3  . ARG A 1 136 ? -12.261 8.864   3.187   1.00 0.00 ? 136 ARG A HG3  5  
ATOM 10963 H HD2  . ARG A 1 136 ? -13.821 7.614   4.700   1.00 0.00 ? 136 ARG A HD2  5  
ATOM 10964 H HD3  . ARG A 1 136 ? -12.931 8.893   5.527   1.00 0.00 ? 136 ARG A HD3  5  
ATOM 10965 H HE   . ARG A 1 136 ? -15.104 10.280  5.063   1.00 0.00 ? 136 ARG A HE   5  
ATOM 10966 H HH11 . ARG A 1 136 ? -16.633 7.980   3.937   1.00 0.00 ? 136 ARG A HH11 5  
ATOM 10967 H HH12 . ARG A 1 136 ? -17.466 7.372   5.328   1.00 0.00 ? 136 ARG A HH12 5  
ATOM 10968 H HH21 . ARG A 1 136 ? -15.433 9.027   7.597   1.00 0.00 ? 136 ARG A HH21 5  
ATOM 10969 H HH22 . ARG A 1 136 ? -16.786 7.965   7.401   1.00 0.00 ? 136 ARG A HH22 5  
ATOM 10970 N N    . GLU A 1 137 ? -12.139 12.284  0.571   1.00 0.00 ? 137 GLU A N    5  
ATOM 10971 C CA   . GLU A 1 137 ? -12.464 13.362  -0.410  1.00 0.00 ? 137 GLU A CA   5  
ATOM 10972 C C    . GLU A 1 137 ? -13.924 13.803  -0.251  1.00 0.00 ? 137 GLU A C    5  
ATOM 10973 O O    . GLU A 1 137 ? -14.792 13.087  -0.723  1.00 0.00 ? 137 GLU A O    5  
ATOM 10974 C CB   . GLU A 1 137 ? -12.247 12.837  -1.831  1.00 0.00 ? 137 GLU A CB   5  
ATOM 10975 C CG   . GLU A 1 137 ? -12.150 14.016  -2.801  1.00 0.00 ? 137 GLU A CG   5  
ATOM 10976 C CD   . GLU A 1 137 ? -12.463 13.538  -4.220  1.00 0.00 ? 137 GLU A CD   5  
ATOM 10977 O OE1  . GLU A 1 137 ? -11.537 13.135  -4.906  1.00 0.00 ? 137 GLU A OE1  5  
ATOM 10978 O OE2  . GLU A 1 137 ? -13.622 13.584  -4.598  1.00 0.00 ? 137 GLU A OE2  5  
ATOM 10979 O OXT  . GLU A 1 137 ? -14.146 14.847  0.338   1.00 0.00 ? 137 GLU A OXT  5  
ATOM 10980 H H    . GLU A 1 137 ? -11.759 11.441  0.258   1.00 0.00 ? 137 GLU A H    5  
ATOM 10981 H HA   . GLU A 1 137 ? -11.811 14.202  -0.238  1.00 0.00 ? 137 GLU A HA   5  
ATOM 10982 H HB2  . GLU A 1 137 ? -11.331 12.264  -1.867  1.00 0.00 ? 137 GLU A HB2  5  
ATOM 10983 H HB3  . GLU A 1 137 ? -13.077 12.208  -2.113  1.00 0.00 ? 137 GLU A HB3  5  
ATOM 10984 H HG2  . GLU A 1 137 ? -12.860 14.778  -2.512  1.00 0.00 ? 137 GLU A HG2  5  
ATOM 10985 H HG3  . GLU A 1 137 ? -11.152 14.425  -2.773  1.00 0.00 ? 137 GLU A HG3  5  
ATOM 10986 N N    . PRO A 1 1   ? -15.911 0.256   10.351  1.00 0.00 ? 1   PRO A N    6  
ATOM 10987 C CA   . PRO A 1 1   ? -14.489 0.157   9.879   1.00 0.00 ? 1   PRO A CA   6  
ATOM 10988 C C    . PRO A 1 1   ? -14.057 1.434   9.139   1.00 0.00 ? 1   PRO A C    6  
ATOM 10989 O O    . PRO A 1 1   ? -12.889 1.755   9.121   1.00 0.00 ? 1   PRO A O    6  
ATOM 10990 C CB   . PRO A 1 1   ? -14.385 -1.034  8.921   1.00 0.00 ? 1   PRO A CB   6  
ATOM 10991 C CG   . PRO A 1 1   ? -15.781 -1.635  8.803   1.00 0.00 ? 1   PRO A CG   6  
ATOM 10992 C CD   . PRO A 1 1   ? -16.734 -0.722  9.577   1.00 0.00 ? 1   PRO A CD   6  
ATOM 10993 H H2   . PRO A 1 1   ? -16.278 1.215   10.209  1.00 0.00 ? 1   PRO A H2   6  
ATOM 10994 H H3   . PRO A 1 1   ? -15.953 0.018   11.364  1.00 0.00 ? 1   PRO A H3   6  
ATOM 10995 H HA   . PRO A 1 1   ? -13.838 -0.008  10.725  1.00 0.00 ? 1   PRO A HA   6  
ATOM 10996 H HB2  . PRO A 1 1   ? -14.030 -0.707  7.951   1.00 0.00 ? 1   PRO A HB2  6  
ATOM 10997 H HB3  . PRO A 1 1   ? -13.709 -1.770  9.324   1.00 0.00 ? 1   PRO A HB3  6  
ATOM 10998 H HG2  . PRO A 1 1   ? -16.074 -1.680  7.763   1.00 0.00 ? 1   PRO A HG2  6  
ATOM 10999 H HG3  . PRO A 1 1   ? -15.795 -2.623  9.235   1.00 0.00 ? 1   PRO A HG3  6  
ATOM 11000 H HD2  . PRO A 1 1   ? -17.376 -0.195  8.887   1.00 0.00 ? 1   PRO A HD2  6  
ATOM 11001 H HD3  . PRO A 1 1   ? -17.332 -1.310  10.257  1.00 0.00 ? 1   PRO A HD3  6  
ATOM 11002 N N    . ASN A 1 2   ? -14.977 2.136   8.500   1.00 0.00 ? 2   ASN A N    6  
ATOM 11003 C CA   . ASN A 1 2   ? -14.609 3.370   7.730   1.00 0.00 ? 2   ASN A CA   6  
ATOM 11004 C C    . ASN A 1 2   ? -13.889 2.936   6.445   1.00 0.00 ? 2   ASN A C    6  
ATOM 11005 O O    . ASN A 1 2   ? -14.267 1.942   5.865   1.00 0.00 ? 2   ASN A O    6  
ATOM 11006 C CB   . ASN A 1 2   ? -13.794 4.339   8.618   1.00 0.00 ? 2   ASN A CB   6  
ATOM 11007 C CG   . ASN A 1 2   ? -14.721 4.942   9.674   1.00 0.00 ? 2   ASN A CG   6  
ATOM 11008 O OD1  . ASN A 1 2   ? -14.797 4.453   10.784  1.00 0.00 ? 2   ASN A OD1  6  
ATOM 11009 N ND2  . ASN A 1 2   ? -15.435 5.993   9.375   1.00 0.00 ? 2   ASN A ND2  6  
ATOM 11010 H H    . ASN A 1 2   ? -15.907 1.835   8.500   1.00 0.00 ? 2   ASN A H    6  
ATOM 11011 H HA   . ASN A 1 2   ? -15.503 3.873   7.424   1.00 0.00 ? 2   ASN A HA   6  
ATOM 11012 H HB2  . ASN A 1 2   ? -13.001 3.817   9.110   1.00 0.00 ? 2   ASN A HB2  6  
ATOM 11013 H HB3  . ASN A 1 2   ? -13.387 5.136   8.019   1.00 0.00 ? 2   ASN A HB3  6  
ATOM 11014 H HD21 . ASN A 1 2   ? -15.374 6.388   8.481   1.00 0.00 ? 2   ASN A HD21 6  
ATOM 11015 H HD22 . ASN A 1 2   ? -16.032 6.387   10.046  1.00 0.00 ? 2   ASN A HD22 6  
ATOM 11016 N N    . PHE A 1 3   ? -12.897 3.660   5.993   1.00 0.00 ? 3   PHE A N    6  
ATOM 11017 C CA   . PHE A 1 3   ? -12.150 3.322   4.721   1.00 0.00 ? 3   PHE A CA   6  
ATOM 11018 C C    . PHE A 1 3   ? -12.933 3.785   3.475   1.00 0.00 ? 3   PHE A C    6  
ATOM 11019 O O    . PHE A 1 3   ? -12.370 4.385   2.579   1.00 0.00 ? 3   PHE A O    6  
ATOM 11020 C CB   . PHE A 1 3   ? -11.873 1.816   4.565   1.00 0.00 ? 3   PHE A CB   6  
ATOM 11021 C CG   . PHE A 1 3   ? -11.042 1.283   5.706   1.00 0.00 ? 3   PHE A CG   6  
ATOM 11022 C CD1  . PHE A 1 3   ? -11.658 0.841   6.881   1.00 0.00 ? 3   PHE A CD1  6  
ATOM 11023 C CD2  . PHE A 1 3   ? -9.651  1.182   5.571   1.00 0.00 ? 3   PHE A CD2  6  
ATOM 11024 C CE1  . PHE A 1 3   ? -10.907 0.302   7.905   1.00 0.00 ? 3   PHE A CE1  6  
ATOM 11025 C CE2  . PHE A 1 3   ? -8.892  0.646   6.612   1.00 0.00 ? 3   PHE A CE2  6  
ATOM 11026 C CZ   . PHE A 1 3   ? -9.529  0.197   7.783   1.00 0.00 ? 3   PHE A CZ   6  
ATOM 11027 H H    . PHE A 1 3   ? -12.637 4.446   6.484   1.00 0.00 ? 3   PHE A H    6  
ATOM 11028 H HA   . PHE A 1 3   ? -11.207 3.844   4.741   1.00 0.00 ? 3   PHE A HA   6  
ATOM 11029 H HB2  . PHE A 1 3   ? -12.801 1.276   4.515   1.00 0.00 ? 3   PHE A HB2  6  
ATOM 11030 H HB3  . PHE A 1 3   ? -11.335 1.660   3.641   1.00 0.00 ? 3   PHE A HB3  6  
ATOM 11031 H HD1  . PHE A 1 3   ? -12.715 0.916   7.006   1.00 0.00 ? 3   PHE A HD1  6  
ATOM 11032 H HD2  . PHE A 1 3   ? -9.159  1.541   4.675   1.00 0.00 ? 3   PHE A HD2  6  
ATOM 11033 H HE1  . PHE A 1 3   ? -11.396 -0.026  8.801   1.00 0.00 ? 3   PHE A HE1  6  
ATOM 11034 H HE2  . PHE A 1 3   ? -7.823  0.575   6.508   1.00 0.00 ? 3   PHE A HE2  6  
ATOM 11035 H HZ   . PHE A 1 3   ? -8.962  -0.235  8.596   1.00 0.00 ? 3   PHE A HZ   6  
ATOM 11036 N N    . SER A 1 4   ? -14.212 3.486   3.389   1.00 0.00 ? 4   SER A N    6  
ATOM 11037 C CA   . SER A 1 4   ? -15.019 3.873   2.188   1.00 0.00 ? 4   SER A CA   6  
ATOM 11038 C C    . SER A 1 4   ? -14.848 5.363   1.861   1.00 0.00 ? 4   SER A C    6  
ATOM 11039 O O    . SER A 1 4   ? -15.262 6.220   2.621   1.00 0.00 ? 4   SER A O    6  
ATOM 11040 C CB   . SER A 1 4   ? -16.498 3.596   2.464   1.00 0.00 ? 4   SER A CB   6  
ATOM 11041 O OG   . SER A 1 4   ? -17.023 4.608   3.315   1.00 0.00 ? 4   SER A OG   6  
ATOM 11042 H H    . SER A 1 4   ? -14.641 2.987   4.101   1.00 0.00 ? 4   SER A H    6  
ATOM 11043 H HA   . SER A 1 4   ? -14.703 3.274   1.343   1.00 0.00 ? 4   SER A HA   6  
ATOM 11044 H HB2  . SER A 1 4   ? -17.045 3.595   1.535   1.00 0.00 ? 4   SER A HB2  6  
ATOM 11045 H HB3  . SER A 1 4   ? -16.598 2.631   2.937   1.00 0.00 ? 4   SER A HB3  6  
ATOM 11046 H HG   . SER A 1 4   ? -16.498 4.623   4.118   1.00 0.00 ? 4   SER A HG   6  
ATOM 11047 N N    . GLY A 1 5   ? -14.260 5.676   0.733   1.00 0.00 ? 5   GLY A N    6  
ATOM 11048 C CA   . GLY A 1 5   ? -14.086 7.110   0.356   1.00 0.00 ? 5   GLY A CA   6  
ATOM 11049 C C    . GLY A 1 5   ? -12.821 7.282   -0.468  1.00 0.00 ? 5   GLY A C    6  
ATOM 11050 O O    . GLY A 1 5   ? -11.887 6.513   -0.365  1.00 0.00 ? 5   GLY A O    6  
ATOM 11051 H H    . GLY A 1 5   ? -13.941 4.968   0.130   1.00 0.00 ? 5   GLY A H    6  
ATOM 11052 H HA2  . GLY A 1 5   ? -14.937 7.439   -0.219  1.00 0.00 ? 5   GLY A HA2  6  
ATOM 11053 H HA3  . GLY A 1 5   ? -14.008 7.713   1.244   1.00 0.00 ? 5   GLY A HA3  6  
ATOM 11054 N N    . ASN A 1 6   ? -12.782 8.311   -1.263  1.00 0.00 ? 6   ASN A N    6  
ATOM 11055 C CA   . ASN A 1 6   ? -11.576 8.583   -2.084  1.00 0.00 ? 6   ASN A CA   6  
ATOM 11056 C C    . ASN A 1 6   ? -10.530 9.160   -1.152  1.00 0.00 ? 6   ASN A C    6  
ATOM 11057 O O    . ASN A 1 6   ? -10.871 9.665   -0.096  1.00 0.00 ? 6   ASN A O    6  
ATOM 11058 C CB   . ASN A 1 6   ? -11.906 9.587   -3.192  1.00 0.00 ? 6   ASN A CB   6  
ATOM 11059 C CG   . ASN A 1 6   ? -10.683 9.776   -4.091  1.00 0.00 ? 6   ASN A CG   6  
ATOM 11060 O OD1  . ASN A 1 6   ? -9.734  10.435  -3.715  1.00 0.00 ? 6   ASN A OD1  6  
ATOM 11061 N ND2  . ASN A 1 6   ? -10.664 9.221   -5.272  1.00 0.00 ? 6   ASN A ND2  6  
ATOM 11062 H H    . ASN A 1 6   ? -13.541 8.918   -1.295  1.00 0.00 ? 6   ASN A H    6  
ATOM 11063 H HA   . ASN A 1 6   ? -11.213 7.665   -2.508  1.00 0.00 ? 6   ASN A HA   6  
ATOM 11064 H HB2  . ASN A 1 6   ? -12.732 9.214   -3.780  1.00 0.00 ? 6   ASN A HB2  6  
ATOM 11065 H HB3  . ASN A 1 6   ? -12.176 10.534  -2.751  1.00 0.00 ? 6   ASN A HB3  6  
ATOM 11066 H HD21 . ASN A 1 6   ? -11.429 8.689   -5.576  1.00 0.00 ? 6   ASN A HD21 6  
ATOM 11067 H HD22 . ASN A 1 6   ? -9.885  9.337   -5.856  1.00 0.00 ? 6   ASN A HD22 6  
ATOM 11068 N N    . TRP A 1 7   ? -9.267  9.064   -1.484  1.00 0.00 ? 7   TRP A N    6  
ATOM 11069 C CA   . TRP A 1 7   ? -8.244  9.592   -0.533  1.00 0.00 ? 7   TRP A CA   6  
ATOM 11070 C C    . TRP A 1 7   ? -7.181  10.439  -1.210  1.00 0.00 ? 7   TRP A C    6  
ATOM 11071 O O    . TRP A 1 7   ? -6.596  10.058  -2.205  1.00 0.00 ? 7   TRP A O    6  
ATOM 11072 C CB   . TRP A 1 7   ? -7.568  8.425   0.150   1.00 0.00 ? 7   TRP A CB   6  
ATOM 11073 C CG   . TRP A 1 7   ? -8.585  7.622   0.868   1.00 0.00 ? 7   TRP A CG   6  
ATOM 11074 C CD1  . TRP A 1 7   ? -9.170  6.504   0.400   1.00 0.00 ? 7   TRP A CD1  6  
ATOM 11075 C CD2  . TRP A 1 7   ? -9.165  7.884   2.162   1.00 0.00 ? 7   TRP A CD2  6  
ATOM 11076 N NE1  . TRP A 1 7   ? -10.037 6.024   1.362   1.00 0.00 ? 7   TRP A NE1  6  
ATOM 11077 C CE2  . TRP A 1 7   ? -10.078 6.853   2.468   1.00 0.00 ? 7   TRP A CE2  6  
ATOM 11078 C CE3  . TRP A 1 7   ? -8.970  8.906   3.094   1.00 0.00 ? 7   TRP A CE3  6  
ATOM 11079 C CZ2  . TRP A 1 7   ? -10.780 6.840   3.675   1.00 0.00 ? 7   TRP A CZ2  6  
ATOM 11080 C CZ3  . TRP A 1 7   ? -9.675  8.915   4.295   1.00 0.00 ? 7   TRP A CZ3  6  
ATOM 11081 C CH2  . TRP A 1 7   ? -10.582 7.882   4.594   1.00 0.00 ? 7   TRP A CH2  6  
ATOM 11082 H H    . TRP A 1 7   ? -8.997  8.616   -2.327  1.00 0.00 ? 7   TRP A H    6  
ATOM 11083 H HA   . TRP A 1 7   ? -8.735  10.190  0.218   1.00 0.00 ? 7   TRP A HA   6  
ATOM 11084 H HB2  . TRP A 1 7   ? -7.073  7.817   -0.576  1.00 0.00 ? 7   TRP A HB2  6  
ATOM 11085 H HB3  . TRP A 1 7   ? -6.850  8.794   0.850   1.00 0.00 ? 7   TRP A HB3  6  
ATOM 11086 H HD1  . TRP A 1 7   ? -8.976  6.051   -0.560  1.00 0.00 ? 7   TRP A HD1  6  
ATOM 11087 H HE1  . TRP A 1 7   ? -10.572 5.210   1.281   1.00 0.00 ? 7   TRP A HE1  6  
ATOM 11088 H HE3  . TRP A 1 7   ? -8.267  9.694   2.881   1.00 0.00 ? 7   TRP A HE3  6  
ATOM 11089 H HZ2  . TRP A 1 7   ? -11.465 6.034   3.899   1.00 0.00 ? 7   TRP A HZ2  6  
ATOM 11090 H HZ3  . TRP A 1 7   ? -9.533  9.733   4.982   1.00 0.00 ? 7   TRP A HZ3  6  
ATOM 11091 H HH2  . TRP A 1 7   ? -11.127 7.892   5.526   1.00 0.00 ? 7   TRP A HH2  6  
ATOM 11092 N N    . LYS A 1 8   ? -6.909  11.580  -0.634  1.00 0.00 ? 8   LYS A N    6  
ATOM 11093 C CA   . LYS A 1 8   ? -5.858  12.470  -1.183  1.00 0.00 ? 8   LYS A CA   6  
ATOM 11094 C C    . LYS A 1 8   ? -4.560  12.166  -0.433  1.00 0.00 ? 8   LYS A C    6  
ATOM 11095 O O    . LYS A 1 8   ? -4.590  11.666  0.677   1.00 0.00 ? 8   LYS A O    6  
ATOM 11096 C CB   . LYS A 1 8   ? -6.222  13.954  -0.967  1.00 0.00 ? 8   LYS A CB   6  
ATOM 11097 C CG   . LYS A 1 8   ? -7.747  14.159  -0.913  1.00 0.00 ? 8   LYS A CG   6  
ATOM 11098 C CD   . LYS A 1 8   ? -8.187  14.306  0.544   1.00 0.00 ? 8   LYS A CD   6  
ATOM 11099 C CE   . LYS A 1 8   ? -8.184  15.787  0.934   1.00 0.00 ? 8   LYS A CE   6  
ATOM 11100 N NZ   . LYS A 1 8   ? -6.838  16.371  0.671   1.00 0.00 ? 8   LYS A NZ   6  
ATOM 11101 H H    . LYS A 1 8   ? -7.390  11.847  0.179   1.00 0.00 ? 8   LYS A H    6  
ATOM 11102 H HA   . LYS A 1 8   ? -5.728  12.264  -2.231  1.00 0.00 ? 8   LYS A HA   6  
ATOM 11103 H HB2  . LYS A 1 8   ? -5.788  14.290  -0.037  1.00 0.00 ? 8   LYS A HB2  6  
ATOM 11104 H HB3  . LYS A 1 8   ? -5.816  14.540  -1.772  1.00 0.00 ? 8   LYS A HB3  6  
ATOM 11105 H HG2  . LYS A 1 8   ? -8.008  15.047  -1.456  1.00 0.00 ? 8   LYS A HG2  6  
ATOM 11106 H HG3  . LYS A 1 8   ? -8.246  13.311  -1.354  1.00 0.00 ? 8   LYS A HG3  6  
ATOM 11107 H HD2  . LYS A 1 8   ? -9.180  13.904  0.663   1.00 0.00 ? 8   LYS A HD2  6  
ATOM 11108 H HD3  . LYS A 1 8   ? -7.502  13.768  1.178   1.00 0.00 ? 8   LYS A HD3  6  
ATOM 11109 H HE2  . LYS A 1 8   ? -8.925  16.314  0.350   1.00 0.00 ? 8   LYS A HE2  6  
ATOM 11110 H HE3  . LYS A 1 8   ? -8.419  15.883  1.984   1.00 0.00 ? 8   LYS A HE3  6  
ATOM 11111 H HZ1  . LYS A 1 8   ? -6.117  15.828  1.186   1.00 0.00 ? 8   LYS A HZ1  6  
ATOM 11112 H HZ2  . LYS A 1 8   ? -6.639  16.335  -0.350  1.00 0.00 ? 8   LYS A HZ2  6  
ATOM 11113 H HZ3  . LYS A 1 8   ? -6.820  17.359  0.993   1.00 0.00 ? 8   LYS A HZ3  6  
ATOM 11114 N N    . ILE A 1 9   ? -3.426  12.460  -1.017  1.00 0.00 ? 9   ILE A N    6  
ATOM 11115 C CA   . ILE A 1 9   ? -2.139  12.181  -0.317  1.00 0.00 ? 9   ILE A CA   6  
ATOM 11116 C C    . ILE A 1 9   ? -1.916  13.255  0.758   1.00 0.00 ? 9   ILE A C    6  
ATOM 11117 O O    . ILE A 1 9   ? -2.233  14.415  0.573   1.00 0.00 ? 9   ILE A O    6  
ATOM 11118 C CB   . ILE A 1 9   ? -0.986  12.119  -1.359  1.00 0.00 ? 9   ILE A CB   6  
ATOM 11119 C CG1  . ILE A 1 9   ? -0.040  10.961  -1.007  1.00 0.00 ? 9   ILE A CG1  6  
ATOM 11120 C CG2  . ILE A 1 9   ? -0.181  13.428  -1.427  1.00 0.00 ? 9   ILE A CG2  6  
ATOM 11121 C CD1  . ILE A 1 9   ? 0.587   11.186  0.374   1.00 0.00 ? 9   ILE A CD1  6  
ATOM 11122 H H    . ILE A 1 9   ? -3.423  12.863  -1.910  1.00 0.00 ? 9   ILE A H    6  
ATOM 11123 H HA   . ILE A 1 9   ? -2.219  11.221  0.181   1.00 0.00 ? 9   ILE A HA   6  
ATOM 11124 H HB   . ILE A 1 9   ? -1.414  11.930  -2.333  1.00 0.00 ? 9   ILE A HB   6  
ATOM 11125 H HG12 . ILE A 1 9   ? -0.596  10.035  -1.001  1.00 0.00 ? 9   ILE A HG12 6  
ATOM 11126 H HG13 . ILE A 1 9   ? 0.743   10.902  -1.748  1.00 0.00 ? 9   ILE A HG13 6  
ATOM 11127 H HG21 . ILE A 1 9   ? -0.856  14.259  -1.565  1.00 0.00 ? 9   ILE A HG21 6  
ATOM 11128 H HG22 . ILE A 1 9   ? 0.366   13.559  -0.503  1.00 0.00 ? 9   ILE A HG22 6  
ATOM 11129 H HG23 . ILE A 1 9   ? 0.512   13.382  -2.253  1.00 0.00 ? 9   ILE A HG23 6  
ATOM 11130 H HD11 . ILE A 1 9   ? 0.520   12.232  0.637   1.00 0.00 ? 9   ILE A HD11 6  
ATOM 11131 H HD12 . ILE A 1 9   ? 0.059   10.597  1.108   1.00 0.00 ? 9   ILE A HD12 6  
ATOM 11132 H HD13 . ILE A 1 9   ? 1.622   10.887  0.351   1.00 0.00 ? 9   ILE A HD13 6  
ATOM 11133 N N    . ILE A 1 10  ? -1.378  12.860  1.873   1.00 0.00 ? 10  ILE A N    6  
ATOM 11134 C CA   . ILE A 1 10  ? -1.128  13.810  2.983   1.00 0.00 ? 10  ILE A CA   6  
ATOM 11135 C C    . ILE A 1 10  ? 0.075   13.290  3.785   1.00 0.00 ? 10  ILE A C    6  
ATOM 11136 O O    . ILE A 1 10  ? 0.003   12.268  4.431   1.00 0.00 ? 10  ILE A O    6  
ATOM 11137 C CB   . ILE A 1 10  ? -2.408  13.892  3.845   1.00 0.00 ? 10  ILE A CB   6  
ATOM 11138 C CG1  . ILE A 1 10  ? -3.447  14.763  3.120   1.00 0.00 ? 10  ILE A CG1  6  
ATOM 11139 C CG2  . ILE A 1 10  ? -2.125  14.502  5.225   1.00 0.00 ? 10  ILE A CG2  6  
ATOM 11140 C CD1  . ILE A 1 10  ? -4.425  13.879  2.337   1.00 0.00 ? 10  ILE A CD1  6  
ATOM 11141 H H    . ILE A 1 10  ? -1.136  11.924  1.984   1.00 0.00 ? 10  ILE A H    6  
ATOM 11142 H HA   . ILE A 1 10  ? -0.902  14.782  2.581   1.00 0.00 ? 10  ILE A HA   6  
ATOM 11143 H HB   . ILE A 1 10  ? -2.805  12.901  3.970   1.00 0.00 ? 10  ILE A HB   6  
ATOM 11144 H HG12 . ILE A 1 10  ? -3.997  15.346  3.845   1.00 0.00 ? 10  ILE A HG12 6  
ATOM 11145 H HG13 . ILE A 1 10  ? -2.943  15.429  2.436   1.00 0.00 ? 10  ILE A HG13 6  
ATOM 11146 H HG21 . ILE A 1 10  ? -1.396  13.897  5.743   1.00 0.00 ? 10  ILE A HG21 6  
ATOM 11147 H HG22 . ILE A 1 10  ? -1.745  15.504  5.104   1.00 0.00 ? 10  ILE A HG22 6  
ATOM 11148 H HG23 . ILE A 1 10  ? -3.042  14.531  5.798   1.00 0.00 ? 10  ILE A HG23 6  
ATOM 11149 H HD11 . ILE A 1 10  ? -4.231  12.841  2.555   1.00 0.00 ? 10  ILE A HD11 6  
ATOM 11150 H HD12 . ILE A 1 10  ? -5.436  14.122  2.624   1.00 0.00 ? 10  ILE A HD12 6  
ATOM 11151 H HD13 . ILE A 1 10  ? -4.302  14.053  1.280   1.00 0.00 ? 10  ILE A HD13 6  
ATOM 11152 N N    . ARG A 1 11  ? 1.177   13.988  3.719   1.00 0.00 ? 11  ARG A N    6  
ATOM 11153 C CA   . ARG A 1 11  ? 2.412   13.565  4.450   1.00 0.00 ? 11  ARG A CA   6  
ATOM 11154 C C    . ARG A 1 11  ? 2.880   12.201  3.940   1.00 0.00 ? 11  ARG A C    6  
ATOM 11155 O O    . ARG A 1 11  ? 2.203   11.204  4.093   1.00 0.00 ? 11  ARG A O    6  
ATOM 11156 C CB   . ARG A 1 11  ? 2.130   13.491  5.956   1.00 0.00 ? 11  ARG A CB   6  
ATOM 11157 C CG   . ARG A 1 11  ? 2.195   14.898  6.557   1.00 0.00 ? 11  ARG A CG   6  
ATOM 11158 C CD   . ARG A 1 11  ? 1.081   15.761  5.961   1.00 0.00 ? 11  ARG A CD   6  
ATOM 11159 N NE   . ARG A 1 11  ? 0.828   16.931  6.849   1.00 0.00 ? 11  ARG A NE   6  
ATOM 11160 C CZ   . ARG A 1 11  ? 0.237   17.994  6.374   1.00 0.00 ? 11  ARG A CZ   6  
ATOM 11161 N NH1  . ARG A 1 11  ? 0.700   18.572  5.300   1.00 0.00 ? 11  ARG A NH1  6  
ATOM 11162 N NH2  . ARG A 1 11  ? -0.816  18.477  6.974   1.00 0.00 ? 11  ARG A NH2  6  
ATOM 11163 H H    . ARG A 1 11  ? 1.195   14.792  3.172   1.00 0.00 ? 11  ARG A H    6  
ATOM 11164 H HA   . ARG A 1 11  ? 3.191   14.293  4.272   1.00 0.00 ? 11  ARG A HA   6  
ATOM 11165 H HB2  . ARG A 1 11  ? 1.149   13.074  6.123   1.00 0.00 ? 11  ARG A HB2  6  
ATOM 11166 H HB3  . ARG A 1 11  ? 2.872   12.866  6.430   1.00 0.00 ? 11  ARG A HB3  6  
ATOM 11167 H HG2  . ARG A 1 11  ? 2.071   14.837  7.629   1.00 0.00 ? 11  ARG A HG2  6  
ATOM 11168 H HG3  . ARG A 1 11  ? 3.153   15.342  6.331   1.00 0.00 ? 11  ARG A HG3  6  
ATOM 11169 H HD2  . ARG A 1 11  ? 1.380   16.108  4.983   1.00 0.00 ? 11  ARG A HD2  6  
ATOM 11170 H HD3  . ARG A 1 11  ? 0.180   15.173  5.873   1.00 0.00 ? 11  ARG A HD3  6  
ATOM 11171 H HE   . ARG A 1 11  ? 1.104   16.902  7.789   1.00 0.00 ? 11  ARG A HE   6  
ATOM 11172 H HH11 . ARG A 1 11  ? 1.506   18.201  4.840   1.00 0.00 ? 11  ARG A HH11 6  
ATOM 11173 H HH12 . ARG A 1 11  ? 0.247   19.386  4.936   1.00 0.00 ? 11  ARG A HH12 6  
ATOM 11174 H HH21 . ARG A 1 11  ? -1.171  18.034  7.797   1.00 0.00 ? 11  ARG A HH21 6  
ATOM 11175 H HH22 . ARG A 1 11  ? -1.269  19.292  6.611   1.00 0.00 ? 11  ARG A HH22 6  
ATOM 11176 N N    . SER A 1 12  ? 4.039   12.154  3.332   1.00 0.00 ? 12  SER A N    6  
ATOM 11177 C CA   . SER A 1 12  ? 4.558   10.859  2.806   1.00 0.00 ? 12  SER A CA   6  
ATOM 11178 C C    . SER A 1 12  ? 5.990   10.626  3.316   1.00 0.00 ? 12  SER A C    6  
ATOM 11179 O O    . SER A 1 12  ? 6.187   9.996   4.338   1.00 0.00 ? 12  SER A O    6  
ATOM 11180 C CB   . SER A 1 12  ? 4.525   10.884  1.273   1.00 0.00 ? 12  SER A CB   6  
ATOM 11181 O OG   . SER A 1 12  ? 5.110   9.689   0.771   1.00 0.00 ? 12  SER A OG   6  
ATOM 11182 H H    . SER A 1 12  ? 4.566   12.973  3.220   1.00 0.00 ? 12  SER A H    6  
ATOM 11183 H HA   . SER A 1 12  ? 3.928   10.057  3.163   1.00 0.00 ? 12  SER A HA   6  
ATOM 11184 H HB2  . SER A 1 12  ? 3.504   10.950  0.934   1.00 0.00 ? 12  SER A HB2  6  
ATOM 11185 H HB3  . SER A 1 12  ? 5.074   11.745  0.915   1.00 0.00 ? 12  SER A HB3  6  
ATOM 11186 H HG   . SER A 1 12  ? 6.049   9.714   0.965   1.00 0.00 ? 12  SER A HG   6  
ATOM 11187 N N    . GLU A 1 13  ? 6.996   11.119  2.620   1.00 0.00 ? 13  GLU A N    6  
ATOM 11188 C CA   . GLU A 1 13  ? 8.409   10.913  3.076   1.00 0.00 ? 13  GLU A CA   6  
ATOM 11189 C C    . GLU A 1 13  ? 8.670   9.419   3.306   1.00 0.00 ? 13  GLU A C    6  
ATOM 11190 O O    . GLU A 1 13  ? 8.561   8.930   4.414   1.00 0.00 ? 13  GLU A O    6  
ATOM 11191 C CB   . GLU A 1 13  ? 8.638   11.677  4.382   1.00 0.00 ? 13  GLU A CB   6  
ATOM 11192 C CG   . GLU A 1 13  ? 10.140  11.809  4.642   1.00 0.00 ? 13  GLU A CG   6  
ATOM 11193 C CD   . GLU A 1 13  ? 10.376  12.799  5.783   1.00 0.00 ? 13  GLU A CD   6  
ATOM 11194 O OE1  . GLU A 1 13  ? 10.142  12.428  6.922   1.00 0.00 ? 13  GLU A OE1  6  
ATOM 11195 O OE2  . GLU A 1 13  ? 10.785  13.913  5.500   1.00 0.00 ? 13  GLU A OE2  6  
ATOM 11196 H H    . GLU A 1 13  ? 6.823   11.623  1.800   1.00 0.00 ? 13  GLU A H    6  
ATOM 11197 H HA   . GLU A 1 13  ? 9.087   11.284  2.321   1.00 0.00 ? 13  GLU A HA   6  
ATOM 11198 H HB2  . GLU A 1 13  ? 8.197   12.660  4.306   1.00 0.00 ? 13  GLU A HB2  6  
ATOM 11199 H HB3  . GLU A 1 13  ? 8.180   11.139  5.198   1.00 0.00 ? 13  GLU A HB3  6  
ATOM 11200 H HG2  . GLU A 1 13  ? 10.545  10.844  4.911   1.00 0.00 ? 13  GLU A HG2  6  
ATOM 11201 H HG3  . GLU A 1 13  ? 10.630  12.168  3.749   1.00 0.00 ? 13  GLU A HG3  6  
ATOM 11202 N N    . ASN A 1 14  ? 9.005   8.696   2.266   1.00 0.00 ? 14  ASN A N    6  
ATOM 11203 C CA   . ASN A 1 14  ? 9.262   7.230   2.423   1.00 0.00 ? 14  ASN A CA   6  
ATOM 11204 C C    . ASN A 1 14  ? 9.850   6.642   1.135   1.00 0.00 ? 14  ASN A C    6  
ATOM 11205 O O    . ASN A 1 14  ? 10.651  5.736   1.191   1.00 0.00 ? 14  ASN A O    6  
ATOM 11206 C CB   . ASN A 1 14  ? 7.947   6.515   2.751   1.00 0.00 ? 14  ASN A CB   6  
ATOM 11207 C CG   . ASN A 1 14  ? 7.840   6.295   4.262   1.00 0.00 ? 14  ASN A CG   6  
ATOM 11208 O OD1  . ASN A 1 14  ? 8.598   5.536   4.833   1.00 0.00 ? 14  ASN A OD1  6  
ATOM 11209 N ND2  . ASN A 1 14  ? 6.923   6.933   4.939   1.00 0.00 ? 14  ASN A ND2  6  
ATOM 11210 H H    . ASN A 1 14  ? 9.082   9.117   1.387   1.00 0.00 ? 14  ASN A H    6  
ATOM 11211 H HA   . ASN A 1 14  ? 9.958   7.075   3.231   1.00 0.00 ? 14  ASN A HA   6  
ATOM 11212 H HB2  . ASN A 1 14  ? 7.120   7.120   2.417   1.00 0.00 ? 14  ASN A HB2  6  
ATOM 11213 H HB3  . ASN A 1 14  ? 7.921   5.558   2.250   1.00 0.00 ? 14  ASN A HB3  6  
ATOM 11214 H HD21 . ASN A 1 14  ? 6.312   7.545   4.479   1.00 0.00 ? 14  ASN A HD21 6  
ATOM 11215 H HD22 . ASN A 1 14  ? 6.846   6.798   5.906   1.00 0.00 ? 14  ASN A HD22 6  
ATOM 11216 N N    . PHE A 1 15  ? 9.446   7.136   -0.021  1.00 0.00 ? 15  PHE A N    6  
ATOM 11217 C CA   . PHE A 1 15  ? 9.964   6.594   -1.332  1.00 0.00 ? 15  PHE A CA   6  
ATOM 11218 C C    . PHE A 1 15  ? 11.486  6.399   -1.290  1.00 0.00 ? 15  PHE A C    6  
ATOM 11219 O O    . PHE A 1 15  ? 11.985  5.346   -1.640  1.00 0.00 ? 15  PHE A O    6  
ATOM 11220 C CB   . PHE A 1 15  ? 9.614   7.570   -2.470  1.00 0.00 ? 15  PHE A CB   6  
ATOM 11221 C CG   . PHE A 1 15  ? 9.635   6.851   -3.811  1.00 0.00 ? 15  PHE A CG   6  
ATOM 11222 C CD1  . PHE A 1 15  ? 10.789  6.181   -4.239  1.00 0.00 ? 15  PHE A CD1  6  
ATOM 11223 C CD2  . PHE A 1 15  ? 8.497   6.855   -4.628  1.00 0.00 ? 15  PHE A CD2  6  
ATOM 11224 C CE1  . PHE A 1 15  ? 10.807  5.519   -5.467  1.00 0.00 ? 15  PHE A CE1  6  
ATOM 11225 C CE2  . PHE A 1 15  ? 8.516   6.187   -5.860  1.00 0.00 ? 15  PHE A CE2  6  
ATOM 11226 C CZ   . PHE A 1 15  ? 9.674   5.516   -6.276  1.00 0.00 ? 15  PHE A CZ   6  
ATOM 11227 H H    . PHE A 1 15  ? 8.785   7.856   -0.030  1.00 0.00 ? 15  PHE A H    6  
ATOM 11228 H HA   . PHE A 1 15  ? 9.496   5.638   -1.527  1.00 0.00 ? 15  PHE A HA   6  
ATOM 11229 H HB2  . PHE A 1 15  ? 8.628   7.977   -2.300  1.00 0.00 ? 15  PHE A HB2  6  
ATOM 11230 H HB3  . PHE A 1 15  ? 10.334  8.374   -2.485  1.00 0.00 ? 15  PHE A HB3  6  
ATOM 11231 H HD1  . PHE A 1 15  ? 11.668  6.191   -3.635  1.00 0.00 ? 15  PHE A HD1  6  
ATOM 11232 H HD2  . PHE A 1 15  ? 7.607   7.372   -4.310  1.00 0.00 ? 15  PHE A HD2  6  
ATOM 11233 H HE1  . PHE A 1 15  ? 11.700  5.002   -5.787  1.00 0.00 ? 15  PHE A HE1  6  
ATOM 11234 H HE2  . PHE A 1 15  ? 7.639   6.196   -6.490  1.00 0.00 ? 15  PHE A HE2  6  
ATOM 11235 H HZ   . PHE A 1 15  ? 9.696   4.999   -7.223  1.00 0.00 ? 15  PHE A HZ   6  
ATOM 11236 N N    . GLU A 1 16  ? 12.224  7.389   -0.882  1.00 0.00 ? 16  GLU A N    6  
ATOM 11237 C CA   . GLU A 1 16  ? 13.706  7.232   -0.839  1.00 0.00 ? 16  GLU A CA   6  
ATOM 11238 C C    . GLU A 1 16  ? 14.058  6.248   0.263   1.00 0.00 ? 16  GLU A C    6  
ATOM 11239 O O    . GLU A 1 16  ? 14.974  5.459   0.130   1.00 0.00 ? 16  GLU A O    6  
ATOM 11240 C CB   . GLU A 1 16  ? 14.383  8.584   -0.580  1.00 0.00 ? 16  GLU A CB   6  
ATOM 11241 C CG   . GLU A 1 16  ? 13.796  9.653   -1.512  1.00 0.00 ? 16  GLU A CG   6  
ATOM 11242 C CD   . GLU A 1 16  ? 12.786  10.510  -0.745  1.00 0.00 ? 16  GLU A CD   6  
ATOM 11243 O OE1  . GLU A 1 16  ? 13.181  11.120  0.236   1.00 0.00 ? 16  GLU A OE1  6  
ATOM 11244 O OE2  . GLU A 1 16  ? 11.636  10.542  -1.151  1.00 0.00 ? 16  GLU A OE2  6  
ATOM 11245 H H    . GLU A 1 16  ? 11.808  8.226   -0.609  1.00 0.00 ? 16  GLU A H    6  
ATOM 11246 H HA   . GLU A 1 16  ? 14.040  6.822   -1.782  1.00 0.00 ? 16  GLU A HA   6  
ATOM 11247 H HB2  . GLU A 1 16  ? 14.222  8.873   0.449   1.00 0.00 ? 16  GLU A HB2  6  
ATOM 11248 H HB3  . GLU A 1 16  ? 15.443  8.494   -0.764  1.00 0.00 ? 16  GLU A HB3  6  
ATOM 11249 H HG2  . GLU A 1 16  ? 14.592  10.282  -1.883  1.00 0.00 ? 16  GLU A HG2  6  
ATOM 11250 H HG3  . GLU A 1 16  ? 13.300  9.174   -2.343  1.00 0.00 ? 16  GLU A HG3  6  
ATOM 11251 N N    . GLU A 1 17  ? 13.311  6.259   1.335   1.00 0.00 ? 17  GLU A N    6  
ATOM 11252 C CA   . GLU A 1 17  ? 13.568  5.287   2.435   1.00 0.00 ? 17  GLU A CA   6  
ATOM 11253 C C    . GLU A 1 17  ? 13.405  3.861   1.880   1.00 0.00 ? 17  GLU A C    6  
ATOM 11254 O O    . GLU A 1 17  ? 13.926  2.910   2.427   1.00 0.00 ? 17  GLU A O    6  
ATOM 11255 C CB   . GLU A 1 17  ? 12.557  5.519   3.556   1.00 0.00 ? 17  GLU A CB   6  
ATOM 11256 C CG   . GLU A 1 17  ? 12.931  4.668   4.768   1.00 0.00 ? 17  GLU A CG   6  
ATOM 11257 C CD   . GLU A 1 17  ? 12.495  5.382   6.049   1.00 0.00 ? 17  GLU A CD   6  
ATOM 11258 O OE1  . GLU A 1 17  ? 11.299  5.493   6.263   1.00 0.00 ? 17  GLU A OE1  6  
ATOM 11259 O OE2  . GLU A 1 17  ? 13.363  5.804   6.794   1.00 0.00 ? 17  GLU A OE2  6  
ATOM 11260 H H    . GLU A 1 17  ? 12.561  6.886   1.402   1.00 0.00 ? 17  GLU A H    6  
ATOM 11261 H HA   . GLU A 1 17  ? 14.568  5.417   2.814   1.00 0.00 ? 17  GLU A HA   6  
ATOM 11262 H HB2  . GLU A 1 17  ? 12.557  6.563   3.832   1.00 0.00 ? 17  GLU A HB2  6  
ATOM 11263 H HB3  . GLU A 1 17  ? 11.579  5.238   3.212   1.00 0.00 ? 17  GLU A HB3  6  
ATOM 11264 H HG2  . GLU A 1 17  ? 12.436  3.711   4.701   1.00 0.00 ? 17  GLU A HG2  6  
ATOM 11265 H HG3  . GLU A 1 17  ? 13.999  4.521   4.787   1.00 0.00 ? 17  GLU A HG3  6  
ATOM 11266 N N    . LEU A 1 18  ? 12.687  3.720   0.787   1.00 0.00 ? 18  LEU A N    6  
ATOM 11267 C CA   . LEU A 1 18  ? 12.478  2.385   0.171   1.00 0.00 ? 18  LEU A CA   6  
ATOM 11268 C C    . LEU A 1 18  ? 13.731  1.967   -0.567  1.00 0.00 ? 18  LEU A C    6  
ATOM 11269 O O    . LEU A 1 18  ? 14.219  0.867   -0.401  1.00 0.00 ? 18  LEU A O    6  
ATOM 11270 C CB   . LEU A 1 18  ? 11.331  2.443   -0.847  1.00 0.00 ? 18  LEU A CB   6  
ATOM 11271 C CG   . LEU A 1 18  ? 10.165  3.323   -0.386  1.00 0.00 ? 18  LEU A CG   6  
ATOM 11272 C CD1  . LEU A 1 18  ? 8.977   3.050   -1.296  1.00 0.00 ? 18  LEU A CD1  6  
ATOM 11273 C CD2  . LEU A 1 18  ? 9.753   3.032   1.053   1.00 0.00 ? 18  LEU A CD2  6  
ATOM 11274 H H    . LEU A 1 18  ? 12.286  4.495   0.368   1.00 0.00 ? 18  LEU A H    6  
ATOM 11275 H HA   . LEU A 1 18  ? 12.258  1.666   0.933   1.00 0.00 ? 18  LEU A HA   6  
ATOM 11276 H HB2  . LEU A 1 18  ? 11.711  2.852   -1.772  1.00 0.00 ? 18  LEU A HB2  6  
ATOM 11277 H HB3  . LEU A 1 18  ? 10.973  1.450   -1.026  1.00 0.00 ? 18  LEU A HB3  6  
ATOM 11278 H HG   . LEU A 1 18  ? 10.447  4.345   -0.473  1.00 0.00 ? 18  LEU A HG   6  
ATOM 11279 H HD11 . LEU A 1 18  ? 9.322   2.969   -2.316  1.00 0.00 ? 18  LEU A HD11 6  
ATOM 11280 H HD12 . LEU A 1 18  ? 8.507   2.123   -1.000  1.00 0.00 ? 18  LEU A HD12 6  
ATOM 11281 H HD13 . LEU A 1 18  ? 8.270   3.858   -1.215  1.00 0.00 ? 18  LEU A HD13 6  
ATOM 11282 H HD21 . LEU A 1 18  ? 10.630  2.909   1.669   1.00 0.00 ? 18  LEU A HD21 6  
ATOM 11283 H HD22 . LEU A 1 18  ? 9.165   3.857   1.427   1.00 0.00 ? 18  LEU A HD22 6  
ATOM 11284 H HD23 . LEU A 1 18  ? 9.163   2.131   1.076   1.00 0.00 ? 18  LEU A HD23 6  
ATOM 11285 N N    . LEU A 1 19  ? 14.254  2.834   -1.387  1.00 0.00 ? 19  LEU A N    6  
ATOM 11286 C CA   . LEU A 1 19  ? 15.482  2.477   -2.134  1.00 0.00 ? 19  LEU A CA   6  
ATOM 11287 C C    . LEU A 1 19  ? 16.714  2.672   -1.230  1.00 0.00 ? 19  LEU A C    6  
ATOM 11288 O O    . LEU A 1 19  ? 17.832  2.399   -1.622  1.00 0.00 ? 19  LEU A O    6  
ATOM 11289 C CB   . LEU A 1 19  ? 15.600  3.337   -3.405  1.00 0.00 ? 19  LEU A CB   6  
ATOM 11290 C CG   . LEU A 1 19  ? 14.283  3.343   -4.233  1.00 0.00 ? 19  LEU A CG   6  
ATOM 11291 C CD1  . LEU A 1 19  ? 13.480  2.037   -4.074  1.00 0.00 ? 19  LEU A CD1  6  
ATOM 11292 C CD2  . LEU A 1 19  ? 13.418  4.528   -3.800  1.00 0.00 ? 19  LEU A CD2  6  
ATOM 11293 H H    . LEU A 1 19  ? 13.841  3.713   -1.504  1.00 0.00 ? 19  LEU A H    6  
ATOM 11294 H HA   . LEU A 1 19  ? 15.407  1.441   -2.415  1.00 0.00 ? 19  LEU A HA   6  
ATOM 11295 H HB2  . LEU A 1 19  ? 15.837  4.351   -3.119  1.00 0.00 ? 19  LEU A HB2  6  
ATOM 11296 H HB3  . LEU A 1 19  ? 16.399  2.952   -4.018  1.00 0.00 ? 19  LEU A HB3  6  
ATOM 11297 H HG   . LEU A 1 19  ? 14.529  3.461   -5.275  1.00 0.00 ? 19  LEU A HG   6  
ATOM 11298 H HD11 . LEU A 1 19  ? 14.155  1.199   -4.071  1.00 0.00 ? 19  LEU A HD11 6  
ATOM 11299 H HD12 . LEU A 1 19  ? 12.931  2.062   -3.143  1.00 0.00 ? 19  LEU A HD12 6  
ATOM 11300 H HD13 . LEU A 1 19  ? 12.787  1.939   -4.896  1.00 0.00 ? 19  LEU A HD13 6  
ATOM 11301 H HD21 . LEU A 1 19  ? 13.887  5.041   -2.973  1.00 0.00 ? 19  LEU A HD21 6  
ATOM 11302 H HD22 . LEU A 1 19  ? 13.309  5.211   -4.628  1.00 0.00 ? 19  LEU A HD22 6  
ATOM 11303 H HD23 . LEU A 1 19  ? 12.442  4.177   -3.495  1.00 0.00 ? 19  LEU A HD23 6  
ATOM 11304 N N    . LYS A 1 20  ? 16.508  3.127   -0.014  1.00 0.00 ? 20  LYS A N    6  
ATOM 11305 C CA   . LYS A 1 20  ? 17.629  3.329   0.937   1.00 0.00 ? 20  LYS A CA   6  
ATOM 11306 C C    . LYS A 1 20  ? 17.693  2.138   1.902   1.00 0.00 ? 20  LYS A C    6  
ATOM 11307 O O    . LYS A 1 20  ? 18.723  1.849   2.480   1.00 0.00 ? 20  LYS A O    6  
ATOM 11308 C CB   . LYS A 1 20  ? 17.357  4.599   1.742   1.00 0.00 ? 20  LYS A CB   6  
ATOM 11309 C CG   . LYS A 1 20  ? 17.990  5.800   1.043   1.00 0.00 ? 20  LYS A CG   6  
ATOM 11310 C CD   . LYS A 1 20  ? 18.086  6.973   2.022   1.00 0.00 ? 20  LYS A CD   6  
ATOM 11311 C CE   . LYS A 1 20  ? 19.474  6.992   2.665   1.00 0.00 ? 20  LYS A CE   6  
ATOM 11312 N NZ   . LYS A 1 20  ? 19.707  8.319   3.302   1.00 0.00 ? 20  LYS A NZ   6  
ATOM 11313 H H    . LYS A 1 20  ? 15.605  3.328   0.285   1.00 0.00 ? 20  LYS A H    6  
ATOM 11314 H HA   . LYS A 1 20  ? 18.556  3.424   0.399   1.00 0.00 ? 20  LYS A HA   6  
ATOM 11315 H HB2  . LYS A 1 20  ? 16.289  4.750   1.817   1.00 0.00 ? 20  LYS A HB2  6  
ATOM 11316 H HB3  . LYS A 1 20  ? 17.772  4.493   2.730   1.00 0.00 ? 20  LYS A HB3  6  
ATOM 11317 H HG2  . LYS A 1 20  ? 18.977  5.535   0.697   1.00 0.00 ? 20  LYS A HG2  6  
ATOM 11318 H HG3  . LYS A 1 20  ? 17.378  6.086   0.201   1.00 0.00 ? 20  LYS A HG3  6  
ATOM 11319 H HD2  . LYS A 1 20  ? 17.922  7.899   1.490   1.00 0.00 ? 20  LYS A HD2  6  
ATOM 11320 H HD3  . LYS A 1 20  ? 17.337  6.862   2.792   1.00 0.00 ? 20  LYS A HD3  6  
ATOM 11321 H HE2  . LYS A 1 20  ? 19.534  6.217   3.415   1.00 0.00 ? 20  LYS A HE2  6  
ATOM 11322 H HE3  . LYS A 1 20  ? 20.224  6.819   1.907   1.00 0.00 ? 20  LYS A HE3  6  
ATOM 11323 H HZ1  . LYS A 1 20  ? 18.849  8.617   3.807   1.00 0.00 ? 20  LYS A HZ1  6  
ATOM 11324 H HZ2  . LYS A 1 20  ? 20.496  8.247   3.975   1.00 0.00 ? 20  LYS A HZ2  6  
ATOM 11325 H HZ3  . LYS A 1 20  ? 19.940  9.019   2.568   1.00 0.00 ? 20  LYS A HZ3  6  
ATOM 11326 N N    . VAL A 1 21  ? 16.587  1.459   2.086   1.00 0.00 ? 21  VAL A N    6  
ATOM 11327 C CA   . VAL A 1 21  ? 16.547  0.303   3.014   1.00 0.00 ? 21  VAL A CA   6  
ATOM 11328 C C    . VAL A 1 21  ? 16.723  -0.994  2.230   1.00 0.00 ? 21  VAL A C    6  
ATOM 11329 O O    . VAL A 1 21  ? 17.328  -1.933  2.714   1.00 0.00 ? 21  VAL A O    6  
ATOM 11330 C CB   . VAL A 1 21  ? 15.211  0.299   3.757   1.00 0.00 ? 21  VAL A CB   6  
ATOM 11331 C CG1  . VAL A 1 21  ? 15.076  1.589   4.565   1.00 0.00 ? 21  VAL A CG1  6  
ATOM 11332 C CG2  . VAL A 1 21  ? 14.049  0.197   2.762   1.00 0.00 ? 21  VAL A CG2  6  
ATOM 11333 H H    . VAL A 1 21  ? 15.780  1.719   1.618   1.00 0.00 ? 21  VAL A H    6  
ATOM 11334 H HA   . VAL A 1 21  ? 17.353  0.393   3.723   1.00 0.00 ? 21  VAL A HA   6  
ATOM 11335 H HB   . VAL A 1 21  ? 15.182  -0.541  4.422   1.00 0.00 ? 21  VAL A HB   6  
ATOM 11336 H HG11 . VAL A 1 21  ? 15.541  2.401   4.025   1.00 0.00 ? 21  VAL A HG11 6  
ATOM 11337 H HG12 . VAL A 1 21  ? 14.030  1.810   4.717   1.00 0.00 ? 21  VAL A HG12 6  
ATOM 11338 H HG13 . VAL A 1 21  ? 15.562  1.467   5.521   1.00 0.00 ? 21  VAL A HG13 6  
ATOM 11339 H HG21 . VAL A 1 21  ? 14.391  0.451   1.774   1.00 0.00 ? 21  VAL A HG21 6  
ATOM 11340 H HG22 . VAL A 1 21  ? 13.670  -0.813  2.758   1.00 0.00 ? 21  VAL A HG22 6  
ATOM 11341 H HG23 . VAL A 1 21  ? 13.262  0.875   3.052   1.00 0.00 ? 21  VAL A HG23 6  
ATOM 11342 N N    . LEU A 1 22  ? 16.240  -1.048  1.007   1.00 0.00 ? 22  LEU A N    6  
ATOM 11343 C CA   . LEU A 1 22  ? 16.436  -2.284  0.190   1.00 0.00 ? 22  LEU A CA   6  
ATOM 11344 C C    . LEU A 1 22  ? 17.945  -2.524  0.048   1.00 0.00 ? 22  LEU A C    6  
ATOM 11345 O O    . LEU A 1 22  ? 18.393  -3.628  -0.195  1.00 0.00 ? 22  LEU A O    6  
ATOM 11346 C CB   . LEU A 1 22  ? 15.770  -2.136  -1.201  1.00 0.00 ? 22  LEU A CB   6  
ATOM 11347 C CG   . LEU A 1 22  ? 16.262  -0.914  -1.988  1.00 0.00 ? 22  LEU A CG   6  
ATOM 11348 C CD1  . LEU A 1 22  ? 17.712  -1.091  -2.466  1.00 0.00 ? 22  LEU A CD1  6  
ATOM 11349 C CD2  . LEU A 1 22  ? 15.360  -0.775  -3.215  1.00 0.00 ? 22  LEU A CD2  6  
ATOM 11350 H H    . LEU A 1 22  ? 15.789  -0.274  0.622   1.00 0.00 ? 22  LEU A H    6  
ATOM 11351 H HA   . LEU A 1 22  ? 15.991  -3.130  0.710   1.00 0.00 ? 22  LEU A HA   6  
ATOM 11352 H HB2  . LEU A 1 22  ? 15.967  -3.012  -1.785  1.00 0.00 ? 22  LEU A HB2  6  
ATOM 11353 H HB3  . LEU A 1 22  ? 14.701  -2.037  -1.064  1.00 0.00 ? 22  LEU A HB3  6  
ATOM 11354 H HG   . LEU A 1 22  ? 16.183  -0.029  -1.377  1.00 0.00 ? 22  LEU A HG   6  
ATOM 11355 H HD11 . LEU A 1 22  ? 17.992  -2.131  -2.391  1.00 0.00 ? 22  LEU A HD11 6  
ATOM 11356 H HD12 . LEU A 1 22  ? 17.798  -0.770  -3.493  1.00 0.00 ? 22  LEU A HD12 6  
ATOM 11357 H HD13 . LEU A 1 22  ? 18.367  -0.494  -1.851  1.00 0.00 ? 22  LEU A HD13 6  
ATOM 11358 H HD21 . LEU A 1 22  ? 15.342  -1.709  -3.755  1.00 0.00 ? 22  LEU A HD21 6  
ATOM 11359 H HD22 . LEU A 1 22  ? 14.360  -0.521  -2.899  1.00 0.00 ? 22  LEU A HD22 6  
ATOM 11360 H HD23 . LEU A 1 22  ? 15.744  0.005   -3.857  1.00 0.00 ? 22  LEU A HD23 6  
ATOM 11361 N N    . GLY A 1 23  ? 18.727  -1.477  0.205   1.00 0.00 ? 23  GLY A N    6  
ATOM 11362 C CA   . GLY A 1 23  ? 20.193  -1.603  0.092   1.00 0.00 ? 23  GLY A CA   6  
ATOM 11363 C C    . GLY A 1 23  ? 20.717  -0.539  -0.857  1.00 0.00 ? 23  GLY A C    6  
ATOM 11364 O O    . GLY A 1 23  ? 21.009  -0.811  -2.006  1.00 0.00 ? 23  GLY A O    6  
ATOM 11365 H H    . GLY A 1 23  ? 18.340  -0.599  0.400   1.00 0.00 ? 23  GLY A H    6  
ATOM 11366 H HA2  . GLY A 1 23  ? 20.639  -1.466  1.067   1.00 0.00 ? 23  GLY A HA2  6  
ATOM 11367 H HA3  . GLY A 1 23  ? 20.437  -2.568  -0.293  1.00 0.00 ? 23  GLY A HA3  6  
ATOM 11368 N N    . VAL A 1 24  ? 20.835  0.676   -0.384  1.00 0.00 ? 24  VAL A N    6  
ATOM 11369 C CA   . VAL A 1 24  ? 21.342  1.788   -1.251  1.00 0.00 ? 24  VAL A CA   6  
ATOM 11370 C C    . VAL A 1 24  ? 22.649  1.354   -1.951  1.00 0.00 ? 24  VAL A C    6  
ATOM 11371 O O    . VAL A 1 24  ? 23.453  0.627   -1.400  1.00 0.00 ? 24  VAL A O    6  
ATOM 11372 C CB   . VAL A 1 24  ? 21.525  3.061   -0.373  1.00 0.00 ? 24  VAL A CB   6  
ATOM 11373 C CG1  . VAL A 1 24  ? 23.003  3.463   -0.194  1.00 0.00 ? 24  VAL A CG1  6  
ATOM 11374 C CG2  . VAL A 1 24  ? 20.777  4.231   -1.021  1.00 0.00 ? 24  VAL A CG2  6  
ATOM 11375 H H    . VAL A 1 24  ? 20.578  0.859   0.547   1.00 0.00 ? 24  VAL A H    6  
ATOM 11376 H HA   . VAL A 1 24  ? 20.601  1.989   -2.012  1.00 0.00 ? 24  VAL A HA   6  
ATOM 11377 H HB   . VAL A 1 24  ? 21.096  2.865   0.600   1.00 0.00 ? 24  VAL A HB   6  
ATOM 11378 H HG11 . VAL A 1 24  ? 23.559  2.628   0.204   1.00 0.00 ? 24  VAL A HG11 6  
ATOM 11379 H HG12 . VAL A 1 24  ? 23.416  3.746   -1.152  1.00 0.00 ? 24  VAL A HG12 6  
ATOM 11380 H HG13 . VAL A 1 24  ? 23.069  4.299   0.486   1.00 0.00 ? 24  VAL A HG13 6  
ATOM 11381 H HG21 . VAL A 1 24  ? 19.806  3.897   -1.354  1.00 0.00 ? 24  VAL A HG21 6  
ATOM 11382 H HG22 . VAL A 1 24  ? 20.658  5.026   -0.301  1.00 0.00 ? 24  VAL A HG22 6  
ATOM 11383 H HG23 . VAL A 1 24  ? 21.343  4.593   -1.867  1.00 0.00 ? 24  VAL A HG23 6  
ATOM 11384 N N    . ASN A 1 25  ? 22.842  1.803   -3.157  1.00 0.00 ? 25  ASN A N    6  
ATOM 11385 C CA   . ASN A 1 25  ? 24.065  1.441   -3.932  1.00 0.00 ? 25  ASN A CA   6  
ATOM 11386 C C    . ASN A 1 25  ? 23.921  2.085   -5.300  1.00 0.00 ? 25  ASN A C    6  
ATOM 11387 O O    . ASN A 1 25  ? 23.630  1.432   -6.280  1.00 0.00 ? 25  ASN A O    6  
ATOM 11388 C CB   . ASN A 1 25  ? 24.174  -0.083  -4.078  1.00 0.00 ? 25  ASN A CB   6  
ATOM 11389 C CG   . ASN A 1 25  ? 25.648  -0.493  -4.068  1.00 0.00 ? 25  ASN A CG   6  
ATOM 11390 O OD1  . ASN A 1 25  ? 26.469  0.167   -3.462  1.00 0.00 ? 25  ASN A OD1  6  
ATOM 11391 N ND2  . ASN A 1 25  ? 26.020  -1.561  -4.718  1.00 0.00 ? 25  ASN A ND2  6  
ATOM 11392 H H    . ASN A 1 25  ? 22.167  2.393   -3.568  1.00 0.00 ? 25  ASN A H    6  
ATOM 11393 H HA   . ASN A 1 25  ? 24.942  1.830   -3.437  1.00 0.00 ? 25  ASN A HA   6  
ATOM 11394 H HB2  . ASN A 1 25  ? 23.662  -0.561  -3.257  1.00 0.00 ? 25  ASN A HB2  6  
ATOM 11395 H HB3  . ASN A 1 25  ? 23.724  -0.391  -5.009  1.00 0.00 ? 25  ASN A HB3  6  
ATOM 11396 H HD21 . ASN A 1 25  ? 25.357  -2.093  -5.206  1.00 0.00 ? 25  ASN A HD21 6  
ATOM 11397 H HD22 . ASN A 1 25  ? 26.962  -1.832  -4.718  1.00 0.00 ? 25  ASN A HD22 6  
ATOM 11398 N N    . VAL A 1 26  ? 24.064  3.388   -5.335  1.00 0.00 ? 26  VAL A N    6  
ATOM 11399 C CA   . VAL A 1 26  ? 23.892  4.187   -6.590  1.00 0.00 ? 26  VAL A CA   6  
ATOM 11400 C C    . VAL A 1 26  ? 22.406  4.501   -6.796  1.00 0.00 ? 26  VAL A C    6  
ATOM 11401 O O    . VAL A 1 26  ? 22.061  5.318   -7.629  1.00 0.00 ? 26  VAL A O    6  
ATOM 11402 C CB   . VAL A 1 26  ? 24.447  3.476   -7.836  1.00 0.00 ? 26  VAL A CB   6  
ATOM 11403 C CG1  . VAL A 1 26  ? 24.386  4.434   -9.023  1.00 0.00 ? 26  VAL A CG1  6  
ATOM 11404 C CG2  . VAL A 1 26  ? 25.898  3.060   -7.585  1.00 0.00 ? 26  VAL A CG2  6  
ATOM 11405 H H    . VAL A 1 26  ? 24.251  3.864   -4.498  1.00 0.00 ? 26  VAL A H    6  
ATOM 11406 H HA   . VAL A 1 26  ? 24.414  5.124   -6.457  1.00 0.00 ? 26  VAL A HA   6  
ATOM 11407 H HB   . VAL A 1 26  ? 23.849  2.607   -8.058  1.00 0.00 ? 26  VAL A HB   6  
ATOM 11408 H HG11 . VAL A 1 26  ? 24.572  5.441   -8.681  1.00 0.00 ? 26  VAL A HG11 6  
ATOM 11409 H HG12 . VAL A 1 26  ? 25.132  4.155   -9.750  1.00 0.00 ? 26  VAL A HG12 6  
ATOM 11410 H HG13 . VAL A 1 26  ? 23.405  4.383   -9.474  1.00 0.00 ? 26  VAL A HG13 6  
ATOM 11411 H HG21 . VAL A 1 26  ? 26.407  3.841   -7.040  1.00 0.00 ? 26  VAL A HG21 6  
ATOM 11412 H HG22 . VAL A 1 26  ? 25.916  2.147   -7.009  1.00 0.00 ? 26  VAL A HG22 6  
ATOM 11413 H HG23 . VAL A 1 26  ? 26.394  2.899   -8.531  1.00 0.00 ? 26  VAL A HG23 6  
ATOM 11414 N N    . MET A 1 27  ? 21.517  3.902   -6.022  1.00 0.00 ? 27  MET A N    6  
ATOM 11415 C CA   . MET A 1 27  ? 20.075  4.221   -6.161  1.00 0.00 ? 27  MET A CA   6  
ATOM 11416 C C    . MET A 1 27  ? 19.925  5.684   -5.759  1.00 0.00 ? 27  MET A C    6  
ATOM 11417 O O    . MET A 1 27  ? 19.654  6.535   -6.584  1.00 0.00 ? 27  MET A O    6  
ATOM 11418 C CB   . MET A 1 27  ? 19.248  3.328   -5.223  1.00 0.00 ? 27  MET A CB   6  
ATOM 11419 C CG   . MET A 1 27  ? 19.653  1.851   -5.386  1.00 0.00 ? 27  MET A CG   6  
ATOM 11420 S SD   . MET A 1 27  ? 18.402  0.969   -6.357  1.00 0.00 ? 27  MET A SD   6  
ATOM 11421 C CE   . MET A 1 27  ? 19.472  -0.368  -6.943  1.00 0.00 ? 27  MET A CE   6  
ATOM 11422 H H    . MET A 1 27  ? 21.797  3.275   -5.333  1.00 0.00 ? 27  MET A H    6  
ATOM 11423 H HA   . MET A 1 27  ? 19.756  4.085   -7.190  1.00 0.00 ? 27  MET A HA   6  
ATOM 11424 H HB2  . MET A 1 27  ? 19.418  3.629   -4.200  1.00 0.00 ? 27  MET A HB2  6  
ATOM 11425 H HB3  . MET A 1 27  ? 18.205  3.442   -5.456  1.00 0.00 ? 27  MET A HB3  6  
ATOM 11426 H HG2  . MET A 1 27  ? 20.604  1.785   -5.889  1.00 0.00 ? 27  MET A HG2  6  
ATOM 11427 H HG3  . MET A 1 27  ? 19.736  1.394   -4.410  1.00 0.00 ? 27  MET A HG3  6  
ATOM 11428 H HE1  . MET A 1 27  ? 20.322  -0.464  -6.287  1.00 0.00 ? 27  MET A HE1  6  
ATOM 11429 H HE2  . MET A 1 27  ? 18.917  -1.296  -6.949  1.00 0.00 ? 27  MET A HE2  6  
ATOM 11430 H HE3  . MET A 1 27  ? 19.815  -0.141  -7.943  1.00 0.00 ? 27  MET A HE3  6  
ATOM 11431 N N    . LEU A 1 28  ? 20.165  5.989   -4.497  1.00 0.00 ? 28  LEU A N    6  
ATOM 11432 C CA   . LEU A 1 28  ? 20.102  7.408   -4.021  1.00 0.00 ? 28  LEU A CA   6  
ATOM 11433 C C    . LEU A 1 28  ? 18.836  8.092   -4.552  1.00 0.00 ? 28  LEU A C    6  
ATOM 11434 O O    . LEU A 1 28  ? 18.896  8.922   -5.439  1.00 0.00 ? 28  LEU A O    6  
ATOM 11435 C CB   . LEU A 1 28  ? 21.357  8.119   -4.537  1.00 0.00 ? 28  LEU A CB   6  
ATOM 11436 C CG   . LEU A 1 28  ? 22.387  8.289   -3.408  1.00 0.00 ? 28  LEU A CG   6  
ATOM 11437 C CD1  . LEU A 1 28  ? 21.791  9.127   -2.267  1.00 0.00 ? 28  LEU A CD1  6  
ATOM 11438 C CD2  . LEU A 1 28  ? 22.801  6.910   -2.877  1.00 0.00 ? 28  LEU A CD2  6  
ATOM 11439 H H    . LEU A 1 28  ? 20.429  5.285   -3.871  1.00 0.00 ? 28  LEU A H    6  
ATOM 11440 H HA   . LEU A 1 28  ? 20.097  7.429   -2.949  1.00 0.00 ? 28  LEU A HA   6  
ATOM 11441 H HB2  . LEU A 1 28  ? 21.797  7.521   -5.327  1.00 0.00 ? 28  LEU A HB2  6  
ATOM 11442 H HB3  . LEU A 1 28  ? 21.088  9.082   -4.925  1.00 0.00 ? 28  LEU A HB3  6  
ATOM 11443 H HG   . LEU A 1 28  ? 23.257  8.796   -3.799  1.00 0.00 ? 28  LEU A HG   6  
ATOM 11444 H HD11 . LEU A 1 28  ? 20.727  9.235   -2.414  1.00 0.00 ? 28  LEU A HD11 6  
ATOM 11445 H HD12 . LEU A 1 28  ? 21.977  8.638   -1.321  1.00 0.00 ? 28  LEU A HD12 6  
ATOM 11446 H HD13 . LEU A 1 28  ? 22.253  10.102  -2.262  1.00 0.00 ? 28  LEU A HD13 6  
ATOM 11447 H HD21 . LEU A 1 28  ? 23.141  6.296   -3.698  1.00 0.00 ? 28  LEU A HD21 6  
ATOM 11448 H HD22 . LEU A 1 28  ? 23.599  7.026   -2.159  1.00 0.00 ? 28  LEU A HD22 6  
ATOM 11449 H HD23 . LEU A 1 28  ? 21.954  6.439   -2.402  1.00 0.00 ? 28  LEU A HD23 6  
ATOM 11450 N N    . ARG A 1 29  ? 17.686  7.705   -4.050  1.00 0.00 ? 29  ARG A N    6  
ATOM 11451 C CA   . ARG A 1 29  ? 16.405  8.285   -4.567  1.00 0.00 ? 29  ARG A CA   6  
ATOM 11452 C C    . ARG A 1 29  ? 16.288  7.933   -6.063  1.00 0.00 ? 29  ARG A C    6  
ATOM 11453 O O    . ARG A 1 29  ? 15.586  8.581   -6.813  1.00 0.00 ? 29  ARG A O    6  
ATOM 11454 C CB   . ARG A 1 29  ? 16.407  9.814   -4.401  1.00 0.00 ? 29  ARG A CB   6  
ATOM 11455 C CG   . ARG A 1 29  ? 16.902  10.192  -3.001  1.00 0.00 ? 29  ARG A CG   6  
ATOM 11456 C CD   . ARG A 1 29  ? 16.592  11.667  -2.730  1.00 0.00 ? 29  ARG A CD   6  
ATOM 11457 N NE   . ARG A 1 29  ? 17.119  12.049  -1.389  1.00 0.00 ? 29  ARG A NE   6  
ATOM 11458 C CZ   . ARG A 1 29  ? 17.745  13.184  -1.232  1.00 0.00 ? 29  ARG A CZ   6  
ATOM 11459 N NH1  . ARG A 1 29  ? 17.219  14.288  -1.688  1.00 0.00 ? 29  ARG A NH1  6  
ATOM 11460 N NH2  . ARG A 1 29  ? 18.896  13.215  -0.619  1.00 0.00 ? 29  ARG A NH2  6  
ATOM 11461 H H    . ARG A 1 29  ? 17.664  7.005   -3.364  1.00 0.00 ? 29  ARG A H    6  
ATOM 11462 H HA   . ARG A 1 29  ? 15.570  7.858   -4.028  1.00 0.00 ? 29  ARG A HA   6  
ATOM 11463 H HB2  . ARG A 1 29  ? 17.059  10.253  -5.143  1.00 0.00 ? 29  ARG A HB2  6  
ATOM 11464 H HB3  . ARG A 1 29  ? 15.404  10.190  -4.539  1.00 0.00 ? 29  ARG A HB3  6  
ATOM 11465 H HG2  . ARG A 1 29  ? 16.407  9.576   -2.265  1.00 0.00 ? 29  ARG A HG2  6  
ATOM 11466 H HG3  . ARG A 1 29  ? 17.969  10.035  -2.942  1.00 0.00 ? 29  ARG A HG3  6  
ATOM 11467 H HD2  . ARG A 1 29  ? 17.059  12.278  -3.487  1.00 0.00 ? 29  ARG A HD2  6  
ATOM 11468 H HD3  . ARG A 1 29  ? 15.523  11.820  -2.753  1.00 0.00 ? 29  ARG A HD3  6  
ATOM 11469 H HE   . ARG A 1 29  ? 16.996  11.448  -0.625  1.00 0.00 ? 29  ARG A HE   6  
ATOM 11470 H HH11 . ARG A 1 29  ? 16.336  14.265  -2.158  1.00 0.00 ? 29  ARG A HH11 6  
ATOM 11471 H HH12 . ARG A 1 29  ? 17.699  15.157  -1.567  1.00 0.00 ? 29  ARG A HH12 6  
ATOM 11472 H HH21 . ARG A 1 29  ? 19.300  12.370  -0.270  1.00 0.00 ? 29  ARG A HH21 6  
ATOM 11473 H HH22 . ARG A 1 29  ? 19.375  14.085  -0.499  1.00 0.00 ? 29  ARG A HH22 6  
ATOM 11474 N N    . LYS A 1 30  ? 17.001  6.907   -6.492  1.00 0.00 ? 30  LYS A N    6  
ATOM 11475 C CA   . LYS A 1 30  ? 16.998  6.470   -7.921  1.00 0.00 ? 30  LYS A CA   6  
ATOM 11476 C C    . LYS A 1 30  ? 17.119  7.660   -8.881  1.00 0.00 ? 30  LYS A C    6  
ATOM 11477 O O    . LYS A 1 30  ? 16.710  7.576   -10.022 1.00 0.00 ? 30  LYS A O    6  
ATOM 11478 C CB   . LYS A 1 30  ? 15.732  5.667   -8.212  1.00 0.00 ? 30  LYS A CB   6  
ATOM 11479 C CG   . LYS A 1 30  ? 16.051  4.171   -8.101  1.00 0.00 ? 30  LYS A CG   6  
ATOM 11480 C CD   . LYS A 1 30  ? 14.790  3.353   -8.388  1.00 0.00 ? 30  LYS A CD   6  
ATOM 11481 C CE   . LYS A 1 30  ? 15.151  1.868   -8.461  1.00 0.00 ? 30  LYS A CE   6  
ATOM 11482 N NZ   . LYS A 1 30  ? 15.440  1.496   -9.875  1.00 0.00 ? 30  LYS A NZ   6  
ATOM 11483 H H    . LYS A 1 30  ? 17.557  6.415   -5.860  1.00 0.00 ? 30  LYS A H    6  
ATOM 11484 H HA   . LYS A 1 30  ? 17.848  5.834   -8.077  1.00 0.00 ? 30  LYS A HA   6  
ATOM 11485 H HB2  . LYS A 1 30  ? 14.971  5.927   -7.494  1.00 0.00 ? 30  LYS A HB2  6  
ATOM 11486 H HB3  . LYS A 1 30  ? 15.384  5.887   -9.209  1.00 0.00 ? 30  LYS A HB3  6  
ATOM 11487 H HG2  . LYS A 1 30  ? 16.821  3.914   -8.816  1.00 0.00 ? 30  LYS A HG2  6  
ATOM 11488 H HG3  . LYS A 1 30  ? 16.403  3.951   -7.104  1.00 0.00 ? 30  LYS A HG3  6  
ATOM 11489 H HD2  . LYS A 1 30  ? 14.071  3.512   -7.598  1.00 0.00 ? 30  LYS A HD2  6  
ATOM 11490 H HD3  . LYS A 1 30  ? 14.365  3.665   -9.330  1.00 0.00 ? 30  LYS A HD3  6  
ATOM 11491 H HE2  . LYS A 1 30  ? 16.024  1.680   -7.854  1.00 0.00 ? 30  LYS A HE2  6  
ATOM 11492 H HE3  . LYS A 1 30  ? 14.324  1.278   -8.095  1.00 0.00 ? 30  LYS A HE3  6  
ATOM 11493 H HZ1  . LYS A 1 30  ? 16.018  2.238   -10.318 1.00 0.00 ? 30  LYS A HZ1  6  
ATOM 11494 H HZ2  . LYS A 1 30  ? 15.959  0.596   -9.898  1.00 0.00 ? 30  LYS A HZ2  6  
ATOM 11495 H HZ3  . LYS A 1 30  ? 14.545  1.395   -10.396 1.00 0.00 ? 30  LYS A HZ3  6  
ATOM 11496 N N    . ILE A 1 31  ? 17.719  8.750   -8.424  1.00 0.00 ? 31  ILE A N    6  
ATOM 11497 C CA   . ILE A 1 31  ? 17.936  9.980   -9.274  1.00 0.00 ? 31  ILE A CA   6  
ATOM 11498 C C    . ILE A 1 31  ? 16.787  10.188  -10.276 1.00 0.00 ? 31  ILE A C    6  
ATOM 11499 O O    . ILE A 1 31  ? 16.981  10.198  -11.476 1.00 0.00 ? 31  ILE A O    6  
ATOM 11500 C CB   . ILE A 1 31  ? 19.267  9.844   -10.016 1.00 0.00 ? 31  ILE A CB   6  
ATOM 11501 C CG1  . ILE A 1 31  ? 20.363  9.354   -9.043  1.00 0.00 ? 31  ILE A CG1  6  
ATOM 11502 C CG2  . ILE A 1 31  ? 19.661  11.205  -10.586 1.00 0.00 ? 31  ILE A CG2  6  
ATOM 11503 C CD1  . ILE A 1 31  ? 20.713  7.896   -9.353  1.00 0.00 ? 31  ILE A CD1  6  
ATOM 11504 H H    . ILE A 1 31  ? 18.063  8.753   -7.511  1.00 0.00 ? 31  ILE A H    6  
ATOM 11505 H HA   . ILE A 1 31  ? 17.990  10.839  -8.629  1.00 0.00 ? 31  ILE A HA   6  
ATOM 11506 H HB   . ILE A 1 31  ? 19.151  9.139   -10.821 1.00 0.00 ? 31  ILE A HB   6  
ATOM 11507 H HG12 . ILE A 1 31  ? 21.247  9.965   -9.149  1.00 0.00 ? 31  ILE A HG12 6  
ATOM 11508 H HG13 . ILE A 1 31  ? 20.001  9.423   -8.025  1.00 0.00 ? 31  ILE A HG13 6  
ATOM 11509 H HG21 . ILE A 1 31  ? 18.870  11.571  -11.222 1.00 0.00 ? 31  ILE A HG21 6  
ATOM 11510 H HG22 . ILE A 1 31  ? 19.823  11.900  -9.775  1.00 0.00 ? 31  ILE A HG22 6  
ATOM 11511 H HG23 . ILE A 1 31  ? 20.569  11.105  -11.161 1.00 0.00 ? 31  ILE A HG23 6  
ATOM 11512 H HD11 . ILE A 1 31  ? 20.561  7.705   -10.404 1.00 0.00 ? 31  ILE A HD11 6  
ATOM 11513 H HD12 . ILE A 1 31  ? 21.747  7.713   -9.099  1.00 0.00 ? 31  ILE A HD12 6  
ATOM 11514 H HD13 . ILE A 1 31  ? 20.079  7.243   -8.772  1.00 0.00 ? 31  ILE A HD13 6  
ATOM 11515 N N    . ALA A 1 32  ? 15.590  10.337  -9.773  1.00 0.00 ? 32  ALA A N    6  
ATOM 11516 C CA   . ALA A 1 32  ? 14.393  10.527  -10.656 1.00 0.00 ? 32  ALA A CA   6  
ATOM 11517 C C    . ALA A 1 32  ? 13.123  10.437  -9.803  1.00 0.00 ? 32  ALA A C    6  
ATOM 11518 O O    . ALA A 1 32  ? 12.130  11.075  -10.093 1.00 0.00 ? 32  ALA A O    6  
ATOM 11519 C CB   . ALA A 1 32  ? 14.346  9.436   -11.735 1.00 0.00 ? 32  ALA A CB   6  
ATOM 11520 H H    . ALA A 1 32  ? 15.477  10.318  -8.801  1.00 0.00 ? 32  ALA A H    6  
ATOM 11521 H HA   . ALA A 1 32  ? 14.443  11.499  -11.126 1.00 0.00 ? 32  ALA A HA   6  
ATOM 11522 H HB1  . ALA A 1 32  ? 14.758  8.520   -11.338 1.00 0.00 ? 32  ALA A HB1  6  
ATOM 11523 H HB2  . ALA A 1 32  ? 13.322  9.270   -12.035 1.00 0.00 ? 32  ALA A HB2  6  
ATOM 11524 H HB3  . ALA A 1 32  ? 14.925  9.750   -12.590 1.00 0.00 ? 32  ALA A HB3  6  
ATOM 11525 N N    . VAL A 1 33  ? 13.158  9.638   -8.752  1.00 0.00 ? 33  VAL A N    6  
ATOM 11526 C CA   . VAL A 1 33  ? 11.975  9.464   -7.834  1.00 0.00 ? 33  VAL A CA   6  
ATOM 11527 C C    . VAL A 1 33  ? 11.261  10.807  -7.579  1.00 0.00 ? 33  VAL A C    6  
ATOM 11528 O O    . VAL A 1 33  ? 11.848  11.867  -7.681  1.00 0.00 ? 33  VAL A O    6  
ATOM 11529 C CB   . VAL A 1 33  ? 12.487  8.885   -6.503  1.00 0.00 ? 33  VAL A CB   6  
ATOM 11530 C CG1  . VAL A 1 33  ? 11.358  8.817   -5.467  1.00 0.00 ? 33  VAL A CG1  6  
ATOM 11531 C CG2  . VAL A 1 33  ? 13.030  7.473   -6.744  1.00 0.00 ? 33  VAL A CG2  6  
ATOM 11532 H H    . VAL A 1 33  ? 13.979  9.133   -8.564  1.00 0.00 ? 33  VAL A H    6  
ATOM 11533 H HA   . VAL A 1 33  ? 11.275  8.768   -8.274  1.00 0.00 ? 33  VAL A HA   6  
ATOM 11534 H HB   . VAL A 1 33  ? 13.281  9.513   -6.123  1.00 0.00 ? 33  VAL A HB   6  
ATOM 11535 H HG11 . VAL A 1 33  ? 10.939  9.801   -5.324  1.00 0.00 ? 33  VAL A HG11 6  
ATOM 11536 H HG12 . VAL A 1 33  ? 10.588  8.144   -5.816  1.00 0.00 ? 33  VAL A HG12 6  
ATOM 11537 H HG13 . VAL A 1 33  ? 11.753  8.456   -4.529  1.00 0.00 ? 33  VAL A HG13 6  
ATOM 11538 H HG21 . VAL A 1 33  ? 13.769  7.498   -7.529  1.00 0.00 ? 33  VAL A HG21 6  
ATOM 11539 H HG22 . VAL A 1 33  ? 13.483  7.101   -5.836  1.00 0.00 ? 33  VAL A HG22 6  
ATOM 11540 H HG23 . VAL A 1 33  ? 12.222  6.822   -7.035  1.00 0.00 ? 33  VAL A HG23 6  
ATOM 11541 N N    . ALA A 1 34  ? 9.995   10.749  -7.248  1.00 0.00 ? 34  ALA A N    6  
ATOM 11542 C CA   . ALA A 1 34  ? 9.216   11.993  -6.980  1.00 0.00 ? 34  ALA A CA   6  
ATOM 11543 C C    . ALA A 1 34  ? 9.202   12.871  -8.237  1.00 0.00 ? 34  ALA A C    6  
ATOM 11544 O O    . ALA A 1 34  ? 9.871   13.886  -8.306  1.00 0.00 ? 34  ALA A O    6  
ATOM 11545 C CB   . ALA A 1 34  ? 9.853   12.763  -5.818  1.00 0.00 ? 34  ALA A CB   6  
ATOM 11546 H H    . ALA A 1 34  ? 9.554   9.877   -7.175  1.00 0.00 ? 34  ALA A H    6  
ATOM 11547 H HA   . ALA A 1 34  ? 8.202   11.724  -6.719  1.00 0.00 ? 34  ALA A HA   6  
ATOM 11548 H HB1  . ALA A 1 34  ? 10.902  12.515  -5.754  1.00 0.00 ? 34  ALA A HB1  6  
ATOM 11549 H HB2  . ALA A 1 34  ? 9.743   13.824  -5.986  1.00 0.00 ? 34  ALA A HB2  6  
ATOM 11550 H HB3  . ALA A 1 34  ? 9.363   12.492  -4.895  1.00 0.00 ? 34  ALA A HB3  6  
ATOM 11551 N N    . ALA A 1 35  ? 8.444   12.482  -9.231  1.00 0.00 ? 35  ALA A N    6  
ATOM 11552 C CA   . ALA A 1 35  ? 8.379   13.282  -10.489 1.00 0.00 ? 35  ALA A CA   6  
ATOM 11553 C C    . ALA A 1 35  ? 7.788   14.663  -10.191 1.00 0.00 ? 35  ALA A C    6  
ATOM 11554 O O    . ALA A 1 35  ? 8.492   15.654  -10.166 1.00 0.00 ? 35  ALA A O    6  
ATOM 11555 C CB   . ALA A 1 35  ? 7.497   12.557  -11.508 1.00 0.00 ? 35  ALA A CB   6  
ATOM 11556 H H    . ALA A 1 35  ? 7.917   11.660  -9.149  1.00 0.00 ? 35  ALA A H    6  
ATOM 11557 H HA   . ALA A 1 35  ? 9.374   13.397  -10.893 1.00 0.00 ? 35  ALA A HA   6  
ATOM 11558 H HB1  . ALA A 1 35  ? 6.730   12.001  -10.990 1.00 0.00 ? 35  ALA A HB1  6  
ATOM 11559 H HB2  . ALA A 1 35  ? 7.035   13.281  -12.164 1.00 0.00 ? 35  ALA A H