data_1BMZ
# 
_entry.id   1BMZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BMZ         
RCSB  RCSB008115   
WWPDB D_1000008115 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BMZ 
_pdbx_database_status.recvd_initial_deposition_date   1998-07-27 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Klabunde, T.'      1 
'Kelly, J.W.'       2 
'Sacchettini, J.C.' 3 
# 
_citation.id                        primary 
_citation.title                     'Inhibiting transthyretin conformational changes that lead to amyloid fibril formation.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            95 
_citation.page_first                12956 
_citation.page_last                 12960 
_citation.year                      1998 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9789022 
_citation.pdbx_database_id_DOI      10.1073/pnas.95.22.12956 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Peterson, S.A.'    1 
primary 'Klabunde, T.'      2 
primary 'Lashuel, H.A.'     3 
primary 'Purkey, H.'        4 
primary 'Sacchettini, J.C.' 5 
primary 'Kelly, J.W.'       6 
# 
_cell.entry_id           1BMZ 
_cell.length_a           42.850 
_cell.length_b           85.800 
_cell.length_c           64.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BMZ 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PROTEIN (TRANSTHYRETIN)' 13777.360 2  ? ? ? ? 
2 water   nat water                     18.015    52 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PREALBUMIN, TBPA, TTR, ATTR' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWK
ALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWK
ALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   THR n 
1 4   GLY n 
1 5   THR n 
1 6   GLY n 
1 7   GLU n 
1 8   SER n 
1 9   LYS n 
1 10  CYS n 
1 11  PRO n 
1 12  LEU n 
1 13  MET n 
1 14  VAL n 
1 15  LYS n 
1 16  VAL n 
1 17  LEU n 
1 18  ASP n 
1 19  ALA n 
1 20  VAL n 
1 21  ARG n 
1 22  GLY n 
1 23  SER n 
1 24  PRO n 
1 25  ALA n 
1 26  ILE n 
1 27  ASN n 
1 28  VAL n 
1 29  ALA n 
1 30  VAL n 
1 31  HIS n 
1 32  VAL n 
1 33  PHE n 
1 34  ARG n 
1 35  LYS n 
1 36  ALA n 
1 37  ALA n 
1 38  ASP n 
1 39  ASP n 
1 40  THR n 
1 41  TRP n 
1 42  GLU n 
1 43  PRO n 
1 44  PHE n 
1 45  ALA n 
1 46  SER n 
1 47  GLY n 
1 48  LYS n 
1 49  THR n 
1 50  SER n 
1 51  GLU n 
1 52  SER n 
1 53  GLY n 
1 54  GLU n 
1 55  LEU n 
1 56  HIS n 
1 57  GLY n 
1 58  LEU n 
1 59  THR n 
1 60  THR n 
1 61  GLU n 
1 62  GLU n 
1 63  GLU n 
1 64  PHE n 
1 65  VAL n 
1 66  GLU n 
1 67  GLY n 
1 68  ILE n 
1 69  TYR n 
1 70  LYS n 
1 71  VAL n 
1 72  GLU n 
1 73  ILE n 
1 74  ASP n 
1 75  THR n 
1 76  LYS n 
1 77  SER n 
1 78  TYR n 
1 79  TRP n 
1 80  LYS n 
1 81  ALA n 
1 82  LEU n 
1 83  GLY n 
1 84  ILE n 
1 85  SER n 
1 86  PRO n 
1 87  PHE n 
1 88  HIS n 
1 89  GLU n 
1 90  HIS n 
1 91  ALA n 
1 92  GLU n 
1 93  VAL n 
1 94  VAL n 
1 95  PHE n 
1 96  THR n 
1 97  ALA n 
1 98  ASN n 
1 99  ASP n 
1 100 SER n 
1 101 GLY n 
1 102 PRO n 
1 103 ARG n 
1 104 ARG n 
1 105 TYR n 
1 106 THR n 
1 107 ILE n 
1 108 ALA n 
1 109 ALA n 
1 110 LEU n 
1 111 LEU n 
1 112 SER n 
1 113 PRO n 
1 114 TYR n 
1 115 SER n 
1 116 TYR n 
1 117 SER n 
1 118 THR n 
1 119 THR n 
1 120 ALA n 
1 121 VAL n 
1 122 VAL n 
1 123 THR n 
1 124 ASN n 
1 125 PRO n 
1 126 LYS n 
1 127 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                PLASMA 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TTHY_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P02766 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BMZ A 10 ? 123 ? P02766 30 ? 143 ? 10 123 
2 1 1BMZ B 10 ? 123 ? P02766 30 ? 143 ? 10 123 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1BMZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.16 
_exptl_crystal.density_percent_sol   43.06 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    'pH 7.4' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MACSCIENCE 
_diffrn_detector.pdbx_collection_date   1998-05-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BMZ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   16218 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.0520000 
_reflns.pdbx_Rsym_value              5.2000000 
_reflns.pdbx_netI_over_sigmaI        13.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   84.0 
_reflns_shell.Rmerge_I_obs           0.1170000 
_reflns_shell.pdbx_Rsym_value        11.7000000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1BMZ 
_refine.ls_number_reflns_obs                     14732 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    91.7 
_refine.ls_R_factor_obs                          0.1830000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1830000 
_refine.ls_R_factor_R_free                       0.2440000 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  1462 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               29.6 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1762 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             52 
_refine_hist.number_atoms_total               1814 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        6.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   RESTRAINTS 
_refine_ls_restr_ncs.rms_dev_position    0.1218 
_refine_ls_restr_ncs.weight_position     100 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.03 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.2220000 
_refine_ls_shell.percent_reflns_obs               70.8 
_refine_ls_shell.R_factor_R_free                  0.3000000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10.0 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       PARHCSDX.PRO 
_pdbx_xplor_file.topol_file       TOPHCSDX.PRO 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.985414 
_struct_ncs_oper.matrix[1][2]   0.170065 
_struct_ncs_oper.matrix[1][3]   0.006154 
_struct_ncs_oper.matrix[2][1]   0.169995 
_struct_ncs_oper.matrix[2][2]   0.985389 
_struct_ncs_oper.matrix[2][3]   -0.010495 
_struct_ncs_oper.matrix[3][1]   -0.007849 
_struct_ncs_oper.matrix[3][2]   -0.009296 
_struct_ncs_oper.matrix[3][3]   -0.999926 
_struct_ncs_oper.vector[1]      35.02380 
_struct_ncs_oper.vector[2]      -2.81610 
_struct_ncs_oper.vector[3]      32.60050 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1BMZ 
_struct.title                     'HUMAN TRANSTHYRETIN (PREALBUMIN)' 
_struct.pdbx_descriptor           TRANSTHYRETIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BMZ 
_struct_keywords.pdbx_keywords   'HORMONE/GROWTH FACTOR' 
_struct_keywords.text            'THYROXINE TRANSPORT, HORMONE-GROWTH FACTOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 75 ? ALA A 81 ? THR A 75 ALA A 81 1 ? 7 
HELX_P HELX_P2 2 THR B 75 ? ALA B 81 ? THR B 75 ALA B 81 1 ? 7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 3 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 12  ? ASP A 18  ? LEU A 12  ASP A 18  
A 2 ARG A 104 ? SER A 112 ? ARG A 104 SER A 112 
A 3 SER A 115 ? THR A 123 ? SER A 115 THR A 123 
B 1 ALA A 91  ? ALA A 97  ? ALA A 91  ALA A 97  
B 2 GLY A 67  ? ILE A 73  ? GLY A 67  ILE A 73  
B 3 ALA A 29  ? LYS A 35  ? ALA A 29  LYS A 35  
B 4 TRP A 41  ? LYS A 48  ? TRP A 41  LYS A 48  
C 1 LEU B 12  ? ASP B 18  ? LEU B 12  ASP B 18  
C 2 ARG B 104 ? SER B 112 ? ARG B 104 SER B 112 
C 3 SER B 115 ? THR B 123 ? SER B 115 THR B 123 
D 1 ALA B 91  ? ALA B 97  ? ALA B 91  ALA B 97  
D 2 GLY B 67  ? ILE B 73  ? GLY B 67  ILE B 73  
D 3 ALA B 29  ? LYS B 35  ? ALA B 29  LYS B 35  
D 4 TRP B 41  ? LYS B 48  ? TRP B 41  LYS B 48  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MET A 13  ? O MET A 13  N TYR A 105 ? N TYR A 105 
A 2 3 O ARG A 104 ? O ARG A 104 N THR A 123 ? N THR A 123 
B 1 2 O ALA A 91  ? O ALA A 91  N ILE A 73  ? N ILE A 73  
B 2 3 O LYS A 70  ? O LYS A 70  N PHE A 33  ? N PHE A 33  
B 3 4 O VAL A 30  ? O VAL A 30  N GLY A 47  ? N GLY A 47  
C 1 2 O MET B 13  ? O MET B 13  N TYR B 105 ? N TYR B 105 
C 2 3 O ARG B 104 ? O ARG B 104 N THR B 123 ? N THR B 123 
D 1 2 O ALA B 91  ? O ALA B 91  N ILE B 73  ? N ILE B 73  
D 2 3 O LYS B 70  ? O LYS B 70  N PHE B 33  ? N PHE B 33  
D 3 4 O VAL B 30  ? O VAL B 30  N GLY B 47  ? N GLY B 47  
# 
_database_PDB_matrix.entry_id          1BMZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BMZ 
_atom_sites.fract_transf_matrix[1][1]   0.023337 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011655 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015432 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 10  ? 14.671 31.135 -7.575  1.00 43.27 ? 10  CYS A N   1 
ATOM   2    C CA  . CYS A 1 10  ? 15.517 31.095 -6.343  1.00 39.26 ? 10  CYS A CA  1 
ATOM   3    C C   . CYS A 1 10  ? 14.618 31.334 -5.152  1.00 33.71 ? 10  CYS A C   1 
ATOM   4    O O   . CYS A 1 10  ? 14.426 32.459 -4.713  1.00 31.78 ? 10  CYS A O   1 
ATOM   5    C CB  . CYS A 1 10  ? 16.607 32.174 -6.379  1.00 43.36 ? 10  CYS A CB  1 
ATOM   6    S SG  . CYS A 1 10  ? 18.238 31.649 -5.683  1.00 50.79 ? 10  CYS A SG  1 
ATOM   7    N N   . PRO A 1 11  ? 14.007 30.273 -4.640  1.00 29.70 ? 11  PRO A N   1 
ATOM   8    C CA  . PRO A 1 11  ? 13.135 30.510 -3.493  1.00 25.39 ? 11  PRO A CA  1 
ATOM   9    C C   . PRO A 1 11  ? 13.835 30.601 -2.168  1.00 23.31 ? 11  PRO A C   1 
ATOM   10   O O   . PRO A 1 11  ? 13.216 30.950 -1.200  1.00 22.61 ? 11  PRO A O   1 
ATOM   11   C CB  . PRO A 1 11  ? 12.203 29.310 -3.528  1.00 24.90 ? 11  PRO A CB  1 
ATOM   12   C CG  . PRO A 1 11  ? 13.072 28.266 -4.031  1.00 25.17 ? 11  PRO A CG  1 
ATOM   13   C CD  . PRO A 1 11  ? 13.831 28.909 -5.160  1.00 24.92 ? 11  PRO A CD  1 
ATOM   14   N N   . LEU A 1 12  ? 15.118 30.271 -2.105  1.00 23.84 ? 12  LEU A N   1 
ATOM   15   C CA  . LEU A 1 12  ? 15.857 30.307 -0.828  1.00 22.76 ? 12  LEU A CA  1 
ATOM   16   C C   . LEU A 1 12  ? 17.263 30.834 -1.075  1.00 24.35 ? 12  LEU A C   1 
ATOM   17   O O   . LEU A 1 12  ? 18.032 30.202 -1.816  1.00 27.87 ? 12  LEU A O   1 
ATOM   18   C CB  . LEU A 1 12  ? 15.923 28.908 -0.193  1.00 18.71 ? 12  LEU A CB  1 
ATOM   19   C CG  . LEU A 1 12  ? 16.760 28.724 1.079   1.00 22.04 ? 12  LEU A CG  1 
ATOM   20   C CD1 . LEU A 1 12  ? 16.164 29.532 2.210   1.00 18.45 ? 12  LEU A CD1 1 
ATOM   21   C CD2 . LEU A 1 12  ? 16.838 27.217 1.450   1.00 21.76 ? 12  LEU A CD2 1 
ATOM   22   N N   . MET A 1 13  ? 17.581 31.978 -0.460  1.00 21.03 ? 13  MET A N   1 
ATOM   23   C CA  . MET A 1 13  ? 18.866 32.645 -0.615  1.00 22.29 ? 13  MET A CA  1 
ATOM   24   C C   . MET A 1 13  ? 19.435 32.964 0.761   1.00 18.44 ? 13  MET A C   1 
ATOM   25   O O   . MET A 1 13  ? 18.696 33.253 1.707   1.00 16.99 ? 13  MET A O   1 
ATOM   26   C CB  . MET A 1 13  ? 18.667 33.920 -1.439  1.00 27.14 ? 13  MET A CB  1 
ATOM   27   C CG  . MET A 1 13  ? 19.866 34.396 -2.226  1.00 44.30 ? 13  MET A CG  1 
ATOM   28   S SD  . MET A 1 13  ? 20.891 35.692 -1.418  1.00 63.31 ? 13  MET A SD  1 
ATOM   29   C CE  . MET A 1 13  ? 19.862 37.195 -1.613  1.00 57.20 ? 13  MET A CE  1 
ATOM   30   N N   . VAL A 1 14  ? 20.750 32.877 0.890   1.00 17.70 ? 14  VAL A N   1 
ATOM   31   C CA  . VAL A 1 14  ? 21.384 33.149 2.169   1.00 14.79 ? 14  VAL A CA  1 
ATOM   32   C C   . VAL A 1 14  ? 22.450 34.191 1.941   1.00 17.67 ? 14  VAL A C   1 
ATOM   33   O O   . VAL A 1 14  ? 23.170 34.143 0.951   1.00 17.37 ? 14  VAL A O   1 
ATOM   34   C CB  . VAL A 1 14  ? 21.995 31.859 2.784   1.00 16.77 ? 14  VAL A CB  1 
ATOM   35   C CG1 . VAL A 1 14  ? 22.670 32.177 4.097   1.00 17.92 ? 14  VAL A CG1 1 
ATOM   36   C CG2 . VAL A 1 14  ? 20.908 30.817 3.000   1.00 15.42 ? 14  VAL A CG2 1 
ATOM   37   N N   . LYS A 1 15  ? 22.502 35.174 2.834   1.00 17.81 ? 15  LYS A N   1 
ATOM   38   C CA  . LYS A 1 15  ? 23.473 36.261 2.739   1.00 18.27 ? 15  LYS A CA  1 
ATOM   39   C C   . LYS A 1 15  ? 24.147 36.415 4.101   1.00 17.80 ? 15  LYS A C   1 
ATOM   40   O O   . LYS A 1 15  ? 23.479 36.489 5.136   1.00 17.31 ? 15  LYS A O   1 
ATOM   41   C CB  . LYS A 1 15  ? 22.752 37.534 2.378   1.00 22.92 ? 15  LYS A CB  1 
ATOM   42   C CG  . LYS A 1 15  ? 23.579 38.457 1.588   1.00 36.52 ? 15  LYS A CG  1 
ATOM   43   C CD  . LYS A 1 15  ? 24.009 39.650 2.418   1.00 47.83 ? 15  LYS A CD  1 
ATOM   44   C CE  . LYS A 1 15  ? 24.749 40.671 1.544   1.00 49.35 ? 15  LYS A CE  1 
ATOM   45   N NZ  . LYS A 1 15  ? 25.963 40.060 0.930   1.00 54.51 ? 15  LYS A NZ  1 
ATOM   46   N N   . VAL A 1 16  ? 25.467 36.462 4.100   1.00 15.02 ? 16  VAL A N   1 
ATOM   47   C CA  . VAL A 1 16  ? 26.215 36.555 5.349   1.00 17.68 ? 16  VAL A CA  1 
ATOM   48   C C   . VAL A 1 16  ? 27.205 37.741 5.362   1.00 18.55 ? 16  VAL A C   1 
ATOM   49   O O   . VAL A 1 16  ? 27.986 37.938 4.426   1.00 16.95 ? 16  VAL A O   1 
ATOM   50   C CB  . VAL A 1 16  ? 27.015 35.220 5.611   1.00 16.31 ? 16  VAL A CB  1 
ATOM   51   C CG1 . VAL A 1 16  ? 27.599 35.227 7.035   1.00 13.25 ? 16  VAL A CG1 1 
ATOM   52   C CG2 . VAL A 1 16  ? 26.103 33.992 5.378   1.00 13.39 ? 16  VAL A CG2 1 
ATOM   53   N N   . LEU A 1 17  ? 27.178 38.522 6.426   1.00 15.63 ? 17  LEU A N   1 
ATOM   54   C CA  . LEU A 1 17  ? 28.075 39.650 6.550   1.00 12.63 ? 17  LEU A CA  1 
ATOM   55   C C   . LEU A 1 17  ? 28.980 39.544 7.796   1.00 14.93 ? 17  LEU A C   1 
ATOM   56   O O   . LEU A 1 17  ? 28.615 38.987 8.848   1.00 14.01 ? 17  LEU A O   1 
ATOM   57   C CB  . LEU A 1 17  ? 27.275 40.958 6.597   1.00 15.84 ? 17  LEU A CB  1 
ATOM   58   C CG  . LEU A 1 17  ? 26.498 41.428 5.357   1.00 18.33 ? 17  LEU A CG  1 
ATOM   59   C CD1 . LEU A 1 17  ? 25.791 42.711 5.744   1.00 17.30 ? 17  LEU A CD1 1 
ATOM   60   C CD2 . LEU A 1 17  ? 27.407 41.676 4.177   1.00 16.40 ? 17  LEU A CD2 1 
ATOM   61   N N   . ASP A 1 18  ? 30.152 40.158 7.693   1.00 14.45 ? 18  ASP A N   1 
ATOM   62   C CA  . ASP A 1 18  ? 31.131 40.164 8.762   1.00 14.97 ? 18  ASP A CA  1 
ATOM   63   C C   . ASP A 1 18  ? 31.084 41.577 9.420   1.00 14.26 ? 18  ASP A C   1 
ATOM   64   O O   . ASP A 1 18  ? 31.400 42.566 8.801   1.00 14.94 ? 18  ASP A O   1 
ATOM   65   C CB  . ASP A 1 18  ? 32.499 39.828 8.121   1.00 19.21 ? 18  ASP A CB  1 
ATOM   66   C CG  . ASP A 1 18  ? 33.666 39.782 9.117   1.00 19.14 ? 18  ASP A CG  1 
ATOM   67   O OD1 . ASP A 1 18  ? 33.636 40.447 10.161  1.00 20.26 ? 18  ASP A OD1 1 
ATOM   68   O OD2 . ASP A 1 18  ? 34.663 39.105 8.815   1.00 22.17 ? 18  ASP A OD2 1 
ATOM   69   N N   . ALA A 1 19  ? 30.708 41.632 10.695  1.00 15.03 ? 19  ALA A N   1 
ATOM   70   C CA  . ALA A 1 19  ? 30.574 42.855 11.468  1.00 14.99 ? 19  ALA A CA  1 
ATOM   71   C C   . ALA A 1 19  ? 31.894 43.326 12.051  1.00 18.36 ? 19  ALA A C   1 
ATOM   72   O O   . ALA A 1 19  ? 31.953 44.424 12.594  1.00 20.10 ? 19  ALA A O   1 
ATOM   73   C CB  . ALA A 1 19  ? 29.540 42.661 12.601  1.00 13.15 ? 19  ALA A CB  1 
ATOM   74   N N   . VAL A 1 20  ? 32.936 42.501 11.982  1.00 15.98 ? 20  VAL A N   1 
ATOM   75   C CA  . VAL A 1 20  ? 34.263 42.881 12.496  1.00 14.64 ? 20  VAL A CA  1 
ATOM   76   C C   . VAL A 1 20  ? 35.073 43.532 11.397  1.00 18.63 ? 20  VAL A C   1 
ATOM   77   O O   . VAL A 1 20  ? 35.785 44.467 11.647  1.00 20.63 ? 20  VAL A O   1 
ATOM   78   C CB  . VAL A 1 20  ? 35.075 41.654 12.978  1.00 15.04 ? 20  VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 20  ? 36.455 42.047 13.345  1.00 13.62 ? 20  VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 20  ? 34.394 40.996 14.163  1.00 17.68 ? 20  VAL A CG2 1 
ATOM   81   N N   . ARG A 1 21  ? 34.916 43.066 10.164  1.00 16.88 ? 21  ARG A N   1 
ATOM   82   C CA  . ARG A 1 21  ? 35.661 43.588 9.039   1.00 17.99 ? 21  ARG A CA  1 
ATOM   83   C C   . ARG A 1 21  ? 34.852 44.491 8.146   1.00 18.06 ? 21  ARG A C   1 
ATOM   84   O O   . ARG A 1 21  ? 35.418 45.130 7.294   1.00 17.91 ? 21  ARG A O   1 
ATOM   85   C CB  . ARG A 1 21  ? 36.227 42.421 8.222   1.00 17.81 ? 21  ARG A CB  1 
ATOM   86   C CG  . ARG A 1 21  ? 36.919 41.441 9.135   1.00 29.54 ? 21  ARG A CG  1 
ATOM   87   C CD  . ARG A 1 21  ? 37.738 40.431 8.430   1.00 34.76 ? 21  ARG A CD  1 
ATOM   88   N NE  . ARG A 1 21  ? 36.952 39.841 7.379   1.00 48.18 ? 21  ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 21  ? 37.465 39.310 6.279   1.00 56.48 ? 21  ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 21  ? 38.782 39.287 6.080   1.00 57.95 ? 21  ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 21  ? 36.649 38.822 5.364   1.00 62.23 ? 21  ARG A NH2 1 
ATOM   92   N N   . GLY A 1 22  ? 33.530 44.515 8.315   1.00 18.08 ? 22  GLY A N   1 
ATOM   93   C CA  . GLY A 1 22  ? 32.685 45.362 7.486   1.00 14.25 ? 22  GLY A CA  1 
ATOM   94   C C   . GLY A 1 22  ? 32.679 44.878 6.053   1.00 18.12 ? 22  GLY A C   1 
ATOM   95   O O   . GLY A 1 22  ? 32.802 45.657 5.076   1.00 16.69 ? 22  GLY A O   1 
ATOM   96   N N   . SER A 1 23  ? 32.512 43.573 5.894   1.00 17.16 ? 23  SER A N   1 
ATOM   97   C CA  . SER A 1 23  ? 32.497 42.997 4.567   1.00 17.34 ? 23  SER A CA  1 
ATOM   98   C C   . SER A 1 23  ? 31.662 41.744 4.529   1.00 18.79 ? 23  SER A C   1 
ATOM   99   O O   . SER A 1 23  ? 31.151 41.273 5.546   1.00 18.80 ? 23  SER A O   1 
ATOM   100  C CB  . SER A 1 23  ? 33.901 42.587 4.179   1.00 23.05 ? 23  SER A CB  1 
ATOM   101  O OG  . SER A 1 23  ? 34.341 41.625 5.112   1.00 33.84 ? 23  SER A OG  1 
ATOM   102  N N   . PRO A 1 24  ? 31.413 41.261 3.321   1.00 18.57 ? 24  PRO A N   1 
ATOM   103  C CA  . PRO A 1 24  ? 30.640 40.027 3.226   1.00 20.89 ? 24  PRO A CA  1 
ATOM   104  C C   . PRO A 1 24  ? 31.550 38.880 3.739   1.00 16.60 ? 24  PRO A C   1 
ATOM   105  O O   . PRO A 1 24  ? 32.789 38.967 3.700   1.00 18.22 ? 24  PRO A O   1 
ATOM   106  C CB  . PRO A 1 24  ? 30.361 39.914 1.732   1.00 19.69 ? 24  PRO A CB  1 
ATOM   107  C CG  . PRO A 1 24  ? 31.461 40.702 1.089   1.00 26.68 ? 24  PRO A CG  1 
ATOM   108  C CD  . PRO A 1 24  ? 31.636 41.878 1.999   1.00 17.26 ? 24  PRO A CD  1 
ATOM   109  N N   . ALA A 1 25  ? 30.934 37.898 4.374   1.00 15.52 ? 25  ALA A N   1 
ATOM   110  C CA  . ALA A 1 25  ? 31.639 36.737 4.894   1.00 17.10 ? 25  ALA A CA  1 
ATOM   111  C C   . ALA A 1 25  ? 31.668 35.778 3.704   1.00 18.37 ? 25  ALA A C   1 
ATOM   112  O O   . ALA A 1 25  ? 30.643 35.276 3.222   1.00 16.62 ? 25  ALA A O   1 
ATOM   113  C CB  . ALA A 1 25  ? 30.885 36.157 6.064   1.00 17.11 ? 25  ALA A CB  1 
ATOM   114  N N   . ILE A 1 26  ? 32.857 35.648 3.155   1.00 21.17 ? 26  ILE A N   1 
ATOM   115  C CA  . ILE A 1 26  ? 33.114 34.844 1.973   1.00 22.96 ? 26  ILE A CA  1 
ATOM   116  C C   . ILE A 1 26  ? 33.518 33.404 2.307   1.00 21.00 ? 26  ILE A C   1 
ATOM   117  O O   . ILE A 1 26  ? 34.161 33.150 3.325   1.00 16.44 ? 26  ILE A O   1 
ATOM   118  C CB  . ILE A 1 26  ? 34.221 35.528 1.173   1.00 24.06 ? 26  ILE A CB  1 
ATOM   119  C CG1 . ILE A 1 26  ? 33.836 36.983 0.955   1.00 23.45 ? 26  ILE A CG1 1 
ATOM   120  C CG2 . ILE A 1 26  ? 34.461 34.815 -0.164  1.00 30.68 ? 26  ILE A CG2 1 
ATOM   121  C CD1 . ILE A 1 26  ? 34.999 37.787 0.535   1.00 31.16 ? 26  ILE A CD1 1 
ATOM   122  N N   . ASN A 1 27  ? 33.072 32.467 1.478   1.00 23.70 ? 27  ASN A N   1 
ATOM   123  C CA  . ASN A 1 27  ? 33.390 31.064 1.670   1.00 27.47 ? 27  ASN A CA  1 
ATOM   124  C C   . ASN A 1 27  ? 32.890 30.409 2.934   1.00 24.04 ? 27  ASN A C   1 
ATOM   125  O O   . ASN A 1 27  ? 33.538 29.522 3.478   1.00 25.94 ? 27  ASN A O   1 
ATOM   126  C CB  . ASN A 1 27  ? 34.875 30.862 1.531   1.00 35.52 ? 27  ASN A CB  1 
ATOM   127  C CG  . ASN A 1 27  ? 35.207 30.280 0.215   1.00 46.65 ? 27  ASN A CG  1 
ATOM   128  O OD1 . ASN A 1 27  ? 35.128 30.959 -0.824  1.00 50.25 ? 27  ASN A OD1 1 
ATOM   129  N ND2 . ASN A 1 27  ? 35.458 28.973 0.213   1.00 54.76 ? 27  ASN A ND2 1 
ATOM   130  N N   . VAL A 1 28  ? 31.737 30.870 3.399   1.00 21.44 ? 28  VAL A N   1 
ATOM   131  C CA  . VAL A 1 28  ? 31.122 30.347 4.589   1.00 21.43 ? 28  VAL A CA  1 
ATOM   132  C C   . VAL A 1 28  ? 30.271 29.127 4.159   1.00 21.12 ? 28  VAL A C   1 
ATOM   133  O O   . VAL A 1 28  ? 29.483 29.212 3.210   1.00 19.34 ? 28  VAL A O   1 
ATOM   134  C CB  . VAL A 1 28  ? 30.221 31.411 5.280   1.00 20.15 ? 28  VAL A CB  1 
ATOM   135  C CG1 . VAL A 1 28  ? 29.512 30.799 6.460   1.00 19.68 ? 28  VAL A CG1 1 
ATOM   136  C CG2 . VAL A 1 28  ? 31.066 32.590 5.766   1.00 21.97 ? 28  VAL A CG2 1 
ATOM   137  N N   . ALA A 1 29  ? 30.480 28.000 4.831   1.00 17.69 ? 29  ALA A N   1 
ATOM   138  C CA  . ALA A 1 29  ? 29.740 26.789 4.549   1.00 17.05 ? 29  ALA A CA  1 
ATOM   139  C C   . ALA A 1 29  ? 28.333 26.945 5.102   1.00 15.58 ? 29  ALA A C   1 
ATOM   140  O O   . ALA A 1 29  ? 28.147 27.442 6.226   1.00 12.95 ? 29  ALA A O   1 
ATOM   141  C CB  . ALA A 1 29  ? 30.414 25.611 5.209   1.00 14.61 ? 29  ALA A CB  1 
ATOM   142  N N   . VAL A 1 30  ? 27.346 26.515 4.317   1.00 14.84 ? 30  VAL A N   1 
ATOM   143  C CA  . VAL A 1 30  ? 25.930 26.549 4.733   1.00 17.24 ? 30  VAL A CA  1 
ATOM   144  C C   . VAL A 1 30  ? 25.330 25.193 4.415   1.00 14.28 ? 30  VAL A C   1 
ATOM   145  O O   . VAL A 1 30  ? 25.508 24.674 3.316   1.00 14.98 ? 30  VAL A O   1 
ATOM   146  C CB  . VAL A 1 30  ? 25.089 27.627 3.971   1.00 16.16 ? 30  VAL A CB  1 
ATOM   147  C CG1 . VAL A 1 30  ? 23.643 27.616 4.435   1.00 17.36 ? 30  VAL A CG1 1 
ATOM   148  C CG2 . VAL A 1 30  ? 25.700 29.021 4.157   1.00 16.94 ? 30  VAL A CG2 1 
ATOM   149  N N   . HIS A 1 31  ? 24.630 24.617 5.382   1.00 15.96 ? 31  HIS A N   1 
ATOM   150  C CA  . HIS A 1 31  ? 23.968 23.320 5.190   1.00 17.13 ? 31  HIS A CA  1 
ATOM   151  C C   . HIS A 1 31  ? 22.514 23.540 5.534   1.00 16.96 ? 31  HIS A C   1 
ATOM   152  O O   . HIS A 1 31  ? 22.205 24.145 6.534   1.00 14.52 ? 31  HIS A O   1 
ATOM   153  C CB  . HIS A 1 31  ? 24.538 22.236 6.131   1.00 16.88 ? 31  HIS A CB  1 
ATOM   154  C CG  . HIS A 1 31  ? 25.908 21.753 5.742   1.00 25.70 ? 31  HIS A CG  1 
ATOM   155  N ND1 . HIS A 1 31  ? 27.068 22.453 6.022   1.00 26.02 ? 31  HIS A ND1 1 
ATOM   156  C CD2 . HIS A 1 31  ? 26.296 20.657 5.051   1.00 25.12 ? 31  HIS A CD2 1 
ATOM   157  C CE1 . HIS A 1 31  ? 28.106 21.808 5.513   1.00 22.78 ? 31  HIS A CE1 1 
ATOM   158  N NE2 . HIS A 1 31  ? 27.665 20.717 4.919   1.00 27.62 ? 31  HIS A NE2 1 
ATOM   159  N N   . VAL A 1 32  ? 21.636 23.088 4.658   1.00 18.21 ? 32  VAL A N   1 
ATOM   160  C CA  . VAL A 1 32  ? 20.187 23.170 4.857   1.00 18.59 ? 32  VAL A CA  1 
ATOM   161  C C   . VAL A 1 32  ? 19.647 21.748 5.063   1.00 19.08 ? 32  VAL A C   1 
ATOM   162  O O   . VAL A 1 32  ? 20.085 20.784 4.379   1.00 17.55 ? 32  VAL A O   1 
ATOM   163  C CB  . VAL A 1 32  ? 19.474 23.763 3.644   1.00 18.47 ? 32  VAL A CB  1 
ATOM   164  C CG1 . VAL A 1 32  ? 18.001 23.888 3.937   1.00 16.78 ? 32  VAL A CG1 1 
ATOM   165  C CG2 . VAL A 1 32  ? 20.103 25.114 3.262   1.00 17.72 ? 32  VAL A CG2 1 
ATOM   166  N N   . PHE A 1 33  ? 18.760 21.616 6.048   1.00 17.52 ? 33  PHE A N   1 
ATOM   167  C CA  . PHE A 1 33  ? 18.139 20.331 6.384   1.00 18.54 ? 33  PHE A CA  1 
ATOM   168  C C   . PHE A 1 33  ? 16.636 20.508 6.373   1.00 21.08 ? 33  PHE A C   1 
ATOM   169  O O   . PHE A 1 33  ? 16.130 21.617 6.526   1.00 18.66 ? 33  PHE A O   1 
ATOM   170  C CB  . PHE A 1 33  ? 18.554 19.848 7.775   1.00 14.10 ? 33  PHE A CB  1 
ATOM   171  C CG  . PHE A 1 33  ? 20.030 19.765 7.958   1.00 18.69 ? 33  PHE A CG  1 
ATOM   172  C CD1 . PHE A 1 33  ? 20.763 20.899 8.371   1.00 18.36 ? 33  PHE A CD1 1 
ATOM   173  C CD2 . PHE A 1 33  ? 20.716 18.576 7.659   1.00 21.13 ? 33  PHE A CD2 1 
ATOM   174  C CE1 . PHE A 1 33  ? 22.165 20.867 8.481   1.00 18.05 ? 33  PHE A CE1 1 
ATOM   175  C CE2 . PHE A 1 33  ? 22.117 18.509 7.758   1.00 19.17 ? 33  PHE A CE2 1 
ATOM   176  C CZ  . PHE A 1 33  ? 22.843 19.653 8.166   1.00 21.43 ? 33  PHE A CZ  1 
ATOM   177  N N   . ARG A 1 34  ? 15.933 19.413 6.152   1.00 18.41 ? 34  ARG A N   1 
ATOM   178  C CA  . ARG A 1 34  ? 14.491 19.418 6.145   1.00 21.75 ? 34  ARG A CA  1 
ATOM   179  C C   . ARG A 1 34  ? 14.022 18.354 7.138   1.00 22.92 ? 34  ARG A C   1 
ATOM   180  O O   . ARG A 1 34  ? 14.573 17.235 7.221   1.00 21.65 ? 34  ARG A O   1 
ATOM   181  C CB  . ARG A 1 34  ? 13.962 19.141 4.741   1.00 22.26 ? 34  ARG A CB  1 
ATOM   182  C CG  . ARG A 1 34  ? 12.477 19.223 4.668   1.00 26.46 ? 34  ARG A CG  1 
ATOM   183  C CD  . ARG A 1 34  ? 11.964 18.997 3.270   1.00 34.67 ? 34  ARG A CD  1 
ATOM   184  N NE  . ARG A 1 34  ? 10.514 19.189 3.254   1.00 44.74 ? 34  ARG A NE  1 
ATOM   185  C CZ  . ARG A 1 34  ? 9.629  18.296 3.695   1.00 45.30 ? 34  ARG A CZ  1 
ATOM   186  N NH1 . ARG A 1 34  ? 10.034 17.129 4.171   1.00 46.28 ? 34  ARG A NH1 1 
ATOM   187  N NH2 . ARG A 1 34  ? 8.343  18.600 3.716   1.00 40.94 ? 34  ARG A NH2 1 
ATOM   188  N N   . LYS A 1 35  ? 13.043 18.715 7.942   1.00 23.13 ? 35  LYS A N   1 
ATOM   189  C CA  . LYS A 1 35  ? 12.547 17.781 8.939   1.00 28.98 ? 35  LYS A CA  1 
ATOM   190  C C   . LYS A 1 35  ? 11.820 16.653 8.230   1.00 29.88 ? 35  LYS A C   1 
ATOM   191  O O   . LYS A 1 35  ? 10.932 16.884 7.394   1.00 26.22 ? 35  LYS A O   1 
ATOM   192  C CB  . LYS A 1 35  ? 11.646 18.477 9.951   1.00 28.80 ? 35  LYS A CB  1 
ATOM   193  C CG  . LYS A 1 35  ? 11.724 17.924 11.349  1.00 31.74 ? 35  LYS A CG  1 
ATOM   194  C CD  . LYS A 1 35  ? 11.308 19.026 12.314  1.00 40.12 ? 35  LYS A CD  1 
ATOM   195  C CE  . LYS A 1 35  ? 11.631 18.674 13.738  1.00 44.73 ? 35  LYS A CE  1 
ATOM   196  N NZ  . LYS A 1 35  ? 13.040 18.173 13.801  1.00 52.26 ? 35  LYS A NZ  1 
ATOM   197  N N   . ALA A 1 36  ? 12.314 15.445 8.485   1.00 34.97 ? 36  ALA A N   1 
ATOM   198  C CA  . ALA A 1 36  ? 11.799 14.221 7.904   1.00 36.81 ? 36  ALA A CA  1 
ATOM   199  C C   . ALA A 1 36  ? 10.549 13.789 8.641   1.00 39.41 ? 36  ALA A C   1 
ATOM   200  O O   . ALA A 1 36  ? 10.269 14.237 9.759   1.00 32.85 ? 36  ALA A O   1 
ATOM   201  C CB  . ALA A 1 36  ? 12.843 13.140 7.989   1.00 39.74 ? 36  ALA A CB  1 
ATOM   202  N N   . ALA A 1 37  ? 9.807  12.903 7.986   1.00 46.64 ? 37  ALA A N   1 
ATOM   203  C CA  . ALA A 1 37  ? 8.566  12.343 8.513   1.00 52.16 ? 37  ALA A CA  1 
ATOM   204  C C   . ALA A 1 37  ? 8.778  11.750 9.893   1.00 53.69 ? 37  ALA A C   1 
ATOM   205  O O   . ALA A 1 37  ? 7.904  11.836 10.737  1.00 55.94 ? 37  ALA A O   1 
ATOM   206  C CB  . ALA A 1 37  ? 8.048  11.284 7.573   1.00 54.75 ? 37  ALA A CB  1 
ATOM   207  N N   . ASP A 1 38  ? 9.955  11.175 10.112  1.00 55.62 ? 38  ASP A N   1 
ATOM   208  C CA  . ASP A 1 38  ? 10.304 10.581 11.395  1.00 60.93 ? 38  ASP A CA  1 
ATOM   209  C C   . ASP A 1 38  ? 11.008 11.589 12.313  1.00 61.74 ? 38  ASP A C   1 
ATOM   210  O O   . ASP A 1 38  ? 11.836 11.223 13.145  1.00 64.44 ? 38  ASP A O   1 
ATOM   211  C CB  . ASP A 1 38  ? 11.195 9.364  11.170  1.00 62.91 ? 38  ASP A CB  1 
ATOM   212  C CG  . ASP A 1 38  ? 12.506 9.725  10.540  1.00 67.04 ? 38  ASP A CG  1 
ATOM   213  O OD1 . ASP A 1 38  ? 12.521 10.181 9.386   1.00 69.86 ? 38  ASP A OD1 1 
ATOM   214  O OD2 . ASP A 1 38  ? 13.531 9.557  11.213  1.00 71.93 ? 38  ASP A OD2 1 
ATOM   215  N N   . ASP A 1 39  ? 10.690 12.863 12.145  1.00 61.51 ? 39  ASP A N   1 
ATOM   216  C CA  . ASP A 1 39  ? 11.289 13.907 12.947  1.00 59.99 ? 39  ASP A CA  1 
ATOM   217  C C   . ASP A 1 39  ? 12.795 14.017 12.945  1.00 57.48 ? 39  ASP A C   1 
ATOM   218  O O   . ASP A 1 39  ? 13.364 14.592 13.873  1.00 62.04 ? 39  ASP A O   1 
ATOM   219  C CB  . ASP A 1 39  ? 10.776 13.859 14.373  1.00 64.25 ? 39  ASP A CB  1 
ATOM   220  C CG  . ASP A 1 39  ? 9.755  14.933 14.638  1.00 71.47 ? 39  ASP A CG  1 
ATOM   221  O OD1 . ASP A 1 39  ? 8.780  15.014 13.850  1.00 74.84 ? 39  ASP A OD1 1 
ATOM   222  O OD2 . ASP A 1 39  ? 9.938  15.714 15.605  1.00 74.76 ? 39  ASP A OD2 1 
ATOM   223  N N   . THR A 1 40  ? 13.452 13.454 11.938  1.00 52.84 ? 40  THR A N   1 
ATOM   224  C CA  . THR A 1 40  ? 14.901 13.582 11.836  1.00 47.10 ? 40  THR A CA  1 
ATOM   225  C C   . THR A 1 40  ? 15.223 14.668 10.789  1.00 41.73 ? 40  THR A C   1 
ATOM   226  O O   . THR A 1 40  ? 14.397 14.967 9.933   1.00 35.40 ? 40  THR A O   1 
ATOM   227  C CB  . THR A 1 40  ? 15.570 12.268 11.371  1.00 47.72 ? 40  THR A CB  1 
ATOM   228  O OG1 . THR A 1 40  ? 14.889 11.747 10.219  1.00 46.20 ? 40  THR A OG1 1 
ATOM   229  C CG2 . THR A 1 40  ? 15.603 11.260 12.494  1.00 48.72 ? 40  THR A CG2 1 
ATOM   230  N N   . TRP A 1 41  ? 16.410 15.259 10.866  1.00 35.43 ? 41  TRP A N   1 
ATOM   231  C CA  . TRP A 1 41  ? 16.803 16.244 9.878   1.00 33.65 ? 41  TRP A CA  1 
ATOM   232  C C   . TRP A 1 41  ? 17.468 15.593 8.679   1.00 33.06 ? 41  TRP A C   1 
ATOM   233  O O   . TRP A 1 41  ? 18.563 15.064 8.785   1.00 38.36 ? 41  TRP A O   1 
ATOM   234  C CB  . TRP A 1 41  ? 17.742 17.285 10.486  1.00 26.56 ? 41  TRP A CB  1 
ATOM   235  C CG  . TRP A 1 41  ? 17.048 18.098 11.473  1.00 27.04 ? 41  TRP A CG  1 
ATOM   236  C CD1 . TRP A 1 41  ? 17.140 17.984 12.802  1.00 27.24 ? 41  TRP A CD1 1 
ATOM   237  C CD2 . TRP A 1 41  ? 16.161 19.201 11.219  1.00 23.18 ? 41  TRP A CD2 1 
ATOM   238  N NE1 . TRP A 1 41  ? 16.386 18.951 13.415  1.00 28.63 ? 41  TRP A NE1 1 
ATOM   239  C CE2 . TRP A 1 41  ? 15.774 19.714 12.463  1.00 23.18 ? 41  TRP A CE2 1 
ATOM   240  C CE3 . TRP A 1 41  ? 15.678 19.808 10.056  1.00 20.63 ? 41  TRP A CE3 1 
ATOM   241  C CZ2 . TRP A 1 41  ? 14.927 20.811 12.599  1.00 22.79 ? 41  TRP A CZ2 1 
ATOM   242  C CZ3 . TRP A 1 41  ? 14.829 20.909 10.187  1.00 25.05 ? 41  TRP A CZ3 1 
ATOM   243  C CH2 . TRP A 1 41  ? 14.463 21.398 11.451  1.00 19.40 ? 41  TRP A CH2 1 
ATOM   244  N N   . GLU A 1 42  ? 16.798 15.613 7.542   1.00 32.20 ? 42  GLU A N   1 
ATOM   245  C CA  . GLU A 1 42  ? 17.372 15.086 6.317   1.00 33.73 ? 42  GLU A CA  1 
ATOM   246  C C   . GLU A 1 42  ? 18.180 16.187 5.633   1.00 30.91 ? 42  GLU A C   1 
ATOM   247  O O   . GLU A 1 42  ? 17.746 17.343 5.620   1.00 29.50 ? 42  GLU A O   1 
ATOM   248  C CB  . GLU A 1 42  ? 16.254 14.755 5.353   1.00 40.51 ? 42  GLU A CB  1 
ATOM   249  C CG  . GLU A 1 42  ? 15.255 13.799 5.880   1.00 57.68 ? 42  GLU A CG  1 
ATOM   250  C CD  . GLU A 1 42  ? 15.642 12.362 5.567   1.00 69.32 ? 42  GLU A CD  1 
ATOM   251  O OE1 . GLU A 1 42  ? 15.294 11.907 4.442   1.00 73.90 ? 42  GLU A OE1 1 
ATOM   252  O OE2 . GLU A 1 42  ? 16.299 11.704 6.428   1.00 73.59 ? 42  GLU A OE2 1 
ATOM   253  N N   . PRO A 1 43  ? 19.365 15.860 5.071   1.00 29.28 ? 43  PRO A N   1 
ATOM   254  C CA  . PRO A 1 43  ? 20.230 16.816 4.356   1.00 26.85 ? 43  PRO A CA  1 
ATOM   255  C C   . PRO A 1 43  ? 19.397 17.305 3.179   1.00 25.28 ? 43  PRO A C   1 
ATOM   256  O O   . PRO A 1 43  ? 18.728 16.511 2.529   1.00 27.60 ? 43  PRO A O   1 
ATOM   257  C CB  . PRO A 1 43  ? 21.369 15.933 3.875   1.00 27.17 ? 43  PRO A CB  1 
ATOM   258  C CG  . PRO A 1 43  ? 21.522 15.005 4.995   1.00 31.96 ? 43  PRO A CG  1 
ATOM   259  C CD  . PRO A 1 43  ? 20.081 14.598 5.281   1.00 31.47 ? 43  PRO A CD  1 
ATOM   260  N N   . PHE A 1 44  ? 19.373 18.595 2.915   1.00 18.72 ? 44  PHE A N   1 
ATOM   261  C CA  . PHE A 1 44  ? 18.531 19.055 1.836   1.00 15.88 ? 44  PHE A CA  1 
ATOM   262  C C   . PHE A 1 44  ? 19.350 19.785 0.773   1.00 17.01 ? 44  PHE A C   1 
ATOM   263  O O   . PHE A 1 44  ? 19.174 19.580 -0.406  1.00 19.22 ? 44  PHE A O   1 
ATOM   264  C CB  . PHE A 1 44  ? 17.388 19.925 2.440   1.00 19.22 ? 44  PHE A CB  1 
ATOM   265  C CG  . PHE A 1 44  ? 16.464 20.548 1.423   1.00 20.44 ? 44  PHE A CG  1 
ATOM   266  C CD1 . PHE A 1 44  ? 15.420 19.819 0.864   1.00 21.40 ? 44  PHE A CD1 1 
ATOM   267  C CD2 . PHE A 1 44  ? 16.674 21.846 0.978   1.00 18.42 ? 44  PHE A CD2 1 
ATOM   268  C CE1 . PHE A 1 44  ? 14.597 20.368 -0.136  1.00 21.90 ? 44  PHE A CE1 1 
ATOM   269  C CE2 . PHE A 1 44  ? 15.859 22.396 -0.021  1.00 21.19 ? 44  PHE A CE2 1 
ATOM   270  C CZ  . PHE A 1 44  ? 14.815 21.642 -0.577  1.00 22.36 ? 44  PHE A CZ  1 
ATOM   271  N N   . ALA A 1 45  ? 20.255 20.647 1.180   1.00 16.10 ? 45  ALA A N   1 
ATOM   272  C CA  . ALA A 1 45  ? 21.060 21.371 0.209   1.00 17.67 ? 45  ALA A CA  1 
ATOM   273  C C   . ALA A 1 45  ? 22.255 21.955 0.973   1.00 17.10 ? 45  ALA A C   1 
ATOM   274  O O   . ALA A 1 45  ? 22.231 22.017 2.225   1.00 16.03 ? 45  ALA A O   1 
ATOM   275  C CB  . ALA A 1 45  ? 20.214 22.500 -0.438  1.00 19.60 ? 45  ALA A CB  1 
ATOM   276  N N   . SER A 1 46  ? 23.325 22.301 0.262   1.00 16.80 ? 46  SER A N   1 
ATOM   277  C CA  . SER A 1 46  ? 24.482 22.923 0.914   1.00 18.48 ? 46  SER A CA  1 
ATOM   278  C C   . SER A 1 46  ? 25.321 23.672 -0.118  1.00 17.89 ? 46  SER A C   1 
ATOM   279  O O   . SER A 1 46  ? 25.192 23.468 -1.317  1.00 19.74 ? 46  SER A O   1 
ATOM   280  C CB  . SER A 1 46  ? 25.344 21.899 1.679   1.00 16.47 ? 46  SER A CB  1 
ATOM   281  O OG  . SER A 1 46  ? 25.911 20.975 0.772   1.00 20.37 ? 46  SER A OG  1 
ATOM   282  N N   . GLY A 1 47  ? 26.153 24.572 0.374   1.00 21.96 ? 47  GLY A N   1 
ATOM   283  C CA  . GLY A 1 47  ? 27.010 25.350 -0.496  1.00 20.80 ? 47  GLY A CA  1 
ATOM   284  C C   . GLY A 1 47  ? 27.865 26.291 0.333   1.00 19.79 ? 47  GLY A C   1 
ATOM   285  O O   . GLY A 1 47  ? 27.895 26.197 1.558   1.00 19.94 ? 47  GLY A O   1 
ATOM   286  N N   . LYS A 1 48  ? 28.577 27.173 -0.345  1.00 15.77 ? 48  LYS A N   1 
ATOM   287  C CA  . LYS A 1 48  ? 29.444 28.125 0.304   1.00 22.88 ? 48  LYS A CA  1 
ATOM   288  C C   . LYS A 1 48  ? 29.078 29.513 -0.227  1.00 21.42 ? 48  LYS A C   1 
ATOM   289  O O   . LYS A 1 48  ? 28.744 29.643 -1.414  1.00 21.99 ? 48  LYS A O   1 
ATOM   290  C CB  . LYS A 1 48  ? 30.913 27.803 -0.043  1.00 25.07 ? 48  LYS A CB  1 
ATOM   291  C CG  . LYS A 1 48  ? 31.599 26.973 1.017   1.00 35.21 ? 48  LYS A CG  1 
ATOM   292  C CD  . LYS A 1 48  ? 33.045 26.660 0.636   1.00 40.99 ? 48  LYS A CD  1 
ATOM   293  C CE  . LYS A 1 48  ? 33.767 25.799 1.703   1.00 41.04 ? 48  LYS A CE  1 
ATOM   294  N NZ  . LYS A 1 48  ? 33.945 26.531 3.005   1.00 44.56 ? 48  LYS A NZ  1 
ATOM   295  N N   . THR A 1 49  ? 29.119 30.538 0.629   1.00 18.54 ? 49  THR A N   1 
ATOM   296  C CA  . THR A 1 49  ? 28.822 31.893 0.163   1.00 18.30 ? 49  THR A CA  1 
ATOM   297  C C   . THR A 1 49  ? 29.930 32.355 -0.820  1.00 20.77 ? 49  THR A C   1 
ATOM   298  O O   . THR A 1 49  ? 31.083 31.932 -0.750  1.00 19.34 ? 49  THR A O   1 
ATOM   299  C CB  . THR A 1 49  ? 28.724 32.881 1.328   1.00 16.16 ? 49  THR A CB  1 
ATOM   300  O OG1 . THR A 1 49  ? 29.952 32.869 2.082   1.00 15.53 ? 49  THR A OG1 1 
ATOM   301  C CG2 . THR A 1 49  ? 27.545 32.493 2.242   1.00 15.38 ? 49  THR A CG2 1 
ATOM   302  N N   . SER A 1 50  ? 29.559 33.223 -1.733  1.00 20.11 ? 50  SER A N   1 
ATOM   303  C CA  . SER A 1 50  ? 30.464 33.732 -2.721  1.00 23.01 ? 50  SER A CA  1 
ATOM   304  C C   . SER A 1 50  ? 31.200 34.931 -2.162  1.00 23.64 ? 50  SER A C   1 
ATOM   305  O O   . SER A 1 50  ? 31.025 35.289 -1.005  1.00 21.35 ? 50  SER A O   1 
ATOM   306  C CB  . SER A 1 50  ? 29.635 34.170 -3.916  1.00 23.47 ? 50  SER A CB  1 
ATOM   307  O OG  . SER A 1 50  ? 28.825 35.247 -3.481  1.00 32.73 ? 50  SER A OG  1 
ATOM   308  N N   . GLU A 1 51  ? 31.961 35.598 -3.030  1.00 27.05 ? 51  GLU A N   1 
ATOM   309  C CA  . GLU A 1 51  ? 32.742 36.780 -2.674  1.00 29.99 ? 51  GLU A CA  1 
ATOM   310  C C   . GLU A 1 51  ? 31.803 37.934 -2.256  1.00 27.50 ? 51  GLU A C   1 
ATOM   311  O O   . GLU A 1 51  ? 32.216 38.878 -1.583  1.00 26.29 ? 51  GLU A O   1 
ATOM   312  C CB  . GLU A 1 51  ? 33.644 37.210 -3.835  1.00 38.45 ? 51  GLU A CB  1 
ATOM   313  C CG  . GLU A 1 51  ? 34.591 36.106 -4.401  1.00 58.95 ? 51  GLU A CG  1 
ATOM   314  C CD  . GLU A 1 51  ? 35.901 35.888 -3.606  1.00 68.26 ? 51  GLU A CD  1 
ATOM   315  O OE1 . GLU A 1 51  ? 36.714 36.844 -3.526  1.00 74.24 ? 51  GLU A OE1 1 
ATOM   316  O OE2 . GLU A 1 51  ? 36.138 34.753 -3.100  1.00 72.31 ? 51  GLU A OE2 1 
ATOM   317  N N   . SER A 1 52  ? 30.532 37.835 -2.617  1.00 23.43 ? 52  SER A N   1 
ATOM   318  C CA  . SER A 1 52  ? 29.590 38.854 -2.225  1.00 23.70 ? 52  SER A CA  1 
ATOM   319  C C   . SER A 1 52  ? 28.844 38.460 -0.944  1.00 20.66 ? 52  SER A C   1 
ATOM   320  O O   . SER A 1 52  ? 27.861 39.118 -0.567  1.00 17.88 ? 52  SER A O   1 
ATOM   321  C CB  . SER A 1 52  ? 28.586 39.089 -3.342  1.00 26.74 ? 52  SER A CB  1 
ATOM   322  O OG  . SER A 1 52  ? 27.718 37.979 -3.486  1.00 33.46 ? 52  SER A OG  1 
ATOM   323  N N   . GLY A 1 53  ? 29.287 37.368 -0.317  1.00 16.73 ? 53  GLY A N   1 
ATOM   324  C CA  . GLY A 1 53  ? 28.662 36.876 0.906   1.00 16.62 ? 53  GLY A CA  1 
ATOM   325  C C   . GLY A 1 53  ? 27.316 36.210 0.690   1.00 16.70 ? 53  GLY A C   1 
ATOM   326  O O   . GLY A 1 53  ? 26.610 35.947 1.652   1.00 18.58 ? 53  GLY A O   1 
ATOM   327  N N   . GLU A 1 54  ? 26.986 35.924 -0.572  1.00 19.56 ? 54  GLU A N   1 
ATOM   328  C CA  . GLU A 1 54  ? 25.722 35.323 -0.981  1.00 21.36 ? 54  GLU A CA  1 
ATOM   329  C C   . GLU A 1 54  ? 25.786 33.917 -1.456  1.00 20.74 ? 54  GLU A C   1 
ATOM   330  O O   . GLU A 1 54  ? 26.795 33.498 -2.004  1.00 23.29 ? 54  GLU A O   1 
ATOM   331  C CB  . GLU A 1 54  ? 25.073 36.157 -2.056  1.00 20.61 ? 54  GLU A CB  1 
ATOM   332  C CG  . GLU A 1 54  ? 24.587 37.427 -1.455  1.00 31.94 ? 54  GLU A CG  1 
ATOM   333  C CD  . GLU A 1 54  ? 24.166 38.457 -2.463  1.00 41.14 ? 54  GLU A CD  1 
ATOM   334  O OE1 . GLU A 1 54  ? 23.812 38.106 -3.615  1.00 44.58 ? 54  GLU A OE1 1 
ATOM   335  O OE2 . GLU A 1 54  ? 24.188 39.644 -2.085  1.00 49.02 ? 54  GLU A OE2 1 
ATOM   336  N N   . LEU A 1 55  ? 24.710 33.176 -1.185  1.00 19.40 ? 55  LEU A N   1 
ATOM   337  C CA  . LEU A 1 55  ? 24.600 31.797 -1.607  1.00 19.09 ? 55  LEU A CA  1 
ATOM   338  C C   . LEU A 1 55  ? 23.289 31.646 -2.383  1.00 17.98 ? 55  LEU A C   1 
ATOM   339  O O   . LEU A 1 55  ? 22.225 31.874 -1.877  1.00 18.00 ? 55  LEU A O   1 
ATOM   340  C CB  . LEU A 1 55  ? 24.672 30.857 -0.406  1.00 17.68 ? 55  LEU A CB  1 
ATOM   341  C CG  . LEU A 1 55  ? 24.600 29.343 -0.697  1.00 16.98 ? 55  LEU A CG  1 
ATOM   342  C CD1 . LEU A 1 55  ? 25.495 28.937 -1.870  1.00 14.96 ? 55  LEU A CD1 1 
ATOM   343  C CD2 . LEU A 1 55  ? 24.997 28.639 0.575   1.00 17.98 ? 55  LEU A CD2 1 
ATOM   344  N N   . HIS A 1 56  ? 23.409 31.396 -3.663  1.00 20.68 ? 56  HIS A N   1 
ATOM   345  C CA  . HIS A 1 56  ? 22.255 31.203 -4.508  1.00 28.24 ? 56  HIS A CA  1 
ATOM   346  C C   . HIS A 1 56  ? 22.186 29.777 -5.040  1.00 29.04 ? 56  HIS A C   1 
ATOM   347  O O   . HIS A 1 56  ? 23.172 29.030 -4.989  1.00 27.59 ? 56  HIS A O   1 
ATOM   348  C CB  . HIS A 1 56  ? 22.380 32.093 -5.729  1.00 31.08 ? 56  HIS A CB  1 
ATOM   349  C CG  . HIS A 1 56  ? 22.295 33.529 -5.412  1.00 34.10 ? 56  HIS A CG  1 
ATOM   350  N ND1 . HIS A 1 56  ? 23.416 34.277 -5.145  1.00 40.22 ? 56  HIS A ND1 1 
ATOM   351  C CD2 . HIS A 1 56  ? 21.234 34.334 -5.193  1.00 34.39 ? 56  HIS A CD2 1 
ATOM   352  C CE1 . HIS A 1 56  ? 23.046 35.487 -4.762  1.00 40.35 ? 56  HIS A CE1 1 
ATOM   353  N NE2 . HIS A 1 56  ? 21.729 35.543 -4.781  1.00 38.91 ? 56  HIS A NE2 1 
ATOM   354  N N   . GLY A 1 57  ? 21.033 29.455 -5.621  1.00 28.50 ? 57  GLY A N   1 
ATOM   355  C CA  . GLY A 1 57  ? 20.835 28.167 -6.263  1.00 29.04 ? 57  GLY A CA  1 
ATOM   356  C C   . GLY A 1 57  ? 20.852 26.946 -5.388  1.00 27.30 ? 57  GLY A C   1 
ATOM   357  O O   . GLY A 1 57  ? 21.279 25.905 -5.840  1.00 25.62 ? 57  GLY A O   1 
ATOM   358  N N   . LEU A 1 58  ? 20.407 27.090 -4.146  1.00 27.81 ? 58  LEU A N   1 
ATOM   359  C CA  . LEU A 1 58  ? 20.338 25.997 -3.208  1.00 25.53 ? 58  LEU A CA  1 
ATOM   360  C C   . LEU A 1 58  ? 19.253 24.997 -3.634  1.00 25.29 ? 58  LEU A C   1 
ATOM   361  O O   . LEU A 1 58  ? 19.476 23.793 -3.534  1.00 23.65 ? 58  LEU A O   1 
ATOM   362  C CB  . LEU A 1 58  ? 20.020 26.531 -1.813  1.00 24.47 ? 58  LEU A CB  1 
ATOM   363  C CG  . LEU A 1 58  ? 21.205 27.095 -1.035  1.00 28.83 ? 58  LEU A CG  1 
ATOM   364  C CD1 . LEU A 1 58  ? 20.706 27.714 0.289   1.00 24.17 ? 58  LEU A CD1 1 
ATOM   365  C CD2 . LEU A 1 58  ? 22.253 25.971 -0.785  1.00 26.18 ? 58  LEU A CD2 1 
ATOM   366  N N   . THR A 1 59  ? 18.101 25.491 -4.112  1.00 25.08 ? 59  THR A N   1 
ATOM   367  C CA  . THR A 1 59  ? 16.961 24.636 -4.521  1.00 25.35 ? 59  THR A CA  1 
ATOM   368  C C   . THR A 1 59  ? 16.209 25.224 -5.692  1.00 25.10 ? 59  THR A C   1 
ATOM   369  O O   . THR A 1 59  ? 16.479 26.327 -6.113  1.00 25.81 ? 59  THR A O   1 
ATOM   370  C CB  . THR A 1 59  ? 15.806 24.590 -3.488  1.00 27.58 ? 59  THR A CB  1 
ATOM   371  O OG1 . THR A 1 59  ? 16.060 25.429 -2.355  1.00 32.24 ? 59  THR A OG1 1 
ATOM   372  C CG2 . THR A 1 59  ? 15.482 23.251 -3.130  1.00 15.32 ? 59  THR A CG2 1 
ATOM   373  N N   . THR A 1 60  ? 15.103 24.570 -6.028  1.00 24.97 ? 60  THR A N   1 
ATOM   374  C CA  . THR A 1 60  ? 14.234 24.997 -7.109  1.00 25.96 ? 60  THR A CA  1 
ATOM   375  C C   . THR A 1 60  ? 12.873 25.077 -6.451  1.00 23.93 ? 60  THR A C   1 
ATOM   376  O O   . THR A 1 60  ? 12.696 24.493 -5.385  1.00 23.92 ? 60  THR A O   1 
ATOM   377  C CB  . THR A 1 60  ? 14.285 23.954 -8.233  1.00 26.06 ? 60  THR A CB  1 
ATOM   378  O OG1 . THR A 1 60  ? 13.836 22.677 -7.756  1.00 28.42 ? 60  THR A OG1 1 
ATOM   379  C CG2 . THR A 1 60  ? 15.708 23.784 -8.677  1.00 26.37 ? 60  THR A CG2 1 
ATOM   380  N N   . GLU A 1 61  ? 11.900 25.769 -7.037  1.00 24.13 ? 61  GLU A N   1 
ATOM   381  C CA  . GLU A 1 61  ? 10.620 25.829 -6.351  1.00 29.75 ? 61  GLU A CA  1 
ATOM   382  C C   . GLU A 1 61  ? 9.990  24.471 -6.326  1.00 29.87 ? 61  GLU A C   1 
ATOM   383  O O   . GLU A 1 61  ? 9.250  24.166 -5.399  1.00 31.07 ? 61  GLU A O   1 
ATOM   384  C CB  . GLU A 1 61  ? 9.623  26.865 -6.929  1.00 38.82 ? 61  GLU A CB  1 
ATOM   385  C CG  . GLU A 1 61  ? 9.325  28.150 -6.012  1.00 55.28 ? 61  GLU A CG  1 
ATOM   386  C CD  . GLU A 1 61  ? 9.100  27.894 -4.448  1.00 64.54 ? 61  GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 61  ? 8.842  26.734 -4.020  1.00 67.22 ? 61  GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 61  ? 9.183  28.874 -3.637  1.00 61.70 ? 61  GLU A OE2 1 
ATOM   389  N N   . GLU A 1 62  ? 10.323 23.646 -7.318  1.00 28.74 ? 62  GLU A N   1 
ATOM   390  C CA  . GLU A 1 62  ? 9.766  22.300 -7.425  1.00 31.90 ? 62  GLU A CA  1 
ATOM   391  C C   . GLU A 1 62  ? 10.115 21.470 -6.211  1.00 28.47 ? 62  GLU A C   1 
ATOM   392  O O   . GLU A 1 62  ? 9.265  20.797 -5.628  1.00 27.31 ? 62  GLU A O   1 
ATOM   393  C CB  . GLU A 1 62  ? 10.295 21.577 -8.674  1.00 41.80 ? 62  GLU A CB  1 
ATOM   394  C CG  . GLU A 1 62  ? 10.224 22.399 -9.991  1.00 61.18 ? 62  GLU A CG  1 
ATOM   395  C CD  . GLU A 1 62  ? 11.489 23.269 -10.307 1.00 67.05 ? 62  GLU A CD  1 
ATOM   396  O OE1 . GLU A 1 62  ? 12.559 22.644 -10.584 1.00 72.32 ? 62  GLU A OE1 1 
ATOM   397  O OE2 . GLU A 1 62  ? 11.396 24.542 -10.328 1.00 63.01 ? 62  GLU A OE2 1 
ATOM   398  N N   . GLU A 1 63  ? 11.376 21.553 -5.822  1.00 24.08 ? 63  GLU A N   1 
ATOM   399  C CA  . GLU A 1 63  ? 11.899 20.784 -4.706  1.00 25.94 ? 63  GLU A CA  1 
ATOM   400  C C   . GLU A 1 63  ? 11.681 21.396 -3.318  1.00 20.70 ? 63  GLU A C   1 
ATOM   401  O O   . GLU A 1 63  ? 11.659 20.683 -2.313  1.00 15.95 ? 63  GLU A O   1 
ATOM   402  C CB  . GLU A 1 63  ? 13.385 20.503 -4.996  1.00 30.39 ? 63  GLU A CB  1 
ATOM   403  C CG  . GLU A 1 63  ? 14.299 20.216 -3.798  1.00 49.57 ? 63  GLU A CG  1 
ATOM   404  C CD  . GLU A 1 63  ? 15.785 20.480 -4.132  1.00 57.37 ? 63  GLU A CD  1 
ATOM   405  O OE1 . GLU A 1 63  ? 16.107 20.583 -5.346  1.00 65.36 ? 63  GLU A OE1 1 
ATOM   406  O OE2 . GLU A 1 63  ? 16.611 20.645 -3.196  1.00 56.07 ? 63  GLU A OE2 1 
ATOM   407  N N   . PHE A 1 64  ? 11.454 22.704 -3.290  1.00 19.82 ? 64  PHE A N   1 
ATOM   408  C CA  . PHE A 1 64  ? 11.283 23.429 -2.050  1.00 19.70 ? 64  PHE A CA  1 
ATOM   409  C C   . PHE A 1 64  ? 9.803  23.395 -1.629  1.00 20.46 ? 64  PHE A C   1 
ATOM   410  O O   . PHE A 1 64  ? 9.059  24.347 -1.847  1.00 24.75 ? 64  PHE A O   1 
ATOM   411  C CB  . PHE A 1 64  ? 11.821 24.863 -2.255  1.00 18.54 ? 64  PHE A CB  1 
ATOM   412  C CG  . PHE A 1 64  ? 12.022 25.636 -0.976  1.00 20.30 ? 64  PHE A CG  1 
ATOM   413  C CD1 . PHE A 1 64  ? 12.556 25.021 0.165   1.00 22.56 ? 64  PHE A CD1 1 
ATOM   414  C CD2 . PHE A 1 64  ? 11.661 26.975 -0.891  1.00 25.24 ? 64  PHE A CD2 1 
ATOM   415  C CE1 . PHE A 1 64  ? 12.722 25.727 1.367   1.00 18.99 ? 64  PHE A CE1 1 
ATOM   416  C CE2 . PHE A 1 64  ? 11.828 27.691 0.318   1.00 24.08 ? 64  PHE A CE2 1 
ATOM   417  C CZ  . PHE A 1 64  ? 12.358 27.060 1.439   1.00 22.49 ? 64  PHE A CZ  1 
ATOM   418  N N   . VAL A 1 65  ? 9.381  22.273 -1.063  1.00 19.59 ? 65  VAL A N   1 
ATOM   419  C CA  . VAL A 1 65  ? 8.002  22.043 -0.623  1.00 17.57 ? 65  VAL A CA  1 
ATOM   420  C C   . VAL A 1 65  ? 7.797  22.487 0.822   1.00 18.92 ? 65  VAL A C   1 
ATOM   421  O O   . VAL A 1 65  ? 8.764  22.792 1.503   1.00 20.33 ? 65  VAL A O   1 
ATOM   422  C CB  . VAL A 1 65  ? 7.653  20.503 -0.741  1.00 16.77 ? 65  VAL A CB  1 
ATOM   423  C CG1 . VAL A 1 65  ? 7.745  20.036 -2.191  1.00 15.20 ? 65  VAL A CG1 1 
ATOM   424  C CG2 . VAL A 1 65  ? 8.561  19.645 0.186   1.00 16.55 ? 65  VAL A CG2 1 
ATOM   425  N N   . GLU A 1 66  ? 6.550  22.529 1.296   1.00 21.75 ? 66  GLU A N   1 
ATOM   426  C CA  . GLU A 1 66  ? 6.260  22.904 2.694   1.00 25.00 ? 66  GLU A CA  1 
ATOM   427  C C   . GLU A 1 66  ? 7.029  21.974 3.594   1.00 23.93 ? 66  GLU A C   1 
ATOM   428  O O   . GLU A 1 66  ? 7.184  20.799 3.280   1.00 23.01 ? 66  GLU A O   1 
ATOM   429  C CB  . GLU A 1 66  ? 4.779  22.737 3.054   1.00 24.10 ? 66  GLU A CB  1 
ATOM   430  C CG  . GLU A 1 66  ? 3.858  23.682 2.360   1.00 41.87 ? 66  GLU A CG  1 
ATOM   431  C CD  . GLU A 1 66  ? 2.364  23.422 2.666   1.00 49.88 ? 66  GLU A CD  1 
ATOM   432  O OE1 . GLU A 1 66  ? 2.036  22.298 3.095   1.00 46.29 ? 66  GLU A OE1 1 
ATOM   433  O OE2 . GLU A 1 66  ? 1.513  24.339 2.440   1.00 56.46 ? 66  GLU A OE2 1 
ATOM   434  N N   . GLY A 1 67  ? 7.513  22.487 4.715   1.00 21.60 ? 67  GLY A N   1 
ATOM   435  C CA  . GLY A 1 67  ? 8.220  21.640 5.647   1.00 20.97 ? 67  GLY A CA  1 
ATOM   436  C C   . GLY A 1 67  ? 8.889  22.546 6.636   1.00 21.59 ? 67  GLY A C   1 
ATOM   437  O O   . GLY A 1 67  ? 8.725  23.776 6.540   1.00 21.10 ? 67  GLY A O   1 
ATOM   438  N N   . ILE A 1 68  ? 9.607  21.954 7.590   1.00 19.98 ? 68  ILE A N   1 
ATOM   439  C CA  . ILE A 1 68  ? 10.343 22.711 8.596   1.00 17.06 ? 68  ILE A CA  1 
ATOM   440  C C   . ILE A 1 68  ? 11.745 22.521 8.135   1.00 18.84 ? 68  ILE A C   1 
ATOM   441  O O   . ILE A 1 68  ? 12.154 21.386 7.831   1.00 15.34 ? 68  ILE A O   1 
ATOM   442  C CB  . ILE A 1 68  ? 10.177 22.159 10.012  1.00 16.63 ? 68  ILE A CB  1 
ATOM   443  C CG1 . ILE A 1 68  ? 8.726  22.304 10.455  1.00 22.54 ? 68  ILE A CG1 1 
ATOM   444  C CG2 . ILE A 1 68  ? 10.997 22.982 10.988  1.00 16.69 ? 68  ILE A CG2 1 
ATOM   445  C CD1 . ILE A 1 68  ? 8.402  21.607 11.766  1.00 22.74 ? 68  ILE A CD1 1 
ATOM   446  N N   . TYR A 1 69  ? 12.425 23.650 7.954   1.00 16.83 ? 69  TYR A N   1 
ATOM   447  C CA  . TYR A 1 69  ? 13.803 23.694 7.469   1.00 18.03 ? 69  TYR A CA  1 
ATOM   448  C C   . TYR A 1 69  ? 14.740 24.258 8.505   1.00 17.86 ? 69  TYR A C   1 
ATOM   449  O O   . TYR A 1 69  ? 14.342 25.094 9.313   1.00 17.13 ? 69  TYR A O   1 
ATOM   450  C CB  . TYR A 1 69  ? 13.918 24.527 6.171   1.00 12.47 ? 69  TYR A CB  1 
ATOM   451  C CG  . TYR A 1 69  ? 13.230 23.862 5.004   1.00 15.59 ? 69  TYR A CG  1 
ATOM   452  C CD1 . TYR A 1 69  ? 11.857 24.014 4.802   1.00 13.37 ? 69  TYR A CD1 1 
ATOM   453  C CD2 . TYR A 1 69  ? 13.932 23.060 4.124   1.00 13.50 ? 69  TYR A CD2 1 
ATOM   454  C CE1 . TYR A 1 69  ? 11.205 23.386 3.765   1.00 15.80 ? 69  TYR A CE1 1 
ATOM   455  C CE2 . TYR A 1 69  ? 13.283 22.437 3.065   1.00 14.36 ? 69  TYR A CE2 1 
ATOM   456  C CZ  . TYR A 1 69  ? 11.926 22.611 2.901   1.00 17.20 ? 69  TYR A CZ  1 
ATOM   457  O OH  . TYR A 1 69  ? 11.299 22.051 1.833   1.00 19.65 ? 69  TYR A OH  1 
ATOM   458  N N   . LYS A 1 70  ? 15.986 23.795 8.465   1.00 20.12 ? 70  LYS A N   1 
ATOM   459  C CA  . LYS A 1 70  ? 17.032 24.293 9.350   1.00 18.88 ? 70  LYS A CA  1 
ATOM   460  C C   . LYS A 1 70  ? 18.200 24.717 8.492   1.00 17.19 ? 70  LYS A C   1 
ATOM   461  O O   . LYS A 1 70  ? 18.671 23.925 7.681   1.00 18.32 ? 70  LYS A O   1 
ATOM   462  C CB  . LYS A 1 70  ? 17.488 23.222 10.314  1.00 17.90 ? 70  LYS A CB  1 
ATOM   463  C CG  . LYS A 1 70  ? 18.880 23.447 10.823  1.00 23.00 ? 70  LYS A CG  1 
ATOM   464  C CD  . LYS A 1 70  ? 18.971 23.384 12.301  1.00 29.22 ? 70  LYS A CD  1 
ATOM   465  C CE  . LYS A 1 70  ? 18.699 22.003 12.818  1.00 32.34 ? 70  LYS A CE  1 
ATOM   466  N NZ  . LYS A 1 70  ? 19.695 21.059 12.255  1.00 39.46 ? 70  LYS A NZ  1 
ATOM   467  N N   . VAL A 1 71  ? 18.573 25.993 8.582   1.00 15.47 ? 71  VAL A N   1 
ATOM   468  C CA  . VAL A 1 71  ? 19.733 26.529 7.879   1.00 14.81 ? 71  VAL A CA  1 
ATOM   469  C C   . VAL A 1 71  ? 20.848 26.669 8.906   1.00 17.78 ? 71  VAL A C   1 
ATOM   470  O O   . VAL A 1 71  ? 20.725 27.377 9.919   1.00 17.22 ? 71  VAL A O   1 
ATOM   471  C CB  . VAL A 1 71  ? 19.466 27.880 7.265   1.00 14.05 ? 71  VAL A CB  1 
ATOM   472  C CG1 . VAL A 1 71  ? 20.709 28.362 6.560   1.00 12.07 ? 71  VAL A CG1 1 
ATOM   473  C CG2 . VAL A 1 71  ? 18.296 27.777 6.335   1.00 15.46 ? 71  VAL A CG2 1 
ATOM   474  N N   . GLU A 1 72  ? 21.943 25.983 8.641   1.00 18.03 ? 72  GLU A N   1 
ATOM   475  C CA  . GLU A 1 72  ? 23.085 25.973 9.531   1.00 17.99 ? 72  GLU A CA  1 
ATOM   476  C C   . GLU A 1 72  ? 24.242 26.678 8.836   1.00 16.31 ? 72  GLU A C   1 
ATOM   477  O O   . GLU A 1 72  ? 24.576 26.384 7.681   1.00 16.14 ? 72  GLU A O   1 
ATOM   478  C CB  . GLU A 1 72  ? 23.408 24.535 9.847   1.00 21.38 ? 72  GLU A CB  1 
ATOM   479  C CG  . GLU A 1 72  ? 24.310 24.333 10.961  1.00 31.21 ? 72  GLU A CG  1 
ATOM   480  C CD  . GLU A 1 72  ? 24.436 22.873 11.212  1.00 40.45 ? 72  GLU A CD  1 
ATOM   481  O OE1 . GLU A 1 72  ? 25.228 22.248 10.468  1.00 46.48 ? 72  GLU A OE1 1 
ATOM   482  O OE2 . GLU A 1 72  ? 23.701 22.358 12.091  1.00 39.05 ? 72  GLU A OE2 1 
ATOM   483  N N   . ILE A 1 73  ? 24.782 27.684 9.511   1.00 16.23 ? 73  ILE A N   1 
ATOM   484  C CA  . ILE A 1 73  ? 25.861 28.489 8.957   1.00 16.44 ? 73  ILE A CA  1 
ATOM   485  C C   . ILE A 1 73  ? 27.100 28.151 9.734   1.00 16.37 ? 73  ILE A C   1 
ATOM   486  O O   . ILE A 1 73  ? 27.082 28.295 10.943  1.00 17.37 ? 73  ILE A O   1 
ATOM   487  C CB  . ILE A 1 73  ? 25.487 29.995 9.088   1.00 17.10 ? 73  ILE A CB  1 
ATOM   488  C CG1 . ILE A 1 73  ? 24.223 30.267 8.262   1.00 18.62 ? 73  ILE A CG1 1 
ATOM   489  C CG2 . ILE A 1 73  ? 26.572 30.863 8.528   1.00 11.92 ? 73  ILE A CG2 1 
ATOM   490  C CD1 . ILE A 1 73  ? 23.639 31.599 8.468   1.00 19.39 ? 73  ILE A CD1 1 
ATOM   491  N N   . ASP A 1 74  ? 28.137 27.626 9.073   1.00 19.77 ? 74  ASP A N   1 
ATOM   492  C CA  . ASP A 1 74  ? 29.360 27.247 9.782   1.00 23.71 ? 74  ASP A CA  1 
ATOM   493  C C   . ASP A 1 74  ? 30.206 28.429 10.161  1.00 20.86 ? 74  ASP A C   1 
ATOM   494  O O   . ASP A 1 74  ? 31.322 28.599 9.653   1.00 18.63 ? 74  ASP A O   1 
ATOM   495  C CB  . ASP A 1 74  ? 30.249 26.252 9.025   1.00 31.72 ? 74  ASP A CB  1 
ATOM   496  C CG  . ASP A 1 74  ? 31.289 25.532 9.972   1.00 50.82 ? 74  ASP A CG  1 
ATOM   497  O OD1 . ASP A 1 74  ? 31.458 25.945 11.180  1.00 51.60 ? 74  ASP A OD1 1 
ATOM   498  O OD2 . ASP A 1 74  ? 31.906 24.514 9.518   1.00 58.70 ? 74  ASP A OD2 1 
ATOM   499  N N   . THR A 1 75  ? 29.731 29.138 11.175  1.00 22.50 ? 75  THR A N   1 
ATOM   500  C CA  . THR A 1 75  ? 30.402 30.328 11.667  1.00 24.62 ? 75  THR A CA  1 
ATOM   501  C C   . THR A 1 75  ? 31.748 30.017 12.322  1.00 24.91 ? 75  THR A C   1 
ATOM   502  O O   . THR A 1 75  ? 32.676 30.805 12.194  1.00 22.42 ? 75  THR A O   1 
ATOM   503  C CB  . THR A 1 75  ? 29.514 31.046 12.669  1.00 24.59 ? 75  THR A CB  1 
ATOM   504  O OG1 . THR A 1 75  ? 29.209 30.137 13.734  1.00 21.45 ? 75  THR A OG1 1 
ATOM   505  C CG2 . THR A 1 75  ? 28.206 31.484 12.001  1.00 22.28 ? 75  THR A CG2 1 
ATOM   506  N N   . LYS A 1 76  ? 31.843 28.881 13.016  1.00 24.51 ? 76  LYS A N   1 
ATOM   507  C CA  . LYS A 1 76  ? 33.087 28.513 13.686  1.00 28.43 ? 76  LYS A CA  1 
ATOM   508  C C   . LYS A 1 76  ? 34.282 28.403 12.737  1.00 28.84 ? 76  LYS A C   1 
ATOM   509  O O   . LYS A 1 76  ? 35.340 28.985 13.007  1.00 29.53 ? 76  LYS A O   1 
ATOM   510  C CB  . LYS A 1 76  ? 32.956 27.234 14.526  1.00 28.07 ? 76  LYS A CB  1 
ATOM   511  C CG  . LYS A 1 76  ? 34.105 27.108 15.545  1.00 31.16 ? 76  LYS A CG  1 
ATOM   512  C CD  . LYS A 1 76  ? 33.936 25.967 16.524  1.00 39.27 ? 76  LYS A CD  1 
ATOM   513  C CE  . LYS A 1 76  ? 34.574 26.301 17.883  1.00 48.47 ? 76  LYS A CE  1 
ATOM   514  N NZ  . LYS A 1 76  ? 33.975 27.538 18.552  1.00 51.74 ? 76  LYS A NZ  1 
ATOM   515  N N   . SER A 1 77  ? 34.108 27.723 11.610  1.00 27.18 ? 77  SER A N   1 
ATOM   516  C CA  . SER A 1 77  ? 35.200 27.582 10.642  1.00 29.92 ? 77  SER A CA  1 
ATOM   517  C C   . SER A 1 77  ? 35.650 28.910 10.136  1.00 28.68 ? 77  SER A C   1 
ATOM   518  O O   . SER A 1 77  ? 36.836 29.148 9.997   1.00 31.33 ? 77  SER A O   1 
ATOM   519  C CB  . SER A 1 77  ? 34.760 26.787 9.432   1.00 29.59 ? 77  SER A CB  1 
ATOM   520  O OG  . SER A 1 77  ? 34.513 25.453 9.810   1.00 41.63 ? 77  SER A OG  1 
ATOM   521  N N   . TYR A 1 78  ? 34.671 29.746 9.816   1.00 25.25 ? 78  TYR A N   1 
ATOM   522  C CA  . TYR A 1 78  ? 34.909 31.070 9.299   1.00 23.84 ? 78  TYR A CA  1 
ATOM   523  C C   . TYR A 1 78  ? 35.857 31.884 10.195  1.00 27.12 ? 78  TYR A C   1 
ATOM   524  O O   . TYR A 1 78  ? 36.896 32.384 9.718   1.00 30.28 ? 78  TYR A O   1 
ATOM   525  C CB  . TYR A 1 78  ? 33.566 31.802 9.148   1.00 19.08 ? 78  TYR A CB  1 
ATOM   526  C CG  . TYR A 1 78  ? 33.725 33.217 8.628   1.00 20.89 ? 78  TYR A CG  1 
ATOM   527  C CD1 . TYR A 1 78  ? 34.063 33.440 7.289   1.00 17.37 ? 78  TYR A CD1 1 
ATOM   528  C CD2 . TYR A 1 78  ? 33.589 34.328 9.475   1.00 18.43 ? 78  TYR A CD2 1 
ATOM   529  C CE1 . TYR A 1 78  ? 34.264 34.701 6.804   1.00 21.48 ? 78  TYR A CE1 1 
ATOM   530  C CE2 . TYR A 1 78  ? 33.794 35.620 8.982   1.00 20.74 ? 78  TYR A CE2 1 
ATOM   531  C CZ  . TYR A 1 78  ? 34.132 35.792 7.645   1.00 19.13 ? 78  TYR A CZ  1 
ATOM   532  O OH  . TYR A 1 78  ? 34.341 37.028 7.099   1.00 23.33 ? 78  TYR A OH  1 
ATOM   533  N N   . TRP A 1 79  ? 35.490 32.053 11.469  1.00 24.14 ? 79  TRP A N   1 
ATOM   534  C CA  . TRP A 1 79  ? 36.314 32.830 12.383  1.00 27.93 ? 79  TRP A CA  1 
ATOM   535  C C   . TRP A 1 79  ? 37.667 32.203 12.642  1.00 29.68 ? 79  TRP A C   1 
ATOM   536  O O   . TRP A 1 79  ? 38.621 32.920 12.851  1.00 26.87 ? 79  TRP A O   1 
ATOM   537  C CB  . TRP A 1 79  ? 35.613 33.063 13.715  1.00 26.62 ? 79  TRP A CB  1 
ATOM   538  C CG  . TRP A 1 79  ? 34.388 33.907 13.606  1.00 23.54 ? 79  TRP A CG  1 
ATOM   539  C CD1 . TRP A 1 79  ? 33.124 33.539 13.907  1.00 20.47 ? 79  TRP A CD1 1 
ATOM   540  C CD2 . TRP A 1 79  ? 34.324 35.269 13.198  1.00 24.57 ? 79  TRP A CD2 1 
ATOM   541  N NE1 . TRP A 1 79  ? 32.270 34.583 13.727  1.00 20.88 ? 79  TRP A NE1 1 
ATOM   542  C CE2 . TRP A 1 79  ? 32.977 35.665 13.290  1.00 21.70 ? 79  TRP A CE2 1 
ATOM   543  C CE3 . TRP A 1 79  ? 35.274 36.199 12.766  1.00 23.08 ? 79  TRP A CE3 1 
ATOM   544  C CZ2 . TRP A 1 79  ? 32.549 36.959 12.967  1.00 18.96 ? 79  TRP A CZ2 1 
ATOM   545  C CZ3 . TRP A 1 79  ? 34.849 37.479 12.454  1.00 24.03 ? 79  TRP A CZ3 1 
ATOM   546  C CH2 . TRP A 1 79  ? 33.490 37.848 12.554  1.00 22.60 ? 79  TRP A CH2 1 
ATOM   547  N N   . LYS A 1 80  ? 37.724 30.872 12.703  1.00 35.57 ? 80  LYS A N   1 
ATOM   548  C CA  . LYS A 1 80  ? 38.990 30.151 12.936  1.00 40.56 ? 80  LYS A CA  1 
ATOM   549  C C   . LYS A 1 80  ? 40.014 30.540 11.869  1.00 41.35 ? 80  LYS A C   1 
ATOM   550  O O   . LYS A 1 80  ? 41.166 30.827 12.198  1.00 42.83 ? 80  LYS A O   1 
ATOM   551  C CB  . LYS A 1 80  ? 38.810 28.625 12.895  1.00 43.57 ? 80  LYS A CB  1 
ATOM   552  C CG  . LYS A 1 80  ? 38.041 28.010 14.040  1.00 51.64 ? 80  LYS A CG  1 
ATOM   553  C CD  . LYS A 1 80  ? 38.568 28.447 15.369  1.00 58.85 ? 80  LYS A CD  1 
ATOM   554  C CE  . LYS A 1 80  ? 37.738 27.851 16.483  1.00 64.73 ? 80  LYS A CE  1 
ATOM   555  N NZ  . LYS A 1 80  ? 38.049 28.467 17.822  1.00 72.81 ? 80  LYS A NZ  1 
ATOM   556  N N   . ALA A 1 81  ? 39.568 30.577 10.608  1.00 41.37 ? 81  ALA A N   1 
ATOM   557  C CA  . ALA A 1 81  ? 40.416 30.923 9.479   1.00 39.20 ? 81  ALA A CA  1 
ATOM   558  C C   . ALA A 1 81  ? 40.929 32.329 9.633   1.00 42.31 ? 81  ALA A C   1 
ATOM   559  O O   . ALA A 1 81  ? 42.013 32.637 9.157   1.00 47.23 ? 81  ALA A O   1 
ATOM   560  C CB  . ALA A 1 81  ? 39.663 30.786 8.218   1.00 40.49 ? 81  ALA A CB  1 
ATOM   561  N N   . LEU A 1 82  ? 40.167 33.184 10.310  1.00 41.35 ? 82  LEU A N   1 
ATOM   562  C CA  . LEU A 1 82  ? 40.595 34.556 10.537  1.00 39.78 ? 82  LEU A CA  1 
ATOM   563  C C   . LEU A 1 82  ? 41.457 34.647 11.803  1.00 39.48 ? 82  LEU A C   1 
ATOM   564  O O   . LEU A 1 82  ? 41.825 35.737 12.255  1.00 42.86 ? 82  LEU A O   1 
ATOM   565  C CB  . LEU A 1 82  ? 39.378 35.486 10.636  1.00 39.63 ? 82  LEU A CB  1 
ATOM   566  C CG  . LEU A 1 82  ? 38.452 35.498 9.405   1.00 43.22 ? 82  LEU A CG  1 
ATOM   567  C CD1 . LEU A 1 82  ? 37.529 36.733 9.422   1.00 42.41 ? 82  LEU A CD1 1 
ATOM   568  C CD2 . LEU A 1 82  ? 39.305 35.488 8.132   1.00 44.41 ? 82  LEU A CD2 1 
ATOM   569  N N   . GLY A 1 83  ? 41.781 33.494 12.377  1.00 39.88 ? 83  GLY A N   1 
ATOM   570  C CA  . GLY A 1 83  ? 42.594 33.446 13.576  1.00 35.53 ? 83  GLY A CA  1 
ATOM   571  C C   . GLY A 1 83  ? 41.866 33.979 14.771  1.00 41.04 ? 83  GLY A C   1 
ATOM   572  O O   . GLY A 1 83  ? 42.491 34.423 15.728  1.00 44.98 ? 83  GLY A O   1 
ATOM   573  N N   . ILE A 1 84  ? 40.536 33.965 14.723  1.00 42.56 ? 84  ILE A N   1 
ATOM   574  C CA  . ILE A 1 84  ? 39.723 34.430 15.844  1.00 40.80 ? 84  ILE A CA  1 
ATOM   575  C C   . ILE A 1 84  ? 39.057 33.208 16.500  1.00 39.55 ? 84  ILE A C   1 
ATOM   576  O O   . ILE A 1 84  ? 38.764 32.217 15.841  1.00 39.57 ? 84  ILE A O   1 
ATOM   577  C CB  . ILE A 1 84  ? 38.657 35.467 15.388  1.00 41.13 ? 84  ILE A CB  1 
ATOM   578  C CG1 . ILE A 1 84  ? 39.339 36.760 14.930  1.00 40.15 ? 84  ILE A CG1 1 
ATOM   579  C CG2 . ILE A 1 84  ? 37.682 35.743 16.520  1.00 42.52 ? 84  ILE A CG2 1 
ATOM   580  C CD1 . ILE A 1 84  ? 38.431 37.722 14.211  1.00 40.17 ? 84  ILE A CD1 1 
ATOM   581  N N   . SER A 1 85  ? 38.881 33.258 17.810  1.00 40.71 ? 85  SER A N   1 
ATOM   582  C CA  . SER A 1 85  ? 38.251 32.158 18.559  1.00 41.46 ? 85  SER A CA  1 
ATOM   583  C C   . SER A 1 85  ? 36.790 32.525 18.866  1.00 39.31 ? 85  SER A C   1 
ATOM   584  O O   . SER A 1 85  ? 36.503 33.259 19.819  1.00 41.40 ? 85  SER A O   1 
ATOM   585  C CB  . SER A 1 85  ? 39.008 31.914 19.862  1.00 46.30 ? 85  SER A CB  1 
ATOM   586  O OG  . SER A 1 85  ? 38.564 30.728 20.482  1.00 54.34 ? 85  SER A OG  1 
ATOM   587  N N   . PRO A 1 86  ? 35.851 31.972 18.089  1.00 33.91 ? 86  PRO A N   1 
ATOM   588  C CA  . PRO A 1 86  ? 34.415 32.216 18.216  1.00 32.90 ? 86  PRO A CA  1 
ATOM   589  C C   . PRO A 1 86  ? 33.760 31.543 19.411  1.00 30.46 ? 86  PRO A C   1 
ATOM   590  O O   . PRO A 1 86  ? 34.264 30.562 19.908  1.00 35.41 ? 86  PRO A O   1 
ATOM   591  C CB  . PRO A 1 86  ? 33.893 31.597 16.935  1.00 32.91 ? 86  PRO A CB  1 
ATOM   592  C CG  . PRO A 1 86  ? 34.764 30.373 16.826  1.00 30.10 ? 86  PRO A CG  1 
ATOM   593  C CD  . PRO A 1 86  ? 36.116 30.929 17.080  1.00 29.22 ? 86  PRO A CD  1 
ATOM   594  N N   . PHE A 1 87  ? 32.601 32.030 19.821  1.00 26.45 ? 87  PHE A N   1 
ATOM   595  C CA  . PHE A 1 87  ? 31.868 31.419 20.916  1.00 22.46 ? 87  PHE A CA  1 
ATOM   596  C C   . PHE A 1 87  ? 30.973 30.310 20.398  1.00 24.22 ? 87  PHE A C   1 
ATOM   597  O O   . PHE A 1 87  ? 30.936 29.204 20.971  1.00 27.77 ? 87  PHE A O   1 
ATOM   598  C CB  . PHE A 1 87  ? 30.972 32.435 21.565  1.00 18.16 ? 87  PHE A CB  1 
ATOM   599  C CG  . PHE A 1 87  ? 30.047 31.857 22.586  1.00 20.09 ? 87  PHE A CG  1 
ATOM   600  C CD1 . PHE A 1 87  ? 30.501 31.606 23.887  1.00 19.47 ? 87  PHE A CD1 1 
ATOM   601  C CD2 . PHE A 1 87  ? 28.689 31.655 22.276  1.00 20.68 ? 87  PHE A CD2 1 
ATOM   602  C CE1 . PHE A 1 87  ? 29.618 31.175 24.879  1.00 19.10 ? 87  PHE A CE1 1 
ATOM   603  C CE2 . PHE A 1 87  ? 27.785 31.221 23.244  1.00 23.23 ? 87  PHE A CE2 1 
ATOM   604  C CZ  . PHE A 1 87  ? 28.251 30.981 24.562  1.00 20.41 ? 87  PHE A CZ  1 
ATOM   605  N N   . HIS A 1 88  ? 30.258 30.587 19.303  1.00 22.81 ? 88  HIS A N   1 
ATOM   606  C CA  . HIS A 1 88  ? 29.311 29.617 18.739  1.00 22.28 ? 88  HIS A CA  1 
ATOM   607  C C   . HIS A 1 88  ? 29.892 28.516 17.864  1.00 21.91 ? 88  HIS A C   1 
ATOM   608  O O   . HIS A 1 88  ? 30.865 28.728 17.130  1.00 22.27 ? 88  HIS A O   1 
ATOM   609  C CB  . HIS A 1 88  ? 28.207 30.340 17.945  1.00 22.80 ? 88  HIS A CB  1 
ATOM   610  C CG  . HIS A 1 88  ? 27.518 31.418 18.722  1.00 22.03 ? 88  HIS A CG  1 
ATOM   611  N ND1 . HIS A 1 88  ? 27.907 32.745 18.656  1.00 23.19 ? 88  HIS A ND1 1 
ATOM   612  C CD2 . HIS A 1 88  ? 26.526 31.363 19.639  1.00 23.37 ? 88  HIS A CD2 1 
ATOM   613  C CE1 . HIS A 1 88  ? 27.188 33.455 19.507  1.00 23.78 ? 88  HIS A CE1 1 
ATOM   614  N NE2 . HIS A 1 88  ? 26.347 32.641 20.116  1.00 27.81 ? 88  HIS A NE2 1 
ATOM   615  N N   . GLU A 1 89  ? 29.261 27.349 17.931  1.00 17.31 ? 89  GLU A N   1 
ATOM   616  C CA  . GLU A 1 89  ? 29.642 26.222 17.082  1.00 20.11 ? 89  GLU A CA  1 
ATOM   617  C C   . GLU A 1 89  ? 29.203 26.580 15.657  1.00 21.28 ? 89  GLU A C   1 
ATOM   618  O O   . GLU A 1 89  ? 29.922 26.372 14.681  1.00 20.70 ? 89  GLU A O   1 
ATOM   619  C CB  . GLU A 1 89  ? 28.950 24.935 17.569  1.00 17.81 ? 89  GLU A CB  1 
ATOM   620  C CG  . GLU A 1 89  ? 29.626 24.346 18.810  1.00 23.61 ? 89  GLU A CG  1 
ATOM   621  C CD  . GLU A 1 89  ? 31.079 23.970 18.516  1.00 28.31 ? 89  GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 89  ? 31.270 23.183 17.577  1.00 36.12 ? 89  GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 89  ? 32.019 24.484 19.160  1.00 28.19 ? 89  GLU A OE2 1 
ATOM   624  N N   . HIS A 1 90  ? 28.009 27.144 15.567  1.00 18.11 ? 90  HIS A N   1 
ATOM   625  C CA  . HIS A 1 90  ? 27.429 27.596 14.318  1.00 19.23 ? 90  HIS A CA  1 
ATOM   626  C C   . HIS A 1 90  ? 26.168 28.354 14.639  1.00 18.84 ? 90  HIS A C   1 
ATOM   627  O O   . HIS A 1 90  ? 25.745 28.402 15.805  1.00 22.45 ? 90  HIS A O   1 
ATOM   628  C CB  . HIS A 1 90  ? 27.111 26.434 13.358  1.00 25.32 ? 90  HIS A CB  1 
ATOM   629  C CG  . HIS A 1 90  ? 26.356 25.316 13.981  1.00 28.90 ? 90  HIS A CG  1 
ATOM   630  N ND1 . HIS A 1 90  ? 26.912 24.066 14.168  1.00 31.44 ? 90  HIS A ND1 1 
ATOM   631  C CD2 . HIS A 1 90  ? 25.122 25.270 14.532  1.00 30.59 ? 90  HIS A CD2 1 
ATOM   632  C CE1 . HIS A 1 90  ? 26.050 23.302 14.820  1.00 31.04 ? 90  HIS A CE1 1 
ATOM   633  N NE2 . HIS A 1 90  ? 24.960 24.010 15.054  1.00 31.17 ? 90  HIS A NE2 1 
ATOM   634  N N   . ALA A 1 91  ? 25.592 28.980 13.618  1.00 16.77 ? 91  ALA A N   1 
ATOM   635  C CA  . ALA A 1 91  ? 24.350 29.716 13.751  1.00 19.23 ? 91  ALA A CA  1 
ATOM   636  C C   . ALA A 1 91  ? 23.279 28.868 13.050  1.00 23.50 ? 91  ALA A C   1 
ATOM   637  O O   . ALA A 1 91  ? 23.516 28.387 11.943  1.00 22.64 ? 91  ALA A O   1 
ATOM   638  C CB  . ALA A 1 91  ? 24.474 31.080 13.081  1.00 14.79 ? 91  ALA A CB  1 
ATOM   639  N N   . GLU A 1 92  ? 22.141 28.632 13.709  1.00 24.89 ? 92  GLU A N   1 
ATOM   640  C CA  . GLU A 1 92  ? 21.039 27.842 13.107  1.00 28.49 ? 92  GLU A CA  1 
ATOM   641  C C   . GLU A 1 92  ? 19.801 28.714 12.922  1.00 24.95 ? 92  GLU A C   1 
ATOM   642  O O   . GLU A 1 92  ? 19.494 29.579 13.737  1.00 23.23 ? 92  GLU A O   1 
ATOM   643  C CB  . GLU A 1 92  ? 20.617 26.668 13.984  1.00 32.23 ? 92  GLU A CB  1 
ATOM   644  C CG  . GLU A 1 92  ? 21.685 26.162 14.899  1.00 51.40 ? 92  GLU A CG  1 
ATOM   645  C CD  . GLU A 1 92  ? 22.214 24.808 14.467  1.00 62.05 ? 92  GLU A CD  1 
ATOM   646  O OE1 . GLU A 1 92  ? 22.471 24.613 13.251  1.00 66.55 ? 92  GLU A OE1 1 
ATOM   647  O OE2 . GLU A 1 92  ? 22.386 23.936 15.351  1.00 66.01 ? 92  GLU A OE2 1 
ATOM   648  N N   . VAL A 1 93  ? 19.092 28.489 11.845  1.00 19.98 ? 93  VAL A N   1 
ATOM   649  C CA  . VAL A 1 93  ? 17.879 29.230 11.600  1.00 21.75 ? 93  VAL A CA  1 
ATOM   650  C C   . VAL A 1 93  ? 16.856 28.135 11.270  1.00 18.93 ? 93  VAL A C   1 
ATOM   651  O O   . VAL A 1 93  ? 17.035 27.415 10.288  1.00 16.26 ? 93  VAL A O   1 
ATOM   652  C CB  . VAL A 1 93  ? 18.045 30.162 10.395  1.00 22.38 ? 93  VAL A CB  1 
ATOM   653  C CG1 . VAL A 1 93  ? 16.786 30.993 10.186  1.00 23.60 ? 93  VAL A CG1 1 
ATOM   654  C CG2 . VAL A 1 93  ? 19.261 31.056 10.611  1.00 29.18 ? 93  VAL A CG2 1 
ATOM   655  N N   . VAL A 1 94  ? 15.853 27.968 12.142  1.00 17.85 ? 94  VAL A N   1 
ATOM   656  C CA  . VAL A 1 94  ? 14.803 26.966 11.961  1.00 16.03 ? 94  VAL A CA  1 
ATOM   657  C C   . VAL A 1 94  ? 13.471 27.655 11.671  1.00 18.03 ? 94  VAL A C   1 
ATOM   658  O O   . VAL A 1 94  ? 13.024 28.503 12.442  1.00 15.86 ? 94  VAL A O   1 
ATOM   659  C CB  . VAL A 1 94  ? 14.661 25.999 13.203  1.00 13.26 ? 94  VAL A CB  1 
ATOM   660  C CG1 . VAL A 1 94  ? 13.710 24.935 12.901  1.00 14.79 ? 94  VAL A CG1 1 
ATOM   661  C CG2 . VAL A 1 94  ? 15.965 25.327 13.518  1.00 16.11 ? 94  VAL A CG2 1 
ATOM   662  N N   . PHE A 1 95  ? 12.827 27.283 10.569  1.00 17.00 ? 95  PHE A N   1 
ATOM   663  C CA  . PHE A 1 95  ? 11.555 27.876 10.220  1.00 16.92 ? 95  PHE A CA  1 
ATOM   664  C C   . PHE A 1 95  ? 10.685 26.958 9.370   1.00 15.73 ? 95  PHE A C   1 
ATOM   665  O O   . PHE A 1 95  ? 11.175 26.103 8.677   1.00 14.20 ? 95  PHE A O   1 
ATOM   666  C CB  . PHE A 1 95  ? 11.789 29.173 9.450   1.00 12.58 ? 95  PHE A CB  1 
ATOM   667  C CG  . PHE A 1 95  ? 12.522 28.983 8.154   1.00 16.28 ? 95  PHE A CG  1 
ATOM   668  C CD1 . PHE A 1 95  ? 13.896 28.719 8.143   1.00 17.91 ? 95  PHE A CD1 1 
ATOM   669  C CD2 . PHE A 1 95  ? 11.841 29.095 6.927   1.00 17.20 ? 95  PHE A CD2 1 
ATOM   670  C CE1 . PHE A 1 95  ? 14.600 28.563 6.907   1.00 19.27 ? 95  PHE A CE1 1 
ATOM   671  C CE2 . PHE A 1 95  ? 12.514 28.949 5.708   1.00 18.96 ? 95  PHE A CE2 1 
ATOM   672  C CZ  . PHE A 1 95  ? 13.909 28.677 5.700   1.00 19.34 ? 95  PHE A CZ  1 
ATOM   673  N N   . THR A 1 96  ? 9.386  27.199 9.406   1.00 17.15 ? 96  THR A N   1 
ATOM   674  C CA  . THR A 1 96  ? 8.433  26.496 8.590   1.00 19.24 ? 96  THR A CA  1 
ATOM   675  C C   . THR A 1 96  ? 8.376  27.301 7.292   1.00 21.04 ? 96  THR A C   1 
ATOM   676  O O   . THR A 1 96  ? 8.283  28.526 7.301   1.00 19.33 ? 96  THR A O   1 
ATOM   677  C CB  . THR A 1 96  ? 7.032  26.476 9.250   1.00 21.85 ? 96  THR A CB  1 
ATOM   678  O OG1 . THR A 1 96  ? 7.107  25.772 10.489  1.00 24.41 ? 96  THR A OG1 1 
ATOM   679  C CG2 . THR A 1 96  ? 6.037  25.751 8.368   1.00 23.37 ? 96  THR A CG2 1 
ATOM   680  N N   . ALA A 1 97  ? 8.470  26.612 6.166   1.00 21.43 ? 97  ALA A N   1 
ATOM   681  C CA  . ALA A 1 97  ? 8.439  27.270 4.874   1.00 24.31 ? 97  ALA A CA  1 
ATOM   682  C C   . ALA A 1 97  ? 7.248  26.810 4.049   1.00 27.11 ? 97  ALA A C   1 
ATOM   683  O O   . ALA A 1 97  ? 6.773  25.681 4.202   1.00 27.09 ? 97  ALA A O   1 
ATOM   684  C CB  . ALA A 1 97  ? 9.745  26.989 4.119   1.00 22.49 ? 97  ALA A CB  1 
ATOM   685  N N   . ASN A 1 98  ? 6.783  27.711 3.185   1.00 33.05 ? 98  ASN A N   1 
ATOM   686  C CA  . ASN A 1 98  ? 5.665  27.519 2.257   1.00 38.52 ? 98  ASN A CA  1 
ATOM   687  C C   . ASN A 1 98  ? 4.350  26.983 2.779   1.00 42.12 ? 98  ASN A C   1 
ATOM   688  O O   . ASN A 1 98  ? 3.538  26.522 1.990   1.00 41.03 ? 98  ASN A O   1 
ATOM   689  C CB  . ASN A 1 98  ? 6.109  26.679 1.059   1.00 34.89 ? 98  ASN A CB  1 
ATOM   690  C CG  . ASN A 1 98  ? 7.428  27.110 0.536   1.00 35.10 ? 98  ASN A CG  1 
ATOM   691  O OD1 . ASN A 1 98  ? 8.392  26.362 0.585   1.00 33.12 ? 98  ASN A OD1 1 
ATOM   692  N ND2 . ASN A 1 98  ? 7.533  28.370 0.193   1.00 30.03 ? 98  ASN A ND2 1 
ATOM   693  N N   . ASP A 1 99  ? 4.144  27.016 4.088   1.00 48.34 ? 99  ASP A N   1 
ATOM   694  C CA  . ASP A 1 99  ? 2.912  26.519 4.677   1.00 55.65 ? 99  ASP A CA  1 
ATOM   695  C C   . ASP A 1 99  ? 1.699  27.228 4.078   1.00 59.44 ? 99  ASP A C   1 
ATOM   696  O O   . ASP A 1 99  ? 0.652  26.620 3.897   1.00 61.32 ? 99  ASP A O   1 
ATOM   697  C CB  . ASP A 1 99  ? 2.949  26.639 6.198   1.00 56.79 ? 99  ASP A CB  1 
ATOM   698  C CG  . ASP A 1 99  ? 3.301  28.033 6.664   1.00 64.39 ? 99  ASP A CG  1 
ATOM   699  O OD1 . ASP A 1 99  ? 4.171  28.699 6.046   1.00 66.97 ? 99  ASP A OD1 1 
ATOM   700  O OD2 . ASP A 1 99  ? 2.710  28.471 7.672   1.00 70.62 ? 99  ASP A OD2 1 
ATOM   701  N N   . SER A 1 100 ? 1.871  28.484 3.680   1.00 62.76 ? 100 SER A N   1 
ATOM   702  C CA  . SER A 1 100 ? 0.785  29.253 3.072   1.00 64.82 ? 100 SER A CA  1 
ATOM   703  C C   . SER A 1 100 ? 1.097  29.523 1.608   1.00 62.40 ? 100 SER A C   1 
ATOM   704  O O   . SER A 1 100 ? 0.734  30.554 1.080   1.00 62.87 ? 100 SER A O   1 
ATOM   705  C CB  . SER A 1 100 ? 0.590  30.582 3.806   1.00 68.64 ? 100 SER A CB  1 
ATOM   706  O OG  . SER A 1 100 ? 0.482  30.379 5.209   1.00 75.62 ? 100 SER A OG  1 
ATOM   707  N N   . GLY A 1 101 ? 1.744  28.571 0.952   1.00 61.13 ? 101 GLY A N   1 
ATOM   708  C CA  . GLY A 1 101 ? 2.103  28.732 -0.439  1.00 58.19 ? 101 GLY A CA  1 
ATOM   709  C C   . GLY A 1 101 ? 3.555  29.124 -0.528  1.00 58.48 ? 101 GLY A C   1 
ATOM   710  O O   . GLY A 1 101 ? 4.139  29.535 0.470   1.00 57.24 ? 101 GLY A O   1 
ATOM   711  N N   . PRO A 1 102 ? 4.178  28.985 -1.703  1.00 58.68 ? 102 PRO A N   1 
ATOM   712  C CA  . PRO A 1 102 ? 5.584  29.329 -1.917  1.00 59.32 ? 102 PRO A CA  1 
ATOM   713  C C   . PRO A 1 102 ? 5.886  30.809 -1.864  1.00 57.53 ? 102 PRO A C   1 
ATOM   714  O O   . PRO A 1 102 ? 5.173  31.610 -2.468  1.00 57.57 ? 102 PRO A O   1 
ATOM   715  C CB  . PRO A 1 102 ? 5.858  28.788 -3.306  1.00 60.11 ? 102 PRO A CB  1 
ATOM   716  C CG  . PRO A 1 102 ? 4.552  28.924 -3.966  1.00 58.97 ? 102 PRO A CG  1 
ATOM   717  C CD  . PRO A 1 102 ? 3.610  28.409 -2.925  1.00 58.75 ? 102 PRO A CD  1 
ATOM   718  N N   . ARG A 1 103 ? 6.983  31.135 -1.176  1.00 52.98 ? 103 ARG A N   1 
ATOM   719  C CA  . ARG A 1 103 ? 7.465  32.487 -1.002  1.00 44.82 ? 103 ARG A CA  1 
ATOM   720  C C   . ARG A 1 103 ? 8.945  32.403 -1.360  1.00 39.80 ? 103 ARG A C   1 
ATOM   721  O O   . ARG A 1 103 ? 9.435  31.307 -1.653  1.00 35.75 ? 103 ARG A O   1 
ATOM   722  C CB  . ARG A 1 103 ? 7.304  32.873 0.456   1.00 42.20 ? 103 ARG A CB  1 
ATOM   723  C CG  . ARG A 1 103 ? 5.940  32.613 1.019   1.00 36.71 ? 103 ARG A CG  1 
ATOM   724  C CD  . ARG A 1 103 ? 4.936  33.547 0.364   1.00 47.74 ? 103 ARG A CD  1 
ATOM   725  N NE  . ARG A 1 103 ? 3.666  33.598 1.087   1.00 56.46 ? 103 ARG A NE  1 
ATOM   726  C CZ  . ARG A 1 103 ? 2.518  33.064 0.669   1.00 59.15 ? 103 ARG A CZ  1 
ATOM   727  N NH1 . ARG A 1 103 ? 2.459  32.426 -0.496  1.00 58.35 ? 103 ARG A NH1 1 
ATOM   728  N NH2 . ARG A 1 103 ? 1.434  33.138 1.445   1.00 59.46 ? 103 ARG A NH2 1 
ATOM   729  N N   . ARG A 1 104 ? 9.604  33.557 -1.460  1.00 35.27 ? 104 ARG A N   1 
ATOM   730  C CA  . ARG A 1 104 ? 11.036 33.634 -1.720  1.00 32.31 ? 104 ARG A CA  1 
ATOM   731  C C   . ARG A 1 104 ? 11.563 34.011 -0.331  1.00 28.02 ? 104 ARG A C   1 
ATOM   732  O O   . ARG A 1 104 ? 11.030 34.897 0.306   1.00 24.02 ? 104 ARG A O   1 
ATOM   733  C CB  . ARG A 1 104 ? 11.400 34.706 -2.738  1.00 38.15 ? 104 ARG A CB  1 
ATOM   734  C CG  . ARG A 1 104 ? 10.758 34.554 -4.126  1.00 54.96 ? 104 ARG A CG  1 
ATOM   735  C CD  . ARG A 1 104 ? 10.775 33.135 -4.682  1.00 66.51 ? 104 ARG A CD  1 
ATOM   736  N NE  . ARG A 1 104 ? 9.449  32.498 -4.626  1.00 80.22 ? 104 ARG A NE  1 
ATOM   737  C CZ  . ARG A 1 104 ? 9.016  31.543 -5.461  1.00 84.73 ? 104 ARG A CZ  1 
ATOM   738  N NH1 . ARG A 1 104 ? 9.800  31.088 -6.437  1.00 85.44 ? 104 ARG A NH1 1 
ATOM   739  N NH2 . ARG A 1 104 ? 7.789  31.039 -5.322  1.00 84.96 ? 104 ARG A NH2 1 
ATOM   740  N N   . TYR A 1 105 ? 12.552 33.278 0.157   1.00 23.05 ? 105 TYR A N   1 
ATOM   741  C CA  . TYR A 1 105 ? 13.130 33.478 1.466   1.00 17.53 ? 105 TYR A CA  1 
ATOM   742  C C   . TYR A 1 105 ? 14.564 33.887 1.364   1.00 18.31 ? 105 TYR A C   1 
ATOM   743  O O   . TYR A 1 105 ? 15.342 33.225 0.701   1.00 17.81 ? 105 TYR A O   1 
ATOM   744  C CB  . TYR A 1 105 ? 13.133 32.169 2.259   1.00 16.67 ? 105 TYR A CB  1 
ATOM   745  C CG  . TYR A 1 105 ? 11.769 31.640 2.587   1.00 18.47 ? 105 TYR A CG  1 
ATOM   746  C CD1 . TYR A 1 105 ? 11.112 32.040 3.756   1.00 20.73 ? 105 TYR A CD1 1 
ATOM   747  C CD2 . TYR A 1 105 ? 11.104 30.783 1.706   1.00 22.17 ? 105 TYR A CD2 1 
ATOM   748  C CE1 . TYR A 1 105 ? 9.824  31.616 4.041   1.00 22.16 ? 105 TYR A CE1 1 
ATOM   749  C CE2 . TYR A 1 105 ? 9.821  30.350 1.971   1.00 21.85 ? 105 TYR A CE2 1 
ATOM   750  C CZ  . TYR A 1 105 ? 9.184  30.776 3.137   1.00 26.65 ? 105 TYR A CZ  1 
ATOM   751  O OH  . TYR A 1 105 ? 7.893  30.405 3.386   1.00 25.71 ? 105 TYR A OH  1 
ATOM   752  N N   . THR A 1 106 ? 14.896 35.011 1.983   1.00 17.70 ? 106 THR A N   1 
ATOM   753  C CA  . THR A 1 106 ? 16.272 35.466 2.057   1.00 17.69 ? 106 THR A CA  1 
ATOM   754  C C   . THR A 1 106 ? 16.602 35.438 3.536   1.00 16.95 ? 106 THR A C   1 
ATOM   755  O O   . THR A 1 106 ? 15.895 36.073 4.328   1.00 16.18 ? 106 THR A O   1 
ATOM   756  C CB  . THR A 1 106 ? 16.453 36.876 1.573   1.00 18.07 ? 106 THR A CB  1 
ATOM   757  O OG1 . THR A 1 106 ? 16.101 36.935 0.192   1.00 22.59 ? 106 THR A OG1 1 
ATOM   758  C CG2 . THR A 1 106 ? 17.901 37.288 1.759   1.00 17.21 ? 106 THR A CG2 1 
ATOM   759  N N   . ILE A 1 107 ? 17.568 34.596 3.920   1.00 15.22 ? 107 ILE A N   1 
ATOM   760  C CA  . ILE A 1 107 ? 17.967 34.481 5.316   1.00 17.23 ? 107 ILE A CA  1 
ATOM   761  C C   . ILE A 1 107 ? 19.264 35.276 5.384   1.00 19.52 ? 107 ILE A C   1 
ATOM   762  O O   . ILE A 1 107 ? 20.205 35.001 4.643   1.00 19.53 ? 107 ILE A O   1 
ATOM   763  C CB  . ILE A 1 107 ? 18.277 33.032 5.730   1.00 19.73 ? 107 ILE A CB  1 
ATOM   764  C CG1 . ILE A 1 107 ? 17.094 32.068 5.449   1.00 20.51 ? 107 ILE A CG1 1 
ATOM   765  C CG2 . ILE A 1 107 ? 18.795 33.017 7.137   1.00 19.08 ? 107 ILE A CG2 1 
ATOM   766  C CD1 . ILE A 1 107 ? 15.751 32.445 6.032   1.00 25.73 ? 107 ILE A CD1 1 
ATOM   767  N N   . ALA A 1 108 ? 19.300 36.309 6.202   1.00 20.66 ? 108 ALA A N   1 
ATOM   768  C CA  . ALA A 1 108 ? 20.518 37.104 6.300   1.00 21.89 ? 108 ALA A CA  1 
ATOM   769  C C   . ALA A 1 108 ? 21.107 36.888 7.674   1.00 21.53 ? 108 ALA A C   1 
ATOM   770  O O   . ALA A 1 108 ? 20.347 36.750 8.660   1.00 25.01 ? 108 ALA A O   1 
ATOM   771  C CB  . ALA A 1 108 ? 20.203 38.566 6.088   1.00 20.08 ? 108 ALA A CB  1 
ATOM   772  N N   . ALA A 1 109 ? 22.434 36.802 7.753   1.00 19.23 ? 109 ALA A N   1 
ATOM   773  C CA  . ALA A 1 109 ? 23.096 36.639 9.038   1.00 15.41 ? 109 ALA A CA  1 
ATOM   774  C C   . ALA A 1 109 ? 24.216 37.681 9.163   1.00 16.19 ? 109 ALA A C   1 
ATOM   775  O O   . ALA A 1 109 ? 24.963 37.932 8.213   1.00 18.18 ? 109 ALA A O   1 
ATOM   776  C CB  . ALA A 1 109 ? 23.641 35.262 9.161   1.00 11.30 ? 109 ALA A CB  1 
ATOM   777  N N   . LEU A 1 110 ? 24.321 38.308 10.319  1.00 14.79 ? 110 LEU A N   1 
ATOM   778  C CA  . LEU A 1 110 ? 25.351 39.303 10.541  1.00 15.26 ? 110 LEU A CA  1 
ATOM   779  C C   . LEU A 1 110 ? 26.210 38.700 11.627  1.00 14.43 ? 110 LEU A C   1 
ATOM   780  O O   . LEU A 1 110 ? 25.699 38.442 12.722  1.00 17.56 ? 110 LEU A O   1 
ATOM   781  C CB  . LEU A 1 110 ? 24.720 40.616 11.001  1.00 16.18 ? 110 LEU A CB  1 
ATOM   782  C CG  . LEU A 1 110 ? 25.767 41.665 11.445  1.00 21.53 ? 110 LEU A CG  1 
ATOM   783  C CD1 . LEU A 1 110 ? 26.643 42.113 10.250  1.00 15.01 ? 110 LEU A CD1 1 
ATOM   784  C CD2 . LEU A 1 110 ? 25.046 42.822 12.080  1.00 19.83 ? 110 LEU A CD2 1 
ATOM   785  N N   . LEU A 1 111 ? 27.501 38.535 11.359  1.00 13.05 ? 111 LEU A N   1 
ATOM   786  C CA  . LEU A 1 111 ? 28.400 37.853 12.309  1.00 17.97 ? 111 LEU A CA  1 
ATOM   787  C C   . LEU A 1 111 ? 29.508 38.588 13.062  1.00 16.46 ? 111 LEU A C   1 
ATOM   788  O O   . LEU A 1 111 ? 30.302 39.305 12.458  1.00 14.94 ? 111 LEU A O   1 
ATOM   789  C CB  . LEU A 1 111 ? 29.089 36.655 11.609  1.00 19.68 ? 111 LEU A CB  1 
ATOM   790  C CG  . LEU A 1 111 ? 28.361 35.664 10.670  1.00 17.59 ? 111 LEU A CG  1 
ATOM   791  C CD1 . LEU A 1 111 ? 29.421 34.698 10.107  1.00 14.12 ? 111 LEU A CD1 1 
ATOM   792  C CD2 . LEU A 1 111 ? 27.201 34.959 11.392  1.00 14.95 ? 111 LEU A CD2 1 
ATOM   793  N N   . SER A 1 112 ? 29.650 38.230 14.339  1.00 14.72 ? 112 SER A N   1 
ATOM   794  C CA  . SER A 1 112 ? 30.721 38.730 15.224  1.00 17.34 ? 112 SER A CA  1 
ATOM   795  C C   . SER A 1 112 ? 31.167 37.494 16.002  1.00 17.70 ? 112 SER A C   1 
ATOM   796  O O   . SER A 1 112 ? 30.447 36.500 16.037  1.00 17.33 ? 112 SER A O   1 
ATOM   797  C CB  . SER A 1 112 ? 30.227 39.810 16.190  1.00 19.04 ? 112 SER A CB  1 
ATOM   798  O OG  . SER A 1 112 ? 29.872 40.962 15.451  1.00 22.20 ? 112 SER A OG  1 
ATOM   799  N N   . PRO A 1 113 ? 32.377 37.511 16.585  1.00 19.15 ? 113 PRO A N   1 
ATOM   800  C CA  . PRO A 1 113 ? 32.897 36.371 17.355  1.00 16.82 ? 113 PRO A CA  1 
ATOM   801  C C   . PRO A 1 113 ? 31.979 35.857 18.472  1.00 19.09 ? 113 PRO A C   1 
ATOM   802  O O   . PRO A 1 113 ? 31.846 34.652 18.630  1.00 18.94 ? 113 PRO A O   1 
ATOM   803  C CB  . PRO A 1 113 ? 34.199 36.911 17.922  1.00 18.34 ? 113 PRO A CB  1 
ATOM   804  C CG  . PRO A 1 113 ? 34.664 37.833 16.811  1.00 19.30 ? 113 PRO A CG  1 
ATOM   805  C CD  . PRO A 1 113 ? 33.391 38.578 16.472  1.00 17.60 ? 113 PRO A CD  1 
ATOM   806  N N   . TYR A 1 114 ? 31.346 36.756 19.230  1.00 16.24 ? 114 TYR A N   1 
ATOM   807  C CA  . TYR A 1 114 ? 30.450 36.375 20.325  1.00 16.52 ? 114 TYR A CA  1 
ATOM   808  C C   . TYR A 1 114 ? 28.978 36.730 20.153  1.00 15.84 ? 114 TYR A C   1 
ATOM   809  O O   . TYR A 1 114 ? 28.204 36.703 21.124  1.00 17.79 ? 114 TYR A O   1 
ATOM   810  C CB  . TYR A 1 114 ? 30.926 37.007 21.617  1.00 17.50 ? 114 TYR A CB  1 
ATOM   811  C CG  . TYR A 1 114 ? 32.095 36.300 22.173  1.00 18.79 ? 114 TYR A CG  1 
ATOM   812  C CD1 . TYR A 1 114 ? 33.331 36.415 21.568  1.00 23.73 ? 114 TYR A CD1 1 
ATOM   813  C CD2 . TYR A 1 114 ? 31.951 35.441 23.255  1.00 19.82 ? 114 TYR A CD2 1 
ATOM   814  C CE1 . TYR A 1 114 ? 34.408 35.683 22.026  1.00 28.15 ? 114 TYR A CE1 1 
ATOM   815  C CE2 . TYR A 1 114 ? 33.004 34.709 23.718  1.00 20.92 ? 114 TYR A CE2 1 
ATOM   816  C CZ  . TYR A 1 114 ? 34.228 34.834 23.104  1.00 28.03 ? 114 TYR A CZ  1 
ATOM   817  O OH  . TYR A 1 114 ? 35.291 34.124 23.584  1.00 40.37 ? 114 TYR A OH  1 
ATOM   818  N N   . SER A 1 115 ? 28.589 37.051 18.926  1.00 15.77 ? 115 SER A N   1 
ATOM   819  C CA  . SER A 1 115 ? 27.214 37.415 18.660  1.00 13.83 ? 115 SER A CA  1 
ATOM   820  C C   . SER A 1 115 ? 26.846 37.261 17.194  1.00 16.05 ? 115 SER A C   1 
ATOM   821  O O   . SER A 1 115 ? 27.702 37.268 16.330  1.00 19.34 ? 115 SER A O   1 
ATOM   822  C CB  . SER A 1 115 ? 27.036 38.868 19.044  1.00 15.07 ? 115 SER A CB  1 
ATOM   823  O OG  . SER A 1 115 ? 25.690 39.270 18.830  1.00 23.03 ? 115 SER A OG  1 
ATOM   824  N N   . TYR A 1 116 ? 25.583 36.994 16.924  1.00 16.19 ? 116 TYR A N   1 
ATOM   825  C CA  . TYR A 1 116 ? 25.112 36.959 15.564  1.00 15.34 ? 116 TYR A CA  1 
ATOM   826  C C   . TYR A 1 116 ? 23.651 37.304 15.575  1.00 14.10 ? 116 TYR A C   1 
ATOM   827  O O   . TYR A 1 116 ? 22.979 37.196 16.586  1.00 11.57 ? 116 TYR A O   1 
ATOM   828  C CB  . TYR A 1 116 ? 25.327 35.620 14.845  1.00 18.76 ? 116 TYR A CB  1 
ATOM   829  C CG  . TYR A 1 116 ? 24.495 34.477 15.356  1.00 16.99 ? 116 TYR A CG  1 
ATOM   830  C CD1 . TYR A 1 116 ? 23.186 34.267 14.912  1.00 18.52 ? 116 TYR A CD1 1 
ATOM   831  C CD2 . TYR A 1 116 ? 25.038 33.574 16.234  1.00 19.56 ? 116 TYR A CD2 1 
ATOM   832  C CE1 . TYR A 1 116 ? 22.445 33.170 15.331  1.00 18.86 ? 116 TYR A CE1 1 
ATOM   833  C CE2 . TYR A 1 116 ? 24.313 32.475 16.654  1.00 20.26 ? 116 TYR A CE2 1 
ATOM   834  C CZ  . TYR A 1 116 ? 23.047 32.278 16.207  1.00 22.09 ? 116 TYR A CZ  1 
ATOM   835  O OH  . TYR A 1 116 ? 22.438 31.138 16.638  1.00 29.40 ? 116 TYR A OH  1 
ATOM   836  N N   . SER A 1 117 ? 23.193 37.852 14.468  1.00 14.50 ? 117 SER A N   1 
ATOM   837  C CA  . SER A 1 117 ? 21.800 38.147 14.335  1.00 18.07 ? 117 SER A CA  1 
ATOM   838  C C   . SER A 1 117 ? 21.424 37.557 13.002  1.00 16.56 ? 117 SER A C   1 
ATOM   839  O O   . SER A 1 117 ? 22.258 37.411 12.097  1.00 17.48 ? 117 SER A O   1 
ATOM   840  C CB  . SER A 1 117 ? 21.559 39.653 14.368  1.00 24.03 ? 117 SER A CB  1 
ATOM   841  O OG  . SER A 1 117 ? 22.179 40.249 13.271  1.00 31.59 ? 117 SER A OG  1 
ATOM   842  N N   . THR A 1 118 ? 20.169 37.209 12.871  1.00 16.10 ? 118 THR A N   1 
ATOM   843  C CA  . THR A 1 118 ? 19.696 36.627 11.645  1.00 16.68 ? 118 THR A CA  1 
ATOM   844  C C   . THR A 1 118 ? 18.316 37.177 11.424  1.00 17.06 ? 118 THR A C   1 
ATOM   845  O O   . THR A 1 118 ? 17.536 37.389 12.379  1.00 18.65 ? 118 THR A O   1 
ATOM   846  C CB  . THR A 1 118 ? 19.652 35.054 11.715  1.00 18.49 ? 118 THR A CB  1 
ATOM   847  O OG1 . THR A 1 118 ? 19.142 34.550 10.492  1.00 22.53 ? 118 THR A OG1 1 
ATOM   848  C CG2 . THR A 1 118 ? 18.721 34.565 12.828  1.00 16.14 ? 118 THR A CG2 1 
ATOM   849  N N   . THR A 1 119 ? 18.082 37.581 10.191  1.00 13.73 ? 119 THR A N   1 
ATOM   850  C CA  . THR A 1 119 ? 16.761 38.059 9.864   1.00 20.07 ? 119 THR A CA  1 
ATOM   851  C C   . THR A 1 119 ? 16.282 37.381 8.604   1.00 17.13 ? 119 THR A C   1 
ATOM   852  O O   . THR A 1 119 ? 17.123 36.898 7.833   1.00 18.79 ? 119 THR A O   1 
ATOM   853  C CB  . THR A 1 119 ? 16.666 39.628 9.822   1.00 24.29 ? 119 THR A CB  1 
ATOM   854  O OG1 . THR A 1 119 ? 16.651 40.127 8.489   1.00 32.54 ? 119 THR A OG1 1 
ATOM   855  C CG2 . THR A 1 119 ? 17.854 40.203 10.490  1.00 27.12 ? 119 THR A CG2 1 
ATOM   856  N N   . ALA A 1 120 ? 14.952 37.253 8.467   1.00 15.53 ? 120 ALA A N   1 
ATOM   857  C CA  . ALA A 1 120 ? 14.341 36.643 7.288   1.00 17.18 ? 120 ALA A CA  1 
ATOM   858  C C   . ALA A 1 120 ? 13.530 37.653 6.522   1.00 16.76 ? 120 ALA A C   1 
ATOM   859  O O   . ALA A 1 120 ? 12.743 38.371 7.117   1.00 18.99 ? 120 ALA A O   1 
ATOM   860  C CB  . ALA A 1 120 ? 13.428 35.501 7.709   1.00 17.69 ? 120 ALA A CB  1 
ATOM   861  N N   . VAL A 1 121 ? 13.762 37.773 5.227   1.00 18.44 ? 121 VAL A N   1 
ATOM   862  C CA  . VAL A 1 121 ? 12.952 38.670 4.392   1.00 19.14 ? 121 VAL A CA  1 
ATOM   863  C C   . VAL A 1 121 ? 12.131 37.745 3.494   1.00 20.86 ? 121 VAL A C   1 
ATOM   864  O O   . VAL A 1 121 ? 12.667 36.989 2.691   1.00 22.81 ? 121 VAL A O   1 
ATOM   865  C CB  . VAL A 1 121 ? 13.808 39.606 3.548   1.00 21.07 ? 121 VAL A CB  1 
ATOM   866  C CG1 . VAL A 1 121 ? 12.916 40.509 2.710   1.00 21.81 ? 121 VAL A CG1 1 
ATOM   867  C CG2 . VAL A 1 121 ? 14.709 40.427 4.457   1.00 22.79 ? 121 VAL A CG2 1 
ATOM   868  N N   . VAL A 1 122 ? 10.832 37.736 3.682   1.00 21.15 ? 122 VAL A N   1 
ATOM   869  C CA  . VAL A 1 122 ? 9.995  36.841 2.922   1.00 22.06 ? 122 VAL A CA  1 
ATOM   870  C C   . VAL A 1 122 ? 9.181  37.619 1.917   1.00 26.50 ? 122 VAL A C   1 
ATOM   871  O O   . VAL A 1 122 ? 8.504  38.554 2.281   1.00 26.01 ? 122 VAL A O   1 
ATOM   872  C CB  . VAL A 1 122 ? 9.045  36.109 3.856   1.00 23.98 ? 122 VAL A CB  1 
ATOM   873  C CG1 . VAL A 1 122 ? 8.173  35.197 3.068   1.00 27.31 ? 122 VAL A CG1 1 
ATOM   874  C CG2 . VAL A 1 122 ? 9.810  35.359 4.909   1.00 22.99 ? 122 VAL A CG2 1 
ATOM   875  N N   . THR A 1 123 ? 9.282  37.266 0.647   1.00 31.51 ? 123 THR A N   1 
ATOM   876  C CA  . THR A 1 123 ? 8.528  37.948 -0.390  1.00 39.65 ? 123 THR A CA  1 
ATOM   877  C C   . THR A 1 123 ? 7.862  36.887 -1.244  1.00 44.49 ? 123 THR A C   1 
ATOM   878  O O   . THR A 1 123 ? 8.560  35.965 -1.677  1.00 45.78 ? 123 THR A O   1 
ATOM   879  C CB  . THR A 1 123 ? 9.422  38.898 -1.242  1.00 40.97 ? 123 THR A CB  1 
ATOM   880  O OG1 . THR A 1 123 ? 10.507 38.167 -1.824  1.00 44.95 ? 123 THR A OG1 1 
ATOM   881  C CG2 . THR A 1 123 ? 10.015 40.024 -0.367  1.00 42.02 ? 123 THR A CG2 1 
ATOM   882  N N   . CYS B 1 10  ? 26.161 30.374 39.743  1.00 42.96 ? 10  CYS B N   1 
ATOM   883  C CA  . CYS B 1 10  ? 25.293 30.423 38.518  1.00 42.66 ? 10  CYS B CA  1 
ATOM   884  C C   . CYS B 1 10  ? 26.252 30.503 37.345  1.00 37.21 ? 10  CYS B C   1 
ATOM   885  O O   . CYS B 1 10  ? 26.738 31.571 37.017  1.00 40.53 ? 10  CYS B O   1 
ATOM   886  C CB  . CYS B 1 10  ? 24.396 31.680 38.541  1.00 45.82 ? 10  CYS B CB  1 
ATOM   887  S SG  . CYS B 1 10  ? 22.701 31.470 37.939  1.00 53.15 ? 10  CYS B SG  1 
ATOM   888  N N   . PRO B 1 11  ? 26.676 29.364 36.825  1.00 31.11 ? 11  PRO B N   1 
ATOM   889  C CA  . PRO B 1 11  ? 27.591 29.468 35.699  1.00 27.68 ? 11  PRO B CA  1 
ATOM   890  C C   . PRO B 1 11  ? 26.878 29.624 34.359  1.00 26.03 ? 11  PRO B C   1 
ATOM   891  O O   . PRO B 1 11  ? 27.538 29.827 33.362  1.00 29.24 ? 11  PRO B O   1 
ATOM   892  C CB  . PRO B 1 11  ? 28.328 28.144 35.762  1.00 27.92 ? 11  PRO B CB  1 
ATOM   893  C CG  . PRO B 1 11  ? 27.235 27.210 36.184  1.00 29.39 ? 11  PRO B CG  1 
ATOM   894  C CD  . PRO B 1 11  ? 26.605 27.982 37.324  1.00 28.56 ? 11  PRO B CD  1 
ATOM   895  N N   . LEU B 1 12  ? 25.556 29.486 34.303  1.00 26.17 ? 12  LEU B N   1 
ATOM   896  C CA  . LEU B 1 12  ? 24.840 29.617 33.020  1.00 26.67 ? 12  LEU B CA  1 
ATOM   897  C C   . LEU B 1 12  ? 23.555 30.399 33.241  1.00 27.27 ? 12  LEU B C   1 
ATOM   898  O O   . LEU B 1 12  ? 22.685 29.929 33.980  1.00 31.87 ? 12  LEU B O   1 
ATOM   899  C CB  . LEU B 1 12  ? 24.527 28.243 32.439  1.00 18.93 ? 12  LEU B CB  1 
ATOM   900  C CG  . LEU B 1 12  ? 23.752 28.226 31.121  1.00 23.10 ? 12  LEU B CG  1 
ATOM   901  C CD1 . LEU B 1 12  ? 24.485 29.023 30.060  1.00 19.49 ? 12  LEU B CD1 1 
ATOM   902  C CD2 . LEU B 1 12  ? 23.531 26.784 30.653  1.00 21.13 ? 12  LEU B CD2 1 
ATOM   903  N N   . MET B 1 13  ? 23.433 31.576 32.619  1.00 26.35 ? 13  MET B N   1 
ATOM   904  C CA  . MET B 1 13  ? 22.241 32.448 32.775  1.00 25.34 ? 13  MET B CA  1 
ATOM   905  C C   . MET B 1 13  ? 21.687 32.856 31.385  1.00 19.97 ? 13  MET B C   1 
ATOM   906  O O   . MET B 1 13  ? 22.432 33.035 30.428  1.00 19.00 ? 13  MET B O   1 
ATOM   907  C CB  . MET B 1 13  ? 22.645 33.676 33.622  1.00 31.81 ? 13  MET B CB  1 
ATOM   908  C CG  . MET B 1 13  ? 21.526 34.379 34.355  1.00 46.74 ? 13  MET B CG  1 
ATOM   909  S SD  . MET B 1 13  ? 20.753 35.793 33.474  1.00 65.62 ? 13  MET B SD  1 
ATOM   910  C CE  . MET B 1 13  ? 22.066 37.089 33.604  1.00 59.32 ? 13  MET B CE  1 
ATOM   911  N N   . VAL B 1 14  ? 20.380 32.954 31.260  1.00 18.15 ? 14  VAL B N   1 
ATOM   912  C CA  . VAL B 1 14  ? 19.816 33.312 29.991  1.00 17.77 ? 14  VAL B CA  1 
ATOM   913  C C   . VAL B 1 14  ? 18.973 34.553 30.189  1.00 17.33 ? 14  VAL B C   1 
ATOM   914  O O   . VAL B 1 14  ? 18.340 34.704 31.231  1.00 20.95 ? 14  VAL B O   1 
ATOM   915  C CB  . VAL B 1 14  ? 19.005 32.141 29.403  1.00 18.49 ? 14  VAL B CB  1 
ATOM   916  C CG1 . VAL B 1 14  ? 18.361 32.556 28.058  1.00 20.04 ? 14  VAL B CG1 1 
ATOM   917  C CG2 . VAL B 1 14  ? 19.912 30.959 29.162  1.00 14.67 ? 14  VAL B CG2 1 
ATOM   918  N N   . LYS B 1 15  ? 19.068 35.494 29.254  1.00 18.78 ? 15  LYS B N   1 
ATOM   919  C CA  . LYS B 1 15  ? 18.300 36.737 29.303  1.00 20.84 ? 15  LYS B CA  1 
ATOM   920  C C   . LYS B 1 15  ? 17.627 36.948 27.956  1.00 17.95 ? 15  LYS B C   1 
ATOM   921  O O   . LYS B 1 15  ? 18.262 36.906 26.925  1.00 19.97 ? 15  LYS B O   1 
ATOM   922  C CB  . LYS B 1 15  ? 19.211 37.912 29.614  1.00 27.00 ? 15  LYS B CB  1 
ATOM   923  C CG  . LYS B 1 15  ? 18.531 38.995 30.404  1.00 38.32 ? 15  LYS B CG  1 
ATOM   924  C CD  . LYS B 1 15  ? 18.349 40.270 29.594  1.00 46.82 ? 15  LYS B CD  1 
ATOM   925  C CE  . LYS B 1 15  ? 17.803 41.387 30.487  1.00 49.48 ? 15  LYS B CE  1 
ATOM   926  N NZ  . LYS B 1 15  ? 16.514 40.990 31.146  1.00 53.88 ? 15  LYS B NZ  1 
ATOM   927  N N   . VAL B 1 16  ? 16.336 37.195 27.973  1.00 16.77 ? 16  VAL B N   1 
ATOM   928  C CA  . VAL B 1 16  ? 15.592 37.381 26.748  1.00 16.65 ? 16  VAL B CA  1 
ATOM   929  C C   . VAL B 1 16  ? 14.809 38.714 26.739  1.00 18.20 ? 16  VAL B C   1 
ATOM   930  O O   . VAL B 1 16  ? 14.048 39.015 27.689  1.00 19.14 ? 16  VAL B O   1 
ATOM   931  C CB  . VAL B 1 16  ? 14.596 36.224 26.574  1.00 16.27 ? 16  VAL B CB  1 
ATOM   932  C CG1 . VAL B 1 16  ? 14.002 36.283 25.170  1.00 15.66 ? 16  VAL B CG1 1 
ATOM   933  C CG2 . VAL B 1 16  ? 15.283 34.881 26.809  1.00 17.43 ? 16  VAL B CG2 1 
ATOM   934  N N   . LEU B 1 17  ? 15.015 39.512 25.684  1.00 18.52 ? 17  LEU B N   1 
ATOM   935  C CA  . LEU B 1 17  ? 14.337 40.796 25.512  1.00 17.89 ? 17  LEU B CA  1 
ATOM   936  C C   . LEU B 1 17  ? 13.404 40.808 24.279  1.00 16.76 ? 17  LEU B C   1 
ATOM   937  O O   . LEU B 1 17  ? 13.607 40.071 23.317  1.00 16.03 ? 17  LEU B O   1 
ATOM   938  C CB  . LEU B 1 17  ? 15.354 41.935 25.437  1.00 17.13 ? 17  LEU B CB  1 
ATOM   939  C CG  . LEU B 1 17  ? 16.218 42.134 26.680  1.00 17.63 ? 17  LEU B CG  1 
ATOM   940  C CD1 . LEU B 1 17  ? 17.129 43.265 26.333  1.00 20.92 ? 17  LEU B CD1 1 
ATOM   941  C CD2 . LEU B 1 17  ? 15.376 42.484 27.930  1.00 19.43 ? 17  LEU B CD2 1 
ATOM   942  N N   . ASP B 1 18  ? 12.363 41.627 24.347  1.00 15.74 ? 18  ASP B N   1 
ATOM   943  C CA  . ASP B 1 18  ? 11.376 41.784 23.291  1.00 13.57 ? 18  ASP B CA  1 
ATOM   944  C C   . ASP B 1 18  ? 11.658 43.149 22.660  1.00 13.03 ? 18  ASP B C   1 
ATOM   945  O O   . ASP B 1 18  ? 11.472 44.191 23.301  1.00 16.56 ? 18  ASP B O   1 
ATOM   946  C CB  . ASP B 1 18  ? 9.994  41.772 23.966  1.00 17.91 ? 18  ASP B CB  1 
ATOM   947  C CG  . ASP B 1 18  ? 8.839  41.880 22.992  1.00 14.62 ? 18  ASP B CG  1 
ATOM   948  O OD1 . ASP B 1 18  ? 8.987  42.468 21.919  1.00 18.25 ? 18  ASP B OD1 1 
ATOM   949  O OD2 . ASP B 1 18  ? 7.759  41.386 23.330  1.00 16.99 ? 18  ASP B OD2 1 
ATOM   950  N N   . ALA B 1 19  ? 12.078 43.137 21.404  1.00 13.63 ? 19  ALA B N   1 
ATOM   951  C CA  . ALA B 1 19  ? 12.392 44.330 20.620  1.00 13.07 ? 19  ALA B CA  1 
ATOM   952  C C   . ALA B 1 19  ? 11.169 45.040 20.063  1.00 16.69 ? 19  ALA B C   1 
ATOM   953  O O   . ALA B 1 19  ? 11.303 46.144 19.522  1.00 19.22 ? 19  ALA B O   1 
ATOM   954  C CB  . ALA B 1 19  ? 13.362 43.972 19.445  1.00 13.85 ? 19  ALA B CB  1 
ATOM   955  N N   . VAL B 1 20  ? 9.999  44.397 20.130  1.00 16.50 ? 20  VAL B N   1 
ATOM   956  C CA  . VAL B 1 20  ? 8.756  44.985 19.621  1.00 16.99 ? 20  VAL B CA  1 
ATOM   957  C C   . VAL B 1 20  ? 8.073  45.827 20.698  1.00 18.17 ? 20  VAL B C   1 
ATOM   958  O O   . VAL B 1 20  ? 7.586  46.902 20.429  1.00 20.74 ? 20  VAL B O   1 
ATOM   959  C CB  . VAL B 1 20  ? 7.761  43.896 19.135  1.00 18.08 ? 20  VAL B CB  1 
ATOM   960  C CG1 . VAL B 1 20  ? 6.463  44.526 18.634  1.00 16.29 ? 20  VAL B CG1 1 
ATOM   961  C CG2 . VAL B 1 20  ? 8.400  43.038 18.059  1.00 15.42 ? 20  VAL B CG2 1 
ATOM   962  N N   . ARG B 1 21  ? 8.095  45.355 21.930  1.00 17.48 ? 21  ARG B N   1 
ATOM   963  C CA  . ARG B 1 21  ? 7.459  46.054 23.006  1.00 18.37 ? 21  ARG B CA  1 
ATOM   964  C C   . ARG B 1 21  ? 8.436  46.822 23.875  1.00 22.20 ? 21  ARG B C   1 
ATOM   965  O O   . ARG B 1 21  ? 7.992  47.624 24.690  1.00 22.69 ? 21  ARG B O   1 
ATOM   966  C CB  . ARG B 1 21  ? 6.644  45.063 23.826  1.00 20.40 ? 21  ARG B CB  1 
ATOM   967  C CG  . ARG B 1 21  ? 5.751  44.223 22.924  1.00 29.80 ? 21  ARG B CG  1 
ATOM   968  C CD  . ARG B 1 21  ? 4.839  43.283 23.660  1.00 36.38 ? 21  ARG B CD  1 
ATOM   969  N NE  . ARG B 1 21  ? 5.555  42.559 24.701  1.00 49.08 ? 21  ARG B NE  1 
ATOM   970  C CZ  . ARG B 1 21  ? 4.990  42.141 25.827  1.00 58.01 ? 21  ARG B CZ  1 
ATOM   971  N NH1 . ARG B 1 21  ? 3.688  42.365 26.056  1.00 60.69 ? 21  ARG B NH1 1 
ATOM   972  N NH2 . ARG B 1 21  ? 5.743  41.582 26.767  1.00 62.09 ? 21  ARG B NH2 1 
ATOM   973  N N   . GLY B 1 22  ? 9.750  46.596 23.709  1.00 18.66 ? 22  GLY B N   1 
ATOM   974  C CA  . GLY B 1 22  ? 10.732 47.285 24.536  1.00 16.58 ? 22  GLY B CA  1 
ATOM   975  C C   . GLY B 1 22  ? 10.658 46.837 25.990  1.00 19.82 ? 22  GLY B C   1 
ATOM   976  O O   . GLY B 1 22  ? 10.657 47.633 26.928  1.00 19.75 ? 22  GLY B O   1 
ATOM   977  N N   . SER B 1 23  ? 10.614 45.527 26.185  1.00 20.00 ? 23  SER B N   1 
ATOM   978  C CA  . SER B 1 23  ? 10.518 44.962 27.520  1.00 21.56 ? 23  SER B CA  1 
ATOM   979  C C   . SER B 1 23  ? 11.125 43.575 27.587  1.00 22.76 ? 23  SER B C   1 
ATOM   980  O O   . SER B 1 23  ? 11.501 42.987 26.570  1.00 22.35 ? 23  SER B O   1 
ATOM   981  C CB  . SER B 1 23  ? 9.048  44.846 27.927  1.00 25.61 ? 23  SER B CB  1 
ATOM   982  O OG  . SER B 1 23  ? 8.338  43.976 27.066  1.00 33.58 ? 23  SER B OG  1 
ATOM   983  N N   . PRO B 1 24  ? 11.264 43.044 28.796  1.00 21.74 ? 24  PRO B N   1 
ATOM   984  C CA  . PRO B 1 24  ? 11.827 41.702 28.907  1.00 21.05 ? 24  PRO B CA  1 
ATOM   985  C C   . PRO B 1 24  ? 10.774 40.726 28.416  1.00 20.12 ? 24  PRO B C   1 
ATOM   986  O O   . PRO B 1 24  ? 9.567  41.007 28.510  1.00 18.24 ? 24  PRO B O   1 
ATOM   987  C CB  . PRO B 1 24  ? 12.046 41.554 30.396  1.00 21.26 ? 24  PRO B CB  1 
ATOM   988  C CG  . PRO B 1 24  ? 11.029 42.495 30.973  1.00 25.08 ? 24  PRO B CG  1 
ATOM   989  C CD  . PRO B 1 24  ? 11.119 43.678 30.112  1.00 17.03 ? 24  PRO B CD  1 
ATOM   990  N N   . ALA B 1 25  ? 11.239 39.642 27.788  1.00 18.52 ? 25  ALA B N   1 
ATOM   991  C CA  . ALA B 1 25  ? 10.352 38.584 27.294  1.00 20.02 ? 25  ALA B CA  1 
ATOM   992  C C   . ALA B 1 25  ? 10.104 37.632 28.482  1.00 22.10 ? 25  ALA B C   1 
ATOM   993  O O   . ALA B 1 25  ? 10.964 36.865 28.921  1.00 21.92 ? 25  ALA B O   1 
ATOM   994  C CB  . ALA B 1 25  ? 10.982 37.869 26.140  1.00 19.15 ? 25  ALA B CB  1 
ATOM   995  N N   . ILE B 1 26  ? 8.919  37.739 29.042  1.00 25.44 ? 26  ILE B N   1 
ATOM   996  C CA  . ILE B 1 26  ? 8.527  36.987 30.215  1.00 24.03 ? 26  ILE B CA  1 
ATOM   997  C C   . ILE B 1 26  ? 7.869  35.642 29.880  1.00 24.64 ? 26  ILE B C   1 
ATOM   998  O O   . ILE B 1 26  ? 7.158  35.498 28.861  1.00 17.90 ? 26  ILE B O   1 
ATOM   999  C CB  . ILE B 1 26  ? 7.545  37.873 31.027  1.00 26.99 ? 26  ILE B CB  1 
ATOM   1000 C CG1 . ILE B 1 26  ? 8.173  39.250 31.251  1.00 27.21 ? 26  ILE B CG1 1 
ATOM   1001 C CG2 . ILE B 1 26  ? 7.214  37.251 32.351  1.00 30.54 ? 26  ILE B CG2 1 
ATOM   1002 C CD1 . ILE B 1 26  ? 7.188  40.275 31.679  1.00 33.97 ? 26  ILE B CD1 1 
ATOM   1003 N N   . ASN B 1 27  ? 8.181  34.647 30.711  1.00 25.42 ? 27  ASN B N   1 
ATOM   1004 C CA  . ASN B 1 27  ? 7.603  33.317 30.586  1.00 26.08 ? 27  ASN B CA  1 
ATOM   1005 C C   . ASN B 1 27  ? 7.927  32.601 29.337  1.00 26.96 ? 27  ASN B C   1 
ATOM   1006 O O   . ASN B 1 27  ? 7.081  31.887 28.776  1.00 25.78 ? 27  ASN B O   1 
ATOM   1007 C CB  . ASN B 1 27  ? 6.106  33.377 30.715  1.00 34.96 ? 27  ASN B CB  1 
ATOM   1008 C CG  . ASN B 1 27  ? 5.653  32.836 32.008  1.00 46.63 ? 27  ASN B CG  1 
ATOM   1009 O OD1 . ASN B 1 27  ? 5.806  33.480 33.062  1.00 52.11 ? 27  ASN B OD1 1 
ATOM   1010 N ND2 . ASN B 1 27  ? 5.172  31.602 31.982  1.00 52.69 ? 27  ASN B ND2 1 
ATOM   1011 N N   . VAL B 1 28  ? 9.147  32.840 28.869  1.00 26.66 ? 28  VAL B N   1 
ATOM   1012 C CA  . VAL B 1 28  ? 9.622  32.198 27.663  1.00 25.19 ? 28  VAL B CA  1 
ATOM   1013 C C   . VAL B 1 28  ? 10.239 30.872 28.110  1.00 22.38 ? 28  VAL B C   1 
ATOM   1014 O O   . VAL B 1 28  ? 10.995 30.818 29.083  1.00 20.11 ? 28  VAL B O   1 
ATOM   1015 C CB  . VAL B 1 28  ? 10.688 33.064 26.922  1.00 22.86 ? 28  VAL B CB  1 
ATOM   1016 C CG1 . VAL B 1 28  ? 11.195 32.308 25.731  1.00 24.42 ? 28  VAL B CG1 1 
ATOM   1017 C CG2 . VAL B 1 28  ? 10.076 34.408 26.456  1.00 25.76 ? 28  VAL B CG2 1 
ATOM   1018 N N   . ALA B 1 29  ? 9.864  29.798 27.429  1.00 20.56 ? 29  ALA B N   1 
ATOM   1019 C CA  . ALA B 1 29  ? 10.422 28.489 27.745  1.00 19.16 ? 29  ALA B CA  1 
ATOM   1020 C C   . ALA B 1 29  ? 11.800 28.359 27.128  1.00 16.26 ? 29  ALA B C   1 
ATOM   1021 O O   . ALA B 1 29  ? 12.026 28.717 25.969  1.00 18.40 ? 29  ALA B O   1 
ATOM   1022 C CB  . ALA B 1 29  ? 9.490  27.362 27.221  1.00 18.35 ? 29  ALA B CB  1 
ATOM   1023 N N   . VAL B 1 30  ? 12.730 27.864 27.919  1.00 17.75 ? 30  VAL B N   1 
ATOM   1024 C CA  . VAL B 1 30  ? 14.090 27.645 27.469  1.00 20.52 ? 30  VAL B CA  1 
ATOM   1025 C C   . VAL B 1 30  ? 14.462 26.206 27.831  1.00 19.67 ? 30  VAL B C   1 
ATOM   1026 O O   . VAL B 1 30  ? 14.202 25.765 28.970  1.00 22.53 ? 30  VAL B O   1 
ATOM   1027 C CB  . VAL B 1 30  ? 15.087 28.571 28.206  1.00 20.56 ? 30  VAL B CB  1 
ATOM   1028 C CG1 . VAL B 1 30  ? 16.531 28.286 27.733  1.00 19.24 ? 30  VAL B CG1 1 
ATOM   1029 C CG2 . VAL B 1 30  ? 14.679 30.036 28.031  1.00 18.47 ? 30  VAL B CG2 1 
ATOM   1030 N N   . HIS B 1 31  ? 15.076 25.501 26.882  1.00 18.64 ? 31  HIS B N   1 
ATOM   1031 C CA  . HIS B 1 31  ? 15.535 24.125 27.073  1.00 19.02 ? 31  HIS B CA  1 
ATOM   1032 C C   . HIS B 1 31  ? 16.987 24.054 26.743  1.00 18.78 ? 31  HIS B C   1 
ATOM   1033 O O   . HIS B 1 31  ? 17.410 24.543 25.708  1.00 20.86 ? 31  HIS B O   1 
ATOM   1034 C CB  . HIS B 1 31  ? 14.773 23.148 26.167  1.00 20.08 ? 31  HIS B CB  1 
ATOM   1035 C CG  . HIS B 1 31  ? 13.366 22.882 26.623  1.00 25.53 ? 31  HIS B CG  1 
ATOM   1036 N ND1 . HIS B 1 31  ? 12.322 23.763 26.392  1.00 29.07 ? 31  HIS B ND1 1 
ATOM   1037 C CD2 . HIS B 1 31  ? 12.839 21.861 27.341  1.00 24.99 ? 31  HIS B CD2 1 
ATOM   1038 C CE1 . HIS B 1 31  ? 11.219 23.298 26.946  1.00 25.07 ? 31  HIS B CE1 1 
ATOM   1039 N NE2 . HIS B 1 31  ? 11.502 22.146 27.528  1.00 29.66 ? 31  HIS B NE2 1 
ATOM   1040 N N   . VAL B 1 32  ? 17.761 23.501 27.650  1.00 16.72 ? 32  VAL B N   1 
ATOM   1041 C CA  . VAL B 1 32  ? 19.182 23.348 27.429  1.00 21.22 ? 32  VAL B CA  1 
ATOM   1042 C C   . VAL B 1 32  ? 19.487 21.856 27.186  1.00 22.57 ? 32  VAL B C   1 
ATOM   1043 O O   . VAL B 1 32  ? 18.955 20.980 27.896  1.00 24.73 ? 32  VAL B O   1 
ATOM   1044 C CB  . VAL B 1 32  ? 19.967 23.851 28.675  1.00 21.06 ? 32  VAL B CB  1 
ATOM   1045 C CG1 . VAL B 1 32  ? 21.517 23.701 28.489  1.00 18.93 ? 32  VAL B CG1 1 
ATOM   1046 C CG2 . VAL B 1 32  ? 19.562 25.295 28.971  1.00 19.06 ? 32  VAL B CG2 1 
ATOM   1047 N N   . PHE B 1 33  ? 20.314 21.578 26.185  1.00 23.67 ? 33  PHE B N   1 
ATOM   1048 C CA  . PHE B 1 33  ? 20.740 20.213 25.844  1.00 23.44 ? 33  PHE B CA  1 
ATOM   1049 C C   . PHE B 1 33  ? 22.263 20.139 25.863  1.00 24.98 ? 33  PHE B C   1 
ATOM   1050 O O   . PHE B 1 33  ? 22.959 21.162 25.687  1.00 20.71 ? 33  PHE B O   1 
ATOM   1051 C CB  . PHE B 1 33  ? 20.247 19.815 24.445  1.00 22.15 ? 33  PHE B CB  1 
ATOM   1052 C CG  . PHE B 1 33  ? 18.785 19.950 24.290  1.00 23.48 ? 33  PHE B CG  1 
ATOM   1053 C CD1 . PHE B 1 33  ? 18.233 21.180 23.927  1.00 22.89 ? 33  PHE B CD1 1 
ATOM   1054 C CD2 . PHE B 1 33  ? 17.931 18.887 24.620  1.00 26.19 ? 33  PHE B CD2 1 
ATOM   1055 C CE1 . PHE B 1 33  ? 16.860 21.367 23.902  1.00 20.84 ? 33  PHE B CE1 1 
ATOM   1056 C CE2 . PHE B 1 33  ? 16.527 19.057 24.600  1.00 23.28 ? 33  PHE B CE2 1 
ATOM   1057 C CZ  . PHE B 1 33  ? 15.996 20.299 24.244  1.00 23.29 ? 33  PHE B CZ  1 
ATOM   1058 N N   . ARG B 1 34  ? 22.757 18.939 26.149  1.00 23.66 ? 34  ARG B N   1 
ATOM   1059 C CA  . ARG B 1 34  ? 24.172 18.666 26.159  1.00 25.36 ? 34  ARG B CA  1 
ATOM   1060 C C   . ARG B 1 34  ? 24.439 17.572 25.095  1.00 25.58 ? 34  ARG B C   1 
ATOM   1061 O O   . ARG B 1 34  ? 23.649 16.655 24.909  1.00 27.95 ? 34  ARG B O   1 
ATOM   1062 C CB  . ARG B 1 34  ? 24.614 18.232 27.559  1.00 25.90 ? 34  ARG B CB  1 
ATOM   1063 C CG  . ARG B 1 34  ? 26.124 18.146 27.663  1.00 32.39 ? 34  ARG B CG  1 
ATOM   1064 C CD  . ARG B 1 34  ? 26.654 17.817 29.068  1.00 40.35 ? 34  ARG B CD  1 
ATOM   1065 N NE  . ARG B 1 34  ? 28.127 17.818 29.029  1.00 50.27 ? 34  ARG B NE  1 
ATOM   1066 C CZ  . ARG B 1 34  ? 28.875 16.824 28.523  1.00 52.35 ? 34  ARG B CZ  1 
ATOM   1067 N NH1 . ARG B 1 34  ? 28.308 15.716 28.016  1.00 53.69 ? 34  ARG B NH1 1 
ATOM   1068 N NH2 . ARG B 1 34  ? 30.194 16.953 28.485  1.00 44.94 ? 34  ARG B NH2 1 
ATOM   1069 N N   . LYS B 1 35  ? 25.496 17.718 24.325  1.00 27.19 ? 35  LYS B N   1 
ATOM   1070 C CA  . LYS B 1 35  ? 25.786 16.732 23.313  1.00 29.25 ? 35  LYS B CA  1 
ATOM   1071 C C   . LYS B 1 35  ? 26.295 15.490 24.019  1.00 32.75 ? 35  LYS B C   1 
ATOM   1072 O O   . LYS B 1 35  ? 27.220 15.566 24.841  1.00 33.65 ? 35  LYS B O   1 
ATOM   1073 C CB  . LYS B 1 35  ? 26.818 17.267 22.333  1.00 29.04 ? 35  LYS B CB  1 
ATOM   1074 C CG  . LYS B 1 35  ? 26.610 16.735 20.962  1.00 34.04 ? 35  LYS B CG  1 
ATOM   1075 C CD  . LYS B 1 35  ? 27.229 17.645 19.969  1.00 40.62 ? 35  LYS B CD  1 
ATOM   1076 C CE  . LYS B 1 35  ? 26.848 17.173 18.589  1.00 45.67 ? 35  LYS B CE  1 
ATOM   1077 N NZ  . LYS B 1 35  ? 25.378 16.995 18.558  1.00 49.08 ? 35  LYS B NZ  1 
ATOM   1078 N N   . ALA B 1 36  ? 25.619 14.377 23.742  1.00 37.94 ? 36  ALA B N   1 
ATOM   1079 C CA  . ALA B 1 36  ? 25.895 13.046 24.296  1.00 41.40 ? 36  ALA B CA  1 
ATOM   1080 C C   . ALA B 1 36  ? 27.022 12.376 23.547  1.00 42.45 ? 36  ALA B C   1 
ATOM   1081 O O   . ALA B 1 36  ? 27.262 12.666 22.380  1.00 36.81 ? 36  ALA B O   1 
ATOM   1082 C CB  . ALA B 1 36  ? 24.647 12.166 24.231  1.00 40.57 ? 36  ALA B CB  1 
ATOM   1083 N N   . ALA B 1 37  ? 27.659 11.426 24.227  1.00 49.84 ? 37  ALA B N   1 
ATOM   1084 C CA  . ALA B 1 37  ? 28.795 10.690 23.692  1.00 53.94 ? 37  ALA B CA  1 
ATOM   1085 C C   . ALA B 1 37  ? 28.468 10.183 22.310  1.00 55.93 ? 37  ALA B C   1 
ATOM   1086 O O   . ALA B 1 37  ? 29.289 10.254 21.391  1.00 57.59 ? 37  ALA B O   1 
ATOM   1087 C CB  . ALA B 1 37  ? 29.151 9.532  24.620  1.00 56.00 ? 37  ALA B CB  1 
ATOM   1088 N N   . ASP B 1 38  ? 27.223 9.767  22.152  1.00 57.57 ? 38  ASP B N   1 
ATOM   1089 C CA  . ASP B 1 38  ? 26.766 9.233  20.890  1.00 62.08 ? 38  ASP B CA  1 
ATOM   1090 C C   . ASP B 1 38  ? 26.229 10.327 19.982  1.00 62.26 ? 38  ASP B C   1 
ATOM   1091 O O   . ASP B 1 38  ? 25.350 10.091 19.152  1.00 63.18 ? 38  ASP B O   1 
ATOM   1092 C CB  . ASP B 1 38  ? 25.700 8.182  21.151  1.00 65.05 ? 38  ASP B CB  1 
ATOM   1093 C CG  . ASP B 1 38  ? 24.474 8.764  21.791  1.00 70.43 ? 38  ASP B CG  1 
ATOM   1094 O OD1 . ASP B 1 38  ? 24.534 9.139  22.992  1.00 72.86 ? 38  ASP B OD1 1 
ATOM   1095 O OD2 . ASP B 1 38  ? 23.452 8.851  21.072  1.00 73.47 ? 38  ASP B OD2 1 
ATOM   1096 N N   . ASP B 1 39  ? 26.759 11.528 20.157  1.00 62.62 ? 39  ASP B N   1 
ATOM   1097 C CA  . ASP B 1 39  ? 26.354 12.673 19.368  1.00 62.10 ? 39  ASP B CA  1 
ATOM   1098 C C   . ASP B 1 39  ? 24.877 13.065 19.368  1.00 59.37 ? 39  ASP B C   1 
ATOM   1099 O O   . ASP B 1 39  ? 24.427 13.758 18.458  1.00 61.20 ? 39  ASP B O   1 
ATOM   1100 C CB  . ASP B 1 39  ? 26.859 12.528 17.939  1.00 67.10 ? 39  ASP B CB  1 
ATOM   1101 C CG  . ASP B 1 39  ? 28.032 13.435 17.664  1.00 74.04 ? 39  ASP B CG  1 
ATOM   1102 O OD1 . ASP B 1 39  ? 29.019 13.373 18.440  1.00 77.42 ? 39  ASP B OD1 1 
ATOM   1103 O OD2 . ASP B 1 39  ? 27.948 14.242 16.706  1.00 77.35 ? 39  ASP B OD2 1 
ATOM   1104 N N   . THR B 1 40  ? 24.108 12.615 20.358  1.00 55.64 ? 40  THR B N   1 
ATOM   1105 C CA  . THR B 1 40  ? 22.686 12.999 20.430  1.00 48.90 ? 40  THR B CA  1 
ATOM   1106 C C   . THR B 1 40  ? 22.581 14.103 21.469  1.00 44.02 ? 40  THR B C   1 
ATOM   1107 O O   . THR B 1 40  ? 23.442 14.211 22.337  1.00 40.00 ? 40  THR B O   1 
ATOM   1108 C CB  . THR B 1 40  ? 21.755 11.842 20.914  1.00 49.87 ? 40  THR B CB  1 
ATOM   1109 O OG1 . THR B 1 40  ? 22.274 11.272 22.129  1.00 52.09 ? 40  THR B OG1 1 
ATOM   1110 C CG2 . THR B 1 40  ? 21.595 10.775 19.835  1.00 51.55 ? 40  THR B CG2 1 
ATOM   1111 N N   . TRP B 1 41  ? 21.514 14.889 21.414  1.00 37.29 ? 41  TRP B N   1 
ATOM   1112 C CA  . TRP B 1 41  ? 21.320 15.947 22.393  1.00 35.07 ? 41  TRP B CA  1 
ATOM   1113 C C   . TRP B 1 41  ? 20.571 15.477 23.618  1.00 35.11 ? 41  TRP B C   1 
ATOM   1114 O O   . TRP B 1 41  ? 19.379 15.231 23.567  1.00 38.79 ? 41  TRP B O   1 
ATOM   1115 C CB  . TRP B 1 41  ? 20.555 17.102 21.780  1.00 30.94 ? 41  TRP B CB  1 
ATOM   1116 C CG  . TRP B 1 41  ? 21.338 17.824 20.765  1.00 30.07 ? 41  TRP B CG  1 
ATOM   1117 C CD1 . TRP B 1 41  ? 21.159 17.783 19.432  1.00 30.68 ? 41  TRP B CD1 1 
ATOM   1118 C CD2 . TRP B 1 41  ? 22.414 18.732 21.001  1.00 24.81 ? 41  TRP B CD2 1 
ATOM   1119 N NE1 . TRP B 1 41  ? 22.044 18.616 18.810  1.00 30.89 ? 41  TRP B NE1 1 
ATOM   1120 C CE2 . TRP B 1 41  ? 22.831 19.215 19.753  1.00 27.63 ? 41  TRP B CE2 1 
ATOM   1121 C CE3 . TRP B 1 41  ? 23.061 19.188 22.150  1.00 24.13 ? 41  TRP B CE3 1 
ATOM   1122 C CZ2 . TRP B 1 41  ? 23.875 20.135 19.608  1.00 24.85 ? 41  TRP B CZ2 1 
ATOM   1123 C CZ3 . TRP B 1 41  ? 24.100 20.105 22.006  1.00 26.29 ? 41  TRP B CZ3 1 
ATOM   1124 C CH2 . TRP B 1 41  ? 24.494 20.565 20.741  1.00 22.08 ? 41  TRP B CH2 1 
ATOM   1125 N N   . GLU B 1 42  ? 21.268 15.364 24.727  1.00 36.56 ? 42  GLU B N   1 
ATOM   1126 C CA  . GLU B 1 42  ? 20.652 14.949 25.975  1.00 38.02 ? 42  GLU B CA  1 
ATOM   1127 C C   . GLU B 1 42  ? 20.028 16.171 26.672  1.00 36.75 ? 42  GLU B C   1 
ATOM   1128 O O   . GLU B 1 42  ? 20.613 17.266 26.695  1.00 38.49 ? 42  GLU B O   1 
ATOM   1129 C CB  . GLU B 1 42  ? 21.733 14.429 26.919  1.00 41.97 ? 42  GLU B CB  1 
ATOM   1130 C CG  . GLU B 1 42  ? 22.514 13.291 26.396  1.00 57.69 ? 42  GLU B CG  1 
ATOM   1131 C CD  . GLU B 1 42  ? 21.836 11.980 26.713  1.00 69.03 ? 42  GLU B CD  1 
ATOM   1132 O OE1 . GLU B 1 42  ? 20.951 11.549 25.926  1.00 74.17 ? 42  GLU B OE1 1 
ATOM   1133 O OE2 . GLU B 1 42  ? 22.175 11.397 27.773  1.00 74.53 ? 42  GLU B OE2 1 
ATOM   1134 N N   . PRO B 1 43  ? 18.807 16.027 27.188  1.00 33.78 ? 43  PRO B N   1 
ATOM   1135 C CA  . PRO B 1 43  ? 18.134 17.121 27.904  1.00 28.87 ? 43  PRO B CA  1 
ATOM   1136 C C   . PRO B 1 43  ? 19.050 17.431 29.080  1.00 26.92 ? 43  PRO B C   1 
ATOM   1137 O O   . PRO B 1 43  ? 19.649 16.521 29.657  1.00 29.47 ? 43  PRO B O   1 
ATOM   1138 C CB  . PRO B 1 43  ? 16.890 16.443 28.365  1.00 27.98 ? 43  PRO B CB  1 
ATOM   1139 C CG  . PRO B 1 43  ? 16.515 15.600 27.165  1.00 32.64 ? 43  PRO B CG  1 
ATOM   1140 C CD  . PRO B 1 43  ? 17.856 14.941 26.869  1.00 34.57 ? 43  PRO B CD  1 
ATOM   1141 N N   . PHE B 1 44  ? 19.212 18.696 29.425  1.00 22.73 ? 44  PHE B N   1 
ATOM   1142 C CA  . PHE B 1 44  ? 20.148 19.022 30.482  1.00 19.78 ? 44  PHE B CA  1 
ATOM   1143 C C   . PHE B 1 44  ? 19.544 19.888 31.574  1.00 19.79 ? 44  PHE B C   1 
ATOM   1144 O O   . PHE B 1 44  ? 19.813 19.690 32.757  1.00 18.73 ? 44  PHE B O   1 
ATOM   1145 C CB  . PHE B 1 44  ? 21.417 19.659 29.835  1.00 19.26 ? 44  PHE B CB  1 
ATOM   1146 C CG  . PHE B 1 44  ? 22.467 20.111 30.830  1.00 21.78 ? 44  PHE B CG  1 
ATOM   1147 C CD1 . PHE B 1 44  ? 23.353 19.192 31.414  1.00 20.74 ? 44  PHE B CD1 1 
ATOM   1148 C CD2 . PHE B 1 44  ? 22.551 21.457 31.220  1.00 21.08 ? 44  PHE B CD2 1 
ATOM   1149 C CE1 . PHE B 1 44  ? 24.319 19.608 32.391  1.00 22.58 ? 44  PHE B CE1 1 
ATOM   1150 C CE2 . PHE B 1 44  ? 23.505 21.883 32.188  1.00 22.96 ? 44  PHE B CE2 1 
ATOM   1151 C CZ  . PHE B 1 44  ? 24.391 20.952 32.774  1.00 21.09 ? 44  PHE B CZ  1 
ATOM   1152 N N   . ALA B 1 45  ? 18.783 20.898 31.170  1.00 21.61 ? 45  ALA B N   1 
ATOM   1153 C CA  . ALA B 1 45  ? 18.125 21.821 32.100  1.00 20.45 ? 45  ALA B CA  1 
ATOM   1154 C C   . ALA B 1 45  ? 17.037 22.548 31.334  1.00 19.75 ? 45  ALA B C   1 
ATOM   1155 O O   . ALA B 1 45  ? 17.074 22.564 30.104  1.00 21.96 ? 45  ALA B O   1 
ATOM   1156 C CB  . ALA B 1 45  ? 19.120 22.830 32.655  1.00 19.70 ? 45  ALA B CB  1 
ATOM   1157 N N   . SER B 1 46  ? 16.041 23.082 32.039  1.00 19.65 ? 46  SER B N   1 
ATOM   1158 C CA  . SER B 1 46  ? 14.984 23.841 31.388  1.00 21.38 ? 46  SER B CA  1 
ATOM   1159 C C   . SER B 1 46  ? 14.289 24.769 32.361  1.00 22.18 ? 46  SER B C   1 
ATOM   1160 O O   . SER B 1 46  ? 14.401 24.607 33.572  1.00 25.09 ? 46  SER B O   1 
ATOM   1161 C CB  . SER B 1 46  ? 13.945 22.937 30.728  1.00 18.98 ? 46  SER B CB  1 
ATOM   1162 O OG  . SER B 1 46  ? 13.335 22.114 31.702  1.00 25.71 ? 46  SER B OG  1 
ATOM   1163 N N   . GLY B 1 47  ? 13.590 25.758 31.833  1.00 21.28 ? 47  GLY B N   1 
ATOM   1164 C CA  . GLY B 1 47  ? 12.889 26.664 32.709  1.00 22.90 ? 47  GLY B CA  1 
ATOM   1165 C C   . GLY B 1 47  ? 12.170 27.722 31.899  1.00 24.30 ? 47  GLY B C   1 
ATOM   1166 O O   . GLY B 1 47  ? 12.048 27.607 30.668  1.00 22.57 ? 47  GLY B O   1 
ATOM   1167 N N   . LYS B 1 48  ? 11.675 28.737 32.601  1.00 21.64 ? 48  LYS B N   1 
ATOM   1168 C CA  . LYS B 1 48  ? 10.973 29.855 31.983  1.00 25.73 ? 48  LYS B CA  1 
ATOM   1169 C C   . LYS B 1 48  ? 11.555 31.179 32.522  1.00 26.51 ? 48  LYS B C   1 
ATOM   1170 O O   . LYS B 1 48  ? 11.926 31.292 33.712  1.00 27.37 ? 48  LYS B O   1 
ATOM   1171 C CB  . LYS B 1 48  ? 9.488  29.778 32.292  1.00 25.39 ? 48  LYS B CB  1 
ATOM   1172 C CG  . LYS B 1 48  ? 8.725  28.918 31.358  1.00 34.94 ? 48  LYS B CG  1 
ATOM   1173 C CD  . LYS B 1 48  ? 7.265  28.918 31.717  1.00 39.36 ? 48  LYS B CD  1 
ATOM   1174 C CE  . LYS B 1 48  ? 6.431  28.236 30.617  1.00 45.17 ? 48  LYS B CE  1 
ATOM   1175 N NZ  . LYS B 1 48  ? 6.328  28.984 29.300  1.00 45.57 ? 48  LYS B NZ  1 
ATOM   1176 N N   . THR B 1 49  ? 11.719 32.153 31.630  1.00 26.09 ? 49  THR B N   1 
ATOM   1177 C CA  . THR B 1 49  ? 12.241 33.461 32.022  1.00 22.05 ? 49  THR B CA  1 
ATOM   1178 C C   . THR B 1 49  ? 11.240 34.124 32.967  1.00 23.57 ? 49  THR B C   1 
ATOM   1179 O O   . THR B 1 49  ? 9.998  34.008 32.814  1.00 20.40 ? 49  THR B O   1 
ATOM   1180 C CB  . THR B 1 49  ? 12.429 34.352 30.808  1.00 21.61 ? 49  THR B CB  1 
ATOM   1181 O OG1 . THR B 1 49  ? 11.158 34.498 30.128  1.00 20.01 ? 49  THR B OG1 1 
ATOM   1182 C CG2 . THR B 1 49  ? 13.507 33.741 29.873  1.00 16.13 ? 49  THR B CG2 1 
ATOM   1183 N N   . SER B 1 50  ? 11.797 34.863 33.910  1.00 24.49 ? 50  SER B N   1 
ATOM   1184 C CA  . SER B 1 50  ? 11.034 35.543 34.928  1.00 25.71 ? 50  SER B CA  1 
ATOM   1185 C C   . SER B 1 50  ? 10.458 36.826 34.374  1.00 28.34 ? 50  SER B C   1 
ATOM   1186 O O   . SER B 1 50  ? 10.615 37.114 33.186  1.00 28.91 ? 50  SER B O   1 
ATOM   1187 C CB  . SER B 1 50  ? 11.993 35.869 36.068  1.00 28.80 ? 50  SER B CB  1 
ATOM   1188 O OG  . SER B 1 50  ? 12.996 36.775 35.619  1.00 31.70 ? 50  SER B OG  1 
ATOM   1189 N N   . GLU B 1 51  ? 9.869  37.633 35.259  1.00 30.44 ? 51  GLU B N   1 
ATOM   1190 C CA  . GLU B 1 51  ? 9.279  38.924 34.885  1.00 33.66 ? 51  GLU B CA  1 
ATOM   1191 C C   . GLU B 1 51  ? 10.367 39.894 34.419  1.00 29.27 ? 51  GLU B C   1 
ATOM   1192 O O   . GLU B 1 51  ? 10.080 40.924 33.822  1.00 27.34 ? 51  GLU B O   1 
ATOM   1193 C CB  . GLU B 1 51  ? 8.486  39.524 36.065  1.00 42.18 ? 51  GLU B CB  1 
ATOM   1194 C CG  . GLU B 1 51  ? 7.311  38.658 36.607  1.00 58.85 ? 51  GLU B CG  1 
ATOM   1195 C CD  . GLU B 1 51  ? 6.019  38.690 35.735  1.00 69.42 ? 51  GLU B CD  1 
ATOM   1196 O OE1 . GLU B 1 51  ? 5.361  39.762 35.653  1.00 72.82 ? 51  GLU B OE1 1 
ATOM   1197 O OE2 . GLU B 1 51  ? 5.637  37.625 35.166  1.00 74.89 ? 51  GLU B OE2 1 
ATOM   1198 N N   . SER B 1 52  ? 11.621 39.582 34.721  1.00 26.30 ? 52  SER B N   1 
ATOM   1199 C CA  . SER B 1 52  ? 12.707 40.441 34.279  1.00 24.61 ? 52  SER B CA  1 
ATOM   1200 C C   . SER B 1 52  ? 13.365 39.843 33.049  1.00 21.44 ? 52  SER B C   1 
ATOM   1201 O O   . SER B 1 52  ? 14.462 40.228 32.689  1.00 23.05 ? 52  SER B O   1 
ATOM   1202 C CB  . SER B 1 52  ? 13.750 40.580 35.364  1.00 28.05 ? 52  SER B CB  1 
ATOM   1203 O OG  . SER B 1 52  ? 14.490 39.379 35.475  1.00 37.73 ? 52  SER B OG  1 
ATOM   1204 N N   . GLY B 1 53  ? 12.736 38.834 32.471  1.00 18.91 ? 53  GLY B N   1 
ATOM   1205 C CA  . GLY B 1 53  ? 13.260 38.213 31.270  1.00 18.30 ? 53  GLY B CA  1 
ATOM   1206 C C   . GLY B 1 53  ? 14.483 37.344 31.493  1.00 20.43 ? 53  GLY B C   1 
ATOM   1207 O O   . GLY B 1 53  ? 15.157 36.929 30.559  1.00 17.70 ? 53  GLY B O   1 
ATOM   1208 N N   . GLU B 1 54  ? 14.784 37.058 32.744  1.00 23.31 ? 54  GLU B N   1 
ATOM   1209 C CA  . GLU B 1 54  ? 15.952 36.242 33.058  1.00 24.31 ? 54  GLU B CA  1 
ATOM   1210 C C   . GLU B 1 54  ? 15.633 34.831 33.543  1.00 24.35 ? 54  GLU B C   1 
ATOM   1211 O O   . GLU B 1 54  ? 14.543 34.543 34.090  1.00 27.68 ? 54  GLU B O   1 
ATOM   1212 C CB  . GLU B 1 54  ? 16.823 36.959 34.082  1.00 24.41 ? 54  GLU B CB  1 
ATOM   1213 C CG  . GLU B 1 54  ? 17.470 38.145 33.466  1.00 32.90 ? 54  GLU B CG  1 
ATOM   1214 C CD  . GLU B 1 54  ? 18.081 39.078 34.451  1.00 41.05 ? 54  GLU B CD  1 
ATOM   1215 O OE1 . GLU B 1 54  ? 18.568 38.627 35.497  1.00 44.15 ? 54  GLU B OE1 1 
ATOM   1216 O OE2 . GLU B 1 54  ? 18.074 40.291 34.171  1.00 50.77 ? 54  GLU B OE2 1 
ATOM   1217 N N   . LEU B 1 55  ? 16.587 33.944 33.333  1.00 21.81 ? 55  LEU B N   1 
ATOM   1218 C CA  . LEU B 1 55  ? 16.443 32.563 33.758  1.00 22.56 ? 55  LEU B CA  1 
ATOM   1219 C C   . LEU B 1 55  ? 17.721 32.171 34.472  1.00 21.97 ? 55  LEU B C   1 
ATOM   1220 O O   . LEU B 1 55  ? 18.792 32.170 33.894  1.00 23.08 ? 55  LEU B O   1 
ATOM   1221 C CB  . LEU B 1 55  ? 16.191 31.679 32.551  1.00 21.87 ? 55  LEU B CB  1 
ATOM   1222 C CG  . LEU B 1 55  ? 15.958 30.218 32.870  1.00 20.40 ? 55  LEU B CG  1 
ATOM   1223 C CD1 . LEU B 1 55  ? 15.027 30.077 34.064  1.00 21.39 ? 55  LEU B CD1 1 
ATOM   1224 C CD2 . LEU B 1 55  ? 15.399 29.585 31.629  1.00 19.89 ? 55  LEU B CD2 1 
ATOM   1225 N N   . HIS B 1 56  ? 17.597 31.983 35.776  1.00 27.61 ? 56  HIS B N   1 
ATOM   1226 C CA  . HIS B 1 56  ? 18.719 31.631 36.650  1.00 33.43 ? 56  HIS B CA  1 
ATOM   1227 C C   . HIS B 1 56  ? 18.574 30.225 37.228  1.00 33.40 ? 56  HIS B C   1 
ATOM   1228 O O   . HIS B 1 56  ? 17.488 29.626 37.205  1.00 34.93 ? 56  HIS B O   1 
ATOM   1229 C CB  . HIS B 1 56  ? 18.771 32.596 37.850  1.00 32.89 ? 56  HIS B CB  1 
ATOM   1230 C CG  . HIS B 1 56  ? 19.016 34.014 37.471  1.00 38.22 ? 56  HIS B CG  1 
ATOM   1231 N ND1 . HIS B 1 56  ? 17.994 34.893 37.176  1.00 41.63 ? 56  HIS B ND1 1 
ATOM   1232 C CD2 . HIS B 1 56  ? 20.166 34.697 37.286  1.00 39.51 ? 56  HIS B CD2 1 
ATOM   1233 C CE1 . HIS B 1 56  ? 18.512 36.054 36.815  1.00 38.81 ? 56  HIS B CE1 1 
ATOM   1234 N NE2 . HIS B 1 56  ? 19.827 35.961 36.876  1.00 38.01 ? 56  HIS B NE2 1 
ATOM   1235 N N   . GLY B 1 57  ? 19.659 29.752 37.820  1.00 30.74 ? 57  GLY B N   1 
ATOM   1236 C CA  . GLY B 1 57  ? 19.642 28.462 38.473  1.00 31.17 ? 57  GLY B CA  1 
ATOM   1237 C C   . GLY B 1 57  ? 19.387 27.293 37.573  1.00 30.87 ? 57  GLY B C   1 
ATOM   1238 O O   . GLY B 1 57  ? 18.742 26.352 37.985  1.00 31.40 ? 57  GLY B O   1 
ATOM   1239 N N   . LEU B 1 58  ? 19.873 27.358 36.338  1.00 30.84 ? 58  LEU B N   1 
ATOM   1240 C CA  . LEU B 1 58  ? 19.714 26.259 35.408  1.00 27.55 ? 58  LEU B CA  1 
ATOM   1241 C C   . LEU B 1 58  ? 20.595 25.042 35.799  1.00 28.25 ? 58  LEU B C   1 
ATOM   1242 O O   . LEU B 1 58  ? 20.174 23.895 35.623  1.00 26.65 ? 58  LEU B O   1 
ATOM   1243 C CB  . LEU B 1 58  ? 20.041 26.748 33.994  1.00 28.28 ? 58  LEU B CB  1 
ATOM   1244 C CG  . LEU B 1 58  ? 18.949 27.528 33.238  1.00 28.87 ? 58  LEU B CG  1 
ATOM   1245 C CD1 . LEU B 1 58  ? 19.480 28.015 31.934  1.00 26.50 ? 58  LEU B CD1 1 
ATOM   1246 C CD2 . LEU B 1 58  ? 17.759 26.634 32.952  1.00 29.03 ? 58  LEU B CD2 1 
ATOM   1247 N N   . THR B 1 59  ? 21.803 25.300 36.325  1.00 29.18 ? 59  THR B N   1 
ATOM   1248 C CA  . THR B 1 59  ? 22.759 24.248 36.735  1.00 26.47 ? 59  THR B CA  1 
ATOM   1249 C C   . THR B 1 59  ? 23.580 24.704 37.911  1.00 26.70 ? 59  THR B C   1 
ATOM   1250 O O   . THR B 1 59  ? 23.462 25.829 38.372  1.00 30.59 ? 59  THR B O   1 
ATOM   1251 C CB  . THR B 1 59  ? 23.904 24.023 35.736  1.00 28.15 ? 59  THR B CB  1 
ATOM   1252 O OG1 . THR B 1 59  ? 23.835 24.932 34.639  1.00 35.73 ? 59  THR B OG1 1 
ATOM   1253 C CG2 . THR B 1 59  ? 23.965 22.672 35.305  1.00 19.88 ? 59  THR B CG2 1 
ATOM   1254 N N   . THR B 1 60  ? 24.586 23.897 38.218  1.00 27.28 ? 60  THR B N   1 
ATOM   1255 C CA  . THR B 1 60  ? 25.529 24.183 39.290  1.00 27.96 ? 60  THR B CA  1 
ATOM   1256 C C   . THR B 1 60  ? 26.915 24.029 38.630  1.00 25.51 ? 60  THR B C   1 
ATOM   1257 O O   . THR B 1 60  ? 27.002 23.418 37.568  1.00 26.28 ? 60  THR B O   1 
ATOM   1258 C CB  . THR B 1 60  ? 25.303 23.197 40.433  1.00 28.34 ? 60  THR B CB  1 
ATOM   1259 O OG1 . THR B 1 60  ? 25.636 21.882 39.989  1.00 29.98 ? 60  THR B OG1 1 
ATOM   1260 C CG2 . THR B 1 60  ? 23.842 23.191 40.807  1.00 25.04 ? 60  THR B CG2 1 
ATOM   1261 N N   . GLU B 1 61  ? 27.982 24.597 39.191  1.00 24.80 ? 61  GLU B N   1 
ATOM   1262 C CA  . GLU B 1 61  ? 29.255 24.435 38.520  1.00 31.19 ? 61  GLU B CA  1 
ATOM   1263 C C   . GLU B 1 61  ? 29.664 22.965 38.529  1.00 32.16 ? 61  GLU B C   1 
ATOM   1264 O O   . GLU B 1 61  ? 30.352 22.488 37.629  1.00 34.15 ? 61  GLU B O   1 
ATOM   1265 C CB  . GLU B 1 61  ? 30.370 25.318 39.109  1.00 38.62 ? 61  GLU B CB  1 
ATOM   1266 C CG  . GLU B 1 61  ? 30.869 26.488 38.161  1.00 55.18 ? 61  GLU B CG  1 
ATOM   1267 C CD  . GLU B 1 61  ? 31.126 26.128 36.631  1.00 64.56 ? 61  GLU B CD  1 
ATOM   1268 O OE1 . GLU B 1 61  ? 31.225 24.926 36.249  1.00 67.33 ? 61  GLU B OE1 1 
ATOM   1269 O OE2 . GLU B 1 61  ? 31.245 27.080 35.796  1.00 64.54 ? 61  GLU B OE2 1 
ATOM   1270 N N   . GLU B 1 62  ? 29.180 22.227 39.513  1.00 32.30 ? 62  GLU B N   1 
ATOM   1271 C CA  . GLU B 1 62  ? 29.499 20.809 39.614  1.00 36.12 ? 62  GLU B CA  1 
ATOM   1272 C C   . GLU B 1 62  ? 29.039 20.046 38.371  1.00 32.30 ? 62  GLU B C   1 
ATOM   1273 O O   . GLU B 1 62  ? 29.795 19.264 37.770  1.00 31.34 ? 62  GLU B O   1 
ATOM   1274 C CB  . GLU B 1 62  ? 28.822 20.198 40.862  1.00 44.68 ? 62  GLU B CB  1 
ATOM   1275 C CG  . GLU B 1 62  ? 29.036 20.990 42.192  1.00 60.30 ? 62  GLU B CG  1 
ATOM   1276 C CD  . GLU B 1 62  ? 27.930 22.037 42.516  1.00 65.73 ? 62  GLU B CD  1 
ATOM   1277 O OE1 . GLU B 1 62  ? 26.778 21.627 42.796  1.00 69.16 ? 62  GLU B OE1 1 
ATOM   1278 O OE2 . GLU B 1 62  ? 28.222 23.261 42.528  1.00 66.01 ? 62  GLU B OE2 1 
ATOM   1279 N N   . GLU B 1 63  ? 27.799 20.320 37.983  1.00 28.87 ? 63  GLU B N   1 
ATOM   1280 C CA  . GLU B 1 63  ? 27.140 19.659 36.864  1.00 29.74 ? 63  GLU B CA  1 
ATOM   1281 C C   . GLU B 1 63  ? 27.501 20.234 35.494  1.00 25.72 ? 63  GLU B C   1 
ATOM   1282 O O   . GLU B 1 63  ? 27.500 19.533 34.488  1.00 23.41 ? 63  GLU B O   1 
ATOM   1283 C CB  . GLU B 1 63  ? 25.624 19.701 37.148  1.00 34.75 ? 63  GLU B CB  1 
ATOM   1284 C CG  . GLU B 1 63  ? 24.632 19.464 36.007  1.00 51.67 ? 63  GLU B CG  1 
ATOM   1285 C CD  . GLU B 1 63  ? 23.191 20.001 36.344  1.00 60.79 ? 63  GLU B CD  1 
ATOM   1286 O OE1 . GLU B 1 63  ? 22.915 20.259 37.555  1.00 67.87 ? 63  GLU B OE1 1 
ATOM   1287 O OE2 . GLU B 1 63  ? 22.358 20.214 35.402  1.00 60.68 ? 63  GLU B OE2 1 
ATOM   1288 N N   . PHE B 1 64  ? 27.914 21.485 35.486  1.00 25.86 ? 64  PHE B N   1 
ATOM   1289 C CA  . PHE B 1 64  ? 28.235 22.160 34.250  1.00 25.25 ? 64  PHE B CA  1 
ATOM   1290 C C   . PHE B 1 64  ? 29.666 21.864 33.792  1.00 26.95 ? 64  PHE B C   1 
ATOM   1291 O O   . PHE B 1 64  ? 30.569 22.697 33.947  1.00 31.95 ? 64  PHE B O   1 
ATOM   1292 C CB  . PHE B 1 64  ? 27.996 23.675 34.404  1.00 20.81 ? 64  PHE B CB  1 
ATOM   1293 C CG  . PHE B 1 64  ? 27.924 24.421 33.092  1.00 22.84 ? 64  PHE B CG  1 
ATOM   1294 C CD1 . PHE B 1 64  ? 27.199 23.920 32.013  1.00 24.13 ? 64  PHE B CD1 1 
ATOM   1295 C CD2 . PHE B 1 64  ? 28.581 25.639 32.934  1.00 30.19 ? 64  PHE B CD2 1 
ATOM   1296 C CE1 . PHE B 1 64  ? 27.130 24.630 30.791  1.00 23.79 ? 64  PHE B CE1 1 
ATOM   1297 C CE2 . PHE B 1 64  ? 28.515 26.348 31.715  1.00 29.27 ? 64  PHE B CE2 1 
ATOM   1298 C CZ  . PHE B 1 64  ? 27.789 25.836 30.655  1.00 25.25 ? 64  PHE B CZ  1 
ATOM   1299 N N   . VAL B 1 65  ? 29.874 20.680 33.227  1.00 23.55 ? 65  VAL B N   1 
ATOM   1300 C CA  . VAL B 1 65  ? 31.204 20.296 32.739  1.00 23.55 ? 65  VAL B CA  1 
ATOM   1301 C C   . VAL B 1 65  ? 31.448 20.712 31.265  1.00 23.55 ? 65  VAL B C   1 
ATOM   1302 O O   . VAL B 1 65  ? 30.542 21.122 30.550  1.00 25.89 ? 65  VAL B O   1 
ATOM   1303 C CB  . VAL B 1 65  ? 31.439 18.763 32.897  1.00 20.19 ? 65  VAL B CB  1 
ATOM   1304 C CG1 . VAL B 1 65  ? 31.369 18.348 34.405  1.00 18.93 ? 65  VAL B CG1 1 
ATOM   1305 C CG2 . VAL B 1 65  ? 30.429 17.981 32.026  1.00 18.04 ? 65  VAL B CG2 1 
ATOM   1306 N N   . GLU B 1 66  ? 32.675 20.598 30.806  1.00 22.59 ? 66  GLU B N   1 
ATOM   1307 C CA  . GLU B 1 66  ? 32.957 20.937 29.437  1.00 25.34 ? 66  GLU B CA  1 
ATOM   1308 C C   . GLU B 1 66  ? 32.096 20.037 28.593  1.00 25.19 ? 66  GLU B C   1 
ATOM   1309 O O   . GLU B 1 66  ? 31.932 18.873 28.903  1.00 28.16 ? 66  GLU B O   1 
ATOM   1310 C CB  . GLU B 1 66  ? 34.412 20.624 29.067  1.00 31.78 ? 66  GLU B CB  1 
ATOM   1311 C CG  . GLU B 1 66  ? 35.461 21.397 29.823  1.00 40.99 ? 66  GLU B CG  1 
ATOM   1312 C CD  . GLU B 1 66  ? 36.885 20.967 29.471  1.00 48.86 ? 66  GLU B CD  1 
ATOM   1313 O OE1 . GLU B 1 66  ? 37.107 19.912 28.825  1.00 55.12 ? 66  GLU B OE1 1 
ATOM   1314 O OE2 . GLU B 1 66  ? 37.799 21.688 29.862  1.00 50.06 ? 66  GLU B OE2 1 
ATOM   1315 N N   . GLY B 1 67  ? 31.615 20.571 27.480  1.00 26.82 ? 67  GLY B N   1 
ATOM   1316 C CA  . GLY B 1 67  ? 30.785 19.821 26.557  1.00 24.24 ? 67  GLY B CA  1 
ATOM   1317 C C   . GLY B 1 67  ? 30.257 20.826 25.560  1.00 21.39 ? 67  GLY B C   1 
ATOM   1318 O O   . GLY B 1 67  ? 30.660 21.986 25.622  1.00 22.82 ? 67  GLY B O   1 
ATOM   1319 N N   . ILE B 1 68  ? 29.432 20.385 24.619  1.00 20.59 ? 68  ILE B N   1 
ATOM   1320 C CA  . ILE B 1 68  ? 28.823 21.265 23.626  1.00 18.33 ? 68  ILE B CA  1 
ATOM   1321 C C   . ILE B 1 68  ? 27.415 21.314 24.134  1.00 20.27 ? 68  ILE B C   1 
ATOM   1322 O O   . ILE B 1 68  ? 26.857 20.306 24.556  1.00 22.59 ? 68  ILE B O   1 
ATOM   1323 C CB  . ILE B 1 68  ? 28.867 20.672 22.215  1.00 21.14 ? 68  ILE B CB  1 
ATOM   1324 C CG1 . ILE B 1 68  ? 30.316 20.704 21.685  1.00 26.99 ? 68  ILE B CG1 1 
ATOM   1325 C CG2 . ILE B 1 68  ? 27.962 21.439 21.294  1.00 19.50 ? 68  ILE B CG2 1 
ATOM   1326 C CD1 . ILE B 1 68  ? 30.573 19.822 20.433  1.00 26.33 ? 68  ILE B CD1 1 
ATOM   1327 N N   . TYR B 1 69  ? 26.898 22.525 24.246  1.00 21.45 ? 69  TYR B N   1 
ATOM   1328 C CA  . TYR B 1 69  ? 25.569 22.770 24.757  1.00 18.70 ? 69  TYR B CA  1 
ATOM   1329 C C   . TYR B 1 69  ? 24.740 23.532 23.736  1.00 20.10 ? 69  TYR B C   1 
ATOM   1330 O O   . TYR B 1 69  ? 25.261 24.292 22.910  1.00 18.55 ? 69  TYR B O   1 
ATOM   1331 C CB  . TYR B 1 69  ? 25.647 23.573 26.038  1.00 17.17 ? 69  TYR B CB  1 
ATOM   1332 C CG  . TYR B 1 69  ? 26.249 22.810 27.184  1.00 19.28 ? 69  TYR B CG  1 
ATOM   1333 C CD1 . TYR B 1 69  ? 27.634 22.751 27.366  1.00 19.30 ? 69  TYR B CD1 1 
ATOM   1334 C CD2 . TYR B 1 69  ? 25.425 22.155 28.125  1.00 22.35 ? 69  TYR B CD2 1 
ATOM   1335 C CE1 . TYR B 1 69  ? 28.194 22.056 28.464  1.00 22.80 ? 69  TYR B CE1 1 
ATOM   1336 C CE2 . TYR B 1 69  ? 25.980 21.457 29.228  1.00 20.26 ? 69  TYR B CE2 1 
ATOM   1337 C CZ  . TYR B 1 69  ? 27.345 21.420 29.379  1.00 23.17 ? 69  TYR B CZ  1 
ATOM   1338 O OH  . TYR B 1 69  ? 27.872 20.729 30.433  1.00 24.03 ? 69  TYR B OH  1 
ATOM   1339 N N   . LYS B 1 70  ? 23.442 23.308 23.811  1.00 21.28 ? 70  LYS B N   1 
ATOM   1340 C CA  . LYS B 1 70  ? 22.497 23.935 22.920  1.00 21.11 ? 70  LYS B CA  1 
ATOM   1341 C C   . LYS B 1 70  ? 21.395 24.543 23.753  1.00 19.04 ? 70  LYS B C   1 
ATOM   1342 O O   . LYS B 1 70  ? 20.742 23.857 24.564  1.00 20.57 ? 70  LYS B O   1 
ATOM   1343 C CB  . LYS B 1 70  ? 21.925 22.901 21.944  1.00 21.23 ? 70  LYS B CB  1 
ATOM   1344 C CG  . LYS B 1 70  ? 20.543 23.302 21.386  1.00 27.98 ? 70  LYS B CG  1 
ATOM   1345 C CD  . LYS B 1 70  ? 20.423 23.234 19.874  1.00 31.57 ? 70  LYS B CD  1 
ATOM   1346 C CE  . LYS B 1 70  ? 20.430 21.798 19.344  1.00 34.72 ? 70  LYS B CE  1 
ATOM   1347 N NZ  . LYS B 1 70  ? 19.332 21.034 19.947  1.00 39.03 ? 70  LYS B NZ  1 
ATOM   1348 N N   . VAL B 1 71  ? 21.230 25.848 23.622  1.00 17.60 ? 71  VAL B N   1 
ATOM   1349 C CA  . VAL B 1 71  ? 20.167 26.526 24.341  1.00 17.39 ? 71  VAL B CA  1 
ATOM   1350 C C   . VAL B 1 71  ? 19.095 26.766 23.314  1.00 19.43 ? 71  VAL B C   1 
ATOM   1351 O O   . VAL B 1 71  ? 19.343 27.354 22.249  1.00 21.96 ? 71  VAL B O   1 
ATOM   1352 C CB  . VAL B 1 71  ? 20.618 27.860 24.973  1.00 16.84 ? 71  VAL B CB  1 
ATOM   1353 C CG1 . VAL B 1 71  ? 19.455 28.529 25.730  1.00 12.47 ? 71  VAL B CG1 1 
ATOM   1354 C CG2 . VAL B 1 71  ? 21.793 27.617 25.914  1.00 17.18 ? 71  VAL B CG2 1 
ATOM   1355 N N   . GLU B 1 72  ? 17.900 26.281 23.609  1.00 19.50 ? 72  GLU B N   1 
ATOM   1356 C CA  . GLU B 1 72  ? 16.782 26.438 22.688  1.00 19.48 ? 72  GLU B CA  1 
ATOM   1357 C C   . GLU B 1 72  ? 15.701 27.295 23.353  1.00 20.85 ? 72  GLU B C   1 
ATOM   1358 O O   . GLU B 1 72  ? 15.206 26.965 24.449  1.00 21.26 ? 72  GLU B O   1 
ATOM   1359 C CB  . GLU B 1 72  ? 16.255 25.091 22.345  1.00 19.26 ? 72  GLU B CB  1 
ATOM   1360 C CG  . GLU B 1 72  ? 15.326 25.113 21.243  1.00 31.33 ? 72  GLU B CG  1 
ATOM   1361 C CD  . GLU B 1 72  ? 14.880 23.720 20.977  1.00 41.62 ? 72  GLU B CD  1 
ATOM   1362 O OE1 . GLU B 1 72  ? 14.029 23.264 21.766  1.00 51.36 ? 72  GLU B OE1 1 
ATOM   1363 O OE2 . GLU B 1 72  ? 15.405 23.055 20.053  1.00 39.39 ? 72  GLU B OE2 1 
ATOM   1364 N N   . ILE B 1 73  ? 15.402 28.431 22.720  1.00 19.18 ? 73  ILE B N   1 
ATOM   1365 C CA  . ILE B 1 73  ? 14.456 29.397 23.230  1.00 18.40 ? 73  ILE B CA  1 
ATOM   1366 C C   . ILE B 1 73  ? 13.167 29.286 22.455  1.00 18.52 ? 73  ILE B C   1 
ATOM   1367 O O   . ILE B 1 73  ? 13.161 29.464 21.235  1.00 20.97 ? 73  ILE B O   1 
ATOM   1368 C CB  . ILE B 1 73  ? 15.098 30.799 23.152  1.00 18.55 ? 73  ILE B CB  1 
ATOM   1369 C CG1 . ILE B 1 73  ? 16.390 30.796 23.986  1.00 18.44 ? 73  ILE B CG1 1 
ATOM   1370 C CG2 . ILE B 1 73  ? 14.106 31.865 23.635  1.00 18.01 ? 73  ILE B CG2 1 
ATOM   1371 C CD1 . ILE B 1 73  ? 17.285 31.983 23.765  1.00 24.55 ? 73  ILE B CD1 1 
ATOM   1372 N N   . ASP B 1 74  ? 12.077 28.940 23.137  1.00 20.07 ? 74  ASP B N   1 
ATOM   1373 C CA  . ASP B 1 74  ? 10.827 28.785 22.419  1.00 24.21 ? 74  ASP B CA  1 
ATOM   1374 C C   . ASP B 1 74  ? 10.194 30.098 22.090  1.00 24.46 ? 74  ASP B C   1 
ATOM   1375 O O   . ASP B 1 74  ? 9.139  30.423 22.648  1.00 21.30 ? 74  ASP B O   1 
ATOM   1376 C CB  . ASP B 1 74  ? 9.802  27.971 23.178  1.00 32.55 ? 74  ASP B CB  1 
ATOM   1377 C CG  . ASP B 1 74  ? 8.571  27.606 22.298  1.00 49.24 ? 74  ASP B CG  1 
ATOM   1378 O OD1 . ASP B 1 74  ? 8.437  28.100 21.128  1.00 50.78 ? 74  ASP B OD1 1 
ATOM   1379 O OD2 . ASP B 1 74  ? 7.752  26.764 22.761  1.00 58.51 ? 74  ASP B OD2 1 
ATOM   1380 N N   . THR B 1 75  ? 10.735 30.735 21.055  1.00 23.76 ? 75  THR B N   1 
ATOM   1381 C CA  . THR B 1 75  ? 10.291 32.043 20.605  1.00 27.14 ? 75  THR B CA  1 
ATOM   1382 C C   . THR B 1 75  ? 8.899  32.002 19.954  1.00 27.26 ? 75  THR B C   1 
ATOM   1383 O O   . THR B 1 75  ? 8.122  32.941 20.077  1.00 25.28 ? 75  THR B O   1 
ATOM   1384 C CB  . THR B 1 75  ? 11.318 32.594 19.582  1.00 28.11 ? 75  THR B CB  1 
ATOM   1385 O OG1 . THR B 1 75  ? 11.464 31.630 18.531  1.00 25.50 ? 75  THR B OG1 1 
ATOM   1386 C CG2 . THR B 1 75  ? 12.700 32.778 20.251  1.00 26.55 ? 75  THR B CG2 1 
ATOM   1387 N N   . LYS B 1 76  ? 8.608  30.921 19.240  1.00 27.16 ? 76  LYS B N   1 
ATOM   1388 C CA  . LYS B 1 76  ? 7.326  30.795 18.561  1.00 30.15 ? 76  LYS B CA  1 
ATOM   1389 C C   . LYS B 1 76  ? 6.123  30.899 19.504  1.00 28.55 ? 76  LYS B C   1 
ATOM   1390 O O   . LYS B 1 76  ? 5.183  31.626 19.207  1.00 25.97 ? 76  LYS B O   1 
ATOM   1391 C CB  . LYS B 1 76  ? 7.242  29.505 17.719  1.00 29.43 ? 76  LYS B CB  1 
ATOM   1392 C CG  . LYS B 1 76  ? 6.071  29.528 16.775  1.00 30.44 ? 76  LYS B CG  1 
ATOM   1393 C CD  . LYS B 1 76  ? 6.099  28.376 15.812  1.00 41.37 ? 76  LYS B CD  1 
ATOM   1394 C CE  . LYS B 1 76  ? 5.552  28.791 14.440  1.00 50.56 ? 76  LYS B CE  1 
ATOM   1395 N NZ  . LYS B 1 76  ? 6.373  29.880 13.746  1.00 53.22 ? 76  LYS B NZ  1 
ATOM   1396 N N   . SER B 1 77  ? 6.179  30.200 20.634  1.00 28.34 ? 77  SER B N   1 
ATOM   1397 C CA  . SER B 1 77  ? 5.105  30.218 21.632  1.00 30.99 ? 77  SER B CA  1 
ATOM   1398 C C   . SER B 1 77  ? 4.886  31.611 22.140  1.00 28.97 ? 77  SER B C   1 
ATOM   1399 O O   . SER B 1 77  ? 3.744  32.048 22.301  1.00 29.47 ? 77  SER B O   1 
ATOM   1400 C CB  . SER B 1 77  ? 5.484  29.358 22.830  1.00 31.47 ? 77  SER B CB  1 
ATOM   1401 O OG  . SER B 1 77  ? 5.505  27.998 22.468  1.00 39.40 ? 77  SER B OG  1 
ATOM   1402 N N   . TYR B 1 78  ? 6.007  32.270 22.430  1.00 26.40 ? 78  TYR B N   1 
ATOM   1403 C CA  . TYR B 1 78  ? 6.036  33.641 22.918  1.00 25.08 ? 78  TYR B CA  1 
ATOM   1404 C C   . TYR B 1 78  ? 5.235  34.599 22.039  1.00 25.90 ? 78  TYR B C   1 
ATOM   1405 O O   . TYR B 1 78  ? 4.343  35.299 22.510  1.00 31.38 ? 78  TYR B O   1 
ATOM   1406 C CB  . TYR B 1 78  ? 7.484  34.146 22.980  1.00 23.86 ? 78  TYR B CB  1 
ATOM   1407 C CG  . TYR B 1 78  ? 7.581  35.565 23.520  1.00 22.76 ? 78  TYR B CG  1 
ATOM   1408 C CD1 . TYR B 1 78  ? 7.325  35.835 24.875  1.00 18.07 ? 78  TYR B CD1 1 
ATOM   1409 C CD2 . TYR B 1 78  ? 7.883  36.633 22.673  1.00 21.15 ? 78  TYR B CD2 1 
ATOM   1410 C CE1 . TYR B 1 78  ? 7.362  37.086 25.369  1.00 20.77 ? 78  TYR B CE1 1 
ATOM   1411 C CE2 . TYR B 1 78  ? 7.921  37.913 23.166  1.00 19.87 ? 78  TYR B CE2 1 
ATOM   1412 C CZ  . TYR B 1 78  ? 7.658  38.135 24.519  1.00 22.05 ? 78  TYR B CZ  1 
ATOM   1413 O OH  . TYR B 1 78  ? 7.655  39.422 25.026  1.00 28.39 ? 78  TYR B OH  1 
ATOM   1414 N N   . TRP B 1 79  ? 5.613  34.685 20.774  1.00 24.11 ? 79  TRP B N   1 
ATOM   1415 C CA  . TRP B 1 79  ? 4.925  35.561 19.843  1.00 27.05 ? 79  TRP B CA  1 
ATOM   1416 C C   . TRP B 1 79  ? 3.459  35.202 19.638  1.00 30.82 ? 79  TRP B C   1 
ATOM   1417 O O   . TRP B 1 79  ? 2.621  36.097 19.530  1.00 28.11 ? 79  TRP B O   1 
ATOM   1418 C CB  . TRP B 1 79  ? 5.652  35.604 18.488  1.00 25.66 ? 79  TRP B CB  1 
ATOM   1419 C CG  . TRP B 1 79  ? 7.003  36.237 18.558  1.00 21.58 ? 79  TRP B CG  1 
ATOM   1420 C CD1 . TRP B 1 79  ? 8.201  35.633 18.316  1.00 21.63 ? 79  TRP B CD1 1 
ATOM   1421 C CD2 . TRP B 1 79  ? 7.297  37.594 18.907  1.00 22.95 ? 79  TRP B CD2 1 
ATOM   1422 N NE1 . TRP B 1 79  ? 9.222  36.530 18.486  1.00 21.50 ? 79  TRP B NE1 1 
ATOM   1423 C CE2 . TRP B 1 79  ? 8.700  37.745 18.849  1.00 20.72 ? 79  TRP B CE2 1 
ATOM   1424 C CE3 . TRP B 1 79  ? 6.506  38.700 19.278  1.00 24.43 ? 79  TRP B CE3 1 
ATOM   1425 C CZ2 . TRP B 1 79  ? 9.347  38.965 19.141  1.00 20.67 ? 79  TRP B CZ2 1 
ATOM   1426 C CZ3 . TRP B 1 79  ? 7.150  39.919 19.576  1.00 25.89 ? 79  TRP B CZ3 1 
ATOM   1427 C CH2 . TRP B 1 79  ? 8.564  40.035 19.503  1.00 23.45 ? 79  TRP B CH2 1 
ATOM   1428 N N   . LYS B 1 80  ? 3.161  33.900 19.578  1.00 35.38 ? 80  LYS B N   1 
ATOM   1429 C CA  . LYS B 1 80  ? 1.798  33.416 19.371  1.00 39.27 ? 80  LYS B CA  1 
ATOM   1430 C C   . LYS B 1 80  ? 0.929  33.979 20.475  1.00 38.63 ? 80  LYS B C   1 
ATOM   1431 O O   . LYS B 1 80  ? -0.187 34.442 20.232  1.00 41.29 ? 80  LYS B O   1 
ATOM   1432 C CB  . LYS B 1 80  ? 1.714  31.881 19.424  1.00 43.24 ? 80  LYS B CB  1 
ATOM   1433 C CG  . LYS B 1 80  ? 2.365  31.137 18.273  1.00 54.36 ? 80  LYS B CG  1 
ATOM   1434 C CD  . LYS B 1 80  ? 2.007  31.735 16.921  1.00 61.92 ? 80  LYS B CD  1 
ATOM   1435 C CE  . LYS B 1 80  ? 2.681  30.958 15.786  1.00 67.97 ? 80  LYS B CE  1 
ATOM   1436 N NZ  . LYS B 1 80  ? 2.417  31.562 14.428  1.00 72.57 ? 80  LYS B NZ  1 
ATOM   1437 N N   . ALA B 1 81  ? 1.450  33.950 21.690  1.00 37.29 ? 81  ALA B N   1 
ATOM   1438 C CA  . ALA B 1 81  ? 0.705  34.442 22.825  1.00 38.55 ? 81  ALA B CA  1 
ATOM   1439 C C   . ALA B 1 81  ? 0.384  35.914 22.634  1.00 42.34 ? 81  ALA B C   1 
ATOM   1440 O O   . ALA B 1 81  ? -0.681 36.397 23.024  1.00 45.06 ? 81  ALA B O   1 
ATOM   1441 C CB  . ALA B 1 81  ? 1.485  34.227 24.078  1.00 38.49 ? 81  ALA B CB  1 
ATOM   1442 N N   . LEU B 1 82  ? 1.289  36.622 21.979  1.00 40.28 ? 82  LEU B N   1 
ATOM   1443 C CA  . LEU B 1 82  ? 1.068  38.026 21.739  1.00 40.55 ? 82  LEU B CA  1 
ATOM   1444 C C   . LEU B 1 82  ? 0.242  38.231 20.468  1.00 40.82 ? 82  LEU B C   1 
ATOM   1445 O O   . LEU B 1 82  ? 0.144  39.341 19.953  1.00 42.91 ? 82  LEU B O   1 
ATOM   1446 C CB  . LEU B 1 82  ? 2.411  38.774 21.656  1.00 42.02 ? 82  LEU B CB  1 
ATOM   1447 C CG  . LEU B 1 82  ? 3.352  38.643 22.857  1.00 41.16 ? 82  LEU B CG  1 
ATOM   1448 C CD1 . LEU B 1 82  ? 4.385  39.727 22.804  1.00 41.58 ? 82  LEU B CD1 1 
ATOM   1449 C CD2 . LEU B 1 82  ? 2.594  38.796 24.114  1.00 42.02 ? 82  LEU B CD2 1 
ATOM   1450 N N   . GLY B 1 83  ? -0.339 37.157 19.951  1.00 39.90 ? 83  GLY B N   1 
ATOM   1451 C CA  . GLY B 1 83  ? -1.125 37.266 18.748  1.00 37.91 ? 83  GLY B CA  1 
ATOM   1452 C C   . GLY B 1 83  ? -0.284 37.655 17.553  1.00 42.25 ? 83  GLY B C   1 
ATOM   1453 O O   . GLY B 1 83  ? -0.812 38.216 16.599  1.00 46.43 ? 83  GLY B O   1 
ATOM   1454 N N   . ILE B 1 84  ? 1.018  37.386 17.574  1.00 42.22 ? 84  ILE B N   1 
ATOM   1455 C CA  . ILE B 1 84  ? 1.850  37.738 16.424  1.00 41.25 ? 84  ILE B CA  1 
ATOM   1456 C C   . ILE B 1 84  ? 2.324  36.481 15.695  1.00 41.24 ? 84  ILE B C   1 
ATOM   1457 O O   . ILE B 1 84  ? 2.472  35.413 16.323  1.00 45.65 ? 84  ILE B O   1 
ATOM   1458 C CB  . ILE B 1 84  ? 3.042  38.610 16.858  1.00 44.14 ? 84  ILE B CB  1 
ATOM   1459 C CG1 . ILE B 1 84  ? 2.557  39.998 17.275  1.00 42.10 ? 84  ILE B CG1 1 
ATOM   1460 C CG2 . ILE B 1 84  ? 4.043  38.759 15.723  1.00 47.58 ? 84  ILE B CG2 1 
ATOM   1461 C CD1 . ILE B 1 84  ? 3.581  40.789 18.058  1.00 43.29 ? 84  ILE B CD1 1 
ATOM   1462 N N   . SER B 1 85  ? 2.509  36.578 14.376  1.00 37.56 ? 85  SER B N   1 
ATOM   1463 C CA  . SER B 1 85  ? 2.963  35.426 13.599  1.00 41.49 ? 85  SER B CA  1 
ATOM   1464 C C   . SER B 1 85  ? 4.473  35.474 13.401  1.00 39.41 ? 85  SER B C   1 
ATOM   1465 O O   . SER B 1 85  ? 4.974  36.233 12.568  1.00 39.44 ? 85  SER B O   1 
ATOM   1466 C CB  . SER B 1 85  ? 2.276  35.365 12.224  1.00 44.90 ? 85  SER B CB  1 
ATOM   1467 O OG  . SER B 1 85  ? 2.407  34.068 11.626  1.00 55.75 ? 85  SER B OG  1 
ATOM   1468 N N   . PRO B 1 86  ? 5.216  34.633 14.142  1.00 34.87 ? 86  PRO B N   1 
ATOM   1469 C CA  . PRO B 1 86  ? 6.680  34.611 14.022  1.00 33.16 ? 86  PRO B CA  1 
ATOM   1470 C C   . PRO B 1 86  ? 7.199  33.805 12.816  1.00 32.06 ? 86  PRO B C   1 
ATOM   1471 O O   . PRO B 1 86  ? 6.540  32.863 12.337  1.00 35.76 ? 86  PRO B O   1 
ATOM   1472 C CB  . PRO B 1 86  ? 7.091  33.914 15.308  1.00 30.42 ? 86  PRO B CB  1 
ATOM   1473 C CG  . PRO B 1 86  ? 5.994  32.815 15.414  1.00 29.64 ? 86  PRO B CG  1 
ATOM   1474 C CD  . PRO B 1 86  ? 4.734  33.609 15.101  1.00 32.19 ? 86  PRO B CD  1 
ATOM   1475 N N   . PHE B 1 87  ? 8.428  34.100 12.408  1.00 27.09 ? 87  PHE B N   1 
ATOM   1476 C CA  . PHE B 1 87  ? 9.057  33.355 11.324  1.00 24.30 ? 87  PHE B CA  1 
ATOM   1477 C C   . PHE B 1 87  ? 9.739  32.057 11.833  1.00 24.80 ? 87  PHE B C   1 
ATOM   1478 O O   . PHE B 1 87  ? 9.601  30.985 11.244  1.00 27.72 ? 87  PHE B O   1 
ATOM   1479 C CB  . PHE B 1 87  ? 10.101 34.212 10.639  1.00 14.74 ? 87  PHE B CB  1 
ATOM   1480 C CG  . PHE B 1 87  ? 10.920 33.473 9.639   1.00 17.40 ? 87  PHE B CG  1 
ATOM   1481 C CD1 . PHE B 1 87  ? 10.412 33.208 8.369   1.00 19.09 ? 87  PHE B CD1 1 
ATOM   1482 C CD2 . PHE B 1 87  ? 12.222 33.102 9.923   1.00 19.58 ? 87  PHE B CD2 1 
ATOM   1483 C CE1 . PHE B 1 87  ? 11.200 32.604 7.399   1.00 17.13 ? 87  PHE B CE1 1 
ATOM   1484 C CE2 . PHE B 1 87  ? 13.020 32.488 8.957   1.00 20.15 ? 87  PHE B CE2 1 
ATOM   1485 C CZ  . PHE B 1 87  ? 12.513 32.246 7.697   1.00 19.25 ? 87  PHE B CZ  1 
ATOM   1486 N N   . HIS B 1 88  ? 10.486 32.172 12.923  1.00 23.61 ? 88  HIS B N   1 
ATOM   1487 C CA  . HIS B 1 88  ? 11.251 31.057 13.481  1.00 23.47 ? 88  HIS B CA  1 
ATOM   1488 C C   . HIS B 1 88  ? 10.496 30.074 14.349  1.00 21.88 ? 88  HIS B C   1 
ATOM   1489 O O   . HIS B 1 88  ? 9.627  30.453 15.120  1.00 22.59 ? 88  HIS B O   1 
ATOM   1490 C CB  . HIS B 1 88  ? 12.447 31.598 14.309  1.00 24.21 ? 88  HIS B CB  1 
ATOM   1491 C CG  . HIS B 1 88  ? 13.319 32.556 13.563  1.00 23.85 ? 88  HIS B CG  1 
ATOM   1492 N ND1 . HIS B 1 88  ? 13.185 33.926 13.678  1.00 21.51 ? 88  HIS B ND1 1 
ATOM   1493 C CD2 . HIS B 1 88  ? 14.272 32.347 12.617  1.00 24.38 ? 88  HIS B CD2 1 
ATOM   1494 C CE1 . HIS B 1 88  ? 14.007 34.517 12.823  1.00 25.20 ? 88  HIS B CE1 1 
ATOM   1495 N NE2 . HIS B 1 88  ? 14.678 33.583 12.170  1.00 26.13 ? 88  HIS B NE2 1 
ATOM   1496 N N   . GLU B 1 89  ? 10.900 28.816 14.273  1.00 19.47 ? 89  GLU B N   1 
ATOM   1497 C CA  . GLU B 1 89  ? 10.332 27.779 15.127  1.00 21.91 ? 89  GLU B CA  1 
ATOM   1498 C C   . GLU B 1 89  ? 10.856 28.061 16.545  1.00 23.58 ? 89  GLU B C   1 
ATOM   1499 O O   . GLU B 1 89  ? 10.150 27.874 17.548  1.00 28.73 ? 89  GLU B O   1 
ATOM   1500 C CB  . GLU B 1 89  ? 10.782 26.384 14.665  1.00 18.19 ? 89  GLU B CB  1 
ATOM   1501 C CG  . GLU B 1 89  ? 10.008 25.927 13.458  1.00 24.78 ? 89  GLU B CG  1 
ATOM   1502 C CD  . GLU B 1 89  ? 8.505  25.855 13.726  1.00 30.44 ? 89  GLU B CD  1 
ATOM   1503 O OE1 . GLU B 1 89  ? 8.091  25.135 14.650  1.00 35.13 ? 89  GLU B OE1 1 
ATOM   1504 O OE2 . GLU B 1 89  ? 7.723  26.544 13.044  1.00 34.93 ? 89  GLU B OE2 1 
ATOM   1505 N N   . HIS B 1 90  ? 12.109 28.499 16.629  1.00 24.62 ? 90  HIS B N   1 
ATOM   1506 C CA  . HIS B 1 90  ? 12.729 28.857 17.920  1.00 24.27 ? 90  HIS B CA  1 
ATOM   1507 C C   . HIS B 1 90  ? 14.108 29.380 17.621  1.00 18.98 ? 90  HIS B C   1 
ATOM   1508 O O   . HIS B 1 90  ? 14.504 29.403 16.465  1.00 22.01 ? 90  HIS B O   1 
ATOM   1509 C CB  . HIS B 1 90  ? 12.810 27.643 18.857  1.00 29.18 ? 90  HIS B CB  1 
ATOM   1510 C CG  . HIS B 1 90  ? 13.370 26.415 18.213  1.00 31.48 ? 90  HIS B CG  1 
ATOM   1511 N ND1 . HIS B 1 90  ? 12.630 25.265 18.052  1.00 31.06 ? 90  HIS B ND1 1 
ATOM   1512 C CD2 . HIS B 1 90  ? 14.574 26.179 17.634  1.00 33.76 ? 90  HIS B CD2 1 
ATOM   1513 C CE1 . HIS B 1 90  ? 13.351 24.373 17.399  1.00 31.13 ? 90  HIS B CE1 1 
ATOM   1514 N NE2 . HIS B 1 90  ? 14.533 24.903 17.134  1.00 32.64 ? 90  HIS B NE2 1 
ATOM   1515 N N   . ALA B 1 91  ? 14.807 29.850 18.642  1.00 20.13 ? 91  ALA B N   1 
ATOM   1516 C CA  . ALA B 1 91  ? 16.170 30.343 18.484  1.00 20.35 ? 91  ALA B CA  1 
ATOM   1517 C C   . ALA B 1 91  ? 17.076 29.305 19.171  1.00 24.79 ? 91  ALA B C   1 
ATOM   1518 O O   . ALA B 1 91  ? 16.730 28.809 20.241  1.00 25.52 ? 91  ALA B O   1 
ATOM   1519 C CB  . ALA B 1 91  ? 16.322 31.703 19.148  1.00 17.49 ? 91  ALA B CB  1 
ATOM   1520 N N   . GLU B 1 92  ? 18.193 28.928 18.545  1.00 25.81 ? 92  GLU B N   1 
ATOM   1521 C CA  . GLU B 1 92  ? 19.102 27.947 19.146  1.00 26.19 ? 92  GLU B CA  1 
ATOM   1522 C C   . GLU B 1 92  ? 20.451 28.580 19.249  1.00 24.47 ? 92  GLU B C   1 
ATOM   1523 O O   . GLU B 1 92  ? 20.898 29.256 18.339  1.00 26.02 ? 92  GLU B O   1 
ATOM   1524 C CB  . GLU B 1 92  ? 19.319 26.743 18.241  1.00 35.09 ? 92  GLU B CB  1 
ATOM   1525 C CG  . GLU B 1 92  ? 18.188 26.427 17.336  1.00 50.57 ? 92  GLU B CG  1 
ATOM   1526 C CD  . GLU B 1 92  ? 17.481 25.196 17.787  1.00 59.54 ? 92  GLU B CD  1 
ATOM   1527 O OE1 . GLU B 1 92  ? 17.250 25.058 19.012  1.00 62.66 ? 92  GLU B OE1 1 
ATOM   1528 O OE2 . GLU B 1 92  ? 17.169 24.360 16.915  1.00 65.13 ? 92  GLU B OE2 1 
ATOM   1529 N N   . VAL B 1 93  ? 21.122 28.329 20.346  1.00 22.03 ? 93  VAL B N   1 
ATOM   1530 C CA  . VAL B 1 93  ? 22.450 28.853 20.541  1.00 23.07 ? 93  VAL B CA  1 
ATOM   1531 C C   . VAL B 1 93  ? 23.263 27.605 20.866  1.00 17.42 ? 93  VAL B C   1 
ATOM   1532 O O   . VAL B 1 93  ? 22.926 26.894 21.806  1.00 20.43 ? 93  VAL B O   1 
ATOM   1533 C CB  . VAL B 1 93  ? 22.460 29.873 21.717  1.00 24.48 ? 93  VAL B CB  1 
ATOM   1534 C CG1 . VAL B 1 93  ? 23.862 30.472 21.905  1.00 26.72 ? 93  VAL B CG1 1 
ATOM   1535 C CG2 . VAL B 1 93  ? 21.398 30.970 21.475  1.00 25.28 ? 93  VAL B CG2 1 
ATOM   1536 N N   . VAL B 1 94  ? 24.224 27.273 20.016  1.00 17.60 ? 94  VAL B N   1 
ATOM   1537 C CA  . VAL B 1 94  ? 25.078 26.107 20.227  1.00 16.51 ? 94  VAL B CA  1 
ATOM   1538 C C   . VAL B 1 94  ? 26.495 26.580 20.496  1.00 17.55 ? 94  VAL B C   1 
ATOM   1539 O O   . VAL B 1 94  ? 27.046 27.377 19.743  1.00 15.85 ? 94  VAL B O   1 
ATOM   1540 C CB  . VAL B 1 94  ? 25.088 25.149 19.009  1.00 15.46 ? 94  VAL B CB  1 
ATOM   1541 C CG1 . VAL B 1 94  ? 25.914 23.936 19.333  1.00 18.06 ? 94  VAL B CG1 1 
ATOM   1542 C CG2 . VAL B 1 94  ? 23.654 24.705 18.631  1.00 16.62 ? 94  VAL B CG2 1 
ATOM   1543 N N   . PHE B 1 95  ? 27.094 26.093 21.576  1.00 19.03 ? 95  PHE B N   1 
ATOM   1544 C CA  . PHE B 1 95  ? 28.449 26.502 21.912  1.00 18.88 ? 95  PHE B CA  1 
ATOM   1545 C C   . PHE B 1 95  ? 29.152 25.446 22.766  1.00 17.87 ? 95  PHE B C   1 
ATOM   1546 O O   . PHE B 1 95  ? 28.502 24.621 23.380  1.00 15.56 ? 95  PHE B O   1 
ATOM   1547 C CB  . PHE B 1 95  ? 28.418 27.845 22.666  1.00 13.78 ? 95  PHE B CB  1 
ATOM   1548 C CG  . PHE B 1 95  ? 27.726 27.767 24.010  1.00 19.22 ? 95  PHE B CG  1 
ATOM   1549 C CD1 . PHE B 1 95  ? 26.319 27.811 24.086  1.00 23.40 ? 95  PHE B CD1 1 
ATOM   1550 C CD2 . PHE B 1 95  ? 28.463 27.626 25.208  1.00 16.95 ? 95  PHE B CD2 1 
ATOM   1551 C CE1 . PHE B 1 95  ? 25.638 27.712 25.325  1.00 20.05 ? 95  PHE B CE1 1 
ATOM   1552 C CE2 . PHE B 1 95  ? 27.807 27.529 26.437  1.00 21.96 ? 95  PHE B CE2 1 
ATOM   1553 C CZ  . PHE B 1 95  ? 26.373 27.572 26.490  1.00 21.05 ? 95  PHE B CZ  1 
ATOM   1554 N N   . THR B 1 96  ? 30.483 25.474 22.763  1.00 20.27 ? 96  THR B N   1 
ATOM   1555 C CA  . THR B 1 96  ? 31.309 24.576 23.570  1.00 21.59 ? 96  THR B CA  1 
ATOM   1556 C C   . THR B 1 96  ? 31.575 25.367 24.847  1.00 22.88 ? 96  THR B C   1 
ATOM   1557 O O   . THR B 1 96  ? 31.916 26.561 24.819  1.00 24.00 ? 96  THR B O   1 
ATOM   1558 C CB  . THR B 1 96  ? 32.646 24.263 22.861  1.00 24.34 ? 96  THR B CB  1 
ATOM   1559 O OG1 . THR B 1 96  ? 32.381 23.488 21.699  1.00 24.80 ? 96  THR B OG1 1 
ATOM   1560 C CG2 . THR B 1 96  ? 33.603 23.485 23.772  1.00 24.48 ? 96  THR B CG2 1 
ATOM   1561 N N   . ALA B 1 97  ? 31.368 24.730 25.976  1.00 21.99 ? 97  ALA B N   1 
ATOM   1562 C CA  . ALA B 1 97  ? 31.559 25.415 27.214  1.00 25.59 ? 97  ALA B CA  1 
ATOM   1563 C C   . ALA B 1 97  ? 32.774 24.862 27.931  1.00 33.24 ? 97  ALA B C   1 
ATOM   1564 O O   . ALA B 1 97  ? 33.283 23.796 27.586  1.00 32.86 ? 97  ALA B O   1 
ATOM   1565 C CB  . ALA B 1 97  ? 30.333 25.248 28.059  1.00 24.86 ? 97  ALA B CB  1 
ATOM   1566 N N   . ASN B 1 98  ? 33.265 25.651 28.886  1.00 42.59 ? 98  ASN B N   1 
ATOM   1567 C CA  . ASN B 1 98  ? 34.383 25.336 29.799  1.00 49.02 ? 98  ASN B CA  1 
ATOM   1568 C C   . ASN B 1 98  ? 35.591 24.569 29.260  1.00 54.76 ? 98  ASN B C   1 
ATOM   1569 O O   . ASN B 1 98  ? 36.403 24.020 30.046  1.00 55.93 ? 98  ASN B O   1 
ATOM   1570 C CB  . ASN B 1 98  ? 33.834 24.562 31.017  1.00 46.94 ? 98  ASN B CB  1 
ATOM   1571 C CG  . ASN B 1 98  ? 32.596 25.193 31.588  1.00 46.65 ? 98  ASN B CG  1 
ATOM   1572 O OD1 . ASN B 1 98  ? 31.566 24.519 31.770  1.00 47.79 ? 98  ASN B OD1 1 
ATOM   1573 N ND2 . ASN B 1 98  ? 32.666 26.503 31.846  1.00 42.83 ? 98  ASN B ND2 1 
ATOM   1574 N N   . ASP B 1 99  ? 35.693 24.466 27.942  1.00 58.57 ? 99  ASP B N   1 
ATOM   1575 C CA  . ASP B 1 99  ? 36.804 23.737 27.351  1.00 63.22 ? 99  ASP B CA  1 
ATOM   1576 C C   . ASP B 1 99  ? 38.129 24.243 27.953  1.00 65.74 ? 99  ASP B C   1 
ATOM   1577 O O   . ASP B 1 99  ? 39.072 23.462 28.132  1.00 68.92 ? 99  ASP B O   1 
ATOM   1578 C CB  . ASP B 1 99  ? 36.769 23.874 25.834  1.00 62.09 ? 99  ASP B CB  1 
ATOM   1579 C CG  . ASP B 1 99  ? 36.695 25.319 25.389  1.00 66.50 ? 99  ASP B CG  1 
ATOM   1580 O OD1 . ASP B 1 99  ? 36.140 26.158 26.144  1.00 67.65 ? 99  ASP B OD1 1 
ATOM   1581 O OD2 . ASP B 1 99  ? 37.199 25.612 24.278  1.00 71.04 ? 99  ASP B OD2 1 
ATOM   1582 N N   . SER B 1 100 ? 38.162 25.513 28.356  1.00 66.95 ? 100 SER B N   1 
ATOM   1583 C CA  . SER B 1 100 ? 39.367 26.088 28.976  1.00 68.91 ? 100 SER B CA  1 
ATOM   1584 C C   . SER B 1 100 ? 39.094 26.432 30.456  1.00 65.46 ? 100 SER B C   1 
ATOM   1585 O O   . SER B 1 100 ? 39.589 27.425 30.997  1.00 63.42 ? 100 SER B O   1 
ATOM   1586 C CB  . SER B 1 100 ? 39.838 27.325 28.183  1.00 73.08 ? 100 SER B CB  1 
ATOM   1587 O OG  . SER B 1 100 ? 39.998 27.020 26.791  1.00 77.54 ? 100 SER B OG  1 
ATOM   1588 N N   . GLY B 1 101 ? 38.329 25.561 31.103  1.00 64.69 ? 101 GLY B N   1 
ATOM   1589 C CA  . GLY B 1 101 ? 37.976 25.758 32.488  1.00 62.88 ? 101 GLY B CA  1 
ATOM   1590 C C   . GLY B 1 101 ? 36.629 26.444 32.514  1.00 65.02 ? 101 GLY B C   1 
ATOM   1591 O O   . GLY B 1 101 ? 36.143 26.893 31.456  1.00 65.31 ? 101 GLY B O   1 
ATOM   1592 N N   . PRO B 1 102 ? 35.935 26.432 33.672  1.00 65.56 ? 102 PRO B N   1 
ATOM   1593 C CA  . PRO B 1 102 ? 34.627 27.054 33.858  1.00 63.88 ? 102 PRO B CA  1 
ATOM   1594 C C   . PRO B 1 102 ? 34.666 28.551 33.902  1.00 62.53 ? 102 PRO B C   1 
ATOM   1595 O O   . PRO B 1 102 ? 35.544 29.170 34.540  1.00 64.62 ? 102 PRO B O   1 
ATOM   1596 C CB  . PRO B 1 102 ? 34.153 26.494 35.208  1.00 63.77 ? 102 PRO B CB  1 
ATOM   1597 C CG  . PRO B 1 102 ? 35.366 26.268 35.924  1.00 64.85 ? 102 PRO B CG  1 
ATOM   1598 C CD  . PRO B 1 102 ? 36.198 25.566 34.823  1.00 66.19 ? 102 PRO B CD  1 
ATOM   1599 N N   . ARG B 1 103 ? 33.655 29.120 33.262  1.00 59.20 ? 103 ARG B N   1 
ATOM   1600 C CA  . ARG B 1 103 ? 33.473 30.577 33.197  1.00 53.60 ? 103 ARG B CA  1 
ATOM   1601 C C   . ARG B 1 103 ? 32.001 30.772 33.631  1.00 48.87 ? 103 ARG B C   1 
ATOM   1602 O O   . ARG B 1 103 ? 31.343 29.797 34.037  1.00 49.88 ? 103 ARG B O   1 
ATOM   1603 C CB  . ARG B 1 103 ? 33.647 31.042 31.724  1.00 49.89 ? 103 ARG B CB  1 
ATOM   1604 C CG  . ARG B 1 103 ? 34.898 30.507 30.994  1.00 46.69 ? 103 ARG B CG  1 
ATOM   1605 C CD  . ARG B 1 103 ? 36.149 31.086 31.597  1.00 52.19 ? 103 ARG B CD  1 
ATOM   1606 N NE  . ARG B 1 103 ? 37.365 30.784 30.830  1.00 61.69 ? 103 ARG B NE  1 
ATOM   1607 C CZ  . ARG B 1 103 ? 38.381 29.995 31.237  1.00 65.14 ? 103 ARG B CZ  1 
ATOM   1608 N NH1 . ARG B 1 103 ? 38.366 29.371 32.431  1.00 63.16 ? 103 ARG B NH1 1 
ATOM   1609 N NH2 . ARG B 1 103 ? 39.466 29.884 30.465  1.00 62.61 ? 103 ARG B NH2 1 
ATOM   1610 N N   . ARG B 1 104 ? 31.526 32.015 33.634  1.00 41.93 ? 104 ARG B N   1 
ATOM   1611 C CA  . ARG B 1 104 ? 30.117 32.314 33.879  1.00 36.81 ? 104 ARG B CA  1 
ATOM   1612 C C   . ARG B 1 104 ? 29.610 32.764 32.490  1.00 31.89 ? 104 ARG B C   1 
ATOM   1613 O O   . ARG B 1 104 ? 30.210 33.634 31.838  1.00 29.37 ? 104 ARG B O   1 
ATOM   1614 C CB  . ARG B 1 104 ? 29.927 33.413 34.887  1.00 37.91 ? 104 ARG B CB  1 
ATOM   1615 C CG  . ARG B 1 104 ? 30.498 33.072 36.242  1.00 57.02 ? 104 ARG B CG  1 
ATOM   1616 C CD  . ARG B 1 104 ? 30.243 31.613 36.680  1.00 66.98 ? 104 ARG B CD  1 
ATOM   1617 N NE  . ARG B 1 104 ? 31.456 30.785 36.628  1.00 78.78 ? 104 ARG B NE  1 
ATOM   1618 C CZ  . ARG B 1 104 ? 31.743 29.802 37.488  1.00 83.97 ? 104 ARG B CZ  1 
ATOM   1619 N NH1 . ARG B 1 104 ? 30.903 29.518 38.483  1.00 85.83 ? 104 ARG B NH1 1 
ATOM   1620 N NH2 . ARG B 1 104 ? 32.868 29.092 37.352  1.00 84.45 ? 104 ARG B NH2 1 
ATOM   1621 N N   . TYR B 1 105 ? 28.551 32.124 32.012  1.00 25.83 ? 105 TYR B N   1 
ATOM   1622 C CA  . TYR B 1 105 ? 28.024 32.426 30.698  1.00 22.76 ? 105 TYR B CA  1 
ATOM   1623 C C   . TYR B 1 105 ? 26.677 33.036 30.811  1.00 20.28 ? 105 TYR B C   1 
ATOM   1624 O O   . TYR B 1 105 ? 25.805 32.498 31.493  1.00 23.29 ? 105 TYR B O   1 
ATOM   1625 C CB  . TYR B 1 105 ? 27.829 31.157 29.848  1.00 20.12 ? 105 TYR B CB  1 
ATOM   1626 C CG  . TYR B 1 105 ? 29.078 30.390 29.528  1.00 23.11 ? 105 TYR B CG  1 
ATOM   1627 C CD1 . TYR B 1 105 ? 29.614 29.492 30.460  1.00 30.13 ? 105 TYR B CD1 1 
ATOM   1628 C CD2 . TYR B 1 105 ? 29.756 30.588 28.326  1.00 24.34 ? 105 TYR B CD2 1 
ATOM   1629 C CE1 . TYR B 1 105 ? 30.807 28.815 30.219  1.00 30.41 ? 105 TYR B CE1 1 
ATOM   1630 C CE2 . TYR B 1 105 ? 30.950 29.924 28.063  1.00 26.48 ? 105 TYR B CE2 1 
ATOM   1631 C CZ  . TYR B 1 105 ? 31.473 29.045 29.027  1.00 33.21 ? 105 TYR B CZ  1 
ATOM   1632 O OH  . TYR B 1 105 ? 32.699 28.459 28.869  1.00 30.65 ? 105 TYR B OH  1 
ATOM   1633 N N   . THR B 1 106 ? 26.517 34.174 30.160  1.00 19.03 ? 106 THR B N   1 
ATOM   1634 C CA  . THR B 1 106 ? 25.228 34.806 30.068  1.00 18.18 ? 106 THR B CA  1 
ATOM   1635 C C   . THR B 1 106 ? 24.964 34.755 28.571  1.00 17.84 ? 106 THR B C   1 
ATOM   1636 O O   . THR B 1 106 ? 25.824 35.140 27.746  1.00 17.14 ? 106 THR B O   1 
ATOM   1637 C CB  . THR B 1 106 ? 25.231 36.281 30.522  1.00 19.56 ? 106 THR B CB  1 
ATOM   1638 O OG1 . THR B 1 106 ? 25.615 36.346 31.883  1.00 22.92 ? 106 THR B OG1 1 
ATOM   1639 C CG2 . THR B 1 106 ? 23.846 36.881 30.430  1.00 17.64 ? 106 THR B CG2 1 
ATOM   1640 N N   . ILE B 1 107 ? 23.831 34.171 28.218  1.00 18.62 ? 107 ILE B N   1 
ATOM   1641 C CA  . ILE B 1 107 ? 23.408 34.112 26.820  1.00 20.48 ? 107 ILE B CA  1 
ATOM   1642 C C   . ILE B 1 107 ? 22.248 35.118 26.747  1.00 16.92 ? 107 ILE B C   1 
ATOM   1643 O O   . ILE B 1 107 ? 21.292 35.021 27.500  1.00 19.26 ? 107 ILE B O   1 
ATOM   1644 C CB  . ILE B 1 107 ? 22.862 32.709 26.426  1.00 20.93 ? 107 ILE B CB  1 
ATOM   1645 C CG1 . ILE B 1 107 ? 23.874 31.607 26.761  1.00 20.21 ? 107 ILE B CG1 1 
ATOM   1646 C CG2 . ILE B 1 107 ? 22.402 32.708 24.963  1.00 21.24 ? 107 ILE B CG2 1 
ATOM   1647 C CD1 . ILE B 1 107 ? 25.201 31.716 26.102  1.00 26.61 ? 107 ILE B CD1 1 
ATOM   1648 N N   . ALA B 1 108 ? 22.344 36.117 25.897  1.00 19.03 ? 108 ALA B N   1 
ATOM   1649 C CA  . ALA B 1 108 ? 21.236 37.075 25.781  1.00 21.81 ? 108 ALA B CA  1 
ATOM   1650 C C   . ALA B 1 108 ? 20.643 36.911 24.393  1.00 18.60 ? 108 ALA B C   1 
ATOM   1651 O O   . ALA B 1 108 ? 21.366 36.622 23.434  1.00 22.47 ? 108 ALA B O   1 
ATOM   1652 C CB  . ALA B 1 108 ? 21.734 38.529 25.973  1.00 19.82 ? 108 ALA B CB  1 
ATOM   1653 N N   . ALA B 1 109 ? 19.336 37.061 24.288  1.00 17.19 ? 109 ALA B N   1 
ATOM   1654 C CA  . ALA B 1 109 ? 18.670 36.966 23.001  1.00 18.26 ? 109 ALA B CA  1 
ATOM   1655 C C   . ALA B 1 109 ? 17.736 38.163 22.909  1.00 16.73 ? 109 ALA B C   1 
ATOM   1656 O O   . ALA B 1 109 ? 17.115 38.524 23.890  1.00 21.06 ? 109 ALA B O   1 
ATOM   1657 C CB  . ALA B 1 109 ? 17.876 35.672 22.906  1.00 12.78 ? 109 ALA B CB  1 
ATOM   1658 N N   . LEU B 1 110 ? 17.679 38.802 21.755  1.00 16.50 ? 110 LEU B N   1 
ATOM   1659 C CA  . LEU B 1 110 ? 16.821 39.957 21.565  1.00 15.75 ? 110 LEU B CA  1 
ATOM   1660 C C   . LEU B 1 110 ? 15.861 39.503 20.479  1.00 13.75 ? 110 LEU B C   1 
ATOM   1661 O O   . LEU B 1 110 ? 16.267 39.215 19.370  1.00 17.63 ? 110 LEU B O   1 
ATOM   1662 C CB  . LEU B 1 110 ? 17.655 41.133 21.090  1.00 17.44 ? 110 LEU B CB  1 
ATOM   1663 C CG  . LEU B 1 110 ? 16.864 42.416 20.743  1.00 24.06 ? 110 LEU B CG  1 
ATOM   1664 C CD1 . LEU B 1 110 ? 16.165 43.055 21.954  1.00 14.73 ? 110 LEU B CD1 1 
ATOM   1665 C CD2 . LEU B 1 110 ? 17.827 43.382 20.106  1.00 24.35 ? 110 LEU B CD2 1 
ATOM   1666 N N   . LEU B 1 111 ? 14.577 39.539 20.747  1.00 16.13 ? 111 LEU B N   1 
ATOM   1667 C CA  . LEU B 1 111 ? 13.623 38.995 19.771  1.00 17.05 ? 111 LEU B CA  1 
ATOM   1668 C C   . LEU B 1 111 ? 12.703 39.937 19.048  1.00 17.33 ? 111 LEU B C   1 
ATOM   1669 O O   . LEU B 1 111 ? 12.144 40.849 19.652  1.00 18.20 ? 111 LEU B O   1 
ATOM   1670 C CB  . LEU B 1 111 ? 12.718 37.952 20.460  1.00 19.25 ? 111 LEU B CB  1 
ATOM   1671 C CG  . LEU B 1 111 ? 13.287 36.919 21.442  1.00 16.75 ? 111 LEU B CG  1 
ATOM   1672 C CD1 . LEU B 1 111 ? 12.119 36.172 22.088  1.00 14.20 ? 111 LEU B CD1 1 
ATOM   1673 C CD2 . LEU B 1 111 ? 14.282 35.998 20.726  1.00 17.20 ? 111 LEU B CD2 1 
ATOM   1674 N N   . SER B 1 112 ? 12.474 39.619 17.779  1.00 15.59 ? 112 SER B N   1 
ATOM   1675 C CA  . SER B 1 112 ? 11.533 40.321 16.909  1.00 17.92 ? 112 SER B CA  1 
ATOM   1676 C C   . SER B 1 112 ? 10.831 39.202 16.115  1.00 17.93 ? 112 SER B C   1 
ATOM   1677 O O   . SER B 1 112 ? 11.366 38.090 15.985  1.00 15.03 ? 112 SER B O   1 
ATOM   1678 C CB  . SER B 1 112 ? 12.266 41.272 15.969  1.00 18.05 ? 112 SER B CB  1 
ATOM   1679 O OG  . SER B 1 112 ? 12.744 42.394 16.696  1.00 23.39 ? 112 SER B OG  1 
ATOM   1680 N N   . PRO B 1 113 ? 9.658  39.486 15.528  1.00 18.44 ? 113 PRO B N   1 
ATOM   1681 C CA  . PRO B 1 113 ? 8.970  38.439 14.779  1.00 18.04 ? 113 PRO B CA  1 
ATOM   1682 C C   . PRO B 1 113 ? 9.785  37.743 13.689  1.00 19.50 ? 113 PRO B C   1 
ATOM   1683 O O   . PRO B 1 113 ? 9.686  36.514 13.532  1.00 15.58 ? 113 PRO B O   1 
ATOM   1684 C CB  . PRO B 1 113 ? 7.748  39.184 14.226  1.00 17.53 ? 113 PRO B CB  1 
ATOM   1685 C CG  . PRO B 1 113 ? 7.449  40.134 15.333  1.00 14.58 ? 113 PRO B CG  1 
ATOM   1686 C CD  . PRO B 1 113 ? 8.814  40.686 15.606  1.00 16.34 ? 113 PRO B CD  1 
ATOM   1687 N N   . TYR B 1 114 ? 10.531 38.518 12.899  1.00 14.24 ? 114 TYR B N   1 
ATOM   1688 C CA  . TYR B 1 114 ? 11.322 37.942 11.821  1.00 15.61 ? 114 TYR B CA  1 
ATOM   1689 C C   . TYR B 1 114 ? 12.822 37.995 12.014  1.00 15.90 ? 114 TYR B C   1 
ATOM   1690 O O   . TYR B 1 114 ? 13.580 37.786 11.066  1.00 17.89 ? 114 TYR B O   1 
ATOM   1691 C CB  . TYR B 1 114 ? 10.979 38.607 10.508  1.00 12.53 ? 114 TYR B CB  1 
ATOM   1692 C CG  . TYR B 1 114 ? 9.687  38.123 9.989   1.00 16.64 ? 114 TYR B CG  1 
ATOM   1693 C CD1 . TYR B 1 114 ? 8.505  38.451 10.621  1.00 21.68 ? 114 TYR B CD1 1 
ATOM   1694 C CD2 . TYR B 1 114 ? 9.641  37.289 8.887   1.00 18.33 ? 114 TYR B CD2 1 
ATOM   1695 C CE1 . TYR B 1 114 ? 7.280  37.951 10.157  1.00 30.95 ? 114 TYR B CE1 1 
ATOM   1696 C CE2 . TYR B 1 114 ? 8.445  36.776 8.408   1.00 24.41 ? 114 TYR B CE2 1 
ATOM   1697 C CZ  . TYR B 1 114 ? 7.260  37.109 9.042   1.00 31.35 ? 114 TYR B CZ  1 
ATOM   1698 O OH  . TYR B 1 114 ? 6.063  36.634 8.549   1.00 36.62 ? 114 TYR B OH  1 
ATOM   1699 N N   . SER B 1 115 ? 13.265 38.221 13.239  1.00 14.69 ? 115 SER B N   1 
ATOM   1700 C CA  . SER B 1 115 ? 14.680 38.324 13.453  1.00 15.98 ? 115 SER B CA  1 
ATOM   1701 C C   . SER B 1 115 ? 15.041 38.146 14.890  1.00 17.72 ? 115 SER B C   1 
ATOM   1702 O O   . SER B 1 115 ? 14.249 38.435 15.781  1.00 21.26 ? 115 SER B O   1 
ATOM   1703 C CB  . SER B 1 115 ? 15.106 39.737 13.057  1.00 17.92 ? 115 SER B CB  1 
ATOM   1704 O OG  . SER B 1 115 ? 16.484 39.906 13.250  1.00 22.24 ? 115 SER B OG  1 
ATOM   1705 N N   . TYR B 1 116 ? 16.265 37.696 15.120  1.00 17.09 ? 116 TYR B N   1 
ATOM   1706 C CA  . TYR B 1 116 ? 16.758 37.605 16.474  1.00 16.30 ? 116 TYR B CA  1 
ATOM   1707 C C   . TYR B 1 116 ? 18.254 37.701 16.526  1.00 14.73 ? 116 TYR B C   1 
ATOM   1708 O O   . TYR B 1 116 ? 18.954 37.509 15.533  1.00 13.35 ? 116 TYR B O   1 
ATOM   1709 C CB  . TYR B 1 116 ? 16.247 36.378 17.230  1.00 15.76 ? 116 TYR B CB  1 
ATOM   1710 C CG  . TYR B 1 116 ? 16.840 35.086 16.793  1.00 18.90 ? 116 TYR B CG  1 
ATOM   1711 C CD1 . TYR B 1 116 ? 18.065 34.641 17.307  1.00 18.37 ? 116 TYR B CD1 1 
ATOM   1712 C CD2 . TYR B 1 116 ? 16.168 34.284 15.877  1.00 18.72 ? 116 TYR B CD2 1 
ATOM   1713 C CE1 . TYR B 1 116 ? 18.604 33.416 16.907  1.00 21.80 ? 116 TYR B CE1 1 
ATOM   1714 C CE2 . TYR B 1 116 ? 16.688 33.078 15.476  1.00 20.15 ? 116 TYR B CE2 1 
ATOM   1715 C CZ  . TYR B 1 116 ? 17.893 32.656 15.990  1.00 24.12 ? 116 TYR B CZ  1 
ATOM   1716 O OH  . TYR B 1 116 ? 18.360 31.455 15.582  1.00 31.24 ? 116 TYR B OH  1 
ATOM   1717 N N   . SER B 1 117 ? 18.740 38.194 17.636  1.00 14.17 ? 117 SER B N   1 
ATOM   1718 C CA  . SER B 1 117 ? 20.156 38.263 17.768  1.00 17.78 ? 117 SER B CA  1 
ATOM   1719 C C   . SER B 1 117 ? 20.452 37.635 19.090  1.00 14.70 ? 117 SER B C   1 
ATOM   1720 O O   . SER B 1 117 ? 19.636 37.636 19.985  1.00 15.06 ? 117 SER B O   1 
ATOM   1721 C CB  . SER B 1 117 ? 20.662 39.703 17.714  1.00 22.15 ? 117 SER B CB  1 
ATOM   1722 O OG  . SER B 1 117 ? 20.112 40.444 18.764  1.00 33.69 ? 117 SER B OG  1 
ATOM   1723 N N   . THR B 1 118 ? 21.617 37.048 19.197  1.00 15.96 ? 118 THR B N   1 
ATOM   1724 C CA  . THR B 1 118 ? 21.983 36.439 20.440  1.00 17.06 ? 118 THR B CA  1 
ATOM   1725 C C   . THR B 1 118 ? 23.441 36.752 20.656  1.00 16.35 ? 118 THR B C   1 
ATOM   1726 O O   . THR B 1 118 ? 24.206 36.807 19.698  1.00 18.56 ? 118 THR B O   1 
ATOM   1727 C CB  . THR B 1 118 ? 21.739 34.934 20.396  1.00 20.08 ? 118 THR B CB  1 
ATOM   1728 O OG1 . THR B 1 118 ? 22.177 34.356 21.623  1.00 19.39 ? 118 THR B OG1 1 
ATOM   1729 C CG2 . THR B 1 118 ? 22.453 34.298 19.208  1.00 17.58 ? 118 THR B CG2 1 
ATOM   1730 N N   . THR B 1 119 ? 23.806 37.087 21.881  1.00 18.97 ? 119 THR B N   1 
ATOM   1731 C CA  . THR B 1 119 ? 25.218 37.374 22.205  1.00 22.16 ? 119 THR B CA  1 
ATOM   1732 C C   . THR B 1 119 ? 25.595 36.704 23.498  1.00 17.76 ? 119 THR B C   1 
ATOM   1733 O O   . THR B 1 119 ? 24.752 36.423 24.332  1.00 18.16 ? 119 THR B O   1 
ATOM   1734 C CB  . THR B 1 119 ? 25.573 38.916 22.178  1.00 27.00 ? 119 THR B CB  1 
ATOM   1735 O OG1 . THR B 1 119 ? 25.829 39.427 23.478  1.00 33.01 ? 119 THR B OG1 1 
ATOM   1736 C CG2 . THR B 1 119 ? 24.453 39.673 21.597  1.00 27.36 ? 119 THR B CG2 1 
ATOM   1737 N N   . ALA B 1 120 ? 26.851 36.330 23.584  1.00 16.59 ? 120 ALA B N   1 
ATOM   1738 C CA  . ALA B 1 120 ? 27.366 35.637 24.737  1.00 19.68 ? 120 ALA B CA  1 
ATOM   1739 C C   . ALA B 1 120 ? 28.289 36.524 25.533  1.00 22.11 ? 120 ALA B C   1 
ATOM   1740 O O   . ALA B 1 120 ? 29.209 37.114 24.968  1.00 24.63 ? 120 ALA B O   1 
ATOM   1741 C CB  . ALA B 1 120 ? 28.160 34.454 24.251  1.00 19.33 ? 120 ALA B CB  1 
ATOM   1742 N N   . VAL B 1 121 ? 28.023 36.696 26.819  1.00 24.68 ? 121 VAL B N   1 
ATOM   1743 C CA  . VAL B 1 121 ? 28.959 37.469 27.651  1.00 23.88 ? 121 VAL B CA  1 
ATOM   1744 C C   . VAL B 1 121 ? 29.647 36.438 28.546  1.00 24.21 ? 121 VAL B C   1 
ATOM   1745 O O   . VAL B 1 121 ? 29.002 35.780 29.366  1.00 26.31 ? 121 VAL B O   1 
ATOM   1746 C CB  . VAL B 1 121 ? 28.252 38.513 28.534  1.00 25.68 ? 121 VAL B CB  1 
ATOM   1747 C CG1 . VAL B 1 121 ? 29.300 39.304 29.303  1.00 25.50 ? 121 VAL B CG1 1 
ATOM   1748 C CG2 . VAL B 1 121 ? 27.405 39.441 27.682  1.00 25.19 ? 121 VAL B CG2 1 
ATOM   1749 N N   . VAL B 1 122 ? 30.923 36.192 28.305  1.00 28.50 ? 122 VAL B N   1 
ATOM   1750 C CA  . VAL B 1 122 ? 31.649 35.210 29.114  1.00 30.59 ? 122 VAL B CA  1 
ATOM   1751 C C   . VAL B 1 122 ? 32.569 35.890 30.110  1.00 32.99 ? 122 VAL B C   1 
ATOM   1752 O O   . VAL B 1 122 ? 33.300 36.822 29.744  1.00 30.95 ? 122 VAL B O   1 
ATOM   1753 C CB  . VAL B 1 122 ? 32.468 34.266 28.237  1.00 29.45 ? 122 VAL B CB  1 
ATOM   1754 C CG1 . VAL B 1 122 ? 33.251 33.303 29.121  1.00 31.80 ? 122 VAL B CG1 1 
ATOM   1755 C CG2 . VAL B 1 122 ? 31.523 33.538 27.232  1.00 29.15 ? 122 VAL B CG2 1 
ATOM   1756 N N   . THR B 1 123 ? 32.434 35.513 31.378  1.00 37.47 ? 123 THR B N   1 
ATOM   1757 C CA  . THR B 1 123 ? 33.273 36.073 32.437  1.00 44.00 ? 123 THR B CA  1 
ATOM   1758 C C   . THR B 1 123 ? 33.717 34.946 33.382  1.00 49.45 ? 123 THR B C   1 
ATOM   1759 O O   . THR B 1 123 ? 32.843 34.286 33.984  1.00 51.81 ? 123 THR B O   1 
ATOM   1760 C CB  . THR B 1 123 ? 32.572 37.193 33.237  1.00 41.45 ? 123 THR B CB  1 
ATOM   1761 O OG1 . THR B 1 123 ? 31.422 36.671 33.901  1.00 44.12 ? 123 THR B OG1 1 
ATOM   1762 C CG2 . THR B 1 123 ? 32.139 38.317 32.326  1.00 42.06 ? 123 THR B CG2 1 
HETATM 1763 O O   . HOH C 2 .   ? 28.664 24.316 8.323   1.00 39.01 ? 128 HOH A O   1 
HETATM 1764 O O   . HOH C 2 .   ? 30.981 30.919 15.605  1.00 22.52 ? 129 HOH A O   1 
HETATM 1765 O O   . HOH C 2 .   ? 17.493 28.570 -3.864  1.00 22.11 ? 130 HOH A O   1 
HETATM 1766 O O   . HOH C 2 .   ? 29.540 34.406 14.508  1.00 16.04 ? 131 HOH A O   1 
HETATM 1767 O O   . HOH C 2 .   ? 31.785 26.628 20.497  1.00 30.38 ? 132 HOH A O   1 
HETATM 1768 O O   . HOH C 2 .   ? 24.122 28.981 17.748  1.00 18.03 ? 133 HOH A O   1 
HETATM 1769 O O   . HOH C 2 .   ? 13.080 37.179 -0.302  1.00 31.53 ? 134 HOH A O   1 
HETATM 1770 O O   . HOH C 2 .   ? 32.320 27.936 7.186   1.00 17.97 ? 135 HOH A O   1 
HETATM 1771 O O   . HOH C 2 .   ? 34.663 29.796 6.167   1.00 43.00 ? 136 HOH A O   1 
HETATM 1772 O O   . HOH C 2 .   ? 9.174  19.130 7.023   1.00 21.74 ? 137 HOH A O   1 
HETATM 1773 O O   . HOH C 2 .   ? 3.964  30.316 2.784   1.00 41.07 ? 138 HOH A O   1 
HETATM 1774 O O   . HOH C 2 .   ? 22.629 21.446 15.993  1.00 24.02 ? 139 HOH A O   1 
HETATM 1775 O O   . HOH C 2 .   ? 30.016 33.197 17.141  1.00 23.06 ? 140 HOH A O   1 
HETATM 1776 O O   . HOH C 2 .   ? 16.543 34.294 10.219  1.00 30.11 ? 141 HOH A O   1 
HETATM 1777 O O   . HOH C 2 .   ? 35.129 37.158 4.412   1.00 31.37 ? 142 HOH A O   1 
HETATM 1778 O O   . HOH C 2 .   ? 25.894 31.421 -4.940  1.00 35.44 ? 143 HOH A O   1 
HETATM 1779 O O   . HOH C 2 .   ? 28.183 27.037 -3.223  1.00 29.06 ? 144 HOH A O   1 
HETATM 1780 O O   . HOH C 2 .   ? 21.453 17.591 -0.145  1.00 53.34 ? 145 HOH A O   1 
HETATM 1781 O O   . HOH C 2 .   ? 22.593 19.436 4.029   1.00 28.00 ? 146 HOH A O   1 
HETATM 1782 O O   . HOH C 2 .   ? 24.769 18.510 4.791   1.00 31.38 ? 147 HOH A O   1 
HETATM 1783 O O   . HOH C 2 .   ? 28.364 30.510 -3.978  1.00 32.68 ? 148 HOH A O   1 
HETATM 1784 O O   . HOH C 2 .   ? 24.099 19.660 15.226  1.00 45.47 ? 149 HOH A O   1 
HETATM 1785 O O   . HOH C 2 .   ? 3.913  32.127 4.577   1.00 43.24 ? 150 HOH A O   1 
HETATM 1786 O O   . HOH C 2 .   ? 27.165 40.615 14.731  1.00 26.39 ? 151 HOH A O   1 
HETATM 1787 O O   . HOH C 2 .   ? 28.487 17.977 3.824   1.00 44.20 ? 152 HOH A O   1 
HETATM 1788 O O   . HOH C 2 .   ? 37.625 37.217 19.452  1.00 40.56 ? 153 HOH A O   1 
HETATM 1789 O O   . HOH C 2 .   ? 4.764  22.537 6.238   1.00 47.96 ? 154 HOH A O   1 
HETATM 1790 O O   . HOH C 2 .   ? 24.933 40.526 16.680  1.00 29.99 ? 155 HOH A O   1 
HETATM 1791 O O   . HOH C 2 .   ? 35.793 46.576 4.874   1.00 33.67 ? 156 HOH A O   1 
HETATM 1792 O O   . HOH C 2 .   ? 20.641 39.701 10.332  1.00 35.42 ? 157 HOH A O   1 
HETATM 1793 O O   . HOH D 2 .   ? 16.119 29.549 14.503  1.00 23.31 ? 128 HOH B O   1 
HETATM 1794 O O   . HOH D 2 .   ? 28.360 36.578 32.395  1.00 29.09 ? 129 HOH B O   1 
HETATM 1795 O O   . HOH D 2 .   ? 8.263  28.763 11.613  1.00 24.05 ? 130 HOH B O   1 
HETATM 1796 O O   . HOH D 2 .   ? 20.237 30.294 16.197  1.00 38.29 ? 131 HOH B O   1 
HETATM 1797 O O   . HOH D 2 .   ? 7.737  30.369 9.293   1.00 40.84 ? 132 HOH B O   1 
HETATM 1798 O O   . HOH D 2 .   ? 15.750 20.425 27.978  1.00 29.92 ? 133 HOH B O   1 
HETATM 1799 O O   . HOH D 2 .   ? 29.272 17.437 25.111  1.00 29.07 ? 134 HOH B O   1 
HETATM 1800 O O   . HOH D 2 .   ? 6.824  39.641 27.634  1.00 40.58 ? 135 HOH B O   1 
HETATM 1801 O O   . HOH D 2 .   ? 11.152 34.655 15.227  1.00 20.12 ? 136 HOH B O   1 
HETATM 1802 O O   . HOH D 2 .   ? 11.950 35.875 17.595  1.00 23.03 ? 137 HOH B O   1 
HETATM 1803 O O   . HOH D 2 .   ? 9.641  32.744 16.645  1.00 25.21 ? 138 HOH B O   1 
HETATM 1804 O O   . HOH D 2 .   ? 15.833 21.269 16.536  1.00 33.81 ? 139 HOH B O   1 
HETATM 1805 O O   . HOH D 2 .   ? 7.719  30.296 25.034  1.00 35.58 ? 140 HOH B O   1 
HETATM 1806 O O   . HOH D 2 .   ? 24.747 33.663 22.157  1.00 31.34 ? 141 HOH B O   1 
HETATM 1807 O O   . HOH D 2 .   ? 14.540 19.535 31.898  1.00 36.16 ? 142 HOH B O   1 
HETATM 1808 O O   . HOH D 2 .   ? 23.030 28.157 36.257  1.00 22.53 ? 143 HOH B O   1 
HETATM 1809 O O   . HOH D 2 .   ? 14.879 33.107 37.231  1.00 47.49 ? 144 HOH B O   1 
HETATM 1810 O O   . HOH D 2 .   ? 15.535 41.638 17.124  1.00 27.72 ? 145 HOH B O   1 
HETATM 1811 O O   . HOH D 2 .   ? 34.888 37.027 27.513  1.00 40.34 ? 146 HOH B O   1 
HETATM 1812 O O   . HOH D 2 .   ? 17.532 41.434 15.594  1.00 36.81 ? 147 HOH B O   1 
HETATM 1813 O O   . HOH D 2 .   ? 33.850 21.721 20.343  1.00 42.41 ? 148 HOH B O   1 
HETATM 1814 O O   . HOH D 2 .   ? 21.892 40.013 21.395  1.00 37.37 ? 149 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   THR 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   SER 8   8   ?   ?   ?   A . n 
A 1 9   LYS 9   9   ?   ?   ?   A . n 
A 1 10  CYS 10  10  10  CYS CYS A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  MET 13  13  13  MET MET A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  TRP 41  41  41  TRP TRP A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  HIS 56  56  56  HIS HIS A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  TYR 69  69  69  TYR TYR A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  TYR 78  78  78  TYR TYR A . n 
A 1 79  TRP 79  79  79  TRP TRP A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  HIS 88  88  88  HIS HIS A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  PHE 95  95  95  PHE PHE A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ASP 99  99  99  ASP ASP A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 ASN 124 124 ?   ?   ?   A . n 
A 1 125 PRO 125 125 ?   ?   ?   A . n 
A 1 126 LYS 126 126 ?   ?   ?   A . n 
A 1 127 GLU 127 127 ?   ?   ?   A . n 
B 1 1   GLY 1   1   ?   ?   ?   B . n 
B 1 2   PRO 2   2   ?   ?   ?   B . n 
B 1 3   THR 3   3   ?   ?   ?   B . n 
B 1 4   GLY 4   4   ?   ?   ?   B . n 
B 1 5   THR 5   5   ?   ?   ?   B . n 
B 1 6   GLY 6   6   ?   ?   ?   B . n 
B 1 7   GLU 7   7   ?   ?   ?   B . n 
B 1 8   SER 8   8   ?   ?   ?   B . n 
B 1 9   LYS 9   9   ?   ?   ?   B . n 
B 1 10  CYS 10  10  10  CYS CYS B . n 
B 1 11  PRO 11  11  11  PRO PRO B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  MET 13  13  13  MET MET B . n 
B 1 14  VAL 14  14  14  VAL VAL B . n 
B 1 15  LYS 15  15  15  LYS LYS B . n 
B 1 16  VAL 16  16  16  VAL VAL B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ASP 18  18  18  ASP ASP B . n 
B 1 19  ALA 19  19  19  ALA ALA B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  GLY 22  22  22  GLY GLY B . n 
B 1 23  SER 23  23  23  SER SER B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  ALA 25  25  25  ALA ALA B . n 
B 1 26  ILE 26  26  26  ILE ILE B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  VAL 28  28  28  VAL VAL B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  VAL 32  32  32  VAL VAL B . n 
B 1 33  PHE 33  33  33  PHE PHE B . n 
B 1 34  ARG 34  34  34  ARG ARG B . n 
B 1 35  LYS 35  35  35  LYS LYS B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  ALA 37  37  37  ALA ALA B . n 
B 1 38  ASP 38  38  38  ASP ASP B . n 
B 1 39  ASP 39  39  39  ASP ASP B . n 
B 1 40  THR 40  40  40  THR THR B . n 
B 1 41  TRP 41  41  41  TRP TRP B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  PRO 43  43  43  PRO PRO B . n 
B 1 44  PHE 44  44  44  PHE PHE B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  SER 46  46  46  SER SER B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  LYS 48  48  48  LYS LYS B . n 
B 1 49  THR 49  49  49  THR THR B . n 
B 1 50  SER 50  50  50  SER SER B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  SER 52  52  52  SER SER B . n 
B 1 53  GLY 53  53  53  GLY GLY B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  LEU 55  55  55  LEU LEU B . n 
B 1 56  HIS 56  56  56  HIS HIS B . n 
B 1 57  GLY 57  57  57  GLY GLY B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  THR 59  59  59  THR THR B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  GLU 63  63  63  GLU GLU B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  VAL 65  65  65  VAL VAL B . n 
B 1 66  GLU 66  66  66  GLU GLU B . n 
B 1 67  GLY 67  67  67  GLY GLY B . n 
B 1 68  ILE 68  68  68  ILE ILE B . n 
B 1 69  TYR 69  69  69  TYR TYR B . n 
B 1 70  LYS 70  70  70  LYS LYS B . n 
B 1 71  VAL 71  71  71  VAL VAL B . n 
B 1 72  GLU 72  72  72  GLU GLU B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  TYR 78  78  78  TYR TYR B . n 
B 1 79  TRP 79  79  79  TRP TRP B . n 
B 1 80  LYS 80  80  80  LYS LYS B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  LEU 82  82  82  LEU LEU B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  ILE 84  84  84  ILE ILE B . n 
B 1 85  SER 85  85  85  SER SER B . n 
B 1 86  PRO 86  86  86  PRO PRO B . n 
B 1 87  PHE 87  87  87  PHE PHE B . n 
B 1 88  HIS 88  88  88  HIS HIS B . n 
B 1 89  GLU 89  89  89  GLU GLU B . n 
B 1 90  HIS 90  90  90  HIS HIS B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  VAL 93  93  93  VAL VAL B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  PHE 95  95  95  PHE PHE B . n 
B 1 96  THR 96  96  96  THR THR B . n 
B 1 97  ALA 97  97  97  ALA ALA B . n 
B 1 98  ASN 98  98  98  ASN ASN B . n 
B 1 99  ASP 99  99  99  ASP ASP B . n 
B 1 100 SER 100 100 100 SER SER B . n 
B 1 101 GLY 101 101 101 GLY GLY B . n 
B 1 102 PRO 102 102 102 PRO PRO B . n 
B 1 103 ARG 103 103 103 ARG ARG B . n 
B 1 104 ARG 104 104 104 ARG ARG B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 THR 106 106 106 THR THR B . n 
B 1 107 ILE 107 107 107 ILE ILE B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 SER 112 112 112 SER SER B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 TYR 114 114 114 TYR TYR B . n 
B 1 115 SER 115 115 115 SER SER B . n 
B 1 116 TYR 116 116 116 TYR TYR B . n 
B 1 117 SER 117 117 117 SER SER B . n 
B 1 118 THR 118 118 118 THR THR B . n 
B 1 119 THR 119 119 119 THR THR B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 VAL 121 121 121 VAL VAL B . n 
B 1 122 VAL 122 122 122 VAL VAL B . n 
B 1 123 THR 123 123 123 THR THR B . n 
B 1 124 ASN 124 124 ?   ?   ?   B . n 
B 1 125 PRO 125 125 ?   ?   ?   B . n 
B 1 126 LYS 126 126 ?   ?   ?   B . n 
B 1 127 GLU 127 127 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  128 1  HOH HOH A . 
C 2 HOH 2  129 2  HOH HOH A . 
C 2 HOH 3  130 3  HOH HOH A . 
C 2 HOH 4  131 4  HOH HOH A . 
C 2 HOH 5  132 5  HOH HOH A . 
C 2 HOH 6  133 6  HOH HOH A . 
C 2 HOH 7  134 8  HOH HOH A . 
C 2 HOH 8  135 9  HOH HOH A . 
C 2 HOH 9  136 10 HOH HOH A . 
C 2 HOH 10 137 11 HOH HOH A . 
C 2 HOH 11 138 12 HOH HOH A . 
C 2 HOH 12 139 13 HOH HOH A . 
C 2 HOH 13 140 14 HOH HOH A . 
C 2 HOH 14 141 17 HOH HOH A . 
C 2 HOH 15 142 18 HOH HOH A . 
C 2 HOH 16 143 20 HOH HOH A . 
C 2 HOH 17 144 21 HOH HOH A . 
C 2 HOH 18 145 22 HOH HOH A . 
C 2 HOH 19 146 23 HOH HOH A . 
C 2 HOH 20 147 24 HOH HOH A . 
C 2 HOH 21 148 25 HOH HOH A . 
C 2 HOH 22 149 26 HOH HOH A . 
C 2 HOH 23 150 28 HOH HOH A . 
C 2 HOH 24 151 29 HOH HOH A . 
C 2 HOH 25 152 30 HOH HOH A . 
C 2 HOH 26 153 31 HOH HOH A . 
C 2 HOH 27 154 32 HOH HOH A . 
C 2 HOH 28 155 48 HOH HOH A . 
C 2 HOH 29 156 50 HOH HOH A . 
C 2 HOH 30 157 51 HOH HOH A . 
D 2 HOH 1  128 7  HOH HOH B . 
D 2 HOH 2  129 15 HOH HOH B . 
D 2 HOH 3  130 16 HOH HOH B . 
D 2 HOH 4  131 19 HOH HOH B . 
D 2 HOH 5  132 27 HOH HOH B . 
D 2 HOH 6  133 33 HOH HOH B . 
D 2 HOH 7  134 34 HOH HOH B . 
D 2 HOH 8  135 35 HOH HOH B . 
D 2 HOH 9  136 36 HOH HOH B . 
D 2 HOH 10 137 37 HOH HOH B . 
D 2 HOH 11 138 38 HOH HOH B . 
D 2 HOH 12 139 39 HOH HOH B . 
D 2 HOH 13 140 40 HOH HOH B . 
D 2 HOH 14 141 41 HOH HOH B . 
D 2 HOH 15 142 42 HOH HOH B . 
D 2 HOH 16 143 43 HOH HOH B . 
D 2 HOH 17 144 44 HOH HOH B . 
D 2 HOH 18 145 45 HOH HOH B . 
D 2 HOH 19 146 46 HOH HOH B . 
D 2 HOH 20 147 47 HOH HOH B . 
D 2 HOH 21 148 49 HOH HOH B . 
D 2 HOH 22 149 52 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D 
2 1,2 A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1700  ? 
1 MORE         -12   ? 
1 'SSA (A^2)'  10100 ? 
2 'ABSA (A^2)' 6080  ? 
2 MORE         -49   ? 
2 'SSA (A^2)'  17530 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 42.8500000000 0.0000000000 -1.0000000000 
0.0000000000 85.8000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-08-05 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    refinement       3.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 39 ? ? 56.74 19.97 
2 1 ASN A 98 ? ? 50.42 16.33 
3 1 ASP B 39 ? ? 56.97 19.24 
4 1 ASN B 98 ? ? 38.58 13.41 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1   ? A GLY 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A THR 3   ? A THR 3   
4  1 Y 1 A GLY 4   ? A GLY 4   
5  1 Y 1 A THR 5   ? A THR 5   
6  1 Y 1 A GLY 6   ? A GLY 6   
7  1 Y 1 A GLU 7   ? A GLU 7   
8  1 Y 1 A SER 8   ? A SER 8   
9  1 Y 1 A LYS 9   ? A LYS 9   
10 1 Y 1 A ASN 124 ? A ASN 124 
11 1 Y 1 A PRO 125 ? A PRO 125 
12 1 Y 1 A LYS 126 ? A LYS 126 
13 1 Y 1 A GLU 127 ? A GLU 127 
14 1 Y 1 B GLY 1   ? B GLY 1   
15 1 Y 1 B PRO 2   ? B PRO 2   
16 1 Y 1 B THR 3   ? B THR 3   
17 1 Y 1 B GLY 4   ? B GLY 4   
18 1 Y 1 B THR 5   ? B THR 5   
19 1 Y 1 B GLY 6   ? B GLY 6   
20 1 Y 1 B GLU 7   ? B GLU 7   
21 1 Y 1 B SER 8   ? B SER 8   
22 1 Y 1 B LYS 9   ? B LYS 9   
23 1 Y 1 B ASN 124 ? B ASN 124 
24 1 Y 1 B PRO 125 ? B PRO 125 
25 1 Y 1 B LYS 126 ? B LYS 126 
26 1 Y 1 B GLU 127 ? B GLU 127 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#