data_1BPH
# 
_entry.id   1BPH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BPH         
WWPDB D_1000171981 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1APH '0.1M SODIUM SALT SOLUTION AT PH 7'  unspecified 
PDB 1CPH '0.1M SODIUM SALT SOLUTION AT PH 10' unspecified 
PDB 1DPH '1.0M SODIUM SALT SOLUTION AT PH 11' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BPH 
_pdbx_database_status.recvd_initial_deposition_date   1992-10-30 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gursky, O.'     1 
'Badger, J.'     2 
'Li, Y.'         3 
'Caspar, D.L.D.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Conformational changes in cubic insulin crystals in the pH range 7-11.'   Biophys.J.                 63  1210 1220 1992 
BIOJAU US 0006-3495 0030 ? 1477273 ? 
1       'Monovalent Cation Binding in Cubic Insulin Crystals'                      Biophys.J.                 61  604  ?    1992 
BIOJAU US 0006-3495 0030 ? ?       ? 
2       'Flexibility in Crystalline Insulins'                                      Biophys.J.                 61  816  ?    1992 
BIOJAU US 0006-3495 0030 ? ?       ? 
3       'Structure of the Pig Insulin Dimer in the Cubic Crystal'                  'Acta Crystallogr.,Sect.B' 47  127  ?    1991 
ASBSDK DK 0108-7681 0622 ? ?       ? 
4       'Water Structure in Cubic Insulin Crystals'                                Proc.Natl.Acad.Sci.USA     88  622  ?    1991 
PNASA6 US 0027-8424 0040 ? ?       ? 
5       'Zinc-Free Cubic Pig Insulin: Crystallization and Structure Determination' J.Mol.Biol.                125 387  ?    1978 
JMOBAK UK 0022-2836 0070 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gursky, O.'     1  
primary 'Badger, J.'     2  
primary 'Li, Y.'         3  
primary 'Caspar, D.L.'   4  
1       'Gursky, O.'     5  
1       'Li, Y.'         6  
1       'Badger, J.'     7  
1       'Caspar, D.L.D.' 8  
2       'Badger, J.'     9  
3       'Badger, J.'     10 
3       'Harris, M.R.'   11 
3       'Reynolds, C.D.' 12 
3       'Evans, A.C.'    13 
3       'Dodson, E.J.'   14 
3       'Dodson, G.G.'   15 
3       'North, A.C.T.'  16 
4       'Badger, J.'     17 
4       'Caspar, D.L.D.' 18 
5       'Dodson, E.J.'   19 
5       'Dodson, G.G.'   20 
5       'Lewitova, A.'   21 
5       'Sabesan, M.'    22 
# 
_cell.entry_id           1BPH 
_cell.length_a           78.900 
_cell.length_b           78.900 
_cell.length_c           78.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1BPH 
_symmetry.space_group_name_H-M             'I 21 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                199 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'INSULIN A CHAIN (PH 9)' 2339.645 1  ? ? ? ? 
2 polymer     man 'INSULIN B CHAIN (PH 9)' 3403.927 1  ? ? ? ? 
3 non-polymer syn 'SODIUM ION'             22.990   1  ? ? ? ? 
4 non-polymer syn 1,2-DICHLOROETHANE       98.959   1  ? ? ? ? 
5 water       nat water                    18.015   55 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GIVEQCCASVCSLYQLENYCN          GIVEQCCASVCSLYQLENYCN          A ? 
2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFFYTPKA B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ILE n 
1 3  VAL n 
1 4  GLU n 
1 5  GLN n 
1 6  CYS n 
1 7  CYS n 
1 8  ALA n 
1 9  SER n 
1 10 VAL n 
1 11 CYS n 
1 12 SER n 
1 13 LEU n 
1 14 TYR n 
1 15 GLN n 
1 16 LEU n 
1 17 GLU n 
1 18 ASN n 
1 19 TYR n 
1 20 CYS n 
1 21 ASN n 
2 1  PHE n 
2 2  VAL n 
2 3  ASN n 
2 4  GLN n 
2 5  HIS n 
2 6  LEU n 
2 7  CYS n 
2 8  GLY n 
2 9  SER n 
2 10 HIS n 
2 11 LEU n 
2 12 VAL n 
2 13 GLU n 
2 14 ALA n 
2 15 LEU n 
2 16 TYR n 
2 17 LEU n 
2 18 VAL n 
2 19 CYS n 
2 20 GLY n 
2 21 GLU n 
2 22 ARG n 
2 23 GLY n 
2 24 PHE n 
2 25 PHE n 
2 26 TYR n 
2 27 THR n 
2 28 PRO n 
2 29 LYS n 
2 30 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? cattle Bos ? ? ? ? ? ? ? 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? cattle Bos ? ? ? ? ? ? ? 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP INS_BOVIN P01317 1 85 ? ? 
2 UNP INS_BOVIN P01317 2 25 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BPH A 1 ? 21 ? P01317 85 ? 105 ? 1 21 
2 2 1BPH B 1 ? 30 ? P01317 25 ? 54  ? 1 30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE            ?                     'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE           ?                     'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE         ?                     'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE           ?                     'C3 H7 N O2 S'   121.158 
DCE non-polymer         . 1,2-DICHLOROETHANE 'ETHYLENE DICHLORIDE' 'C2 H4 Cl2'      98.959  
GLN 'L-peptide linking' y GLUTAMINE          ?                     'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'    ?                     'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE            ?                     'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE          ?                     'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER              ?                     'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE         ?                     'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE            ?                     'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE             ?                     'C6 H15 N2 O2 1' 147.195 
NA  non-polymer         . 'SODIUM ION'       ?                     'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE      ?                     'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE            ?                     'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE             ?                     'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE          ?                     'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE           ?                     'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE             ?                     'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1BPH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.56 
_exptl_crystal.density_percent_sol   65.47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1BPH 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.16 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;IN 1BPH AND 1CPH, THE SIDE CHAIN OF GLU A 4 CAN ADOPT TWO
ALTERNATIVE POSITIONS WHICH OVERLAP.  THEIR RELATIVE WEIGHT
AND THE ATOMIC POSITIONS OF THE SECOND CONFORMER ARE NOT
ACCURATELY DETERMINED.

IN 1APH, 1BPH, AND 1DPH, THE SIDE CHAIN OF GLU B 21 IS
DISORDERED.  IT HAS BEEN MODELED AS SUPERPOSITION OF TWO
CONFORMATIONS BUT ATOMIC POSITIONS FOR THESE CONFORMATIONS
ARE PROBABLY NOT VERY ACCURATE.

THE SIDE CHAIN OF LYS B 29 IS POORLY DEFINED IN THE
ELECTRON DENSITY MAPS.  IN 1APH AND 1CPH, IT IS INCLUDED
WITH PARTIAL OCCUPANCY.  IN 1BPH AND 1DPH, ITS COORDINATES
HAVE BEEN OMITTED FROM THE ENTRY.

THE MAIN AND SIDE CHAIN OF ALA B 30 (C-TERMINAL RESIDUE OF
CHAIN B) CAN ADOPT TWO SEPARATE CONFORMATIONS AND IS
DISORDERED IN EACH OF THESE CONFORMATIONS, WHICH LIMITED
THE ACCURACY OF DETERMINATION OF ATOMIC POSITIONS FOR THE
CONFORMERS OF ALA B 30.  IN 1APH AND 1CPH, SINGLE
ALTERNATIVE CONFORMERS ARE PREDOMINANT BUT, DUE TO
DISORDER, THEY ARE ASSIGNED PARTIAL OCCUPANCIES.  IN 1BPH
AND 1DPH, BOTH ALTERNATIVE CONFORMERS ARE INCLUDED IN THE
ENTRY.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        439 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             55 
_refine_hist.number_atoms_total               499 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1BPH 
_struct.title                     'CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11' 
_struct.pdbx_descriptor           'INSULIN (CUBIC) IN 0.1M SODIUM SALT SOLUTION AT PH9' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BPH 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            HORMONE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 A1 GLY A 1  ? VAL A 10 ? GLY A 1  VAL A 10 1 ?           10 
HELX_P HELX_P2 A2 SER A 12 ? GLU A 17 ? SER A 12 GLU A 17 5 'NOT IDEAL' 6  
HELX_P HELX_P3 B1 SER B 9  ? GLY B 20 ? SER B 9  GLY B 20 1 ?           12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6  A CYS 11  1_555 ? ? ? ? ? ? ? 1.991 ? 
disulf2 disulf ? ? A CYS 7  SG ? ? ? 1_555 B CYS 7  SG ? ? A CYS 7  B CYS 7   1_555 ? ? ? ? ? ? ? 1.997 ? 
disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19  1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc1 metalc ? ? C NA  .  NA ? ? ? 1_555 E HOH .  O  ? ? A NA  88 A HOH 102 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc2 metalc ? ? C NA  .  NA ? ? ? 1_555 A GLN 5  O  ? ? A NA  88 A GLN 5   1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc3 metalc ? ? C NA  .  NA ? ? ? 1_555 A VAL 10 O  ? ? A NA  88 A VAL 10  1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc4 metalc ? ? C NA  .  NA ? ? ? 1_555 E HOH .  O  ? ? A NA  88 A HOH 100 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc5 metalc ? ? A SER 9  OG ? ? ? 1_555 C NA  .  NA ? ? A SER 9  A NA  88  1_555 ? ? ? ? ? ? ? 2.847 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 88'   
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE DCE B 200' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 GLN A 5  ? GLN A 5   . ? 1_555  ? 
2  AC1 7 SER A 9  ? SER A 9   . ? 1_555  ? 
3  AC1 7 VAL A 10 ? VAL A 10  . ? 1_555  ? 
4  AC1 7 HOH E .  ? HOH A 100 . ? 15_556 ? 
5  AC1 7 HOH E .  ? HOH A 100 . ? 1_555  ? 
6  AC1 7 HOH E .  ? HOH A 102 . ? 15_556 ? 
7  AC1 7 HOH E .  ? HOH A 102 . ? 1_555  ? 
8  AC2 7 SER B 9  ? SER B 9   . ? 1_555  ? 
9  AC2 7 SER B 9  ? SER B 9   . ? 16_565 ? 
10 AC2 7 VAL B 12 ? VAL B 12  . ? 16_565 ? 
11 AC2 7 VAL B 12 ? VAL B 12  . ? 1_555  ? 
12 AC2 7 GLU B 13 ? GLU B 13  . ? 16_565 ? 
13 AC2 7 HOH F .  ? HOH B 216 . ? 16_565 ? 
14 AC2 7 HOH F .  ? HOH B 216 . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          1BPH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BPH 
_atom_sites.fract_transf_matrix[1][1]   0.012674 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012674 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012674 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . GLY A 1 1  ? 13.994 47.196 31.798 1.00 35.87 ? 1   GLY A N   1 
ATOM   2   C  CA  . GLY A 1 1  ? 14.277 46.226 30.708 1.00 38.67 ? 1   GLY A CA  1 
ATOM   3   C  C   . GLY A 1 1  ? 15.574 45.507 31.085 1.00 31.18 ? 1   GLY A C   1 
ATOM   4   O  O   . GLY A 1 1  ? 16.078 45.660 32.217 1.00 22.60 ? 1   GLY A O   1 
ATOM   5   N  N   . ILE A 1 2  ? 16.088 44.766 30.126 1.00 28.39 ? 2   ILE A N   1 
ATOM   6   C  CA  . ILE A 1 2  ? 17.342 44.034 30.404 1.00 23.76 ? 2   ILE A CA  1 
ATOM   7   C  C   . ILE A 1 2  ? 18.526 44.939 30.686 1.00 25.29 ? 2   ILE A C   1 
ATOM   8   O  O   . ILE A 1 2  ? 19.425 44.457 31.392 1.00 18.74 ? 2   ILE A O   1 
ATOM   9   C  CB  . ILE A 1 2  ? 17.571 43.072 29.158 1.00 27.36 ? 2   ILE A CB  1 
ATOM   10  C  CG1 . ILE A 1 2  ? 18.638 42.049 29.605 1.00 18.03 ? 2   ILE A CG1 1 
ATOM   11  C  CG2 . ILE A 1 2  ? 17.859 43.936 27.903 1.00 25.54 ? 2   ILE A CG2 1 
ATOM   12  C  CD1 . ILE A 1 2  ? 18.914 40.930 28.590 1.00 17.07 ? 2   ILE A CD1 1 
ATOM   13  N  N   . VAL A 1 3  ? 18.619 46.195 30.192 1.00 24.42 ? 3   VAL A N   1 
ATOM   14  C  CA  . VAL A 1 3  ? 19.774 47.080 30.436 1.00 30.26 ? 3   VAL A CA  1 
ATOM   15  C  C   . VAL A 1 3  ? 19.952 47.453 31.895 1.00 19.08 ? 3   VAL A C   1 
ATOM   16  O  O   . VAL A 1 3  ? 21.018 47.421 32.561 1.00 28.15 ? 3   VAL A O   1 
ATOM   17  C  CB  . VAL A 1 3  ? 19.719 48.274 29.462 1.00 33.87 ? 3   VAL A CB  1 
ATOM   18  C  CG1 . VAL A 1 3  ? 20.847 49.225 29.754 1.00 30.40 ? 3   VAL A CG1 1 
ATOM   19  C  CG2 . VAL A 1 3  ? 19.868 47.724 28.044 1.00 24.51 ? 3   VAL A CG2 1 
ATOM   20  N  N   . GLU A 1 4  ? 18.785 47.805 32.424 1.00 26.59 ? 4   GLU A N   1 
ATOM   21  C  CA  . GLU A 1 4  ? 18.622 48.172 33.836 1.00 33.10 ? 4   GLU A CA  1 
ATOM   22  C  C   . GLU A 1 4  ? 18.969 46.987 34.752 1.00 22.38 ? 4   GLU A C   1 
ATOM   23  O  O   . GLU A 1 4  ? 19.636 47.147 35.769 1.00 29.96 ? 4   GLU A O   1 
ATOM   24  C  CB  A GLU A 1 4  ? 17.142 48.344 34.231 0.35 22.89 ? 4   GLU A CB  1 
ATOM   25  C  CB  B GLU A 1 4  ? 17.162 48.608 34.081 0.65 37.01 ? 4   GLU A CB  1 
ATOM   26  C  CG  A GLU A 1 4  ? 16.803 49.669 34.917 0.35 33.05 ? 4   GLU A CG  1 
ATOM   27  C  CG  B GLU A 1 4  ? 16.697 49.754 33.207 0.65 48.14 ? 4   GLU A CG  1 
ATOM   28  C  CD  A GLU A 1 4  ? 16.821 50.817 33.941 0.35 40.87 ? 4   GLU A CD  1 
ATOM   29  C  CD  B GLU A 1 4  ? 16.519 49.715 31.729 0.65 41.33 ? 4   GLU A CD  1 
ATOM   30  O  OE1 A GLU A 1 4  ? 16.938 50.442 32.747 0.35 41.84 ? 4   GLU A OE1 1 
ATOM   31  O  OE1 B GLU A 1 4  ? 16.123 48.772 31.061 0.65 41.92 ? 4   GLU A OE1 1 
ATOM   32  O  OE2 A GLU A 1 4  ? 16.720 51.979 34.305 0.35 54.29 ? 4   GLU A OE2 1 
ATOM   33  O  OE2 B GLU A 1 4  ? 16.817 50.811 31.170 0.65 56.54 ? 4   GLU A OE2 1 
ATOM   34  N  N   . GLN A 1 5  ? 18.441 45.830 34.333 1.00 20.82 ? 5   GLN A N   1 
ATOM   35  C  CA  . GLN A 1 5  ? 18.635 44.641 35.151 1.00 19.86 ? 5   GLN A CA  1 
ATOM   36  C  C   . GLN A 1 5  ? 19.994 43.960 35.023 1.00 16.78 ? 5   GLN A C   1 
ATOM   37  O  O   . GLN A 1 5  ? 20.404 43.353 36.022 1.00 20.67 ? 5   GLN A O   1 
ATOM   38  C  CB  . GLN A 1 5  ? 17.478 43.610 34.976 1.00 18.46 ? 5   GLN A CB  1 
ATOM   39  C  CG  . GLN A 1 5  ? 16.150 44.045 35.586 1.00 37.02 ? 5   GLN A CG  1 
ATOM   40  C  CD  . GLN A 1 5  ? 16.141 44.774 36.915 1.00 49.99 ? 5   GLN A CD  1 
ATOM   41  O  OE1 . GLN A 1 5  ? 16.708 44.380 37.938 1.00 39.65 ? 5   GLN A OE1 1 
ATOM   42  N  NE2 . GLN A 1 5  ? 15.509 45.970 37.000 1.00 39.64 ? 5   GLN A NE2 1 
ATOM   43  N  N   . CYS A 1 6  ? 20.601 44.044 33.852 1.00 19.89 ? 6   CYS A N   1 
ATOM   44  C  CA  . CYS A 1 6  ? 21.830 43.306 33.613 1.00 14.11 ? 6   CYS A CA  1 
ATOM   45  C  C   . CYS A 1 6  ? 23.046 44.140 33.333 1.00 16.37 ? 6   CYS A C   1 
ATOM   46  O  O   . CYS A 1 6  ? 24.131 43.578 33.553 1.00 19.27 ? 6   CYS A O   1 
ATOM   47  C  CB  . CYS A 1 6  ? 21.540 42.343 32.426 1.00 12.56 ? 6   CYS A CB  1 
ATOM   48  S  SG  . CYS A 1 6  ? 20.620 40.860 33.004 1.00 18.49 ? 6   CYS A SG  1 
ATOM   49  N  N   . CYS A 1 7  ? 22.800 45.361 32.956 1.00 18.24 ? 7   CYS A N   1 
ATOM   50  C  CA  . CYS A 1 7  ? 23.972 46.225 32.671 1.00 18.70 ? 7   CYS A CA  1 
ATOM   51  C  C   . CYS A 1 7  ? 24.119 47.181 33.861 1.00 29.28 ? 7   CYS A C   1 
ATOM   52  O  O   . CYS A 1 7  ? 25.178 47.219 34.496 1.00 20.97 ? 7   CYS A O   1 
ATOM   53  C  CB  . CYS A 1 7  ? 23.719 46.956 31.352 1.00 22.67 ? 7   CYS A CB  1 
ATOM   54  S  SG  . CYS A 1 7  ? 24.924 48.305 30.971 1.00 25.81 ? 7   CYS A SG  1 
ATOM   55  N  N   . ALA A 1 8  ? 23.058 47.915 34.156 1.00 16.88 ? 8   ALA A N   1 
ATOM   56  C  CA  . ALA A 1 8  ? 23.070 48.889 35.257 1.00 24.50 ? 8   ALA A CA  1 
ATOM   57  C  C   . ALA A 1 8  ? 23.185 48.109 36.572 1.00 34.44 ? 8   ALA A C   1 
ATOM   58  O  O   . ALA A 1 8  ? 23.745 48.650 37.551 1.00 30.42 ? 8   ALA A O   1 
ATOM   59  C  CB  . ALA A 1 8  ? 21.895 49.858 35.177 1.00 18.63 ? 8   ALA A CB  1 
ATOM   60  N  N   . SER A 1 9  ? 22.664 46.884 36.657 1.00 25.11 ? 9   SER A N   1 
ATOM   61  C  CA  . SER A 1 9  ? 22.851 46.121 37.910 1.00 22.63 ? 9   SER A CA  1 
ATOM   62  C  C   . SER A 1 9  ? 23.385 44.771 37.460 1.00 29.30 ? 9   SER A C   1 
ATOM   63  O  O   . SER A 1 9  ? 23.598 44.542 36.265 1.00 15.34 ? 9   SER A O   1 
ATOM   64  C  CB  . SER A 1 9  ? 21.649 46.119 38.816 1.00 22.94 ? 9   SER A CB  1 
ATOM   65  O  OG  . SER A 1 9  ? 20.526 45.975 38.010 1.00 34.86 ? 9   SER A OG  1 
ATOM   66  N  N   . VAL A 1 10 ? 23.661 43.919 38.409 1.00 17.74 ? 10  VAL A N   1 
ATOM   67  C  CA  . VAL A 1 10 ? 24.193 42.573 38.101 1.00 20.85 ? 10  VAL A CA  1 
ATOM   68  C  C   . VAL A 1 10 ? 23.045 41.689 37.593 1.00 17.87 ? 10  VAL A C   1 
ATOM   69  O  O   . VAL A 1 10 ? 21.941 41.599 38.137 1.00 18.28 ? 10  VAL A O   1 
ATOM   70  C  CB  . VAL A 1 10 ? 24.831 42.008 39.371 1.00 24.84 ? 10  VAL A CB  1 
ATOM   71  C  CG1 . VAL A 1 10 ? 25.318 40.584 39.225 1.00 19.36 ? 10  VAL A CG1 1 
ATOM   72  C  CG2 . VAL A 1 10 ? 25.949 42.906 39.870 1.00 24.23 ? 10  VAL A CG2 1 
ATOM   73  N  N   . CYS A 1 11 ? 23.409 41.073 36.475 1.00 17.34 ? 11  CYS A N   1 
ATOM   74  C  CA  . CYS A 1 11 ? 22.505 40.156 35.785 1.00 12.14 ? 11  CYS A CA  1 
ATOM   75  C  C   . CYS A 1 11 ? 22.391 38.858 36.587 1.00 13.83 ? 11  CYS A C   1 
ATOM   76  O  O   . CYS A 1 11 ? 23.093 38.527 37.518 1.00 17.27 ? 11  CYS A O   1 
ATOM   77  C  CB  . CYS A 1 11 ? 23.231 39.975 34.427 1.00 14.85 ? 11  CYS A CB  1 
ATOM   78  S  SG  . CYS A 1 11 ? 22.037 39.465 33.101 1.00 18.76 ? 11  CYS A SG  1 
ATOM   79  N  N   . SER A 1 12 ? 21.467 38.013 36.149 1.00 21.32 ? 12  SER A N   1 
ATOM   80  C  CA  . SER A 1 12 ? 21.230 36.670 36.695 1.00 23.01 ? 12  SER A CA  1 
ATOM   81  C  C   . SER A 1 12 ? 20.829 35.760 35.522 1.00 26.32 ? 12  SER A C   1 
ATOM   82  O  O   . SER A 1 12 ? 20.358 36.259 34.464 1.00 12.20 ? 12  SER A O   1 
ATOM   83  C  CB  . SER A 1 12 ? 20.217 36.757 37.839 1.00 17.58 ? 12  SER A CB  1 
ATOM   84  O  OG  . SER A 1 12 ? 18.887 36.877 37.368 1.00 19.66 ? 12  SER A OG  1 
ATOM   85  N  N   . LEU A 1 13 ? 20.929 34.442 35.626 1.00 12.68 ? 13  LEU A N   1 
ATOM   86  C  CA  . LEU A 1 13 ? 20.507 33.477 34.628 1.00 14.94 ? 13  LEU A CA  1 
ATOM   87  C  C   . LEU A 1 13 ? 18.999 33.601 34.423 1.00 19.36 ? 13  LEU A C   1 
ATOM   88  O  O   . LEU A 1 13 ? 18.325 33.607 33.364 1.00 16.76 ? 13  LEU A O   1 
ATOM   89  C  CB  . LEU A 1 13 ? 21.047 32.094 35.028 1.00 15.38 ? 13  LEU A CB  1 
ATOM   90  C  CG  . LEU A 1 13 ? 20.643 30.910 34.154 1.00 18.77 ? 13  LEU A CG  1 
ATOM   91  C  CD1 . LEU A 1 13 ? 21.120 31.186 32.746 1.00 15.37 ? 13  LEU A CD1 1 
ATOM   92  C  CD2 . LEU A 1 13 ? 21.204 29.577 34.634 1.00 16.24 ? 13  LEU A CD2 1 
ATOM   93  N  N   . TYR A 1 14 ? 18.322 33.783 35.540 1.00 16.62 ? 14  TYR A N   1 
ATOM   94  C  CA  . TYR A 1 14 ? 16.870 33.937 35.558 1.00 15.35 ? 14  TYR A CA  1 
ATOM   95  C  C   . TYR A 1 14 ? 16.458 35.067 34.636 1.00 20.63 ? 14  TYR A C   1 
ATOM   96  O  O   . TYR A 1 14 ? 15.536 34.933 33.817 1.00 25.35 ? 14  TYR A O   1 
ATOM   97  C  CB  . TYR A 1 14 ? 16.372 34.081 37.019 1.00 25.01 ? 14  TYR A CB  1 
ATOM   98  C  CG  . TYR A 1 14 ? 14.870 34.312 37.062 1.00 31.63 ? 14  TYR A CG  1 
ATOM   99  C  CD1 . TYR A 1 14 ? 14.371 35.585 36.750 1.00 24.28 ? 14  TYR A CD1 1 
ATOM   100 C  CD2 . TYR A 1 14 ? 13.960 33.303 37.382 1.00 35.42 ? 14  TYR A CD2 1 
ATOM   101 C  CE1 . TYR A 1 14 ? 13.014 35.862 36.749 1.00 23.66 ? 14  TYR A CE1 1 
ATOM   102 C  CE2 . TYR A 1 14 ? 12.599 33.580 37.383 1.00 34.93 ? 14  TYR A CE2 1 
ATOM   103 C  CZ  . TYR A 1 14 ? 12.121 34.844 37.073 1.00 39.52 ? 14  TYR A CZ  1 
ATOM   104 O  OH  . TYR A 1 14 ? 10.777 35.174 37.078 1.00 68.21 ? 14  TYR A OH  1 
ATOM   105 N  N   . GLN A 1 15 ? 17.065 36.223 34.801 1.00 19.89 ? 15  GLN A N   1 
ATOM   106 C  CA  . GLN A 1 15 ? 16.730 37.391 33.994 1.00 20.93 ? 15  GLN A CA  1 
ATOM   107 C  C   . GLN A 1 15 ? 17.065 37.151 32.532 1.00 19.19 ? 15  GLN A C   1 
ATOM   108 O  O   . GLN A 1 15 ? 16.218 37.525 31.709 1.00 25.94 ? 15  GLN A O   1 
ATOM   109 C  CB  A GLN A 1 15 ? 17.543 38.619 34.420 0.50 23.60 ? 15  GLN A CB  1 
ATOM   110 C  CB  B GLN A 1 15 ? 17.555 38.614 34.440 0.50 23.00 ? 15  GLN A CB  1 
ATOM   111 C  CG  A GLN A 1 15 ? 16.739 39.886 34.618 0.50 33.72 ? 15  GLN A CG  1 
ATOM   112 C  CG  B GLN A 1 15 ? 17.209 38.979 35.881 0.50 31.07 ? 15  GLN A CG  1 
ATOM   113 C  CD  A GLN A 1 15 ? 16.388 39.952 36.106 0.50 39.35 ? 15  GLN A CD  1 
ATOM   114 C  CD  B GLN A 1 15 ? 15.809 39.573 35.895 0.50 41.33 ? 15  GLN A CD  1 
ATOM   115 O  OE1 A GLN A 1 15 ? 15.218 39.680 36.411 0.50 35.08 ? 15  GLN A OE1 1 
ATOM   116 O  OE1 B GLN A 1 15 ? 14.884 39.088 36.560 0.50 34.81 ? 15  GLN A OE1 1 
ATOM   117 N  NE2 A GLN A 1 15 ? 17.446 40.258 36.864 0.50 27.66 ? 15  GLN A NE2 1 
ATOM   118 N  NE2 B GLN A 1 15 ? 15.698 40.650 35.103 0.50 31.57 ? 15  GLN A NE2 1 
ATOM   119 N  N   . LEU A 1 16 ? 18.288 36.621 32.288 1.00 14.13 ? 16  LEU A N   1 
ATOM   120 C  CA  . LEU A 1 16 ? 18.624 36.401 30.881 1.00 14.29 ? 16  LEU A CA  1 
ATOM   121 C  C   . LEU A 1 16 ? 17.652 35.441 30.216 1.00 18.55 ? 16  LEU A C   1 
ATOM   122 O  O   . LEU A 1 16 ? 17.286 35.647 29.050 1.00 16.30 ? 16  LEU A O   1 
ATOM   123 C  CB  . LEU A 1 16 ? 20.042 35.820 30.697 1.00 21.68 ? 16  LEU A CB  1 
ATOM   124 C  CG  . LEU A 1 16 ? 21.271 36.691 30.744 1.00 25.01 ? 16  LEU A CG  1 
ATOM   125 C  CD1 . LEU A 1 16 ? 22.479 35.759 30.515 1.00 25.05 ? 16  LEU A CD1 1 
ATOM   126 C  CD2 . LEU A 1 16 ? 21.217 37.844 29.749 1.00 18.88 ? 16  LEU A CD2 1 
ATOM   127 N  N   . GLU A 1 17 ? 17.257 34.367 30.913 1.00 17.57 ? 17  GLU A N   1 
ATOM   128 C  CA  . GLU A 1 17 ? 16.353 33.393 30.338 1.00 13.26 ? 17  GLU A CA  1 
ATOM   129 C  C   . GLU A 1 17 ? 14.968 33.889 30.001 1.00 22.70 ? 17  GLU A C   1 
ATOM   130 O  O   . GLU A 1 17 ? 14.234 33.275 29.212 1.00 25.00 ? 17  GLU A O   1 
ATOM   131 C  CB  . GLU A 1 17 ? 16.183 32.146 31.209 1.00 17.01 ? 17  GLU A CB  1 
ATOM   132 C  CG  . GLU A 1 17 ? 17.252 31.160 30.695 1.00 14.38 ? 17  GLU A CG  1 
ATOM   133 C  CD  . GLU A 1 17 ? 16.968 29.843 31.385 1.00 24.91 ? 17  GLU A CD  1 
ATOM   134 O  OE1 . GLU A 1 17 ? 16.230 29.713 32.350 1.00 25.72 ? 17  GLU A OE1 1 
ATOM   135 O  OE2 . GLU A 1 17 ? 17.675 28.984 30.830 1.00 22.42 ? 17  GLU A OE2 1 
ATOM   136 N  N   . ASN A 1 18 ? 14.618 35.021 30.563 1.00 22.30 ? 18  ASN A N   1 
ATOM   137 C  CA  . ASN A 1 18 ? 13.371 35.753 30.369 1.00 29.65 ? 18  ASN A CA  1 
ATOM   138 C  C   . ASN A 1 18 ? 13.330 36.318 28.943 1.00 23.17 ? 18  ASN A C   1 
ATOM   139 O  O   . ASN A 1 18 ? 12.197 36.611 28.486 1.00 30.58 ? 18  ASN A O   1 
ATOM   140 C  CB  . ASN A 1 18 ? 13.153 36.870 31.413 1.00 36.00 ? 18  ASN A CB  1 
ATOM   141 C  CG  . ASN A 1 18 ? 12.471 36.382 32.685 1.00 40.48 ? 18  ASN A CG  1 
ATOM   142 O  OD1 . ASN A 1 18 ? 11.899 35.275 32.723 1.00 33.48 ? 18  ASN A OD1 1 
ATOM   143 N  ND2 . ASN A 1 18 ? 12.521 37.159 33.766 1.00 51.14 ? 18  ASN A ND2 1 
ATOM   144 N  N   . TYR A 1 19 ? 14.489 36.480 28.344 1.00 18.69 ? 19  TYR A N   1 
ATOM   145 C  CA  . TYR A 1 19 ? 14.612 37.028 26.974 1.00 19.02 ? 19  TYR A CA  1 
ATOM   146 C  C   . TYR A 1 19 ? 14.875 36.010 25.898 1.00 17.88 ? 19  TYR A C   1 
ATOM   147 O  O   . TYR A 1 19 ? 15.089 36.370 24.716 1.00 34.62 ? 19  TYR A O   1 
ATOM   148 C  CB  . TYR A 1 19 ? 15.582 38.242 26.956 1.00 11.17 ? 19  TYR A CB  1 
ATOM   149 C  CG  . TYR A 1 19 ? 15.202 39.302 27.972 1.00 22.53 ? 19  TYR A CG  1 
ATOM   150 C  CD1 . TYR A 1 19 ? 14.256 40.274 27.592 1.00 29.17 ? 19  TYR A CD1 1 
ATOM   151 C  CD2 . TYR A 1 19 ? 15.718 39.328 29.269 1.00 25.46 ? 19  TYR A CD2 1 
ATOM   152 C  CE1 . TYR A 1 19 ? 13.851 41.279 28.473 1.00 33.99 ? 19  TYR A CE1 1 
ATOM   153 C  CE2 . TYR A 1 19 ? 15.309 40.322 30.152 1.00 31.02 ? 19  TYR A CE2 1 
ATOM   154 C  CZ  . TYR A 1 19 ? 14.378 41.296 29.759 1.00 34.79 ? 19  TYR A CZ  1 
ATOM   155 O  OH  . TYR A 1 19 ? 13.945 42.300 30.596 1.00 47.62 ? 19  TYR A OH  1 
ATOM   156 N  N   . CYS A 1 20 ? 14.882 34.724 26.229 1.00 22.03 ? 20  CYS A N   1 
ATOM   157 C  CA  . CYS A 1 20 ? 15.071 33.633 25.251 1.00 13.67 ? 20  CYS A CA  1 
ATOM   158 C  C   . CYS A 1 20 ? 13.703 33.483 24.597 1.00 25.89 ? 20  CYS A C   1 
ATOM   159 O  O   . CYS A 1 20 ? 12.739 33.787 25.363 1.00 23.95 ? 20  CYS A O   1 
ATOM   160 C  CB  . CYS A 1 20 ? 15.466 32.310 25.854 1.00 17.26 ? 20  CYS A CB  1 
ATOM   161 S  SG  . CYS A 1 20 ? 17.051 32.374 26.639 1.00 18.75 ? 20  CYS A SG  1 
ATOM   162 N  N   . ASN A 1 21 ? 13.709 33.073 23.332 1.00 27.33 ? 21  ASN A N   1 
ATOM   163 C  CA  . ASN A 1 21 ? 12.374 32.921 22.688 1.00 49.49 ? 21  ASN A CA  1 
ATOM   164 C  C   . ASN A 1 21 ? 11.765 31.551 23.055 1.00 53.32 ? 21  ASN A C   1 
ATOM   165 O  O   . ASN A 1 21 ? 12.375 30.767 23.810 1.00 44.50 ? 21  ASN A O   1 
ATOM   166 C  CB  . ASN A 1 21 ? 12.289 33.173 21.186 1.00 35.48 ? 21  ASN A CB  1 
ATOM   167 C  CG  . ASN A 1 21 ? 12.437 34.625 20.776 1.00 44.81 ? 21  ASN A CG  1 
ATOM   168 O  OD1 . ASN A 1 21 ? 13.159 34.867 19.780 1.00 53.99 ? 21  ASN A OD1 1 
ATOM   169 N  ND2 . ASN A 1 21 ? 11.812 35.564 21.495 1.00 46.56 ? 21  ASN A ND2 1 
ATOM   170 O  OXT . ASN A 1 21 ? 10.648 31.342 22.535 1.00 80.48 ? 21  ASN A OXT 1 
ATOM   171 N  N   . PHE B 2 1  ? 28.961 32.694 34.302 1.00 38.09 ? 1   PHE B N   1 
ATOM   172 C  CA  . PHE B 2 1  ? 29.545 33.933 33.691 1.00 44.75 ? 1   PHE B CA  1 
ATOM   173 C  C   . PHE B 2 1  ? 28.483 35.030 33.562 1.00 18.46 ? 1   PHE B C   1 
ATOM   174 O  O   . PHE B 2 1  ? 28.656 36.170 33.083 1.00 29.15 ? 1   PHE B O   1 
ATOM   175 C  CB  . PHE B 2 1  ? 30.190 33.486 32.346 1.00 36.50 ? 1   PHE B CB  1 
ATOM   176 C  CG  . PHE B 2 1  ? 29.191 32.986 31.322 1.00 29.77 ? 1   PHE B CG  1 
ATOM   177 C  CD1 . PHE B 2 1  ? 28.691 31.688 31.351 1.00 22.29 ? 1   PHE B CD1 1 
ATOM   178 C  CD2 . PHE B 2 1  ? 28.736 33.844 30.327 1.00 30.11 ? 1   PHE B CD2 1 
ATOM   179 C  CE1 . PHE B 2 1  ? 27.758 31.234 30.415 1.00 30.11 ? 1   PHE B CE1 1 
ATOM   180 C  CE2 . PHE B 2 1  ? 27.822 33.423 29.377 1.00 29.49 ? 1   PHE B CE2 1 
ATOM   181 C  CZ  . PHE B 2 1  ? 27.329 32.125 29.428 1.00 27.29 ? 1   PHE B CZ  1 
ATOM   182 N  N   . VAL B 2 2  ? 27.235 34.671 33.935 1.00 25.09 ? 2   VAL B N   1 
ATOM   183 C  CA  . VAL B 2 2  ? 26.085 35.571 33.793 1.00 23.88 ? 2   VAL B CA  1 
ATOM   184 C  C   . VAL B 2 2  ? 25.902 36.506 34.969 1.00 24.42 ? 2   VAL B C   1 
ATOM   185 O  O   . VAL B 2 2  ? 25.269 37.560 34.801 1.00 19.63 ? 2   VAL B O   1 
ATOM   186 C  CB  . VAL B 2 2  ? 24.846 34.751 33.391 1.00 28.89 ? 2   VAL B CB  1 
ATOM   187 C  CG1 . VAL B 2 2  ? 25.094 33.931 32.115 1.00 27.49 ? 2   VAL B CG1 1 
ATOM   188 C  CG2 . VAL B 2 2  ? 24.362 33.851 34.497 1.00 31.38 ? 2   VAL B CG2 1 
ATOM   189 N  N   . ASN B 2 3  ? 26.523 36.166 36.098 1.00 23.96 ? 3   ASN B N   1 
ATOM   190 C  CA  . ASN B 2 3  ? 26.319 37.001 37.308 1.00 26.03 ? 3   ASN B CA  1 
ATOM   191 C  C   . ASN B 2 3  ? 27.296 38.147 37.504 1.00 23.25 ? 3   ASN B C   1 
ATOM   192 O  O   . ASN B 2 3  ? 28.095 38.255 38.450 1.00 31.89 ? 3   ASN B O   1 
ATOM   193 C  CB  . ASN B 2 3  ? 26.126 36.055 38.509 1.00 20.70 ? 3   ASN B CB  1 
ATOM   194 C  CG  . ASN B 2 3  ? 25.048 34.990 38.438 1.00 21.82 ? 3   ASN B CG  1 
ATOM   195 O  OD1 . ASN B 2 3  ? 25.464 33.818 38.212 1.00 34.83 ? 3   ASN B OD1 1 
ATOM   196 N  ND2 . ASN B 2 3  ? 23.735 35.160 38.603 1.00 21.66 ? 3   ASN B ND2 1 
ATOM   197 N  N   . GLN B 2 4  ? 27.150 39.080 36.576 1.00 19.70 ? 4   GLN B N   1 
ATOM   198 C  CA  . GLN B 2 4  ? 27.884 40.341 36.453 1.00 23.53 ? 4   GLN B CA  1 
ATOM   199 C  C   . GLN B 2 4  ? 27.092 41.384 35.655 1.00 17.64 ? 4   GLN B C   1 
ATOM   200 O  O   . GLN B 2 4  ? 25.952 41.165 35.167 1.00 21.32 ? 4   GLN B O   1 
ATOM   201 C  CB  A GLN B 2 4  ? 29.230 40.191 35.711 0.50 25.72 ? 4   GLN B CB  1 
ATOM   202 C  CB  B GLN B 2 4  ? 29.290 40.111 35.846 0.50 19.78 ? 4   GLN B CB  1 
ATOM   203 C  CG  A GLN B 2 4  ? 29.094 39.381 34.422 0.50 29.56 ? 4   GLN B CG  1 
ATOM   204 C  CG  B GLN B 2 4  ? 29.281 39.276 34.564 0.50 26.90 ? 4   GLN B CG  1 
ATOM   205 C  CD  A GLN B 2 4  ? 30.425 39.286 33.708 0.50 45.07 ? 4   GLN B CD  1 
ATOM   206 C  CD  B GLN B 2 4  ? 30.715 38.911 34.223 0.50 45.48 ? 4   GLN B CD  1 
ATOM   207 O  OE1 A GLN B 2 4  ? 31.085 40.292 33.432 0.50 29.76 ? 4   GLN B OE1 1 
ATOM   208 O  OE1 B GLN B 2 4  ? 31.608 39.122 35.038 0.50 48.68 ? 4   GLN B OE1 1 
ATOM   209 N  NE2 A GLN B 2 4  ? 30.823 38.045 33.409 0.50 48.65 ? 4   GLN B NE2 1 
ATOM   210 N  NE2 B GLN B 2 4  ? 30.934 38.382 33.020 0.50 51.98 ? 4   GLN B NE2 1 
ATOM   211 N  N   . HIS B 2 5  ? 27.794 42.523 35.577 1.00 17.74 ? 5   HIS B N   1 
ATOM   212 C  CA  . HIS B 2 5  ? 27.245 43.647 34.804 1.00 20.53 ? 5   HIS B CA  1 
ATOM   213 C  C   . HIS B 2 5  ? 27.629 43.308 33.357 1.00 27.58 ? 5   HIS B C   1 
ATOM   214 O  O   . HIS B 2 5  ? 28.829 43.196 33.087 1.00 32.38 ? 5   HIS B O   1 
ATOM   215 C  CB  . HIS B 2 5  ? 27.871 45.015 35.095 1.00 25.02 ? 5   HIS B CB  1 
ATOM   216 C  CG  . HIS B 2 5  ? 27.648 45.348 36.552 1.00 30.13 ? 5   HIS B CG  1 
ATOM   217 N  ND1 . HIS B 2 5  ? 26.575 46.106 36.975 1.00 32.60 ? 5   HIS B ND1 1 
ATOM   218 C  CD2 . HIS B 2 5  ? 28.379 44.998 37.644 1.00 26.30 ? 5   HIS B CD2 1 
ATOM   219 C  CE1 . HIS B 2 5  ? 26.635 46.222 38.293 1.00 23.86 ? 5   HIS B CE1 1 
ATOM   220 N  NE2 . HIS B 2 5  ? 27.700 45.560 38.701 1.00 34.89 ? 5   HIS B NE2 1 
ATOM   221 N  N   . LEU B 2 6  ? 26.631 43.149 32.533 1.00 24.85 ? 6   LEU B N   1 
ATOM   222 C  CA  . LEU B 2 6  ? 26.735 42.784 31.109 1.00 23.97 ? 6   LEU B CA  1 
ATOM   223 C  C   . LEU B 2 6  ? 26.114 43.926 30.322 1.00 18.31 ? 6   LEU B C   1 
ATOM   224 O  O   . LEU B 2 6  ? 24.915 44.128 30.431 1.00 21.19 ? 6   LEU B O   1 
ATOM   225 C  CB  . LEU B 2 6  ? 26.005 41.442 30.891 1.00 16.72 ? 6   LEU B CB  1 
ATOM   226 C  CG  . LEU B 2 6  ? 26.621 40.268 31.612 1.00 15.45 ? 6   LEU B CG  1 
ATOM   227 C  CD1 . LEU B 2 6  ? 25.816 39.046 31.244 1.00 19.17 ? 6   LEU B CD1 1 
ATOM   228 C  CD2 . LEU B 2 6  ? 28.043 40.002 31.126 1.00 19.27 ? 6   LEU B CD2 1 
ATOM   229 N  N   . CYS B 2 7  ? 26.920 44.674 29.556 1.00 17.86 ? 7   CYS B N   1 
ATOM   230 C  CA  . CYS B 2 7  ? 26.462 45.814 28.768 1.00 19.62 ? 7   CYS B CA  1 
ATOM   231 C  C   . CYS B 2 7  ? 26.858 45.662 27.288 1.00 22.38 ? 7   CYS B C   1 
ATOM   232 O  O   . CYS B 2 7  ? 27.898 45.036 27.074 1.00 22.92 ? 7   CYS B O   1 
ATOM   233 C  CB  . CYS B 2 7  ? 27.109 47.123 29.287 1.00 17.85 ? 7   CYS B CB  1 
ATOM   234 S  SG  . CYS B 2 7  ? 26.732 47.463 31.070 1.00 25.70 ? 7   CYS B SG  1 
ATOM   235 N  N   . GLY B 2 8  ? 26.025 46.230 26.437 1.00 24.29 ? 8   GLY B N   1 
ATOM   236 C  CA  . GLY B 2 8  ? 26.287 46.249 25.009 1.00 24.38 ? 8   GLY B CA  1 
ATOM   237 C  C   . GLY B 2 8  ? 26.513 44.910 24.356 1.00 25.51 ? 8   GLY B C   1 
ATOM   238 O  O   . GLY B 2 8  ? 25.719 43.989 24.621 1.00 20.58 ? 8   GLY B O   1 
ATOM   239 N  N   . SER B 2 9  ? 27.559 44.734 23.567 1.00 17.06 ? 9   SER B N   1 
ATOM   240 C  CA  . SER B 2 9  ? 27.780 43.457 22.821 1.00 20.76 ? 9   SER B CA  1 
ATOM   241 C  C   . SER B 2 9  ? 27.960 42.271 23.756 1.00 13.26 ? 9   SER B C   1 
ATOM   242 O  O   . SER B 2 9  ? 27.726 41.050 23.546 1.00 21.64 ? 9   SER B O   1 
ATOM   243 C  CB  . SER B 2 9  ? 28.926 43.722 21.836 1.00 9.93  ? 9   SER B CB  1 
ATOM   244 O  OG  . SER B 2 9  ? 30.124 43.870 22.628 1.00 21.17 ? 9   SER B OG  1 
ATOM   245 N  N   . HIS B 2 10 ? 28.457 42.657 24.911 1.00 16.62 ? 10  HIS B N   1 
ATOM   246 C  CA  . HIS B 2 10 ? 28.734 41.832 26.083 1.00 25.79 ? 10  HIS B CA  1 
ATOM   247 C  C   . HIS B 2 10 ? 27.460 41.128 26.575 1.00 20.90 ? 10  HIS B C   1 
ATOM   248 O  O   . HIS B 2 10 ? 27.418 39.921 26.909 1.00 17.92 ? 10  HIS B O   1 
ATOM   249 C  CB  A HIS B 2 10 ? 29.335 42.777 27.162 0.55 27.94 ? 10  HIS B CB  1 
ATOM   250 C  CB  B HIS B 2 10 ? 29.433 42.195 27.451 0.45 13.37 ? 10  HIS B CB  1 
ATOM   251 C  CG  A HIS B 2 10 ? 30.525 43.567 26.692 0.55 32.44 ? 10  HIS B CG  1 
ATOM   252 C  CG  B HIS B 2 10 ? 30.246 41.172 28.185 0.45 17.51 ? 10  HIS B CG  1 
ATOM   253 N  ND1 A HIS B 2 10 ? 31.593 43.770 27.539 0.55 17.49 ? 10  HIS B ND1 1 
ATOM   254 N  ND1 B HIS B 2 10 ? 30.703 41.322 29.476 0.45 32.32 ? 10  HIS B ND1 1 
ATOM   255 C  CD2 A HIS B 2 10 ? 30.835 44.205 25.517 0.55 19.87 ? 10  HIS B CD2 1 
ATOM   256 C  CD2 B HIS B 2 10 ? 30.675 39.942 27.769 0.45 19.36 ? 10  HIS B CD2 1 
ATOM   257 C  CE1 A HIS B 2 10 ? 32.517 44.483 26.899 0.55 21.40 ? 10  HIS B CE1 1 
ATOM   258 C  CE1 B HIS B 2 10 ? 31.378 40.228 29.817 0.45 26.29 ? 10  HIS B CE1 1 
ATOM   259 N  NE2 A HIS B 2 10 ? 32.069 44.777 25.695 0.55 23.22 ? 10  HIS B NE2 1 
ATOM   260 N  NE2 B HIS B 2 10 ? 31.377 39.382 28.809 0.45 27.71 ? 10  HIS B NE2 1 
ATOM   261 N  N   . LEU B 2 11 ? 26.380 41.850 26.686 1.00 16.42 ? 11  LEU B N   1 
ATOM   262 C  CA  . LEU B 2 11 ? 25.074 41.416 27.079 1.00 15.37 ? 11  LEU B CA  1 
ATOM   263 C  C   . LEU B 2 11 ? 24.463 40.535 25.985 1.00 22.39 ? 11  LEU B C   1 
ATOM   264 O  O   . LEU B 2 11 ? 23.865 39.466 26.274 1.00 18.48 ? 11  LEU B O   1 
ATOM   265 C  CB  . LEU B 2 11 ? 24.123 42.578 27.404 1.00 15.75 ? 11  LEU B CB  1 
ATOM   266 C  CG  . LEU B 2 11 ? 22.712 42.161 27.865 1.00 19.09 ? 11  LEU B CG  1 
ATOM   267 C  CD1 . LEU B 2 11 ? 22.828 41.159 29.003 1.00 13.73 ? 11  LEU B CD1 1 
ATOM   268 C  CD2 . LEU B 2 11 ? 22.006 43.433 28.285 1.00 22.91 ? 11  LEU B CD2 1 
ATOM   269 N  N   . VAL B 2 12 ? 24.627 40.983 24.752 1.00 22.66 ? 12  VAL B N   1 
ATOM   270 C  CA  . VAL B 2 12 ? 24.089 40.267 23.569 1.00 16.84 ? 12  VAL B CA  1 
ATOM   271 C  C   . VAL B 2 12 ? 24.764 38.918 23.429 1.00 18.98 ? 12  VAL B C   1 
ATOM   272 O  O   . VAL B 2 12 ? 24.123 37.948 23.079 1.00 15.29 ? 12  VAL B O   1 
ATOM   273 C  CB  . VAL B 2 12 ? 24.186 41.080 22.252 1.00 21.43 ? 12  VAL B CB  1 
ATOM   274 C  CG1 . VAL B 2 12 ? 23.924 40.228 21.031 1.00 16.49 ? 12  VAL B CG1 1 
ATOM   275 C  CG2 . VAL B 2 12 ? 23.250 42.289 22.279 1.00 15.00 ? 12  VAL B CG2 1 
ATOM   276 N  N   . GLU B 2 13 ? 26.059 38.848 23.646 1.00 16.90 ? 13  GLU B N   1 
ATOM   277 C  CA  . GLU B 2 13 ? 26.842 37.606 23.590 1.00 20.70 ? 13  GLU B CA  1 
ATOM   278 C  C   . GLU B 2 13 ? 26.359 36.650 24.674 1.00 15.13 ? 13  GLU B C   1 
ATOM   279 O  O   . GLU B 2 13 ? 26.298 35.442 24.385 1.00 20.98 ? 13  GLU B O   1 
ATOM   280 C  CB  . GLU B 2 13 ? 28.279 38.024 23.829 1.00 15.61 ? 13  GLU B CB  1 
ATOM   281 C  CG  . GLU B 2 13 ? 29.322 36.949 23.949 1.00 35.67 ? 13  GLU B CG  1 
ATOM   282 C  CD  . GLU B 2 13 ? 30.683 37.640 23.806 1.00 42.31 ? 13  GLU B CD  1 
ATOM   283 O  OE1 . GLU B 2 13 ? 31.063 38.092 22.736 1.00 38.69 ? 13  GLU B OE1 1 
ATOM   284 O  OE2 . GLU B 2 13 ? 31.150 37.644 24.962 1.00 45.93 ? 13  GLU B OE2 1 
ATOM   285 N  N   . ALA B 2 14 ? 26.033 37.139 25.878 1.00 13.46 ? 14  ALA B N   1 
ATOM   286 C  CA  . ALA B 2 14 ? 25.493 36.342 26.975 1.00 15.84 ? 14  ALA B CA  1 
ATOM   287 C  C   . ALA B 2 14 ? 24.127 35.815 26.540 1.00 15.81 ? 14  ALA B C   1 
ATOM   288 O  O   . ALA B 2 14 ? 23.949 34.566 26.746 1.00 13.74 ? 14  ALA B O   1 
ATOM   289 C  CB  . ALA B 2 14 ? 25.481 37.089 28.314 1.00 13.53 ? 14  ALA B CB  1 
ATOM   290 N  N   . LEU B 2 15 ? 23.228 36.592 25.926 1.00 15.58 ? 15  LEU B N   1 
ATOM   291 C  CA  . LEU B 2 15 ? 21.919 36.071 25.461 1.00 10.19 ? 15  LEU B CA  1 
ATOM   292 C  C   . LEU B 2 15 ? 22.047 34.973 24.433 1.00 13.55 ? 15  LEU B C   1 
ATOM   293 O  O   . LEU B 2 15 ? 21.409 33.900 24.370 1.00 16.74 ? 15  LEU B O   1 
ATOM   294 C  CB  . LEU B 2 15 ? 21.155 37.262 24.912 1.00 17.54 ? 15  LEU B CB  1 
ATOM   295 C  CG  . LEU B 2 15 ? 20.459 38.063 26.004 1.00 21.93 ? 15  LEU B CG  1 
ATOM   296 C  CD1 . LEU B 2 15 ? 20.024 39.374 25.342 1.00 22.50 ? 15  LEU B CD1 1 
ATOM   297 C  CD2 . LEU B 2 15 ? 19.220 37.352 26.497 1.00 19.03 ? 15  LEU B CD2 1 
ATOM   298 N  N   . TYR B 2 16 ? 22.989 35.262 23.523 1.00 16.09 ? 16  TYR B N   1 
ATOM   299 C  CA  . TYR B 2 16 ? 23.333 34.339 22.435 1.00 13.16 ? 16  TYR B CA  1 
ATOM   300 C  C   . TYR B 2 16 ? 23.766 32.983 22.946 1.00 12.93 ? 16  TYR B C   1 
ATOM   301 O  O   . TYR B 2 16 ? 23.294 31.923 22.469 1.00 16.48 ? 16  TYR B O   1 
ATOM   302 C  CB  . TYR B 2 16 ? 24.429 35.044 21.617 1.00 11.68 ? 16  TYR B CB  1 
ATOM   303 C  CG  . TYR B 2 16 ? 24.933 34.090 20.552 1.00 14.65 ? 16  TYR B CG  1 
ATOM   304 C  CD1 . TYR B 2 16 ? 24.123 33.790 19.469 1.00 20.50 ? 16  TYR B CD1 1 
ATOM   305 C  CD2 . TYR B 2 16 ? 26.205 33.529 20.621 1.00 15.14 ? 16  TYR B CD2 1 
ATOM   306 C  CE1 . TYR B 2 16 ? 24.601 32.932 18.460 1.00 17.59 ? 16  TYR B CE1 1 
ATOM   307 C  CE2 . TYR B 2 16 ? 26.730 32.669 19.650 1.00 12.82 ? 16  TYR B CE2 1 
ATOM   308 C  CZ  . TYR B 2 16 ? 25.887 32.420 18.568 1.00 22.15 ? 16  TYR B CZ  1 
ATOM   309 O  OH  . TYR B 2 16 ? 26.360 31.579 17.601 1.00 17.89 ? 16  TYR B OH  1 
ATOM   310 N  N   . LEU B 2 17 ? 24.675 32.973 23.893 1.00 17.43 ? 17  LEU B N   1 
ATOM   311 C  CA  . LEU B 2 17 ? 25.242 31.773 24.507 1.00 15.03 ? 17  LEU B CA  1 
ATOM   312 C  C   . LEU B 2 17 ? 24.259 31.012 25.366 1.00 20.12 ? 17  LEU B C   1 
ATOM   313 O  O   . LEU B 2 17 ? 24.151 29.775 25.246 1.00 15.32 ? 17  LEU B O   1 
ATOM   314 C  CB  . LEU B 2 17 ? 26.521 32.145 25.269 1.00 19.15 ? 17  LEU B CB  1 
ATOM   315 C  CG  . LEU B 2 17 ? 27.759 32.528 24.462 1.00 28.76 ? 17  LEU B CG  1 
ATOM   316 C  CD1 . LEU B 2 17 ? 28.871 33.013 25.404 1.00 30.86 ? 17  LEU B CD1 1 
ATOM   317 C  CD2 . LEU B 2 17 ? 28.147 31.338 23.587 1.00 18.48 ? 17  LEU B CD2 1 
ATOM   318 N  N   . VAL B 2 18 ? 23.490 31.650 26.195 1.00 15.94 ? 18  VAL B N   1 
ATOM   319 C  CA  . VAL B 2 18 ? 22.523 31.051 27.093 1.00 19.10 ? 18  VAL B CA  1 
ATOM   320 C  C   . VAL B 2 18 ? 21.275 30.611 26.350 1.00 18.03 ? 18  VAL B C   1 
ATOM   321 O  O   . VAL B 2 18 ? 20.721 29.579 26.708 1.00 19.66 ? 18  VAL B O   1 
ATOM   322 C  CB  . VAL B 2 18 ? 22.197 32.054 28.238 1.00 18.92 ? 18  VAL B CB  1 
ATOM   323 C  CG1 . VAL B 2 18 ? 20.864 31.770 28.926 1.00 16.58 ? 18  VAL B CG1 1 
ATOM   324 C  CG2 . VAL B 2 18 ? 23.354 32.196 29.202 1.00 19.69 ? 18  VAL B CG2 1 
ATOM   325 N  N   . CYS B 2 19 ? 20.862 31.405 25.370 1.00 14.58 ? 19  CYS B N   1 
ATOM   326 C  CA  . CYS B 2 19 ? 19.590 31.054 24.687 1.00 20.78 ? 19  CYS B CA  1 
ATOM   327 C  C   . CYS B 2 19 ? 19.740 29.962 23.651 1.00 22.90 ? 19  CYS B C   1 
ATOM   328 O  O   . CYS B 2 19 ? 18.750 29.224 23.431 1.00 25.13 ? 19  CYS B O   1 
ATOM   329 C  CB  . CYS B 2 19 ? 18.870 32.312 24.167 1.00 14.23 ? 19  CYS B CB  1 
ATOM   330 S  SG  . CYS B 2 19 ? 18.325 33.435 25.477 1.00 18.44 ? 19  CYS B SG  1 
ATOM   331 N  N   . GLY B 2 20 ? 20.916 29.873 23.059 1.00 20.42 ? 20  GLY B N   1 
ATOM   332 C  CA  . GLY B 2 20 ? 21.184 28.845 22.045 1.00 28.47 ? 20  GLY B CA  1 
ATOM   333 C  C   . GLY B 2 20 ? 20.204 28.975 20.883 1.00 27.38 ? 20  GLY B C   1 
ATOM   334 O  O   . GLY B 2 20 ? 19.860 30.077 20.446 1.00 25.32 ? 20  GLY B O   1 
ATOM   335 N  N   . GLU B 2 21 ? 19.683 27.825 20.492 1.00 23.51 ? 21  GLU B N   1 
ATOM   336 C  CA  . GLU B 2 21 ? 18.767 27.688 19.356 1.00 22.79 ? 21  GLU B CA  1 
ATOM   337 C  C   . GLU B 2 21 ? 17.364 28.226 19.490 1.00 23.55 ? 21  GLU B C   1 
ATOM   338 O  O   . GLU B 2 21 ? 16.572 28.430 18.542 1.00 43.32 ? 21  GLU B O   1 
ATOM   339 C  CB  A GLU B 2 21 ? 18.859 26.215 18.941 0.50 32.24 ? 21  GLU B CB  1 
ATOM   340 C  CB  B GLU B 2 21 ? 18.816 26.311 18.721 0.50 44.15 ? 21  GLU B CB  1 
ATOM   341 C  CG  A GLU B 2 21 ? 18.378 25.260 20.035 0.50 53.18 ? 21  GLU B CG  1 
ATOM   342 C  CG  B GLU B 2 21 ? 17.857 25.168 19.045 0.50 71.75 ? 21  GLU B CG  1 
ATOM   343 C  CD  A GLU B 2 21 ? 18.252 23.818 19.621 0.50 76.93 ? 21  GLU B CD  1 
ATOM   344 C  CD  B GLU B 2 21 ? 18.136 23.817 18.446 0.50 77.06 ? 21  GLU B CD  1 
ATOM   345 O  OE1 A GLU B 2 21 ? 19.209 23.104 19.342 0.50 80.08 ? 21  GLU B OE1 1 
ATOM   346 O  OE1 B GLU B 2 21 ? 17.630 23.667 17.305 0.50 71.56 ? 21  GLU B OE1 1 
ATOM   347 O  OE2 A GLU B 2 21 ? 17.052 23.450 19.601 0.50 75.98 ? 21  GLU B OE2 1 
ATOM   348 O  OE2 B GLU B 2 21 ? 18.777 22.935 19.017 0.50 80.80 ? 21  GLU B OE2 1 
ATOM   349 N  N   . ARG B 2 22 ? 17.077 28.594 20.739 1.00 22.10 ? 22  ARG B N   1 
ATOM   350 C  CA  . ARG B 2 22 ? 15.791 29.231 20.994 1.00 18.98 ? 22  ARG B CA  1 
ATOM   351 C  C   . ARG B 2 22 ? 15.879 30.641 20.378 1.00 18.56 ? 22  ARG B C   1 
ATOM   352 O  O   . ARG B 2 22 ? 14.904 31.088 19.746 1.00 42.38 ? 22  ARG B O   1 
ATOM   353 C  CB  A ARG B 2 22 ? 15.492 29.399 22.492 0.50 9.24  ? 22  ARG B CB  1 
ATOM   354 C  CB  B ARG B 2 22 ? 15.582 29.686 22.588 0.50 20.08 ? 22  ARG B CB  1 
ATOM   355 C  CG  A ARG B 2 22 ? 14.972 28.127 23.158 0.50 17.98 ? 22  ARG B CG  1 
ATOM   356 C  CG  B ARG B 2 22 ? 15.281 28.313 23.184 0.50 37.23 ? 22  ARG B CG  1 
ATOM   357 C  CD  A ARG B 2 22 ? 15.075 28.268 24.641 0.50 34.73 ? 22  ARG B CD  1 
ATOM   358 C  CD  B ARG B 2 22 ? 16.299 27.936 24.208 0.50 39.44 ? 22  ARG B CD  1 
ATOM   359 N  NE  A ARG B 2 22 ? 14.014 29.044 25.246 0.50 25.13 ? 22  ARG B NE  1 
ATOM   360 N  NE  B ARG B 2 22 ? 15.871 28.298 25.586 0.50 18.60 ? 22  ARG B NE  1 
ATOM   361 C  CZ  A ARG B 2 22 ? 13.996 29.348 26.552 0.50 32.64 ? 22  ARG B CZ  1 
ATOM   362 C  CZ  B ARG B 2 22 ? 16.859 28.110 26.487 0.50 27.52 ? 22  ARG B CZ  1 
ATOM   363 N  NH1 A ARG B 2 22 ? 14.997 28.924 27.329 0.50 22.11 ? 22  ARG B NH1 1 
ATOM   364 N  NH1 B ARG B 2 22 ? 17.844 27.323 26.036 0.50 35.85 ? 22  ARG B NH1 1 
ATOM   365 N  NH2 A ARG B 2 22 ? 12.979 30.074 27.020 0.50 23.08 ? 22  ARG B NH2 1 
ATOM   366 N  NH2 B ARG B 2 22 ? 16.875 28.645 27.689 0.50 15.95 ? 22  ARG B NH2 1 
ATOM   367 N  N   . GLY B 2 23 ? 17.009 31.302 20.575 1.00 21.37 ? 23  GLY B N   1 
ATOM   368 C  CA  . GLY B 2 23 ? 17.081 32.725 20.040 1.00 24.76 ? 23  GLY B CA  1 
ATOM   369 C  C   . GLY B 2 23 ? 16.625 33.576 21.237 1.00 20.74 ? 23  GLY B C   1 
ATOM   370 O  O   . GLY B 2 23 ? 16.251 33.080 22.331 1.00 23.79 ? 23  GLY B O   1 
ATOM   371 N  N   . PHE B 2 24 ? 16.609 34.871 21.058 1.00 16.16 ? 24  PHE B N   1 
ATOM   372 C  CA  . PHE B 2 24 ? 16.259 35.828 22.135 1.00 20.18 ? 24  PHE B CA  1 
ATOM   373 C  C   . PHE B 2 24 ? 15.747 37.093 21.444 1.00 22.61 ? 24  PHE B C   1 
ATOM   374 O  O   . PHE B 2 24 ? 15.751 37.262 20.216 1.00 19.52 ? 24  PHE B O   1 
ATOM   375 C  CB  . PHE B 2 24 ? 17.536 36.122 22.994 1.00 16.16 ? 24  PHE B CB  1 
ATOM   376 C  CG  . PHE B 2 24 ? 18.734 36.613 22.192 1.00 23.39 ? 24  PHE B CG  1 
ATOM   377 C  CD1 . PHE B 2 24 ? 19.597 35.730 21.525 1.00 17.05 ? 24  PHE B CD1 1 
ATOM   378 C  CD2 . PHE B 2 24 ? 18.978 37.990 22.047 1.00 15.66 ? 24  PHE B CD2 1 
ATOM   379 C  CE1 . PHE B 2 24 ? 20.679 36.170 20.758 1.00 17.28 ? 24  PHE B CE1 1 
ATOM   380 C  CE2 . PHE B 2 24 ? 20.030 38.490 21.281 1.00 17.82 ? 24  PHE B CE2 1 
ATOM   381 C  CZ  . PHE B 2 24 ? 20.877 37.562 20.642 1.00 18.98 ? 24  PHE B CZ  1 
ATOM   382 N  N   . PHE B 2 25 ? 15.333 38.026 22.260 1.00 15.44 ? 25  PHE B N   1 
ATOM   383 C  CA  . PHE B 2 25 ? 14.902 39.348 21.755 1.00 18.96 ? 25  PHE B CA  1 
ATOM   384 C  C   . PHE B 2 25 ? 15.733 40.274 22.636 1.00 20.74 ? 25  PHE B C   1 
ATOM   385 O  O   . PHE B 2 25 ? 15.943 40.031 23.845 1.00 23.56 ? 25  PHE B O   1 
ATOM   386 C  CB  . PHE B 2 25 ? 13.410 39.424 21.662 1.00 28.65 ? 25  PHE B CB  1 
ATOM   387 C  CG  . PHE B 2 25 ? 12.700 39.257 22.947 1.00 44.71 ? 25  PHE B CG  1 
ATOM   388 C  CD1 . PHE B 2 25 ? 12.560 40.338 23.828 1.00 56.33 ? 25  PHE B CD1 1 
ATOM   389 C  CD2 . PHE B 2 25 ? 12.177 37.996 23.288 1.00 60.90 ? 25  PHE B CD2 1 
ATOM   390 C  CE1 . PHE B 2 25 ? 11.875 40.179 25.064 1.00 44.39 ? 25  PHE B CE1 1 
ATOM   391 C  CE2 . PHE B 2 25 ? 11.506 37.808 24.495 1.00 57.24 ? 25  PHE B CE2 1 
ATOM   392 C  CZ  . PHE B 2 25 ? 11.363 38.902 25.373 1.00 58.50 ? 25  PHE B CZ  1 
ATOM   393 N  N   . TYR B 2 26 ? 16.306 41.294 22.026 1.00 26.92 ? 26  TYR B N   1 
ATOM   394 C  CA  . TYR B 2 26 ? 17.153 42.278 22.725 1.00 19.55 ? 26  TYR B CA  1 
ATOM   395 C  C   . TYR B 2 26 ? 16.499 43.636 22.535 1.00 30.21 ? 26  TYR B C   1 
ATOM   396 O  O   . TYR B 2 26 ? 16.600 44.187 21.417 1.00 24.71 ? 26  TYR B O   1 
ATOM   397 C  CB  . TYR B 2 26 ? 18.562 42.278 22.106 1.00 11.61 ? 26  TYR B CB  1 
ATOM   398 C  CG  . TYR B 2 26 ? 19.452 43.398 22.631 1.00 21.36 ? 26  TYR B CG  1 
ATOM   399 C  CD1 . TYR B 2 26 ? 19.755 43.387 24.008 1.00 20.58 ? 26  TYR B CD1 1 
ATOM   400 C  CD2 . TYR B 2 26 ? 19.916 44.465 21.863 1.00 15.42 ? 26  TYR B CD2 1 
ATOM   401 C  CE1 . TYR B 2 26 ? 20.583 44.345 24.584 1.00 22.78 ? 26  TYR B CE1 1 
ATOM   402 C  CE2 . TYR B 2 26 ? 20.723 45.448 22.460 1.00 18.05 ? 26  TYR B CE2 1 
ATOM   403 C  CZ  . TYR B 2 26 ? 21.073 45.393 23.806 1.00 28.02 ? 26  TYR B CZ  1 
ATOM   404 O  OH  . TYR B 2 26 ? 21.890 46.316 24.421 1.00 31.47 ? 26  TYR B OH  1 
ATOM   405 N  N   . THR B 2 27 ? 15.848 44.126 23.579 1.00 27.14 ? 27  THR B N   1 
ATOM   406 C  CA  . THR B 2 27 ? 15.158 45.457 23.477 1.00 42.36 ? 27  THR B CA  1 
ATOM   407 C  C   . THR B 2 27 ? 15.780 46.346 24.533 1.00 34.16 ? 27  THR B C   1 
ATOM   408 O  O   . THR B 2 27 ? 15.374 46.325 25.714 1.00 38.15 ? 27  THR B O   1 
ATOM   409 C  CB  . THR B 2 27 ? 13.612 45.233 23.635 1.00 49.00 ? 27  THR B CB  1 
ATOM   410 O  OG1 . THR B 2 27 ? 13.389 44.741 24.999 1.00 70.15 ? 27  THR B OG1 1 
ATOM   411 C  CG2 . THR B 2 27 ? 13.021 44.176 22.692 1.00 54.18 ? 27  THR B CG2 1 
ATOM   412 N  N   . PRO B 2 28 ? 16.809 47.082 24.129 1.00 39.30 ? 28  PRO B N   1 
ATOM   413 C  CA  . PRO B 2 28 ? 17.550 47.958 25.065 1.00 50.32 ? 28  PRO B CA  1 
ATOM   414 C  C   . PRO B 2 28 ? 16.747 49.100 25.692 1.00 51.41 ? 28  PRO B C   1 
ATOM   415 O  O   . PRO B 2 28 ? 16.922 49.526 26.848 1.00 52.87 ? 28  PRO B O   1 
ATOM   416 C  CB  . PRO B 2 28 ? 18.744 48.435 24.231 1.00 33.07 ? 28  PRO B CB  1 
ATOM   417 C  CG  . PRO B 2 28 ? 18.261 48.353 22.779 1.00 28.91 ? 28  PRO B CG  1 
ATOM   418 C  CD  . PRO B 2 28 ? 17.355 47.133 22.751 1.00 30.72 ? 28  PRO B CD  1 
ATOM   419 N  N   . LYS B 2 29 ? 15.830 49.593 24.905 1.00 58.03 ? 29  LYS B N   1 
ATOM   420 C  CA  A LYS B 2 29 ? 14.935 50.708 25.214 0.50 56.38 ? 29  LYS B CA  1 
ATOM   421 C  CA  B LYS B 2 29 ? 15.106 50.841 24.970 0.50 57.81 ? 29  LYS B CA  1 
ATOM   422 C  C   A LYS B 2 29 ? 13.602 50.396 25.876 0.50 73.09 ? 29  LYS B C   1 
ATOM   423 C  C   B LYS B 2 29 ? 13.915 50.201 25.692 0.50 66.40 ? 29  LYS B C   1 
ATOM   424 O  O   A LYS B 2 29 ? 13.044 51.332 26.517 0.50 80.92 ? 29  LYS B O   1 
ATOM   425 O  O   B LYS B 2 29 ? 12.908 49.842 25.053 0.50 53.34 ? 29  LYS B O   1 
ATOM   426 C  CB  A LYS B 2 29 ? 14.689 51.541 23.932 0.50 58.98 ? 29  LYS B CB  1 
ATOM   427 C  CB  B LYS B 2 29 ? 14.658 51.386 23.598 0.50 45.66 ? 29  LYS B CB  1 
ATOM   428 N  N   A ALA B 2 30 ? 13.056 49.194 25.782 0.50 74.55 ? 30  ALA B N   1 
ATOM   429 N  N   B ALA B 2 30 ? 14.075 50.102 27.005 0.50 71.75 ? 30  ALA B N   1 
ATOM   430 C  CA  A ALA B 2 30 ? 11.762 48.878 26.416 0.50 75.29 ? 30  ALA B CA  1 
ATOM   431 C  CA  B ALA B 2 30 ? 13.075 49.536 27.915 0.50 73.80 ? 30  ALA B CA  1 
ATOM   432 C  C   A ALA B 2 30 ? 11.853 47.818 27.515 0.50 68.10 ? 30  ALA B C   1 
ATOM   433 C  C   B ALA B 2 30 ? 12.867 50.426 29.144 0.50 73.94 ? 30  ALA B C   1 
ATOM   434 O  O   A ALA B 2 30 ? 10.774 47.235 27.799 0.50 65.90 ? 30  ALA B O   1 
ATOM   435 O  O   B ALA B 2 30 ? 12.394 49.828 30.144 0.50 69.68 ? 30  ALA B O   1 
ATOM   436 C  CB  A ALA B 2 30 ? 10.728 48.457 25.375 0.50 76.93 ? 30  ALA B CB  1 
ATOM   437 C  CB  B ALA B 2 30 ? 13.512 48.144 28.366 0.50 73.70 ? 30  ALA B CB  1 
ATOM   438 O  OXT A ALA B 2 30 ? 12.952 47.610 28.048 0.50 63.45 ? 30  ALA B OXT 1 
ATOM   439 O  OXT B ALA B 2 30 ? 13.182 51.623 29.061 0.50 76.41 ? 30  ALA B OXT 1 
HETATM 440 NA NA  . NA  C 3 .  ? 20.339 43.145 38.263 0.50 13.22 ? 88  NA  A NA  1 
HETATM 441 CL CL1 . DCE D 4 .  ? 26.950 41.213 19.536 0.50 34.85 ? 200 DCE B CL1 1 
HETATM 442 C  C1  . DCE D 4 .  ? 28.222 40.003 20.178 0.50 24.42 ? 200 DCE B C1  1 
HETATM 443 C  C2  . DCE D 4 .  ? 28.307 38.776 19.363 0.50 24.99 ? 200 DCE B C2  1 
HETATM 444 CL CL2 . DCE D 4 .  ? 26.941 37.681 19.833 0.50 33.75 ? 200 DCE B CL2 1 
HETATM 445 O  O   . HOH E 5 .  ? 19.213 33.037 38.295 1.00 42.10 ? 89  HOH A O   1 
HETATM 446 O  O   . HOH E 5 .  ? 19.309 51.671 37.680 1.00 71.85 ? 90  HOH A O   1 
HETATM 447 O  O   . HOH E 5 .  ? 19.460 51.625 32.662 1.00 56.77 ? 91  HOH A O   1 
HETATM 448 O  O   . HOH E 5 .  ? 13.529 46.905 34.521 1.00 56.86 ? 92  HOH A O   1 
HETATM 449 O  O   . HOH E 5 .  ? 27.754 49.256 34.634 1.00 59.80 ? 93  HOH A O   1 
HETATM 450 O  O   . HOH E 5 .  ? 25.911 50.450 38.269 1.00 73.37 ? 94  HOH A O   1 
HETATM 451 O  O   . HOH E 5 .  ? 22.874 37.394 40.001 1.00 32.18 ? 95  HOH A O   1 
HETATM 452 O  O   . HOH E 5 .  ? 14.461 44.482 27.832 1.00 33.04 ? 96  HOH A O   1 
HETATM 453 O  O   . HOH E 5 .  ? 16.330 47.795 28.775 1.00 26.21 ? 97  HOH A O   1 
HETATM 454 O  O   . HOH E 5 .  ? 19.660 39.683 39.396 0.50 34.39 ? 98  HOH A O   1 
HETATM 455 O  O   . HOH E 5 .  ? 19.070 48.888 38.055 1.00 45.21 ? 99  HOH A O   1 
HETATM 456 O  O   . HOH E 5 .  ? 20.424 43.275 40.602 0.50 17.83 ? 100 HOH A O   1 
HETATM 457 O  O   . HOH E 5 .  ? 16.006 48.573 38.268 1.00 49.72 ? 101 HOH A O   1 
HETATM 458 O  O   . HOH E 5 .  ? 18.140 42.467 38.272 0.50 14.58 ? 102 HOH A O   1 
HETATM 459 O  O   . HOH E 5 .  ? 15.276 42.423 33.112 1.00 45.79 ? 103 HOH A O   1 
HETATM 460 O  O   . HOH E 5 .  ? 13.721 39.677 33.357 1.00 67.60 ? 104 HOH A O   1 
HETATM 461 O  O   . HOH E 5 .  ? 13.370 41.327 35.143 1.00 66.32 ? 105 HOH A O   1 
HETATM 462 O  O   . HOH E 5 .  ? 23.340 51.881 29.149 1.00 78.00 ? 106 HOH A O   1 
HETATM 463 O  O   . HOH E 5 .  ? 8.026  34.511 20.502 1.00 80.27 ? 107 HOH A O   1 
HETATM 464 O  O   . HOH E 5 .  ? 19.217 52.503 35.050 1.00 68.12 ? 108 HOH A O   1 
HETATM 465 O  O   . HOH E 5 .  ? 21.768 55.234 32.076 1.00 85.97 ? 109 HOH A O   1 
HETATM 466 O  O   . HOH E 5 .  ? 22.667 52.737 33.359 1.00 81.22 ? 110 HOH A O   1 
HETATM 467 O  O   . HOH F 5 .  ? 26.102 28.408 28.110 0.33 28.57 ? 201 HOH B O   1 
HETATM 468 O  O   . HOH F 5 .  ? 26.719 28.525 28.242 0.66 30.29 ? 202 HOH B O   1 
HETATM 469 O  O   . HOH F 5 .  ? 21.104 32.216 20.645 1.00 26.61 ? 203 HOH B O   1 
HETATM 470 O  O   . HOH F 5 .  ? 21.954 33.637 38.117 1.00 22.77 ? 204 HOH B O   1 
HETATM 471 O  O   . HOH F 5 .  ? 25.355 29.575 16.012 1.00 37.71 ? 205 HOH B O   1 
HETATM 472 O  O   . HOH F 5 .  ? 29.416 48.036 26.266 1.00 52.28 ? 206 HOH B O   1 
HETATM 473 O  O   . HOH F 5 .  ? 23.316 47.073 26.907 1.00 35.56 ? 207 HOH B O   1 
HETATM 474 O  O   . HOH F 5 .  ? 12.001 26.642 23.852 1.00 84.10 ? 208 HOH B O   1 
HETATM 475 O  O   . HOH F 5 .  ? 29.629 38.631 27.887 0.50 36.47 ? 209 HOH B O   1 
HETATM 476 O  O   . HOH F 5 .  ? 24.783 28.010 23.225 1.00 48.85 ? 210 HOH B O   1 
HETATM 477 O  O   . HOH F 5 .  ? 10.060 28.856 28.439 1.00 57.62 ? 211 HOH B O   1 
HETATM 478 O  O   . HOH F 5 .  ? 24.661 29.722 20.716 1.00 34.18 ? 212 HOH B O   1 
HETATM 479 O  O   . HOH F 5 .  ? 29.883 44.140 30.180 1.00 31.20 ? 213 HOH B O   1 
HETATM 480 O  O   . HOH F 5 .  ? 28.651 33.964 37.187 1.00 40.95 ? 214 HOH B O   1 
HETATM 481 O  O   . HOH F 5 .  ? 15.852 42.384 25.719 1.00 31.84 ? 215 HOH B O   1 
HETATM 482 O  O   . HOH F 5 .  ? 30.929 40.726 21.439 1.00 51.07 ? 216 HOH B O   1 
HETATM 483 O  O   . HOH F 5 .  ? 30.639 36.135 26.950 0.50 32.80 ? 217 HOH B O   1 
HETATM 484 O  O   . HOH F 5 .  ? 31.046 34.811 27.077 0.50 33.10 ? 218 HOH B O   1 
HETATM 485 O  O   . HOH F 5 .  ? 30.194 36.915 29.974 1.00 56.34 ? 219 HOH B O   1 
HETATM 486 O  O   . HOH F 5 .  ? 22.081 48.485 22.596 1.00 55.97 ? 220 HOH B O   1 
HETATM 487 O  O   . HOH F 5 .  ? 9.533  41.911 22.840 1.00 64.24 ? 221 HOH B O   1 
HETATM 488 O  O   . HOH F 5 .  ? 11.567 44.462 28.369 1.00 52.66 ? 222 HOH B O   1 
HETATM 489 O  O   . HOH F 5 .  ? 28.678 39.163 40.782 1.00 62.27 ? 223 HOH B O   1 
HETATM 490 O  O   . HOH F 5 .  ? 22.167 27.022 26.193 0.50 30.18 ? 224 HOH B O   1 
HETATM 491 O  O   . HOH F 5 .  ? 20.620 26.388 25.258 0.50 29.67 ? 225 HOH B O   1 
HETATM 492 O  O   . HOH F 5 .  ? 8.372  44.680 24.941 1.00 83.29 ? 226 HOH B O   1 
HETATM 493 O  O   . HOH F 5 .  ? 23.122 28.165 19.140 1.00 72.74 ? 227 HOH B O   1 
HETATM 494 O  O   . HOH F 5 .  ? 33.640 44.617 30.079 1.00 80.98 ? 228 HOH B O   1 
HETATM 495 O  O   . HOH F 5 .  ? 30.981 47.108 34.555 1.00 81.53 ? 229 HOH B O   1 
HETATM 496 O  O   . HOH F 5 .  ? 34.483 40.238 32.020 1.00 81.32 ? 230 HOH B O   1 
HETATM 497 O  O   . HOH F 5 .  ? 10.258 41.722 20.218 1.00 69.65 ? 231 HOH B O   1 
HETATM 498 O  O   . HOH F 5 .  ? 17.829 25.379 14.678 1.00 78.16 ? 232 HOH B O   1 
HETATM 499 O  O   . HOH F 5 .  ? 15.376 24.434 25.540 1.00 82.81 ? 233 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  ILE 2  2  2  ILE ILE A . n 
A 1 3  VAL 3  3  3  VAL VAL A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  GLN 5  5  5  GLN GLN A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  ALA 8  8  8  ALA ALA A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 VAL 10 10 10 VAL VAL A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 LEU 16 16 16 LEU LEU A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 ASN 18 18 18 ASN ASN A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
B 2 1  PHE 1  1  1  PHE PHE B . n 
B 2 2  VAL 2  2  2  VAL VAL B . n 
B 2 3  ASN 3  3  3  ASN ASN B . n 
B 2 4  GLN 4  4  4  GLN GLN B . n 
B 2 5  HIS 5  5  5  HIS HIS B . n 
B 2 6  LEU 6  6  6  LEU LEU B . n 
B 2 7  CYS 7  7  7  CYS CYS B . n 
B 2 8  GLY 8  8  8  GLY GLY B . n 
B 2 9  SER 9  9  9  SER SER B . n 
B 2 10 HIS 10 10 10 HIS HIS B . n 
B 2 11 LEU 11 11 11 LEU LEU B . n 
B 2 12 VAL 12 12 12 VAL VAL B . n 
B 2 13 GLU 13 13 13 GLU GLU B . n 
B 2 14 ALA 14 14 14 ALA ALA B . n 
B 2 15 LEU 15 15 15 LEU LEU B . n 
B 2 16 TYR 16 16 16 TYR TYR B . n 
B 2 17 LEU 17 17 17 LEU LEU B . n 
B 2 18 VAL 18 18 18 VAL VAL B . n 
B 2 19 CYS 19 19 19 CYS CYS B . n 
B 2 20 GLY 20 20 20 GLY GLY B . n 
B 2 21 GLU 21 21 21 GLU GLU B . n 
B 2 22 ARG 22 22 22 ARG ARG B . n 
B 2 23 GLY 23 23 23 GLY GLY B . n 
B 2 24 PHE 24 24 24 PHE PHE B . n 
B 2 25 PHE 25 25 25 PHE PHE B . n 
B 2 26 TYR 26 26 26 TYR TYR B . n 
B 2 27 THR 27 27 27 THR THR B . n 
B 2 28 PRO 28 28 28 PRO PRO B . n 
B 2 29 LYS 29 29 29 LYS LYS B . n 
B 2 30 ALA 30 30 30 ALA ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 NA  1  88  88  NA  NA  A . 
D 4 DCE 1  200 200 DCE DCE B . 
E 5 HOH 1  89  3   HOH HOH A . 
E 5 HOH 2  90  14  HOH HOH A . 
E 5 HOH 3  91  16  HOH HOH A . 
E 5 HOH 4  92  17  HOH HOH A . 
E 5 HOH 5  93  18  HOH HOH A . 
E 5 HOH 6  94  20  HOH HOH A . 
E 5 HOH 7  95  21  HOH HOH A . 
E 5 HOH 8  96  22  HOH HOH A . 
E 5 HOH 9  97  24  HOH HOH A . 
E 5 HOH 10 98  25  HOH HOH A . 
E 5 HOH 11 99  27  HOH HOH A . 
E 5 HOH 12 100 28  HOH HOH A . 
E 5 HOH 13 101 29  HOH HOH A . 
E 5 HOH 14 102 33  HOH HOH A . 
E 5 HOH 15 103 37  HOH HOH A . 
E 5 HOH 16 104 39  HOH HOH A . 
E 5 HOH 17 105 40  HOH HOH A . 
E 5 HOH 18 106 46  HOH HOH A . 
E 5 HOH 19 107 49  HOH HOH A . 
E 5 HOH 20 108 52  HOH HOH A . 
E 5 HOH 21 109 54  HOH HOH A . 
E 5 HOH 22 110 55  HOH HOH A . 
F 5 HOH 1  201 1   HOH HOH B . 
F 5 HOH 2  202 2   HOH HOH B . 
F 5 HOH 3  203 4   HOH HOH B . 
F 5 HOH 4  204 5   HOH HOH B . 
F 5 HOH 5  205 6   HOH HOH B . 
F 5 HOH 6  206 7   HOH HOH B . 
F 5 HOH 7  207 8   HOH HOH B . 
F 5 HOH 8  208 9   HOH HOH B . 
F 5 HOH 9  209 10  HOH HOH B . 
F 5 HOH 10 210 11  HOH HOH B . 
F 5 HOH 11 211 12  HOH HOH B . 
F 5 HOH 12 212 13  HOH HOH B . 
F 5 HOH 13 213 15  HOH HOH B . 
F 5 HOH 14 214 19  HOH HOH B . 
F 5 HOH 15 215 23  HOH HOH B . 
F 5 HOH 16 216 26  HOH HOH B . 
F 5 HOH 17 217 30  HOH HOH B . 
F 5 HOH 18 218 31  HOH HOH B . 
F 5 HOH 19 219 32  HOH HOH B . 
F 5 HOH 20 220 34  HOH HOH B . 
F 5 HOH 21 221 35  HOH HOH B . 
F 5 HOH 22 222 36  HOH HOH B . 
F 5 HOH 23 223 38  HOH HOH B . 
F 5 HOH 24 224 41  HOH HOH B . 
F 5 HOH 25 225 42  HOH HOH B . 
F 5 HOH 26 226 43  HOH HOH B . 
F 5 HOH 27 227 44  HOH HOH B . 
F 5 HOH 28 228 45  HOH HOH B . 
F 5 HOH 29 229 47  HOH HOH B . 
F 5 HOH 30 230 48  HOH HOH B . 
F 5 HOH 31 231 50  HOH HOH B . 
F 5 HOH 32 232 51  HOH HOH B . 
F 5 HOH 33 233 53  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
3 software_defined_assembly            PISA tetrameric 4 
4 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F 
2 1,2 A,B,C,D,E,F 
3 1,3 A,C,E       
3 4,5 B,D,F       
4 1,3 A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1640 ? 
1 MORE         -20  ? 
1 'SSA (A^2)'  3360 ? 
2 'ABSA (A^2)' 4900 ? 
2 MORE         -71  ? 
2 'SSA (A^2)'  5530 ? 
3 'ABSA (A^2)' 3300 ? 
3 MORE         -67  ? 
3 'SSA (A^2)'  7140 ? 
4 'ABSA (A^2)' 4260 ? 
4 MORE         -53  ? 
4 'SSA (A^2)'  5740 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z         1.0000000000  0.0000000000 0.0000000000  0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000  1.0000000000  0.0000000000  
2 'crystal symmetry operation' 16_565 x,-y+1,-z+1/2 1.0000000000  0.0000000000 0.0000000000  0.0000000000  0.0000000000 
-1.0000000000 0.0000000000 78.9000000000 0.0000000000 0.0000000000  -1.0000000000 39.4500000000 
3 'crystal symmetry operation' 15_556 -x+1/2,y,-z+1 -1.0000000000 0.0000000000 0.0000000000  39.4500000000 0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000  -1.0000000000 78.9000000000 
4 'crystal symmetry operation' 5_555  z,x,y         0.0000000000  0.0000000000 1.0000000000  0.0000000000  1.0000000000 
0.0000000000  0.0000000000 0.0000000000  0.0000000000 1.0000000000  0.0000000000  0.0000000000  
5 'crystal symmetry operation' 20_556 -z+1/2,x,-y+1 0.0000000000  0.0000000000 -1.0000000000 39.4500000000 1.0000000000 
0.0000000000  0.0000000000 0.0000000000  0.0000000000 -1.0000000000 0.0000000000  78.9000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     98 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? E HOH .  ? A HOH 102 ? 1_555 NA ? C NA . ? A NA 88 ? 1_555 O  ? A GLN 5  ? A GLN 5   ? 1_555 93.4  ? 
2  O ? E HOH .  ? A HOH 102 ? 1_555 NA ? C NA . ? A NA 88 ? 1_555 O  ? A VAL 10 ? A VAL 10  ? 1_555 118.8 ? 
3  O ? A GLN 5  ? A GLN 5   ? 1_555 NA ? C NA . ? A NA 88 ? 1_555 O  ? A VAL 10 ? A VAL 10  ? 1_555 89.3  ? 
4  O ? E HOH .  ? A HOH 102 ? 1_555 NA ? C NA . ? A NA 88 ? 1_555 O  ? E HOH .  ? A HOH 100 ? 1_555 92.7  ? 
5  O ? A GLN 5  ? A GLN 5   ? 1_555 NA ? C NA . ? A NA 88 ? 1_555 O  ? E HOH .  ? A HOH 100 ? 1_555 170.7 ? 
6  O ? A VAL 10 ? A VAL 10  ? 1_555 NA ? C NA . ? A NA 88 ? 1_555 O  ? E HOH .  ? A HOH 100 ? 1_555 93.9  ? 
7  O ? E HOH .  ? A HOH 102 ? 1_555 NA ? C NA . ? A NA 88 ? 1_555 OG ? A SER 9  ? A SER 9   ? 1_555 110.9 ? 
8  O ? A GLN 5  ? A GLN 5   ? 1_555 NA ? C NA . ? A NA 88 ? 1_555 OG ? A SER 9  ? A SER 9   ? 1_555 79.5  ? 
9  O ? A VAL 10 ? A VAL 10  ? 1_555 NA ? C NA . ? A NA 88 ? 1_555 OG ? A SER 9  ? A SER 9   ? 1_555 129.6 ? 
10 O ? E HOH .  ? A HOH 100 ? 1_555 NA ? C NA . ? A NA 88 ? 1_555 OG ? A SER 9  ? A SER 9   ? 1_555 91.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1993-01-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
_software.name             PROLSQ 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;SHEET
THERE IS A SHEET COMPRISING TWO ANTIPARALLEL STRANDS
PHE B 24 - TYR B 26 FROM TWO DIMER-FORMING INSULIN
MOLECULES.
;
# 
_pdbx_entry_details.entry_id             1BPH 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;THE 1,2-DICHLOROETHANE IS BOUND IS CIS CONFORMATION IN A
SYMMETRIC POSITION ACROSS THE CRYSTALLOGRAPHIC TWO-FOLD
AXIS BETWEEN THE TWO INSULIN DIMER-FORMING MOLECULES.
;
_pdbx_entry_details.sequence_details     ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CA 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             22 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             22 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            B 
_pdbx_validate_rmsd_bond.bond_value                1.671 
_pdbx_validate_rmsd_bond.bond_target_value         1.535 
_pdbx_validate_rmsd_bond.bond_deviation            0.136 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.022 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N   B HIS 10 ? ? CA B HIS 10 ? ? CB  B HIS 10 ? B 130.53 110.60 19.93  1.80 N 
2  1 OE1 B GLU 13 ? ? CD B GLU 13 ? ? OE2 B GLU 13 ? ? 133.96 123.30 10.66  1.20 N 
3  1 CG  B GLU 13 ? ? CD B GLU 13 ? ? OE2 B GLU 13 ? ? 104.33 118.30 -13.97 2.00 N 
4  1 CB  B ARG 22 ? B CA B ARG 22 ? ? C   B ARG 22 ? ? 98.01  110.40 -12.39 2.00 N 
5  1 CA  B ARG 22 ? ? CB B ARG 22 ? B CG  B ARG 22 ? B 98.75  113.40 -14.65 2.20 N 
6  1 CD  B ARG 22 ? B NE B ARG 22 ? B CZ  B ARG 22 ? B 111.94 123.60 -11.66 1.40 N 
7  1 NE  B ARG 22 ? B CZ B ARG 22 ? B NH1 B ARG 22 ? B 113.29 120.30 -7.01  0.50 N 
8  1 NE  B ARG 22 ? B CZ B ARG 22 ? B NH2 B ARG 22 ? B 124.18 120.30 3.88   0.50 N 
9  1 CB  B PHE 25 ? ? CA B PHE 25 ? ? C   B PHE 25 ? ? 123.26 110.40 12.86  2.00 N 
10 1 CB  B TYR 26 ? ? CG B TYR 26 ? ? CD1 B TYR 26 ? ? 117.14 121.00 -3.86  0.60 N 
11 1 N   B LYS 29 ? ? CA B LYS 29 ? B C   B LYS 29 ? B 92.86  111.00 -18.14 2.70 N 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     22 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.104 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B LYS 29 ? CG ? B LYS 29 CG 
2 1 Y 1 B LYS 29 ? CD ? B LYS 29 CD 
3 1 Y 1 B LYS 29 ? CE ? B LYS 29 CE 
4 1 Y 1 B LYS 29 ? NZ ? B LYS 29 NZ 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SODIUM ION'       NA  
4 1,2-DICHLOROETHANE DCE 
5 water              HOH 
#