data_1BQ8
# 
_entry.id   1BQ8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BQ8         
RCSB  RCSB008025   
WWPDB D_1000008025 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1CAA . unspecified 
PDB 1BQ9 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BQ8 
_pdbx_database_status.recvd_initial_deposition_date   1998-08-22 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bau, R.'        1 
'Rees, D.C.'     2 
'Kurtz, D.M.'    3 
'Scott, R.A.'    4 
'Huang, H.'      5 
'Adams, M.W.W.'  6 
'Eidsness, M.K.' 7 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structure of Rubredoxin from Pyrococcus Furiosus at 0.95 Angstroms Resolution, and the structures of N-terminal methionine and formylmethionine variants of Pf Rd. Contributions of N-terminal interactions to thermostability
;
_citation.journal_abbrev            J.BIOL.INORG.CHEM. 
_citation.journal_volume            3 
_citation.page_first                484 
_citation.page_last                 493 
_citation.year                      1998 
_citation.journal_id_ASTM           JJBCFA 
_citation.country                   GW 
_citation.journal_id_ISSN           0949-8257 
_citation.journal_id_CSD            2154 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   -1 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bau, R.'        1 
primary 'Rees, D.C.'     2 
primary 'Kurtz, D.M.'    3 
primary 'Scott, R.A.'    4 
primary 'Huang, H.'      5 
primary 'Adams, M.W.W.'  6 
primary 'Eidsness, M.K.' 7 
# 
_cell.entry_id           1BQ8 
_cell.length_a           33.823 
_cell.length_b           34.705 
_cell.length_c           43.204 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BQ8 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (RUBREDOXIN)' 6031.728 1   ? ? ? 'EXTRA MET IN N-TERMINUS' 
2 non-polymer syn 'FE (III) ION'         55.845   1   ? ? ? ?                         
3 water       nat water                  18.015   190 ? ? ? ?                         
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '[_0M] PF RD' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 
_entity_poly.pdbx_seq_one_letter_code_can   MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  LYS n 
1 4  TRP n 
1 5  VAL n 
1 6  CYS n 
1 7  LYS n 
1 8  ILE n 
1 9  CYS n 
1 10 GLY n 
1 11 TYR n 
1 12 ILE n 
1 13 TYR n 
1 14 ASP n 
1 15 GLU n 
1 16 ASP n 
1 17 ALA n 
1 18 GLY n 
1 19 ASP n 
1 20 PRO n 
1 21 ASP n 
1 22 ASN n 
1 23 GLY n 
1 24 ILE n 
1 25 SER n 
1 26 PRO n 
1 27 GLY n 
1 28 THR n 
1 29 LYS n 
1 30 PHE n 
1 31 GLU n 
1 32 GLU n 
1 33 LEU n 
1 34 PRO n 
1 35 ASP n 
1 36 ASP n 
1 37 TRP n 
1 38 VAL n 
1 39 CYS n 
1 40 PRO n 
1 41 ILE n 
1 42 CYS n 
1 43 GLY n 
1 44 ALA n 
1 45 PRO n 
1 46 LYS n 
1 47 SER n 
1 48 GLU n 
1 49 PHE n 
1 50 GLU n 
1 51 LYS n 
1 52 LEU n 
1 53 GLU n 
1 54 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'PRODUCT OF A SYNTHETIC PF RD GENE' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RUBR_PYRFU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P24297 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1BQ8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 54 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P24297 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  54 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       54 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1BQ8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.10 
_exptl_crystal.density_percent_sol   41.43 
_exptl_crystal.description           'KNOWN STRUCTURE (SEE TEXT)' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION AGAINST 3.6M NA,K PHOSPHATE, pH 8.5, vapor diffusion' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           123 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'SIEMENS X-1000' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BQ8 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            1.1 
_reflns.number_obs                   45654 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.2 
_reflns.pdbx_Rmerge_I_obs            0.0560000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.1 
_reflns_shell.d_res_low              1.2 
_reflns_shell.percent_possible_all   87.2 
_reflns_shell.Rmerge_I_obs           0.1250000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        1.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1BQ8 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     18377 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            1.1 
_refine.ls_percent_reflns_obs                    96.2 
_refine.ls_R_factor_obs                          0.1190000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.1490000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     4541 
_refine.ls_number_restraints                     4888 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'ANISOTROPIC C,N,O,S,FE B23 (A**2) : ESTIMATED OVERALL COORDINATE ERROR.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'EVERY 10TH REFLECTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1BQ8 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      0 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        421 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             190 
_refine_hist.number_atoms_total               612 
_refine_hist.d_res_high                       1.1 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  2.6   ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1BQ8 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1190000 
_pdbx_refine.free_R_factor_no_cutoff                     0.1490000 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1150000 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               17213 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1BQ8 
_struct.title                     'Rubredoxin (Methionine Mutant) from Pyrococcus Furiosus' 
_struct.pdbx_descriptor           'PROTEIN (RUBREDOXIN) MUTANT (METHIONINE MUTANT)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BQ8 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'IRON-SULFUR PROTEIN, HIGH-RESOLUTION STRUCTURE, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 20 ? ASN A 22 ? PRO A 20 ASN A 22 5 ? 3 
HELX_P HELX_P2 2 PHE A 30 ? GLU A 32 ? PHE A 30 GLU A 32 5 ? 3 
HELX_P HELX_P3 3 LYS A 46 ? GLU A 48 ? LYS A 46 GLU A 48 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 6  SG ? ? ? 1_555 B FE . FE ? ? A CYS 6  A FE 55 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc2 metalc ? ? A CYS 9  SG ? ? ? 1_555 B FE . FE ? ? A CYS 9  A FE 55 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc3 metalc ? ? A CYS 39 SG ? ? ? 1_555 B FE . FE ? ? A CYS 39 A FE 55 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc4 metalc ? ? A CYS 42 SG ? ? ? 1_555 B FE . FE ? ? A CYS 42 A FE 55 1_555 ? ? ? ? ? ? ? 2.266 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 12 ? ASP A 14 ? ILE A 12 ASP A 14 
A 2 LYS A 3  ? CYS A 6  ? LYS A 3  CYS A 6  
A 3 PHE A 49 ? LYS A 51 ? PHE A 49 LYS A 51 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 13 ? O TYR A 13 N TRP A 4  ? N TRP A 4  
A 2 3 O VAL A 5  ? O VAL A 5  N GLU A 50 ? N GLU A 50 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE FE A 55' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 6  ? CYS A 6  . ? 1_555 ? 
2 AC1 4 CYS A 9  ? CYS A 9  . ? 1_555 ? 
3 AC1 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 
4 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1BQ8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BQ8 
_atom_sites.fract_transf_matrix[1][1]   0.029566 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028814 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023146 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . MET A 1 1  ? 24.235 -3.831  5.464   1.00 6.76  ? 1   MET A N   1 
ATOM   2   C  CA  . MET A 1 1  ? 22.963 -4.052  4.750   1.00 5.59  ? 1   MET A CA  1 
ATOM   3   C  C   . MET A 1 1  ? 22.621 -2.823  3.939   1.00 5.67  ? 1   MET A C   1 
ATOM   4   O  O   . MET A 1 1  ? 23.394 -1.866  3.931   1.00 6.21  ? 1   MET A O   1 
ATOM   5   C  CB  . MET A 1 1  ? 21.858 -4.415  5.739   1.00 5.72  ? 1   MET A CB  1 
ATOM   6   C  CG  . MET A 1 1  ? 22.124 -5.688  6.529   1.00 6.27  ? 1   MET A CG  1 
ATOM   7   S  SD  . MET A 1 1  ? 20.736 -6.129  7.587   1.00 6.50  ? 1   MET A SD  1 
ATOM   8   C  CE  . MET A 1 1  ? 19.593 -6.695  6.343   1.00 6.71  ? 1   MET A CE  1 
ATOM   9   N  N   . ALA A 1 2  ? 21.516 -2.856  3.204   1.00 5.15  ? 2   ALA A N   1 
ATOM   10  C  CA  . ALA A 1 2  ? 21.204 -1.814  2.278   1.00 4.54  ? 2   ALA A CA  1 
ATOM   11  C  C   . ALA A 1 2  ? 20.592 -0.605  2.904   1.00 3.70  ? 2   ALA A C   1 
ATOM   12  O  O   . ALA A 1 2  ? 20.106 -0.668  4.041   1.00 4.34  ? 2   ALA A O   1 
ATOM   13  C  CB  . ALA A 1 2  ? 20.292 -2.316  1.157   1.00 5.04  ? 2   ALA A CB  1 
ATOM   14  N  N   . LYS A 1 3  ? 20.671 0.527   2.230   1.00 3.70  ? 3   LYS A N   1 
ATOM   15  C  CA  . LYS A 1 3  ? 20.056 1.782   2.593   1.00 3.33  ? 3   LYS A CA  1 
ATOM   16  C  C   . LYS A 1 3  ? 19.131 2.177   1.445   1.00 3.05  ? 3   LYS A C   1 
ATOM   17  O  O   . LYS A 1 3  ? 19.423 1.958   0.258   1.00 3.82  ? 3   LYS A O   1 
ATOM   18  C  CB  . LYS A 1 3  ? 21.086 2.850   2.877   1.00 4.77  ? 3   LYS A CB  1 
ATOM   19  C  CG  . LYS A 1 3  ? 21.956 2.505   4.130   1.00 7.74  ? 3   LYS A CG  1 
ATOM   20  C  CD  . LYS A 1 3  ? 23.210 1.710   3.818   1.00 8.76  ? 3   LYS A CD  1 
ATOM   21  C  CE  . LYS A 1 3  ? 24.143 1.434   4.915   1.00 9.36  ? 3   LYS A CE  1 
ATOM   22  N  NZ  . LYS A 1 3  ? 23.719 0.372   5.895   1.00 8.43  ? 3   LYS A NZ  1 
ATOM   23  N  N   . TRP A 1 4  ? 18.015 2.797   1.838   1.00 2.64  ? 4   TRP A N   1 
ATOM   24  C  CA  . TRP A 1 4  ? 16.969 3.222   0.927   1.00 2.99  ? 4   TRP A CA  1 
ATOM   25  C  C   . TRP A 1 4  ? 16.646 4.681   1.256   1.00 3.47  ? 4   TRP A C   1 
ATOM   26  O  O   . TRP A 1 4  ? 16.619 5.062   2.424   1.00 8.05  ? 4   TRP A O   1 
ATOM   27  C  CB  . TRP A 1 4  ? 15.688 2.396   1.159   1.00 3.82  ? 4   TRP A CB  1 
ATOM   28  C  CG  . TRP A 1 4  ? 15.848 0.924   0.872   1.00 3.47  ? 4   TRP A CG  1 
ATOM   29  C  CD1 . TRP A 1 4  ? 16.577 0.009   1.561   1.00 3.70  ? 4   TRP A CD1 1 
ATOM   30  C  CD2 . TRP A 1 4  ? 15.222 0.224   -0.190  1.00 3.56  ? 4   TRP A CD2 1 
ATOM   31  N  NE1 . TRP A 1 4  ? 16.503 -1.224  0.976   1.00 4.42  ? 4   TRP A NE1 1 
ATOM   32  C  CE2 . TRP A 1 4  ? 15.615 -1.140  -0.099  1.00 3.87  ? 4   TRP A CE2 1 
ATOM   33  C  CE3 . TRP A 1 4  ? 14.293 0.556   -1.198  1.00 3.73  ? 4   TRP A CE3 1 
ATOM   34  C  CZ2 . TRP A 1 4  ? 15.174 -2.113  -0.977  1.00 4.81  ? 4   TRP A CZ2 1 
ATOM   35  C  CZ3 . TRP A 1 4  ? 13.840 -0.412  -2.069  1.00 4.48  ? 4   TRP A CZ3 1 
ATOM   36  C  CH2 . TRP A 1 4  ? 14.297 -1.728  -1.937  1.00 5.12  ? 4   TRP A CH2 1 
ATOM   37  N  N   . VAL A 1 5  ? 16.394 5.495   0.266   1.00 3.20  ? 5   VAL A N   1 
ATOM   38  C  CA  . VAL A 1 5  ? 15.980 6.892   0.493   1.00 3.49  ? 5   VAL A CA  1 
ATOM   39  C  C   . VAL A 1 5  ? 14.480 7.032   0.278   1.00 2.98  ? 5   VAL A C   1 
ATOM   40  O  O   . VAL A 1 5  ? 13.922 6.570   -0.728  1.00 3.30  ? 5   VAL A O   1 
ATOM   41  C  CB  . VAL A 1 5  ? 16.763 7.863   -0.366  1.00 3.68  ? 5   VAL A CB  1 
ATOM   42  C  CG1 . VAL A 1 5  ? 16.514 7.724   -1.870  1.00 4.62  ? 5   VAL A CG1 1 
ATOM   43  C  CG2 . VAL A 1 5  ? 16.523 9.338   0.046   1.00 5.32  ? 5   VAL A CG2 1 
ATOM   44  N  N   . CYS A 1 6  ? 13.876 7.840   1.115   1.00 2.56  ? 6   CYS A N   1 
ATOM   45  C  CA  . CYS A 1 6  ? 12.515 8.342   0.910   1.00 2.77  ? 6   CYS A CA  1 
ATOM   46  C  C   . CYS A 1 6  ? 12.644 9.458   -0.142  1.00 2.56  ? 6   CYS A C   1 
ATOM   47  O  O   . CYS A 1 6  ? 13.271 10.473  0.122   1.00 3.23  ? 6   CYS A O   1 
ATOM   48  C  CB  . CYS A 1 6  ? 11.937 8.897   2.187   1.00 2.83  ? 6   CYS A CB  1 
ATOM   49  S  SG  . CYS A 1 6  ? 10.256 9.599   1.876   1.00 3.04  ? 6   CYS A SG  1 
ATOM   50  N  N   . LYS A 1 7  ? 12.120 9.227   -1.346  1.00 2.98  ? 7   LYS A N   1 
ATOM   51  C  CA  . LYS A 1 7  ? 12.260 10.201  -2.421  1.00 3.51  ? 7   LYS A CA  1 
ATOM   52  C  C   . LYS A 1 7  ? 11.541 11.504  -2.103  1.00 3.88  ? 7   LYS A C   1 
ATOM   53  O  O   . LYS A 1 7  ? 11.857 12.540  -2.672  1.00 5.65  ? 7   LYS A O   1 
ATOM   54  C  CB  . LYS A 1 7  ? 11.742 9.650   -3.758  1.00 5.11  ? 7   LYS A CB  1 
ATOM   55  C  CG  . LYS A 1 7  ? 12.524 8.451   -4.265  1.00 6.96  ? 7   LYS A CG  1 
ATOM   56  C  CD  . LYS A 1 7  ? 11.938 7.989   -5.583  1.00 8.84  ? 7   LYS A CD  1 
ATOM   57  C  CE  . LYS A 1 7  ? 10.500 7.483   -5.529  1.00 9.73  ? 7   LYS A CE  1 
ATOM   58  N  NZ  . LYS A 1 7  ? 10.079 6.961   -6.833  1.00 11.95 ? 7   LYS A NZ  1 
ATOM   59  N  N   . ILE A 1 8  ? 10.572 11.487  -1.162  1.00 3.53  ? 8   ILE A N   1 
ATOM   60  C  CA  . ILE A 1 8  ? 9.858  12.717  -0.799  1.00 3.44  ? 8   ILE A CA  1 
ATOM   61  C  C   . ILE A 1 8  ? 10.661 13.609  0.123   1.00 3.26  ? 8   ILE A C   1 
ATOM   62  O  O   . ILE A 1 8  ? 10.797 14.826  -0.111  1.00 5.13  ? 8   ILE A O   1 
ATOM   63  C  CB  . ILE A 1 8  ? 8.487  12.375  -0.162  1.00 5.11  ? 8   ILE A CB  1 
ATOM   64  C  CG1 . ILE A 1 8  ? 7.671  11.360  -0.956  1.00 5.47  ? 8   ILE A CG1 1 
ATOM   65  C  CG2 . ILE A 1 8  ? 7.719  13.652  0.102   1.00 5.65  ? 8   ILE A CG2 1 
ATOM   66  C  CD1 . ILE A 1 8  ? 7.349  11.801  -2.358  1.00 8.43  ? 8   ILE A CD1 1 
ATOM   67  N  N   . CYS A 1 9  ? 11.210 13.074  1.223   1.00 3.35  ? 9   CYS A N   1 
ATOM   68  C  CA  . CYS A 1 9  ? 11.769 13.851  2.272   1.00 3.49  ? 9   CYS A CA  1 
ATOM   69  C  C   . CYS A 1 9  ? 13.219 13.660  2.581   1.00 3.53  ? 9   CYS A C   1 
ATOM   70  O  O   . CYS A 1 9  ? 13.796 14.406  3.390   1.00 3.48  ? 9   CYS A O   1 
ATOM   71  C  CB  . CYS A 1 9  ? 10.948 13.686  3.564   1.00 3.16  ? 9   CYS A CB  1 
ATOM   72  S  SG  . CYS A 1 9  ? 11.311 12.173  4.470   1.00 3.34  ? 9   CYS A SG  1 
ATOM   73  N  N   . GLY A 1 10 ? 13.879 12.653  2.014   1.00 2.95  ? 10  GLY A N   1 
ATOM   74  C  CA  . GLY A 1 10 ? 15.282 12.416  2.247   1.00 2.72  ? 10  GLY A CA  1 
ATOM   75  C  C   . GLY A 1 10 ? 15.614 11.546  3.426   1.00 2.73  ? 10  GLY A C   1 
ATOM   76  O  O   . GLY A 1 10 ? 16.820 11.254  3.626   1.00 3.00  ? 10  GLY A O   1 
ATOM   77  N  N   . TYR A 1 11 ? 14.667 11.081  4.202   1.00 2.81  ? 11  TYR A N   1 
ATOM   78  C  CA  . TYR A 1 11 ? 14.915 10.112  5.274   1.00 2.91  ? 11  TYR A CA  1 
ATOM   79  C  C   . TYR A 1 11 ? 15.553 8.845   4.649   1.00 2.90  ? 11  TYR A C   1 
ATOM   80  O  O   . TYR A 1 11 ? 15.159 8.433   3.551   1.00 3.10  ? 11  TYR A O   1 
ATOM   81  C  CB  . TYR A 1 11 ? 13.580 9.729   5.930   1.00 2.88  ? 11  TYR A CB  1 
ATOM   82  C  CG  . TYR A 1 11 ? 13.703 8.536   6.859   1.00 2.57  ? 11  TYR A CG  1 
ATOM   83  C  CD1 . TYR A 1 11 ? 14.232 8.652   8.139   1.00 3.41  ? 11  TYR A CD1 1 
ATOM   84  C  CD2 . TYR A 1 11 ? 13.305 7.275   6.410   1.00 3.49  ? 11  TYR A CD2 1 
ATOM   85  C  CE1 . TYR A 1 11 ? 14.336 7.547   8.970   1.00 4.29  ? 11  TYR A CE1 1 
ATOM   86  C  CE2 . TYR A 1 11 ? 13.427 6.178   7.235   1.00 3.09  ? 11  TYR A CE2 1 
ATOM   87  C  CZ  . TYR A 1 11 ? 13.946 6.307   8.493   1.00 3.73  ? 11  TYR A CZ  1 
ATOM   88  O  OH  . TYR A 1 11 ? 14.053 5.156   9.266   1.00 4.47  ? 11  TYR A OH  1 
ATOM   89  N  N   . ILE A 1 12 ? 16.530 8.325   5.360   1.00 2.50  ? 12  ILE A N   1 
ATOM   90  C  CA  . ILE A 1 12 ? 17.176 7.071   4.961   1.00 2.77  ? 12  ILE A CA  1 
ATOM   91  C  C   . ILE A 1 12 ? 16.631 5.931   5.778   1.00 2.84  ? 12  ILE A C   1 
ATOM   92  O  O   . ILE A 1 12 ? 16.815 5.923   6.989   1.00 3.43  ? 12  ILE A O   1 
ATOM   93  C  CB  . ILE A 1 12 ? 18.702 7.193   5.103   1.00 3.75  ? 12  ILE A CB  1 
ATOM   94  C  CG1 . ILE A 1 12 ? 19.290 8.421   4.373   1.00 4.12  ? 12  ILE A CG1 1 
ATOM   95  C  CG2 . ILE A 1 12 ? 19.388 5.922   4.674   1.00 4.75  ? 12  ILE A CG2 1 
ATOM   96  C  CD1 . ILE A 1 12 ? 19.194 8.339   2.859   1.00 6.27  ? 12  ILE A CD1 1 
ATOM   97  N  N   . TYR A 1 13 ? 16.049 4.930   5.126   1.00 2.76  ? 13  TYR A N   1 
ATOM   98  C  CA  . TYR A 1 13 ? 15.756 3.682   5.791   1.00 2.93  ? 13  TYR A CA  1 
ATOM   99  C  C   . TYR A 1 13 ? 17.033 2.838   5.669   1.00 2.51  ? 13  TYR A C   1 
ATOM   100 O  O   . TYR A 1 13 ? 17.414 2.399   4.591   1.00 3.21  ? 13  TYR A O   1 
ATOM   101 C  CB  . TYR A 1 13 ? 14.570 2.905   5.234   1.00 2.89  ? 13  TYR A CB  1 
ATOM   102 C  CG  . TYR A 1 13 ? 14.426 1.594   6.015   1.00 2.53  ? 13  TYR A CG  1 
ATOM   103 C  CD1 . TYR A 1 13 ? 13.996 1.639   7.337   1.00 3.70  ? 13  TYR A CD1 1 
ATOM   104 C  CD2 . TYR A 1 13 ? 14.842 0.397   5.528   1.00 2.70  ? 13  TYR A CD2 1 
ATOM   105 C  CE1 . TYR A 1 13 ? 13.885 0.500   8.110   1.00 3.02  ? 13  TYR A CE1 1 
ATOM   106 C  CE2 . TYR A 1 13 ? 14.778 -0.784  6.298   1.00 2.63  ? 13  TYR A CE2 1 
ATOM   107 C  CZ  . TYR A 1 13 ? 14.329 -0.700  7.576   1.00 2.74  ? 13  TYR A CZ  1 
ATOM   108 O  OH  . TYR A 1 13 ? 14.298 -1.804  8.422   1.00 3.76  ? 13  TYR A OH  1 
ATOM   109 N  N   . ASP A 1 14 ? 17.742 2.743   6.804   1.00 2.52  ? 14  ASP A N   1 
ATOM   110 C  CA  . ASP A 1 14 ? 18.993 2.006   6.865   1.00 3.12  ? 14  ASP A CA  1 
ATOM   111 C  C   . ASP A 1 14 ? 18.687 0.637   7.440   1.00 2.67  ? 14  ASP A C   1 
ATOM   112 O  O   . ASP A 1 14 ? 18.266 0.526   8.624   1.00 3.18  ? 14  ASP A O   1 
ATOM   113 C  CB  . ASP A 1 14 ? 19.967 2.734   7.806   1.00 3.18  ? 14  ASP A CB  1 
ATOM   114 C  CG  . ASP A 1 14 ? 21.283 2.063   7.996   1.00 3.76  ? 14  ASP A CG  1 
ATOM   115 O  OD1 . ASP A 1 14 ? 21.465 0.916   7.516   1.00 4.38  ? 14  ASP A OD1 1 
ATOM   116 O  OD2 . ASP A 1 14 ? 22.180 2.659   8.681   1.00 4.77  ? 14  ASP A OD2 1 
ATOM   117 N  N   . GLU A 1 15 ? 18.795 -0.416  6.662   1.00 2.67  ? 15  GLU A N   1 
ATOM   118 C  CA  . GLU A 1 15 ? 18.426 -1.760  7.138   1.00 2.68  ? 15  GLU A CA  1 
ATOM   119 C  C   . GLU A 1 15 ? 19.161 -2.123  8.407   1.00 3.46  ? 15  GLU A C   1 
ATOM   120 O  O   . GLU A 1 15 ? 18.638 -2.867  9.240   1.00 3.76  ? 15  GLU A O   1 
ATOM   121 C  CB  . GLU A 1 15 ? 18.626 -2.807  6.059   1.00 3.05  ? 15  GLU A CB  1 
ATOM   122 C  CG  . GLU A 1 15 ? 17.681 -2.620  4.862   1.00 3.45  ? 15  GLU A CG  1 
ATOM   123 C  CD  . GLU A 1 15 ? 17.918 -3.561  3.743   1.00 3.60  ? 15  GLU A CD  1 
ATOM   124 O  OE1 . GLU A 1 15 ? 18.925 -4.295  3.699   1.00 4.43  ? 15  GLU A OE1 1 
ATOM   125 O  OE2 . GLU A 1 15 ? 16.997 -3.609  2.827   1.00 3.68  ? 15  GLU A OE2 1 
ATOM   126 N  N   . ASP A 1 16 ? 20.395 -1.675  8.589   1.00 3.35  ? 16  ASP A N   1 
ATOM   127 C  CA  . ASP A 1 16 ? 21.167 -1.973  9.799   1.00 3.45  ? 16  ASP A CA  1 
ATOM   128 C  C   . ASP A 1 16 ? 20.584 -1.302  11.033  1.00 3.83  ? 16  ASP A C   1 
ATOM   129 O  O   . ASP A 1 16 ? 20.818 -1.765  12.140  1.00 5.11  ? 16  ASP A O   1 
ATOM   130 C  CB  . ASP A 1 16 ? 22.626 -1.609  9.602   1.00 4.49  ? 16  ASP A CB  1 
ATOM   131 C  CG  . ASP A 1 16 ? 23.357 -2.501  8.630   1.00 4.96  ? 16  ASP A CG  1 
ATOM   132 O  OD1 . ASP A 1 16 ? 23.572 -3.670  8.975   1.00 9.23  ? 16  ASP A OD1 1 
ATOM   133 O  OD2 . ASP A 1 16 ? 23.697 -2.057  7.496   1.00 7.44  ? 16  ASP A OD2 1 
ATOM   134 N  N   . ALA A 1 17 ? 19.920 -0.167  10.833  1.00 3.70  ? 17  ALA A N   1 
ATOM   135 C  CA  . ALA A 1 17 ? 19.297 0.561   11.926  1.00 3.48  ? 17  ALA A CA  1 
ATOM   136 C  C   . ALA A 1 17 ? 17.868 0.097   12.188  1.00 3.50  ? 17  ALA A C   1 
ATOM   137 O  O   . ALA A 1 17 ? 17.368 0.261   13.330  1.00 4.06  ? 17  ALA A O   1 
ATOM   138 C  CB  . ALA A 1 17 ? 19.246 2.052   11.590  1.00 4.32  ? 17  ALA A CB  1 
ATOM   139 N  N   . GLY A 1 18 ? 17.149 -0.424  11.213  1.00 3.13  ? 18  GLY A N   1 
ATOM   140 C  CA  . GLY A 1 18 ? 15.768 -0.636  11.367  1.00 3.41  ? 18  GLY A CA  1 
ATOM   141 C  C   . GLY A 1 18 ? 14.994 0.637   11.691  1.00 2.95  ? 18  GLY A C   1 
ATOM   142 O  O   . GLY A 1 18 ? 15.365 1.744   11.250  1.00 3.52  ? 18  GLY A O   1 
ATOM   143 N  N   . ASP A 1 19 ? 13.943 0.510   12.451  1.00 3.24  ? 19  ASP A N   1 
ATOM   144 C  CA  . ASP A 1 19 ? 13.086 1.649   12.814  1.00 2.91  ? 19  ASP A CA  1 
ATOM   145 C  C   . ASP A 1 19 ? 12.366 1.251   14.103  1.00 2.65  ? 19  ASP A C   1 
ATOM   146 O  O   . ASP A 1 19 ? 11.139 1.074   14.159  1.00 3.00  ? 19  ASP A O   1 
ATOM   147 C  CB  . ASP A 1 19 ? 12.122 1.956   11.676  1.00 3.32  ? 19  ASP A CB  1 
ATOM   148 C  CG  . ASP A 1 19 ? 11.190 3.099   11.879  1.00 3.61  ? 19  ASP A CG  1 
ATOM   149 O  OD1 . ASP A 1 19 ? 11.482 4.023   12.691  1.00 4.58  ? 19  ASP A OD1 1 
ATOM   150 O  OD2 . ASP A 1 19 ? 10.138 3.134   11.168  1.00 4.03  ? 19  ASP A OD2 1 
ATOM   151 N  N   . PRO A 1 20 ? 13.114 1.085   15.191  1.00 3.22  ? 20  PRO A N   1 
ATOM   152 C  CA  . PRO A 1 20 ? 12.555 0.509   16.403  1.00 3.89  ? 20  PRO A CA  1 
ATOM   153 C  C   . PRO A 1 20 ? 11.440 1.313   17.015  1.00 3.73  ? 20  PRO A C   1 
ATOM   154 O  O   . PRO A 1 20 ? 10.516 0.722   17.612  1.00 4.48  ? 20  PRO A O   1 
ATOM   155 C  CB  . PRO A 1 20 ? 13.749 0.379   17.326  1.00 5.74  ? 20  PRO A CB  1 
ATOM   156 C  CG  . PRO A 1 20 ? 14.726 1.353   16.811  1.00 7.03  ? 20  PRO A CG  1 
ATOM   157 C  CD  . PRO A 1 20 ? 14.591 1.293   15.313  1.00 4.31  ? 20  PRO A CD  1 
ATOM   158 N  N   . ASP A 1 21 ? 11.454 2.640   16.890  1.00 3.86  ? 21  ASP A N   1 
ATOM   159 C  CA  . ASP A 1 21 ? 10.426 3.465   17.451  1.00 4.72  ? 21  ASP A CA  1 
ATOM   160 C  C   . ASP A 1 21 ? 9.064  3.192   16.829  1.00 5.22  ? 21  ASP A C   1 
ATOM   161 O  O   . ASP A 1 21 ? 8.049  3.529   17.407  1.00 6.90  ? 21  ASP A O   1 
ATOM   162 C  CB  . ASP A 1 21 ? 10.774 4.947   17.364  1.00 7.84  ? 21  ASP A CB  1 
ATOM   163 C  CG  . ASP A 1 21 ? 11.966 5.353   18.183  1.00 10.10 ? 21  ASP A CG  1 
ATOM   164 O  OD1 . ASP A 1 21 ? 12.586 4.525   18.938  1.00 11.20 ? 21  ASP A OD1 1 
ATOM   165 O  OD2 . ASP A 1 21 ? 12.510 6.450   17.927  1.00 12.50 ? 21  ASP A OD2 1 
ATOM   166 N  N   . ASN A 1 22 ? 9.056  2.596   15.640  1.00 4.12  ? 22  ASN A N   1 
ATOM   167 C  CA  . ASN A 1 22 ? 7.889  2.263   14.876  1.00 4.35  ? 22  ASN A CA  1 
ATOM   168 C  C   . ASN A 1 22 ? 7.738  0.777   14.632  1.00 3.64  ? 22  ASN A C   1 
ATOM   169 O  O   . ASN A 1 22 ? 7.069  0.353   13.697  1.00 5.33  ? 22  ASN A O   1 
ATOM   170 C  CB  . ASN A 1 22 ? 7.829  3.093   13.561  1.00 5.36  ? 22  ASN A CB  1 
ATOM   171 C  CG  . ASN A 1 22 ? 7.891  4.566   13.946  1.00 5.99  ? 22  ASN A CG  1 
ATOM   172 O  OD1 . ASN A 1 22 ? 6.922  5.068   14.560  1.00 7.98  ? 22  ASN A OD1 1 
ATOM   173 N  ND2 . ASN A 1 22 ? 8.986  5.243   13.652  1.00 6.19  ? 22  ASN A ND2 1 
ATOM   174 N  N   . GLY A 1 23 ? 8.310  -0.053  15.490  1.00 3.63  ? 23  GLY A N   1 
ATOM   175 C  CA  . GLY A 1 23 ? 8.087  -1.458  15.511  1.00 3.32  ? 23  GLY A CA  1 
ATOM   176 C  C   . GLY A 1 23 ? 8.945  -2.328  14.629  1.00 3.01  ? 23  GLY A C   1 
ATOM   177 O  O   . GLY A 1 23 ? 8.618  -3.480  14.389  1.00 3.85  ? 23  GLY A O   1 
ATOM   178 N  N   . ILE A 1 24 ? 10.107 -1.814  14.215  1.00 2.76  ? 24  ILE A N   1 
ATOM   179 C  CA  . ILE A 1 24 ? 10.995 -2.530  13.292  1.00 3.00  ? 24  ILE A CA  1 
ATOM   180 C  C   . ILE A 1 24 ? 12.363 -2.689  13.900  1.00 2.84  ? 24  ILE A C   1 
ATOM   181 O  O   . ILE A 1 24 ? 13.094 -1.716  14.168  1.00 3.53  ? 24  ILE A O   1 
ATOM   182 C  CB  . ILE A 1 24 ? 11.128 -1.753  11.947  1.00 3.20  ? 24  ILE A CB  1 
ATOM   183 C  CG1 . ILE A 1 24 ? 9.766  -1.430  11.341  1.00 4.19  ? 24  ILE A CG1 1 
ATOM   184 C  CG2 . ILE A 1 24 ? 12.075 -2.475  11.044  1.00 3.71  ? 24  ILE A CG2 1 
ATOM   185 C  CD1 . ILE A 1 24 ? 8.928  -2.660  10.964  1.00 4.55  ? 24  ILE A CD1 1 
ATOM   186 N  N   . SER A 1 25 ? 12.776 -3.930  14.148  1.00 3.30  ? 25  SER A N   1 
ATOM   187 C  CA  . SER A 1 25 ? 14.078 -4.197  14.724  1.00 2.82  ? 25  SER A CA  1 
ATOM   188 C  C   . SER A 1 25 ? 15.212 -3.929  13.770  1.00 3.01  ? 25  SER A C   1 
ATOM   189 O  O   . SER A 1 25 ? 15.105 -4.098  12.561  1.00 3.55  ? 25  SER A O   1 
ATOM   190 C  CB  . SER A 1 25 ? 14.128 -5.616  15.279  1.00 3.50  ? 25  SER A CB  1 
ATOM   191 O  OG  . SER A 1 25 ? 13.836 -6.588  14.245  1.00 3.72  ? 25  SER A OG  1 
ATOM   192 N  N   . PRO A 1 26 ? 16.392 -3.508  14.278  1.00 3.70  ? 26  PRO A N   1 
ATOM   193 C  CA  . PRO A 1 26 ? 17.577 -3.358  13.470  1.00 4.10  ? 26  PRO A CA  1 
ATOM   194 C  C   . PRO A 1 26 ? 17.865 -4.634  12.708  1.00 3.96  ? 26  PRO A C   1 
ATOM   195 O  O   . PRO A 1 26 ? 17.772 -5.751  13.228  1.00 4.59  ? 26  PRO A O   1 
ATOM   196 C  CB  . PRO A 1 26 ? 18.675 -3.037  14.499  1.00 4.83  ? 26  PRO A CB  1 
ATOM   197 C  CG  . PRO A 1 26 ? 17.957 -2.414  15.636  1.00 5.10  ? 26  PRO A CG  1 
ATOM   198 C  CD  . PRO A 1 26 ? 16.652 -3.149  15.709  1.00 4.57  ? 26  PRO A CD  1 
ATOM   199 N  N   . GLY A 1 27 ? 18.230 -4.501  11.422  1.00 4.53  ? 27  GLY A N   1 
ATOM   200 C  CA  . GLY A 1 27 ? 18.527 -5.642  10.577  1.00 5.29  ? 27  GLY A CA  1 
ATOM   201 C  C   . GLY A 1 27 ? 17.364 -6.121  9.737   1.00 5.57  ? 27  GLY A C   1 
ATOM   202 O  O   . GLY A 1 27 ? 17.503 -7.143  8.979   1.00 7.87  ? 27  GLY A O   1 
ATOM   203 N  N   . THR A 1 28 ? 16.272 -5.415  9.690   1.00 4.67  ? 28  THR A N   1 
ATOM   204 C  CA  . THR A 1 28 ? 15.106 -5.781  8.896   1.00 3.95  ? 28  THR A CA  1 
ATOM   205 C  C   . THR A 1 28 ? 15.260 -5.254  7.472   1.00 3.55  ? 28  THR A C   1 
ATOM   206 O  O   . THR A 1 28 ? 15.381 -4.034  7.245   1.00 3.84  ? 28  THR A O   1 
ATOM   207 C  CB  . THR A 1 28 ? 13.829 -5.236  9.554   1.00 4.28  ? 28  THR A CB  1 
ATOM   208 O  OG1 . THR A 1 28 ? 13.703 -5.780  10.884  1.00 5.67  ? 28  THR A OG1 1 
ATOM   209 C  CG2 . THR A 1 28 ? 12.603 -5.615  8.787   1.00 4.56  ? 28  THR A CG2 1 
ATOM   210 N  N   . LYS A 1 29 ? 15.208 -6.125  6.498   1.00 3.63  ? 29  LYS A N   1 
ATOM   211 C  CA  . LYS A 1 29 ? 15.262 -5.727  5.102   1.00 3.77  ? 29  LYS A CA  1 
ATOM   212 C  C   . LYS A 1 29 ? 14.058 -4.881  4.743   1.00 3.66  ? 29  LYS A C   1 
ATOM   213 O  O   . LYS A 1 29 ? 12.931 -5.153  5.196   1.00 3.65  ? 29  LYS A O   1 
ATOM   214 C  CB  . LYS A 1 29 ? 15.451 -6.898  4.193   1.00 5.19  ? 29  LYS A CB  1 
ATOM   215 C  CG  . LYS A 1 29 ? 16.775 -7.599  4.322   1.00 7.28  ? 29  LYS A CG  1 
ATOM   216 C  CD  . LYS A 1 29 ? 17.113 -8.643  3.325   1.00 9.04  ? 29  LYS A CD  1 
ATOM   217 C  CE  . LYS A 1 29 ? 18.414 -9.339  3.602   1.00 11.77 ? 29  LYS A CE  1 
ATOM   218 N  NZ  . LYS A 1 29 ? 18.896 -10.127 2.482   1.00 13.56 ? 29  LYS A NZ  1 
ATOM   219 N  N   . PHE A 1 30 ? 14.248 -3.942  3.811   1.00 3.35  ? 30  PHE A N   1 
ATOM   220 C  CA  . PHE A 1 30 ? 13.117 -3.147  3.378   1.00 3.37  ? 30  PHE A CA  1 
ATOM   221 C  C   . PHE A 1 30 ? 11.944 -3.974  2.888   1.00 3.80  ? 30  PHE A C   1 
ATOM   222 O  O   . PHE A 1 30 ? 10.781 -3.639  3.167   1.00 3.70  ? 30  PHE A O   1 
ATOM   223 C  CB  . PHE A 1 30 ? 13.583 -2.193  2.259   1.00 3.77  ? 30  PHE A CB  1 
ATOM   224 C  CG  . PHE A 1 30 ? 12.537 -1.193  1.815   1.00 3.55  ? 30  PHE A CG  1 
ATOM   225 C  CD1 . PHE A 1 30 ? 12.385 0.022   2.472   1.00 4.21  ? 30  PHE A CD1 1 
ATOM   226 C  CD2 . PHE A 1 30 ? 11.737 -1.448  0.720   1.00 4.14  ? 30  PHE A CD2 1 
ATOM   227 C  CE1 . PHE A 1 30 ? 11.405 0.875   2.103   1.00 5.18  ? 30  PHE A CE1 1 
ATOM   228 C  CE2 . PHE A 1 30 ? 10.748 -0.578  0.330   1.00 4.89  ? 30  PHE A CE2 1 
ATOM   229 C  CZ  . PHE A 1 30 ? 10.574 0.570   1.044   1.00 5.20  ? 30  PHE A CZ  1 
ATOM   230 N  N   . GLU A 1 31 ? 12.184 -5.031  2.126   1.00 4.29  ? 31  GLU A N   1 
ATOM   231 C  CA  . GLU A 1 31 ? 11.141 -5.892  1.652   1.00 5.59  ? 31  GLU A CA  1 
ATOM   232 C  C   . GLU A 1 31 ? 10.225 -6.388  2.751   1.00 4.96  ? 31  GLU A C   1 
ATOM   233 O  O   . GLU A 1 31 ? 9.036  -6.617  2.497   1.00 6.47  ? 31  GLU A O   1 
ATOM   234 C  CB  . GLU A 1 31 ? 11.692 -7.038  0.835   1.00 6.99  ? 31  GLU A CB  1 
ATOM   235 C  CG  . GLU A 1 31 ? 12.275 -6.670  -0.456  1.00 10.16 ? 31  GLU A CG  1 
ATOM   236 C  CD  . GLU A 1 31 ? 13.574 -5.899  -0.482  1.00 10.02 ? 31  GLU A CD  1 
ATOM   237 O  OE1 . GLU A 1 31 ? 14.385 -5.942  0.548   1.00 8.77  ? 31  GLU A OE1 1 
ATOM   238 O  OE2 . GLU A 1 31 ? 13.736 -5.294  -1.592  1.00 9.94  ? 31  GLU A OE2 1 
ATOM   239 N  N   . GLU A 1 32 ? 10.808 -6.640  3.921   1.00 5.18  ? 32  GLU A N   1 
ATOM   240 C  CA  . GLU A 1 32 ? 10.106 -7.217  5.049   1.00 6.11  ? 32  GLU A CA  1 
ATOM   241 C  C   . GLU A 1 32 ? 9.366  -6.214  5.894   1.00 5.57  ? 32  GLU A C   1 
ATOM   242 O  O   . GLU A 1 32 ? 8.598  -6.616  6.795   1.00 6.62  ? 32  GLU A O   1 
ATOM   243 C  CB  . GLU A 1 32 ? 11.011 -8.101  5.888   1.00 7.17  ? 32  GLU A CB  1 
ATOM   244 C  CG  . GLU A 1 32 ? 11.646 -9.279  5.136   1.00 13.19 ? 32  GLU A CG  1 
ATOM   245 C  CD  . GLU A 1 32 ? 10.655 -10.035 4.296   1.00 13.73 ? 32  GLU A CD  1 
ATOM   246 O  OE1 . GLU A 1 32 ? 9.542  -10.311 4.776   1.00 18.42 ? 32  GLU A OE1 1 
ATOM   247 O  OE2 . GLU A 1 32 ? 11.108 -10.523 3.244   1.00 21.99 ? 32  GLU A OE2 1 
ATOM   248 N  N   . LEU A 1 33 ? 9.539  -4.935  5.654   1.00 3.93  ? 33  LEU A N   1 
ATOM   249 C  CA  . LEU A 1 33 ? 8.723  -3.963  6.391   1.00 3.81  ? 33  LEU A CA  1 
ATOM   250 C  C   . LEU A 1 33 ? 7.250  -4.276  6.036   1.00 3.64  ? 33  LEU A C   1 
ATOM   251 O  O   . LEU A 1 33 ? 6.993  -4.558  4.872   1.00 4.14  ? 33  LEU A O   1 
ATOM   252 C  CB  . LEU A 1 33 ? 9.085  -2.538  5.902   1.00 4.14  ? 33  LEU A CB  1 
ATOM   253 C  CG  . LEU A 1 33 ? 10.510 -2.087  6.247   1.00 3.82  ? 33  LEU A CG  1 
ATOM   254 C  CD1 . LEU A 1 33 ? 10.856 -0.769  5.560   1.00 4.83  ? 33  LEU A CD1 1 
ATOM   255 C  CD2 . LEU A 1 33 ? 10.658 -1.959  7.768   1.00 7.59  ? 33  LEU A CD2 1 
ATOM   256 N  N   . PRO A 1 34 ? 6.351  -4.179  6.983   1.00 3.94  ? 34  PRO A N   1 
ATOM   257 C  CA  . PRO A 1 34 ? 4.908  -4.385  6.641   1.00 4.39  ? 34  PRO A CA  1 
ATOM   258 C  C   . PRO A 1 34 ? 4.480  -3.508  5.486   1.00 4.26  ? 34  PRO A C   1 
ATOM   259 O  O   . PRO A 1 34 ? 4.981  -2.407  5.283   1.00 3.83  ? 34  PRO A O   1 
ATOM   260 C  CB  . PRO A 1 34 ? 4.233  -3.977  7.943   1.00 6.12  ? 34  PRO A CB  1 
ATOM   261 C  CG  . PRO A 1 34 ? 5.211  -4.230  8.995   1.00 7.07  ? 34  PRO A CG  1 
ATOM   262 C  CD  . PRO A 1 34 ? 6.560  -3.923  8.400   1.00 5.04  ? 34  PRO A CD  1 
ATOM   263 N  N   . ASP A 1 35 ? 3.514  -4.002  4.693   1.00 4.46  ? 35  ASP A N   1 
ATOM   264 C  CA  . ASP A 1 35 ? 3.074  -3.295  3.551   1.00 5.44  ? 35  ASP A CA  1 
ATOM   265 C  C   . ASP A 1 35 ? 2.653  -1.841  3.847   1.00 4.96  ? 35  ASP A C   1 
ATOM   266 O  O   . ASP A 1 35 ? 2.765  -0.983  2.983   1.00 5.90  ? 35  ASP A O   1 
ATOM   267 C  CB  . ASP A 1 35 ? 1.931  -4.008  2.846   1.00 6.18  ? 35  ASP A CB  1 
ATOM   268 C  CG  . ASP A 1 35 ? 2.296  -5.321  2.191   1.00 7.65  ? 35  ASP A CG  1 
ATOM   269 O  OD1 . ASP A 1 35 ? 3.495  -5.656  2.041   1.00 7.99  ? 35  ASP A OD1 1 
ATOM   270 O  OD2 . ASP A 1 35 ? 1.327  -6.035  1.827   1.00 9.40  ? 35  ASP A OD2 1 
ATOM   271 N  N   . ASP A 1 36 ? 2.074  -1.616  5.023   1.00 4.50  ? 36  ASP A N   1 
ATOM   272 C  CA  . ASP A 1 36 ? 1.574  -0.387  5.527   1.00 5.11  ? 36  ASP A CA  1 
ATOM   273 C  C   . ASP A 1 36 ? 2.553  0.406   6.372   1.00 4.64  ? 36  ASP A C   1 
ATOM   274 O  O   . ASP A 1 36 ? 2.199  1.451   6.907   1.00 5.34  ? 36  ASP A O   1 
ATOM   275 C  CB  . ASP A 1 36 ? 0.212  -0.465  6.162   1.00 6.86  ? 36  ASP A CB  1 
ATOM   276 C  CG  . ASP A 1 36 ? 0.169  -1.336  7.371   1.00 9.16  ? 36  ASP A CG  1 
ATOM   277 O  OD1 . ASP A 1 36 ? 1.178  -2.021  7.639   1.00 8.64  ? 36  ASP A OD1 1 
ATOM   278 O  OD2 . ASP A 1 36 ? -0.878 -1.334  8.071   1.00 11.72 ? 36  ASP A OD2 1 
ATOM   279 N  N   . TRP A 1 37 ? 3.798  -0.020  6.436   1.00 4.44  ? 37  TRP A N   1 
ATOM   280 C  CA  . TRP A 1 37 ? 4.860  0.808   7.049   1.00 3.68  ? 37  TRP A CA  1 
ATOM   281 C  C   . TRP A 1 37 ? 5.032  2.052   6.206   1.00 3.09  ? 37  TRP A C   1 
ATOM   282 O  O   . TRP A 1 37 ? 4.931  2.011   5.003   1.00 4.07  ? 37  TRP A O   1 
ATOM   283 C  CB  . TRP A 1 37 ? 6.150  -0.001  7.149   1.00 3.69  ? 37  TRP A CB  1 
ATOM   284 C  CG  . TRP A 1 37 ? 7.317  0.766   7.681   1.00 3.57  ? 37  TRP A CG  1 
ATOM   285 C  CD1 . TRP A 1 37 ? 7.768  0.734   8.982   1.00 3.65  ? 37  TRP A CD1 1 
ATOM   286 C  CD2 . TRP A 1 37 ? 8.215  1.617   6.994   1.00 3.73  ? 37  TRP A CD2 1 
ATOM   287 N  NE1 . TRP A 1 37 ? 8.896  1.532   9.118   1.00 3.98  ? 37  TRP A NE1 1 
ATOM   288 C  CE2 . TRP A 1 37 ? 9.187  2.061   7.896   1.00 3.73  ? 37  TRP A CE2 1 
ATOM   289 C  CE3 . TRP A 1 37 ? 8.319  2.027   5.639   1.00 3.78  ? 37  TRP A CE3 1 
ATOM   290 C  CZ2 . TRP A 1 37 ? 10.240 2.931   7.536   1.00 3.88  ? 37  TRP A CZ2 1 
ATOM   291 C  CZ3 . TRP A 1 37 ? 9.358  2.853   5.292   1.00 4.00  ? 37  TRP A CZ3 1 
ATOM   292 C  CH2 . TRP A 1 37 ? 10.308 3.297   6.238   1.00 4.03  ? 37  TRP A CH2 1 
ATOM   293 N  N   . VAL A 1 38 ? 5.270  3.185   6.882   1.00 2.88  ? 38  VAL A N   1 
ATOM   294 C  CA  . VAL A 1 38 ? 5.473  4.448   6.200   1.00 3.57  ? 38  VAL A CA  1 
ATOM   295 C  C   . VAL A 1 38 ? 6.750  5.130   6.648   1.00 3.48  ? 38  VAL A C   1 
ATOM   296 O  O   . VAL A 1 38 ? 7.242  4.891   7.767   1.00 3.30  ? 38  VAL A O   1 
ATOM   297 C  CB  . VAL A 1 38 ? 4.286  5.394   6.306   1.00 4.43  ? 38  VAL A CB  1 
ATOM   298 C  CG1 . VAL A 1 38 ? 3.017  4.799   5.695   1.00 5.23  ? 38  VAL A CG1 1 
ATOM   299 C  CG2 . VAL A 1 38 ? 4.031  5.795   7.745   1.00 5.51  ? 38  VAL A CG2 1 
ATOM   300 N  N   . CYS A 1 39 ? 7.214  6.059   5.822   1.00 3.08  ? 39  CYS A N   1 
ATOM   301 C  CA  . CYS A 1 39 ? 8.351  6.911   6.228   1.00 3.01  ? 39  CYS A CA  1 
ATOM   302 C  C   . CYS A 1 39 ? 8.015  7.538   7.573   1.00 2.69  ? 39  CYS A C   1 
ATOM   303 O  O   . CYS A 1 39 ? 6.957  8.180   7.696   1.00 2.90  ? 39  CYS A O   1 
ATOM   304 C  CB  . CYS A 1 39 ? 8.518  8.006   5.167   1.00 2.63  ? 39  CYS A CB  1 
ATOM   305 S  SG  . CYS A 1 39 ? 9.909  9.101   5.614   1.00 3.02  ? 39  CYS A SG  1 
ATOM   306 N  N   . PRO A 1 40 ? 8.872  7.421   8.563   1.00 3.42  ? 40  PRO A N   1 
ATOM   307 C  CA  . PRO A 1 40 ? 8.561  7.954   9.916   1.00 3.79  ? 40  PRO A CA  1 
ATOM   308 C  C   . PRO A 1 40 ? 8.613  9.480   9.954   1.00 3.62  ? 40  PRO A C   1 
ATOM   309 O  O   . PRO A 1 40 ? 8.148  10.060  10.929  1.00 5.67  ? 40  PRO A O   1 
ATOM   310 C  CB  . PRO A 1 40 ? 9.655  7.382   10.800  1.00 4.40  ? 40  PRO A CB  1 
ATOM   311 C  CG  . PRO A 1 40 ? 10.750 7.051   9.885   1.00 5.10  ? 40  PRO A CG  1 
ATOM   312 C  CD  . PRO A 1 40 ? 10.139 6.613   8.599   1.00 3.49  ? 40  PRO A CD  1 
ATOM   313 N  N   . ILE A 1 41 ? 9.158  10.104  8.922   1.00 3.58  ? 41  ILE A N   1 
ATOM   314 C  CA  . ILE A 1 41 ? 9.257  11.549  8.867   1.00 3.55  ? 41  ILE A CA  1 
ATOM   315 C  C   . ILE A 1 41 ? 8.095  12.177  8.150   1.00 3.59  ? 41  ILE A C   1 
ATOM   316 O  O   . ILE A 1 41 ? 7.399  13.021  8.678   1.00 4.62  ? 41  ILE A O   1 
ATOM   317 C  CB  . ILE A 1 41 ? 10.614 11.965  8.241   1.00 3.97  ? 41  ILE A CB  1 
ATOM   318 C  CG1 . ILE A 1 41 ? 11.762 11.284  8.954   1.00 4.60  ? 41  ILE A CG1 1 
ATOM   319 C  CG2 . ILE A 1 41 ? 10.737 13.460  8.152   1.00 5.47  ? 41  ILE A CG2 1 
ATOM   320 C  CD1 . ILE A 1 41 ? 11.735 11.381  10.447  1.00 7.33  ? 41  ILE A CD1 1 
ATOM   321 N  N   . CYS A 1 42 ? 7.817  11.737  6.928   1.00 3.39  ? 42  CYS A N   1 
ATOM   322 C  CA  . CYS A 1 42 ? 6.813  12.362  6.092   1.00 2.32  ? 42  CYS A CA  1 
ATOM   323 C  C   . CYS A 1 42 ? 5.546  11.599  5.836   1.00 2.80  ? 42  CYS A C   1 
ATOM   324 O  O   . CYS A 1 42 ? 4.605  12.109  5.233   1.00 3.24  ? 42  CYS A O   1 
ATOM   325 C  CB  . CYS A 1 42 ? 7.416  12.822  4.772   1.00 3.36  ? 42  CYS A CB  1 
ATOM   326 S  SG  . CYS A 1 42 ? 7.709  11.447  3.585   1.00 3.47  ? 42  CYS A SG  1 
ATOM   327 N  N   . GLY A 1 43 ? 5.529  10.292  6.224   1.00 2.45  ? 43  GLY A N   1 
ATOM   328 C  CA  . GLY A 1 43 ? 4.397  9.433   6.041   1.00 3.04  ? 43  GLY A CA  1 
ATOM   329 C  C   . GLY A 1 43 ? 4.241  8.817   4.697   1.00 3.00  ? 43  GLY A C   1 
ATOM   330 O  O   . GLY A 1 43 ? 3.225  8.146   4.401   1.00 4.16  ? 43  GLY A O   1 
ATOM   331 N  N   . ALA A 1 44 ? 5.237  8.944   3.824   1.00 3.45  ? 44  ALA A N   1 
ATOM   332 C  CA  . ALA A 1 44 ? 5.165  8.344   2.481   1.00 3.40  ? 44  ALA A CA  1 
ATOM   333 C  C   . ALA A 1 44 ? 5.111  6.836   2.552   1.00 3.56  ? 44  ALA A C   1 
ATOM   334 O  O   . ALA A 1 44 ? 5.790  6.203   3.365   1.00 3.89  ? 44  ALA A O   1 
ATOM   335 C  CB  . ALA A 1 44 ? 6.378  8.747   1.654   1.00 3.81  ? 44  ALA A CB  1 
ATOM   336 N  N   . PRO A 1 45 ? 4.346  6.215   1.643   1.00 3.69  ? 45  PRO A N   1 
ATOM   337 C  CA  . PRO A 1 45 ? 4.298  4.754   1.585   1.00 4.02  ? 45  PRO A CA  1 
ATOM   338 C  C   . PRO A 1 45 ? 5.576  4.171   1.101   1.00 3.00  ? 45  PRO A C   1 
ATOM   339 O  O   . PRO A 1 45 ? 6.468  4.880   0.549   1.00 3.12  ? 45  PRO A O   1 
ATOM   340 C  CB  . PRO A 1 45 ? 3.135  4.457   0.624   1.00 5.15  ? 45  PRO A CB  1 
ATOM   341 C  CG  . PRO A 1 45 ? 2.917  5.686   -0.103  1.00 6.41  ? 45  PRO A CG  1 
ATOM   342 C  CD  . PRO A 1 45 ? 3.406  6.842   0.655   1.00 4.15  ? 45  PRO A CD  1 
ATOM   343 N  N   . LYS A 1 46 ? 5.703  2.864   1.229   1.00 3.28  ? 46  LYS A N   1 
ATOM   344 C  CA  . LYS A 1 46 ? 6.895  2.104   0.797   1.00 3.02  ? 46  LYS A CA  1 
ATOM   345 C  C   . LYS A 1 46 ? 7.219  2.359   -0.674  1.00 2.50  ? 46  LYS A C   1 
ATOM   346 O  O   . LYS A 1 46 ? 8.424  2.345   -1.040  1.00 3.32  ? 46  LYS A O   1 
ATOM   347 C  CB  . LYS A 1 46 ? 6.750  0.631   1.070   1.00 3.23  ? 46  LYS A CB  1 
ATOM   348 C  CG  . LYS A 1 46 ? 6.844  0.191   2.518   1.00 3.73  ? 46  LYS A CG  1 
ATOM   349 C  CD  . LYS A 1 46 ? 6.778  -1.324  2.669   1.00 3.62  ? 46  LYS A CD  1 
ATOM   350 C  CE  . LYS A 1 46 ? 8.029  -2.038  2.193   1.00 3.55  ? 46  LYS A CE  1 
ATOM   351 N  NZ  . LYS A 1 46 ? 7.937  -3.508  2.407   1.00 4.28  ? 46  LYS A NZ  1 
ATOM   352 N  N   . SER A 1 47 ? 6.241  2.566   -1.496  1.00 2.60  ? 47  SER A N   1 
ATOM   353 C  CA  . SER A 1 47 ? 6.435  2.815   -2.916  1.00 2.57  ? 47  SER A CA  1 
ATOM   354 C  C   . SER A 1 47 ? 7.389  3.948   -3.192  1.00 2.64  ? 47  SER A C   1 
ATOM   355 O  O   . SER A 1 47 ? 7.967  3.997   -4.275  1.00 3.05  ? 47  SER A O   1 
ATOM   356 C  CB  . SER A 1 47 ? 5.101  3.095   -3.616  1.00 3.25  ? 47  SER A CB  1 
ATOM   357 O  OG  . SER A 1 47 ? 4.481  4.294   -3.165  1.00 3.54  ? 47  SER A OG  1 
ATOM   358 N  N   . GLU A 1 48 ? 7.481  4.933   -2.272  1.00 2.79  ? 48  GLU A N   1 
ATOM   359 C  CA  . GLU A 1 48 ? 8.221  6.151   -2.488  1.00 3.20  ? 48  GLU A CA  1 
ATOM   360 C  C   . GLU A 1 48 ? 9.676  6.047   -2.095  1.00 2.89  ? 48  GLU A C   1 
ATOM   361 O  O   . GLU A 1 48 ? 10.378 7.082   -2.151  1.00 3.92  ? 48  GLU A O   1 
ATOM   362 C  CB  . GLU A 1 48 ? 7.533  7.364   -1.863  1.00 3.74  ? 48  GLU A CB  1 
ATOM   363 C  CG  . GLU A 1 48 ? 6.066  7.505   -2.237  1.00 3.93  ? 48  GLU A CG  1 
ATOM   364 C  CD  . GLU A 1 48 ? 5.870  7.509   -3.737  1.00 3.85  ? 48  GLU A CD  1 
ATOM   365 O  OE1 . GLU A 1 48 ? 6.135  8.569   -4.357  1.00 5.88  ? 48  GLU A OE1 1 
ATOM   366 O  OE2 . GLU A 1 48 ? 5.533  6.437   -4.316  1.00 4.39  ? 48  GLU A OE2 1 
ATOM   367 N  N   . PHE A 1 49 ? 10.156 4.875   -1.748  1.00 2.54  ? 49  PHE A N   1 
ATOM   368 C  CA  . PHE A 1 49 ? 11.543 4.634   -1.421  1.00 3.16  ? 49  PHE A CA  1 
ATOM   369 C  C   . PHE A 1 49 ? 12.287 4.035   -2.598  1.00 3.23  ? 49  PHE A C   1 
ATOM   370 O  O   . PHE A 1 49 ? 11.739 3.260   -3.399  1.00 4.57  ? 49  PHE A O   1 
ATOM   371 C  CB  . PHE A 1 49 ? 11.623 3.646   -0.221  1.00 3.07  ? 49  PHE A CB  1 
ATOM   372 C  CG  . PHE A 1 49 ? 11.333 4.340   1.105   1.00 2.65  ? 49  PHE A CG  1 
ATOM   373 C  CD1 . PHE A 1 49 ? 10.072 4.713   1.442   1.00 2.91  ? 49  PHE A CD1 1 
ATOM   374 C  CD2 . PHE A 1 49 ? 12.383 4.683   1.940   1.00 2.86  ? 49  PHE A CD2 1 
ATOM   375 C  CE1 . PHE A 1 49 ? 9.830  5.384   2.660   1.00 3.94  ? 49  PHE A CE1 1 
ATOM   376 C  CE2 . PHE A 1 49 ? 12.152 5.386   3.132   1.00 3.21  ? 49  PHE A CE2 1 
ATOM   377 C  CZ  . PHE A 1 49 ? 10.853 5.721   3.494   1.00 3.61  ? 49  PHE A CZ  1 
ATOM   378 N  N   . GLU A 1 50 ? 13.551 4.425   -2.712  1.00 3.92  ? 50  GLU A N   1 
ATOM   379 C  CA  . GLU A 1 50 ? 14.456 3.932   -3.734  1.00 4.54  ? 50  GLU A CA  1 
ATOM   380 C  C   . GLU A 1 50 ? 15.705 3.332   -3.085  1.00 3.90  ? 50  GLU A C   1 
ATOM   381 O  O   . GLU A 1 50 ? 16.324 3.932   -2.186  1.00 3.73  ? 50  GLU A O   1 
ATOM   382 C  CB  . GLU A 1 50 ? 14.817 5.078   -4.679  1.00 7.54  ? 50  GLU A CB  1 
ATOM   383 C  CG  . GLU A 1 50 ? 15.826 4.837   -5.723  1.00 8.27  ? 50  GLU A CG  1 
ATOM   384 C  CD  . GLU A 1 50 ? 15.992 6.076   -6.586  1.00 14.84 ? 50  GLU A CD  1 
ATOM   385 O  OE1 . GLU A 1 50 ? 14.931 6.543   -7.140  1.00 16.22 ? 50  GLU A OE1 1 
ATOM   386 O  OE2 . GLU A 1 50 ? 17.087 6.654   -6.632  1.00 19.67 ? 50  GLU A OE2 1 
ATOM   387 N  N   . LYS A 1 51 ? 16.117 2.169   -3.515  1.00 3.50  ? 51  LYS A N   1 
ATOM   388 C  CA  . LYS A 1 51 ? 17.296 1.484   -2.981  1.00 3.20  ? 51  LYS A CA  1 
ATOM   389 C  C   . LYS A 1 51 ? 18.556 2.208   -3.407  1.00 3.21  ? 51  LYS A C   1 
ATOM   390 O  O   . LYS A 1 51 ? 18.731 2.478   -4.607  1.00 3.87  ? 51  LYS A O   1 
ATOM   391 C  CB  . LYS A 1 51 ? 17.290 0.024   -3.392  1.00 4.07  ? 51  LYS A CB  1 
ATOM   392 C  CG  . LYS A 1 51 ? 18.273 -0.846  -2.626  1.00 4.72  ? 51  LYS A CG  1 
ATOM   393 C  CD  . LYS A 1 51 ? 18.124 -2.327  -2.987  1.00 6.15  ? 51  LYS A CD  1 
ATOM   394 C  CE  . LYS A 1 51 ? 18.921 -3.203  -2.012  1.00 6.45  ? 51  LYS A CE  1 
ATOM   395 N  NZ  . LYS A 1 51 ? 18.729 -4.648  -2.294  1.00 8.89  ? 51  LYS A NZ  1 
ATOM   396 N  N   . LEU A 1 52 ? 19.453 2.498   -2.491  1.00 3.24  ? 52  LEU A N   1 
ATOM   397 C  CA  . LEU A 1 52 ? 20.672 3.238   -2.795  1.00 3.64  ? 52  LEU A CA  1 
ATOM   398 C  C   . LEU A 1 52 ? 21.802 2.282   -3.225  1.00 3.80  ? 52  LEU A C   1 
ATOM   399 O  O   . LEU A 1 52 ? 22.697 1.969   -2.518  1.00 3.92  ? 52  LEU A O   1 
ATOM   400 C  CB  . LEU A 1 52 ? 21.099 4.109   -1.611  1.00 3.27  ? 52  LEU A CB  1 
ATOM   401 C  CG  . LEU A 1 52 ? 20.090 5.157   -1.218  1.00 4.06  ? 52  LEU A CG  1 
ATOM   402 C  CD1 . LEU A 1 52 ? 20.564 5.942   -0.029  1.00 4.62  ? 52  LEU A CD1 1 
ATOM   403 C  CD2 . LEU A 1 52 ? 19.676 6.060   -2.372  1.00 4.42  ? 52  LEU A CD2 1 
ATOM   404 N  N   . GLU A 1 53 ? 21.673 1.905   -4.488  1.00 4.84  ? 53  GLU A N   1 
ATOM   405 C  CA  . GLU A 1 53 ? 22.652 1.078   -5.154  1.00 6.43  ? 53  GLU A CA  1 
ATOM   406 C  C   . GLU A 1 53 ? 22.490 1.273   -6.673  1.00 8.11  ? 53  GLU A C   1 
ATOM   407 O  O   . GLU A 1 53 ? 21.427 1.658   -7.147  1.00 13.06 ? 53  GLU A O   1 
ATOM   408 C  CB  . GLU A 1 53 ? 22.508 -0.384  -4.844  1.00 9.66  ? 53  GLU A CB  1 
ATOM   409 C  CG  . GLU A 1 53 ? 21.246 -0.945  -5.476  1.00 12.20 ? 53  GLU A CG  1 
ATOM   410 C  CD  . GLU A 1 53 ? 21.022 -2.357  -5.127  1.00 14.41 ? 53  GLU A CD  1 
ATOM   411 O  OE1 . GLU A 1 53 ? 21.569 -2.875  -4.090  1.00 15.64 ? 53  GLU A OE1 1 
ATOM   412 O  OE2 . GLU A 1 53 ? 20.270 -3.054  -5.868  1.00 15.56 ? 53  GLU A OE2 1 
ATOM   413 N  N   . ASP A 1 54 ? 23.549 0.985   -7.367  1.00 7.96  ? 54  ASP A N   1 
ATOM   414 C  CA  . ASP A 1 54 ? 23.513 0.945   -8.781  1.00 10.61 ? 54  ASP A CA  1 
ATOM   415 C  C   . ASP A 1 54 ? 22.686 -0.309  -9.224  1.00 11.06 ? 54  ASP A C   1 
ATOM   416 O  O   . ASP A 1 54 ? 22.958 -1.323  -8.594  1.00 19.94 ? 54  ASP A O   1 
ATOM   417 C  CB  . ASP A 1 54 ? 24.859 0.940   -9.415  1.00 8.43  ? 54  ASP A CB  1 
ATOM   418 C  CG  . ASP A 1 54 ? 24.789 0.838   -10.928 1.00 9.05  ? 54  ASP A CG  1 
ATOM   419 O  OD1 . ASP A 1 54 ? 24.259 1.838   -11.519 1.00 11.58 ? 54  ASP A OD1 1 
ATOM   420 O  OD2 . ASP A 1 54 ? 25.242 -0.140  -11.488 1.00 9.36  ? 54  ASP A OD2 1 
ATOM   421 O  OXT . ASP A 1 54 ? 21.925 -0.080  -10.153 1.00 17.59 ? 54  ASP A OXT 1 
HETATM 422 FE FE  . FE  B 2 .  ? 9.794  10.608  3.873   1.00 2.90  ? 55  FE  A FE  1 
HETATM 423 O  O   . HOH C 3 .  ? 22.525 0.367   -0.168  1.00 7.92  ? 101 HOH A O   1 
HETATM 424 O  O   . HOH C 3 .  ? 3.403  1.736   2.869   1.00 4.83  ? 102 HOH A O   1 
HETATM 425 O  O   . HOH C 3 .  ? 18.065 7.114   9.034   1.00 5.38  ? 103 HOH A O   1 
HETATM 426 O  O   . HOH C 3 .  ? 27.163 -1.733  -10.699 1.00 7.45  ? 104 HOH A O   1 
HETATM 427 O  O   . HOH C 3 .  ? 16.504 3.523   9.343   1.00 3.92  ? 105 HOH A O   1 
HETATM 428 O  O   . HOH C 3 .  ? 5.309  2.911   9.920   1.00 9.41  ? 106 HOH A O   1 
HETATM 429 O  O   . HOH C 3 .  ? 5.079  8.927   9.538   1.00 12.57 ? 107 HOH A O   1 
HETATM 430 O  O   . HOH C 3 .  ? 7.687  4.397   10.389  1.00 5.63  ? 108 HOH A O   1 
HETATM 431 O  O   . HOH C 3 .  ? 5.883  6.145   11.561  1.00 11.72 ? 109 HOH A O   1 
HETATM 432 O  O   . HOH C 3 .  ? 17.872 5.733   11.385  1.00 9.93  ? 110 HOH A O   1 
HETATM 433 O  O   . HOH C 3 .  ? 15.879 4.148   12.675  1.00 8.51  ? 111 HOH A O   1 
HETATM 434 O  O   . HOH C 3 .  ? 12.999 4.254   15.070  1.00 5.69  ? 112 HOH A O   1 
HETATM 435 O  O   . HOH C 3 .  ? 18.223 2.119   15.148  1.00 7.60  ? 113 HOH A O   1 
HETATM 436 O  O   . HOH C 3 .  ? 6.072  1.474   18.013  1.00 7.29  ? 114 HOH A O   1 
HETATM 437 O  O   . HOH C 3 .  ? 9.355  1.562   20.195  1.00 6.24  ? 115 HOH A O   1 
HETATM 438 O  O   . HOH C 3 .  ? 11.830 2.668   20.737  1.00 8.13  ? 116 HOH A O   1 
HETATM 439 O  O   . HOH C 3 .  ? 7.865  3.837   21.003  1.00 7.16  ? 117 HOH A O   1 
HETATM 440 O  O   . HOH C 3 .  ? 5.802  -4.561  0.951   1.00 8.40  ? 118 HOH A O   1 
HETATM 441 O  O   . HOH C 3 .  ? 2.469  -6.584  5.337   1.00 11.96 ? 119 HOH A O   1 
HETATM 442 O  O   . HOH C 3 .  ? 16.158 -7.821  13.733  1.00 3.72  ? 120 HOH A O   1 
HETATM 443 O  O   . HOH C 3 .  ? 22.146 -0.808  14.465  1.00 5.22  ? 121 HOH A O   1 
HETATM 444 O  O   . HOH C 3 .  ? 11.805 -8.395  14.678  1.00 6.44  ? 122 HOH A O   1 
HETATM 445 O  O   . HOH C 3 .  ? 9.120  16.310  5.902   1.00 10.75 ? 123 HOH A O   1 
HETATM 446 O  O   . HOH C 3 .  ? 12.913 16.679  4.634   1.00 5.39  ? 124 HOH A O   1 
HETATM 447 O  O   . HOH C 3 .  ? 9.954  1.068   -2.988  1.00 5.42  ? 125 HOH A O   1 
HETATM 448 O  O   . HOH C 3 .  ? 18.687 13.234  3.189   1.00 5.16  ? 126 HOH A O   1 
HETATM 449 O  O   . HOH C 3 .  ? 16.371 17.183  2.052   1.00 10.50 ? 127 HOH A O   1 
HETATM 450 O  O   . HOH C 3 .  ? 17.858 15.058  1.462   1.00 6.31  ? 128 HOH A O   1 
HETATM 451 O  O   . HOH C 3 .  ? 20.484 15.953  1.037   1.00 4.60  ? 129 HOH A O   1 
HETATM 452 O  O   . HOH C 3 .  ? 16.999 -4.989  0.489   1.00 7.20  ? 130 HOH A O   1 
HETATM 453 O  O   . HOH C 3 .  ? 11.385 -3.908  -2.157  1.00 9.24  ? 131 HOH A O   1 
HETATM 454 O  O   . HOH C 3 .  ? -0.428 3.284   0.664   1.00 14.96 ? 132 HOH A O   1 
HETATM 455 O  O   . HOH C 3 .  ? 13.585 5.624   11.850  1.00 5.84  ? 133 HOH A O   1 
HETATM 456 O  O   . HOH C 3 .  ? 20.427 5.247   12.206  1.00 7.24  ? 134 HOH A O   1 
HETATM 457 O  O   . HOH C 3 .  ? 18.847 0.998   17.534  1.00 8.06  ? 135 HOH A O   1 
HETATM 458 O  O   . HOH C 3 .  ? 13.753 1.131   21.856  1.00 6.34  ? 136 HOH A O   1 
HETATM 459 O  O   . HOH C 3 .  ? 5.650  -6.733  3.680   1.00 9.87  ? 137 HOH A O   1 
HETATM 460 O  O   . HOH C 3 .  ? -1.736 5.252   1.279   1.00 17.25 ? 138 HOH A O   1 
HETATM 461 O  O   . HOH C 3 .  ? 10.166 14.205  -4.252  1.00 11.48 ? 139 HOH A O   1 
HETATM 462 O  O   . HOH C 3 .  ? 19.342 4.636   -6.959  1.00 14.39 ? 140 HOH A O   1 
HETATM 463 O  O   . HOH C 3 .  ? 20.674 7.101   8.529   1.00 8.12  ? 141 HOH A O   1 
HETATM 464 O  O   . HOH C 3 .  ? 14.541 0.938   -5.711  1.00 9.38  ? 142 HOH A O   1 
HETATM 465 O  O   . HOH C 3 .  ? 2.355  -1.524  10.120  1.00 13.21 ? 143 HOH A O   1 
HETATM 466 O  O   . HOH C 3 .  ? 14.973 -8.600  0.382   1.00 14.93 ? 144 HOH A O   1 
HETATM 467 O  O   . HOH C 3 .  ? 0.075  5.903   7.633   1.00 19.31 ? 145 HOH A O   1 
HETATM 468 O  O   . HOH C 3 .  ? 15.904 -5.124  -3.048  1.00 11.50 ? 146 HOH A O   1 
HETATM 469 O  O   . HOH C 3 .  ? 5.798  -1.836  12.503  1.00 10.35 ? 147 HOH A O   1 
HETATM 470 O  O   . HOH C 3 .  ? 13.863 16.664  0.689   1.00 19.89 ? 148 HOH A O   1 
HETATM 471 O  O   . HOH C 3 .  ? 16.949 -9.663  8.207   1.00 15.96 ? 149 HOH A O   1 
HETATM 472 O  O   . HOH C 3 .  ? 16.657 4.220   15.296  1.00 16.80 ? 150 HOH A O   1 
HETATM 473 O  O   . HOH C 3 .  ? 3.992  1.377   16.171  1.00 11.78 ? 151 HOH A O   1 
HETATM 474 O  O   . HOH C 3 .  ? 21.946 5.082   9.902   1.00 8.32  ? 152 HOH A O   1 
HETATM 475 O  O   . HOH C 3 .  ? 6.286  -4.776  12.702  1.00 12.40 ? 153 HOH A O   1 
HETATM 476 O  O   . HOH C 3 .  ? -3.005 4.704   4.611   1.00 12.93 ? 154 HOH A O   1 
HETATM 477 O  O   . HOH C 3 .  ? 10.193 -9.289  9.706   1.00 22.38 ? 155 HOH A O   1 
HETATM 478 O  O   . HOH C 3 .  ? 4.262  1.649   13.438  1.00 18.36 ? 156 HOH A O   1 
HETATM 479 O  O   . HOH C 3 .  ? 21.724 4.461   16.605  1.00 23.21 ? 157 HOH A O   1 
HETATM 480 O  O   . HOH C 3 .  ? 13.763 14.830  -1.239  1.00 16.61 ? 158 HOH A O   1 
HETATM 481 O  O   . HOH C 3 .  ? 9.296  6.081   20.587  1.00 17.31 ? 159 HOH A O   1 
HETATM 482 O  O   . HOH C 3 .  ? 0.493  -4.427  8.564   1.00 18.28 ? 160 HOH A O   1 
HETATM 483 O  O   . HOH C 3 .  ? 4.184  4.694   13.534  1.00 12.36 ? 161 HOH A O   1 
HETATM 484 O  O   . HOH C 3 .  ? 5.929  7.691   14.039  1.00 19.46 ? 162 HOH A O   1 
HETATM 485 O  O   . HOH C 3 .  ? 24.815 3.484   8.231   1.00 12.99 ? 163 HOH A O   1 
HETATM 486 O  O   . HOH C 3 .  ? 8.536  15.979  3.044   1.00 8.33  ? 164 HOH A O   1 
HETATM 487 O  O   . HOH C 3 .  ? 24.421 6.186   10.044  1.00 9.25  ? 165 HOH A O   1 
HETATM 488 O  O   . HOH C 3 .  ? 14.674 -10.927 5.033   1.00 16.23 ? 166 HOH A O   1 
HETATM 489 O  O   . HOH C 3 .  ? 19.175 -5.149  -4.968  1.00 18.59 ? 167 HOH A O   1 
HETATM 490 O  O   . HOH C 3 .  ? 6.282  12.861  14.292  1.00 22.11 ? 168 HOH A O   1 
HETATM 491 O  O   . HOH C 3 .  ? 10.691 11.622  -7.640  1.00 22.00 ? 169 HOH A O   1 
HETATM 492 O  O   . HOH C 3 .  ? 9.665  20.362  -3.498  1.00 23.78 ? 170 HOH A O   1 
HETATM 493 O  O   . HOH C 3 .  ? 5.044  10.858  11.480  1.00 21.16 ? 171 HOH A O   1 
HETATM 494 O  O   . HOH C 3 .  ? 5.333  -9.039  4.698   1.00 18.07 ? 172 HOH A O   1 
HETATM 495 O  O   . HOH C 3 .  ? 14.579 6.687   15.164  1.00 23.10 ? 173 HOH A O   1 
HETATM 496 O  O   . HOH C 3 .  ? 22.247 -7.208  2.858   1.00 28.75 ? 174 HOH A O   1 
HETATM 497 O  O   . HOH C 3 .  ? 18.619 2.833   -11.354 1.00 25.87 ? 175 HOH A O   1 
HETATM 498 O  O   . HOH C 3 .  ? 2.285  -3.442  12.437  1.00 31.37 ? 176 HOH A O   1 
HETATM 499 O  O   . HOH C 3 .  ? 20.078 2.992   19.106  1.00 20.51 ? 177 HOH A O   1 
HETATM 500 O  O   . HOH C 3 .  ? 20.666 3.437   14.411  1.00 12.83 ? 178 HOH A O   1 
HETATM 501 O  O   . HOH C 3 .  ? 9.993  7.968   14.498  1.00 12.94 ? 179 HOH A O   1 
HETATM 502 O  O   . HOH C 3 .  ? 8.039  17.612  -0.954  1.00 14.86 ? 180 HOH A O   1 
HETATM 503 O  O   . HOH C 3 .  ? 9.699  16.068  -2.511  1.00 15.91 ? 181 HOH A O   1 
HETATM 504 O  O   . HOH C 3 .  ? 23.049 -9.059  4.593   1.00 20.06 ? 182 HOH A O   1 
HETATM 505 O  O   . HOH C 3 .  ? 11.838 17.652  2.302   1.00 20.40 ? 183 HOH A O   1 
HETATM 506 O  O   . HOH C 3 .  ? 15.051 -3.566  -5.166  1.00 16.34 ? 184 HOH A O   1 
HETATM 507 O  O   . HOH C 3 .  ? 13.085 11.630  -6.758  1.00 43.69 ? 185 HOH A O   1 
HETATM 508 O  O   . HOH C 3 .  ? 8.205  20.383  -1.523  1.00 25.87 ? 186 HOH A O   1 
HETATM 509 O  O   . HOH C 3 .  ? -0.861 0.130   2.533   1.00 32.86 ? 187 HOH A O   1 
HETATM 510 O  O   . HOH C 3 .  ? 4.173  -8.172  1.359   1.00 33.83 ? 188 HOH A O   1 
HETATM 511 O  O   . HOH C 3 .  ? 3.310  4.412   11.134  1.00 21.65 ? 189 HOH A O   1 
HETATM 512 O  O   . HOH C 3 .  ? 12.883 -7.148  -3.733  1.00 28.36 ? 190 HOH A O   1 
HETATM 513 O  O   . HOH C 3 .  ? 7.838  7.488   18.448  1.00 24.78 ? 191 HOH A O   1 
HETATM 514 O  O   . HOH C 3 .  ? 1.973  2.595   9.760   1.00 30.57 ? 192 HOH A O   1 
HETATM 515 O  O   . HOH C 3 .  ? 20.343 -2.924  -8.265  1.00 47.48 ? 193 HOH A O   1 
HETATM 516 O  O   . HOH C 3 .  ? -0.249 -3.703  12.577  1.00 25.57 ? 194 HOH A O   1 
HETATM 517 O  O   . HOH C 3 .  ? 18.922 5.889   -11.760 1.00 44.10 ? 195 HOH A O   1 
HETATM 518 O  O   . HOH C 3 .  ? 18.897 4.871   21.140  1.00 37.17 ? 196 HOH A O   1 
HETATM 519 O  O   . HOH C 3 .  ? 10.565 8.787   -8.939  1.00 29.32 ? 197 HOH A O   1 
HETATM 520 O  O   . HOH C 3 .  ? 1.495  0.218   11.982  1.00 30.92 ? 198 HOH A O   1 
HETATM 521 O  O   . HOH C 3 .  ? 14.667 -8.993  6.973   1.00 9.03  ? 199 HOH A O   1 
HETATM 522 O  O   . HOH C 3 .  ? 12.626 7.981   13.195  1.00 15.84 ? 200 HOH A O   1 
HETATM 523 O  O   . HOH C 3 .  ? 6.594  9.214   19.838  1.00 34.85 ? 201 HOH A O   1 
HETATM 524 O  O   . HOH C 3 .  ? -1.415 1.548   10.429  1.00 48.48 ? 202 HOH A O   1 
HETATM 525 O  O   . HOH C 3 .  ? 12.541 -9.549  8.816   1.00 12.16 ? 203 HOH A O   1 
HETATM 526 O  O   . HOH C 3 .  ? 3.523  7.578   10.947  1.00 28.01 ? 204 HOH A O   1 
HETATM 527 O  O   . HOH C 3 .  ? 8.662  -9.633  0.019   1.00 31.22 ? 205 HOH A O   1 
HETATM 528 O  O   . HOH C 3 .  ? 24.206 5.537   13.840  1.00 36.95 ? 206 HOH A O   1 
HETATM 529 O  O   . HOH C 3 .  ? 17.287 -6.770  -6.421  1.00 45.89 ? 207 HOH A O   1 
HETATM 530 O  O   . HOH C 3 .  ? 4.657  16.759  12.932  1.00 27.17 ? 208 HOH A O   1 
HETATM 531 O  O   . HOH C 3 .  ? 8.948  19.397  6.441   1.00 16.44 ? 209 HOH A O   1 
HETATM 532 O  O   . HOH C 3 .  ? 12.889 2.798   -7.174  1.00 13.93 ? 210 HOH A O   1 
HETATM 533 O  O   . HOH C 3 .  ? 7.330  -8.800  6.292   1.00 40.91 ? 211 HOH A O   1 
HETATM 534 O  O   . HOH C 3 .  ? 8.227  9.938   -5.353  1.00 11.94 ? 212 HOH A O   1 
HETATM 535 O  O   . HOH C 3 .  ? 2.239  5.526   14.968  1.00 39.22 ? 213 HOH A O   1 
HETATM 536 O  O   . HOH C 3 .  ? 19.303 8.466   -9.281  1.00 30.44 ? 214 HOH A O   1 
HETATM 537 O  O   . HOH C 3 .  ? 8.593  12.516  -5.958  1.00 12.05 ? 215 HOH A O   1 
HETATM 538 O  O   . HOH C 3 .  ? 17.333 6.520   -9.227  1.00 35.53 ? 216 HOH A O   1 
HETATM 539 O  O   . HOH C 3 .  ? 22.554 -5.053  -5.381  1.00 52.31 ? 217 HOH A O   1 
HETATM 540 O  O   . HOH C 3 .  ? 28.020 -1.679  -8.062  1.00 7.78  ? 218 HOH A O   1 
HETATM 541 O  O   . HOH C 3 .  ? 22.707 -2.227  -1.720  1.00 15.27 ? 219 HOH A O   1 
HETATM 542 O  O   . HOH C 3 .  ? 28.437 -0.613  2.614   1.00 53.55 ? 220 HOH A O   1 
HETATM 543 O  O   . HOH C 3 .  ? 5.580  -8.237  -1.174  1.00 32.48 ? 221 HOH A O   1 
HETATM 544 O  O   . HOH C 3 .  ? 13.727 -10.219 2.328   1.00 21.25 ? 222 HOH A O   1 
HETATM 545 O  O   . HOH C 3 .  ? 17.158 -2.493  -6.715  1.00 33.82 ? 223 HOH A O   1 
HETATM 546 O  O   . HOH C 3 .  ? 14.235 9.141   -7.353  1.00 44.80 ? 224 HOH A O   1 
HETATM 547 O  O   . HOH C 3 .  ? 22.695 -4.702  -0.391  1.00 33.35 ? 225 HOH A O   1 
HETATM 548 O  O   . HOH C 3 .  ? 16.865 5.189   17.298  1.00 32.04 ? 226 HOH A O   1 
HETATM 549 O  O   . HOH C 3 .  ? 19.361 3.557   -13.604 1.00 33.42 ? 227 HOH A O   1 
HETATM 550 O  O   . HOH C 3 .  ? 3.710  -5.777  12.529  1.00 37.13 ? 228 HOH A O   1 
HETATM 551 O  O   . HOH C 3 .  ? 1.560  -5.484  11.149  1.00 60.03 ? 229 HOH A O   1 
HETATM 552 O  O   . HOH C 3 .  ? 10.231 23.600  -3.637  1.00 34.86 ? 230 HOH A O   1 
HETATM 553 O  O   . HOH C 3 .  ? 1.090  3.492   3.067   0.66 9.44  ? 301 HOH A O   1 
HETATM 554 O  O   . HOH C 3 .  ? 0.001  3.197   7.228   0.66 10.56 ? 302 HOH A O   1 
HETATM 555 O  O   . HOH C 3 .  ? 15.599 2.498   20.217  0.66 21.91 ? 303 HOH A O   1 
HETATM 556 O  O   . HOH C 3 .  ? 10.868 -5.881  12.631  0.66 7.40  ? 304 HOH A O   1 
HETATM 557 O  O   . HOH C 3 .  ? 6.913  -7.505  1.140   0.66 5.02  ? 305 HOH A O   1 
HETATM 558 O  O   . HOH C 3 .  ? 10.560 -5.649  -4.263  0.66 3.22  ? 306 HOH A O   1 
HETATM 559 O  O   . HOH C 3 .  ? 9.914  17.434  0.789   0.66 11.76 ? 307 HOH A O   1 
HETATM 560 O  O   . HOH C 3 .  ? 1.193  8.156   6.502   0.66 12.20 ? 308 HOH A O   1 
HETATM 561 O  O   . HOH C 3 .  ? 9.672  -5.952  15.186  0.66 6.64  ? 309 HOH A O   1 
HETATM 562 O  O   . HOH C 3 .  ? 6.429  12.898  11.215  0.66 4.89  ? 310 HOH A O   1 
HETATM 563 O  O   . HOH C 3 .  ? 4.954  -1.302  10.231  0.66 12.01 ? 311 HOH A O   1 
HETATM 564 O  O   . HOH C 3 .  ? 10.785 4.188   -5.867  0.66 5.46  ? 312 HOH A O   1 
HETATM 565 O  O   . HOH C 3 .  ? 19.857 -6.385  2.361   0.66 10.88 ? 313 HOH A O   1 
HETATM 566 O  O   . HOH C 3 .  ? 12.314 -8.154  11.388  0.66 10.61 ? 314 HOH A O   1 
HETATM 567 O  O   . HOH C 3 .  ? 9.242  -8.975  13.467  0.66 11.04 ? 315 HOH A O   1 
HETATM 568 O  O   . HOH C 3 .  ? 8.131  9.575   13.579  0.66 12.09 ? 316 HOH A O   1 
HETATM 569 O  O   . HOH C 3 .  ? 8.212  11.237  15.647  0.66 8.77  ? 317 HOH A O   1 
HETATM 570 O  O   . HOH C 3 .  ? 26.347 4.721   9.828   0.66 6.48  ? 318 HOH A O   1 
HETATM 571 O  O   . HOH C 3 .  ? 26.602 -1.987  7.598   0.66 8.67  ? 319 HOH A O   1 
HETATM 572 O  O   . HOH C 3 .  ? 24.730 -0.915  -13.779 0.66 6.77  ? 320 HOH A O   1 
HETATM 573 O  O   . HOH C 3 .  ? 8.227  -7.584  9.133   0.66 9.98  ? 321 HOH A O   1 
HETATM 574 O  O   . HOH C 3 .  ? 22.491 -1.960  -15.122 0.66 17.13 ? 322 HOH A O   1 
HETATM 575 O  O   . HOH C 3 .  ? 8.332  -6.203  11.731  0.66 11.98 ? 323 HOH A O   1 
HETATM 576 O  O   . HOH C 3 .  ? -0.799 3.193   4.755   0.66 16.44 ? 324 HOH A O   1 
HETATM 577 O  O   . HOH C 3 .  ? 1.253  6.369   3.122   0.66 9.60  ? 325 HOH A O   1 
HETATM 578 O  O   . HOH C 3 .  ? 26.731 -0.963  5.093   0.66 14.75 ? 326 HOH A O   1 
HETATM 579 O  O   . HOH C 3 .  ? 25.391 -5.252  8.465   0.66 14.89 ? 327 HOH A O   1 
HETATM 580 O  O   . HOH C 3 .  ? 18.631 2.209   -7.364  0.66 3.26  ? 328 HOH A O   1 
HETATM 581 O  O   . HOH C 3 .  ? 4.764  14.160  12.716  0.66 19.10 ? 329 HOH A O   1 
HETATM 582 O  O   . HOH C 3 .  ? -1.339 6.921   4.027   0.66 14.99 ? 330 HOH A O   1 
HETATM 583 O  O   . HOH C 3 .  ? 26.776 2.801   9.989   0.34 13.04 ? 401 HOH A O   1 
HETATM 584 O  O   . HOH C 3 .  ? 7.081  -8.121  1.685   0.34 4.50  ? 402 HOH A O   1 
HETATM 585 O  O   . HOH C 3 .  ? 25.558 3.548   11.556  0.34 5.10  ? 403 HOH A O   1 
HETATM 586 O  O   . HOH C 3 .  ? 5.950  13.430  10.783  0.34 3.93  ? 404 HOH A O   1 
HETATM 587 O  O   . HOH C 3 .  ? 0.711  7.775   5.114   0.34 5.46  ? 405 HOH A O   1 
HETATM 588 O  O   . HOH C 3 .  ? 7.973  11.087  14.252  0.34 3.40  ? 406 HOH A O   1 
HETATM 589 O  O   . HOH C 3 .  ? 4.866  -0.203  10.442  0.34 6.78  ? 407 HOH A O   1 
HETATM 590 O  O   . HOH C 3 .  ? 27.848 -0.301  6.788   0.34 5.58  ? 408 HOH A O   1 
HETATM 591 O  O   . HOH C 3 .  ? 0.776  2.085   2.871   0.34 7.64  ? 409 HOH A O   1 
HETATM 592 O  O   . HOH C 3 .  ? 26.043 -4.735  9.411   0.34 5.30  ? 410 HOH A O   1 
HETATM 593 O  O   . HOH C 3 .  ? 7.041  12.885  11.358  0.34 4.04  ? 411 HOH A O   1 
HETATM 594 O  O   . HOH C 3 .  ? 16.452 1.580   21.459  0.34 7.57  ? 412 HOH A O   1 
HETATM 595 O  O   . HOH C 3 .  ? 13.601 -8.394  11.196  0.34 7.84  ? 413 HOH A O   1 
HETATM 596 O  O   . HOH C 3 .  ? 16.102 1.928   20.577  0.34 6.66  ? 414 HOH A O   1 
HETATM 597 O  O   . HOH C 3 .  ? 9.774  -7.423  13.435  0.34 7.96  ? 415 HOH A O   1 
HETATM 598 O  O   . HOH C 3 .  ? 0.055  3.039   5.801   0.34 8.81  ? 416 HOH A O   1 
HETATM 599 O  O   . HOH C 3 .  ? 27.614 6.164   11.259  0.34 13.35 ? 417 HOH A O   1 
HETATM 600 O  O   . HOH C 3 .  ? 11.073 -5.283  -4.604  0.34 2.36  ? 418 HOH A O   1 
HETATM 601 O  O   . HOH C 3 .  ? 18.830 1.521   -7.140  0.34 3.73  ? 419 HOH A O   1 
HETATM 602 O  O   . HOH C 3 .  ? 24.776 -0.099  -14.351 0.34 4.90  ? 420 HOH A O   1 
HETATM 603 O  O   . HOH C 3 .  ? 10.575 -5.680  14.758  0.34 6.40  ? 421 HOH A O   1 
HETATM 604 O  O   . HOH C 3 .  ? 9.389  18.060  1.780   0.34 9.73  ? 422 HOH A O   1 
HETATM 605 O  O   . HOH C 3 .  ? 17.749 -9.436  -0.074  0.34 12.05 ? 423 HOH A O   1 
HETATM 606 O  O   . HOH C 3 .  ? 19.568 2.478   -8.968  0.34 8.45  ? 424 HOH A O   1 
HETATM 607 O  O   . HOH C 3 .  ? 20.212 -6.426  1.026   0.34 7.74  ? 425 HOH A O   1 
HETATM 608 O  O   . HOH C 3 .  ? 9.148  -6.425  9.680   0.34 9.78  ? 426 HOH A O   1 
HETATM 609 O  O   . HOH C 3 .  ? 4.091  14.113  9.392   0.34 15.67 ? 427 HOH A O   1 
HETATM 610 O  O   . HOH C 3 .  ? 2.426  -10.873 0.285   0.34 12.26 ? 428 HOH A O   1 
HETATM 611 O  O   . HOH C 3 .  ? 17.352 -7.691  -0.008  0.34 10.95 ? 429 HOH A O   1 
HETATM 612 O  O   . HOH C 3 .  ? 24.540 4.071   11.928  0.34 12.22 ? 430 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  ALA 2  2  2  ALA ALA A . n 
A 1 3  LYS 3  3  3  LYS LYS A . n 
A 1 4  TRP 4  4  4  TRP TRP A . n 
A 1 5  VAL 5  5  5  VAL VAL A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  LYS 7  7  7  LYS LYS A . n 
A 1 8  ILE 8  8  8  ILE ILE A . n 
A 1 9  CYS 9  9  9  CYS CYS A . n 
A 1 10 GLY 10 10 10 GLY GLY A . n 
A 1 11 TYR 11 11 11 TYR TYR A . n 
A 1 12 ILE 12 12 12 ILE ILE A . n 
A 1 13 TYR 13 13 13 TYR TYR A . n 
A 1 14 ASP 14 14 14 ASP ASP A . n 
A 1 15 GLU 15 15 15 GLU GLU A . n 
A 1 16 ASP 16 16 16 ASP ASP A . n 
A 1 17 ALA 17 17 17 ALA ALA A . n 
A 1 18 GLY 18 18 18 GLY GLY A . n 
A 1 19 ASP 19 19 19 ASP ASP A . n 
A 1 20 PRO 20 20 20 PRO PRO A . n 
A 1 21 ASP 21 21 21 ASP ASP A . n 
A 1 22 ASN 22 22 22 ASN ASN A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 ILE 24 24 24 ILE ILE A . n 
A 1 25 SER 25 25 25 SER SER A . n 
A 1 26 PRO 26 26 26 PRO PRO A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 THR 28 28 28 THR THR A . n 
A 1 29 LYS 29 29 29 LYS LYS A . n 
A 1 30 PHE 30 30 30 PHE PHE A . n 
A 1 31 GLU 31 31 31 GLU GLU A . n 
A 1 32 GLU 32 32 32 GLU GLU A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 PRO 34 34 34 PRO PRO A . n 
A 1 35 ASP 35 35 35 ASP ASP A . n 
A 1 36 ASP 36 36 36 ASP ASP A . n 
A 1 37 TRP 37 37 37 TRP TRP A . n 
A 1 38 VAL 38 38 38 VAL VAL A . n 
A 1 39 CYS 39 39 39 CYS CYS A . n 
A 1 40 PRO 40 40 40 PRO PRO A . n 
A 1 41 ILE 41 41 41 ILE ILE A . n 
A 1 42 CYS 42 42 42 CYS CYS A . n 
A 1 43 GLY 43 43 43 GLY GLY A . n 
A 1 44 ALA 44 44 44 ALA ALA A . n 
A 1 45 PRO 45 45 45 PRO PRO A . n 
A 1 46 LYS 46 46 46 LYS LYS A . n 
A 1 47 SER 47 47 47 SER SER A . n 
A 1 48 GLU 48 48 48 GLU GLU A . n 
A 1 49 PHE 49 49 49 PHE PHE A . n 
A 1 50 GLU 50 50 50 GLU GLU A . n 
A 1 51 LYS 51 51 51 LYS LYS A . n 
A 1 52 LEU 52 52 52 LEU LEU A . n 
A 1 53 GLU 53 53 53 GLU GLU A . n 
A 1 54 ASP 54 54 54 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FE  1   55  55  FE  FE  A . 
C 3 HOH 1   101 101 HOH HOH A . 
C 3 HOH 2   102 102 HOH HOH A . 
C 3 HOH 3   103 103 HOH HOH A . 
C 3 HOH 4   104 104 HOH HOH A . 
C 3 HOH 5   105 105 HOH HOH A . 
C 3 HOH 6   106 106 HOH HOH A . 
C 3 HOH 7   107 107 HOH HOH A . 
C 3 HOH 8   108 108 HOH HOH A . 
C 3 HOH 9   109 109 HOH HOH A . 
C 3 HOH 10  110 110 HOH HOH A . 
C 3 HOH 11  111 111 HOH HOH A . 
C 3 HOH 12  112 112 HOH HOH A . 
C 3 HOH 13  113 113 HOH HOH A . 
C 3 HOH 14  114 114 HOH HOH A . 
C 3 HOH 15  115 115 HOH HOH A . 
C 3 HOH 16  116 116 HOH HOH A . 
C 3 HOH 17  117 117 HOH HOH A . 
C 3 HOH 18  118 118 HOH HOH A . 
C 3 HOH 19  119 119 HOH HOH A . 
C 3 HOH 20  120 120 HOH HOH A . 
C 3 HOH 21  121 121 HOH HOH A . 
C 3 HOH 22  122 122 HOH HOH A . 
C 3 HOH 23  123 123 HOH HOH A . 
C 3 HOH 24  124 124 HOH HOH A . 
C 3 HOH 25  125 125 HOH HOH A . 
C 3 HOH 26  126 126 HOH HOH A . 
C 3 HOH 27  127 127 HOH HOH A . 
C 3 HOH 28  128 128 HOH HOH A . 
C 3 HOH 29  129 129 HOH HOH A . 
C 3 HOH 30  130 130 HOH HOH A . 
C 3 HOH 31  131 131 HOH HOH A . 
C 3 HOH 32  132 132 HOH HOH A . 
C 3 HOH 33  133 133 HOH HOH A . 
C 3 HOH 34  134 134 HOH HOH A . 
C 3 HOH 35  135 135 HOH HOH A . 
C 3 HOH 36  136 136 HOH HOH A . 
C 3 HOH 37  137 137 HOH HOH A . 
C 3 HOH 38  138 138 HOH HOH A . 
C 3 HOH 39  139 139 HOH HOH A . 
C 3 HOH 40  140 140 HOH HOH A . 
C 3 HOH 41  141 141 HOH HOH A . 
C 3 HOH 42  142 142 HOH HOH A . 
C 3 HOH 43  143 143 HOH HOH A . 
C 3 HOH 44  144 144 HOH HOH A . 
C 3 HOH 45  145 145 HOH HOH A . 
C 3 HOH 46  146 146 HOH HOH A . 
C 3 HOH 47  147 147 HOH HOH A . 
C 3 HOH 48  148 148 HOH HOH A . 
C 3 HOH 49  149 149 HOH HOH A . 
C 3 HOH 50  150 150 HOH HOH A . 
C 3 HOH 51  151 151 HOH HOH A . 
C 3 HOH 52  152 152 HOH HOH A . 
C 3 HOH 53  153 153 HOH HOH A . 
C 3 HOH 54  154 154 HOH HOH A . 
C 3 HOH 55  155 155 HOH HOH A . 
C 3 HOH 56  156 156 HOH HOH A . 
C 3 HOH 57  157 157 HOH HOH A . 
C 3 HOH 58  158 158 HOH HOH A . 
C 3 HOH 59  159 159 HOH HOH A . 
C 3 HOH 60  160 160 HOH HOH A . 
C 3 HOH 61  161 161 HOH HOH A . 
C 3 HOH 62  162 162 HOH HOH A . 
C 3 HOH 63  163 163 HOH HOH A . 
C 3 HOH 64  164 164 HOH HOH A . 
C 3 HOH 65  165 165 HOH HOH A . 
C 3 HOH 66  166 166 HOH HOH A . 
C 3 HOH 67  167 167 HOH HOH A . 
C 3 HOH 68  168 168 HOH HOH A . 
C 3 HOH 69  169 169 HOH HOH A . 
C 3 HOH 70  170 170 HOH HOH A . 
C 3 HOH 71  171 171 HOH HOH A . 
C 3 HOH 72  172 172 HOH HOH A . 
C 3 HOH 73  173 173 HOH HOH A . 
C 3 HOH 74  174 174 HOH HOH A . 
C 3 HOH 75  175 175 HOH HOH A . 
C 3 HOH 76  176 176 HOH HOH A . 
C 3 HOH 77  177 177 HOH HOH A . 
C 3 HOH 78  178 178 HOH HOH A . 
C 3 HOH 79  179 179 HOH HOH A . 
C 3 HOH 80  180 180 HOH HOH A . 
C 3 HOH 81  181 181 HOH HOH A . 
C 3 HOH 82  182 182 HOH HOH A . 
C 3 HOH 83  183 183 HOH HOH A . 
C 3 HOH 84  184 184 HOH HOH A . 
C 3 HOH 85  185 185 HOH HOH A . 
C 3 HOH 86  186 186 HOH HOH A . 
C 3 HOH 87  187 187 HOH HOH A . 
C 3 HOH 88  188 188 HOH HOH A . 
C 3 HOH 89  189 189 HOH HOH A . 
C 3 HOH 90  190 190 HOH HOH A . 
C 3 HOH 91  191 191 HOH HOH A . 
C 3 HOH 92  192 192 HOH HOH A . 
C 3 HOH 93  193 193 HOH HOH A . 
C 3 HOH 94  194 194 HOH HOH A . 
C 3 HOH 95  195 195 HOH HOH A . 
C 3 HOH 96  196 196 HOH HOH A . 
C 3 HOH 97  197 197 HOH HOH A . 
C 3 HOH 98  198 198 HOH HOH A . 
C 3 HOH 99  199 199 HOH HOH A . 
C 3 HOH 100 200 200 HOH HOH A . 
C 3 HOH 101 201 201 HOH HOH A . 
C 3 HOH 102 202 202 HOH HOH A . 
C 3 HOH 103 203 203 HOH HOH A . 
C 3 HOH 104 204 204 HOH HOH A . 
C 3 HOH 105 205 205 HOH HOH A . 
C 3 HOH 106 206 206 HOH HOH A . 
C 3 HOH 107 207 207 HOH HOH A . 
C 3 HOH 108 208 208 HOH HOH A . 
C 3 HOH 109 209 209 HOH HOH A . 
C 3 HOH 110 210 210 HOH HOH A . 
C 3 HOH 111 211 211 HOH HOH A . 
C 3 HOH 112 212 212 HOH HOH A . 
C 3 HOH 113 213 213 HOH HOH A . 
C 3 HOH 114 214 214 HOH HOH A . 
C 3 HOH 115 215 215 HOH HOH A . 
C 3 HOH 116 216 216 HOH HOH A . 
C 3 HOH 117 217 217 HOH HOH A . 
C 3 HOH 118 218 218 HOH HOH A . 
C 3 HOH 119 219 219 HOH HOH A . 
C 3 HOH 120 220 220 HOH HOH A . 
C 3 HOH 121 221 221 HOH HOH A . 
C 3 HOH 122 222 222 HOH HOH A . 
C 3 HOH 123 223 223 HOH HOH A . 
C 3 HOH 124 224 224 HOH HOH A . 
C 3 HOH 125 225 225 HOH HOH A . 
C 3 HOH 126 226 226 HOH HOH A . 
C 3 HOH 127 227 227 HOH HOH A . 
C 3 HOH 128 228 228 HOH HOH A . 
C 3 HOH 129 229 229 HOH HOH A . 
C 3 HOH 130 230 230 HOH HOH A . 
C 3 HOH 131 301 301 HOH HOH A . 
C 3 HOH 132 302 302 HOH HOH A . 
C 3 HOH 133 303 303 HOH HOH A . 
C 3 HOH 134 304 304 HOH HOH A . 
C 3 HOH 135 305 305 HOH HOH A . 
C 3 HOH 136 306 306 HOH HOH A . 
C 3 HOH 137 307 307 HOH HOH A . 
C 3 HOH 138 308 308 HOH HOH A . 
C 3 HOH 139 309 309 HOH HOH A . 
C 3 HOH 140 310 310 HOH HOH A . 
C 3 HOH 141 311 311 HOH HOH A . 
C 3 HOH 142 312 312 HOH HOH A . 
C 3 HOH 143 313 313 HOH HOH A . 
C 3 HOH 144 314 314 HOH HOH A . 
C 3 HOH 145 315 315 HOH HOH A . 
C 3 HOH 146 316 316 HOH HOH A . 
C 3 HOH 147 317 317 HOH HOH A . 
C 3 HOH 148 318 318 HOH HOH A . 
C 3 HOH 149 319 319 HOH HOH A . 
C 3 HOH 150 320 320 HOH HOH A . 
C 3 HOH 151 321 321 HOH HOH A . 
C 3 HOH 152 322 322 HOH HOH A . 
C 3 HOH 153 323 323 HOH HOH A . 
C 3 HOH 154 324 324 HOH HOH A . 
C 3 HOH 155 325 325 HOH HOH A . 
C 3 HOH 156 326 326 HOH HOH A . 
C 3 HOH 157 327 327 HOH HOH A . 
C 3 HOH 158 328 328 HOH HOH A . 
C 3 HOH 159 329 329 HOH HOH A . 
C 3 HOH 160 330 330 HOH HOH A . 
C 3 HOH 161 401 401 HOH HOH A . 
C 3 HOH 162 402 402 HOH HOH A . 
C 3 HOH 163 403 403 HOH HOH A . 
C 3 HOH 164 404 404 HOH HOH A . 
C 3 HOH 165 405 405 HOH HOH A . 
C 3 HOH 166 406 406 HOH HOH A . 
C 3 HOH 167 407 407 HOH HOH A . 
C 3 HOH 168 408 408 HOH HOH A . 
C 3 HOH 169 409 409 HOH HOH A . 
C 3 HOH 170 410 410 HOH HOH A . 
C 3 HOH 171 411 411 HOH HOH A . 
C 3 HOH 172 412 412 HOH HOH A . 
C 3 HOH 173 413 413 HOH HOH A . 
C 3 HOH 174 414 414 HOH HOH A . 
C 3 HOH 175 415 415 HOH HOH A . 
C 3 HOH 176 416 416 HOH HOH A . 
C 3 HOH 177 417 417 HOH HOH A . 
C 3 HOH 178 418 418 HOH HOH A . 
C 3 HOH 179 419 419 HOH HOH A . 
C 3 HOH 180 420 420 HOH HOH A . 
C 3 HOH 181 421 421 HOH HOH A . 
C 3 HOH 182 422 422 HOH HOH A . 
C 3 HOH 183 423 423 HOH HOH A . 
C 3 HOH 184 424 424 HOH HOH A . 
C 3 HOH 185 425 425 HOH HOH A . 
C 3 HOH 186 426 426 HOH HOH A . 
C 3 HOH 187 427 427 HOH HOH A . 
C 3 HOH 188 428 428 HOH HOH A . 
C 3 HOH 189 429 429 HOH HOH A . 
C 3 HOH 190 430 430 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 6  ? A CYS 6  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 9  ? A CYS 9  ? 1_555 113.6 ? 
2 SG ? A CYS 6  ? A CYS 6  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 111.2 ? 
3 SG ? A CYS 9  ? A CYS 9  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 102.7 ? 
4 SG ? A CYS 6  ? A CYS 6  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 103.8 ? 
5 SG ? A CYS 9  ? A CYS 9  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 113.3 ? 
6 SG ? A CYS 39 ? A CYS 39 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 112.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-08-26 
2 'Structure model' 1 1 2007-10-21 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL refinement       . ? 1 
XDS    'data reduction' . ? 2 
XSCALE 'data scaling'   . ? 3 
# 
_pdbx_entry_details.entry_id             1BQ8 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   'IRON ATOM OF A FES4 UNIT' 
_pdbx_entry_details.sequence_details     ? 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     19 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -157.18 
_pdbx_validate_torsion.psi             65.75 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION' FE  
3 water          HOH 
#