data_1BTE
# 
_entry.id   1BTE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BTE         
RCSB  RCSB008230   
WWPDB D_1000008230 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BTE 
_pdbx_database_status.recvd_initial_deposition_date   1998-09-01 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Greenwald, J.' 1 
'Fischer, W.'   2 
'Vale, W.'      3 
'Choe, S.'      4 
# 
_citation.id                        primary 
_citation.title                     
'Three-finger toxin fold for the extracellular ligand-binding domain of the type II activin receptor serine kinase.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            6 
_citation.page_first                18 
_citation.page_last                 22 
_citation.year                      1999 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9886286 
_citation.pdbx_database_id_DOI      10.1038/4887 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Greenwald, J.' 1 
primary 'Fischer, W.H.' 2 
primary 'Vale, W.W.'    3 
primary 'Choe, S.'      4 
# 
_cell.entry_id           1BTE 
_cell.length_a           71.630 
_cell.length_b           71.630 
_cell.length_c           37.380 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BTE 
_symmetry.space_group_name_H-M             'P 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                143 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (ACTIVIN RECEPTOR TYPE II)' 11507.803 2   2.7.1.- ? 'LIGAND-BINDING DOMAIN' ? 
2 non-polymer man N-ACETYL-D-GLUCOSAMINE               221.208   4   ?       ? ?                       ? 
3 water       nat water                                18.015    202 ?       ? ?                       ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCC
CEGNMCNEKFSYFPEME
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCC
CEGNMCNEKFSYFPEME
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  GLU n 
1 3  THR n 
1 4  GLN n 
1 5  GLU n 
1 6  CYS n 
1 7  LEU n 
1 8  PHE n 
1 9  PHE n 
1 10 ASN n 
1 11 ALA n 
1 12 ASN n 
1 13 TRP n 
1 14 GLU n 
1 15 ARG n 
1 16 ASP n 
1 17 ARG n 
1 18 THR n 
1 19 ASN n 
1 20 GLN n 
1 21 THR n 
1 22 GLY n 
1 23 VAL n 
1 24 GLU n 
1 25 PRO n 
1 26 CYS n 
1 27 TYR n 
1 28 GLY n 
1 29 ASP n 
1 30 LYS n 
1 31 ASP n 
1 32 LYS n 
1 33 ARG n 
1 34 ARG n 
1 35 HIS n 
1 36 CYS n 
1 37 PHE n 
1 38 ALA n 
1 39 THR n 
1 40 TRP n 
1 41 LYS n 
1 42 ASN n 
1 43 ILE n 
1 44 SER n 
1 45 GLY n 
1 46 SER n 
1 47 ILE n 
1 48 GLU n 
1 49 ILE n 
1 50 VAL n 
1 51 LYS n 
1 52 GLN n 
1 53 GLY n 
1 54 CYS n 
1 55 TRP n 
1 56 LEU n 
1 57 ASP n 
1 58 ASP n 
1 59 ILE n 
1 60 ASN n 
1 61 CYS n 
1 62 TYR n 
1 63 ASP n 
1 64 ARG n 
1 65 THR n 
1 66 ASP n 
1 67 CYS n 
1 68 ILE n 
1 69 GLU n 
1 70 LYS n 
1 71 LYS n 
1 72 ASP n 
1 73 SER n 
1 74 PRO n 
1 75 GLU n 
1 76 VAL n 
1 77 TYR n 
1 78 PHE n 
1 79 CYS n 
1 80 CYS n 
1 81 CYS n 
1 82 GLU n 
1 83 GLY n 
1 84 ASN n 
1 85 MET n 
1 86 CYS n 
1 87 ASN n 
1 88 GLU n 
1 89 LYS n 
1 90 PHE n 
1 91 SER n 
1 92 TYR n 
1 93 PHE n 
1 94 PRO n 
1 95 GLU n 
1 96 MET n 
1 97 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     Pichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               SMD1168 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PPIC9K 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACVR2_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P27038 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BTE A 1 ? 97 ? P27038 25 ? 121 ? 6 102 
2 1 1BTE B 1 ? 97 ? P27038 25 ? 121 ? 6 102 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ? 'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking' y PHENYLALANINE          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1BTE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_percent_sol   42 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_details    '100 MM SODIUM ACETATE, PH 4.5, 5% PEG 8000, 0.5M NACL' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   1998-01-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             0.97 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BTE 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            1.5 
_reflns.number_obs                   30005 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         83.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.034 
_reflns.pdbx_netI_over_sigmaI        11.6 
_reflns.B_iso_Wilson_estimate        18.10 
_reflns.pdbx_redundancy              4.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.54 
_reflns_shell.percent_possible_all   37.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.295 
_reflns_shell.meanI_over_sigI_obs    0.3 
_reflns_shell.pdbx_redundancy        2.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1BTE 
_refine.ls_number_reflns_obs                     30005 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.5 
_refine.ls_percent_reflns_obs                    83.9 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.181 
_refine.ls_R_factor_R_free                       0.222 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_number_reflns_R_free                  1500 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               23.6 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.086 
_refine.pdbx_overall_ESU_R_Free                  0.092 
_refine.overall_SU_ML                            0.063 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1484 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             202 
_refine_hist.number_atoms_total               1742 
_refine_hist.d_res_high                       1.5 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            .013  .020  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           .029  .040  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          .032  .050  ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         1.613 2.000 ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        2.678 3.000 ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         2.007 2.000 ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        2.989 3.000 ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      .141  .150  ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       .171  .30   ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       .256  .30   ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        5.5   7     ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     16.5  15    ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    20.6  20    ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.894500 
_struct_ncs_oper.matrix[1][2]   -0.445800 
_struct_ncs_oper.matrix[1][3]   -0.034900 
_struct_ncs_oper.matrix[2][1]   0.444500 
_struct_ncs_oper.matrix[2][2]   0.895000 
_struct_ncs_oper.matrix[2][3]   -0.038200 
_struct_ncs_oper.matrix[3][1]   0.048200 
_struct_ncs_oper.matrix[3][2]   0.018700 
_struct_ncs_oper.matrix[3][3]   0.998700 
_struct_ncs_oper.vector[1]      -19.71370 
_struct_ncs_oper.vector[2]      -37.41570 
_struct_ncs_oper.vector[3]      -14.03470 
# 
_struct.entry_id                  1BTE 
_struct.title                     'CRYSTAL STRUCTURE OF THE EXTRACELLULAR DOMAIN OF THE TYPE II ACTIVIN RECEPTOR' 
_struct.pdbx_descriptor           'ACTIVIN RECEPTOR TYPE II (E.C.2.7.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BTE 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'RECEPTOR, SERINE KINASE, LIGAND BINDING DOMAIN, THREE-FINGER TOXIN, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 TRP A 13 ? ASP A 16 ? TRP A 18 ASP A 21 1 ? 4 
HELX_P HELX_P2 2 CYS A 86 ? GLU A 88 ? CYS A 91 GLU A 93 5 ? 3 
HELX_P HELX_P3 3 TRP B 13 ? ASP B 16 ? TRP B 18 ASP B 21 1 ? 4 
HELX_P HELX_P4 4 CYS B 86 ? GLU B 88 ? CYS B 91 GLU B 93 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 6  SG  ? ? ? 1_555 A CYS 36 SG ? ? A CYS 11 A CYS 41  1_555 ? ? ? ? ? ? ? 2.064 ? 
disulf2  disulf ? ? A CYS 26 SG  ? ? ? 1_555 A CYS 54 SG ? ? A CYS 31 A CYS 59  1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf3  disulf ? ? A CYS 61 SG  ? ? ? 1_555 A CYS 80 SG ? ? A CYS 66 A CYS 85  1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf4  disulf ? ? A CYS 67 SG  ? ? ? 1_555 A CYS 79 SG ? ? A CYS 72 A CYS 84  1_555 ? ? ? ? ? ? ? 2.078 ? 
disulf5  disulf ? ? A CYS 81 SG  ? ? ? 1_555 A CYS 86 SG ? ? A CYS 86 A CYS 91  1_555 ? ? ? ? ? ? ? 2.092 ? 
disulf6  disulf ? ? B CYS 6  SG  ? ? ? 1_555 B CYS 36 SG ? ? B CYS 11 B CYS 41  1_555 ? ? ? ? ? ? ? 2.064 ? 
disulf7  disulf ? ? B CYS 26 SG  ? ? ? 1_555 B CYS 54 SG ? ? B CYS 31 B CYS 59  1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf8  disulf ? ? B CYS 61 SG  ? ? ? 1_555 B CYS 80 SG ? ? B CYS 66 B CYS 85  1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf9  disulf ? ? B CYS 67 SG  ? ? ? 1_555 B CYS 79 SG ? ? B CYS 72 B CYS 84  1_555 ? ? ? ? ? ? ? 2.087 ? 
disulf10 disulf ? ? B CYS 81 SG  ? ? ? 1_555 B CYS 86 SG ? ? B CYS 86 B CYS 91  1_555 ? ? ? ? ? ? ? 2.042 ? 
covale1  covale ? ? A ASN 19 ND2 ? ? ? 1_555 C NAG .  C1 ? ? A ASN 24 A NAG 124 1_555 ? ? ? ? ? ? ? 1.429 ? 
covale2  covale ? ? A ASN 42 ND2 ? ? ? 1_555 D NAG .  C1 ? ? A ASN 47 A NAG 147 1_555 ? ? ? ? ? ? ? 1.428 ? 
covale3  covale ? ? B ASN 19 ND2 ? ? ? 1_555 E NAG .  C1 ? ? B ASN 24 B NAG 124 1_555 ? ? ? ? ? ? ? 1.413 ? 
covale4  covale ? ? B ASN 42 ND2 ? ? ? 1_555 F NAG .  C1 ? ? B ASN 47 B NAG 147 1_555 ? ? ? ? ? ? ? 1.409 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 5  ? PHE A 9  ? GLU A 10 PHE A 14 
A 2 THR A 21 ? PRO A 25 ? THR A 26 PRO A 30 
B 1 TYR A 77 ? CYS A 81 ? TYR A 82 CYS A 86 
B 2 HIS A 35 ? ILE A 43 ? HIS A 40 ILE A 48 
B 3 SER A 46 ? TRP A 55 ? SER A 51 TRP A 60 
C 1 CYS A 67 ? GLU A 69 ? CYS A 72 GLU A 74 
C 2 PHE A 90 ? TYR A 92 ? PHE A 95 TYR A 97 
D 1 GLU B 5  ? PHE B 9  ? GLU B 10 PHE B 14 
D 2 THR B 21 ? PRO B 25 ? THR B 26 PRO B 30 
E 1 TYR B 77 ? CYS B 81 ? TYR B 82 CYS B 86 
E 2 HIS B 35 ? ILE B 43 ? HIS B 40 ILE B 48 
E 3 SER B 46 ? TRP B 55 ? SER B 51 TRP B 60 
F 1 CYS B 67 ? GLU B 69 ? CYS B 72 GLU B 74 
F 2 PHE B 90 ? TYR B 92 ? PHE B 95 TYR B 97 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O CYS A 6  ? O CYS A 11 N GLU A 24 ? N GLU A 29 
B 1 2 O TYR A 77 ? O TYR A 82 N TRP A 40 ? N TRP A 45 
B 2 3 O HIS A 35 ? O HIS A 40 N TRP A 55 ? N TRP A 60 
C 1 2 O CYS A 67 ? O CYS A 72 N SER A 91 ? N SER A 96 
D 1 2 O CYS B 6  ? O CYS B 11 N GLU B 24 ? N GLU B 29 
E 1 2 O TYR B 77 ? O TYR B 82 N TRP B 40 ? N TRP B 45 
E 2 3 O HIS B 35 ? O HIS B 40 N TRP B 55 ? N TRP B 60 
F 1 2 O CYS B 67 ? O CYS B 72 N SER B 91 ? N SER B 96 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
NAG Author   ? ? ? ? 4  'GLYCOSYLATION SITE'                 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE NAG A 124' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE NAG B 124' 
AC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE NAG A 147' 
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NAG B 147' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  NAG 4  ASN A 19 ? ASN A 24  . ? 1_555 ? 
2  NAG 4  ASN A 42 ? ASN A 47  . ? 1_555 ? 
3  NAG 4  ASN B 19 ? ASN B 24  . ? 1_555 ? 
4  NAG 4  ASN B 42 ? ASN B 47  . ? 1_555 ? 
5  AC1 12 PHE A 8  ? PHE A 13  . ? 1_555 ? 
6  AC1 12 ASN A 19 ? ASN A 24  . ? 1_555 ? 
7  AC1 12 ASN A 19 ? ASN A 24  . ? 2_665 ? 
8  AC1 12 GLN A 20 ? GLN A 25  . ? 2_665 ? 
9  AC1 12 THR A 21 ? THR A 26  . ? 2_665 ? 
10 AC1 12 GLY A 22 ? GLY A 27  . ? 1_555 ? 
11 AC1 12 VAL A 23 ? VAL A 28  . ? 1_555 ? 
12 AC1 12 HOH G .  ? HOH A 189 . ? 1_555 ? 
13 AC1 12 HOH G .  ? HOH A 192 . ? 1_555 ? 
14 AC1 12 HOH G .  ? HOH A 192 . ? 3_565 ? 
15 AC1 12 HOH G .  ? HOH A 202 . ? 1_555 ? 
16 AC1 12 HOH G .  ? HOH A 218 . ? 1_555 ? 
17 AC2 10 PHE B 8  ? PHE B 13  . ? 1_555 ? 
18 AC2 10 ASN B 19 ? ASN B 24  . ? 2_555 ? 
19 AC2 10 ASN B 19 ? ASN B 24  . ? 1_555 ? 
20 AC2 10 GLN B 20 ? GLN B 25  . ? 2_555 ? 
21 AC2 10 THR B 21 ? THR B 26  . ? 2_555 ? 
22 AC2 10 GLY B 22 ? GLY B 27  . ? 1_555 ? 
23 AC2 10 VAL B 23 ? VAL B 28  . ? 1_555 ? 
24 AC2 10 HOH H .  ? HOH B 158 . ? 1_555 ? 
25 AC2 10 HOH H .  ? HOH B 183 . ? 1_555 ? 
26 AC2 10 HOH H .  ? HOH B 219 . ? 1_555 ? 
27 AC3 12 TRP A 40 ? TRP A 45  . ? 1_555 ? 
28 AC3 12 ASN A 42 ? ASN A 47  . ? 1_555 ? 
29 AC3 12 GLY A 45 ? GLY A 50  . ? 1_555 ? 
30 AC3 12 ILE A 47 ? ILE A 52  . ? 1_555 ? 
31 AC3 12 TYR A 92 ? TYR A 97  . ? 1_555 ? 
32 AC3 12 HOH G .  ? HOH A 150 . ? 1_555 ? 
33 AC3 12 HOH G .  ? HOH A 176 . ? 1_555 ? 
34 AC3 12 HOH G .  ? HOH A 221 . ? 1_555 ? 
35 AC3 12 HOH G .  ? HOH A 230 . ? 1_555 ? 
36 AC3 12 TRP B 55 ? TRP B 60  . ? 2_555 ? 
37 AC3 12 LEU B 56 ? LEU B 61  . ? 2_555 ? 
38 AC3 12 ASP B 57 ? ASP B 62  . ? 2_555 ? 
39 AC4 7  TRP B 40 ? TRP B 45  . ? 1_555 ? 
40 AC4 7  ASN B 42 ? ASN B 47  . ? 1_555 ? 
41 AC4 7  GLY B 45 ? GLY B 50  . ? 1_555 ? 
42 AC4 7  TYR B 77 ? TYR B 82  . ? 1_555 ? 
43 AC4 7  TYR B 92 ? TYR B 97  . ? 1_555 ? 
44 AC4 7  HOH H .  ? HOH B 181 . ? 1_555 ? 
45 AC4 7  HOH H .  ? HOH B 192 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1BTE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BTE 
_atom_sites.fract_transf_matrix[1][1]   0.013961 
_atom_sites.fract_transf_matrix[1][2]   0.008060 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016120 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026752 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 2  ? 15.888  47.505  13.150  1.00 34.63 ? 7   GLU A N   1 
ATOM   2    C CA  . GLU A 1 2  ? 14.455  47.789  12.947  1.00 33.53 ? 7   GLU A CA  1 
ATOM   3    C C   . GLU A 1 2  ? 13.538  46.900  13.794  1.00 29.91 ? 7   GLU A C   1 
ATOM   4    O O   . GLU A 1 2  ? 12.342  46.832  13.476  1.00 30.54 ? 7   GLU A O   1 
ATOM   5    C CB  . GLU A 1 2  ? 14.084  47.715  11.461  1.00 37.16 ? 7   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 2  ? 14.284  46.356  10.821  1.00 41.38 ? 7   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 2  ? 14.124  46.366  9.313   1.00 43.82 ? 7   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 2  ? 12.959  46.323  8.849   1.00 46.10 ? 7   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 2  ? 15.151  46.420  8.600   1.00 45.51 ? 7   GLU A OE2 1 
ATOM   10   N N   . THR A 1 3  ? 14.042  46.347  14.892  1.00 24.79 ? 8   THR A N   1 
ATOM   11   C CA  . THR A 1 3  ? 13.172  45.572  15.783  1.00 20.45 ? 8   THR A CA  1 
ATOM   12   C C   . THR A 1 3  ? 13.181  46.123  17.198  1.00 19.37 ? 8   THR A C   1 
ATOM   13   O O   . THR A 1 3  ? 14.203  46.072  17.887  1.00 19.91 ? 8   THR A O   1 
ATOM   14   C CB  . THR A 1 3  ? 13.699  44.118  15.863  1.00 20.85 ? 8   THR A CB  1 
ATOM   15   O OG1 . THR A 1 3  ? 13.892  43.635  14.525  1.00 21.50 ? 8   THR A OG1 1 
ATOM   16   C CG2 . THR A 1 3  ? 12.631  43.269  16.554  1.00 20.20 ? 8   THR A CG2 1 
ATOM   17   N N   . GLN A 1 4  ? 12.026  46.583  17.686  1.00 16.67 ? 9   GLN A N   1 
ATOM   18   C CA  . GLN A 1 4  ? 11.901  47.113  19.036  1.00 15.51 ? 9   GLN A CA  1 
ATOM   19   C C   . GLN A 1 4  ? 11.055  46.217  19.938  1.00 16.14 ? 9   GLN A C   1 
ATOM   20   O O   . GLN A 1 4  ? 11.022  46.449  21.119  1.00 16.54 ? 9   GLN A O   1 
ATOM   21   C CB  . GLN A 1 4  ? 11.267  48.524  18.991  1.00 18.10 ? 9   GLN A CB  1 
ATOM   22   C CG  . GLN A 1 4  ? 12.151  49.481  18.169  1.00 20.96 ? 9   GLN A CG  1 
ATOM   23   C CD  . GLN A 1 4  ? 11.797  49.542  16.699  1.00 20.95 ? 9   GLN A CD  1 
ATOM   24   O OE1 . GLN A 1 4  ? 10.665  49.587  16.257  1.00 20.72 ? 9   GLN A OE1 1 
ATOM   25   N NE2 . GLN A 1 4  ? 12.854  49.620  15.875  1.00 23.78 ? 9   GLN A NE2 1 
ATOM   26   N N   . GLU A 1 5  ? 10.221  45.342  19.371  1.00 13.69 ? 10  GLU A N   1 
ATOM   27   C CA  . GLU A 1 5  ? 9.316   44.570  20.233  1.00 13.03 ? 10  GLU A CA  1 
ATOM   28   C C   . GLU A 1 5  ? 8.965   43.254  19.532  1.00 15.26 ? 10  GLU A C   1 
ATOM   29   O O   . GLU A 1 5  ? 8.878   43.216  18.306  1.00 15.26 ? 10  GLU A O   1 
ATOM   30   C CB  . GLU A 1 5  ? 8.041   45.346  20.541  1.00 14.11 ? 10  GLU A CB  1 
ATOM   31   C CG  . GLU A 1 5  ? 7.240   45.747  19.305  1.00 14.82 ? 10  GLU A CG  1 
ATOM   32   C CD  . GLU A 1 5  ? 6.379   46.966  19.497  1.00 15.33 ? 10  GLU A CD  1 
ATOM   33   O OE1 . GLU A 1 5  ? 6.592   47.740  20.506  1.00 14.65 ? 10  GLU A OE1 1 
ATOM   34   O OE2 . GLU A 1 5  ? 5.498   47.234  18.666  1.00 13.48 ? 10  GLU A OE2 1 
ATOM   35   N N   . CYS A 1 6  ? 8.692   42.232  20.333  1.00 12.35 ? 11  CYS A N   1 
ATOM   36   C CA  . CYS A 1 6  ? 8.377   40.888  19.829  1.00 13.24 ? 11  CYS A CA  1 
ATOM   37   C C   . CYS A 1 6  ? 7.247   40.195  20.584  1.00 12.74 ? 11  CYS A C   1 
ATOM   38   O O   . CYS A 1 6  ? 6.833   40.603  21.685  1.00 12.76 ? 11  CYS A O   1 
ATOM   39   C CB  . CYS A 1 6  ? 9.655   40.043  20.084  1.00 13.23 ? 11  CYS A CB  1 
ATOM   40   S SG  . CYS A 1 6  ? 11.124  40.631  19.187  1.00 14.43 ? 11  CYS A SG  1 
ATOM   41   N N   . LEU A 1 7  ? 6.600   39.171  19.946  1.00 12.56 ? 12  LEU A N   1 
ATOM   42   C CA  . LEU A 1 7  ? 5.653   38.334  20.680  1.00 11.69 ? 12  LEU A CA  1 
ATOM   43   C C   . LEU A 1 7  ? 6.476   37.569  21.740  1.00 12.24 ? 12  LEU A C   1 
ATOM   44   O O   . LEU A 1 7  ? 7.535   37.023  21.445  1.00 12.43 ? 12  LEU A O   1 
ATOM   45   C CB  . LEU A 1 7  ? 4.955   37.322  19.753  1.00 13.85 ? 12  LEU A CB  1 
ATOM   46   C CG  . LEU A 1 7  ? 3.597   36.752  20.131  1.00 12.33 ? 12  LEU A CG  1 
ATOM   47   C CD1 . LEU A 1 7  ? 3.766   35.749  21.256  1.00 14.33 ? 12  LEU A CD1 1 
ATOM   48   C CD2 . LEU A 1 7  ? 2.502   37.781  20.447  1.00 15.13 ? 12  LEU A CD2 1 
ATOM   49   N N   . PHE A 1 8  ? 5.951   37.580  22.987  1.00 11.68 ? 13  PHE A N   1 
ATOM   50   C CA  . PHE A 1 8  ? 6.627   36.851  24.091  1.00 13.24 ? 13  PHE A CA  1 
ATOM   51   C C   . PHE A 1 8  ? 5.785   35.647  24.495  1.00 13.42 ? 13  PHE A C   1 
ATOM   52   O O   . PHE A 1 8  ? 4.555   35.728  24.661  1.00 13.56 ? 13  PHE A O   1 
ATOM   53   C CB  . PHE A 1 8  ? 6.763   37.796  25.312  1.00 13.74 ? 13  PHE A CB  1 
ATOM   54   C CG  . PHE A 1 8  ? 7.551   37.130  26.426  1.00 13.30 ? 13  PHE A CG  1 
ATOM   55   C CD1 . PHE A 1 8  ? 8.916   37.070  26.372  1.00 13.92 ? 13  PHE A CD1 1 
ATOM   56   C CD2 . PHE A 1 8  ? 6.877   36.571  27.509  1.00 13.53 ? 13  PHE A CD2 1 
ATOM   57   C CE1 . PHE A 1 8  ? 9.674   36.470  27.383  1.00 13.66 ? 13  PHE A CE1 1 
ATOM   58   C CE2 . PHE A 1 8  ? 7.599   35.943  28.515  1.00 15.10 ? 13  PHE A CE2 1 
ATOM   59   C CZ  . PHE A 1 8  ? 8.972   35.899  28.454  1.00 13.96 ? 13  PHE A CZ  1 
ATOM   60   N N   . PHE A 1 9  ? 6.438   34.481  24.639  1.00 12.97 ? 14  PHE A N   1 
ATOM   61   C CA  . PHE A 1 9  ? 5.827   33.229  25.104  1.00 12.71 ? 14  PHE A CA  1 
ATOM   62   C C   . PHE A 1 9  ? 6.909   32.443  25.860  1.00 12.72 ? 14  PHE A C   1 
ATOM   63   O O   . PHE A 1 9  ? 8.060   32.357  25.405  1.00 14.28 ? 14  PHE A O   1 
ATOM   64   C CB  . PHE A 1 9  ? 5.354   32.402  23.891  1.00 13.78 ? 14  PHE A CB  1 
ATOM   65   C CG  . PHE A 1 9  ? 4.428   31.234  24.110  1.00 13.61 ? 14  PHE A CG  1 
ATOM   66   C CD1 . PHE A 1 9  ? 4.878   30.113  24.782  1.00 14.48 ? 14  PHE A CD1 1 
ATOM   67   C CD2 . PHE A 1 9  ? 3.158   31.218  23.581  1.00 15.78 ? 14  PHE A CD2 1 
ATOM   68   C CE1 . PHE A 1 9  ? 4.032   29.030  24.984  1.00 15.65 ? 14  PHE A CE1 1 
ATOM   69   C CE2 . PHE A 1 9  ? 2.321   30.121  23.733  1.00 16.82 ? 14  PHE A CE2 1 
ATOM   70   C CZ  . PHE A 1 9  ? 2.762   29.027  24.442  1.00 17.20 ? 14  PHE A CZ  1 
ATOM   71   N N   . ASN A 1 10 ? 6.544   31.827  27.004  1.00 12.95 ? 15  ASN A N   1 
ATOM   72   C CA  . ASN A 1 10 ? 7.464   30.982  27.767  1.00 14.57 ? 15  ASN A CA  1 
ATOM   73   C C   . ASN A 1 10 ? 6.701   29.827  28.419  1.00 14.68 ? 15  ASN A C   1 
ATOM   74   O O   . ASN A 1 10 ? 5.901   30.031  29.336  1.00 16.36 ? 15  ASN A O   1 
ATOM   75   C CB  . ASN A 1 10 ? 8.187   31.817  28.857  1.00 13.79 ? 15  ASN A CB  1 
ATOM   76   C CG  . ASN A 1 10 ? 9.216   30.950  29.587  1.00 15.84 ? 15  ASN A CG  1 
ATOM   77   O OD1 . ASN A 1 10 ? 9.512   29.850  29.123  1.00 18.03 ? 15  ASN A OD1 1 
ATOM   78   N ND2 . ASN A 1 10 ? 9.784   31.496  30.676  1.00 15.08 ? 15  ASN A ND2 1 
ATOM   79   N N   . ALA A 1 11 ? 6.845   28.636  27.813  1.00 15.24 ? 16  ALA A N   1 
ATOM   80   C CA  . ALA A 1 11 ? 6.137   27.490  28.406  1.00 16.37 ? 16  ALA A CA  1 
ATOM   81   C C   . ALA A 1 11 ? 6.663   27.194  29.807  1.00 17.20 ? 16  ALA A C   1 
ATOM   82   O O   . ALA A 1 11 ? 5.846   26.627  30.563  1.00 18.00 ? 16  ALA A O   1 
ATOM   83   C CB  . ALA A 1 11 ? 6.320   26.253  27.522  1.00 19.05 ? 16  ALA A CB  1 
ATOM   84   N N   . ASN A 1 12 ? 7.852   27.608  30.169  1.00 19.21 ? 17  ASN A N   1 
ATOM   85   C CA  . ASN A 1 12 ? 8.388   27.383  31.515  1.00 19.13 ? 17  ASN A CA  1 
ATOM   86   C C   . ASN A 1 12 ? 8.167   28.588  32.427  1.00 17.64 ? 17  ASN A C   1 
ATOM   87   O O   . ASN A 1 12 ? 8.990   28.817  33.324  1.00 18.33 ? 17  ASN A O   1 
ATOM   88   C CB  . ASN A 1 12 ? 9.896   27.103  31.369  1.00 20.77 ? 17  ASN A CB  1 
ATOM   89   C CG  . ASN A 1 12 ? 10.165  25.686  30.890  1.00 23.89 ? 17  ASN A CG  1 
ATOM   90   O OD1 . ASN A 1 12 ? 9.275   24.826  30.867  1.00 24.81 ? 17  ASN A OD1 1 
ATOM   91   N ND2 . ASN A 1 12 ? 11.422  25.430  30.523  1.00 26.09 ? 17  ASN A ND2 1 
ATOM   92   N N   . TRP A 1 13 ? 7.117   29.399  32.180  1.00 15.50 ? 18  TRP A N   1 
ATOM   93   C CA  . TRP A 1 13 ? 6.893   30.621  32.940  1.00 16.46 ? 18  TRP A CA  1 
ATOM   94   C C   . TRP A 1 13 ? 6.803   30.427  34.444  1.00 16.16 ? 18  TRP A C   1 
ATOM   95   O O   . TRP A 1 13 ? 7.241   31.366  35.149  1.00 16.35 ? 18  TRP A O   1 
ATOM   96   C CB  . TRP A 1 13 ? 5.637   31.333  32.395  1.00 16.33 ? 18  TRP A CB  1 
ATOM   97   C CG  . TRP A 1 13 ? 4.339   30.584  32.565  1.00 15.23 ? 18  TRP A CG  1 
ATOM   98   C CD1 . TRP A 1 13 ? 3.899   29.519  31.810  1.00 16.45 ? 18  TRP A CD1 1 
ATOM   99   C CD2 . TRP A 1 13 ? 3.347   30.766  33.589  1.00 18.27 ? 18  TRP A CD2 1 
ATOM   100  N NE1 . TRP A 1 13 ? 2.667   29.060  32.280  1.00 17.87 ? 18  TRP A NE1 1 
ATOM   101  C CE2 . TRP A 1 13 ? 2.334   29.837  33.354  1.00 18.90 ? 18  TRP A CE2 1 
ATOM   102  C CE3 . TRP A 1 13 ? 3.255   31.647  34.652  1.00 20.69 ? 18  TRP A CE3 1 
ATOM   103  C CZ2 . TRP A 1 13 ? 1.199   29.749  34.171  1.00 21.07 ? 18  TRP A CZ2 1 
ATOM   104  C CZ3 . TRP A 1 13 ? 2.124   31.589  35.457  1.00 22.76 ? 18  TRP A CZ3 1 
ATOM   105  C CH2 . TRP A 1 13 ? 1.108   30.657  35.186  1.00 22.17 ? 18  TRP A CH2 1 
ATOM   106  N N   . GLU A 1 14 ? 6.172   29.351  34.910  1.00 18.45 ? 19  GLU A N   1 
ATOM   107  C CA  . GLU A 1 14 ? 5.993   29.262  36.352  1.00 19.18 ? 19  GLU A CA  1 
ATOM   108  C C   . GLU A 1 14 ? 7.345   29.135  37.037  1.00 17.96 ? 19  GLU A C   1 
ATOM   109  O O   . GLU A 1 14 ? 7.689   29.870  37.979  1.00 18.07 ? 19  GLU A O   1 
ATOM   110  C CB  . GLU A 1 14 ? 5.130   28.028  36.701  1.00 22.59 ? 19  GLU A CB  1 
ATOM   111  C CG  . GLU A 1 14 ? 3.672   28.185  36.302  1.00 26.69 ? 19  GLU A CG  1 
ATOM   112  C CD  . GLU A 1 14 ? 2.826   28.805  37.402  1.00 30.31 ? 19  GLU A CD  1 
ATOM   113  O OE1 . GLU A 1 14 ? 3.330   29.694  38.134  1.00 30.86 ? 19  GLU A OE1 1 
ATOM   114  O OE2 . GLU A 1 14 ? 1.627   28.450  37.505  1.00 32.87 ? 19  GLU A OE2 1 
ATOM   115  N N   . ARG A 1 15 ? 8.185   28.217  36.588  1.00 17.86 ? 20  ARG A N   1 
ATOM   116  C CA  . ARG A 1 15 ? 9.498   28.040  37.249  1.00 20.02 ? 20  ARG A CA  1 
ATOM   117  C C   . ARG A 1 15 ? 10.442  29.181  36.950  1.00 20.25 ? 20  ARG A C   1 
ATOM   118  O O   . ARG A 1 15 ? 11.239  29.606  37.819  1.00 20.45 ? 20  ARG A O   1 
ATOM   119  C CB  . ARG A 1 15 ? 10.023  26.651  36.944  1.00 22.83 ? 20  ARG A CB  1 
ATOM   120  C CG  . ARG A 1 15 ? 10.524  26.370  35.537  1.00 26.13 ? 20  ARG A CG  1 
ATOM   121  C CD  . ARG A 1 15 ? 10.824  24.888  35.500  1.00 29.84 ? 20  ARG A CD  1 
ATOM   122  N NE  . ARG A 1 15 ? 11.310  24.301  34.261  1.00 31.04 ? 20  ARG A NE  1 
ATOM   123  C CZ  . ARG A 1 15 ? 10.557  23.414  33.589  1.00 30.73 ? 20  ARG A CZ  1 
ATOM   124  N NH1 . ARG A 1 15 ? 9.320   23.141  33.970  1.00 30.54 ? 20  ARG A NH1 1 
ATOM   125  N NH2 . ARG A 1 15 ? 11.068  22.838  32.513  1.00 31.44 ? 20  ARG A NH2 1 
ATOM   126  N N   . ASP A 1 16 ? 10.361  29.837  35.782  1.00 18.53 ? 21  ASP A N   1 
ATOM   127  C CA  . ASP A 1 16 ? 11.234  30.925  35.418  1.00 19.94 ? 21  ASP A CA  1 
ATOM   128  C C   . ASP A 1 16 ? 10.847  32.297  35.970  1.00 19.67 ? 21  ASP A C   1 
ATOM   129  O O   . ASP A 1 16 ? 11.640  33.264  35.957  1.00 21.14 ? 21  ASP A O   1 
ATOM   130  C CB  . ASP A 1 16 ? 11.363  31.057  33.895  1.00 20.41 ? 21  ASP A CB  1 
ATOM   131  C CG  . ASP A 1 16 ? 12.062  29.914  33.216  1.00 22.45 ? 21  ASP A CG  1 
ATOM   132  O OD1 . ASP A 1 16 ? 12.682  29.027  33.836  1.00 22.51 ? 21  ASP A OD1 1 
ATOM   133  O OD2 . ASP A 1 16 ? 12.002  29.904  31.901  1.00 19.42 ? 21  ASP A OD2 1 
ATOM   134  N N   . ARG A 1 17 ? 9.650   32.410  36.527  1.00 19.58 ? 22  ARG A N   1 
ATOM   135  C CA  . ARG A 1 17 ? 9.105   33.631  37.072  1.00 19.61 ? 22  ARG A CA  1 
ATOM   136  C C   . ARG A 1 17 ? 8.964   34.746  36.027  1.00 19.95 ? 22  ARG A C   1 
ATOM   137  O O   . ARG A 1 17 ? 9.301   35.904  36.223  1.00 21.46 ? 22  ARG A O   1 
ATOM   138  C CB  . ARG A 1 17 ? 9.938   34.150  38.267  1.00 19.47 ? 22  ARG A CB  1 
ATOM   139  C CG  . ARG A 1 17 ? 10.314  33.042  39.257  1.00 20.50 ? 22  ARG A CG  1 
ATOM   140  C CD  . ARG A 1 17 ? 9.123   32.224  39.706  1.00 21.84 ? 22  ARG A CD  1 
ATOM   141  N NE  . ARG A 1 17 ? 8.200   33.036  40.489  1.00 23.35 ? 22  ARG A NE  1 
ATOM   142  C CZ  . ARG A 1 17 ? 6.908   32.762  40.580  1.00 23.87 ? 22  ARG A CZ  1 
ATOM   143  N NH1 . ARG A 1 17 ? 6.411   31.725  39.897  1.00 23.65 ? 22  ARG A NH1 1 
ATOM   144  N NH2 . ARG A 1 17 ? 6.130   33.552  41.321  1.00 26.81 ? 22  ARG A NH2 1 
ATOM   145  N N   . THR A 1 18 ? 8.343   34.370  34.903  1.00 16.58 ? 23  THR A N   1 
ATOM   146  C CA  . THR A 1 18 ? 8.033   35.330  33.829  1.00 16.50 ? 23  THR A CA  1 
ATOM   147  C C   . THR A 1 18 ? 6.544   35.291  33.531  1.00 15.50 ? 23  THR A C   1 
ATOM   148  O O   . THR A 1 18 ? 5.769   34.487  33.994  1.00 16.55 ? 23  THR A O   1 
ATOM   149  C CB  . THR A 1 18 ? 8.805   34.981  32.538  1.00 17.76 ? 23  THR A CB  1 
ATOM   150  O OG1 . THR A 1 18 ? 8.289   33.786  31.928  1.00 16.65 ? 23  THR A OG1 1 
ATOM   151  C CG2 . THR A 1 18 ? 10.297  34.802  32.732  1.00 18.46 ? 23  THR A CG2 1 
ATOM   152  N N   . ASN A 1 19 ? 6.098   36.247  32.660  1.00 14.43 ? 24  ASN A N   1 
ATOM   153  C CA  . ASN A 1 19 ? 4.764   36.104  32.103  1.00 14.16 ? 24  ASN A CA  1 
ATOM   154  C C   . ASN A 1 19 ? 4.724   34.808  31.281  1.00 14.05 ? 24  ASN A C   1 
ATOM   155  O O   . ASN A 1 19 ? 5.731   34.281  30.792  1.00 14.16 ? 24  ASN A O   1 
ATOM   156  C CB  . ASN A 1 19 ? 4.565   37.247  31.084  1.00 14.16 ? 24  ASN A CB  1 
ATOM   157  C CG  . ASN A 1 19 ? 4.485   38.653  31.650  1.00 16.45 ? 24  ASN A CG  1 
ATOM   158  O OD1 . ASN A 1 19 ? 4.429   38.787  32.886  1.00 18.89 ? 24  ASN A OD1 1 
ATOM   159  N ND2 . ASN A 1 19 ? 4.428   39.670  30.768  1.00 14.91 ? 24  ASN A ND2 1 
ATOM   160  N N   . GLN A 1 20 ? 3.504   34.281  31.093  1.00 14.49 ? 25  GLN A N   1 
ATOM   161  C CA  . GLN A 1 20 ? 3.338   33.117  30.188  1.00 14.52 ? 25  GLN A CA  1 
ATOM   162  C C   . GLN A 1 20 ? 3.380   33.656  28.746  1.00 15.16 ? 25  GLN A C   1 
ATOM   163  O O   . GLN A 1 20 ? 3.944   32.985  27.848  1.00 14.57 ? 25  GLN A O   1 
ATOM   164  C CB  . GLN A 1 20 ? 2.010   32.406  30.499  1.00 17.06 ? 25  GLN A CB  1 
ATOM   165  C CG  . GLN A 1 20 ? 1.710   31.213  29.620  1.00 18.98 ? 25  GLN A CG  1 
ATOM   166  C CD  . GLN A 1 20 ? 0.525   30.342  30.055  1.00 21.45 ? 25  GLN A CD  1 
ATOM   167  O OE1 . GLN A 1 20 ? -0.306  30.717  30.851  1.00 24.97 ? 25  GLN A OE1 1 
ATOM   168  N NE2 . GLN A 1 20 ? 0.450   29.175  29.412  1.00 25.10 ? 25  GLN A NE2 1 
ATOM   169  N N   . THR A 1 21 ? 2.712   34.774  28.505  1.00 14.43 ? 26  THR A N   1 
ATOM   170  C CA  . THR A 1 21 ? 2.702   35.410  27.174  1.00 14.15 ? 26  THR A CA  1 
ATOM   171  C C   . THR A 1 21 ? 2.729   36.916  27.336  1.00 14.36 ? 26  THR A C   1 
ATOM   172  O O   . THR A 1 21 ? 2.412   37.469  28.399  1.00 14.70 ? 26  THR A O   1 
ATOM   173  C CB  . THR A 1 21 ? 1.404   35.143  26.364  1.00 12.05 ? 26  THR A CB  1 
ATOM   174  O OG1 . THR A 1 21 ? 0.300   35.688  27.117  1.00 13.56 ? 26  THR A OG1 1 
ATOM   175  C CG2 . THR A 1 21 ? 1.140   33.662  26.134  1.00 14.60 ? 26  THR A CG2 1 
ATOM   176  N N   . GLY A 1 22 ? 3.002   37.683  26.251  1.00 14.02 ? 27  GLY A N   1 
ATOM   177  C CA  . GLY A 1 22 ? 2.899   39.118  26.207  1.00 13.75 ? 27  GLY A CA  1 
ATOM   178  C C   . GLY A 1 22 ? 3.631   39.741  24.997  1.00 13.88 ? 27  GLY A C   1 
ATOM   179  O O   . GLY A 1 22 ? 3.744   39.042  24.001  1.00 14.07 ? 27  GLY A O   1 
ATOM   180  N N   . VAL A 1 23 ? 4.100   40.947  25.233  1.00 12.90 ? 28  VAL A N   1 
ATOM   181  C CA  . VAL A 1 23 ? 4.879   41.698  24.237  1.00 12.82 ? 28  VAL A CA  1 
ATOM   182  C C   . VAL A 1 23 ? 6.246   41.987  24.870  1.00 14.74 ? 28  VAL A C   1 
ATOM   183  O O   . VAL A 1 23 ? 6.283   42.662  25.923  1.00 15.74 ? 28  VAL A O   1 
ATOM   184  C CB  . VAL A 1 23 ? 4.179   42.963  23.798  1.00 12.99 ? 28  VAL A CB  1 
ATOM   185  C CG1 . VAL A 1 23 ? 4.931   43.854  22.798  1.00 13.46 ? 28  VAL A CG1 1 
ATOM   186  C CG2 . VAL A 1 23 ? 2.793   42.675  23.185  1.00 13.85 ? 28  VAL A CG2 1 
ATOM   187  N N   . GLU A 1 24 ? 7.352   41.482  24.353  1.00 14.13 ? 29  GLU A N   1 
ATOM   188  C CA  . GLU A 1 24 ? 8.662   41.812  24.948  1.00 15.11 ? 29  GLU A CA  1 
ATOM   189  C C   . GLU A 1 24 ? 9.258   43.018  24.267  1.00 15.54 ? 29  GLU A C   1 
ATOM   190  O O   . GLU A 1 24 ? 9.539   42.995  23.054  1.00 14.92 ? 29  GLU A O   1 
ATOM   191  C CB  . GLU A 1 24 ? 9.614   40.598  24.829  1.00 15.03 ? 29  GLU A CB  1 
ATOM   192  C CG  . GLU A 1 24 ? 10.851  40.833  25.740  1.00 15.83 ? 29  GLU A CG  1 
ATOM   193  C CD  . GLU A 1 24 ? 11.745  39.613  25.723  1.00 17.01 ? 29  GLU A CD  1 
ATOM   194  O OE1 . GLU A 1 24 ? 11.712  38.681  24.890  1.00 15.78 ? 29  GLU A OE1 1 
ATOM   195  O OE2 . GLU A 1 24 ? 12.663  39.600  26.636  1.00 18.34 ? 29  GLU A OE2 1 
ATOM   196  N N   . PRO A 1 25 ? 9.736   44.042  25.007  1.00 16.82 ? 30  PRO A N   1 
ATOM   197  C CA  . PRO A 1 25 ? 10.501  45.153  24.489  1.00 17.52 ? 30  PRO A CA  1 
ATOM   198  C C   . PRO A 1 25 ? 11.956  44.751  24.334  1.00 18.87 ? 30  PRO A C   1 
ATOM   199  O O   . PRO A 1 25 ? 12.535  44.204  25.302  1.00 19.90 ? 30  PRO A O   1 
ATOM   200  C CB  . PRO A 1 25 ? 10.353  46.262  25.552  1.00 17.15 ? 30  PRO A CB  1 
ATOM   201  C CG  . PRO A 1 25 ? 10.018  45.526  26.786  1.00 17.68 ? 30  PRO A CG  1 
ATOM   202  C CD  . PRO A 1 25 ? 9.470   44.150  26.465  1.00 17.88 ? 30  PRO A CD  1 
ATOM   203  N N   . CYS A 1 26 ? 12.535  44.947  23.164  1.00 18.96 ? 31  CYS A N   1 
ATOM   204  C CA  . CYS A 1 26 ? 13.918  44.568  22.945  1.00 20.62 ? 31  CYS A CA  1 
ATOM   205  C C   . CYS A 1 26 ? 14.897  45.712  23.264  1.00 21.55 ? 31  CYS A C   1 
ATOM   206  O O   . CYS A 1 26 ? 14.752  46.773  22.697  1.00 22.36 ? 31  CYS A O   1 
ATOM   207  C CB  . CYS A 1 26 ? 14.170  44.099  21.522  1.00 20.05 ? 31  CYS A CB  1 
ATOM   208  S SG  . CYS A 1 26 ? 12.959  42.911  20.913  1.00 18.46 ? 31  CYS A SG  1 
ATOM   209  N N   . TYR A 1 27 ? 15.865  45.431  24.136  1.00 26.01 ? 32  TYR A N   1 
ATOM   210  C CA  . TYR A 1 27 ? 16.836  46.481  24.488  1.00 30.62 ? 32  TYR A CA  1 
ATOM   211  C C   . TYR A 1 27 ? 18.239  45.974  24.214  1.00 35.57 ? 32  TYR A C   1 
ATOM   212  O O   . TYR A 1 27 ? 18.522  45.676  23.053  1.00 37.72 ? 32  TYR A O   1 
ATOM   213  C CB  . TYR A 1 27 ? 16.612  46.950  25.920  1.00 30.46 ? 32  TYR A CB  1 
ATOM   214  C CG  . TYR A 1 27 ? 15.394  47.849  26.054  1.00 30.54 ? 32  TYR A CG  1 
ATOM   215  C CD1 . TYR A 1 27 ? 15.348  49.071  25.394  1.00 30.51 ? 32  TYR A CD1 1 
ATOM   216  C CD2 . TYR A 1 27 ? 14.290  47.465  26.813  1.00 30.85 ? 32  TYR A CD2 1 
ATOM   217  C CE1 . TYR A 1 27 ? 14.232  49.891  25.492  1.00 30.98 ? 32  TYR A CE1 1 
ATOM   218  C CE2 . TYR A 1 27 ? 13.181  48.286  26.910  1.00 31.31 ? 32  TYR A CE2 1 
ATOM   219  C CZ  . TYR A 1 27 ? 13.153  49.496  26.256  1.00 31.06 ? 32  TYR A CZ  1 
ATOM   220  O OH  . TYR A 1 27 ? 12.047  50.323  26.368  1.00 31.82 ? 32  TYR A OH  1 
ATOM   221  N N   . GLY A 1 28 ? 19.097  45.844  25.213  1.00 39.86 ? 33  GLY A N   1 
ATOM   222  C CA  . GLY A 1 28 ? 20.451  45.352  24.982  1.00 43.16 ? 33  GLY A CA  1 
ATOM   223  C C   . GLY A 1 28 ? 21.183  46.219  23.957  1.00 45.82 ? 33  GLY A C   1 
ATOM   224  O O   . GLY A 1 28 ? 21.088  45.896  22.746  1.00 48.42 ? 33  GLY A O   1 
ATOM   225  N N   . ARG A 1 33 ? 22.157  45.100  16.285  1.00 35.73 ? 38  ARG A N   1 
ATOM   226  C CA  . ARG A 1 33 ? 20.876  44.662  15.667  1.00 34.05 ? 38  ARG A CA  1 
ATOM   227  C C   . ARG A 1 33 ? 20.107  43.684  16.566  1.00 33.87 ? 38  ARG A C   1 
ATOM   228  O O   . ARG A 1 33 ? 20.597  42.654  17.003  1.00 34.23 ? 38  ARG A O   1 
ATOM   229  C CB  . ARG A 1 33 ? 21.055  44.014  14.303  1.00 35.97 ? 38  ARG A CB  1 
ATOM   230  N N   . ARG A 1 34 ? 18.850  44.034  16.791  1.00 29.65 ? 39  ARG A N   1 
ATOM   231  C CA  . ARG A 1 34 ? 17.922  43.214  17.554  1.00 27.91 ? 39  ARG A CA  1 
ATOM   232  C C   . ARG A 1 34 ? 17.107  42.344  16.599  1.00 24.04 ? 39  ARG A C   1 
ATOM   233  O O   . ARG A 1 34 ? 17.031  42.627  15.401  1.00 22.90 ? 39  ARG A O   1 
ATOM   234  C CB  . ARG A 1 34 ? 16.982  44.146  18.343  1.00 29.42 ? 39  ARG A CB  1 
ATOM   235  C CG  . ARG A 1 34 ? 17.799  45.009  19.306  1.00 33.49 ? 39  ARG A CG  1 
ATOM   236  C CD  . ARG A 1 34 ? 16.986  46.113  19.937  1.00 35.78 ? 39  ARG A CD  1 
ATOM   237  N NE  . ARG A 1 34 ? 16.606  47.180  19.028  1.00 37.35 ? 39  ARG A NE  1 
ATOM   238  C CZ  . ARG A 1 34 ? 16.058  48.341  19.401  1.00 38.69 ? 39  ARG A CZ  1 
ATOM   239  N NH1 . ARG A 1 34 ? 15.819  48.586  20.682  1.00 37.39 ? 39  ARG A NH1 1 
ATOM   240  N NH2 . ARG A 1 34 ? 15.733  49.240  18.470  1.00 40.05 ? 39  ARG A NH2 1 
ATOM   241  N N   . HIS A 1 35 ? 16.659  41.185  17.099  1.00 20.17 ? 40  HIS A N   1 
ATOM   242  C CA  . HIS A 1 35 ? 15.802  40.304  16.336  1.00 17.83 ? 40  HIS A CA  1 
ATOM   243  C C   . HIS A 1 35 ? 14.675  39.769  17.238  1.00 17.05 ? 40  HIS A C   1 
ATOM   244  O O   . HIS A 1 35 ? 14.811  39.855  18.464  1.00 17.80 ? 40  HIS A O   1 
ATOM   245  C CB  . HIS A 1 35 ? 16.528  39.065  15.766  1.00 19.02 ? 40  HIS A CB  1 
ATOM   246  C CG  . HIS A 1 35 ? 17.656  39.368  14.817  1.00 24.04 ? 40  HIS A CG  1 
ATOM   247  N ND1 . HIS A 1 35 ? 17.527  39.234  13.463  1.00 26.05 ? 40  HIS A ND1 1 
ATOM   248  C CD2 . HIS A 1 35 ? 18.922  39.780  15.078  1.00 24.58 ? 40  HIS A CD2 1 
ATOM   249  C CE1 . HIS A 1 35 ? 18.682  39.610  12.893  1.00 26.36 ? 40  HIS A CE1 1 
ATOM   250  N NE2 . HIS A 1 35 ? 19.541  39.940  13.856  1.00 28.67 ? 40  HIS A NE2 1 
ATOM   251  N N   . CYS A 1 36 ? 13.648  39.181  16.627  1.00 14.87 ? 41  CYS A N   1 
ATOM   252  C CA  . CYS A 1 36 ? 12.695  38.309  17.327  1.00 14.14 ? 41  CYS A CA  1 
ATOM   253  C C   . CYS A 1 36 ? 12.988  36.864  16.955  1.00 13.07 ? 41  CYS A C   1 
ATOM   254  O O   . CYS A 1 36 ? 13.715  36.530  16.015  1.00 15.34 ? 41  CYS A O   1 
ATOM   255  C CB  . CYS A 1 36 ? 11.240  38.595  16.928  1.00 14.86 ? 41  CYS A CB  1 
ATOM   256  S SG  . CYS A 1 36 ? 10.672  40.303  17.200  1.00 14.87 ? 41  CYS A SG  1 
ATOM   257  N N   . PHE A 1 37 ? 12.497  35.939  17.798  1.00 13.38 ? 42  PHE A N   1 
ATOM   258  C CA  . PHE A 1 37 ? 12.698  34.517  17.507  1.00 13.46 ? 42  PHE A CA  1 
ATOM   259  C C   . PHE A 1 37 ? 11.533  33.688  18.012  1.00 12.98 ? 42  PHE A C   1 
ATOM   260  O O   . PHE A 1 37 ? 10.750  34.094  18.864  1.00 13.43 ? 42  PHE A O   1 
ATOM   261  C CB  . PHE A 1 37 ? 14.002  33.947  18.187  1.00 14.33 ? 42  PHE A CB  1 
ATOM   262  C CG  . PHE A 1 37 ? 13.849  33.625  19.663  1.00 14.82 ? 42  PHE A CG  1 
ATOM   263  C CD1 . PHE A 1 37 ? 13.811  34.646  20.609  1.00 14.82 ? 42  PHE A CD1 1 
ATOM   264  C CD2 . PHE A 1 37 ? 13.689  32.320  20.080  1.00 14.65 ? 42  PHE A CD2 1 
ATOM   265  C CE1 . PHE A 1 37 ? 13.659  34.354  21.958  1.00 15.80 ? 42  PHE A CE1 1 
ATOM   266  C CE2 . PHE A 1 37 ? 13.422  32.017  21.408  1.00 17.19 ? 42  PHE A CE2 1 
ATOM   267  C CZ  . PHE A 1 37 ? 13.436  33.060  22.334  1.00 15.10 ? 42  PHE A CZ  1 
ATOM   268  N N   . ALA A 1 38 ? 11.471  32.452  17.523  1.00 12.41 ? 43  ALA A N   1 
ATOM   269  C CA  . ALA A 1 38 ? 10.622  31.407  18.076  1.00 12.52 ? 43  ALA A CA  1 
ATOM   270  C C   . ALA A 1 38 ? 11.368  30.083  18.142  1.00 14.34 ? 43  ALA A C   1 
ATOM   271  O O   . ALA A 1 38 ? 12.197  29.753  17.279  1.00 13.88 ? 43  ALA A O   1 
ATOM   272  C CB  . ALA A 1 38 ? 9.422   31.191  17.145  1.00 13.44 ? 43  ALA A CB  1 
ATOM   273  N N   . THR A 1 39 ? 11.034  29.264  19.169  1.00 13.29 ? 44  THR A N   1 
ATOM   274  C CA  . THR A 1 39 ? 11.529  27.901  19.268  1.00 15.50 ? 44  THR A CA  1 
ATOM   275  C C   . THR A 1 39 ? 10.341  26.992  19.540  1.00 15.26 ? 44  THR A C   1 
ATOM   276  O O   . THR A 1 39 ? 9.405   27.355  20.281  1.00 15.03 ? 44  THR A O   1 
ATOM   277  C CB  . THR A 1 39 ? 12.564  27.632  20.368  1.00 17.51 ? 44  THR A CB  1 
ATOM   278  O OG1 . THR A 1 39 ? 12.044  28.171  21.585  1.00 18.40 ? 44  THR A OG1 1 
ATOM   279  C CG2 . THR A 1 39 ? 13.898  28.265  20.011  1.00 18.52 ? 44  THR A CG2 1 
ATOM   280  N N   . TRP A 1 40 ? 10.295  25.827  18.860  1.00 14.18 ? 45  TRP A N   1 
ATOM   281  C CA  . TRP A 1 40 ? 9.116   24.961  19.018  1.00 14.07 ? 45  TRP A CA  1 
ATOM   282  C C   . TRP A 1 40 ? 9.449   23.488  18.760  1.00 14.96 ? 45  TRP A C   1 
ATOM   283  O O   . TRP A 1 40 ? 10.546  23.205  18.243  1.00 14.94 ? 45  TRP A O   1 
ATOM   284  C CB  . TRP A 1 40 ? 8.032   25.417  18.047  1.00 15.42 ? 45  TRP A CB  1 
ATOM   285  C CG  . TRP A 1 40 ? 8.260   25.245  16.573  1.00 14.50 ? 45  TRP A CG  1 
ATOM   286  C CD1 . TRP A 1 40 ? 7.725   24.254  15.781  1.00 15.66 ? 45  TRP A CD1 1 
ATOM   287  C CD2 . TRP A 1 40 ? 8.956   26.154  15.691  1.00 15.10 ? 45  TRP A CD2 1 
ATOM   288  N NE1 . TRP A 1 40 ? 8.157   24.435  14.482  1.00 14.63 ? 45  TRP A NE1 1 
ATOM   289  C CE2 . TRP A 1 40 ? 8.825   25.631  14.395  1.00 14.07 ? 45  TRP A CE2 1 
ATOM   290  C CE3 . TRP A 1 40 ? 9.617   27.360  15.872  1.00 12.82 ? 45  TRP A CE3 1 
ATOM   291  C CZ2 . TRP A 1 40 ? 9.366   26.270  13.260  1.00 14.22 ? 45  TRP A CZ2 1 
ATOM   292  C CZ3 . TRP A 1 40 ? 10.208  27.992  14.789  1.00 14.43 ? 45  TRP A CZ3 1 
ATOM   293  C CH2 . TRP A 1 40 ? 10.059  27.424  13.502  1.00 15.06 ? 45  TRP A CH2 1 
ATOM   294  N N   . LYS A 1 41 ? 8.541   22.617  19.210  1.00 16.00 ? 46  LYS A N   1 
ATOM   295  C CA  . LYS A 1 41 ? 8.638   21.202  18.878  1.00 17.14 ? 46  LYS A CA  1 
ATOM   296  C C   . LYS A 1 41 ? 7.555   20.919  17.838  1.00 15.85 ? 46  LYS A C   1 
ATOM   297  O O   . LYS A 1 41 ? 6.485   21.544  17.821  1.00 15.93 ? 46  LYS A O   1 
ATOM   298  C CB  . LYS A 1 41 ? 8.366   20.333  20.141  1.00 20.94 ? 46  LYS A CB  1 
ATOM   299  C CG  . LYS A 1 41 ? 9.407   20.682  21.194  1.00 25.30 ? 46  LYS A CG  1 
ATOM   300  C CD  . LYS A 1 41 ? 9.688   19.639  22.252  1.00 31.14 ? 46  LYS A CD  1 
ATOM   301  C CE  . LYS A 1 41 ? 11.043  19.925  22.918  1.00 33.11 ? 46  LYS A CE  1 
ATOM   302  N NZ  . LYS A 1 41 ? 11.975  18.757  22.875  1.00 36.41 ? 46  LYS A NZ  1 
ATOM   303  N N   . ASN A 1 42 ? 7.816   19.966  16.939  1.00 15.17 ? 47  ASN A N   1 
ATOM   304  C CA  . ASN A 1 42 ? 6.858   19.576  15.909  1.00 17.39 ? 47  ASN A CA  1 
ATOM   305  C C   . ASN A 1 42 ? 6.940   18.048  15.754  1.00 20.18 ? 47  ASN A C   1 
ATOM   306  O O   . ASN A 1 42 ? 7.926   17.562  15.204  1.00 21.08 ? 47  ASN A O   1 
ATOM   307  C CB  . ASN A 1 42 ? 7.146   20.289  14.586  1.00 19.02 ? 47  ASN A CB  1 
ATOM   308  C CG  . ASN A 1 42 ? 6.207   19.890  13.436  1.00 19.29 ? 47  ASN A CG  1 
ATOM   309  O OD1 . ASN A 1 42 ? 5.341   19.028  13.678  1.00 19.89 ? 47  ASN A OD1 1 
ATOM   310  N ND2 . ASN A 1 42 ? 6.424   20.558  12.312  1.00 19.43 ? 47  ASN A ND2 1 
ATOM   311  N N   . ILE A 1 43 ? 5.983   17.378  16.374  1.00 19.17 ? 48  ILE A N   1 
ATOM   312  C CA  . ILE A 1 43 ? 5.939   15.900  16.327  1.00 21.39 ? 48  ILE A CA  1 
ATOM   313  C C   . ILE A 1 43 ? 4.733   15.503  15.499  1.00 21.06 ? 48  ILE A C   1 
ATOM   314  O O   . ILE A 1 43 ? 3.561   15.686  15.824  1.00 18.41 ? 48  ILE A O   1 
ATOM   315  C CB  . ILE A 1 43 ? 5.816   15.305  17.733  1.00 23.58 ? 48  ILE A CB  1 
ATOM   316  C CG1 . ILE A 1 43 ? 6.914   15.845  18.660  1.00 24.74 ? 48  ILE A CG1 1 
ATOM   317  C CG2 . ILE A 1 43 ? 5.823   13.771  17.724  1.00 23.20 ? 48  ILE A CG2 1 
ATOM   318  C CD1 . ILE A 1 43 ? 8.319   15.600  18.181  1.00 24.87 ? 48  ILE A CD1 1 
ATOM   319  N N   . SER A 1 44 ? 5.073   14.938  14.327  1.00 21.76 ? 49  SER A N   1 
ATOM   320  C CA  . SER A 1 44 ? 4.030   14.532  13.365  1.00 24.00 ? 49  SER A CA  1 
ATOM   321  C C   . SER A 1 44 ? 3.048   15.640  13.044  1.00 22.41 ? 49  SER A C   1 
ATOM   322  O O   . SER A 1 44 ? 1.839   15.388  12.972  1.00 23.01 ? 49  SER A O   1 
ATOM   323  C CB  . SER A 1 44 ? 3.288   13.284  13.898  1.00 24.07 ? 49  SER A CB  1 
ATOM   324  O OG  . SER A 1 44 ? 4.233   12.288  14.294  1.00 26.91 ? 49  SER A OG  1 
ATOM   325  N N   . GLY A 1 45 ? 3.461   16.904  12.930  1.00 21.68 ? 50  GLY A N   1 
ATOM   326  C CA  . GLY A 1 45 ? 2.553   17.992  12.629  1.00 21.86 ? 50  GLY A CA  1 
ATOM   327  C C   . GLY A 1 45 ? 2.002   18.689  13.855  1.00 21.23 ? 50  GLY A C   1 
ATOM   328  O O   . GLY A 1 45 ? 1.461   19.794  13.713  1.00 25.85 ? 50  GLY A O   1 
ATOM   329  N N   . SER A 1 46 ? 2.085   18.110  15.050  1.00 19.73 ? 51  SER A N   1 
ATOM   330  C CA  . SER A 1 46 ? 1.595   18.775  16.266  1.00 20.98 ? 51  SER A CA  1 
ATOM   331  C C   . SER A 1 46 ? 2.645   19.716  16.850  1.00 19.37 ? 51  SER A C   1 
ATOM   332  O O   . SER A 1 46 ? 3.754   19.312  17.219  1.00 18.19 ? 51  SER A O   1 
ATOM   333  C CB  . SER A 1 46 ? 1.177   17.715  17.293  1.00 23.85 ? 51  SER A CB  1 
ATOM   334  O OG  . SER A 1 46 ? 0.014   17.084  16.716  1.00 28.70 ? 51  SER A OG  1 
ATOM   335  N N   . ILE A 1 47 ? 2.307   20.999  16.871  1.00 19.14 ? 52  ILE A N   1 
ATOM   336  C CA  . ILE A 1 47 ? 3.256   22.045  17.275  1.00 18.15 ? 52  ILE A CA  1 
ATOM   337  C C   . ILE A 1 47 ? 3.111   22.453  18.731  1.00 19.55 ? 52  ILE A C   1 
ATOM   338  O O   . ILE A 1 47 ? 1.997   22.696  19.175  1.00 21.09 ? 52  ILE A O   1 
ATOM   339  C CB  . ILE A 1 47 ? 2.993   23.309  16.424  1.00 19.08 ? 52  ILE A CB  1 
ATOM   340  C CG1 . ILE A 1 47 ? 2.965   23.008  14.934  1.00 20.41 ? 52  ILE A CG1 1 
ATOM   341  C CG2 . ILE A 1 47 ? 3.938   24.461  16.771  1.00 17.42 ? 52  ILE A CG2 1 
ATOM   342  C CD1 . ILE A 1 47 ? 4.239   22.435  14.405  1.00 19.33 ? 52  ILE A CD1 1 
ATOM   343  N N   . GLU A 1 48 ? 4.212   22.535  19.440  1.00 18.10 ? 53  GLU A N   1 
ATOM   344  C CA  . GLU A 1 48 ? 4.254   22.988  20.829  1.00 20.44 ? 53  GLU A CA  1 
ATOM   345  C C   . GLU A 1 48 ? 5.289   24.100  20.933  1.00 18.35 ? 53  GLU A C   1 
ATOM   346  O O   . GLU A 1 48 ? 6.487   23.837  20.783  1.00 19.74 ? 53  GLU A O   1 
ATOM   347  C CB  . GLU A 1 48 ? 4.694   21.803  21.697  1.00 25.35 ? 53  GLU A CB  1 
ATOM   348  C CG  . GLU A 1 48 ? 4.742   22.150  23.173  1.00 29.14 ? 53  GLU A CG  1 
ATOM   349  C CD  . GLU A 1 48 ? 5.236   20.980  24.019  1.00 32.41 ? 53  GLU A CD  1 
ATOM   350  O OE1 . GLU A 1 48 ? 4.907   19.830  23.649  1.00 34.47 ? 53  GLU A OE1 1 
ATOM   351  O OE2 . GLU A 1 48 ? 5.904   21.244  25.038  1.00 34.43 ? 53  GLU A OE2 1 
ATOM   352  N N   . ILE A 1 49 ? 4.846   25.339  21.253  1.00 17.19 ? 54  ILE A N   1 
ATOM   353  C CA  . ILE A 1 49 ? 5.851   26.387  21.423  1.00 16.84 ? 54  ILE A CA  1 
ATOM   354  C C   . ILE A 1 49 ? 6.692   26.195  22.686  1.00 16.92 ? 54  ILE A C   1 
ATOM   355  O O   . ILE A 1 49 ? 6.135   25.836  23.734  1.00 18.07 ? 54  ILE A O   1 
ATOM   356  C CB  . ILE A 1 49 ? 5.202   27.789  21.449  1.00 17.70 ? 54  ILE A CB  1 
ATOM   357  C CG1 . ILE A 1 49 ? 4.500   27.997  20.088  1.00 18.61 ? 54  ILE A CG1 1 
ATOM   358  C CG2 . ILE A 1 49 ? 6.216   28.886  21.752  1.00 15.42 ? 54  ILE A CG2 1 
ATOM   359  C CD1 . ILE A 1 49 ? 3.638   29.249  20.062  1.00 19.95 ? 54  ILE A CD1 1 
ATOM   360  N N   . VAL A 1 50 ? 7.981   26.420  22.560  1.00 15.45 ? 55  VAL A N   1 
ATOM   361  C CA  . VAL A 1 50 ? 8.896   26.420  23.703  1.00 14.94 ? 55  VAL A CA  1 
ATOM   362  C C   . VAL A 1 50 ? 9.076   27.837  24.187  1.00 15.41 ? 55  VAL A C   1 
ATOM   363  O O   . VAL A 1 50 ? 8.722   28.204  25.303  1.00 17.15 ? 55  VAL A O   1 
ATOM   364  C CB  . VAL A 1 50 ? 10.240  25.784  23.318  1.00 16.05 ? 55  VAL A CB  1 
ATOM   365  C CG1 . VAL A 1 50 ? 11.239  25.859  24.457  1.00 16.72 ? 55  VAL A CG1 1 
ATOM   366  C CG2 . VAL A 1 50 ? 9.992   24.335  22.900  1.00 17.10 ? 55  VAL A CG2 1 
ATOM   367  N N   . LYS A 1 51 ? 9.552   28.769  23.334  1.00 14.78 ? 56  LYS A N   1 
ATOM   368  C CA  . LYS A 1 51 ? 9.710   30.163  23.693  1.00 14.73 ? 56  LYS A CA  1 
ATOM   369  C C   . LYS A 1 51 ? 9.494   31.071  22.462  1.00 15.19 ? 56  LYS A C   1 
ATOM   370  O O   . LYS A 1 51 ? 9.786   30.652  21.317  1.00 15.10 ? 56  LYS A O   1 
ATOM   371  C CB  . LYS A 1 51 ? 11.087  30.540  24.263  1.00 15.12 ? 56  LYS A CB  1 
ATOM   372  C CG  . LYS A 1 51 ? 11.302  29.995  25.701  1.00 18.63 ? 56  LYS A CG  1 
ATOM   373  C CD  . LYS A 1 51 ? 12.601  30.500  26.280  1.00 22.74 ? 56  LYS A CD  1 
ATOM   374  C CE  . LYS A 1 51 ? 12.712  30.179  27.768  1.00 22.05 ? 56  LYS A CE  1 
ATOM   375  N NZ  . LYS A 1 51 ? 12.234  28.818  28.157  1.00 24.82 ? 56  LYS A NZ  1 
ATOM   376  N N   . GLN A 1 52 ? 9.041   32.283  22.705  1.00 13.83 ? 57  GLN A N   1 
ATOM   377  C CA  . GLN A 1 52 ? 9.001   33.346  21.684  1.00 12.81 ? 57  GLN A CA  1 
ATOM   378  C C   . GLN A 1 52 ? 9.594   34.595  22.374  1.00 13.46 ? 57  GLN A C   1 
ATOM   379  O O   . GLN A 1 52 ? 9.178   34.827  23.515  1.00 13.68 ? 57  GLN A O   1 
ATOM   380  C CB  . GLN A 1 52 ? 7.624   33.675  21.108  1.00 11.95 ? 57  GLN A CB  1 
ATOM   381  C CG  . GLN A 1 52 ? 7.206   32.625  20.057  1.00 13.94 ? 57  GLN A CG  1 
ATOM   382  C CD  . GLN A 1 52 ? 5.722   32.719  19.757  1.00 13.33 ? 57  GLN A CD  1 
ATOM   383  O OE1 . GLN A 1 52 ? 4.878   32.458  20.628  1.00 13.50 ? 57  GLN A OE1 1 
ATOM   384  N NE2 . GLN A 1 52 ? 5.343   33.175  18.555  1.00 13.54 ? 57  GLN A NE2 1 
ATOM   385  N N   . GLY A 1 53 ? 10.285  35.477  21.657  1.00 13.23 ? 58  GLY A N   1 
ATOM   386  C CA  . GLY A 1 53 ? 10.665  36.739  22.340  1.00 14.43 ? 58  GLY A CA  1 
ATOM   387  C C   . GLY A 1 53 ? 11.743  37.464  21.552  1.00 15.01 ? 58  GLY A C   1 
ATOM   388  O O   . GLY A 1 53 ? 11.878  37.192  20.354  1.00 14.49 ? 58  GLY A O   1 
ATOM   389  N N   . CYS A 1 54 ? 12.424  38.428  22.194  1.00 13.44 ? 59  CYS A N   1 
ATOM   390  C CA  . CYS A 1 54 ? 13.554  39.068  21.541  1.00 15.79 ? 59  CYS A CA  1 
ATOM   391  C C   . CYS A 1 54 ? 14.801  38.193  21.638  1.00 16.59 ? 59  CYS A C   1 
ATOM   392  O O   . CYS A 1 54 ? 14.957  37.407  22.581  1.00 17.95 ? 59  CYS A O   1 
ATOM   393  C CB  . CYS A 1 54 ? 13.887  40.368  22.316  1.00 16.80 ? 59  CYS A CB  1 
ATOM   394  S SG  . CYS A 1 54 ? 12.542  41.582  22.424  1.00 17.01 ? 59  CYS A SG  1 
ATOM   395  N N   . TRP A 1 55 ? 15.686  38.345  20.671  1.00 19.52 ? 60  TRP A N   1 
ATOM   396  C CA  . TRP A 1 55 ? 16.950  37.608  20.621  1.00 23.14 ? 60  TRP A CA  1 
ATOM   397  C C   . TRP A 1 55 ? 18.021  38.696  20.462  1.00 24.77 ? 60  TRP A C   1 
ATOM   398  O O   . TRP A 1 55 ? 17.946  39.488  19.516  1.00 25.33 ? 60  TRP A O   1 
ATOM   399  C CB  . TRP A 1 55 ? 17.012  36.645  19.438  1.00 24.66 ? 60  TRP A CB  1 
ATOM   400  C CG  . TRP A 1 55 ? 18.241  35.771  19.512  1.00 25.14 ? 60  TRP A CG  1 
ATOM   401  C CD1 . TRP A 1 55 ? 19.501  36.077  19.046  1.00 27.04 ? 60  TRP A CD1 1 
ATOM   402  C CD2 . TRP A 1 55 ? 18.334  34.481  20.097  1.00 24.67 ? 60  TRP A CD2 1 
ATOM   403  N NE1 . TRP A 1 55 ? 20.365  35.046  19.309  1.00 27.00 ? 60  TRP A NE1 1 
ATOM   404  C CE2 . TRP A 1 55 ? 19.673  34.048  19.958  1.00 26.33 ? 60  TRP A CE2 1 
ATOM   405  C CE3 . TRP A 1 55 ? 17.438  33.641  20.761  1.00 22.73 ? 60  TRP A CE3 1 
ATOM   406  C CZ2 . TRP A 1 55 ? 20.110  32.804  20.426  1.00 27.12 ? 60  TRP A CZ2 1 
ATOM   407  C CZ3 . TRP A 1 55 ? 17.867  32.422  21.241  1.00 23.39 ? 60  TRP A CZ3 1 
ATOM   408  C CH2 . TRP A 1 55 ? 19.202  32.010  21.046  1.00 24.87 ? 60  TRP A CH2 1 
ATOM   409  N N   . LEU A 1 56 ? 18.872  38.805  21.488  1.00 29.60 ? 61  LEU A N   1 
ATOM   410  C CA  . LEU A 1 56 ? 19.781  39.957  21.502  1.00 32.54 ? 61  LEU A CA  1 
ATOM   411  C C   . LEU A 1 56 ? 21.194  39.645  21.031  1.00 34.96 ? 61  LEU A C   1 
ATOM   412  O O   . LEU A 1 56 ? 21.846  40.601  20.574  1.00 36.25 ? 61  LEU A O   1 
ATOM   413  C CB  . LEU A 1 56 ? 19.807  40.532  22.915  1.00 34.05 ? 61  LEU A CB  1 
ATOM   414  N N   . ASP A 1 57 ? 21.673  38.416  21.143  1.00 36.47 ? 62  ASP A N   1 
ATOM   415  C CA  . ASP A 1 57 ? 23.047  38.135  20.703  1.00 37.53 ? 62  ASP A CA  1 
ATOM   416  C C   . ASP A 1 57 ? 23.115  38.209  19.175  1.00 37.52 ? 62  ASP A C   1 
ATOM   417  O O   . ASP A 1 57 ? 22.122  37.939  18.497  1.00 35.69 ? 62  ASP A O   1 
ATOM   418  C CB  . ASP A 1 57 ? 23.531  36.752  21.113  1.00 39.79 ? 62  ASP A CB  1 
ATOM   419  C CG  . ASP A 1 57 ? 23.524  36.400  22.574  1.00 41.36 ? 62  ASP A CG  1 
ATOM   420  O OD1 . ASP A 1 57 ? 23.745  37.286  23.423  1.00 41.56 ? 62  ASP A OD1 1 
ATOM   421  O OD2 . ASP A 1 57 ? 23.263  35.212  22.884  1.00 42.83 ? 62  ASP A OD2 1 
ATOM   422  N N   . ASP A 1 58 ? 24.293  38.513  18.638  1.00 35.82 ? 63  ASP A N   1 
ATOM   423  C CA  . ASP A 1 58 ? 24.484  38.546  17.199  1.00 35.57 ? 63  ASP A CA  1 
ATOM   424  C C   . ASP A 1 58 ? 24.019  37.225  16.592  1.00 34.53 ? 63  ASP A C   1 
ATOM   425  O O   . ASP A 1 58 ? 24.464  36.178  17.064  1.00 34.87 ? 63  ASP A O   1 
ATOM   426  C CB  . ASP A 1 58 ? 25.969  38.724  16.862  1.00 36.79 ? 63  ASP A CB  1 
ATOM   427  N N   . ILE A 1 59 ? 23.317  37.271  15.466  1.00 33.24 ? 64  ILE A N   1 
ATOM   428  C CA  . ILE A 1 59 ? 22.860  36.015  14.873  1.00 33.17 ? 64  ILE A CA  1 
ATOM   429  C C   . ILE A 1 59 ? 22.492  36.239  13.417  1.00 34.04 ? 64  ILE A C   1 
ATOM   430  O O   . ILE A 1 59 ? 22.159  37.355  13.014  1.00 34.05 ? 64  ILE A O   1 
ATOM   431  C CB  . ILE A 1 59 ? 21.628  35.502  15.671  1.00 32.50 ? 64  ILE A CB  1 
ATOM   432  C CG1 . ILE A 1 59 ? 21.333  34.049  15.309  1.00 32.43 ? 64  ILE A CG1 1 
ATOM   433  C CG2 . ILE A 1 59 ? 20.458  36.437  15.422  1.00 32.41 ? 64  ILE A CG2 1 
ATOM   434  C CD1 . ILE A 1 59 ? 20.243  33.327  16.046  1.00 32.28 ? 64  ILE A CD1 1 
ATOM   435  N N   . ASN A 1 60 ? 22.507  35.169  12.629  1.00 35.97 ? 65  ASN A N   1 
ATOM   436  C CA  . ASN A 1 60 ? 22.062  35.254  11.237  1.00 36.08 ? 65  ASN A CA  1 
ATOM   437  C C   . ASN A 1 60 ? 20.776  34.435  11.114  1.00 34.09 ? 65  ASN A C   1 
ATOM   438  O O   . ASN A 1 60 ? 20.636  33.439  11.844  1.00 33.95 ? 65  ASN A O   1 
ATOM   439  C CB  . ASN A 1 60 ? 23.164  34.751  10.293  1.00 40.34 ? 65  ASN A CB  1 
ATOM   440  C CG  . ASN A 1 60 ? 24.215  35.845  10.141  1.00 43.13 ? 65  ASN A CG  1 
ATOM   441  O OD1 . ASN A 1 60 ? 24.150  36.653  9.212   1.00 45.21 ? 65  ASN A OD1 1 
ATOM   442  N ND2 . ASN A 1 60 ? 25.133  35.935  11.101  1.00 45.31 ? 65  ASN A ND2 1 
ATOM   443  N N   . CYS A 1 61 ? 19.834  34.954  10.340  1.00 31.45 ? 66  CYS A N   1 
ATOM   444  C CA  . CYS A 1 61 ? 18.552  34.249  10.219  1.00 28.98 ? 66  CYS A CA  1 
ATOM   445  C C   . CYS A 1 61 ? 18.388  33.760  8.794   1.00 28.59 ? 66  CYS A C   1 
ATOM   446  O O   . CYS A 1 61 ? 19.039  34.273  7.871   1.00 29.03 ? 66  CYS A O   1 
ATOM   447  C CB  . CYS A 1 61 ? 17.397  35.162  10.655  1.00 26.83 ? 66  CYS A CB  1 
ATOM   448  S SG  . CYS A 1 61 ? 17.742  35.956  12.258  1.00 25.97 ? 66  CYS A SG  1 
ATOM   449  N N   . TYR A 1 62 ? 17.449  32.867  8.541   1.00 28.23 ? 67  TYR A N   1 
ATOM   450  C CA  . TYR A 1 62 ? 17.248  32.320  7.202   1.00 28.55 ? 67  TYR A CA  1 
ATOM   451  C C   . TYR A 1 62 ? 16.516  33.290  6.282   1.00 30.50 ? 67  TYR A C   1 
ATOM   452  O O   . TYR A 1 62 ? 16.692  33.230  5.058   1.00 31.91 ? 67  TYR A O   1 
ATOM   453  C CB  . TYR A 1 62 ? 16.565  30.956  7.299   1.00 26.73 ? 67  TYR A CB  1 
ATOM   454  C CG  . TYR A 1 62 ? 17.487  29.834  7.721   1.00 24.93 ? 67  TYR A CG  1 
ATOM   455  C CD1 . TYR A 1 62 ? 18.596  29.494  6.933   1.00 24.27 ? 67  TYR A CD1 1 
ATOM   456  C CD2 . TYR A 1 62 ? 17.215  29.089  8.882   1.00 24.00 ? 67  TYR A CD2 1 
ATOM   457  C CE1 . TYR A 1 62 ? 19.423  28.453  7.308   1.00 24.10 ? 67  TYR A CE1 1 
ATOM   458  C CE2 . TYR A 1 62 ? 18.056  28.064  9.246   1.00 24.04 ? 67  TYR A CE2 1 
ATOM   459  C CZ  . TYR A 1 62 ? 19.156  27.751  8.456   1.00 24.26 ? 67  TYR A CZ  1 
ATOM   460  O OH  . TYR A 1 62 ? 19.985  26.727  8.831   1.00 26.10 ? 67  TYR A OH  1 
ATOM   461  N N   . ASP A 1 63 ? 15.705  34.165  6.822   1.00 29.50 ? 68  ASP A N   1 
ATOM   462  C CA  . ASP A 1 63 ? 14.973  35.190  6.074   1.00 28.34 ? 68  ASP A CA  1 
ATOM   463  C C   . ASP A 1 63 ? 14.953  36.453  6.941   1.00 28.65 ? 68  ASP A C   1 
ATOM   464  O O   . ASP A 1 63 ? 14.954  36.364  8.159   1.00 29.18 ? 68  ASP A O   1 
ATOM   465  C CB  . ASP A 1 63 ? 13.556  34.760  5.751   1.00 30.09 ? 68  ASP A CB  1 
ATOM   466  C CG  . ASP A 1 63 ? 12.884  35.584  4.678   1.00 30.79 ? 68  ASP A CG  1 
ATOM   467  O OD1 . ASP A 1 63 ? 13.118  35.241  3.482   1.00 34.34 ? 68  ASP A OD1 1 
ATOM   468  O OD2 . ASP A 1 63 ? 12.139  36.550  4.956   1.00 28.47 ? 68  ASP A OD2 1 
ATOM   469  N N   . ARG A 1 64 ? 14.994  37.615  6.320   1.00 28.67 ? 69  ARG A N   1 
ATOM   470  C CA  . ARG A 1 64 ? 15.045  38.874  7.026   1.00 29.66 ? 69  ARG A CA  1 
ATOM   471  C C   . ARG A 1 64 ? 13.729  39.191  7.736   1.00 28.60 ? 69  ARG A C   1 
ATOM   472  O O   . ARG A 1 64 ? 13.755  39.624  8.888   1.00 29.80 ? 69  ARG A O   1 
ATOM   473  C CB  . ARG A 1 64 ? 15.348  39.973  5.988   1.00 30.94 ? 69  ARG A CB  1 
ATOM   474  N N   . THR A 1 65 ? 12.632  39.050  7.022   1.00 25.31 ? 70  THR A N   1 
ATOM   475  C CA  . THR A 1 65 ? 11.297  39.406  7.410   1.00 25.30 ? 70  THR A CA  1 
ATOM   476  C C   . THR A 1 65 ? 10.460  38.301  8.047   1.00 24.40 ? 70  THR A C   1 
ATOM   477  O O   . THR A 1 65 ? 9.658   38.558  8.952   1.00 24.59 ? 70  THR A O   1 
ATOM   478  C CB  . THR A 1 65 ? 10.546  39.833  6.113   1.00 27.22 ? 70  THR A CB  1 
ATOM   479  N N   . ASP A 1 66 ? 10.496  37.123  7.429   1.00 20.31 ? 71  ASP A N   1 
ATOM   480  C CA  . ASP A 1 66 ? 9.700   35.989  7.880   1.00 19.78 ? 71  ASP A CA  1 
ATOM   481  C C   . ASP A 1 66 ? 10.543  35.126  8.817   1.00 19.45 ? 71  ASP A C   1 
ATOM   482  O O   . ASP A 1 66 ? 11.720  34.943  8.536   1.00 19.96 ? 71  ASP A O   1 
ATOM   483  C CB  . ASP A 1 66 ? 9.345   35.087  6.685   1.00 22.05 ? 71  ASP A CB  1 
ATOM   484  C CG  . ASP A 1 66 ? 8.346   35.663  5.702   1.00 24.99 ? 71  ASP A CG  1 
ATOM   485  O OD1 . ASP A 1 66 ? 7.392   36.323  6.168   1.00 26.51 ? 71  ASP A OD1 1 
ATOM   486  O OD2 . ASP A 1 66 ? 8.498   35.471  4.473   1.00 27.01 ? 71  ASP A OD2 1 
ATOM   487  N N   . CYS A 1 67 ? 9.934   34.543  9.850   1.00 15.08 ? 72  CYS A N   1 
ATOM   488  C CA  . CYS A 1 67 ? 10.685  33.658  10.763  1.00 15.96 ? 72  CYS A CA  1 
ATOM   489  C C   . CYS A 1 67 ? 10.583  32.234  10.215  1.00 14.79 ? 72  CYS A C   1 
ATOM   490  O O   . CYS A 1 67 ? 9.503   31.634  10.246  1.00 14.99 ? 72  CYS A O   1 
ATOM   491  C CB  . CYS A 1 67 ? 9.908   33.732  12.109  1.00 14.46 ? 72  CYS A CB  1 
ATOM   492  S SG  . CYS A 1 67 ? 11.012  33.348  13.540  1.00 15.05 ? 72  CYS A SG  1 
ATOM   493  N N   . ILE A 1 68 ? 11.712  31.707  9.712   1.00 14.57 ? 73  ILE A N   1 
ATOM   494  C CA  . ILE A 1 68 ? 11.713  30.407  9.020   1.00 15.74 ? 73  ILE A CA  1 
ATOM   495  C C   . ILE A 1 68 ? 12.831  29.487  9.523   1.00 14.70 ? 73  ILE A C   1 
ATOM   496  O O   . ILE A 1 68 ? 13.986  29.928  9.696   1.00 16.36 ? 73  ILE A O   1 
ATOM   497  C CB  . ILE A 1 68 ? 11.908  30.624  7.496   1.00 16.70 ? 73  ILE A CB  1 
ATOM   498  C CG1 . ILE A 1 68 ? 10.740  31.383  6.842   1.00 17.74 ? 73  ILE A CG1 1 
ATOM   499  C CG2 . ILE A 1 68 ? 11.994  29.285  6.744   1.00 18.26 ? 73  ILE A CG2 1 
ATOM   500  C CD1 . ILE A 1 68 ? 11.030  31.908  5.438   1.00 19.30 ? 73  ILE A CD1 1 
ATOM   501  N N   . GLU A 1 69 ? 12.508  28.206  9.780   1.00 14.96 ? 74  GLU A N   1 
ATOM   502  C CA  . GLU A 1 69 ? 13.542  27.211  10.101  1.00 14.31 ? 74  GLU A CA  1 
ATOM   503  C C   . GLU A 1 69 ? 13.903  26.477  8.806   1.00 15.21 ? 74  GLU A C   1 
ATOM   504  O O   . GLU A 1 69 ? 12.959  26.059  8.129   1.00 14.85 ? 74  GLU A O   1 
ATOM   505  C CB  . GLU A 1 69 ? 12.907  26.191  11.075  1.00 13.76 ? 74  GLU A CB  1 
ATOM   506  C CG  . GLU A 1 69 ? 13.695  24.885  11.264  1.00 14.95 ? 74  GLU A CG  1 
ATOM   507  C CD  . GLU A 1 69 ? 15.034  25.145  11.911  1.00 15.62 ? 74  GLU A CD  1 
ATOM   508  O OE1 . GLU A 1 69 ? 16.058  25.540  11.252  1.00 15.77 ? 74  GLU A OE1 1 
ATOM   509  O OE2 . GLU A 1 69 ? 15.127  24.847  13.118  1.00 16.54 ? 74  GLU A OE2 1 
ATOM   510  N N   . LYS A 1 70 ? 15.188  26.394  8.463   1.00 15.17 ? 75  LYS A N   1 
ATOM   511  C CA  . LYS A 1 70 ? 15.578  25.707  7.209   1.00 15.88 ? 75  LYS A CA  1 
ATOM   512  C C   . LYS A 1 70 ? 16.413  24.492  7.518   1.00 16.53 ? 75  LYS A C   1 
ATOM   513  O O   . LYS A 1 70 ? 16.943  23.848  6.567   1.00 16.54 ? 75  LYS A O   1 
ATOM   514  C CB  . LYS A 1 70 ? 16.228  26.722  6.248   1.00 14.98 ? 75  LYS A CB  1 
ATOM   515  C CG  . LYS A 1 70 ? 15.253  27.801  5.740   1.00 17.47 ? 75  LYS A CG  1 
ATOM   516  C CD  . LYS A 1 70 ? 15.751  28.549  4.496   1.00 18.08 ? 75  LYS A CD  1 
ATOM   517  C CE  . LYS A 1 70 ? 15.622  27.629  3.279   1.00 19.45 ? 75  LYS A CE  1 
ATOM   518  N NZ  . LYS A 1 70 ? 14.201  27.307  2.957   1.00 20.51 ? 75  LYS A NZ  1 
ATOM   519  N N   . LYS A 1 71 ? 16.684  24.113  8.787   1.00 15.20 ? 76  LYS A N   1 
ATOM   520  C CA  . LYS A 1 71 ? 17.422  22.891  9.051   1.00 16.16 ? 76  LYS A CA  1 
ATOM   521  C C   . LYS A 1 71 ? 16.500  21.684  8.793   1.00 17.09 ? 76  LYS A C   1 
ATOM   522  O O   . LYS A 1 71 ? 15.267  21.848  8.834   1.00 17.65 ? 76  LYS A O   1 
ATOM   523  C CB  . LYS A 1 71 ? 17.935  22.825  10.500  1.00 17.51 ? 76  LYS A CB  1 
ATOM   524  C CG  . LYS A 1 71 ? 19.055  23.868  10.667  1.00 19.58 ? 76  LYS A CG  1 
ATOM   525  C CD  . LYS A 1 71 ? 19.532  23.957  12.111  1.00 24.31 ? 76  LYS A CD  1 
ATOM   526  C CE  . LYS A 1 71 ? 20.631  25.021  12.196  1.00 27.61 ? 76  LYS A CE  1 
ATOM   527  N NZ  . LYS A 1 71 ? 21.153  25.178  13.590  1.00 29.34 ? 76  LYS A NZ  1 
ATOM   528  N N   . ASP A 1 72 ? 17.099  20.527  8.484   1.00 16.60 ? 77  ASP A N   1 
ATOM   529  C CA  . ASP A 1 72 ? 16.312  19.340  8.164   1.00 16.93 ? 77  ASP A CA  1 
ATOM   530  C C   . ASP A 1 72 ? 15.959  18.455  9.348   1.00 17.21 ? 77  ASP A C   1 
ATOM   531  O O   . ASP A 1 72 ? 16.837  17.988  10.088  1.00 19.12 ? 77  ASP A O   1 
ATOM   532  C CB  . ASP A 1 72 ? 17.118  18.484  7.158   1.00 16.11 ? 77  ASP A CB  1 
ATOM   533  C CG  . ASP A 1 72 ? 17.395  19.163  5.844   1.00 16.65 ? 77  ASP A CG  1 
ATOM   534  O OD1 . ASP A 1 72 ? 16.575  19.924  5.278   1.00 15.51 ? 77  ASP A OD1 1 
ATOM   535  O OD2 . ASP A 1 72 ? 18.513  18.900  5.310   1.00 18.92 ? 77  ASP A OD2 1 
ATOM   536  N N   . SER A 1 73 ? 14.647  18.339  9.597   1.00 16.68 ? 78  SER A N   1 
ATOM   537  C CA  . SER A 1 73 ? 14.161  17.498  10.698  1.00 17.70 ? 78  SER A CA  1 
ATOM   538  C C   . SER A 1 73 ? 14.881  17.717  12.001  1.00 19.26 ? 78  SER A C   1 
ATOM   539  O O   . SER A 1 73 ? 15.320  16.739  12.643  1.00 20.66 ? 78  SER A O   1 
ATOM   540  C CB  . SER A 1 73 ? 14.305  16.026  10.250  1.00 18.20 ? 78  SER A CB  1 
ATOM   541  O OG  . SER A 1 73 ? 13.395  15.720  9.177   1.00 19.07 ? 78  SER A OG  1 
ATOM   542  N N   . PRO A 1 74 ? 14.905  18.922  12.561  1.00 17.05 ? 79  PRO A N   1 
ATOM   543  C CA  . PRO A 1 74 ? 15.564  19.164  13.834  1.00 18.97 ? 79  PRO A CA  1 
ATOM   544  C C   . PRO A 1 74 ? 14.773  18.685  15.039  1.00 18.04 ? 79  PRO A C   1 
ATOM   545  O O   . PRO A 1 74 ? 13.564  18.497  14.897  1.00 18.45 ? 79  PRO A O   1 
ATOM   546  C CB  . PRO A 1 74 ? 15.721  20.692  13.846  1.00 18.92 ? 79  PRO A CB  1 
ATOM   547  C CG  . PRO A 1 74 ? 14.511  21.152  13.071  1.00 17.71 ? 79  PRO A CG  1 
ATOM   548  C CD  . PRO A 1 74 ? 14.387  20.167  11.925  1.00 17.17 ? 79  PRO A CD  1 
ATOM   549  N N   . GLU A 1 75 ? 15.386  18.466  16.206  1.00 20.20 ? 80  GLU A N   1 
ATOM   550  C CA  . GLU A 1 75 ? 14.553  18.087  17.358  1.00 22.97 ? 80  GLU A CA  1 
ATOM   551  C C   . GLU A 1 75 ? 13.911  19.332  17.966  1.00 23.50 ? 80  GLU A C   1 
ATOM   552  O O   . GLU A 1 75 ? 12.738  19.309  18.378  1.00 27.35 ? 80  GLU A O   1 
ATOM   553  C CB  . GLU A 1 75 ? 15.364  17.315  18.389  1.00 25.60 ? 80  GLU A CB  1 
ATOM   554  C CG  . GLU A 1 75 ? 15.450  15.824  18.084  1.00 28.96 ? 80  GLU A CG  1 
ATOM   555  C CD  . GLU A 1 75 ? 15.996  15.061  19.278  1.00 29.89 ? 80  GLU A CD  1 
ATOM   556  O OE1 . GLU A 1 75 ? 16.643  15.733  20.126  1.00 32.13 ? 80  GLU A OE1 1 
ATOM   557  O OE2 . GLU A 1 75 ? 15.794  13.837  19.361  1.00 31.99 ? 80  GLU A OE2 1 
ATOM   558  N N   . VAL A 1 76 ? 14.617  20.448  18.049  1.00 21.50 ? 81  VAL A N   1 
ATOM   559  C CA  . VAL A 1 76 ? 14.062  21.713  18.498  1.00 20.53 ? 81  VAL A CA  1 
ATOM   560  C C   . VAL A 1 76 ? 14.162  22.711  17.329  1.00 17.85 ? 81  VAL A C   1 
ATOM   561  O O   . VAL A 1 76 ? 15.286  22.981  16.896  1.00 18.85 ? 81  VAL A O   1 
ATOM   562  C CB  . VAL A 1 76 ? 14.700  22.255  19.770  1.00 20.13 ? 81  VAL A CB  1 
ATOM   563  C CG1 . VAL A 1 76 ? 14.027  23.550  20.223  1.00 19.50 ? 81  VAL A CG1 1 
ATOM   564  C CG2 . VAL A 1 76 ? 14.554  21.217  20.896  1.00 20.99 ? 81  VAL A CG2 1 
ATOM   565  N N   . TYR A 1 77 ? 12.995  23.135  16.837  1.00 16.27 ? 82  TYR A N   1 
ATOM   566  C CA  . TYR A 1 77 ? 12.947  24.070  15.722  1.00 15.77 ? 82  TYR A CA  1 
ATOM   567  C C   . TYR A 1 77 ? 13.305  25.459  16.205  1.00 14.93 ? 82  TYR A C   1 
ATOM   568  O O   . TYR A 1 77 ? 12.823  25.832  17.296  1.00 16.44 ? 82  TYR A O   1 
ATOM   569  C CB  . TYR A 1 77 ? 11.547  24.007  15.101  1.00 15.00 ? 82  TYR A CB  1 
ATOM   570  C CG  . TYR A 1 77 ? 11.205  22.710  14.381  1.00 15.02 ? 82  TYR A CG  1 
ATOM   571  C CD1 . TYR A 1 77 ? 11.168  21.485  15.014  1.00 15.28 ? 82  TYR A CD1 1 
ATOM   572  C CD2 . TYR A 1 77 ? 10.912  22.749  13.017  1.00 16.45 ? 82  TYR A CD2 1 
ATOM   573  C CE1 . TYR A 1 77 ? 10.808  20.310  14.320  1.00 16.04 ? 82  TYR A CE1 1 
ATOM   574  C CE2 . TYR A 1 77 ? 10.612  21.601  12.299  1.00 16.63 ? 82  TYR A CE2 1 
ATOM   575  C CZ  . TYR A 1 77 ? 10.574  20.386  12.973  1.00 16.85 ? 82  TYR A CZ  1 
ATOM   576  O OH  . TYR A 1 77 ? 10.328  19.243  12.229  1.00 18.24 ? 82  TYR A OH  1 
ATOM   577  N N   . PHE A 1 78 ? 13.955  26.272  15.379  1.00 14.36 ? 83  PHE A N   1 
ATOM   578  C CA  . PHE A 1 78 ? 14.319  27.634  15.757  1.00 14.16 ? 83  PHE A CA  1 
ATOM   579  C C   . PHE A 1 78 ? 14.211  28.524  14.523  1.00 15.53 ? 83  PHE A C   1 
ATOM   580  O O   . PHE A 1 78 ? 14.593  28.130  13.404  1.00 14.65 ? 83  PHE A O   1 
ATOM   581  C CB  . PHE A 1 78 ? 15.746  27.703  16.328  1.00 15.09 ? 83  PHE A CB  1 
ATOM   582  C CG  . PHE A 1 78 ? 16.284  29.073  16.602  1.00 16.59 ? 83  PHE A CG  1 
ATOM   583  C CD1 . PHE A 1 78 ? 16.875  29.815  15.597  1.00 17.54 ? 83  PHE A CD1 1 
ATOM   584  C CD2 . PHE A 1 78 ? 16.083  29.717  17.823  1.00 19.76 ? 83  PHE A CD2 1 
ATOM   585  C CE1 . PHE A 1 78 ? 17.299  31.114  15.789  1.00 17.42 ? 83  PHE A CE1 1 
ATOM   586  C CE2 . PHE A 1 78 ? 16.547  31.013  18.038  1.00 19.78 ? 83  PHE A CE2 1 
ATOM   587  C CZ  . PHE A 1 78 ? 17.149  31.728  17.017  1.00 19.41 ? 83  PHE A CZ  1 
ATOM   588  N N   . CYS A 1 79 ? 13.763  29.766  14.719  1.00 13.88 ? 84  CYS A N   1 
ATOM   589  C CA  . CYS A 1 79 ? 13.853  30.773  13.666  1.00 12.64 ? 84  CYS A CA  1 
ATOM   590  C C   . CYS A 1 79 ? 14.138  32.142  14.284  1.00 14.87 ? 84  CYS A C   1 
ATOM   591  O O   . CYS A 1 79 ? 13.704  32.413  15.414  1.00 14.00 ? 84  CYS A O   1 
ATOM   592  C CB  . CYS A 1 79 ? 12.642  30.878  12.754  1.00 13.47 ? 84  CYS A CB  1 
ATOM   593  S SG  . CYS A 1 79 ? 11.059  31.271  13.521  1.00 15.42 ? 84  CYS A SG  1 
ATOM   594  N N   . CYS A 1 80 ? 14.740  33.058  13.508  1.00 15.54 ? 85  CYS A N   1 
ATOM   595  C CA  . CYS A 1 80 ? 14.769  34.458  13.938  1.00 14.94 ? 85  CYS A CA  1 
ATOM   596  C C   . CYS A 1 80 ? 14.364  35.391  12.791  1.00 15.92 ? 85  CYS A C   1 
ATOM   597  O O   . CYS A 1 80 ? 14.341  34.940  11.647  1.00 16.80 ? 85  CYS A O   1 
ATOM   598  C CB  . CYS A 1 80 ? 16.078  34.827  14.568  1.00 17.88 ? 85  CYS A CB  1 
ATOM   599  S SG  . CYS A 1 80 ? 17.545  34.442  13.587  1.00 21.25 ? 85  CYS A SG  1 
ATOM   600  N N   . CYS A 1 81 ? 13.960  36.599  13.109  1.00 14.05 ? 86  CYS A N   1 
ATOM   601  C CA  . CYS A 1 81 ? 13.458  37.526  12.076  1.00 14.75 ? 86  CYS A CA  1 
ATOM   602  C C   . CYS A 1 81 ? 13.668  38.963  12.538  1.00 15.30 ? 86  CYS A C   1 
ATOM   603  O O   . CYS A 1 81 ? 13.858  39.205  13.719  1.00 15.24 ? 86  CYS A O   1 
ATOM   604  C CB  . CYS A 1 81 ? 11.972  37.269  11.801  1.00 14.73 ? 86  CYS A CB  1 
ATOM   605  S SG  . CYS A 1 81 ? 10.859  37.356  13.228  1.00 15.34 ? 86  CYS A SG  1 
ATOM   606  N N   . GLU A 1 82 ? 13.550  39.917  11.622  1.00 16.03 ? 87  GLU A N   1 
ATOM   607  C CA  . GLU A 1 82 ? 13.573  41.324  11.920  1.00 16.56 ? 87  GLU A CA  1 
ATOM   608  C C   . GLU A 1 82 ? 12.214  41.970  11.636  1.00 15.35 ? 87  GLU A C   1 
ATOM   609  O O   . GLU A 1 82 ? 11.476  41.601  10.713  1.00 16.55 ? 87  GLU A O   1 
ATOM   610  C CB  . GLU A 1 82 ? 14.619  42.021  11.017  1.00 20.27 ? 87  GLU A CB  1 
ATOM   611  C CG  . GLU A 1 82 ? 16.038  41.754  11.533  1.00 25.47 ? 87  GLU A CG  1 
ATOM   612  C CD  . GLU A 1 82 ? 17.081  42.522  10.739  1.00 30.17 ? 87  GLU A CD  1 
ATOM   613  O OE1 . GLU A 1 82 ? 17.509  42.052  9.664   1.00 32.71 ? 87  GLU A OE1 1 
ATOM   614  O OE2 . GLU A 1 82 ? 17.490  43.609  11.205  1.00 32.20 ? 87  GLU A OE2 1 
ATOM   615  N N   . GLY A 1 83 ? 11.857  42.937  12.492  1.00 16.53 ? 88  GLY A N   1 
ATOM   616  C CA  . GLY A 1 83 ? 10.570  43.612  12.392  1.00 16.23 ? 88  GLY A CA  1 
ATOM   617  C C   . GLY A 1 83 ? 9.648   43.397  13.589  1.00 15.06 ? 88  GLY A C   1 
ATOM   618  O O   . GLY A 1 83 ? 9.584   42.251  14.096  1.00 16.43 ? 88  GLY A O   1 
ATOM   619  N N   . ASN A 1 84 ? 9.008   44.471  14.043  1.00 14.11 ? 89  ASN A N   1 
ATOM   620  C CA  . ASN A 1 84 ? 8.129   44.391  15.198  1.00 14.26 ? 89  ASN A CA  1 
ATOM   621  C C   . ASN A 1 84 ? 7.064   43.326  15.071  1.00 15.38 ? 89  ASN A C   1 
ATOM   622  O O   . ASN A 1 84 ? 6.367   43.124  14.081  1.00 16.49 ? 89  ASN A O   1 
ATOM   623  C CB  . ASN A 1 84 ? 7.439   45.727  15.500  1.00 14.60 ? 89  ASN A CB  1 
ATOM   624  C CG  . ASN A 1 84 ? 8.482   46.742  15.989  1.00 15.87 ? 89  ASN A CG  1 
ATOM   625  O OD1 . ASN A 1 84 ? 9.544   46.360  16.451  1.00 16.59 ? 89  ASN A OD1 1 
ATOM   626  N ND2 . ASN A 1 84 ? 8.117   48.006  15.849  1.00 15.61 ? 89  ASN A ND2 1 
ATOM   627  N N   . MET A 1 85 ? 7.072   42.387  16.051  1.00 14.53 ? 90  MET A N   1 
ATOM   628  C CA  . MET A 1 85 ? 6.115   41.297  16.168  1.00 13.76 ? 90  MET A CA  1 
ATOM   629  C C   . MET A 1 85 ? 6.298   40.261  15.071  1.00 12.69 ? 90  MET A C   1 
ATOM   630  O O   . MET A 1 85 ? 5.395   39.460  14.834  1.00 13.63 ? 90  MET A O   1 
ATOM   631  C CB  . MET A 1 85 ? 4.665   41.820  16.302  1.00 14.21 ? 90  MET A CB  1 
ATOM   632  C CG  . MET A 1 85 ? 4.400   42.938  17.318  1.00 14.31 ? 90  MET A CG  1 
ATOM   633  S SD  . MET A 1 85 ? 5.025   42.528  18.984  1.00 14.64 ? 90  MET A SD  1 
ATOM   634  C CE  . MET A 1 85 ? 3.708   41.422  19.542  1.00 15.26 ? 90  MET A CE  1 
ATOM   635  N N   . CYS A 1 86 ? 7.459   40.228  14.387  1.00 13.61 ? 91  CYS A N   1 
ATOM   636  C CA  . CYS A 1 86 ? 7.605   39.302  13.238  1.00 14.17 ? 91  CYS A CA  1 
ATOM   637  C C   . CYS A 1 86 ? 7.544   37.854  13.599  1.00 15.88 ? 91  CYS A C   1 
ATOM   638  O O   . CYS A 1 86 ? 7.289   36.985  12.728  1.00 16.07 ? 91  CYS A O   1 
ATOM   639  C CB  . CYS A 1 86 ? 8.945   39.646  12.547  1.00 14.84 ? 91  CYS A CB  1 
ATOM   640  S SG  . CYS A 1 86 ? 10.455  39.391  13.494  1.00 15.27 ? 91  CYS A SG  1 
ATOM   641  N N   . ASN A 1 87 ? 7.844   37.473  14.834  1.00 12.46 ? 92  ASN A N   1 
ATOM   642  C CA  . ASN A 1 87 ? 7.807   36.084  15.248  1.00 12.87 ? 92  ASN A CA  1 
ATOM   643  C C   . ASN A 1 87 ? 6.440   35.557  15.618  1.00 12.88 ? 92  ASN A C   1 
ATOM   644  O O   . ASN A 1 87 ? 6.397   34.394  16.088  1.00 12.79 ? 92  ASN A O   1 
ATOM   645  C CB  . ASN A 1 87 ? 8.786   35.909  16.449  1.00 11.10 ? 92  ASN A CB  1 
ATOM   646  C CG  . ASN A 1 87 ? 8.337   36.752  17.653  1.00 13.92 ? 92  ASN A CG  1 
ATOM   647  O OD1 . ASN A 1 87 ? 7.688   37.773  17.560  1.00 12.44 ? 92  ASN A OD1 1 
ATOM   648  N ND2 . ASN A 1 87 ? 8.745   36.272  18.851  1.00 13.02 ? 92  ASN A ND2 1 
ATOM   649  N N   . GLU A 1 88 ? 5.328   36.282  15.343  1.00 14.44 ? 93  GLU A N   1 
ATOM   650  C CA  . GLU A 1 88 ? 4.026   35.686  15.651  1.00 14.76 ? 93  GLU A CA  1 
ATOM   651  C C   . GLU A 1 88 ? 3.735   34.516  14.709  1.00 17.37 ? 93  GLU A C   1 
ATOM   652  O O   . GLU A 1 88 ? 3.155   33.509  15.129  1.00 19.32 ? 93  GLU A O   1 
ATOM   653  C CB  . GLU A 1 88 ? 2.909   36.703  15.395  1.00 16.17 ? 93  GLU A CB  1 
ATOM   654  C CG  . GLU A 1 88 ? 2.890   37.701  16.552  1.00 17.53 ? 93  GLU A CG  1 
ATOM   655  C CD  . GLU A 1 88 ? 1.948   38.858  16.179  1.00 16.72 ? 93  GLU A CD  1 
ATOM   656  O OE1 . GLU A 1 88 ? 1.438   38.986  15.054  1.00 20.53 ? 93  GLU A OE1 1 
ATOM   657  O OE2 . GLU A 1 88 ? 1.736   39.626  17.140  1.00 19.30 ? 93  GLU A OE2 1 
ATOM   658  N N   . LYS A 1 89 ? 4.181   34.638  13.476  1.00 16.96 ? 94  LYS A N   1 
ATOM   659  C CA  . LYS A 1 89 ? 4.042   33.556  12.497  1.00 19.58 ? 94  LYS A CA  1 
ATOM   660  C C   . LYS A 1 89 ? 5.410   32.912  12.303  1.00 19.52 ? 94  LYS A C   1 
ATOM   661  O O   . LYS A 1 89 ? 6.410   33.656  12.265  1.00 20.12 ? 94  LYS A O   1 
ATOM   662  C CB  . LYS A 1 89 ? 3.579   34.105  11.136  1.00 22.84 ? 94  LYS A CB  1 
ATOM   663  C CG  . LYS A 1 89 ? 2.294   34.902  11.245  1.00 28.55 ? 94  LYS A CG  1 
ATOM   664  C CD  . LYS A 1 89 ? 1.093   34.101  11.711  1.00 31.92 ? 94  LYS A CD  1 
ATOM   665  C CE  . LYS A 1 89 ? -0.118  34.318  10.817  1.00 33.90 ? 94  LYS A CE  1 
ATOM   666  N NZ  . LYS A 1 89 ? -0.552  33.090  10.081  1.00 35.72 ? 94  LYS A NZ  1 
ATOM   667  N N   . PHE A 1 90 ? 5.465   31.585  12.334  1.00 16.68 ? 95  PHE A N   1 
ATOM   668  C CA  . PHE A 1 90 ? 6.770   30.931  12.124  1.00 16.76 ? 95  PHE A CA  1 
ATOM   669  C C   . PHE A 1 90 ? 6.549   29.672  11.276  1.00 16.99 ? 95  PHE A C   1 
ATOM   670  O O   . PHE A 1 90 ? 5.483   29.079  11.393  1.00 18.96 ? 95  PHE A O   1 
ATOM   671  C CB  . PHE A 1 90 ? 7.472   30.561  13.433  1.00 17.13 ? 95  PHE A CB  1 
ATOM   672  C CG  . PHE A 1 90 ? 6.639   29.862  14.466  1.00 17.55 ? 95  PHE A CG  1 
ATOM   673  C CD1 . PHE A 1 90 ? 5.913   30.581  15.406  1.00 16.28 ? 95  PHE A CD1 1 
ATOM   674  C CD2 . PHE A 1 90 ? 6.574   28.474  14.461  1.00 17.48 ? 95  PHE A CD2 1 
ATOM   675  C CE1 . PHE A 1 90 ? 5.105   29.898  16.333  1.00 17.27 ? 95  PHE A CE1 1 
ATOM   676  C CE2 . PHE A 1 90 ? 5.818   27.796  15.404  1.00 17.34 ? 95  PHE A CE2 1 
ATOM   677  C CZ  . PHE A 1 90 ? 5.066   28.520  16.324  1.00 17.87 ? 95  PHE A CZ  1 
ATOM   678  N N   . SER A 1 91 ? 7.509   29.418  10.370  1.00 15.95 ? 96  SER A N   1 
ATOM   679  C CA  . SER A 1 91 ? 7.287   28.364  9.385   1.00 16.64 ? 96  SER A CA  1 
ATOM   680  C C   . SER A 1 91 ? 8.489   27.431  9.231   1.00 16.81 ? 96  SER A C   1 
ATOM   681  O O   . SER A 1 91 ? 9.587   27.825  9.633   1.00 17.00 ? 96  SER A O   1 
ATOM   682  C CB  . SER A 1 91 ? 7.126   29.098  8.014   1.00 18.32 ? 96  SER A CB  1 
ATOM   683  O OG  . SER A 1 91 ? 5.957   29.911  8.116   1.00 20.88 ? 96  SER A OG  1 
ATOM   684  N N   . TYR A 1 92 ? 8.285   26.277  8.621   1.00 17.04 ? 97  TYR A N   1 
ATOM   685  C CA  . TYR A 1 92 ? 9.313   25.272  8.379   1.00 16.47 ? 97  TYR A CA  1 
ATOM   686  C C   . TYR A 1 92 ? 9.459   25.063  6.883   1.00 16.67 ? 97  TYR A C   1 
ATOM   687  O O   . TYR A 1 92 ? 8.500   24.587  6.232   1.00 16.67 ? 97  TYR A O   1 
ATOM   688  C CB  . TYR A 1 92 ? 8.890   23.947  9.055   1.00 15.67 ? 97  TYR A CB  1 
ATOM   689  C CG  . TYR A 1 92 ? 9.790   22.747  8.867   1.00 16.07 ? 97  TYR A CG  1 
ATOM   690  C CD1 . TYR A 1 92 ? 11.169  22.874  9.113   1.00 15.90 ? 97  TYR A CD1 1 
ATOM   691  C CD2 . TYR A 1 92 ? 9.273   21.502  8.489   1.00 15.61 ? 97  TYR A CD2 1 
ATOM   692  C CE1 . TYR A 1 92 ? 12.011  21.769  8.957   1.00 15.01 ? 97  TYR A CE1 1 
ATOM   693  C CE2 . TYR A 1 92 ? 10.121  20.399  8.335   1.00 15.94 ? 97  TYR A CE2 1 
ATOM   694  C CZ  . TYR A 1 92 ? 11.480  20.540  8.571   1.00 15.19 ? 97  TYR A CZ  1 
ATOM   695  O OH  . TYR A 1 92 ? 12.320  19.434  8.412   1.00 15.60 ? 97  TYR A OH  1 
ATOM   696  N N   . PHE A 1 93 ? 10.590  25.490  6.306   1.00 17.09 ? 98  PHE A N   1 
ATOM   697  C CA  . PHE A 1 93 ? 10.928  25.227  4.900   1.00 17.70 ? 98  PHE A CA  1 
ATOM   698  C C   . PHE A 1 93 ? 12.328  24.637  4.836   1.00 16.33 ? 98  PHE A C   1 
ATOM   699  O O   . PHE A 1 93 ? 13.339  25.347  4.638   1.00 18.63 ? 98  PHE A O   1 
ATOM   700  C CB  . PHE A 1 93 ? 10.910  26.547  4.080   1.00 16.97 ? 98  PHE A CB  1 
ATOM   701  C CG  . PHE A 1 93 ? 9.525   27.109  3.905   1.00 16.43 ? 98  PHE A CG  1 
ATOM   702  C CD1 . PHE A 1 93 ? 8.587   26.465  3.109   1.00 15.95 ? 98  PHE A CD1 1 
ATOM   703  C CD2 . PHE A 1 93 ? 9.142   28.292  4.504   1.00 17.67 ? 98  PHE A CD2 1 
ATOM   704  C CE1 . PHE A 1 93 ? 7.322   26.983  2.946   1.00 18.25 ? 98  PHE A CE1 1 
ATOM   705  C CE2 . PHE A 1 93 ? 7.890   28.837  4.334   1.00 19.70 ? 98  PHE A CE2 1 
ATOM   706  C CZ  . PHE A 1 93 ? 6.948   28.179  3.564   1.00 18.22 ? 98  PHE A CZ  1 
ATOM   707  N N   . PRO A 1 94 ? 12.495  23.341  5.103   1.00 16.20 ? 99  PRO A N   1 
ATOM   708  C CA  . PRO A 1 94 ? 13.795  22.696  5.205   1.00 15.46 ? 99  PRO A CA  1 
ATOM   709  C C   . PRO A 1 94 ? 14.543  22.862  3.898   1.00 16.84 ? 99  PRO A C   1 
ATOM   710  O O   . PRO A 1 94 ? 13.916  22.805  2.824   1.00 18.19 ? 99  PRO A O   1 
ATOM   711  C CB  . PRO A 1 94 ? 13.476  21.240  5.579   1.00 17.26 ? 99  PRO A CB  1 
ATOM   712  C CG  . PRO A 1 94 ? 12.086  21.033  5.052   1.00 17.16 ? 99  PRO A CG  1 
ATOM   713  C CD  . PRO A 1 94 ? 11.416  22.353  5.367   1.00 17.03 ? 99  PRO A CD  1 
ATOM   714  N N   . GLU A 1 95 ? 15.844  23.055  3.990   1.00 17.66 ? 100 GLU A N   1 
ATOM   715  C CA  . GLU A 1 95 ? 16.713  23.184  2.833   1.00 16.70 ? 100 GLU A CA  1 
ATOM   716  C C   . GLU A 1 95 ? 16.545  22.035  1.847   1.00 18.33 ? 100 GLU A C   1 
ATOM   717  O O   . GLU A 1 95 ? 16.753  22.252  0.645   1.00 19.62 ? 100 GLU A O   1 
ATOM   718  C CB  . GLU A 1 95 ? 18.178  23.336  3.206   1.00 17.33 ? 100 GLU A CB  1 
ATOM   719  C CG  . GLU A 1 95 ? 18.906  22.178  3.853   1.00 18.41 ? 100 GLU A CG  1 
ATOM   720  C CD  . GLU A 1 95 ? 19.330  21.108  2.887   1.00 20.57 ? 100 GLU A CD  1 
ATOM   721  O OE1 . GLU A 1 95 ? 19.718  21.492  1.737   1.00 22.10 ? 100 GLU A OE1 1 
ATOM   722  O OE2 . GLU A 1 95 ? 19.331  19.901  3.198   1.00 21.18 ? 100 GLU A OE2 1 
ATOM   723  N N   . MET A 1 96 ? 16.236  20.840  2.324   1.00 17.73 ? 101 MET A N   1 
ATOM   724  C CA  . MET A 1 96 ? 16.123  19.672  1.457   1.00 16.57 ? 101 MET A CA  1 
ATOM   725  C C   . MET A 1 96 ? 15.049  19.770  0.414   1.00 19.89 ? 101 MET A C   1 
ATOM   726  O O   . MET A 1 96 ? 15.100  18.980  -0.546  1.00 20.07 ? 101 MET A O   1 
ATOM   727  C CB  . MET A 1 96 ? 15.983  18.397  2.350   1.00 15.76 ? 101 MET A CB  1 
ATOM   728  C CG  . MET A 1 96 ? 14.692  18.439  3.178   1.00 15.44 ? 101 MET A CG  1 
ATOM   729  S SD  . MET A 1 96 ? 14.596  16.965  4.218   1.00 16.80 ? 101 MET A SD  1 
ATOM   730  C CE  . MET A 1 96 ? 13.241  17.363  5.317   1.00 18.03 ? 101 MET A CE  1 
ATOM   731  N N   . GLU A 1 97 ? 14.062  20.625  0.527   1.00 21.44 ? 102 GLU A N   1 
ATOM   732  C CA  . GLU A 1 97 ? 13.011  20.768  -0.474  1.00 26.77 ? 102 GLU A CA  1 
ATOM   733  C C   . GLU A 1 97 ? 13.547  21.309  -1.819  1.00 28.52 ? 102 GLU A C   1 
ATOM   734  C CB  . GLU A 1 97 ? 12.010  21.777  0.047   1.00 28.32 ? 102 GLU A CB  1 
ATOM   735  C CG  . GLU A 1 97 ? 11.132  21.316  1.194   1.00 29.94 ? 102 GLU A CG  1 
ATOM   736  C CD  . GLU A 1 97 ? 10.019  22.353  1.361   1.00 32.13 ? 102 GLU A CD  1 
ATOM   737  O OE1 . GLU A 1 97 ? 9.462   22.736  0.304   1.00 32.84 ? 102 GLU A OE1 1 
ATOM   738  O OE2 . GLU A 1 97 ? 9.679   22.777  2.482   1.00 33.00 ? 102 GLU A OE2 1 
ATOM   739  O OXT A GLU A 1 97 ? 14.640  21.922  -1.850  0.50 29.19 ? 102 GLU A OXT 1 
ATOM   740  O OXT B GLU A 1 97 ? 13.346  20.535  -2.808  0.50 30.19 ? 102 GLU A OXT 1 
ATOM   741  N N   . GLU B 1 2  ? 16.889  -1.429  -2.422  1.00 30.70 ? 7   GLU B N   1 
ATOM   742  C CA  . GLU B 1 2  ? 15.608  -0.971  -2.975  1.00 28.14 ? 7   GLU B CA  1 
ATOM   743  C C   . GLU B 1 2  ? 14.464  -1.384  -2.042  1.00 25.21 ? 7   GLU B C   1 
ATOM   744  O O   . GLU B 1 2  ? 13.399  -0.910  -2.392  1.00 27.84 ? 7   GLU B O   1 
ATOM   745  C CB  . GLU B 1 2  ? 15.338  -1.453  -4.397  1.00 29.25 ? 7   GLU B CB  1 
ATOM   746  N N   . THR B 1 3  ? 14.654  -2.135  -0.978  1.00 22.93 ? 8   THR B N   1 
ATOM   747  C CA  . THR B 1 3  ? 13.505  -2.474  -0.095  1.00 20.82 ? 8   THR B CA  1 
ATOM   748  C C   . THR B 1 3  ? 13.781  -1.994  1.318   1.00 19.83 ? 8   THR B C   1 
ATOM   749  O O   . THR B 1 3  ? 14.668  -2.519  2.022   1.00 22.76 ? 8   THR B O   1 
ATOM   750  C CB  . THR B 1 3  ? 13.251  -3.995  -0.064  1.00 20.08 ? 8   THR B CB  1 
ATOM   751  O OG1 . THR B 1 3  ? 13.143  -4.479  -1.393  1.00 20.48 ? 8   THR B OG1 1 
ATOM   752  C CG2 . THR B 1 3  ? 11.934  -4.342  0.675   1.00 18.49 ? 8   THR B CG2 1 
ATOM   753  N N   . GLN B 1 4  ? 13.007  -1.020  1.811   1.00 17.72 ? 9   GLN B N   1 
ATOM   754  C CA  . GLN B 1 4  ? 13.214  -0.509  3.155   1.00 17.12 ? 9   GLN B CA  1 
ATOM   755  C C   . GLN B 1 4  ? 12.064  -0.871  4.113   1.00 16.86 ? 9   GLN B C   1 
ATOM   756  O O   . GLN B 1 4  ? 12.210  -0.671  5.311   1.00 17.61 ? 9   GLN B O   1 
ATOM   757  C CB  . GLN B 1 4  ? 13.344  1.035   3.200   1.00 18.15 ? 9   GLN B CB  1 
ATOM   758  C CG  . GLN B 1 4  ? 14.529  1.531   2.358   1.00 21.16 ? 9   GLN B CG  1 
ATOM   759  C CD  . GLN B 1 4  ? 14.162  1.787   0.912   1.00 21.97 ? 9   GLN B CD  1 
ATOM   760  O OE1 . GLN B 1 4  ? 13.100  2.258   0.524   1.00 21.79 ? 9   GLN B OE1 1 
ATOM   761  N NE2 . GLN B 1 4  ? 15.137  1.422   0.065   1.00 24.51 ? 9   GLN B NE2 1 
ATOM   762  N N   . GLU B 1 5  ? 10.925  -1.277  3.579   1.00 15.10 ? 10  GLU B N   1 
ATOM   763  C CA  . GLU B 1 5  ? 9.762   -1.538  4.439   1.00 15.08 ? 10  GLU B CA  1 
ATOM   764  C C   . GLU B 1 5  ? 8.794   -2.518  3.788   1.00 16.70 ? 10  GLU B C   1 
ATOM   765  O O   . GLU B 1 5  ? 8.691   -2.513  2.566   1.00 16.49 ? 10  GLU B O   1 
ATOM   766  C CB  . GLU B 1 5  ? 9.114   -0.202  4.843   1.00 16.18 ? 10  GLU B CB  1 
ATOM   767  C CG  . GLU B 1 5  ? 8.468   0.541   3.685   1.00 17.72 ? 10  GLU B CG  1 
ATOM   768  C CD  . GLU B 1 5  ? 8.280   2.019   3.942   1.00 16.13 ? 10  GLU B CD  1 
ATOM   769  O OE1 . GLU B 1 5  ? 8.827   2.547   4.928   1.00 17.19 ? 10  GLU B OE1 1 
ATOM   770  O OE2 . GLU B 1 5  ? 7.567   2.673   3.159   1.00 15.66 ? 10  GLU B OE2 1 
ATOM   771  N N   . CYS B 1 6  ? 8.075   -3.303  4.605   1.00 13.27 ? 11  CYS B N   1 
ATOM   772  C CA  . CYS B 1 6  ? 7.194   -4.358  4.095   1.00 13.43 ? 11  CYS B CA  1 
ATOM   773  C C   . CYS B 1 6  ? 5.895   -4.467  4.896   1.00 14.09 ? 11  CYS B C   1 
ATOM   774  O O   . CYS B 1 6  ? 5.767   -3.891  5.975   1.00 13.72 ? 11  CYS B O   1 
ATOM   775  C CB  . CYS B 1 6  ? 7.880   -5.739  4.284   1.00 13.72 ? 11  CYS B CB  1 
ATOM   776  S SG  . CYS B 1 6  ? 9.462   -5.853  3.359   1.00 15.02 ? 11  CYS B SG  1 
ATOM   777  N N   . LEU B 1 7  ? 4.848   -5.018  4.283   1.00 12.55 ? 12  LEU B N   1 
ATOM   778  C CA  . LEU B 1 7  ? 3.609   -5.329  5.001   1.00 11.93 ? 12  LEU B CA  1 
ATOM   779  C C   . LEU B 1 7  ? 4.022   -6.363  6.065   1.00 14.09 ? 12  LEU B C   1 
ATOM   780  O O   . LEU B 1 7  ? 4.685   -7.360  5.767   1.00 14.82 ? 12  LEU B O   1 
ATOM   781  C CB  . LEU B 1 7  ? 2.518   -5.899  4.079   1.00 13.26 ? 12  LEU B CB  1 
ATOM   782  C CG  . LEU B 1 7  ? 1.050   -5.795  4.498   1.00 14.55 ? 12  LEU B CG  1 
ATOM   783  C CD1 . LEU B 1 7  ? 0.776   -6.695  5.724   1.00 14.86 ? 12  LEU B CD1 1 
ATOM   784  C CD2 . LEU B 1 7  ? 0.553   -4.375  4.719   1.00 15.95 ? 12  LEU B CD2 1 
ATOM   785  N N   . PHE B 1 8  ? 3.548   -6.113  7.318   1.00 13.65 ? 13  PHE B N   1 
ATOM   786  C CA  . PHE B 1 8  ? 3.873   -7.076  8.414   1.00 14.83 ? 13  PHE B CA  1 
ATOM   787  C C   . PHE B 1 8  ? 2.593   -7.802  8.820   1.00 12.13 ? 13  PHE B C   1 
ATOM   788  O O   . PHE B 1 8  ? 1.549   -7.158  8.994   1.00 12.94 ? 13  PHE B O   1 
ATOM   789  C CB  . PHE B 1 8  ? 4.386   -6.294  9.648   1.00 13.70 ? 13  PHE B CB  1 
ATOM   790  C CG  . PHE B 1 8  ? 4.715   -7.205  10.822  1.00 14.39 ? 13  PHE B CG  1 
ATOM   791  C CD1 . PHE B 1 8  ? 5.899   -7.892  10.798  1.00 13.42 ? 13  PHE B CD1 1 
ATOM   792  C CD2 . PHE B 1 8  ? 3.837   -7.346  11.902  1.00 14.24 ? 13  PHE B CD2 1 
ATOM   793  C CE1 . PHE B 1 8  ? 6.254   -8.746  11.831  1.00 13.51 ? 13  PHE B CE1 1 
ATOM   794  C CE2 . PHE B 1 8  ? 4.189   -8.208  12.953  1.00 15.52 ? 13  PHE B CE2 1 
ATOM   795  C CZ  . PHE B 1 8  ? 5.386   -8.895  12.897  1.00 14.90 ? 13  PHE B CZ  1 
ATOM   796  N N   . PHE B 1 9  ? 2.692   -9.115  9.021   1.00 12.45 ? 14  PHE B N   1 
ATOM   797  C CA  . PHE B 1 9  ? 1.566   -9.902  9.532   1.00 12.77 ? 14  PHE B CA  1 
ATOM   798  C C   . PHE B 1 9  ? 2.205   -11.038 10.355  1.00 13.65 ? 14  PHE B C   1 
ATOM   799  O O   . PHE B 1 9  ? 3.184   -11.651 9.902   1.00 14.51 ? 14  PHE B O   1 
ATOM   800  C CB  . PHE B 1 9  ? 0.750   -10.513 8.382   1.00 13.83 ? 14  PHE B CB  1 
ATOM   801  C CG  . PHE B 1 9  ? -0.605  -11.098 8.702   1.00 14.30 ? 14  PHE B CG  1 
ATOM   802  C CD1 . PHE B 1 9  ? -0.737  -12.245 9.420   1.00 15.84 ? 14  PHE B CD1 1 
ATOM   803  C CD2 . PHE B 1 9  ? -1.752  -10.445 8.270   1.00 17.50 ? 14  PHE B CD2 1 
ATOM   804  C CE1 . PHE B 1 9  ? -1.982  -12.770 9.719   1.00 19.10 ? 14  PHE B CE1 1 
ATOM   805  C CE2 . PHE B 1 9  ? -3.022  -10.935 8.535   1.00 19.65 ? 14  PHE B CE2 1 
ATOM   806  C CZ  . PHE B 1 9  ? -3.105  -12.105 9.251   1.00 18.47 ? 14  PHE B CZ  1 
ATOM   807  N N   . ASN B 1 10 ? 1.607   -11.392 11.500  1.00 13.59 ? 15  ASN B N   1 
ATOM   808  C CA  . ASN B 1 10 ? 2.127   -12.522 12.288  1.00 14.42 ? 15  ASN B CA  1 
ATOM   809  C C   . ASN B 1 10 ? 0.908   -13.257 12.849  1.00 14.95 ? 15  ASN B C   1 
ATOM   810  O O   . ASN B 1 10 ? 0.293   -12.775 13.798  1.00 15.38 ? 15  ASN B O   1 
ATOM   811  C CB  . ASN B 1 10 ? 3.063   -12.078 13.397  1.00 13.40 ? 15  ASN B CB  1 
ATOM   812  C CG  . ASN B 1 10 ? 3.641   -13.270 14.175  1.00 16.23 ? 15  ASN B CG  1 
ATOM   813  O OD1 . ASN B 1 10 ? 3.592   -14.393 13.669  1.00 19.60 ? 15  ASN B OD1 1 
ATOM   814  N ND2 . ASN B 1 10 ? 4.304   -12.973 15.268  1.00 17.43 ? 15  ASN B ND2 1 
ATOM   815  N N   . ALA B 1 11 ? 0.605   -14.440 12.291  1.00 15.98 ? 16  ALA B N   1 
ATOM   816  C CA  . ALA B 1 11 ? -0.532  -15.201 12.841  1.00 16.89 ? 16  ALA B CA  1 
ATOM   817  C C   . ALA B 1 11 ? -0.278  -15.654 14.275  1.00 18.23 ? 16  ALA B C   1 
ATOM   818  O O   . ALA B 1 11 ? -1.299  -15.777 15.010  1.00 17.76 ? 16  ALA B O   1 
ATOM   819  C CB  . ALA B 1 11 ? -0.698  -16.450 11.969  1.00 17.01 ? 16  ALA B CB  1 
ATOM   820  N N   . ASN B 1 12 ? 0.980   -15.781 14.664  1.00 17.25 ? 17  ASN B N   1 
ATOM   821  C CA  . ASN B 1 12 ? 1.264   -16.222 16.044  1.00 17.41 ? 17  ASN B CA  1 
ATOM   822  C C   . ASN B 1 12 ? 1.585   -15.047 16.967  1.00 16.63 ? 17  ASN B C   1 
ATOM   823  O O   . ASN B 1 12 ? 2.386   -15.173 17.899  1.00 16.88 ? 17  ASN B O   1 
ATOM   824  C CB  . ASN B 1 12 ? 2.483   -17.135 15.986  1.00 19.03 ? 17  ASN B CB  1 
ATOM   825  C CG  . ASN B 1 12 ? 2.563   -18.111 17.148  1.00 21.83 ? 17  ASN B CG  1 
ATOM   826  O OD1 . ASN B 1 12 ? 1.530   -18.633 17.593  1.00 24.93 ? 17  ASN B OD1 1 
ATOM   827  N ND2 . ASN B 1 12 ? 3.774   -18.365 17.566  1.00 22.51 ? 17  ASN B ND2 1 
ATOM   828  N N   . TRP B 1 13 ? 0.994   -13.887 16.694  1.00 15.46 ? 18  TRP B N   1 
ATOM   829  C CA  . TRP B 1 13 ? 1.260   -12.665 17.462  1.00 16.93 ? 18  TRP B CA  1 
ATOM   830  C C   . TRP B 1 13 ? 1.010   -12.769 18.972  1.00 18.08 ? 18  TRP B C   1 
ATOM   831  O O   . TRP B 1 13 ? 1.717   -12.108 19.737  1.00 17.28 ? 18  TRP B O   1 
ATOM   832  C CB  . TRP B 1 13 ? 0.416   -11.497 16.923  1.00 17.33 ? 18  TRP B CB  1 
ATOM   833  C CG  . TRP B 1 13 ? -1.070  -11.670 17.048  1.00 17.63 ? 18  TRP B CG  1 
ATOM   834  C CD1 . TRP B 1 13 ? -1.892  -12.399 16.242  1.00 17.64 ? 18  TRP B CD1 1 
ATOM   835  C CD2 . TRP B 1 13 ? -1.928  -11.099 18.053  1.00 20.33 ? 18  TRP B CD2 1 
ATOM   836  N NE1 . TRP B 1 13 ? -3.214  -12.353 16.676  1.00 20.95 ? 18  TRP B NE1 1 
ATOM   837  C CE2 . TRP B 1 13 ? -3.219  -11.550 17.793  1.00 21.44 ? 18  TRP B CE2 1 
ATOM   838  C CE3 . TRP B 1 13 ? -1.691  -10.274 19.146  1.00 23.18 ? 18  TRP B CE3 1 
ATOM   839  C CZ2 . TRP B 1 13 ? -4.322  -11.180 18.582  1.00 24.14 ? 18  TRP B CZ2 1 
ATOM   840  C CZ3 . TRP B 1 13 ? -2.760  -9.905  19.947  1.00 23.91 ? 18  TRP B CZ3 1 
ATOM   841  C CH2 . TRP B 1 13 ? -4.048  -10.346 19.642  1.00 23.94 ? 18  TRP B CH2 1 
ATOM   842  N N   . GLU B 1 14 ? 0.015   -13.573 19.373  1.00 17.31 ? 19  GLU B N   1 
ATOM   843  C CA  . GLU B 1 14 ? -0.311  -13.617 20.795  1.00 21.53 ? 19  GLU B CA  1 
ATOM   844  C C   . GLU B 1 14 ? 0.794   -14.360 21.538  1.00 20.70 ? 19  GLU B C   1 
ATOM   845  O O   . GLU B 1 14 ? 1.253   -13.825 22.539  1.00 22.70 ? 19  GLU B O   1 
ATOM   846  C CB  . GLU B 1 14 ? -1.652  -14.315 21.035  1.00 23.44 ? 19  GLU B CB  1 
ATOM   847  C CG  . GLU B 1 14 ? -2.411  -13.656 22.179  1.00 32.35 ? 19  GLU B CG  1 
ATOM   848  C CD  . GLU B 1 14 ? -3.842  -14.155 22.296  1.00 35.34 ? 19  GLU B CD  1 
ATOM   849  O OE1 . GLU B 1 14 ? -4.513  -14.351 21.256  1.00 37.78 ? 19  GLU B OE1 1 
ATOM   850  O OE2 . GLU B 1 14 ? -4.267  -14.351 23.460  1.00 38.51 ? 19  GLU B OE2 1 
ATOM   851  N N   . ARG B 1 15 ? 1.278   -15.467 21.010  1.00 20.78 ? 20  ARG B N   1 
ATOM   852  C CA  . ARG B 1 15 ? 2.389   -16.165 21.673  1.00 21.30 ? 20  ARG B CA  1 
ATOM   853  C C   . ARG B 1 15 ? 3.739   -15.483 21.519  1.00 20.33 ? 20  ARG B C   1 
ATOM   854  O O   . ARG B 1 15 ? 4.619   -15.506 22.393  1.00 21.69 ? 20  ARG B O   1 
ATOM   855  C CB  . ARG B 1 15 ? 2.416   -17.618 21.157  1.00 22.55 ? 20  ARG B CB  1 
ATOM   856  C CG  . ARG B 1 15 ? 1.314   -18.457 21.826  1.00 24.37 ? 20  ARG B CG  1 
ATOM   857  C CD  . ARG B 1 15 ? 1.024   -19.764 21.072  1.00 27.12 ? 20  ARG B CD  1 
ATOM   858  N NE  . ARG B 1 15 ? 2.157   -20.674 21.153  1.00 28.78 ? 20  ARG B NE  1 
ATOM   859  C CZ  . ARG B 1 15 ? 2.390   -21.491 22.189  1.00 30.91 ? 20  ARG B CZ  1 
ATOM   860  N NH1 . ARG B 1 15 ? 1.577   -21.536 23.244  1.00 29.34 ? 20  ARG B NH1 1 
ATOM   861  N NH2 . ARG B 1 15 ? 3.461   -22.274 22.190  1.00 30.72 ? 20  ARG B NH2 1 
ATOM   862  N N   . ASP B 1 16 ? 3.984   -14.816 20.374  1.00 19.34 ? 21  ASP B N   1 
ATOM   863  C CA  . ASP B 1 16 ? 5.253   -14.193 20.063  1.00 19.86 ? 21  ASP B CA  1 
ATOM   864  C C   . ASP B 1 16 ? 5.350   -12.787 20.658  1.00 21.02 ? 21  ASP B C   1 
ATOM   865  O O   . ASP B 1 16 ? 6.458   -12.253 20.737  1.00 23.80 ? 21  ASP B O   1 
ATOM   866  C CB  . ASP B 1 16 ? 5.506   -14.037 18.550  1.00 19.82 ? 21  ASP B CB  1 
ATOM   867  C CG  . ASP B 1 16 ? 5.776   -15.302 17.789  1.00 22.02 ? 21  ASP B CG  1 
ATOM   868  O OD1 . ASP B 1 16 ? 6.111   -16.363 18.375  1.00 23.35 ? 21  ASP B OD1 1 
ATOM   869  O OD2 . ASP B 1 16 ? 5.575   -15.369 16.503  1.00 18.76 ? 21  ASP B OD2 1 
ATOM   870  N N   . ARG B 1 17 ? 4.248   -12.192 21.107  1.00 20.73 ? 22  ARG B N   1 
ATOM   871  C CA  . ARG B 1 17 ? 4.206   -10.849 21.661  1.00 21.81 ? 22  ARG B CA  1 
ATOM   872  C C   . ARG B 1 17 ? 4.616   -9.803  20.622  1.00 19.93 ? 22  ARG B C   1 
ATOM   873  O O   . ARG B 1 17 ? 5.447   -8.912  20.870  1.00 21.98 ? 22  ARG B O   1 
ATOM   874  C CB  . ARG B 1 17 ? 5.050   -10.694 22.938  1.00 21.92 ? 22  ARG B CB  1 
ATOM   875  C CG  . ARG B 1 17 ? 4.964   -11.909 23.889  1.00 25.02 ? 22  ARG B CG  1 
ATOM   876  C CD  . ARG B 1 17 ? 3.510   -12.246 24.199  1.00 27.37 ? 22  ARG B CD  1 
ATOM   877  N NE  . ARG B 1 17 ? 2.885   -11.140 24.929  1.00 29.13 ? 22  ARG B NE  1 
ATOM   878  C CZ  . ARG B 1 17 ? 1.573   -10.941 24.966  1.00 32.10 ? 22  ARG B CZ  1 
ATOM   879  N NH1 . ARG B 1 17 ? 0.708   -11.719 24.320  1.00 32.81 ? 22  ARG B NH1 1 
ATOM   880  N NH2 . ARG B 1 17 ? 1.108   -9.914  25.664  1.00 33.26 ? 22  ARG B NH2 1 
ATOM   881  N N   . THR B 1 18 ? 3.948   -9.844  19.451  1.00 17.85 ? 23  THR B N   1 
ATOM   882  C CA  . THR B 1 18 ? 4.203   -8.817  18.425  1.00 16.43 ? 23  THR B CA  1 
ATOM   883  C C   . THR B 1 18 ? 2.851   -8.255  18.015  1.00 13.75 ? 23  THR B C   1 
ATOM   884  O O   . THR B 1 18 ? 1.761   -8.660  18.496  1.00 15.42 ? 23  THR B O   1 
ATOM   885  C CB  . THR B 1 18 ? 4.794   -9.498  17.159  1.00 16.12 ? 23  THR B CB  1 
ATOM   886  O OG1 . THR B 1 18 ? 3.825   -10.365 16.549  1.00 16.56 ? 23  THR B OG1 1 
ATOM   887  C CG2 . THR B 1 18 ? 6.091   -10.270 17.421  1.00 19.01 ? 23  THR B CG2 1 
ATOM   888  N N   . ASN B 1 19 ? 2.941   -7.209  17.132  1.00 13.15 ? 24  ASN B N   1 
ATOM   889  C CA  . ASN B 1 19 ? 1.702   -6.770  16.506  1.00 12.52 ? 24  ASN B CA  1 
ATOM   890  C C   . ASN B 1 19 ? 1.106   -7.921  15.696  1.00 11.96 ? 24  ASN B C   1 
ATOM   891  O O   . ASN B 1 19 ? 1.840   -8.850  15.302  1.00 14.18 ? 24  ASN B O   1 
ATOM   892  C CB  . ASN B 1 19 ? 2.099   -5.689  15.458  1.00 12.28 ? 24  ASN B CB  1 
ATOM   893  C CG  . ASN B 1 19 ? 2.627   -4.371  16.020  1.00 12.95 ? 24  ASN B CG  1 
ATOM   894  O OD1 . ASN B 1 19 ? 2.605   -4.195  17.239  1.00 15.68 ? 24  ASN B OD1 1 
ATOM   895  N ND2 . ASN B 1 19 ? 3.111   -3.469  15.126  1.00 12.51 ? 24  ASN B ND2 1 
ATOM   896  N N   . GLN B 1 20 ? -0.204  -7.884  15.410  1.00 12.07 ? 25  GLN B N   1 
ATOM   897  C CA  . GLN B 1 20 ? -0.765  -8.892  14.502  1.00 13.76 ? 25  GLN B CA  1 
ATOM   898  C C   . GLN B 1 20 ? -0.457  -8.387  13.073  1.00 14.10 ? 25  GLN B C   1 
ATOM   899  O O   . GLN B 1 20 ? -0.217  -9.216  12.160  1.00 15.07 ? 25  GLN B O   1 
ATOM   900  C CB  . GLN B 1 20 ? -2.255  -9.058  14.712  1.00 16.07 ? 25  GLN B CB  1 
ATOM   901  C CG  . GLN B 1 20 ? -2.832  -10.097 13.749  1.00 18.03 ? 25  GLN B CG  1 
ATOM   902  C CD  . GLN B 1 20 ? -4.298  -10.396 14.031  1.00 19.33 ? 25  GLN B CD  1 
ATOM   903  O OE1 . GLN B 1 20 ? -4.959  -9.648  14.719  1.00 21.15 ? 25  GLN B OE1 1 
ATOM   904  N NE2 . GLN B 1 20 ? -4.757  -11.489 13.418  1.00 21.14 ? 25  GLN B NE2 1 
ATOM   905  N N   . THR B 1 21 ? -0.615  -7.108  12.807  1.00 13.21 ? 26  THR B N   1 
ATOM   906  C CA  . THR B 1 21 ? -0.361  -6.501  11.520  1.00 13.25 ? 26  THR B CA  1 
ATOM   907  C C   . THR B 1 21 ? 0.354   -5.172  11.666  1.00 13.67 ? 26  THR B C   1 
ATOM   908  O O   . THR B 1 21 ? 0.320   -4.520  12.723  1.00 12.02 ? 26  THR B O   1 
ATOM   909  C CB  . THR B 1 21 ? -1.654  -6.191  10.729  1.00 11.41 ? 26  THR B CB  1 
ATOM   910  O OG1 . THR B 1 21 ? -2.398  -5.157  11.429  1.00 12.19 ? 26  THR B OG1 1 
ATOM   911  C CG2 . THR B 1 21 ? -2.594  -7.380  10.623  1.00 13.64 ? 26  THR B CG2 1 
ATOM   912  N N   . GLY B 1 22 ? 0.981   -4.670  10.592  1.00 13.21 ? 27  GLY B N   1 
ATOM   913  C CA  . GLY B 1 22 ? 1.577   -3.352  10.553  1.00 12.99 ? 27  GLY B CA  1 
ATOM   914  C C   . GLY B 1 22 ? 2.481   -3.136  9.323   1.00 14.22 ? 27  GLY B C   1 
ATOM   915  O O   . GLY B 1 22 ? 2.260   -3.830  8.336   1.00 13.42 ? 27  GLY B O   1 
ATOM   916  N N   . VAL B 1 23 ? 3.483   -2.309  9.564   1.00 12.62 ? 28  VAL B N   1 
ATOM   917  C CA  . VAL B 1 23 ? 4.539   -2.014  8.578   1.00 12.99 ? 28  VAL B CA  1 
ATOM   918  C C   . VAL B 1 23 ? 5.889   -2.336  9.216   1.00 13.57 ? 28  VAL B C   1 
ATOM   919  O O   . VAL B 1 23 ? 6.267   -1.727  10.215  1.00 14.28 ? 28  VAL B O   1 
ATOM   920  C CB  . VAL B 1 23 ? 4.458   -0.551  8.134   1.00 14.65 ? 28  VAL B CB  1 
ATOM   921  C CG1 . VAL B 1 23 ? 5.555   -0.217  7.098   1.00 14.81 ? 28  VAL B CG1 1 
ATOM   922  C CG2 . VAL B 1 23 ? 3.108   -0.187  7.517   1.00 14.55 ? 28  VAL B CG2 1 
ATOM   923  N N   . GLU B 1 24 ? 6.651   -3.289  8.622   1.00 14.36 ? 29  GLU B N   1 
ATOM   924  C CA  . GLU B 1 24 ? 7.967   -3.612  9.207   1.00 14.74 ? 29  GLU B CA  1 
ATOM   925  C C   . GLU B 1 24 ? 9.089   -2.850  8.557   1.00 16.50 ? 29  GLU B C   1 
ATOM   926  O O   . GLU B 1 24 ? 9.253   -2.917  7.339   1.00 16.53 ? 29  GLU B O   1 
ATOM   927  C CB  . GLU B 1 24 ? 8.220   -5.141  9.032   1.00 14.20 ? 29  GLU B CB  1 
ATOM   928  C CG  . GLU B 1 24 ? 9.403   -5.591  9.897   1.00 15.47 ? 29  GLU B CG  1 
ATOM   929  C CD  . GLU B 1 24 ? 9.770   -7.044  9.734   1.00 17.40 ? 29  GLU B CD  1 
ATOM   930  O OE1 . GLU B 1 24 ? 9.174   -7.848  9.011   1.00 17.11 ? 29  GLU B OE1 1 
ATOM   931  O OE2 . GLU B 1 24 ? 10.797  -7.467  10.391  1.00 20.52 ? 29  GLU B OE2 1 
ATOM   932  N N   . PRO B 1 25 ? 9.980   -2.191  9.308   1.00 17.23 ? 30  PRO B N   1 
ATOM   933  C CA  . PRO B 1 25 ? 11.177  -1.564  8.741   1.00 18.15 ? 30  PRO B CA  1 
ATOM   934  C C   . PRO B 1 25 ? 12.231  -2.617  8.441   1.00 17.76 ? 30  PRO B C   1 
ATOM   935  O O   . PRO B 1 25 ? 12.478  -3.478  9.326   1.00 18.93 ? 30  PRO B O   1 
ATOM   936  C CB  . PRO B 1 25 ? 11.631  -0.587  9.822   1.00 20.35 ? 30  PRO B CB  1 
ATOM   937  C CG  . PRO B 1 25 ? 10.800  -0.835  11.025  1.00 20.60 ? 30  PRO B CG  1 
ATOM   938  C CD  . PRO B 1 25 ? 9.863   -1.980  10.775  1.00 17.78 ? 30  PRO B CD  1 
ATOM   939  N N   . CYS B 1 26 ? 12.880  -2.670  7.271   1.00 18.68 ? 31  CYS B N   1 
ATOM   940  C CA  . CYS B 1 26 ? 13.858  -3.716  6.993   1.00 21.38 ? 31  CYS B CA  1 
ATOM   941  C C   . CYS B 1 26 ? 15.309  -3.379  7.325   1.00 27.78 ? 31  CYS B C   1 
ATOM   942  O O   . CYS B 1 26 ? 16.138  -4.317  7.394   1.00 29.53 ? 31  CYS B O   1 
ATOM   943  C CB  . CYS B 1 26 ? 13.819  -4.209  5.540   1.00 19.75 ? 31  CYS B CB  1 
ATOM   944  S SG  . CYS B 1 26 ? 12.176  -4.665  4.962   1.00 18.50 ? 31  CYS B SG  1 
ATOM   945  N N   . TYR B 1 27 ? 15.664  -2.125  7.427   1.00 31.39 ? 32  TYR B N   1 
ATOM   946  C CA  . TYR B 1 27 ? 17.033  -1.695  7.691   1.00 37.15 ? 32  TYR B CA  1 
ATOM   947  C C   . TYR B 1 27 ? 18.065  -2.430  6.835   1.00 40.25 ? 32  TYR B C   1 
ATOM   948  O O   . TYR B 1 27 ? 18.854  -3.215  7.356   1.00 41.35 ? 32  TYR B O   1 
ATOM   949  C CB  . TYR B 1 27 ? 17.495  -1.843  9.132   1.00 38.06 ? 32  TYR B CB  1 
ATOM   950  C CG  . TYR B 1 27 ? 16.568  -1.398  10.224  1.00 39.55 ? 32  TYR B CG  1 
ATOM   951  C CD1 . TYR B 1 27 ? 16.202  -0.071  10.383  1.00 40.00 ? 32  TYR B CD1 1 
ATOM   952  C CD2 . TYR B 1 27 ? 16.068  -2.342  11.118  1.00 40.58 ? 32  TYR B CD2 1 
ATOM   953  C CE1 . TYR B 1 27 ? 15.348  0.308   11.404  1.00 40.45 ? 32  TYR B CE1 1 
ATOM   954  C CE2 . TYR B 1 27 ? 15.214  -1.965  12.140  1.00 41.04 ? 32  TYR B CE2 1 
ATOM   955  C CZ  . TYR B 1 27 ? 14.876  -0.642  12.278  1.00 41.11 ? 32  TYR B CZ  1 
ATOM   956  O OH  . TYR B 1 27 ? 14.046  -0.279  13.317  1.00 42.59 ? 32  TYR B OH  1 
ATOM   957  N N   . GLY B 1 28 ? 18.049  -2.184  5.531   1.00 44.13 ? 33  GLY B N   1 
ATOM   958  C CA  . GLY B 1 28 ? 19.047  -2.863  4.680   1.00 48.28 ? 33  GLY B CA  1 
ATOM   959  C C   . GLY B 1 28 ? 20.184  -1.856  4.473   1.00 50.98 ? 33  GLY B C   1 
ATOM   960  O O   . GLY B 1 28 ? 20.095  -0.740  4.999   1.00 51.72 ? 33  GLY B O   1 
ATOM   961  N N   . ASP B 1 29 ? 21.209  -2.274  3.738   1.00 52.78 ? 34  ASP B N   1 
ATOM   962  C CA  . ASP B 1 29 ? 22.321  -1.371  3.465   1.00 54.73 ? 34  ASP B CA  1 
ATOM   963  C C   . ASP B 1 29 ? 23.022  -1.750  2.166   1.00 55.95 ? 34  ASP B C   1 
ATOM   964  O O   . ASP B 1 29 ? 22.552  -2.607  1.419   1.00 56.44 ? 34  ASP B O   1 
ATOM   965  C CB  . ASP B 1 29 ? 23.310  -1.349  4.624   1.00 55.00 ? 34  ASP B CB  1 
ATOM   966  C CG  . ASP B 1 29 ? 23.798  -2.728  5.009   1.00 54.96 ? 34  ASP B CG  1 
ATOM   967  O OD1 . ASP B 1 29 ? 24.695  -3.246  4.327   1.00 55.21 ? 34  ASP B OD1 1 
ATOM   968  O OD2 . ASP B 1 29 ? 23.267  -3.285  5.994   1.00 56.13 ? 34  ASP B OD2 1 
ATOM   969  N N   . LYS B 1 30 ? 24.154  -1.096  1.918   1.00 57.00 ? 35  LYS B N   1 
ATOM   970  C CA  . LYS B 1 30 ? 24.899  -1.311  0.683   1.00 58.30 ? 35  LYS B CA  1 
ATOM   971  C C   . LYS B 1 30 ? 25.105  -2.800  0.429   1.00 58.43 ? 35  LYS B C   1 
ATOM   972  O O   . LYS B 1 30 ? 24.677  -3.322  -0.600  1.00 58.93 ? 35  LYS B O   1 
ATOM   973  C CB  . LYS B 1 30 ? 26.237  -0.583  0.725   1.00 58.16 ? 35  LYS B CB  1 
ATOM   974  N N   . ASP B 1 31 ? 25.710  -3.483  1.393   1.00 58.65 ? 36  ASP B N   1 
ATOM   975  C CA  . ASP B 1 31 ? 25.987  -4.910  1.273   1.00 58.60 ? 36  ASP B CA  1 
ATOM   976  C C   . ASP B 1 31 ? 24.767  -5.796  1.485   1.00 57.24 ? 36  ASP B C   1 
ATOM   977  O O   . ASP B 1 31 ? 24.718  -6.916  0.957   1.00 57.69 ? 36  ASP B O   1 
ATOM   978  C CB  . ASP B 1 31 ? 27.113  -5.269  2.257   1.00 60.50 ? 36  ASP B CB  1 
ATOM   979  C CG  . ASP B 1 31 ? 28.498  -5.016  1.695   1.00 62.01 ? 36  ASP B CG  1 
ATOM   980  O OD1 . ASP B 1 31 ? 28.670  -4.046  0.924   1.00 62.85 ? 36  ASP B OD1 1 
ATOM   981  O OD2 . ASP B 1 31 ? 29.437  -5.782  2.014   1.00 62.93 ? 36  ASP B OD2 1 
ATOM   982  N N   . LYS B 1 32 ? 23.777  -5.347  2.254   1.00 54.36 ? 37  LYS B N   1 
ATOM   983  C CA  . LYS B 1 32 ? 22.612  -6.171  2.561   1.00 51.89 ? 37  LYS B CA  1 
ATOM   984  C C   . LYS B 1 32 ? 21.388  -5.794  1.739   1.00 49.06 ? 37  LYS B C   1 
ATOM   985  O O   . LYS B 1 32 ? 20.693  -4.832  2.088   1.00 49.96 ? 37  LYS B O   1 
ATOM   986  C CB  . LYS B 1 32 ? 22.326  -6.087  4.073   1.00 52.94 ? 37  LYS B CB  1 
ATOM   987  C CG  . LYS B 1 32 ? 23.571  -6.190  4.939   1.00 53.92 ? 37  LYS B CG  1 
ATOM   988  C CD  . LYS B 1 32 ? 23.416  -6.973  6.221   1.00 54.63 ? 37  LYS B CD  1 
ATOM   989  C CE  . LYS B 1 32 ? 23.054  -6.117  7.420   1.00 54.75 ? 37  LYS B CE  1 
ATOM   990  N NZ  . LYS B 1 32 ? 24.216  -5.504  8.114   1.00 54.55 ? 37  LYS B NZ  1 
ATOM   991  N N   . ARG B 1 33 ? 21.108  -6.520  0.654   1.00 44.53 ? 38  ARG B N   1 
ATOM   992  C CA  . ARG B 1 33 ? 19.963  -6.248  -0.212  1.00 39.71 ? 38  ARG B CA  1 
ATOM   993  C C   . ARG B 1 33 ? 18.708  -6.975  0.275   1.00 36.28 ? 38  ARG B C   1 
ATOM   994  O O   . ARG B 1 33 ? 18.605  -8.196  0.196   1.00 35.82 ? 38  ARG B O   1 
ATOM   995  C CB  . ARG B 1 33 ? 20.274  -6.658  -1.640  1.00 38.74 ? 38  ARG B CB  1 
ATOM   996  N N   . ARG B 1 34 ? 17.742  -6.237  0.797   1.00 31.07 ? 39  ARG B N   1 
ATOM   997  C CA  . ARG B 1 34 ? 16.566  -6.790  1.441   1.00 26.83 ? 39  ARG B CA  1 
ATOM   998  C C   . ARG B 1 34 ? 15.409  -7.108  0.510   1.00 22.52 ? 39  ARG B C   1 
ATOM   999  O O   . ARG B 1 34 ? 15.451  -6.778  -0.672  1.00 20.49 ? 39  ARG B O   1 
ATOM   1000 C CB  . ARG B 1 34 ? 16.058  -5.766  2.483   1.00 27.90 ? 39  ARG B CB  1 
ATOM   1001 C CG  . ARG B 1 34 ? 17.161  -5.439  3.488   1.00 30.96 ? 39  ARG B CG  1 
ATOM   1002 C CD  . ARG B 1 34 ? 17.258  -6.536  4.542   1.00 33.77 ? 39  ARG B CD  1 
ATOM   1003 N NE  . ARG B 1 34 ? 17.887  -6.062  5.765   1.00 34.96 ? 39  ARG B NE  1 
ATOM   1004 C CZ  . ARG B 1 34 ? 18.895  -6.664  6.391   1.00 35.54 ? 39  ARG B CZ  1 
ATOM   1005 N NH1 . ARG B 1 34 ? 19.413  -7.788  5.902   1.00 36.26 ? 39  ARG B NH1 1 
ATOM   1006 N NH2 . ARG B 1 34 ? 19.370  -6.123  7.505   1.00 35.76 ? 39  ARG B NH2 1 
ATOM   1007 N N   . HIS B 1 35 ? 14.470  -7.930  1.006   1.00 19.77 ? 40  HIS B N   1 
ATOM   1008 C CA  . HIS B 1 35 ? 13.301  -8.337  0.239   1.00 17.86 ? 40  HIS B CA  1 
ATOM   1009 C C   . HIS B 1 35 ? 12.095  -8.350  1.217   1.00 17.40 ? 40  HIS B C   1 
ATOM   1010 O O   . HIS B 1 35 ? 12.390  -8.441  2.419   1.00 17.85 ? 40  HIS B O   1 
ATOM   1011 C CB  . HIS B 1 35 ? 13.407  -9.749  -0.353  1.00 19.52 ? 40  HIS B CB  1 
ATOM   1012 C CG  . HIS B 1 35 ? 14.534  -9.944  -1.335  1.00 22.03 ? 40  HIS B CG  1 
ATOM   1013 N ND1 . HIS B 1 35 ? 14.323  -10.039 -2.696  1.00 24.67 ? 40  HIS B ND1 1 
ATOM   1014 C CD2 . HIS B 1 35 ? 15.857  -10.046 -1.137  1.00 21.90 ? 40  HIS B CD2 1 
ATOM   1015 C CE1 . HIS B 1 35 ? 15.514  -10.193 -3.290  1.00 22.19 ? 40  HIS B CE1 1 
ATOM   1016 N NE2 . HIS B 1 35 ? 16.442  -10.187 -2.379  1.00 25.17 ? 40  HIS B NE2 1 
ATOM   1017 N N   . CYS B 1 36 ? 10.894  -8.345  0.699   1.00 15.58 ? 41  CYS B N   1 
ATOM   1018 C CA  . CYS B 1 36 ? 9.703   -8.640  1.480   1.00 14.41 ? 41  CYS B CA  1 
ATOM   1019 C C   . CYS B 1 36 ? 9.307   -10.075 1.158   1.00 15.29 ? 41  CYS B C   1 
ATOM   1020 O O   . CYS B 1 36 ? 9.757   -10.693 0.176   1.00 15.00 ? 41  CYS B O   1 
ATOM   1021 C CB  . CYS B 1 36 ? 8.513   -7.747  1.162   1.00 15.53 ? 41  CYS B CB  1 
ATOM   1022 S SG  . CYS B 1 36 ? 8.836   -5.974  1.396   1.00 15.63 ? 41  CYS B SG  1 
ATOM   1023 N N   . PHE B 1 37 ? 8.483   -10.700 1.991   1.00 14.99 ? 42  PHE B N   1 
ATOM   1024 C CA  . PHE B 1 37 ? 8.039   -12.081 1.792   1.00 14.17 ? 42  PHE B CA  1 
ATOM   1025 C C   . PHE B 1 37 ? 6.649   -12.289 2.358   1.00 13.43 ? 42  PHE B C   1 
ATOM   1026 O O   . PHE B 1 37 ? 6.168   -11.505 3.231   1.00 15.29 ? 42  PHE B O   1 
ATOM   1027 C CB  . PHE B 1 37 ? 8.987   -13.137 2.442   1.00 15.48 ? 42  PHE B CB  1 
ATOM   1028 C CG  . PHE B 1 37 ? 8.789   -13.318 3.931   1.00 15.28 ? 42  PHE B CG  1 
ATOM   1029 C CD1 . PHE B 1 37 ? 9.322   -12.387 4.805   1.00 15.24 ? 42  PHE B CD1 1 
ATOM   1030 C CD2 . PHE B 1 37 ? 8.135   -14.420 4.469   1.00 15.61 ? 42  PHE B CD2 1 
ATOM   1031 C CE1 . PHE B 1 37 ? 9.173   -12.514 6.189   1.00 15.54 ? 42  PHE B CE1 1 
ATOM   1032 C CE2 . PHE B 1 37 ? 7.977   -14.548 5.840   1.00 16.06 ? 42  PHE B CE2 1 
ATOM   1033 C CZ  . PHE B 1 37 ? 8.478   -13.579 6.722   1.00 13.42 ? 42  PHE B CZ  1 
ATOM   1034 N N   . ALA B 1 38 ? 6.010   -13.385 1.954   1.00 13.42 ? 43  ALA B N   1 
ATOM   1035 C CA  . ALA B 1 38 ? 4.733   -13.826 2.521   1.00 12.70 ? 43  ALA B CA  1 
ATOM   1036 C C   . ALA B 1 38 ? 4.765   -15.324 2.649   1.00 13.30 ? 43  ALA B C   1 
ATOM   1037 O O   . ALA B 1 38 ? 5.314   -15.991 1.723   1.00 14.92 ? 43  ALA B O   1 
ATOM   1038 C CB  . ALA B 1 38 ? 3.566   -13.422 1.604   1.00 14.64 ? 43  ALA B CB  1 
ATOM   1039 N N   . THR B 1 39 ? 4.131   -15.943 3.648   1.00 13.39 ? 44  THR B N   1 
ATOM   1040 C CA  . THR B 1 39 ? 3.959   -17.390 3.721   1.00 14.47 ? 44  THR B CA  1 
ATOM   1041 C C   . THR B 1 39 ? 2.543   -17.669 4.219   1.00 13.71 ? 44  THR B C   1 
ATOM   1042 O O   . THR B 1 39 ? 2.039   -16.917 5.067   1.00 14.79 ? 44  THR B O   1 
ATOM   1043 C CB  . THR B 1 39 ? 4.996   -18.111 4.581   1.00 14.19 ? 44  THR B CB  1 
ATOM   1044 O OG1 . THR B 1 39 ? 4.676   -19.511 4.762   1.00 16.22 ? 44  THR B OG1 1 
ATOM   1045 C CG2 . THR B 1 39 ? 5.216   -17.490 5.964   1.00 15.80 ? 44  THR B CG2 1 
ATOM   1046 N N   . TRP B 1 40 ? 1.857   -18.634 3.579   1.00 14.86 ? 45  TRP B N   1 
ATOM   1047 C CA  . TRP B 1 40 ? 0.452   -18.864 3.819   1.00 15.60 ? 45  TRP B CA  1 
ATOM   1048 C C   . TRP B 1 40 ? 0.090   -20.342 3.583   1.00 15.61 ? 45  TRP B C   1 
ATOM   1049 O O   . TRP B 1 40 ? 0.859   -21.081 2.969   1.00 17.04 ? 45  TRP B O   1 
ATOM   1050 C CB  . TRP B 1 40 ? -0.447  -18.003 2.889   1.00 16.64 ? 45  TRP B CB  1 
ATOM   1051 C CG  . TRP B 1 40 ? -0.320  -18.204 1.412   1.00 15.25 ? 45  TRP B CG  1 
ATOM   1052 C CD1 . TRP B 1 40 ? -1.244  -18.862 0.623   1.00 16.01 ? 45  TRP B CD1 1 
ATOM   1053 C CD2 . TRP B 1 40 ? 0.666   -17.716 0.498   1.00 16.36 ? 45  TRP B CD2 1 
ATOM   1054 N NE1 . TRP B 1 40 ? -0.855  -18.831 -0.680  1.00 17.54 ? 45  TRP B NE1 1 
ATOM   1055 C CE2 . TRP B 1 40 ? 0.287   -18.100 -0.807  1.00 16.14 ? 45  TRP B CE2 1 
ATOM   1056 C CE3 . TRP B 1 40 ? 1.814   -16.934 0.623   1.00 16.05 ? 45  TRP B CE3 1 
ATOM   1057 C CZ2 . TRP B 1 40 ? 1.021   -17.782 -1.953  1.00 17.35 ? 45  TRP B CZ2 1 
ATOM   1058 C CZ3 . TRP B 1 40 ? 2.590   -16.647 -0.487  1.00 16.99 ? 45  TRP B CZ3 1 
ATOM   1059 C CH2 . TRP B 1 40 ? 2.163   -17.063 -1.769  1.00 16.65 ? 45  TRP B CH2 1 
ATOM   1060 N N   . LYS B 1 41 ? -1.101  -20.668 4.071   1.00 16.52 ? 46  LYS B N   1 
ATOM   1061 C CA  . LYS B 1 41 ? -1.761  -21.953 3.729   1.00 17.90 ? 46  LYS B CA  1 
ATOM   1062 C C   . LYS B 1 41 ? -2.904  -21.655 2.759   1.00 18.27 ? 46  LYS B C   1 
ATOM   1063 O O   . LYS B 1 41 ? -3.467  -20.546 2.755   1.00 18.39 ? 46  LYS B O   1 
ATOM   1064 C CB  . LYS B 1 41 ? -2.243  -22.689 4.992   1.00 21.00 ? 46  LYS B CB  1 
ATOM   1065 C CG  . LYS B 1 41 ? -1.081  -22.933 5.955   1.00 23.68 ? 46  LYS B CG  1 
ATOM   1066 C CD  . LYS B 1 41 ? -1.507  -23.641 7.242   1.00 29.33 ? 46  LYS B CD  1 
ATOM   1067 C CE  . LYS B 1 41 ? -0.251  -23.903 8.075   1.00 32.43 ? 46  LYS B CE  1 
ATOM   1068 N NZ  . LYS B 1 41 ? -0.459  -24.851 9.210   1.00 34.56 ? 46  LYS B NZ  1 
ATOM   1069 N N   . ASN B 1 42 ? -3.255  -22.664 1.931   1.00 19.97 ? 47  ASN B N   1 
ATOM   1070 C CA  . ASN B 1 42 ? -4.332  -22.519 0.957   1.00 21.32 ? 47  ASN B CA  1 
ATOM   1071 C C   . ASN B 1 42 ? -5.035  -23.889 0.885   1.00 24.99 ? 47  ASN B C   1 
ATOM   1072 O O   . ASN B 1 42 ? -4.589  -24.774 0.166   1.00 26.79 ? 47  ASN B O   1 
ATOM   1073 C CB  . ASN B 1 42 ? -3.788  -22.175 -0.424  1.00 21.41 ? 47  ASN B CB  1 
ATOM   1074 C CG  . ASN B 1 42 ? -4.865  -21.903 -1.484  1.00 22.32 ? 47  ASN B CG  1 
ATOM   1075 O OD1 . ASN B 1 42 ? -6.044  -22.124 -1.203  1.00 24.26 ? 47  ASN B OD1 1 
ATOM   1076 N ND2 . ASN B 1 42 ? -4.385  -21.401 -2.617  1.00 22.60 ? 47  ASN B ND2 1 
ATOM   1077 N N   . ILE B 1 43 ? -6.043  -24.063 1.742   1.00 29.24 ? 48  ILE B N   1 
ATOM   1078 C CA  . ILE B 1 43 ? -6.690  -25.401 1.723   1.00 33.87 ? 48  ILE B CA  1 
ATOM   1079 C C   . ILE B 1 43 ? -7.979  -25.254 0.936   1.00 33.98 ? 48  ILE B C   1 
ATOM   1080 O O   . ILE B 1 43 ? -8.956  -24.611 1.307   1.00 33.86 ? 48  ILE B O   1 
ATOM   1081 C CB  . ILE B 1 43 ? -6.779  -26.056 3.094   1.00 36.25 ? 48  ILE B CB  1 
ATOM   1082 C CG1 . ILE B 1 43 ? -8.012  -25.649 3.897   1.00 38.05 ? 48  ILE B CG1 1 
ATOM   1083 C CG2 . ILE B 1 43 ? -5.538  -25.790 3.949   1.00 36.94 ? 48  ILE B CG2 1 
ATOM   1084 C CD1 . ILE B 1 43 ? -8.784  -26.867 4.387   1.00 39.12 ? 48  ILE B CD1 1 
ATOM   1085 N N   . SER B 1 44 ? -7.931  -25.817 -0.267  1.00 36.54 ? 49  SER B N   1 
ATOM   1086 C CA  . SER B 1 44 ? -9.014  -25.787 -1.233  1.00 37.23 ? 49  SER B CA  1 
ATOM   1087 C C   . SER B 1 44 ? -9.553  -24.404 -1.550  1.00 36.89 ? 49  SER B C   1 
ATOM   1088 O O   . SER B 1 44 ? -10.767 -24.197 -1.667  1.00 37.29 ? 49  SER B O   1 
ATOM   1089 C CB  . SER B 1 44 ? -10.130 -26.745 -0.767  1.00 38.33 ? 49  SER B CB  1 
ATOM   1090 O OG  . SER B 1 44 ? -9.633  -28.073 -0.923  1.00 39.69 ? 49  SER B OG  1 
ATOM   1091 N N   . GLY B 1 45 ? -8.660  -23.418 -1.731  1.00 35.36 ? 50  GLY B N   1 
ATOM   1092 C CA  . GLY B 1 45 ? -9.056  -22.065 -2.061  1.00 33.69 ? 50  GLY B CA  1 
ATOM   1093 C C   . GLY B 1 45 ? -9.138  -21.116 -0.878  1.00 31.55 ? 50  GLY B C   1 
ATOM   1094 O O   . GLY B 1 45 ? -9.140  -19.901 -1.066  1.00 30.63 ? 50  GLY B O   1 
ATOM   1095 N N   . SER B 1 46 ? -9.163  -21.649 0.338   1.00 31.20 ? 51  SER B N   1 
ATOM   1096 C CA  . SER B 1 46 ? -9.216  -20.847 1.551   1.00 29.71 ? 51  SER B CA  1 
ATOM   1097 C C   . SER B 1 46 ? -7.835  -20.434 2.073   1.00 27.22 ? 51  SER B C   1 
ATOM   1098 O O   . SER B 1 46 ? -7.126  -21.273 2.617   1.00 26.25 ? 51  SER B O   1 
ATOM   1099 C CB  . SER B 1 46 ? -9.929  -21.661 2.636   1.00 30.82 ? 51  SER B CB  1 
ATOM   1100 O OG  . SER B 1 46 ? -11.223 -21.996 2.134   1.00 34.22 ? 51  SER B OG  1 
ATOM   1101 N N   . ILE B 1 47 ? -7.524  -19.159 1.946   1.00 26.38 ? 52  ILE B N   1 
ATOM   1102 C CA  . ILE B 1 47 ? -6.228  -18.636 2.348   1.00 26.27 ? 52  ILE B CA  1 
ATOM   1103 C C   . ILE B 1 47 ? -6.116  -18.198 3.796   1.00 24.45 ? 52  ILE B C   1 
ATOM   1104 O O   . ILE B 1 47 ? -6.932  -17.448 4.339   1.00 25.04 ? 52  ILE B O   1 
ATOM   1105 C CB  . ILE B 1 47 ? -5.836  -17.431 1.441   1.00 27.62 ? 52  ILE B CB  1 
ATOM   1106 C CG1 . ILE B 1 47 ? -4.432  -16.948 1.786   1.00 27.07 ? 52  ILE B CG1 1 
ATOM   1107 C CG2 . ILE B 1 47 ? -6.907  -16.362 1.478   1.00 31.57 ? 52  ILE B CG2 1 
ATOM   1108 C CD1 . ILE B 1 47 ? -4.213  -15.597 2.382   1.00 31.54 ? 52  ILE B CD1 1 
ATOM   1109 N N   . GLU B 1 48 ? -5.051  -18.678 4.438   1.00 21.95 ? 53  GLU B N   1 
ATOM   1110 C CA  . GLU B 1 48 ? -4.677  -18.359 5.797   1.00 21.67 ? 53  GLU B CA  1 
ATOM   1111 C C   . GLU B 1 48 ? -3.232  -17.830 5.820   1.00 18.10 ? 53  GLU B C   1 
ATOM   1112 O O   . GLU B 1 48 ? -2.284  -18.592 5.573   1.00 18.74 ? 53  GLU B O   1 
ATOM   1113 C CB  . GLU B 1 48 ? -4.768  -19.633 6.656   1.00 25.60 ? 53  GLU B CB  1 
ATOM   1114 C CG  . GLU B 1 48 ? -4.517  -19.399 8.133   1.00 32.65 ? 53  GLU B CG  1 
ATOM   1115 C CD  . GLU B 1 48 ? -4.575  -20.748 8.858   1.00 36.59 ? 53  GLU B CD  1 
ATOM   1116 O OE1 . GLU B 1 48 ? -5.642  -21.403 8.733   1.00 39.44 ? 53  GLU B OE1 1 
ATOM   1117 O OE2 . GLU B 1 48 ? -3.561  -21.121 9.472   1.00 38.52 ? 53  GLU B OE2 1 
ATOM   1118 N N   . ILE B 1 49 ? -3.066  -16.538 6.101   1.00 16.74 ? 54  ILE B N   1 
ATOM   1119 C CA  . ILE B 1 49 ? -1.699  -16.012 6.204   1.00 15.47 ? 54  ILE B CA  1 
ATOM   1120 C C   . ILE B 1 49 ? -0.965  -16.525 7.448   1.00 17.57 ? 54  ILE B C   1 
ATOM   1121 O O   . ILE B 1 49 ? -1.588  -16.557 8.501   1.00 19.30 ? 54  ILE B O   1 
ATOM   1122 C CB  . ILE B 1 49 ? -1.697  -14.478 6.191   1.00 15.34 ? 54  ILE B CB  1 
ATOM   1123 C CG1 . ILE B 1 49 ? -2.296  -13.987 4.857   1.00 16.66 ? 54  ILE B CG1 1 
ATOM   1124 C CG2 . ILE B 1 49 ? -0.262  -13.932 6.361   1.00 17.65 ? 54  ILE B CG2 1 
ATOM   1125 C CD1 . ILE B 1 49 ? -2.554  -12.478 4.846   1.00 18.59 ? 54  ILE B CD1 1 
ATOM   1126 N N   . VAL B 1 50 ? 0.289   -16.919 7.328   1.00 15.54 ? 55  VAL B N   1 
ATOM   1127 C CA  . VAL B 1 50 ? 1.111   -17.367 8.458   1.00 14.92 ? 55  VAL B CA  1 
ATOM   1128 C C   . VAL B 1 50 ? 2.006   -16.199 8.848   1.00 15.82 ? 55  VAL B C   1 
ATOM   1129 O O   . VAL B 1 50 ? 2.014   -15.738 10.015  1.00 15.46 ? 55  VAL B O   1 
ATOM   1130 C CB  . VAL B 1 50 ? 1.924   -18.620 8.123   1.00 16.00 ? 55  VAL B CB  1 
ATOM   1131 C CG1 . VAL B 1 50 ? 2.901   -19.002 9.228   1.00 15.88 ? 55  VAL B CG1 1 
ATOM   1132 C CG2 . VAL B 1 50 ? 1.032   -19.813 7.786   1.00 17.17 ? 55  VAL B CG2 1 
ATOM   1133 N N   . LYS B 1 51 ? 2.781   -15.615 7.904   1.00 14.00 ? 56  LYS B N   1 
ATOM   1134 C CA  . LYS B 1 51 ? 3.557   -14.397 8.173   1.00 13.38 ? 56  LYS B CA  1 
ATOM   1135 C C   . LYS B 1 51 ? 3.637   -13.531 6.916   1.00 16.31 ? 56  LYS B C   1 
ATOM   1136 O O   . LYS B 1 51 ? 3.668   -14.102 5.783   1.00 14.17 ? 56  LYS B O   1 
ATOM   1137 C CB  . LYS B 1 51 ? 5.022   -14.671 8.553   1.00 15.07 ? 56  LYS B CB  1 
ATOM   1138 C CG  . LYS B 1 51 ? 5.204   -15.448 9.866   1.00 19.19 ? 56  LYS B CG  1 
ATOM   1139 C CD  . LYS B 1 51 ? 6.676   -15.634 10.151  1.00 20.21 ? 56  LYS B CD  1 
ATOM   1140 C CE  . LYS B 1 51 ? 6.964   -16.303 11.473  1.00 22.88 ? 56  LYS B CE  1 
ATOM   1141 N NZ  . LYS B 1 51 ? 6.745   -15.265 12.543  1.00 24.33 ? 56  LYS B NZ  1 
ATOM   1142 N N   . GLN B 1 52 ? 3.847   -12.235 7.079   1.00 14.07 ? 57  GLN B N   1 
ATOM   1143 C CA  . GLN B 1 52 ? 4.314   -11.310 6.050   1.00 14.27 ? 57  GLN B CA  1 
ATOM   1144 C C   . GLN B 1 52 ? 5.381   -10.427 6.693   1.00 13.38 ? 57  GLN B C   1 
ATOM   1145 O O   . GLN B 1 52 ? 5.189   -9.987  7.861   1.00 14.38 ? 57  GLN B O   1 
ATOM   1146 C CB  . GLN B 1 52 ? 3.225   -10.394 5.491   1.00 13.55 ? 57  GLN B CB  1 
ATOM   1147 C CG  . GLN B 1 52 ? 2.284   -11.140 4.526   1.00 13.92 ? 57  GLN B CG  1 
ATOM   1148 C CD  . GLN B 1 52 ? 1.067   -10.328 4.223   1.00 12.89 ? 57  GLN B CD  1 
ATOM   1149 O OE1 . GLN B 1 52 ? 0.204   -10.169 5.128   1.00 13.66 ? 57  GLN B OE1 1 
ATOM   1150 N NE2 . GLN B 1 52 ? 0.835   -9.735  3.058   1.00 14.64 ? 57  GLN B NE2 1 
ATOM   1151 N N   . GLY B 1 53 ? 6.457   -10.042 5.985   1.00 12.17 ? 58  GLY B N   1 
ATOM   1152 C CA  . GLY B 1 53 ? 7.412   -9.095  6.583   1.00 13.85 ? 58  GLY B CA  1 
ATOM   1153 C C   . GLY B 1 53 ? 8.658   -8.930  5.712   1.00 16.19 ? 58  GLY B C   1 
ATOM   1154 O O   . GLY B 1 53 ? 8.599   -9.267  4.533   1.00 15.73 ? 58  GLY B O   1 
ATOM   1155 N N   . CYS B 1 54 ? 9.713   -8.453  6.350   1.00 13.82 ? 59  CYS B N   1 
ATOM   1156 C CA  . CYS B 1 54 ? 11.029  -8.348  5.722   1.00 16.05 ? 59  CYS B CA  1 
ATOM   1157 C C   . CYS B 1 54 ? 11.818  -9.651  5.780   1.00 16.49 ? 59  CYS B C   1 
ATOM   1158 O O   . CYS B 1 54 ? 11.841  -10.342 6.815   1.00 15.91 ? 59  CYS B O   1 
ATOM   1159 C CB  . CYS B 1 54 ? 11.860  -7.306  6.467   1.00 17.31 ? 59  CYS B CB  1 
ATOM   1160 S SG  . CYS B 1 54 ? 11.232  -5.619  6.513   1.00 17.38 ? 59  CYS B SG  1 
ATOM   1161 N N   . TRP B 1 55 ? 12.493  -10.007 4.681   1.00 16.97 ? 60  TRP B N   1 
ATOM   1162 C CA  . TRP B 1 55 ? 13.351  -11.198 4.670   1.00 18.05 ? 60  TRP B CA  1 
ATOM   1163 C C   . TRP B 1 55 ? 14.777  -10.667 4.718   1.00 20.73 ? 60  TRP B C   1 
ATOM   1164 O O   . TRP B 1 55 ? 15.147  -9.859  3.865   1.00 18.73 ? 60  TRP B O   1 
ATOM   1165 C CB  . TRP B 1 55 ? 13.117  -12.056 3.440   1.00 17.80 ? 60  TRP B CB  1 
ATOM   1166 C CG  . TRP B 1 55 ? 13.839  -13.374 3.544   1.00 18.15 ? 60  TRP B CG  1 
ATOM   1167 C CD1 . TRP B 1 55 ? 15.061  -13.687 3.032   1.00 18.17 ? 60  TRP B CD1 1 
ATOM   1168 C CD2 . TRP B 1 55 ? 13.362  -14.551 4.212   1.00 17.98 ? 60  TRP B CD2 1 
ATOM   1169 N NE1 . TRP B 1 55 ? 15.395  -14.981 3.372   1.00 19.79 ? 60  TRP B NE1 1 
ATOM   1170 C CE2 . TRP B 1 55 ? 14.358  -15.538 4.068   1.00 19.97 ? 60  TRP B CE2 1 
ATOM   1171 C CE3 . TRP B 1 55 ? 12.204  -14.860 4.932   1.00 17.68 ? 60  TRP B CE3 1 
ATOM   1172 C CZ2 . TRP B 1 55 ? 14.228  -16.827 4.603   1.00 20.05 ? 60  TRP B CZ2 1 
ATOM   1173 C CZ3 . TRP B 1 55 ? 12.055  -16.142 5.451   1.00 19.50 ? 60  TRP B CZ3 1 
ATOM   1174 C CH2 . TRP B 1 55 ? 13.078  -17.096 5.283   1.00 19.76 ? 60  TRP B CH2 1 
ATOM   1175 N N   . LEU B 1 56 ? 15.554  -11.065 5.726   1.00 23.59 ? 61  LEU B N   1 
ATOM   1176 C CA  . LEU B 1 56 ? 16.787  -10.355 6.025   1.00 28.54 ? 61  LEU B CA  1 
ATOM   1177 C C   . LEU B 1 56 ? 18.053  -10.996 5.504   1.00 30.45 ? 61  LEU B C   1 
ATOM   1178 O O   . LEU B 1 56 ? 19.157  -10.493 5.791   1.00 33.77 ? 61  LEU B O   1 
ATOM   1179 C CB  . LEU B 1 56 ? 16.864  -10.178 7.553   1.00 31.49 ? 61  LEU B CB  1 
ATOM   1180 C CG  . LEU B 1 56 ? 15.660  -9.527  8.242   1.00 32.55 ? 61  LEU B CG  1 
ATOM   1181 C CD1 . LEU B 1 56 ? 15.974  -9.201  9.701   1.00 33.23 ? 61  LEU B CD1 1 
ATOM   1182 C CD2 . LEU B 1 56 ? 15.204  -8.260  7.542   1.00 31.24 ? 61  LEU B CD2 1 
ATOM   1183 N N   . ASP B 1 57 ? 17.925  -12.107 4.806   1.00 28.60 ? 62  ASP B N   1 
ATOM   1184 C CA  . ASP B 1 57 ? 19.100  -12.825 4.313   1.00 29.17 ? 62  ASP B CA  1 
ATOM   1185 C C   . ASP B 1 57 ? 19.100  -12.824 2.795   1.00 27.77 ? 62  ASP B C   1 
ATOM   1186 O O   . ASP B 1 57 ? 18.042  -12.615 2.182   1.00 28.07 ? 62  ASP B O   1 
ATOM   1187 C CB  . ASP B 1 57 ? 19.020  -14.288 4.761   1.00 29.99 ? 62  ASP B CB  1 
ATOM   1188 C CG  . ASP B 1 57 ? 18.931  -14.494 6.249   1.00 31.69 ? 62  ASP B CG  1 
ATOM   1189 O OD1 . ASP B 1 57 ? 19.530  -13.693 7.006   1.00 30.70 ? 62  ASP B OD1 1 
ATOM   1190 O OD2 . ASP B 1 57 ? 18.281  -15.477 6.700   1.00 33.07 ? 62  ASP B OD2 1 
ATOM   1191 N N   . ASP B 1 58 ? 20.280  -13.059 2.209   1.00 27.76 ? 63  ASP B N   1 
ATOM   1192 C CA  . ASP B 1 58 ? 20.374  -13.142 0.761   1.00 27.68 ? 63  ASP B CA  1 
ATOM   1193 C C   . ASP B 1 58 ? 19.486  -14.289 0.264   1.00 25.54 ? 63  ASP B C   1 
ATOM   1194 O O   . ASP B 1 58 ? 19.532  -15.379 0.820   1.00 25.54 ? 63  ASP B O   1 
ATOM   1195 C CB  . ASP B 1 58 ? 21.818  -13.440 0.340   1.00 28.88 ? 63  ASP B CB  1 
ATOM   1196 N N   . ILE B 1 59 ? 18.699  -14.052 -0.752  1.00 25.76 ? 64  ILE B N   1 
ATOM   1197 C CA  . ILE B 1 59 ? 17.749  -15.047 -1.257  1.00 25.79 ? 64  ILE B CA  1 
ATOM   1198 C C   . ILE B 1 59 ? 17.462  -14.805 -2.724  1.00 26.42 ? 64  ILE B C   1 
ATOM   1199 O O   . ILE B 1 59 ? 17.561  -13.645 -3.161  1.00 27.34 ? 64  ILE B O   1 
ATOM   1200 C CB  . ILE B 1 59 ? 16.417  -14.951 -0.469  1.00 25.07 ? 64  ILE B CB  1 
ATOM   1201 C CG1 . ILE B 1 59 ? 15.400  -16.009 -0.888  1.00 24.93 ? 64  ILE B CG1 1 
ATOM   1202 C CG2 . ILE B 1 59 ? 15.827  -13.543 -0.665  1.00 24.74 ? 64  ILE B CG2 1 
ATOM   1203 C CD1 . ILE B 1 59 ? 14.226  -16.216 0.070   1.00 25.35 ? 64  ILE B CD1 1 
ATOM   1204 N N   . ASN B 1 60 ? 17.021  -15.804 -3.452  1.00 27.59 ? 65  ASN B N   1 
ATOM   1205 C CA  . ASN B 1 60 ? 16.591  -15.723 -4.840  1.00 28.52 ? 65  ASN B CA  1 
ATOM   1206 C C   . ASN B 1 60 ? 15.081  -15.843 -4.990  1.00 27.67 ? 65  ASN B C   1 
ATOM   1207 O O   . ASN B 1 60 ? 14.508  -16.849 -4.549  1.00 26.33 ? 65  ASN B O   1 
ATOM   1208 C CB  . ASN B 1 60 ? 17.306  -16.851 -5.618  1.00 29.87 ? 65  ASN B CB  1 
ATOM   1209 C CG  . ASN B 1 60 ? 17.044  -16.667 -7.109  1.00 29.43 ? 65  ASN B CG  1 
ATOM   1210 O OD1 . ASN B 1 60 ? 17.152  -15.549 -7.608  1.00 30.17 ? 65  ASN B OD1 1 
ATOM   1211 N ND2 . ASN B 1 60 ? 16.585  -17.716 -7.756  1.00 30.55 ? 65  ASN B ND2 1 
ATOM   1212 N N   . CYS B 1 61 ? 14.385  -14.860 -5.577  1.00 28.52 ? 66  CYS B N   1 
ATOM   1213 C CA  . CYS B 1 61 ? 12.920  -14.933 -5.700  1.00 29.78 ? 66  CYS B CA  1 
ATOM   1214 C C   . CYS B 1 61 ? 12.368  -15.327 -7.041  1.00 32.75 ? 66  CYS B C   1 
ATOM   1215 O O   . CYS B 1 61 ? 13.109  -15.246 -8.043  1.00 35.65 ? 66  CYS B O   1 
ATOM   1216 C CB  . CYS B 1 61 ? 12.390  -13.552 -5.227  1.00 27.94 ? 66  CYS B CB  1 
ATOM   1217 S SG  . CYS B 1 61 ? 12.966  -13.167 -3.548  1.00 24.54 ? 66  CYS B SG  1 
ATOM   1218 N N   . TYR B 1 62 ? 11.089  -15.673 -7.201  1.00 34.65 ? 67  TYR B N   1 
ATOM   1219 C CA  . TYR B 1 62 ? 10.544  -16.025 -8.524  1.00 36.88 ? 67  TYR B CA  1 
ATOM   1220 C C   . TYR B 1 62 ? 10.355  -14.829 -9.446  1.00 37.50 ? 67  TYR B C   1 
ATOM   1221 O O   . TYR B 1 62 ? 10.563  -14.917 -10.673 1.00 37.88 ? 67  TYR B O   1 
ATOM   1222 C CB  . TYR B 1 62 ? 9.268   -16.846 -8.381  1.00 38.99 ? 67  TYR B CB  1 
ATOM   1223 C CG  . TYR B 1 62 ? 9.498   -18.315 -8.065  1.00 40.46 ? 67  TYR B CG  1 
ATOM   1224 C CD1 . TYR B 1 62 ? 10.258  -19.134 -8.890  1.00 41.72 ? 67  TYR B CD1 1 
ATOM   1225 C CD2 . TYR B 1 62 ? 8.949   -18.889 -6.919  1.00 41.03 ? 67  TYR B CD2 1 
ATOM   1226 C CE1 . TYR B 1 62 ? 10.462  -20.472 -8.594  1.00 42.08 ? 67  TYR B CE1 1 
ATOM   1227 C CE2 . TYR B 1 62 ? 9.140   -20.221 -6.597  1.00 40.71 ? 67  TYR B CE2 1 
ATOM   1228 C CZ  . TYR B 1 62 ? 9.908   -21.003 -7.442  1.00 42.24 ? 67  TYR B CZ  1 
ATOM   1229 O OH  . TYR B 1 62 ? 10.102  -22.335 -7.142  1.00 43.17 ? 67  TYR B OH  1 
ATOM   1230 N N   . ASP B 1 63 ? 9.926   -13.680 -8.929  1.00 35.84 ? 68  ASP B N   1 
ATOM   1231 C CA  . ASP B 1 63 ? 9.815   -12.463 -9.741  1.00 33.59 ? 68  ASP B CA  1 
ATOM   1232 C C   . ASP B 1 63 ? 10.406  -11.351 -8.876  1.00 33.37 ? 68  ASP B C   1 
ATOM   1233 O O   . ASP B 1 63 ? 10.612  -11.541 -7.679  1.00 32.97 ? 68  ASP B O   1 
ATOM   1234 C CB  . ASP B 1 63 ? 8.414   -12.096 -10.193 1.00 35.08 ? 68  ASP B CB  1 
ATOM   1235 C CG  . ASP B 1 63 ? 8.328   -10.933 -11.169 1.00 36.11 ? 68  ASP B CG  1 
ATOM   1236 O OD1 . ASP B 1 63 ? 8.697   -11.106 -12.367 1.00 36.28 ? 68  ASP B OD1 1 
ATOM   1237 O OD2 . ASP B 1 63 ? 7.882   -9.828  -10.800 1.00 34.69 ? 68  ASP B OD2 1 
ATOM   1238 N N   . ARG B 1 64 ? 11.049  -10.384 -9.507  1.00 32.42 ? 69  ARG B N   1 
ATOM   1239 C CA  . ARG B 1 64 ? 11.719  -9.320  -8.805  1.00 30.61 ? 69  ARG B CA  1 
ATOM   1240 C C   . ARG B 1 64 ? 10.697  -8.400  -8.139  1.00 30.84 ? 69  ARG B C   1 
ATOM   1241 O O   . ARG B 1 64 ? 11.056  -7.939  -7.042  1.00 33.76 ? 69  ARG B O   1 
ATOM   1242 C CB  . ARG B 1 64 ? 12.581  -8.516  -9.772  1.00 29.66 ? 69  ARG B CB  1 
ATOM   1243 N N   . THR B 1 65 ? 9.548   -8.106  -8.777  1.00 27.25 ? 70  THR B N   1 
ATOM   1244 C CA  . THR B 1 65 ? 8.672   -7.150  -8.089  1.00 25.87 ? 70  THR B CA  1 
ATOM   1245 C C   . THR B 1 65 ? 7.346   -7.691  -7.606  1.00 22.90 ? 70  THR B C   1 
ATOM   1246 O O   . THR B 1 65 ? 6.756   -7.116  -6.663  1.00 24.04 ? 70  THR B O   1 
ATOM   1247 C CB  . THR B 1 65 ? 8.451   -5.887  -8.963  1.00 27.75 ? 70  THR B CB  1 
ATOM   1248 O OG1 . THR B 1 65 ? 7.756   -6.232  -10.158 1.00 31.15 ? 70  THR B OG1 1 
ATOM   1249 C CG2 . THR B 1 65 ? 9.763   -5.228  -9.353  1.00 29.90 ? 70  THR B CG2 1 
ATOM   1250 N N   . ASP B 1 66 ? 6.819   -8.754  -8.207  1.00 22.12 ? 71  ASP B N   1 
ATOM   1251 C CA  . ASP B 1 66 ? 5.585   -9.354  -7.706  1.00 21.48 ? 71  ASP B CA  1 
ATOM   1252 C C   . ASP B 1 66 ? 5.947   -10.510 -6.786  1.00 20.69 ? 71  ASP B C   1 
ATOM   1253 O O   . ASP B 1 66 ? 6.959   -11.133 -7.027  1.00 21.29 ? 71  ASP B O   1 
ATOM   1254 C CB  . ASP B 1 66 ? 4.717   -9.908  -8.853  1.00 23.77 ? 71  ASP B CB  1 
ATOM   1255 C CG  . ASP B 1 66 ? 4.212   -8.778  -9.732  1.00 27.98 ? 71  ASP B CG  1 
ATOM   1256 O OD1 . ASP B 1 66 ? 3.780   -7.747  -9.181  1.00 26.78 ? 71  ASP B OD1 1 
ATOM   1257 O OD2 . ASP B 1 66 ? 4.246   -8.943  -10.972 1.00 30.32 ? 71  ASP B OD2 1 
ATOM   1258 N N   . CYS B 1 67 ? 5.139   -10.785 -5.788  1.00 17.15 ? 72  CYS B N   1 
ATOM   1259 C CA  . CYS B 1 67 ? 5.407   -11.895 -4.857  1.00 17.82 ? 72  CYS B CA  1 
ATOM   1260 C C   . CYS B 1 67 ? 4.597   -13.094 -5.346  1.00 17.62 ? 72  CYS B C   1 
ATOM   1261 O O   . CYS B 1 67 ? 3.392   -13.151 -5.211  1.00 17.98 ? 72  CYS B O   1 
ATOM   1262 C CB  . CYS B 1 67 ? 4.953   -11.435 -3.440  1.00 17.45 ? 72  CYS B CB  1 
ATOM   1263 S SG  . CYS B 1 67 ? 5.737   -12.335 -2.100  1.00 17.08 ? 72  CYS B SG  1 
ATOM   1264 N N   . ILE B 1 68 ? 5.292   -14.043 -5.976  1.00 17.28 ? 73  ILE B N   1 
ATOM   1265 C CA  . ILE B 1 68 ? 4.662   -15.227 -6.600  1.00 19.76 ? 73  ILE B CA  1 
ATOM   1266 C C   . ILE B 1 68 ? 5.269   -16.560 -6.153  1.00 17.72 ? 73  ILE B C   1 
ATOM   1267 O O   . ILE B 1 68 ? 6.481   -16.720 -6.052  1.00 18.59 ? 73  ILE B O   1 
ATOM   1268 C CB  . ILE B 1 68 ? 4.841   -15.134 -8.129  1.00 22.62 ? 73  ILE B CB  1 
ATOM   1269 C CG1 . ILE B 1 68 ? 4.088   -13.931 -8.690  1.00 23.76 ? 73  ILE B CG1 1 
ATOM   1270 C CG2 . ILE B 1 68 ? 4.307   -16.394 -8.813  1.00 23.08 ? 73  ILE B CG2 1 
ATOM   1271 C CD1 . ILE B 1 68 ? 4.626   -13.477 -10.042 1.00 24.61 ? 73  ILE B CD1 1 
ATOM   1272 N N   . GLU B 1 69 ? 4.411   -17.513 -5.816  1.00 20.01 ? 74  GLU B N   1 
ATOM   1273 C CA  . GLU B 1 69 ? 4.769   -18.892 -5.503  1.00 19.86 ? 74  GLU B CA  1 
ATOM   1274 C C   . GLU B 1 69 ? 4.665   -19.692 -6.825  1.00 21.91 ? 74  GLU B C   1 
ATOM   1275 O O   . GLU B 1 69 ? 3.585   -19.696 -7.389  1.00 21.62 ? 74  GLU B O   1 
ATOM   1276 C CB  . GLU B 1 69 ? 3.785   -19.507 -4.504  1.00 20.76 ? 74  GLU B CB  1 
ATOM   1277 C CG  . GLU B 1 69 ? 3.885   -21.019 -4.283  1.00 22.81 ? 74  GLU B CG  1 
ATOM   1278 C CD  . GLU B 1 69 ? 5.178   -21.452 -3.656  1.00 22.56 ? 74  GLU B CD  1 
ATOM   1279 O OE1 . GLU B 1 69 ? 6.246   -21.379 -4.305  1.00 23.48 ? 74  GLU B OE1 1 
ATOM   1280 O OE2 . GLU B 1 69 ? 5.220   -21.856 -2.470  1.00 23.90 ? 74  GLU B OE2 1 
ATOM   1281 N N   . LYS B 1 70 ? 5.761   -20.339 -7.219  1.00 24.32 ? 75  LYS B N   1 
ATOM   1282 C CA  . LYS B 1 70 ? 5.722   -21.189 -8.423  1.00 26.28 ? 75  LYS B CA  1 
ATOM   1283 C C   . LYS B 1 70 ? 5.925   -22.666 -8.119  1.00 28.14 ? 75  LYS B C   1 
ATOM   1284 O O   . LYS B 1 70 ? 5.838   -23.530 -9.023  1.00 26.78 ? 75  LYS B O   1 
ATOM   1285 C CB  . LYS B 1 70 ? 6.734   -20.720 -9.475  1.00 28.58 ? 75  LYS B CB  1 
ATOM   1286 C CG  . LYS B 1 70 ? 6.546   -19.264 -9.876  1.00 31.86 ? 75  LYS B CG  1 
ATOM   1287 C CD  . LYS B 1 70 ? 7.127   -18.829 -11.208 1.00 33.53 ? 75  LYS B CD  1 
ATOM   1288 C CE  . LYS B 1 70 ? 6.663   -19.694 -12.368 1.00 34.54 ? 75  LYS B CE  1 
ATOM   1289 N NZ  . LYS B 1 70 ? 5.289   -19.356 -12.828 1.00 35.27 ? 75  LYS B NZ  1 
ATOM   1290 N N   . LYS B 1 71 ? 6.152   -23.048 -6.860  1.00 28.23 ? 76  LYS B N   1 
ATOM   1291 C CA  . LYS B 1 71 ? 6.195   -24.492 -6.545  1.00 29.20 ? 76  LYS B CA  1 
ATOM   1292 C C   . LYS B 1 71 ? 4.805   -25.068 -6.716  1.00 30.30 ? 76  LYS B C   1 
ATOM   1293 O O   . LYS B 1 71 ? 3.770   -24.450 -6.438  1.00 28.66 ? 76  LYS B O   1 
ATOM   1294 C CB  . LYS B 1 71 ? 6.776   -24.660 -5.150  1.00 32.47 ? 76  LYS B CB  1 
ATOM   1295 C CG  . LYS B 1 71 ? 7.315   -26.038 -4.833  1.00 36.75 ? 76  LYS B CG  1 
ATOM   1296 C CD  . LYS B 1 71 ? 8.277   -25.981 -3.645  1.00 39.37 ? 76  LYS B CD  1 
ATOM   1297 C CE  . LYS B 1 71 ? 9.197   -27.200 -3.732  1.00 42.25 ? 76  LYS B CE  1 
ATOM   1298 N NZ  . LYS B 1 71 ? 9.418   -27.802 -2.381  1.00 44.94 ? 76  LYS B NZ  1 
ATOM   1299 N N   . ASP B 1 72 ? 4.716   -26.311 -7.220  1.00 29.98 ? 77  ASP B N   1 
ATOM   1300 C CA  . ASP B 1 72 ? 3.399   -26.913 -7.456  1.00 31.80 ? 77  ASP B CA  1 
ATOM   1301 C C   . ASP B 1 72 ? 2.758   -27.522 -6.231  1.00 29.53 ? 77  ASP B C   1 
ATOM   1302 O O   . ASP B 1 72 ? 3.334   -28.345 -5.518  1.00 29.62 ? 77  ASP B O   1 
ATOM   1303 C CB  . ASP B 1 72 ? 3.588   -27.931 -8.584  1.00 34.58 ? 77  ASP B CB  1 
ATOM   1304 C CG  . ASP B 1 72 ? 2.374   -28.713 -8.990  1.00 37.91 ? 77  ASP B CG  1 
ATOM   1305 O OD1 . ASP B 1 72 ? 1.225   -28.287 -8.773  1.00 38.87 ? 77  ASP B OD1 1 
ATOM   1306 O OD2 . ASP B 1 72 ? 2.589   -29.827 -9.552  1.00 40.84 ? 77  ASP B OD2 1 
ATOM   1307 N N   . SER B 1 73 ? 1.530   -27.120 -5.936  1.00 30.20 ? 78  SER B N   1 
ATOM   1308 C CA  . SER B 1 73 ? 0.687   -27.538 -4.842  1.00 29.97 ? 78  SER B CA  1 
ATOM   1309 C C   . SER B 1 73 ? 1.421   -27.920 -3.574  1.00 29.54 ? 78  SER B C   1 
ATOM   1310 O O   . SER B 1 73 ? 1.347   -29.050 -3.072  1.00 29.72 ? 78  SER B O   1 
ATOM   1311 C CB  . SER B 1 73 ? -0.192  -28.735 -5.283  1.00 33.51 ? 78  SER B CB  1 
ATOM   1312 O OG  . SER B 1 73 ? -0.387  -28.699 -6.702  1.00 36.42 ? 78  SER B OG  1 
ATOM   1313 N N   . PRO B 1 74 ? 2.069   -26.934 -2.943  1.00 26.16 ? 79  PRO B N   1 
ATOM   1314 C CA  . PRO B 1 74 ? 2.812   -27.192 -1.727  1.00 27.05 ? 79  PRO B CA  1 
ATOM   1315 C C   . PRO B 1 74 ? 1.925   -27.249 -0.500  1.00 25.84 ? 79  PRO B C   1 
ATOM   1316 O O   . PRO B 1 74 ? 0.804   -26.768 -0.550  1.00 25.97 ? 79  PRO B O   1 
ATOM   1317 C CB  . PRO B 1 74 ? 3.749   -25.980 -1.672  1.00 26.98 ? 79  PRO B CB  1 
ATOM   1318 C CG  . PRO B 1 74 ? 3.000   -24.879 -2.320  1.00 26.02 ? 79  PRO B CG  1 
ATOM   1319 C CD  . PRO B 1 74 ? 2.152   -25.528 -3.405  1.00 26.44 ? 79  PRO B CD  1 
ATOM   1320 N N   . GLU B 1 75 ? 2.402   -27.818 0.606   1.00 25.68 ? 80  GLU B N   1 
ATOM   1321 C CA  . GLU B 1 75 ? 1.622   -27.822 1.833   1.00 24.90 ? 80  GLU B CA  1 
ATOM   1322 C C   . GLU B 1 75 ? 1.661   -26.377 2.388   1.00 23.64 ? 80  GLU B C   1 
ATOM   1323 O O   . GLU B 1 75 ? 0.636   -25.901 2.883   1.00 24.56 ? 80  GLU B O   1 
ATOM   1324 C CB  . GLU B 1 75 ? 2.229   -28.752 2.882   1.00 26.32 ? 80  GLU B CB  1 
ATOM   1325 N N   . VAL B 1 76 ? 2.849   -25.757 2.361   1.00 20.59 ? 81  VAL B N   1 
ATOM   1326 C CA  . VAL B 1 76 ? 2.981   -24.380 2.860   1.00 18.57 ? 81  VAL B CA  1 
ATOM   1327 C C   . VAL B 1 76 ? 3.503   -23.495 1.722   1.00 16.91 ? 81  VAL B C   1 
ATOM   1328 O O   . VAL B 1 76 ? 4.478   -23.900 1.059   1.00 18.94 ? 81  VAL B O   1 
ATOM   1329 C CB  . VAL B 1 76 ? 3.962   -24.299 4.052   1.00 18.84 ? 81  VAL B CB  1 
ATOM   1330 C CG1 . VAL B 1 76 ? 4.083   -22.865 4.549   1.00 19.04 ? 81  VAL B CG1 1 
ATOM   1331 C CG2 . VAL B 1 76 ? 3.551   -25.215 5.212   1.00 21.13 ? 81  VAL B CG2 1 
ATOM   1332 N N   . TYR B 1 77 ? 2.825   -22.390 1.433   1.00 17.23 ? 82  TYR B N   1 
ATOM   1333 C CA  . TYR B 1 77 ? 3.194   -21.514 0.307   1.00 14.61 ? 82  TYR B CA  1 
ATOM   1334 C C   . TYR B 1 77 ? 4.168   -20.442 0.759   1.00 14.16 ? 82  TYR B C   1 
ATOM   1335 O O   . TYR B 1 77 ? 4.088   -19.960 1.910   1.00 15.98 ? 82  TYR B O   1 
ATOM   1336 C CB  . TYR B 1 77 ? 1.908   -20.901 -0.230  1.00 16.29 ? 82  TYR B CB  1 
ATOM   1337 C CG  . TYR B 1 77 ? 0.944   -21.852 -0.909  1.00 18.35 ? 82  TYR B CG  1 
ATOM   1338 C CD1 . TYR B 1 77 ? 0.273   -22.826 -0.192  1.00 17.92 ? 82  TYR B CD1 1 
ATOM   1339 C CD2 . TYR B 1 77 ? 0.642   -21.684 -2.252  1.00 19.13 ? 82  TYR B CD2 1 
ATOM   1340 C CE1 . TYR B 1 77 ? -0.632  -23.686 -0.837  1.00 20.63 ? 82  TYR B CE1 1 
ATOM   1341 C CE2 . TYR B 1 77 ? -0.244  -22.546 -2.906  1.00 20.30 ? 82  TYR B CE2 1 
ATOM   1342 C CZ  . TYR B 1 77 ? -0.876  -23.521 -2.174  1.00 22.21 ? 82  TYR B CZ  1 
ATOM   1343 O OH  . TYR B 1 77 ? -1.708  -24.415 -2.840  1.00 23.27 ? 82  TYR B OH  1 
ATOM   1344 N N   . PHE B 1 78 ? 5.021   -19.952 -0.159  1.00 14.62 ? 83  PHE B N   1 
ATOM   1345 C CA  . PHE B 1 78 ? 5.993   -18.913 0.173   1.00 15.17 ? 83  PHE B CA  1 
ATOM   1346 C C   . PHE B 1 78 ? 6.284   -18.080 -1.075  1.00 17.76 ? 83  PHE B C   1 
ATOM   1347 O O   . PHE B 1 78 ? 6.258   -18.635 -2.168  1.00 17.87 ? 83  PHE B O   1 
ATOM   1348 C CB  . PHE B 1 78 ? 7.338   -19.504 0.616   1.00 16.11 ? 83  PHE B CB  1 
ATOM   1349 C CG  . PHE B 1 78 ? 8.467   -18.575 0.877   1.00 15.91 ? 83  PHE B CG  1 
ATOM   1350 C CD1 . PHE B 1 78 ? 8.647   -18.005 2.129   1.00 16.18 ? 83  PHE B CD1 1 
ATOM   1351 C CD2 . PHE B 1 78 ? 9.391   -18.240 -0.121  1.00 15.98 ? 83  PHE B CD2 1 
ATOM   1352 C CE1 . PHE B 1 78 ? 9.700   -17.139 2.378   1.00 15.40 ? 83  PHE B CE1 1 
ATOM   1353 C CE2 . PHE B 1 78 ? 10.434  -17.374 0.128   1.00 16.01 ? 83  PHE B CE2 1 
ATOM   1354 C CZ  . PHE B 1 78 ? 10.600  -16.782 1.361   1.00 17.49 ? 83  PHE B CZ  1 
ATOM   1355 N N   . CYS B 1 79 ? 6.533   -16.787 -0.942  1.00 16.70 ? 84  CYS B N   1 
ATOM   1356 C CA  . CYS B 1 79 ? 7.023   -15.974 -2.041  1.00 14.71 ? 84  CYS B CA  1 
ATOM   1357 C C   . CYS B 1 79 ? 7.949   -14.894 -1.487  1.00 15.96 ? 84  CYS B C   1 
ATOM   1358 O O   . CYS B 1 79 ? 7.748   -14.441 -0.328  1.00 16.26 ? 84  CYS B O   1 
ATOM   1359 C CB  . CYS B 1 79 ? 5.942   -15.336 -2.895  1.00 15.94 ? 84  CYS B CB  1 
ATOM   1360 S SG  . CYS B 1 79 ? 4.790   -14.194 -2.068  1.00 16.82 ? 84  CYS B SG  1 
ATOM   1361 N N   . CYS B 1 80 ? 8.836   -14.330 -2.319  1.00 16.30 ? 85  CYS B N   1 
ATOM   1362 C CA  . CYS B 1 80 ? 9.585   -13.137 -1.952  1.00 16.62 ? 85  CYS B CA  1 
ATOM   1363 C C   . CYS B 1 80 ? 9.665   -12.121 -3.102  1.00 17.76 ? 85  CYS B C   1 
ATOM   1364 O O   . CYS B 1 80 ? 9.269   -12.435 -4.212  1.00 17.53 ? 85  CYS B O   1 
ATOM   1365 C CB  . CYS B 1 80 ? 10.924  -13.494 -1.322  1.00 20.03 ? 85  CYS B CB  1 
ATOM   1366 S SG  . CYS B 1 80 ? 11.994  -14.505 -2.381  1.00 21.10 ? 85  CYS B SG  1 
ATOM   1367 N N   . CYS B 1 81 ? 9.873   -10.847 -2.774  1.00 15.63 ? 86  CYS B N   1 
ATOM   1368 C CA  . CYS B 1 81 ? 9.842   -9.776  -3.772  1.00 15.78 ? 86  CYS B CA  1 
ATOM   1369 C C   . CYS B 1 81 ? 10.712  -8.613  -3.330  1.00 15.20 ? 86  CYS B C   1 
ATOM   1370 O O   . CYS B 1 81 ? 11.045  -8.449  -2.168  1.00 16.13 ? 86  CYS B O   1 
ATOM   1371 C CB  . CYS B 1 81 ? 8.409   -9.300  -4.008  1.00 14.91 ? 86  CYS B CB  1 
ATOM   1372 S SG  . CYS B 1 81 ? 7.512   -8.705  -2.534  1.00 17.08 ? 86  CYS B SG  1 
ATOM   1373 N N   . GLU B 1 82 ? 10.978  -7.698  -4.306  1.00 16.71 ? 87  GLU B N   1 
ATOM   1374 C CA  . GLU B 1 82 ? 11.693  -6.464  -3.973  1.00 18.32 ? 87  GLU B CA  1 
ATOM   1375 C C   . GLU B 1 82 ? 10.806  -5.220  -4.199  1.00 15.63 ? 87  GLU B C   1 
ATOM   1376 O O   . GLU B 1 82 ? 9.930   -5.237  -5.089  1.00 18.88 ? 87  GLU B O   1 
ATOM   1377 C CB  . GLU B 1 82 ? 12.925  -6.303  -4.882  1.00 22.47 ? 87  GLU B CB  1 
ATOM   1378 C CG  . GLU B 1 82 ? 14.045  -7.300  -4.713  1.00 28.21 ? 87  GLU B CG  1 
ATOM   1379 C CD  . GLU B 1 82 ? 14.895  -7.432  -5.974  1.00 33.15 ? 87  GLU B CD  1 
ATOM   1380 O OE1 . GLU B 1 82 ? 14.949  -6.497  -6.803  1.00 36.25 ? 87  GLU B OE1 1 
ATOM   1381 O OE2 . GLU B 1 82 ? 15.511  -8.494  -6.193  1.00 36.51 ? 87  GLU B OE2 1 
ATOM   1382 N N   . GLY B 1 83 ? 10.983  -4.183  -3.406  1.00 18.56 ? 88  GLY B N   1 
ATOM   1383 C CA  . GLY B 1 83 ? 10.207  -2.955  -3.471  1.00 19.04 ? 88  GLY B CA  1 
ATOM   1384 C C   . GLY B 1 83 ? 9.311   -2.742  -2.238  1.00 18.42 ? 88  GLY B C   1 
ATOM   1385 O O   . GLY B 1 83 ? 8.729   -3.739  -1.785  1.00 18.18 ? 88  GLY B O   1 
ATOM   1386 N N   . ASN B 1 84 ? 9.258   -1.515  -1.743  1.00 16.46 ? 89  ASN B N   1 
ATOM   1387 C CA  . ASN B 1 84 ? 8.512   -1.272  -0.510  1.00 15.51 ? 89  ASN B CA  1 
ATOM   1388 C C   . ASN B 1 84 ? 7.073   -1.697  -0.615  1.00 16.39 ? 89  ASN B C   1 
ATOM   1389 O O   . ASN B 1 84 ? 6.355   -1.508  -1.598  1.00 16.78 ? 89  ASN B O   1 
ATOM   1390 C CB  . ASN B 1 84 ? 8.532   0.207   -0.119  1.00 16.05 ? 89  ASN B CB  1 
ATOM   1391 C CG  . ASN B 1 84 ? 9.928   0.621   0.319   1.00 16.46 ? 89  ASN B CG  1 
ATOM   1392 O OD1 . ASN B 1 84 ? 10.765  -0.252  0.576   1.00 17.12 ? 89  ASN B OD1 1 
ATOM   1393 N ND2 . ASN B 1 84 ? 10.218  1.924   0.338   1.00 18.39 ? 89  ASN B ND2 1 
ATOM   1394 N N   . MET B 1 85 ? 6.632   -2.497  0.395   1.00 14.51 ? 90  MET B N   1 
ATOM   1395 C CA  . MET B 1 85 ? 5.274   -2.977  0.528   1.00 14.75 ? 90  MET B CA  1 
ATOM   1396 C C   . MET B 1 85 ? 4.925   -3.951  -0.591  1.00 14.02 ? 90  MET B C   1 
ATOM   1397 O O   . MET B 1 85 ? 3.739   -4.265  -0.800  1.00 15.23 ? 90  MET B O   1 
ATOM   1398 C CB  . MET B 1 85 ? 4.259   -1.831  0.629   1.00 15.36 ? 90  MET B CB  1 
ATOM   1399 C CG  . MET B 1 85 ? 4.578   -0.705  1.626   1.00 15.52 ? 90  MET B CG  1 
ATOM   1400 S SD  . MET B 1 85 ? 4.981   -1.359  3.290   1.00 15.74 ? 90  MET B SD  1 
ATOM   1401 C CE  . MET B 1 85 ? 3.302   -1.725  3.825   1.00 14.83 ? 90  MET B CE  1 
ATOM   1402 N N   . CYS B 1 86 ? 5.933   -4.549  -1.277  1.00 13.84 ? 91  CYS B N   1 
ATOM   1403 C CA  . CYS B 1 86 ? 5.622   -5.442  -2.397  1.00 14.64 ? 91  CYS B CA  1 
ATOM   1404 C C   . CYS B 1 86 ? 4.836   -6.676  -2.065  1.00 15.56 ? 91  CYS B C   1 
ATOM   1405 O O   . CYS B 1 86 ? 4.236   -7.345  -2.943  1.00 16.93 ? 91  CYS B O   1 
ATOM   1406 C CB  . CYS B 1 86 ? 6.901   -5.812  -3.201  1.00 15.34 ? 91  CYS B CB  1 
ATOM   1407 S SG  . CYS B 1 86 ? 8.125   -6.770  -2.307  1.00 16.43 ? 91  CYS B SG  1 
ATOM   1408 N N   . ASN B 1 87 ? 4.924   -7.157  -0.818  1.00 13.80 ? 92  ASN B N   1 
ATOM   1409 C CA  . ASN B 1 87 ? 4.298   -8.388  -0.371  1.00 13.96 ? 92  ASN B CA  1 
ATOM   1410 C C   . ASN B 1 87 ? 2.853   -8.187  0.068   1.00 14.58 ? 92  ASN B C   1 
ATOM   1411 O O   . ASN B 1 87 ? 2.273   -9.183  0.527   1.00 14.94 ? 92  ASN B O   1 
ATOM   1412 C CB  . ASN B 1 87 ? 5.126   -9.001  0.780   1.00 12.90 ? 92  ASN B CB  1 
ATOM   1413 C CG  . ASN B 1 87 ? 5.145   -8.077  2.008   1.00 14.23 ? 92  ASN B CG  1 
ATOM   1414 O OD1 . ASN B 1 87 ? 5.059   -6.869  1.886   1.00 13.28 ? 92  ASN B OD1 1 
ATOM   1415 N ND2 . ASN B 1 87 ? 5.368   -8.679  3.164   1.00 13.09 ? 92  ASN B ND2 1 
ATOM   1416 N N   . GLU B 1 88 ? 2.230   -7.035  -0.144  1.00 15.88 ? 93  GLU B N   1 
ATOM   1417 C CA  . GLU B 1 88 ? 0.810   -6.888  0.165   1.00 18.25 ? 93  GLU B CA  1 
ATOM   1418 C C   . GLU B 1 88 ? -0.047  -7.803  -0.708  1.00 19.94 ? 93  GLU B C   1 
ATOM   1419 O O   . GLU B 1 88 ? -0.970  -8.400  -0.177  1.00 22.38 ? 93  GLU B O   1 
ATOM   1420 C CB  . GLU B 1 88 ? 0.300   -5.452  -0.115  1.00 20.29 ? 93  GLU B CB  1 
ATOM   1421 C CG  . GLU B 1 88 ? 0.757   -4.525  0.973   1.00 19.74 ? 93  GLU B CG  1 
ATOM   1422 C CD  . GLU B 1 88 ? 0.470   -3.060  0.611   1.00 17.88 ? 93  GLU B CD  1 
ATOM   1423 O OE1 . GLU B 1 88 ? 0.079   -2.798  -0.528  1.00 23.38 ? 93  GLU B OE1 1 
ATOM   1424 O OE2 . GLU B 1 88 ? 0.642   -2.232  1.520   1.00 21.45 ? 93  GLU B OE2 1 
ATOM   1425 N N   . LYS B 1 89 ? 0.339   -7.968  -1.975  1.00 21.32 ? 94  LYS B N   1 
ATOM   1426 C CA  . LYS B 1 89 ? -0.369  -8.908  -2.843  1.00 23.15 ? 94  LYS B CA  1 
ATOM   1427 C C   . LYS B 1 89 ? 0.568   -10.096 -3.055  1.00 22.87 ? 94  LYS B C   1 
ATOM   1428 O O   . LYS B 1 89 ? 1.778   -9.908  -3.179  1.00 22.53 ? 94  LYS B O   1 
ATOM   1429 C CB  . LYS B 1 89 ? -0.741  -8.249  -4.171  1.00 26.59 ? 94  LYS B CB  1 
ATOM   1430 C CG  . LYS B 1 89 ? -1.700  -7.083  -3.990  1.00 30.98 ? 94  LYS B CG  1 
ATOM   1431 C CD  . LYS B 1 89 ? -2.889  -7.080  -4.926  1.00 33.87 ? 94  LYS B CD  1 
ATOM   1432 C CE  . LYS B 1 89 ? -3.676  -5.768  -4.783  1.00 35.43 ? 94  LYS B CE  1 
ATOM   1433 N NZ  . LYS B 1 89 ? -3.843  -5.121  -6.125  1.00 38.17 ? 94  LYS B NZ  1 
ATOM   1434 N N   . PHE B 1 90 ? 0.006   -11.290 -3.041  1.00 18.25 ? 95  PHE B N   1 
ATOM   1435 C CA  . PHE B 1 90 ? 0.840   -12.496 -3.210  1.00 19.19 ? 95  PHE B CA  1 
ATOM   1436 C C   . PHE B 1 90 ? 0.002   -13.522 -3.989  1.00 19.80 ? 95  PHE B C   1 
ATOM   1437 O O   . PHE B 1 90 ? -1.195  -13.538 -3.731  1.00 21.91 ? 95  PHE B O   1 
ATOM   1438 C CB  . PHE B 1 90 ? 1.354   -13.028 -1.879  1.00 18.22 ? 95  PHE B CB  1 
ATOM   1439 C CG  . PHE B 1 90 ? 0.328   -13.332 -0.841  1.00 16.33 ? 95  PHE B CG  1 
ATOM   1440 C CD1 . PHE B 1 90 ? -0.330  -14.569 -0.773  1.00 17.62 ? 95  PHE B CD1 1 
ATOM   1441 C CD2 . PHE B 1 90 ? 0.015   -12.365 0.106   1.00 17.00 ? 95  PHE B CD2 1 
ATOM   1442 C CE1 . PHE B 1 90 ? -1.301  -14.814 0.186   1.00 17.48 ? 95  PHE B CE1 1 
ATOM   1443 C CE2 . PHE B 1 90 ? -0.962  -12.611 1.064   1.00 19.32 ? 95  PHE B CE2 1 
ATOM   1444 C CZ  . PHE B 1 90 ? -1.607  -13.818 1.103   1.00 16.06 ? 95  PHE B CZ  1 
ATOM   1445 N N   . SER B 1 91 ? 0.654   -14.155 -4.957  1.00 19.74 ? 96  SER B N   1 
ATOM   1446 C CA  . SER B 1 91 ? -0.057  -15.043 -5.874  1.00 22.75 ? 96  SER B CA  1 
ATOM   1447 C C   . SER B 1 91 ? 0.582   -16.404 -6.110  1.00 23.59 ? 96  SER B C   1 
ATOM   1448 O O   . SER B 1 91 ? 1.756   -16.617 -5.830  1.00 23.09 ? 96  SER B O   1 
ATOM   1449 C CB  . SER B 1 91 ? -0.026  -14.355 -7.267  1.00 24.14 ? 96  SER B CB  1 
ATOM   1450 O OG  . SER B 1 91 ? -0.718  -13.117 -7.156  1.00 28.92 ? 96  SER B OG  1 
ATOM   1451 N N   . TYR B 1 92 ? -0.196  -17.296 -6.746  1.00 23.62 ? 97  TYR B N   1 
ATOM   1452 C CA  . TYR B 1 92 ? 0.222   -18.672 -7.029  1.00 26.01 ? 97  TYR B CA  1 
ATOM   1453 C C   . TYR B 1 92 ? 0.201   -19.014 -8.517  1.00 25.53 ? 97  TYR B C   1 
ATOM   1454 O O   . TYR B 1 92 ? -0.878  -18.965 -9.122  1.00 27.51 ? 97  TYR B O   1 
ATOM   1455 C CB  . TYR B 1 92 ? -0.757  -19.613 -6.305  1.00 25.33 ? 97  TYR B CB  1 
ATOM   1456 C CG  . TYR B 1 92 ? -0.589  -21.105 -6.541  1.00 24.48 ? 97  TYR B CG  1 
ATOM   1457 C CD1 . TYR B 1 92 ? 0.624   -21.720 -6.287  1.00 24.89 ? 97  TYR B CD1 1 
ATOM   1458 C CD2 . TYR B 1 92 ? -1.639  -21.894 -6.983  1.00 26.35 ? 97  TYR B CD2 1 
ATOM   1459 C CE1 . TYR B 1 92 ? 0.829   -23.082 -6.476  1.00 26.44 ? 97  TYR B CE1 1 
ATOM   1460 C CE2 . TYR B 1 92 ? -1.450  -23.261 -7.173  1.00 26.71 ? 97  TYR B CE2 1 
ATOM   1461 C CZ  . TYR B 1 92 ? -0.238  -23.839 -6.917  1.00 28.08 ? 97  TYR B CZ  1 
ATOM   1462 O OH  . TYR B 1 92 ? -0.020  -25.206 -7.099  1.00 30.02 ? 97  TYR B OH  1 
ATOM   1463 N N   . PHE B 1 93 ? 1.348   -19.324 -9.112  1.00 27.86 ? 98  PHE B N   1 
ATOM   1464 C CA  . PHE B 1 93 ? 1.471   -19.696 -10.524 1.00 28.97 ? 98  PHE B CA  1 
ATOM   1465 C C   . PHE B 1 93 ? 2.395   -20.908 -10.625 1.00 29.81 ? 98  PHE B C   1 
ATOM   1466 O O   . PHE B 1 93 ? 3.609   -20.789 -10.809 1.00 29.37 ? 98  PHE B O   1 
ATOM   1467 C CB  . PHE B 1 93 ? 2.060   -18.564 -11.380 1.00 30.86 ? 98  PHE B CB  1 
ATOM   1468 C CG  . PHE B 1 93 ? 1.175   -17.361 -11.535 1.00 31.63 ? 98  PHE B CG  1 
ATOM   1469 C CD1 . PHE B 1 93 ? -0.098  -17.471 -12.068 1.00 33.39 ? 98  PHE B CD1 1 
ATOM   1470 C CD2 . PHE B 1 93 ? 1.629   -16.107 -11.151 1.00 33.64 ? 98  PHE B CD2 1 
ATOM   1471 C CE1 . PHE B 1 93 ? -0.916  -16.361 -12.195 1.00 33.25 ? 98  PHE B CE1 1 
ATOM   1472 C CE2 . PHE B 1 93 ? 0.823   -14.993 -11.278 1.00 33.74 ? 98  PHE B CE2 1 
ATOM   1473 C CZ  . PHE B 1 93 ? -0.446  -15.117 -11.800 1.00 34.06 ? 98  PHE B CZ  1 
ATOM   1474 N N   . PRO B 1 94 ? 1.817   -22.102 -10.465 1.00 29.18 ? 99  PRO B N   1 
ATOM   1475 C CA  . PRO B 1 94 ? 2.584   -23.333 -10.435 1.00 30.33 ? 99  PRO B CA  1 
ATOM   1476 C C   . PRO B 1 94 ? 3.376   -23.610 -11.704 1.00 31.80 ? 99  PRO B C   1 
ATOM   1477 O O   . PRO B 1 94 ? 2.810   -23.481 -12.782 1.00 31.75 ? 99  PRO B O   1 
ATOM   1478 C CB  . PRO B 1 94 ? 1.565   -24.436 -10.184 1.00 29.78 ? 99  PRO B CB  1 
ATOM   1479 C CG  . PRO B 1 94 ? 0.226   -23.843 -10.417 1.00 29.71 ? 99  PRO B CG  1 
ATOM   1480 C CD  . PRO B 1 94 ? 0.373   -22.352 -10.240 1.00 29.14 ? 99  PRO B CD  1 
ATOM   1481 N N   . GLU B 1 95 ? 4.639   -24.003 -11.546 1.00 33.74 ? 100 GLU B N   1 
ATOM   1482 C CA  . GLU B 1 95 ? 5.464   -24.276 -12.729 1.00 35.85 ? 100 GLU B CA  1 
ATOM   1483 C C   . GLU B 1 95 ? 5.047   -25.583 -13.398 1.00 37.62 ? 100 GLU B C   1 
ATOM   1484 O O   . GLU B 1 95 ? 4.139   -26.265 -12.858 1.00 37.78 ? 100 GLU B O   1 
ATOM   1485 C CB  . GLU B 1 95 ? 6.940   -24.255 -12.365 1.00 37.13 ? 100 GLU B CB  1 
HETATM 1486 C C1  . NAG C 2 .  ? 4.504   41.019  31.233  1.00 14.58 ? 124 NAG A C1  1 
HETATM 1487 C C2  . NAG C 2 .  ? 5.086   41.882  30.098  1.00 14.17 ? 124 NAG A C2  1 
HETATM 1488 C C3  . NAG C 2 .  ? 5.187   43.320  30.609  1.00 14.62 ? 124 NAG A C3  1 
HETATM 1489 C C4  . NAG C 2 .  ? 3.799   43.779  31.067  1.00 14.52 ? 124 NAG A C4  1 
HETATM 1490 C C5  . NAG C 2 .  ? 3.191   42.758  32.069  1.00 15.34 ? 124 NAG A C5  1 
HETATM 1491 C C6  . NAG C 2 .  ? 1.801   43.088  32.525  1.00 17.99 ? 124 NAG A C6  1 
HETATM 1492 C C7  . NAG C 2 .  ? 6.578   40.415  28.715  1.00 14.73 ? 124 NAG A C7  1 
HETATM 1493 C C8  . NAG C 2 .  ? 7.989   40.103  28.417  1.00 16.32 ? 124 NAG A C8  1 
HETATM 1494 N N2  . NAG C 2 .  ? 6.406   41.424  29.636  1.00 14.52 ? 124 NAG A N2  1 
HETATM 1495 O O3  . NAG C 2 .  ? 5.735   44.242  29.648  1.00 15.16 ? 124 NAG A O3  1 
HETATM 1496 O O4  . NAG C 2 .  ? 3.846   45.071  31.739  1.00 16.21 ? 124 NAG A O4  1 
HETATM 1497 O O5  . NAG C 2 .  ? 3.157   41.478  31.431  1.00 16.35 ? 124 NAG A O5  1 
HETATM 1498 O O6  A NAG C 2 .  ? 1.313   42.278  33.546  0.50 14.39 ? 124 NAG A O6  1 
HETATM 1499 O O6  B NAG C 2 .  ? 0.886   43.278  31.517  0.50 19.84 ? 124 NAG A O6  1 
HETATM 1500 O O7  . NAG C 2 .  ? 5.666   39.889  28.217  1.00 15.78 ? 124 NAG A O7  1 
HETATM 1501 C C1  . NAG D 2 .  ? 5.543   20.418  11.197  1.00 20.60 ? 147 NAG A C1  1 
HETATM 1502 C C2  . NAG D 2 .  ? 5.839   21.554  10.220  1.00 21.89 ? 147 NAG A C2  1 
HETATM 1503 C C3  . NAG D 2 .  ? 5.087   21.314  8.908   1.00 23.59 ? 147 NAG A C3  1 
HETATM 1504 C C4  . NAG D 2 .  ? 5.316   19.891  8.384   1.00 24.56 ? 147 NAG A C4  1 
HETATM 1505 C C5  . NAG D 2 .  ? 5.003   18.861  9.488   1.00 23.73 ? 147 NAG A C5  1 
HETATM 1506 C C6  . NAG D 2 .  ? 5.292   17.467  9.001   1.00 24.79 ? 147 NAG A C6  1 
HETATM 1507 C C7  . NAG D 2 .  ? 6.208   23.627  11.566  1.00 19.50 ? 147 NAG A C7  1 
HETATM 1508 C C8  . NAG D 2 .  ? 5.683   24.951  11.951  1.00 20.76 ? 147 NAG A C8  1 
HETATM 1509 N N2  . NAG D 2 .  ? 5.428   22.853  10.757  1.00 18.61 ? 147 NAG A N2  1 
HETATM 1510 O O3  . NAG D 2 .  ? 5.666   22.209  7.928   1.00 25.58 ? 147 NAG A O3  1 
HETATM 1511 O O4  . NAG D 2 .  ? 4.446   19.648  7.241   1.00 26.20 ? 147 NAG A O4  1 
HETATM 1512 O O5  . NAG D 2 .  ? 5.887   19.168  10.583  1.00 22.43 ? 147 NAG A O5  1 
HETATM 1513 O O6  . NAG D 2 .  ? 5.085   16.419  9.898   1.00 24.02 ? 147 NAG A O6  1 
HETATM 1514 O O7  . NAG D 2 .  ? 7.245   23.226  11.922  1.00 19.83 ? 147 NAG A O7  1 
HETATM 1515 C C1  . NAG E 2 .  ? 3.824   -2.344  15.599  1.00 13.30 ? 124 NAG B C1  1 
HETATM 1516 C C2  . NAG E 2 .  ? 4.735   -1.814  14.488  1.00 13.94 ? 124 NAG B C2  1 
HETATM 1517 C C3  . NAG E 2 .  ? 5.528   -0.653  15.050  1.00 12.57 ? 124 NAG B C3  1 
HETATM 1518 C C4  . NAG E 2 .  ? 4.515   0.434   15.462  1.00 14.62 ? 124 NAG B C4  1 
HETATM 1519 C C5  . NAG E 2 .  ? 3.515   -0.183  16.470  1.00 13.40 ? 124 NAG B C5  1 
HETATM 1520 C C6  . NAG E 2 .  ? 2.483   0.848   16.898  1.00 15.82 ? 124 NAG B C6  1 
HETATM 1521 C C7  . NAG E 2 .  ? 5.344   -3.756  13.022  1.00 14.82 ? 124 NAG B C7  1 
HETATM 1522 C C8  . NAG E 2 .  ? 6.481   -4.639  12.666  1.00 15.39 ? 124 NAG B C8  1 
HETATM 1523 N N2  . NAG E 2 .  ? 5.664   -2.835  13.969  1.00 14.10 ? 124 NAG B N2  1 
HETATM 1524 O O3  . NAG E 2 .  ? 6.369   -0.032  14.034  1.00 14.23 ? 124 NAG B O3  1 
HETATM 1525 O O4  . NAG E 2 .  ? 5.196   1.526   16.134  1.00 16.44 ? 124 NAG B O4  1 
HETATM 1526 O O5  . NAG E 2 .  ? 2.864   -1.287  15.844  1.00 14.34 ? 124 NAG B O5  1 
HETATM 1527 O O6  A NAG E 2 .  ? 1.628   1.234   15.885  0.50 18.14 ? 124 NAG B O6  1 
HETATM 1528 O O6  B NAG E 2 .  ? 1.617   0.332   17.870  0.50 15.45 ? 124 NAG B O6  1 
HETATM 1529 O O7  . NAG E 2 .  ? 4.279   -3.843  12.581  1.00 15.35 ? 124 NAG B O7  1 
HETATM 1530 C C1  . NAG F 2 .  ? -5.244  -21.074 -3.685  1.00 24.14 ? 147 NAG B C1  1 
HETATM 1531 C C2  . NAG F 2 .  ? -4.476  -20.209 -4.677  1.00 23.79 ? 147 NAG B C2  1 
HETATM 1532 C C3  . NAG F 2 .  ? -5.326  -19.928 -5.905  1.00 23.48 ? 147 NAG B C3  1 
HETATM 1533 C C4  . NAG F 2 .  ? -5.785  -21.281 -6.493  1.00 25.51 ? 147 NAG B C4  1 
HETATM 1534 C C5  . NAG F 2 .  ? -6.442  -22.133 -5.404  1.00 26.53 ? 147 NAG B C5  1 
HETATM 1535 C C6  . NAG F 2 .  ? -6.755  -23.561 -5.875  1.00 27.02 ? 147 NAG B C6  1 
HETATM 1536 C C7  . NAG F 2 .  ? -3.008  -18.667 -3.407  1.00 21.77 ? 147 NAG B C7  1 
HETATM 1537 C C8  . NAG F 2 .  ? -2.850  -17.259 -2.938  1.00 21.69 ? 147 NAG B C8  1 
HETATM 1538 N N2  . NAG F 2 .  ? -4.161  -18.864 -4.092  1.00 23.28 ? 147 NAG B N2  1 
HETATM 1539 O O3  . NAG F 2 .  ? -4.589  -19.199 -6.889  1.00 24.99 ? 147 NAG B O3  1 
HETATM 1540 O O4  . NAG F 2 .  ? -6.764  -20.970 -7.519  1.00 27.65 ? 147 NAG B O4  1 
HETATM 1541 O O5  . NAG F 2 .  ? -5.515  -22.367 -4.344  1.00 24.83 ? 147 NAG B O5  1 
HETATM 1542 O O6  . NAG F 2 .  ? -7.766  -24.035 -5.037  1.00 31.81 ? 147 NAG B O6  1 
HETATM 1543 O O7  . NAG F 2 .  ? -2.244  -19.499 -3.188  1.00 22.21 ? 147 NAG B O7  1 
HETATM 1544 O O   . HOH G 3 .  ? 7.153   25.226  34.993  1.00 16.20 ? 148 HOH A O   1 
HETATM 1545 O O   . HOH G 3 .  ? 2.652   42.362  27.373  1.00 15.25 ? 149 HOH A O   1 
HETATM 1546 O O   . HOH G 3 .  ? 2.549   15.460  9.590   1.00 20.21 ? 150 HOH A O   1 
HETATM 1547 O O   . HOH G 3 .  ? 7.809   38.468  31.700  1.00 16.28 ? 151 HOH A O   1 
HETATM 1548 O O   . HOH G 3 .  ? 11.145  16.957  8.165   1.00 18.16 ? 152 HOH A O   1 
HETATM 1549 O O   . HOH G 3 .  ? 16.903  24.113  14.929  1.00 20.48 ? 153 HOH A O   1 
HETATM 1550 O O   . HOH G 3 .  ? -0.205  41.510  17.466  1.00 37.59 ? 154 HOH A O   1 
HETATM 1551 O O   . HOH G 3 .  ? 2.601   10.508  15.554  1.00 24.14 ? 155 HOH A O   1 
HETATM 1552 O O   . HOH G 3 .  ? 0.036   41.334  14.221  0.33 32.49 ? 156 HOH A O   1 
HETATM 1553 O O   . HOH G 3 .  ? 7.183   32.320  8.468   1.00 22.80 ? 157 HOH A O   1 
HETATM 1554 O O   . HOH G 3 .  ? 12.227  48.424  22.707  1.00 19.68 ? 158 HOH A O   1 
HETATM 1555 O O   . HOH G 3 .  ? 9.514   46.940  12.611  1.00 24.88 ? 159 HOH A O   1 
HETATM 1556 O O   . HOH G 3 .  ? 1.998   25.490  22.333  1.00 18.52 ? 160 HOH A O   1 
HETATM 1557 O O   . HOH G 3 .  ? 14.033  33.395  9.344   1.00 18.05 ? 161 HOH A O   1 
HETATM 1558 O O   . HOH G 3 .  ? 15.359  15.175  7.278   1.00 16.76 ? 162 HOH A O   1 
HETATM 1559 O O   . HOH G 3 .  ? 11.817  17.216  13.127  1.00 19.71 ? 163 HOH A O   1 
HETATM 1560 O O   . HOH G 3 .  ? 5.157   26.752  33.493  1.00 19.12 ? 164 HOH A O   1 
HETATM 1561 O O   . HOH G 3 .  ? 7.385   15.397  12.385  1.00 21.22 ? 165 HOH A O   1 
HETATM 1562 O O   . HOH G 3 .  ? 9.970   27.156  27.646  1.00 25.34 ? 166 HOH A O   1 
HETATM 1563 O O   . HOH G 3 .  ? 11.226  33.836  25.647  1.00 27.58 ? 167 HOH A O   1 
HETATM 1564 O O   . HOH G 3 .  ? 15.899  31.768  11.009  1.00 18.00 ? 168 HOH A O   1 
HETATM 1565 O O   . HOH G 3 .  ? 6.962   11.989  13.163  1.00 28.55 ? 169 HOH A O   1 
HETATM 1566 O O   . HOH G 3 .  ? 5.414   25.693  8.323   1.00 21.69 ? 170 HOH A O   1 
HETATM 1567 O O   . HOH G 3 .  ? 14.014  28.017  23.537  1.00 25.88 ? 171 HOH A O   1 
HETATM 1568 O O   . HOH G 3 .  ? 17.698  30.229  12.127  1.00 29.09 ? 172 HOH A O   1 
HETATM 1569 O O   . HOH G 3 .  ? 7.182   35.365  10.373  1.00 24.88 ? 173 HOH A O   1 
HETATM 1570 O O   . HOH G 3 .  ? 7.904   19.122  25.395  1.00 43.38 ? 174 HOH A O   1 
HETATM 1571 O O   . HOH G 3 .  ? 19.969  30.889  13.390  1.00 40.68 ? 175 HOH A O   1 
HETATM 1572 O O   . HOH G 3 .  ? 2.779   23.615  10.363  1.00 32.75 ? 176 HOH A O   1 
HETATM 1573 O O   . HOH G 3 .  ? 13.367  31.959  30.599  1.00 27.03 ? 177 HOH A O   1 
HETATM 1574 O O   . HOH G 3 .  ? 13.833  27.180  26.309  1.00 31.26 ? 178 HOH A O   1 
HETATM 1575 O O   . HOH G 3 .  ? 10.352  18.432  17.436  1.00 20.70 ? 179 HOH A O   1 
HETATM 1576 O O   . HOH G 3 .  ? 7.863   41.042  32.980  1.00 29.43 ? 180 HOH A O   1 
HETATM 1577 O O   . HOH G 3 .  ? 18.863  22.169  15.288  1.00 27.84 ? 181 HOH A O   1 
HETATM 1578 O O   . HOH G 3 .  ? 11.995  33.707  28.727  1.00 24.14 ? 182 HOH A O   1 
HETATM 1579 O O   . HOH G 3 .  ? 12.577  29.662  40.204  1.00 21.35 ? 183 HOH A O   1 
HETATM 1580 O O   . HOH G 3 .  ? 19.463  20.073  -0.531  1.00 30.48 ? 184 HOH A O   1 
HETATM 1581 O O   . HOH G 3 .  ? 12.346  36.284  30.083  1.00 23.76 ? 185 HOH A O   1 
HETATM 1582 O O   . HOH G 3 .  ? 19.774  24.639  6.564   1.00 27.26 ? 186 HOH A O   1 
HETATM 1583 O O   . HOH G 3 .  ? 2.848   30.358  12.287  1.00 25.07 ? 187 HOH A O   1 
HETATM 1584 O O   . HOH G 3 .  ? 10.574  38.185  31.151  1.00 24.55 ? 188 HOH A O   1 
HETATM 1585 O O   . HOH G 3 .  ? 8.662   42.648  31.101  1.00 32.84 ? 189 HOH A O   1 
HETATM 1586 O O   . HOH G 3 .  ? 3.542   23.358  26.394  1.00 45.17 ? 190 HOH A O   1 
HETATM 1587 O O   . HOH G 3 .  ? 21.187  18.141  2.178   1.00 40.24 ? 191 HOH A O   1 
HETATM 1588 O O   . HOH G 3 .  ? 0.136   43.062  29.127  1.00 27.52 ? 192 HOH A O   1 
HETATM 1589 O O   . HOH G 3 .  ? 13.717  37.292  27.942  1.00 26.62 ? 193 HOH A O   1 
HETATM 1590 O O   . HOH G 3 .  ? 17.560  20.514  17.527  1.00 33.37 ? 194 HOH A O   1 
HETATM 1591 O O   . HOH G 3 .  ? 11.759  40.090  29.396  1.00 36.57 ? 195 HOH A O   1 
HETATM 1592 O O   . HOH G 3 .  ? 20.109  20.499  8.510   1.00 24.82 ? 196 HOH A O   1 
HETATM 1593 O O   . HOH G 3 .  ? 9.574   24.136  27.305  1.00 34.30 ? 197 HOH A O   1 
HETATM 1594 O O   . HOH G 3 .  ? 18.780  36.827  23.644  1.00 43.91 ? 198 HOH A O   1 
HETATM 1595 O O   . HOH G 3 .  ? 15.305  35.997  26.479  1.00 33.37 ? 199 HOH A O   1 
HETATM 1596 O O   . HOH G 3 .  ? 12.188  22.729  29.973  1.00 47.65 ? 200 HOH A O   1 
HETATM 1597 O O   . HOH G 3 .  ? 20.161  30.999  9.770   1.00 38.20 ? 201 HOH A O   1 
HETATM 1598 O O   . HOH G 3 .  ? 3.257   40.398  34.696  1.00 34.42 ? 202 HOH A O   1 
HETATM 1599 O O   . HOH G 3 .  ? 14.032  15.043  14.707  1.00 24.78 ? 203 HOH A O   1 
HETATM 1600 O O   . HOH G 3 .  ? 23.279  34.193  18.801  1.00 34.50 ? 204 HOH A O   1 
HETATM 1601 O O   . HOH G 3 .  ? 18.725  26.137  14.900  1.00 29.98 ? 205 HOH A O   1 
HETATM 1602 O O   . HOH G 3 .  ? 12.012  23.593  27.514  1.00 55.70 ? 206 HOH A O   1 
HETATM 1603 O O   . HOH G 3 .  ? -0.864  32.499  32.927  1.00 30.31 ? 207 HOH A O   1 
HETATM 1604 O O   . HOH G 3 .  ? 16.269  24.521  -0.673  1.00 41.10 ? 208 HOH A O   1 
HETATM 1605 O O   . HOH G 3 .  ? 17.238  27.350  12.673  1.00 20.46 ? 209 HOH A O   1 
HETATM 1606 O O   . HOH G 3 .  ? 11.716  17.604  20.443  1.00 42.03 ? 210 HOH A O   1 
HETATM 1607 O O   . HOH G 3 .  ? 6.942   38.481  9.616   1.00 37.35 ? 211 HOH A O   1 
HETATM 1608 O O   . HOH G 3 .  ? 3.147   26.047  29.963  1.00 34.85 ? 212 HOH A O   1 
HETATM 1609 O O   . HOH G 3 .  ? 9.869   15.828  14.687  1.00 23.42 ? 213 HOH A O   1 
HETATM 1610 O O   . HOH G 3 .  ? 17.071  14.621  11.781  1.00 38.61 ? 214 HOH A O   1 
HETATM 1611 O O   . HOH G 3 .  ? 6.328   37.649  36.195  1.00 41.37 ? 215 HOH A O   1 
HETATM 1612 O O   . HOH G 3 .  ? 1.881   14.294  17.656  1.00 26.13 ? 216 HOH A O   1 
HETATM 1613 O O   . HOH G 3 .  ? 20.743  23.635  0.718   1.00 45.95 ? 217 HOH A O   1 
HETATM 1614 O O   . HOH G 3 .  ? 5.393   45.126  34.090  1.00 28.80 ? 218 HOH A O   1 
HETATM 1615 O O   . HOH G 3 .  ? 15.358  51.307  22.099  1.00 27.64 ? 219 HOH A O   1 
HETATM 1616 O O   . HOH G 3 .  ? 4.328   29.589  5.874   1.00 30.25 ? 220 HOH A O   1 
HETATM 1617 O O   . HOH G 3 .  ? 7.989   17.934  11.525  1.00 24.91 ? 221 HOH A O   1 
HETATM 1618 O O   . HOH G 3 .  ? 5.968   18.300  21.652  1.00 35.25 ? 222 HOH A O   1 
HETATM 1619 O O   . HOH G 3 .  ? 12.192  52.556  24.761  1.00 21.93 ? 223 HOH A O   1 
HETATM 1620 O O   . HOH G 3 .  ? 8.668   16.621  9.026   1.00 26.38 ? 224 HOH A O   1 
HETATM 1621 O O   . HOH G 3 .  ? 11.105  42.836  29.649  1.00 33.33 ? 225 HOH A O   1 
HETATM 1622 O O   . HOH G 3 .  ? 12.116  50.623  12.089  1.00 33.38 ? 226 HOH A O   1 
HETATM 1623 O O   . HOH G 3 .  ? 13.196  36.386  25.043  1.00 28.04 ? 227 HOH A O   1 
HETATM 1624 O O   . HOH G 3 .  ? 3.352   30.352  9.473   1.00 34.26 ? 228 HOH A O   1 
HETATM 1625 O O   . HOH G 3 .  ? 15.205  40.392  25.807  1.00 31.73 ? 229 HOH A O   1 
HETATM 1626 O O   . HOH G 3 .  ? 6.809   14.624  9.945   1.00 27.23 ? 230 HOH A O   1 
HETATM 1627 O O   . HOH G 3 .  ? 13.199  27.925  30.618  1.00 25.05 ? 231 HOH A O   1 
HETATM 1628 O O   . HOH G 3 .  ? 7.188   23.580  25.411  1.00 31.45 ? 232 HOH A O   1 
HETATM 1629 O O   . HOH G 3 .  ? 9.571   21.277  25.307  1.00 66.71 ? 233 HOH A O   1 
HETATM 1630 O O   . HOH G 3 .  ? 4.449   37.286  11.938  1.00 30.28 ? 234 HOH A O   1 
HETATM 1631 O O   . HOH G 3 .  ? 20.885  25.928  4.497   1.00 37.84 ? 235 HOH A O   1 
HETATM 1632 O O   . HOH G 3 .  ? 17.352  46.793  15.792  1.00 34.98 ? 236 HOH A O   1 
HETATM 1633 O O   . HOH G 3 .  ? -0.533  21.650  16.057  1.00 32.83 ? 237 HOH A O   1 
HETATM 1634 O O   . HOH G 3 .  ? 16.247  44.435  13.469  1.00 28.49 ? 238 HOH A O   1 
HETATM 1635 O O   . HOH G 3 .  ? 16.450  38.496  10.020  1.00 36.52 ? 239 HOH A O   1 
HETATM 1636 O O   . HOH G 3 .  ? 3.681   27.269  9.933   1.00 28.15 ? 240 HOH A O   1 
HETATM 1637 O O   . HOH G 3 .  ? 15.788  29.995  23.521  1.00 35.21 ? 241 HOH A O   1 
HETATM 1638 O O   . HOH G 3 .  ? 13.975  36.221  32.263  1.00 41.33 ? 242 HOH A O   1 
HETATM 1639 O O   . HOH G 3 .  ? 3.131   35.172  35.308  1.00 30.07 ? 243 HOH A O   1 
HETATM 1640 O O   . HOH G 3 .  ? 14.030  32.025  2.863   1.00 35.94 ? 244 HOH A O   1 
HETATM 1641 O O   . HOH G 3 .  ? 19.617  34.275  23.136  1.00 59.19 ? 245 HOH A O   1 
HETATM 1642 O O   . HOH G 3 .  ? 15.233  43.124  25.905  1.00 38.10 ? 246 HOH A O   1 
HETATM 1643 O O   . HOH G 3 .  ? 15.294  30.527  0.228   1.00 43.58 ? 247 HOH A O   1 
HETATM 1644 O O   . HOH G 3 .  ? 9.021   41.602  9.323   1.00 37.30 ? 248 HOH A O   1 
HETATM 1645 O O   . HOH G 3 .  ? 3.159   39.649  12.553  1.00 30.24 ? 249 HOH A O   1 
HETATM 1646 O O   . HOH G 3 .  ? 16.180  32.449  24.890  1.00 42.32 ? 250 HOH A O   1 
HETATM 1647 O O   . HOH G 3 .  ? 18.992  26.644  17.509  1.00 33.66 ? 251 HOH A O   1 
HETATM 1648 O O   . HOH G 3 .  ? 16.339  35.403  24.024  1.00 35.77 ? 252 HOH A O   1 
HETATM 1649 O O   . HOH G 3 .  ? 17.428  24.642  18.410  1.00 38.82 ? 253 HOH A O   1 
HETATM 1650 O O   . HOH G 3 .  ? 5.673   33.376  36.832  1.00 31.20 ? 254 HOH A O   1 
HETATM 1651 O O   . HOH G 3 .  ? 18.974  27.208  3.251   1.00 33.16 ? 255 HOH A O   1 
HETATM 1652 O O   . HOH G 3 .  ? 8.307   16.919  22.337  1.00 36.55 ? 256 HOH A O   1 
HETATM 1653 O O   . HOH G 3 .  ? -2.363  28.561  30.284  1.00 53.34 ? 257 HOH A O   1 
HETATM 1654 O O   . HOH G 3 .  ? 12.967  44.014  28.127  1.00 37.87 ? 258 HOH A O   1 
HETATM 1655 O O   . HOH G 3 .  ? 6.060   34.715  7.962   1.00 33.68 ? 259 HOH A O   1 
HETATM 1656 O O   . HOH G 3 .  ? 2.761   32.149  7.560   1.00 62.05 ? 260 HOH A O   1 
HETATM 1657 O O   . HOH G 3 .  ? 14.229  24.515  26.606  1.00 37.37 ? 261 HOH A O   1 
HETATM 1658 O O   . HOH G 3 .  ? 9.857   50.681  13.613  1.00 34.82 ? 262 HOH A O   1 
HETATM 1659 O O   . HOH G 3 .  ? 10.432  44.685  8.847   1.00 56.31 ? 263 HOH A O   1 
HETATM 1660 O O   . HOH H 3 .  ? 5.477   -5.986  16.172  1.00 15.28 ? 148 HOH B O   1 
HETATM 1661 O O   . HOH H 3 .  ? -0.196  0.277   1.818   1.00 29.50 ? 149 HOH B O   1 
HETATM 1662 O O   . HOH H 3 .  ? 2.789   -0.441  11.746  1.00 16.02 ? 150 HOH B O   1 
HETATM 1663 O O   . HOH H 3 .  ? 16.705  -10.417 1.541   1.00 25.67 ? 151 HOH B O   1 
HETATM 1664 O O   . HOH H 3 .  ? 14.036  0.585   7.032   1.00 22.05 ? 152 HOH B O   1 
HETATM 1665 O O   . HOH H 3 .  ? 6.507   -11.779 10.013  1.00 27.12 ? 153 HOH B O   1 
HETATM 1666 O O   . HOH H 3 .  ? 9.047   -15.916 -4.898  1.00 19.88 ? 154 HOH B O   1 
HETATM 1667 O O   . HOH H 3 .  ? -1.807  -15.472 17.789  1.00 21.21 ? 155 HOH B O   1 
HETATM 1668 O O   . HOH H 3 .  ? 8.174   -13.582 -6.512  1.00 21.29 ? 156 HOH B O   1 
HETATM 1669 O O   . HOH H 3 .  ? 7.885   -3.748  -6.125  1.00 34.21 ? 157 HOH B O   1 
HETATM 1670 O O   . HOH H 3 .  ? 6.841   0.707   18.149  1.00 25.13 ? 158 HOH B O   1 
HETATM 1671 O O   . HOH H 3 .  ? 11.082  0.529   -2.856  1.00 23.53 ? 159 HOH B O   1 
HETATM 1672 O O   . HOH H 3 .  ? -5.529  -14.939 7.206   1.00 20.48 ? 160 HOH B O   1 
HETATM 1673 O O   . HOH H 3 .  ? 8.837   -10.635 9.851   1.00 29.15 ? 161 HOH B O   1 
HETATM 1674 O O   . HOH H 3 .  ? 8.175   -26.068 -10.244 1.00 58.39 ? 162 HOH B O   1 
HETATM 1675 O O   . HOH H 3 .  ? 15.730  -4.807  -2.533  1.00 27.12 ? 163 HOH B O   1 
HETATM 1676 O O   . HOH H 3 .  ? 3.756   -22.684 8.579   1.00 24.18 ? 164 HOH B O   1 
HETATM 1677 O O   . HOH H 3 .  ? 5.349   -16.930 14.029  1.00 25.92 ? 165 HOH B O   1 
HETATM 1678 O O   . HOH H 3 .  ? -4.365  -15.573 18.556  1.00 32.90 ? 166 HOH B O   1 
HETATM 1679 O O   . HOH H 3 .  ? 8.532   -21.264 -2.943  1.00 37.53 ? 167 HOH B O   1 
HETATM 1680 O O   . HOH H 3 .  ? -0.002  -0.004  -1.468  0.33 37.54 ? 168 HOH B O   1 
HETATM 1681 O O   . HOH H 3 .  ? 18.350  -17.565 5.042   1.00 22.02 ? 169 HOH B O   1 
HETATM 1682 O O   . HOH H 3 .  ? 3.099   -17.056 12.496  1.00 20.88 ? 170 HOH B O   1 
HETATM 1683 O O   . HOH H 3 .  ? -2.613  -26.272 -8.201  1.00 41.31 ? 171 HOH B O   1 
HETATM 1684 O O   . HOH H 3 .  ? -0.261  -17.280 19.176  1.00 25.17 ? 172 HOH B O   1 
HETATM 1685 O O   . HOH H 3 .  ? 7.824   -17.988 16.644  1.00 26.33 ? 173 HOH B O   1 
HETATM 1686 O O   . HOH H 3 .  ? 19.977  -9.672  2.053   1.00 53.43 ? 174 HOH B O   1 
HETATM 1687 O O   . HOH H 3 .  ? -5.889  -24.929 -2.628  1.00 35.91 ? 175 HOH B O   1 
HETATM 1688 O O   . HOH H 3 .  ? 17.504  -3.365  -0.264  1.00 28.42 ? 176 HOH B O   1 
HETATM 1689 O O   . HOH H 3 .  ? 3.236   -8.800  -5.169  1.00 28.88 ? 177 HOH B O   1 
HETATM 1690 O O   . HOH H 3 .  ? 22.772  -13.098 3.805   1.00 42.91 ? 178 HOH B O   1 
HETATM 1691 O O   . HOH H 3 .  ? 17.514  -16.855 2.394   1.00 23.12 ? 179 HOH B O   1 
HETATM 1692 O O   . HOH H 3 .  ? 1.397   -4.888  19.609  1.00 27.15 ? 180 HOH B O   1 
HETATM 1693 O O   . HOH H 3 .  ? -3.219  -16.677 -6.790  1.00 25.63 ? 181 HOH B O   1 
HETATM 1694 O O   . HOH H 3 .  ? 15.534  -11.856 -6.372  1.00 42.99 ? 182 HOH B O   1 
HETATM 1695 O O   . HOH H 3 .  ? 8.282   -3.059  15.562  1.00 29.25 ? 183 HOH B O   1 
HETATM 1696 O O   . HOH H 3 .  ? 4.595   -5.706  -6.163  1.00 39.99 ? 184 HOH B O   1 
HETATM 1697 O O   . HOH H 3 .  ? -3.409  -13.495 -1.873  1.00 30.59 ? 185 HOH B O   1 
HETATM 1698 O O   . HOH H 3 .  ? 22.582  -15.215 6.452   1.00 48.00 ? 186 HOH B O   1 
HETATM 1699 O O   . HOH H 3 .  ? 2.530   -19.721 12.884  1.00 32.33 ? 187 HOH B O   1 
HETATM 1700 O O   . HOH H 3 .  ? -2.859  -11.128 -3.305  1.00 31.09 ? 188 HOH B O   1 
HETATM 1701 O O   . HOH H 3 .  ? 12.920  -10.283 -5.903  1.00 29.92 ? 189 HOH B O   1 
HETATM 1702 O O   . HOH H 3 .  ? 7.099   -17.358 20.687  1.00 28.74 ? 190 HOH B O   1 
HETATM 1703 O O   . HOH H 3 .  ? 10.250  -6.309  -12.484 1.00 50.51 ? 191 HOH B O   1 
HETATM 1704 O O   . HOH H 3 .  ? -3.713  -24.591 -4.572  1.00 38.59 ? 192 HOH B O   1 
HETATM 1705 O O   . HOH H 3 .  ? -1.961  -25.269 2.241   1.00 22.82 ? 193 HOH B O   1 
HETATM 1706 O O   . HOH H 3 .  ? 9.931   -18.122 -3.810  1.00 31.91 ? 194 HOH B O   1 
HETATM 1707 O O   . HOH H 3 .  ? -1.534  -20.773 24.136  1.00 27.22 ? 195 HOH B O   1 
HETATM 1708 O O   . HOH H 3 .  ? -5.260  -2.848  -5.317  1.00 33.66 ? 196 HOH B O   1 
HETATM 1709 O O   . HOH H 3 .  ? -4.093  -14.297 12.219  1.00 31.66 ? 197 HOH B O   1 
HETATM 1710 O O   . HOH H 3 .  ? -4.076  -15.796 9.585   1.00 19.37 ? 198 HOH B O   1 
HETATM 1711 O O   . HOH H 3 .  ? -7.571  -16.725 7.632   1.00 47.55 ? 199 HOH B O   1 
HETATM 1712 O O   . HOH H 3 .  ? 6.787   -3.745  17.523  1.00 31.65 ? 200 HOH B O   1 
HETATM 1713 O O   . HOH H 3 .  ? -9.894  -17.507 1.184   1.00 34.03 ? 201 HOH B O   1 
HETATM 1714 O O   . HOH H 3 .  ? 1.505   -11.455 -6.834  1.00 30.99 ? 202 HOH B O   1 
HETATM 1715 O O   . HOH H 3 .  ? -0.485  -6.952  19.552  1.00 25.36 ? 203 HOH B O   1 
HETATM 1716 O O   . HOH H 3 .  ? 7.093   -27.563 -8.273  1.00 40.43 ? 204 HOH B O   1 
HETATM 1717 O O   . HOH H 3 .  ? 19.061  -13.454 -7.252  1.00 48.88 ? 205 HOH B O   1 
HETATM 1718 O O   . HOH H 3 .  ? 14.298  -12.001 -9.280  1.00 50.17 ? 206 HOH B O   1 
HETATM 1719 O O   . HOH H 3 .  ? 6.432   -23.776 -0.947  1.00 32.17 ? 207 HOH B O   1 
HETATM 1720 O O   . HOH H 3 .  ? 14.428  -14.501 -10.197 1.00 49.01 ? 208 HOH B O   1 
HETATM 1721 O O   . HOH H 3 .  ? 3.734   -25.543 8.728   1.00 29.11 ? 209 HOH B O   1 
HETATM 1722 O O   . HOH H 3 .  ? 1.921   -3.139  -3.084  1.00 33.26 ? 210 HOH B O   1 
HETATM 1723 O O   . HOH H 3 .  ? -6.339  -16.674 -4.447  1.00 27.30 ? 211 HOH B O   1 
HETATM 1724 O O   . HOH H 3 .  ? 5.992   -5.759  19.837  1.00 47.60 ? 212 HOH B O   1 
HETATM 1725 O O   . HOH H 3 .  ? 14.974  2.157   -3.058  1.00 32.91 ? 213 HOH B O   1 
HETATM 1726 O O   . HOH H 3 .  ? -4.747  -7.828  16.853  1.00 28.81 ? 214 HOH B O   1 
HETATM 1727 O O   . HOH H 3 .  ? 16.980  -1.663  3.050   1.00 41.15 ? 215 HOH B O   1 
HETATM 1728 O O   . HOH H 3 .  ? 11.333  -6.287  12.856  1.00 35.98 ? 216 HOH B O   1 
HETATM 1729 O O   . HOH H 3 .  ? -5.874  -27.671 -0.449  1.00 51.44 ? 217 HOH B O   1 
HETATM 1730 O O   . HOH H 3 .  ? 12.622  -18.698 -5.665  1.00 37.04 ? 218 HOH B O   1 
HETATM 1731 O O   . HOH H 3 .  ? 0.897   1.218   13.435  1.00 30.66 ? 219 HOH B O   1 
HETATM 1732 O O   . HOH H 3 .  ? 7.656   -14.070 15.046  1.00 33.03 ? 220 HOH B O   1 
HETATM 1733 O O   . HOH H 3 .  ? 8.317   -13.496 23.169  1.00 54.70 ? 221 HOH B O   1 
HETATM 1734 O O   . HOH H 3 .  ? 2.320   -22.145 10.730  1.00 35.81 ? 222 HOH B O   1 
HETATM 1735 O O   . HOH H 3 .  ? 5.599   -28.871 -4.211  1.00 59.33 ? 223 HOH B O   1 
HETATM 1736 O O   . HOH H 3 .  ? 2.226   -21.931 17.161  1.00 47.63 ? 224 HOH B O   1 
HETATM 1737 O O   . HOH H 3 .  ? -2.588  -11.120 -6.252  1.00 41.59 ? 225 HOH B O   1 
HETATM 1738 O O   . HOH H 3 .  ? 6.404   -16.094 -12.213 1.00 60.83 ? 226 HOH B O   1 
HETATM 1739 O O   . HOH H 3 .  ? 6.791   -7.401  -14.562 1.00 37.74 ? 227 HOH B O   1 
HETATM 1740 O O   . HOH H 3 .  ? 8.326   -10.050 -16.502 1.00 36.39 ? 228 HOH B O   1 
HETATM 1741 O O   . HOH H 3 .  ? 7.804   -29.052 -5.902  1.00 53.47 ? 229 HOH B O   1 
HETATM 1742 O O   . HOH H 3 .  ? 6.356   -28.915 -1.664  1.00 35.58 ? 230 HOH B O   1 
HETATM 1743 O O   . HOH H 3 .  ? 3.691   -32.076 -2.864  1.00 65.29 ? 231 HOH B O   1 
HETATM 1744 O O   . HOH H 3 .  ? 3.409   -20.944 14.980  1.00 31.22 ? 232 HOH B O   1 
HETATM 1745 O O   . HOH H 3 .  ? 4.982   -25.702 18.059  1.00 62.64 ? 233 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  6   ?   ?   ?   A . n 
A 1 2  GLU 2  7   7   GLU GLU A . n 
A 1 3  THR 3  8   8   THR THR A . n 
A 1 4  GLN 4  9   9   GLN GLN A . n 
A 1 5  GLU 5  10  10  GLU GLU A . n 
A 1 6  CYS 6  11  11  CYS CYS A . n 
A 1 7  LEU 7  12  12  LEU LEU A . n 
A 1 8  PHE 8  13  13  PHE PHE A . n 
A 1 9  PHE 9  14  14  PHE PHE A . n 
A 1 10 ASN 10 15  15  ASN ASN A . n 
A 1 11 ALA 11 16  16  ALA ALA A . n 
A 1 12 ASN 12 17  17  ASN ASN A . n 
A 1 13 TRP 13 18  18  TRP TRP A . n 
A 1 14 GLU 14 19  19  GLU GLU A . n 
A 1 15 ARG 15 20  20  ARG ARG A . n 
A 1 16 ASP 16 21  21  ASP ASP A . n 
A 1 17 ARG 17 22  22  ARG ARG A . n 
A 1 18 THR 18 23  23  THR THR A . n 
A 1 19 ASN 19 24  24  ASN ASN A . n 
A 1 20 GLN 20 25  25  GLN GLN A . n 
A 1 21 THR 21 26  26  THR THR A . n 
A 1 22 GLY 22 27  27  GLY GLY A . n 
A 1 23 VAL 23 28  28  VAL VAL A . n 
A 1 24 GLU 24 29  29  GLU GLU A . n 
A 1 25 PRO 25 30  30  PRO PRO A . n 
A 1 26 CYS 26 31  31  CYS CYS A . n 
A 1 27 TYR 27 32  32  TYR TYR A . n 
A 1 28 GLY 28 33  33  GLY GLY A . n 
A 1 29 ASP 29 34  ?   ?   ?   A . n 
A 1 30 LYS 30 35  ?   ?   ?   A . n 
A 1 31 ASP 31 36  ?   ?   ?   A . n 
A 1 32 LYS 32 37  ?   ?   ?   A . n 
A 1 33 ARG 33 38  38  ARG ARG A . n 
A 1 34 ARG 34 39  39  ARG ARG A . n 
A 1 35 HIS 35 40  40  HIS HIS A . n 
A 1 36 CYS 36 41  41  CYS CYS A . n 
A 1 37 PHE 37 42  42  PHE PHE A . n 
A 1 38 ALA 38 43  43  ALA ALA A . n 
A 1 39 THR 39 44  44  THR THR A . n 
A 1 40 TRP 40 45  45  TRP TRP A . n 
A 1 41 LYS 41 46  46  LYS LYS A . n 
A 1 42 ASN 42 47  47  ASN ASN A . n 
A 1 43 ILE 43 48  48  ILE ILE A . n 
A 1 44 SER 44 49  49  SER SER A . n 
A 1 45 GLY 45 50  50  GLY GLY A . n 
A 1 46 SER 46 51  51  SER SER A . n 
A 1 47 ILE 47 52  52  ILE ILE A . n 
A 1 48 GLU 48 53  53  GLU GLU A . n 
A 1 49 ILE 49 54  54  ILE ILE A . n 
A 1 50 VAL 50 55  55  VAL VAL A . n 
A 1 51 LYS 51 56  56  LYS LYS A . n 
A 1 52 GLN 52 57  57  GLN GLN A . n 
A 1 53 GLY 53 58  58  GLY GLY A . n 
A 1 54 CYS 54 59  59  CYS CYS A . n 
A 1 55 TRP 55 60  60  TRP TRP A . n 
A 1 56 LEU 56 61  61  LEU LEU A . n 
A 1 57 ASP 57 62  62  ASP ASP A . n 
A 1 58 ASP 58 63  63  ASP ASP A . n 
A 1 59 ILE 59 64  64  ILE ILE A . n 
A 1 60 ASN 60 65  65  ASN ASN A . n 
A 1 61 CYS 61 66  66  CYS CYS A . n 
A 1 62 TYR 62 67  67  TYR TYR A . n 
A 1 63 ASP 63 68  68  ASP ASP A . n 
A 1 64 ARG 64 69  69  ARG ARG A . n 
A 1 65 THR 65 70  70  THR THR A . n 
A 1 66 ASP 66 71  71  ASP ASP A . n 
A 1 67 CYS 67 72  72  CYS CYS A . n 
A 1 68 ILE 68 73  73  ILE ILE A . n 
A 1 69 GLU 69 74  74  GLU GLU A . n 
A 1 70 LYS 70 75  75  LYS LYS A . n 
A 1 71 LYS 71 76  76  LYS LYS A . n 
A 1 72 ASP 72 77  77  ASP ASP A . n 
A 1 73 SER 73 78  78  SER SER A . n 
A 1 74 PRO 74 79  79  PRO PRO A . n 
A 1 75 GLU 75 80  80  GLU GLU A . n 
A 1 76 VAL 76 81  81  VAL VAL A . n 
A 1 77 TYR 77 82  82  TYR TYR A . n 
A 1 78 PHE 78 83  83  PHE PHE A . n 
A 1 79 CYS 79 84  84  CYS CYS A . n 
A 1 80 CYS 80 85  85  CYS CYS A . n 
A 1 81 CYS 81 86  86  CYS CYS A . n 
A 1 82 GLU 82 87  87  GLU GLU A . n 
A 1 83 GLY 83 88  88  GLY GLY A . n 
A 1 84 ASN 84 89  89  ASN ASN A . n 
A 1 85 MET 85 90  90  MET MET A . n 
A 1 86 CYS 86 91  91  CYS CYS A . n 
A 1 87 ASN 87 92  92  ASN ASN A . n 
A 1 88 GLU 88 93  93  GLU GLU A . n 
A 1 89 LYS 89 94  94  LYS LYS A . n 
A 1 90 PHE 90 95  95  PHE PHE A . n 
A 1 91 SER 91 96  96  SER SER A . n 
A 1 92 TYR 92 97  97  TYR TYR A . n 
A 1 93 PHE 93 98  98  PHE PHE A . n 
A 1 94 PRO 94 99  99  PRO PRO A . n 
A 1 95 GLU 95 100 100 GLU GLU A . n 
A 1 96 MET 96 101 101 MET MET A . n 
A 1 97 GLU 97 102 102 GLU GLU A . n 
B 1 1  SER 1  6   ?   ?   ?   B . n 
B 1 2  GLU 2  7   7   GLU GLU B . n 
B 1 3  THR 3  8   8   THR THR B . n 
B 1 4  GLN 4  9   9   GLN GLN B . n 
B 1 5  GLU 5  10  10  GLU GLU B . n 
B 1 6  CYS 6  11  11  CYS CYS B . n 
B 1 7  LEU 7  12  12  LEU LEU B . n 
B 1 8  PHE 8  13  13  PHE PHE B . n 
B 1 9  PHE 9  14  14  PHE PHE B . n 
B 1 10 ASN 10 15  15  ASN ASN B . n 
B 1 11 ALA 11 16  16  ALA ALA B . n 
B 1 12 ASN 12 17  17  ASN ASN B . n 
B 1 13 TRP 13 18  18  TRP TRP B . n 
B 1 14 GLU 14 19  19  GLU GLU B . n 
B 1 15 ARG 15 20  20  ARG ARG B . n 
B 1 16 ASP 16 21  21  ASP ASP B . n 
B 1 17 ARG 17 22  22  ARG ARG B . n 
B 1 18 THR 18 23  23  THR THR B . n 
B 1 19 ASN 19 24  24  ASN ASN B . n 
B 1 20 GLN 20 25  25  GLN GLN B . n 
B 1 21 THR 21 26  26  THR THR B . n 
B 1 22 GLY 22 27  27  GLY GLY B . n 
B 1 23 VAL 23 28  28  VAL VAL B . n 
B 1 24 GLU 24 29  29  GLU GLU B . n 
B 1 25 PRO 25 30  30  PRO PRO B . n 
B 1 26 CYS 26 31  31  CYS CYS B . n 
B 1 27 TYR 27 32  32  TYR TYR B . n 
B 1 28 GLY 28 33  33  GLY GLY B . n 
B 1 29 ASP 29 34  34  ASP ASP B . n 
B 1 30 LYS 30 35  35  LYS LYS B . n 
B 1 31 ASP 31 36  36  ASP ASP B . n 
B 1 32 LYS 32 37  37  LYS LYS B . n 
B 1 33 ARG 33 38  38  ARG ARG B . n 
B 1 34 ARG 34 39  39  ARG ARG B . n 
B 1 35 HIS 35 40  40  HIS HIS B . n 
B 1 36 CYS 36 41  41  CYS CYS B . n 
B 1 37 PHE 37 42  42  PHE PHE B . n 
B 1 38 ALA 38 43  43  ALA ALA B . n 
B 1 39 THR 39 44  44  THR THR B . n 
B 1 40 TRP 40 45  45  TRP TRP B . n 
B 1 41 LYS 41 46  46  LYS LYS B . n 
B 1 42 ASN 42 47  47  ASN ASN B . n 
B 1 43 ILE 43 48  48  ILE ILE B . n 
B 1 44 SER 44 49  49  SER SER B . n 
B 1 45 GLY 45 50  50  GLY GLY B . n 
B 1 46 SER 46 51  51  SER SER B . n 
B 1 47 ILE 47 52  52  ILE ILE B . n 
B 1 48 GLU 48 53  53  GLU GLU B . n 
B 1 49 ILE 49 54  54  ILE ILE B . n 
B 1 50 VAL 50 55  55  VAL VAL B . n 
B 1 51 LYS 51 56  56  LYS LYS B . n 
B 1 52 GLN 52 57  57  GLN GLN B . n 
B 1 53 GLY 53 58  58  GLY GLY B . n 
B 1 54 CYS 54 59  59  CYS CYS B . n 
B 1 55 TRP 55 60  60  TRP TRP B . n 
B 1 56 LEU 56 61  61  LEU LEU B . n 
B 1 57 ASP 57 62  62  ASP ASP B . n 
B 1 58 ASP 58 63  63  ASP ASP B . n 
B 1 59 ILE 59 64  64  ILE ILE B . n 
B 1 60 ASN 60 65  65  ASN ASN B . n 
B 1 61 CYS 61 66  66  CYS CYS B . n 
B 1 62 TYR 62 67  67  TYR TYR B . n 
B 1 63 ASP 63 68  68  ASP ASP B . n 
B 1 64 ARG 64 69  69  ARG ARG B . n 
B 1 65 THR 65 70  70  THR THR B . n 
B 1 66 ASP 66 71  71  ASP ASP B . n 
B 1 67 CYS 67 72  72  CYS CYS B . n 
B 1 68 ILE 68 73  73  ILE ILE B . n 
B 1 69 GLU 69 74  74  GLU GLU B . n 
B 1 70 LYS 70 75  75  LYS LYS B . n 
B 1 71 LYS 71 76  76  LYS LYS B . n 
B 1 72 ASP 72 77  77  ASP ASP B . n 
B 1 73 SER 73 78  78  SER SER B . n 
B 1 74 PRO 74 79  79  PRO PRO B . n 
B 1 75 GLU 75 80  80  GLU GLU B . n 
B 1 76 VAL 76 81  81  VAL VAL B . n 
B 1 77 TYR 77 82  82  TYR TYR B . n 
B 1 78 PHE 78 83  83  PHE PHE B . n 
B 1 79 CYS 79 84  84  CYS CYS B . n 
B 1 80 CYS 80 85  85  CYS CYS B . n 
B 1 81 CYS 81 86  86  CYS CYS B . n 
B 1 82 GLU 82 87  87  GLU GLU B . n 
B 1 83 GLY 83 88  88  GLY GLY B . n 
B 1 84 ASN 84 89  89  ASN ASN B . n 
B 1 85 MET 85 90  90  MET MET B . n 
B 1 86 CYS 86 91  91  CYS CYS B . n 
B 1 87 ASN 87 92  92  ASN ASN B . n 
B 1 88 GLU 88 93  93  GLU GLU B . n 
B 1 89 LYS 89 94  94  LYS LYS B . n 
B 1 90 PHE 90 95  95  PHE PHE B . n 
B 1 91 SER 91 96  96  SER SER B . n 
B 1 92 TYR 92 97  97  TYR TYR B . n 
B 1 93 PHE 93 98  98  PHE PHE B . n 
B 1 94 PRO 94 99  99  PRO PRO B . n 
B 1 95 GLU 95 100 100 GLU GLU B . n 
B 1 96 MET 96 101 ?   ?   ?   B . n 
B 1 97 GLU 97 102 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 19 A ASN 24 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 42 A ASN 47 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 19 B ASN 24 ? ASN 'GLYCOSYLATION SITE' 
4 B ASN 42 B ASN 47 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 156 ? G HOH . 
2 1 B HOH 168 ? H HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-02-09 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM   'data reduction' .         ? 1 
SCALA    'data scaling'   .         ? 2 
MLPHARE  phasing          .         ? 3 
ARP      'model building' .         ? 4 
DM       'model building' .         ? 5 
REFMAC   refinement       .         ? 6 
CCP4     'data scaling'   '(SCALA)' ? 7 
ARP/wARP 'model building' .         ? 8 
DM       phasing          .         ? 9 
# 
_pdbx_entry_details.entry_id             1BTE 
_pdbx_entry_details.compound_details     
;GLYCOSYLATION FROM HOST EXPRESSION SYSTEM WAS REMOVED USING
 ENDOGLYCOSIDASE H, LEAVING BEHIND THE N-ACETYL GLUCOSAMINE
 (NAG) RESIDUES ON THE ASN.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;O6 OF NAG A 124 AND NAG B 124 IS MODELED
IN TWO ALTERNATIVE CONFORMATIONS.
;
_pdbx_entry_details.sequence_details     
;THE NUMBERING OF RESIDUES IN THE PDB FILE IS
BASED ON THE SEQUENCE WITHOUT THE SIGNAL
PEPTIDE.

THE MOLECULE IN THE CRYSTAL IS LACKING THE
14 C-TERMINAL RESIDUES WHICH HAVE BEEN
REMOVED BY TREATMENT WITH ENDOPROTEINASE GLUC,
MAKING GLU 102, THE NEW C-TERMINUS
;
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A HOH 154 ? ? 1_555 O A HOH 154 ? ? 2_665 0.44 
2 1 O   B HOH 149 ? ? 1_555 O B HOH 149 ? ? 2_555 0.59 
3 1 O   A HOH 214 ? ? 1_555 O B HOH 222 ? ? 2_555 2.09 
4 1 OE2 B GLU 93  ? ? 1_555 O B HOH 149 ? ? 2_555 2.10 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 32 ? ? -124.25 -117.21 
2 1 ASN B 17 ? ? -98.59  31.05   
3 1 SER B 78 ? ? 31.61   66.20   
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             ASP 
_pdbx_validate_main_chain_plane.auth_asym_id             B 
_pdbx_validate_main_chain_plane.auth_seq_id              68 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   10.91 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 38  ? CG  ? A ARG 33 CG  
2  1 Y 1 A ARG 38  ? CD  ? A ARG 33 CD  
3  1 Y 1 A ARG 38  ? NE  ? A ARG 33 NE  
4  1 Y 1 A ARG 38  ? CZ  ? A ARG 33 CZ  
5  1 Y 1 A ARG 38  ? NH1 ? A ARG 33 NH1 
6  1 Y 1 A ARG 38  ? NH2 ? A ARG 33 NH2 
7  1 Y 1 A LEU 61  ? CG  ? A LEU 56 CG  
8  1 Y 1 A LEU 61  ? CD1 ? A LEU 56 CD1 
9  1 Y 1 A LEU 61  ? CD2 ? A LEU 56 CD2 
10 1 Y 1 A ASP 63  ? CG  ? A ASP 58 CG  
11 1 Y 1 A ASP 63  ? OD1 ? A ASP 58 OD1 
12 1 Y 1 A ASP 63  ? OD2 ? A ASP 58 OD2 
13 1 Y 1 A ARG 69  ? CG  ? A ARG 64 CG  
14 1 Y 1 A ARG 69  ? CD  ? A ARG 64 CD  
15 1 Y 1 A ARG 69  ? NE  ? A ARG 64 NE  
16 1 Y 1 A ARG 69  ? CZ  ? A ARG 64 CZ  
17 1 Y 1 A ARG 69  ? NH1 ? A ARG 64 NH1 
18 1 Y 1 A ARG 69  ? NH2 ? A ARG 64 NH2 
19 1 Y 1 A THR 70  ? OG1 ? A THR 65 OG1 
20 1 Y 1 A THR 70  ? CG2 ? A THR 65 CG2 
21 1 Y 1 A GLU 102 ? O   ? A GLU 97 O   
22 1 Y 1 B GLU 7   ? CG  ? B GLU 2  CG  
23 1 Y 1 B GLU 7   ? CD  ? B GLU 2  CD  
24 1 Y 1 B GLU 7   ? OE1 ? B GLU 2  OE1 
25 1 Y 1 B GLU 7   ? OE2 ? B GLU 2  OE2 
26 1 Y 1 B LYS 35  ? CG  ? B LYS 30 CG  
27 1 Y 1 B LYS 35  ? CD  ? B LYS 30 CD  
28 1 Y 1 B LYS 35  ? CE  ? B LYS 30 CE  
29 1 Y 1 B LYS 35  ? NZ  ? B LYS 30 NZ  
30 1 Y 1 B ARG 38  ? CG  ? B ARG 33 CG  
31 1 Y 1 B ARG 38  ? CD  ? B ARG 33 CD  
32 1 Y 1 B ARG 38  ? NE  ? B ARG 33 NE  
33 1 Y 1 B ARG 38  ? CZ  ? B ARG 33 CZ  
34 1 Y 1 B ARG 38  ? NH1 ? B ARG 33 NH1 
35 1 Y 1 B ARG 38  ? NH2 ? B ARG 33 NH2 
36 1 Y 1 B ASP 63  ? CG  ? B ASP 58 CG  
37 1 Y 1 B ASP 63  ? OD1 ? B ASP 58 OD1 
38 1 Y 1 B ASP 63  ? OD2 ? B ASP 58 OD2 
39 1 Y 1 B ARG 69  ? CG  ? B ARG 64 CG  
40 1 Y 1 B ARG 69  ? CD  ? B ARG 64 CD  
41 1 Y 1 B ARG 69  ? NE  ? B ARG 64 NE  
42 1 Y 1 B ARG 69  ? CZ  ? B ARG 64 CZ  
43 1 Y 1 B ARG 69  ? NH1 ? B ARG 64 NH1 
44 1 Y 1 B ARG 69  ? NH2 ? B ARG 64 NH2 
45 1 Y 1 B GLU 80  ? CG  ? B GLU 75 CG  
46 1 Y 1 B GLU 80  ? CD  ? B GLU 75 CD  
47 1 Y 1 B GLU 80  ? OE1 ? B GLU 75 OE1 
48 1 Y 1 B GLU 80  ? OE2 ? B GLU 75 OE2 
49 1 Y 1 B GLU 100 ? CG  ? B GLU 95 CG  
50 1 Y 1 B GLU 100 ? CD  ? B GLU 95 CD  
51 1 Y 1 B GLU 100 ? OE1 ? B GLU 95 OE1 
52 1 Y 1 B GLU 100 ? OE2 ? B GLU 95 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 6   ? A SER 1  
2 1 Y 1 A ASP 34  ? A ASP 29 
3 1 Y 1 A LYS 35  ? A LYS 30 
4 1 Y 1 A ASP 36  ? A ASP 31 
5 1 Y 1 A LYS 37  ? A LYS 32 
6 1 Y 1 B SER 6   ? B SER 1  
7 1 Y 1 B MET 101 ? B MET 96 
8 1 Y 1 B GLU 102 ? B GLU 97 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-ACETYL-D-GLUCOSAMINE NAG 
3 water                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1   124 124 NAG NAG A . 
D 2 NAG 1   147 147 NAG NAG A . 
E 2 NAG 1   124 124 NAG NAG B . 
F 2 NAG 1   147 147 NAG NAG B . 
G 3 HOH 1   148 2   HOH HOH A . 
G 3 HOH 2   149 3   HOH HOH A . 
G 3 HOH 3   150 4   HOH HOH A . 
G 3 HOH 4   151 5   HOH HOH A . 
G 3 HOH 5   152 9   HOH HOH A . 
G 3 HOH 6   153 11  HOH HOH A . 
G 3 HOH 7   154 12  HOH HOH A . 
G 3 HOH 8   155 14  HOH HOH A . 
G 3 HOH 9   156 15  HOH HOH A . 
G 3 HOH 10  157 16  HOH HOH A . 
G 3 HOH 11  158 17  HOH HOH A . 
G 3 HOH 12  159 20  HOH HOH A . 
G 3 HOH 13  160 21  HOH HOH A . 
G 3 HOH 14  161 23  HOH HOH A . 
G 3 HOH 15  162 24  HOH HOH A . 
G 3 HOH 16  163 26  HOH HOH A . 
G 3 HOH 17  164 27  HOH HOH A . 
G 3 HOH 18  165 28  HOH HOH A . 
G 3 HOH 19  166 33  HOH HOH A . 
G 3 HOH 20  167 34  HOH HOH A . 
G 3 HOH 21  168 35  HOH HOH A . 
G 3 HOH 22  169 38  HOH HOH A . 
G 3 HOH 23  170 40  HOH HOH A . 
G 3 HOH 24  171 42  HOH HOH A . 
G 3 HOH 25  172 43  HOH HOH A . 
G 3 HOH 26  173 44  HOH HOH A . 
G 3 HOH 27  174 46  HOH HOH A . 
G 3 HOH 28  175 47  HOH HOH A . 
G 3 HOH 29  176 50  HOH HOH A . 
G 3 HOH 30  177 54  HOH HOH A . 
G 3 HOH 31  178 55  HOH HOH A . 
G 3 HOH 32  179 56  HOH HOH A . 
G 3 HOH 33  180 59  HOH HOH A . 
G 3 HOH 34  181 62  HOH HOH A . 
G 3 HOH 35  182 63  HOH HOH A . 
G 3 HOH 36  183 64  HOH HOH A . 
G 3 HOH 37  184 66  HOH HOH A . 
G 3 HOH 38  185 67  HOH HOH A . 
G 3 HOH 39  186 70  HOH HOH A . 
G 3 HOH 40  187 71  HOH HOH A . 
G 3 HOH 41  188 73  HOH HOH A . 
G 3 HOH 42  189 74  HOH HOH A . 
G 3 HOH 43  190 75  HOH HOH A . 
G 3 HOH 44  191 76  HOH HOH A . 
G 3 HOH 45  192 79  HOH HOH A . 
G 3 HOH 46  193 80  HOH HOH A . 
G 3 HOH 47  194 81  HOH HOH A . 
G 3 HOH 48  195 82  HOH HOH A . 
G 3 HOH 49  196 83  HOH HOH A . 
G 3 HOH 50  197 84  HOH HOH A . 
G 3 HOH 51  198 86  HOH HOH A . 
G 3 HOH 52  199 87  HOH HOH A . 
G 3 HOH 53  200 88  HOH HOH A . 
G 3 HOH 54  201 89  HOH HOH A . 
G 3 HOH 55  202 90  HOH HOH A . 
G 3 HOH 56  203 91  HOH HOH A . 
G 3 HOH 57  204 93  HOH HOH A . 
G 3 HOH 58  205 95  HOH HOH A . 
G 3 HOH 59  206 96  HOH HOH A . 
G 3 HOH 60  207 99  HOH HOH A . 
G 3 HOH 61  208 101 HOH HOH A . 
G 3 HOH 62  209 104 HOH HOH A . 
G 3 HOH 63  210 107 HOH HOH A . 
G 3 HOH 64  211 111 HOH HOH A . 
G 3 HOH 65  212 112 HOH HOH A . 
G 3 HOH 66  213 113 HOH HOH A . 
G 3 HOH 67  214 114 HOH HOH A . 
G 3 HOH 68  215 116 HOH HOH A . 
G 3 HOH 69  216 117 HOH HOH A . 
G 3 HOH 70  217 118 HOH HOH A . 
G 3 HOH 71  218 121 HOH HOH A . 
G 3 HOH 72  219 123 HOH HOH A . 
G 3 HOH 73  220 124 HOH HOH A . 
G 3 HOH 74  221 125 HOH HOH A . 
G 3 HOH 75  222 126 HOH HOH A . 
G 3 HOH 76  223 127 HOH HOH A . 
G 3 HOH 77  224 129 HOH HOH A . 
G 3 HOH 78  225 131 HOH HOH A . 
G 3 HOH 79  226 132 HOH HOH A . 
G 3 HOH 80  227 134 HOH HOH A . 
G 3 HOH 81  228 139 HOH HOH A . 
G 3 HOH 82  229 141 HOH HOH A . 
G 3 HOH 83  230 142 HOH HOH A . 
G 3 HOH 84  231 143 HOH HOH A . 
G 3 HOH 85  232 145 HOH HOH A . 
G 3 HOH 86  233 147 HOH HOH A . 
G 3 HOH 87  234 148 HOH HOH A . 
G 3 HOH 88  235 151 HOH HOH A . 
G 3 HOH 89  236 153 HOH HOH A . 
G 3 HOH 90  237 154 HOH HOH A . 
G 3 HOH 91  238 155 HOH HOH A . 
G 3 HOH 92  239 156 HOH HOH A . 
G 3 HOH 93  240 157 HOH HOH A . 
G 3 HOH 94  241 158 HOH HOH A . 
G 3 HOH 95  242 161 HOH HOH A . 
G 3 HOH 96  243 162 HOH HOH A . 
G 3 HOH 97  244 163 HOH HOH A . 
G 3 HOH 98  245 164 HOH HOH A . 
G 3 HOH 99  246 167 HOH HOH A . 
G 3 HOH 100 247 168 HOH HOH A . 
G 3 HOH 101 248 171 HOH HOH A . 
G 3 HOH 102 249 173 HOH HOH A . 
G 3 HOH 103 250 174 HOH HOH A . 
G 3 HOH 104 251 175 HOH HOH A . 
G 3 HOH 105 252 176 HOH HOH A . 
G 3 HOH 106 253 177 HOH HOH A . 
G 3 HOH 107 254 178 HOH HOH A . 
G 3 HOH 108 255 180 HOH HOH A . 
G 3 HOH 109 256 181 HOH HOH A . 
G 3 HOH 110 257 182 HOH HOH A . 
G 3 HOH 111 258 184 HOH HOH A . 
G 3 HOH 112 259 186 HOH HOH A . 
G 3 HOH 113 260 189 HOH HOH A . 
G 3 HOH 114 261 190 HOH HOH A . 
G 3 HOH 115 262 196 HOH HOH A . 
G 3 HOH 116 263 197 HOH HOH A . 
H 3 HOH 1   148 1   HOH HOH B . 
H 3 HOH 2   149 6   HOH HOH B . 
H 3 HOH 3   150 7   HOH HOH B . 
H 3 HOH 4   151 8   HOH HOH B . 
H 3 HOH 5   152 10  HOH HOH B . 
H 3 HOH 6   153 13  HOH HOH B . 
H 3 HOH 7   154 18  HOH HOH B . 
H 3 HOH 8   155 19  HOH HOH B . 
H 3 HOH 9   156 22  HOH HOH B . 
H 3 HOH 10  157 25  HOH HOH B . 
H 3 HOH 11  158 29  HOH HOH B . 
H 3 HOH 12  159 30  HOH HOH B . 
H 3 HOH 13  160 31  HOH HOH B . 
H 3 HOH 14  161 32  HOH HOH B . 
H 3 HOH 15  162 36  HOH HOH B . 
H 3 HOH 16  163 37  HOH HOH B . 
H 3 HOH 17  164 39  HOH HOH B . 
H 3 HOH 18  165 41  HOH HOH B . 
H 3 HOH 19  166 45  HOH HOH B . 
H 3 HOH 20  167 48  HOH HOH B . 
H 3 HOH 21  168 49  HOH HOH B . 
H 3 HOH 22  169 51  HOH HOH B . 
H 3 HOH 23  170 52  HOH HOH B . 
H 3 HOH 24  171 53  HOH HOH B . 
H 3 HOH 25  172 57  HOH HOH B . 
H 3 HOH 26  173 58  HOH HOH B . 
H 3 HOH 27  174 60  HOH HOH B . 
H 3 HOH 28  175 61  HOH HOH B . 
H 3 HOH 29  176 65  HOH HOH B . 
H 3 HOH 30  177 68  HOH HOH B . 
H 3 HOH 31  178 69  HOH HOH B . 
H 3 HOH 32  179 72  HOH HOH B . 
H 3 HOH 33  180 77  HOH HOH B . 
H 3 HOH 34  181 78  HOH HOH B . 
H 3 HOH 35  182 85  HOH HOH B . 
H 3 HOH 36  183 92  HOH HOH B . 
H 3 HOH 37  184 94  HOH HOH B . 
H 3 HOH 38  185 97  HOH HOH B . 
H 3 HOH 39  186 98  HOH HOH B . 
H 3 HOH 40  187 100 HOH HOH B . 
H 3 HOH 41  188 102 HOH HOH B . 
H 3 HOH 42  189 103 HOH HOH B . 
H 3 HOH 43  190 105 HOH HOH B . 
H 3 HOH 44  191 106 HOH HOH B . 
H 3 HOH 45  192 108 HOH HOH B . 
H 3 HOH 46  193 109 HOH HOH B . 
H 3 HOH 47  194 110 HOH HOH B . 
H 3 HOH 48  195 115 HOH HOH B . 
H 3 HOH 49  196 119 HOH HOH B . 
H 3 HOH 50  197 120 HOH HOH B . 
H 3 HOH 51  198 122 HOH HOH B . 
H 3 HOH 52  199 128 HOH HOH B . 
H 3 HOH 53  200 130 HOH HOH B . 
H 3 HOH 54  201 133 HOH HOH B . 
H 3 HOH 55  202 135 HOH HOH B . 
H 3 HOH 56  203 136 HOH HOH B . 
H 3 HOH 57  204 137 HOH HOH B . 
H 3 HOH 58  205 138 HOH HOH B . 
H 3 HOH 59  206 140 HOH HOH B . 
H 3 HOH 60  207 144 HOH HOH B . 
H 3 HOH 61  208 146 HOH HOH B . 
H 3 HOH 62  209 149 HOH HOH B . 
H 3 HOH 63  210 150 HOH HOH B . 
H 3 HOH 64  211 152 HOH HOH B . 
H 3 HOH 65  212 159 HOH HOH B . 
H 3 HOH 66  213 160 HOH HOH B . 
H 3 HOH 67  214 165 HOH HOH B . 
H 3 HOH 68  215 166 HOH HOH B . 
H 3 HOH 69  216 169 HOH HOH B . 
H 3 HOH 70  217 170 HOH HOH B . 
H 3 HOH 71  218 172 HOH HOH B . 
H 3 HOH 72  219 179 HOH HOH B . 
H 3 HOH 73  220 183 HOH HOH B . 
H 3 HOH 74  221 185 HOH HOH B . 
H 3 HOH 75  222 187 HOH HOH B . 
H 3 HOH 76  223 188 HOH HOH B . 
H 3 HOH 77  224 191 HOH HOH B . 
H 3 HOH 78  225 192 HOH HOH B . 
H 3 HOH 79  226 193 HOH HOH B . 
H 3 HOH 80  227 194 HOH HOH B . 
H 3 HOH 81  228 195 HOH HOH B . 
H 3 HOH 82  229 198 HOH HOH B . 
H 3 HOH 83  230 199 HOH HOH B . 
H 3 HOH 84  231 200 HOH HOH B . 
H 3 HOH 85  232 201 HOH HOH B . 
H 3 HOH 86  233 202 HOH HOH B . 
#