data_1BU8
# 
_entry.id   1BU8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BU8         
RCSB  RCSB008317   
WWPDB D_1000008317 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BU8 
_pdbx_database_status.recvd_initial_deposition_date   1998-09-14 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Roussel, A.'   1 
'Cambillau, C.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structure and activity of rat pancreatic lipase-related protein 2.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            273 
_citation.page_first                32121 
_citation.page_last                 32128 
_citation.year                      1998 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9822688 
_citation.pdbx_database_id_DOI      10.1074/jbc.273.48.32121 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Roussel, A.'   1 ? 
primary 'Yang, Y.'      2 ? 
primary 'Ferrato, F.'   3 ? 
primary 'Verger, R.'    4 ? 
primary 'Cambillau, C.' 5 ? 
primary 'Lowe, M.'      6 ? 
# 
_cell.entry_id           1BU8 
_cell.length_a           57.393 
_cell.length_b           79.133 
_cell.length_c           60.940 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.07 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BU8 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (PANCREATIC LIPASE RELATED PROTEIN 2)' 50920.418 1   3.1.1.3 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose        221.208   1   ?       ? ? ? 
3 water       nat water                                           18.015    295 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KEVCYGHLGCFSNDKPWAGMLQRPLKIFPWSPEDIDTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFI
DKGEDGWLLDMCKKMFQVEKVNCICVDWRRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVV
GEAGRRLEGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGGKEMPGCQ
KNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSILNPDGFLGYPCSSYEKFQQNDCFPCPEEGCPKMGHYADQFEGKT
ATVEQTVYLNTGDSGNFTRWRYKVSVTLSGAKKLSGYILVALYGNNGNSKQYEIFKGSLKPEARHVRDIDVDINVGEIQK
VKFLWNNKVINLFRPTLGASQITVQSGVDGKEYNFCSSDTVREDVLQSLYPC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KEVCYGHLGCFSNDKPWAGMLQRPLKIFPWSPEDIDTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFI
DKGEDGWLLDMCKKMFQVEKVNCICVDWRRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVV
GEAGRRLEGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGGKEMPGCQ
KNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSILNPDGFLGYPCSSYEKFQQNDCFPCPEEGCPKMGHYADQFEGKT
ATVEQTVYLNTGDSGNFTRWRYKVSVTLSGAKKLSGYILVALYGNNGNSKQYEIFKGSLKPEARHVRDIDVDINVGEIQK
VKFLWNNKVINLFRPTLGASQITVQSGVDGKEYNFCSSDTVREDVLQSLYPC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   GLU n 
1 3   VAL n 
1 4   CYS n 
1 5   TYR n 
1 6   GLY n 
1 7   HIS n 
1 8   LEU n 
1 9   GLY n 
1 10  CYS n 
1 11  PHE n 
1 12  SER n 
1 13  ASN n 
1 14  ASP n 
1 15  LYS n 
1 16  PRO n 
1 17  TRP n 
1 18  ALA n 
1 19  GLY n 
1 20  MET n 
1 21  LEU n 
1 22  GLN n 
1 23  ARG n 
1 24  PRO n 
1 25  LEU n 
1 26  LYS n 
1 27  ILE n 
1 28  PHE n 
1 29  PRO n 
1 30  TRP n 
1 31  SER n 
1 32  PRO n 
1 33  GLU n 
1 34  ASP n 
1 35  ILE n 
1 36  ASP n 
1 37  THR n 
1 38  ARG n 
1 39  PHE n 
1 40  LEU n 
1 41  LEU n 
1 42  TYR n 
1 43  THR n 
1 44  ASN n 
1 45  GLU n 
1 46  ASN n 
1 47  PRO n 
1 48  ASN n 
1 49  ASN n 
1 50  TYR n 
1 51  GLN n 
1 52  LYS n 
1 53  ILE n 
1 54  SER n 
1 55  ALA n 
1 56  THR n 
1 57  GLU n 
1 58  PRO n 
1 59  ASP n 
1 60  THR n 
1 61  ILE n 
1 62  LYS n 
1 63  PHE n 
1 64  SER n 
1 65  ASN n 
1 66  PHE n 
1 67  GLN n 
1 68  LEU n 
1 69  ASP n 
1 70  ARG n 
1 71  LYS n 
1 72  THR n 
1 73  ARG n 
1 74  PHE n 
1 75  ILE n 
1 76  VAL n 
1 77  HIS n 
1 78  GLY n 
1 79  PHE n 
1 80  ILE n 
1 81  ASP n 
1 82  LYS n 
1 83  GLY n 
1 84  GLU n 
1 85  ASP n 
1 86  GLY n 
1 87  TRP n 
1 88  LEU n 
1 89  LEU n 
1 90  ASP n 
1 91  MET n 
1 92  CYS n 
1 93  LYS n 
1 94  LYS n 
1 95  MET n 
1 96  PHE n 
1 97  GLN n 
1 98  VAL n 
1 99  GLU n 
1 100 LYS n 
1 101 VAL n 
1 102 ASN n 
1 103 CYS n 
1 104 ILE n 
1 105 CYS n 
1 106 VAL n 
1 107 ASP n 
1 108 TRP n 
1 109 ARG n 
1 110 ARG n 
1 111 GLY n 
1 112 SER n 
1 113 ARG n 
1 114 THR n 
1 115 GLU n 
1 116 TYR n 
1 117 THR n 
1 118 GLN n 
1 119 ALA n 
1 120 SER n 
1 121 TYR n 
1 122 ASN n 
1 123 THR n 
1 124 ARG n 
1 125 VAL n 
1 126 VAL n 
1 127 GLY n 
1 128 ALA n 
1 129 GLU n 
1 130 ILE n 
1 131 ALA n 
1 132 PHE n 
1 133 LEU n 
1 134 VAL n 
1 135 GLN n 
1 136 VAL n 
1 137 LEU n 
1 138 SER n 
1 139 THR n 
1 140 GLU n 
1 141 MET n 
1 142 GLY n 
1 143 TYR n 
1 144 SER n 
1 145 PRO n 
1 146 GLU n 
1 147 ASN n 
1 148 VAL n 
1 149 HIS n 
1 150 LEU n 
1 151 ILE n 
1 152 GLY n 
1 153 HIS n 
1 154 SER n 
1 155 LEU n 
1 156 GLY n 
1 157 ALA n 
1 158 HIS n 
1 159 VAL n 
1 160 VAL n 
1 161 GLY n 
1 162 GLU n 
1 163 ALA n 
1 164 GLY n 
1 165 ARG n 
1 166 ARG n 
1 167 LEU n 
1 168 GLU n 
1 169 GLY n 
1 170 HIS n 
1 171 VAL n 
1 172 GLY n 
1 173 ARG n 
1 174 ILE n 
1 175 THR n 
1 176 GLY n 
1 177 LEU n 
1 178 ASP n 
1 179 PRO n 
1 180 ALA n 
1 181 GLU n 
1 182 PRO n 
1 183 CYS n 
1 184 PHE n 
1 185 GLN n 
1 186 GLY n 
1 187 LEU n 
1 188 PRO n 
1 189 GLU n 
1 190 GLU n 
1 191 VAL n 
1 192 ARG n 
1 193 LEU n 
1 194 ASP n 
1 195 PRO n 
1 196 SER n 
1 197 ASP n 
1 198 ALA n 
1 199 MET n 
1 200 PHE n 
1 201 VAL n 
1 202 ASP n 
1 203 VAL n 
1 204 ILE n 
1 205 HIS n 
1 206 THR n 
1 207 ASP n 
1 208 SER n 
1 209 ALA n 
1 210 PRO n 
1 211 ILE n 
1 212 ILE n 
1 213 PRO n 
1 214 TYR n 
1 215 LEU n 
1 216 GLY n 
1 217 PHE n 
1 218 GLY n 
1 219 MET n 
1 220 SER n 
1 221 GLN n 
1 222 LYS n 
1 223 VAL n 
1 224 GLY n 
1 225 HIS n 
1 226 LEU n 
1 227 ASP n 
1 228 PHE n 
1 229 PHE n 
1 230 PRO n 
1 231 ASN n 
1 232 GLY n 
1 233 GLY n 
1 234 LYS n 
1 235 GLU n 
1 236 MET n 
1 237 PRO n 
1 238 GLY n 
1 239 CYS n 
1 240 GLN n 
1 241 LYS n 
1 242 ASN n 
1 243 ILE n 
1 244 LEU n 
1 245 SER n 
1 246 THR n 
1 247 ILE n 
1 248 VAL n 
1 249 ASP n 
1 250 ILE n 
1 251 ASN n 
1 252 GLY n 
1 253 ILE n 
1 254 TRP n 
1 255 GLU n 
1 256 GLY n 
1 257 THR n 
1 258 GLN n 
1 259 ASN n 
1 260 PHE n 
1 261 VAL n 
1 262 ALA n 
1 263 CYS n 
1 264 ASN n 
1 265 HIS n 
1 266 LEU n 
1 267 ARG n 
1 268 SER n 
1 269 TYR n 
1 270 LYS n 
1 271 TYR n 
1 272 TYR n 
1 273 ALA n 
1 274 SER n 
1 275 SER n 
1 276 ILE n 
1 277 LEU n 
1 278 ASN n 
1 279 PRO n 
1 280 ASP n 
1 281 GLY n 
1 282 PHE n 
1 283 LEU n 
1 284 GLY n 
1 285 TYR n 
1 286 PRO n 
1 287 CYS n 
1 288 SER n 
1 289 SER n 
1 290 TYR n 
1 291 GLU n 
1 292 LYS n 
1 293 PHE n 
1 294 GLN n 
1 295 GLN n 
1 296 ASN n 
1 297 ASP n 
1 298 CYS n 
1 299 PHE n 
1 300 PRO n 
1 301 CYS n 
1 302 PRO n 
1 303 GLU n 
1 304 GLU n 
1 305 GLY n 
1 306 CYS n 
1 307 PRO n 
1 308 LYS n 
1 309 MET n 
1 310 GLY n 
1 311 HIS n 
1 312 TYR n 
1 313 ALA n 
1 314 ASP n 
1 315 GLN n 
1 316 PHE n 
1 317 GLU n 
1 318 GLY n 
1 319 LYS n 
1 320 THR n 
1 321 ALA n 
1 322 THR n 
1 323 VAL n 
1 324 GLU n 
1 325 GLN n 
1 326 THR n 
1 327 VAL n 
1 328 TYR n 
1 329 LEU n 
1 330 ASN n 
1 331 THR n 
1 332 GLY n 
1 333 ASP n 
1 334 SER n 
1 335 GLY n 
1 336 ASN n 
1 337 PHE n 
1 338 THR n 
1 339 ARG n 
1 340 TRP n 
1 341 ARG n 
1 342 TYR n 
1 343 LYS n 
1 344 VAL n 
1 345 SER n 
1 346 VAL n 
1 347 THR n 
1 348 LEU n 
1 349 SER n 
1 350 GLY n 
1 351 ALA n 
1 352 LYS n 
1 353 LYS n 
1 354 LEU n 
1 355 SER n 
1 356 GLY n 
1 357 TYR n 
1 358 ILE n 
1 359 LEU n 
1 360 VAL n 
1 361 ALA n 
1 362 LEU n 
1 363 TYR n 
1 364 GLY n 
1 365 ASN n 
1 366 ASN n 
1 367 GLY n 
1 368 ASN n 
1 369 SER n 
1 370 LYS n 
1 371 GLN n 
1 372 TYR n 
1 373 GLU n 
1 374 ILE n 
1 375 PHE n 
1 376 LYS n 
1 377 GLY n 
1 378 SER n 
1 379 LEU n 
1 380 LYS n 
1 381 PRO n 
1 382 GLU n 
1 383 ALA n 
1 384 ARG n 
1 385 HIS n 
1 386 VAL n 
1 387 ARG n 
1 388 ASP n 
1 389 ILE n 
1 390 ASP n 
1 391 VAL n 
1 392 ASP n 
1 393 ILE n 
1 394 ASN n 
1 395 VAL n 
1 396 GLY n 
1 397 GLU n 
1 398 ILE n 
1 399 GLN n 
1 400 LYS n 
1 401 VAL n 
1 402 LYS n 
1 403 PHE n 
1 404 LEU n 
1 405 TRP n 
1 406 ASN n 
1 407 ASN n 
1 408 LYS n 
1 409 VAL n 
1 410 ILE n 
1 411 ASN n 
1 412 LEU n 
1 413 PHE n 
1 414 ARG n 
1 415 PRO n 
1 416 THR n 
1 417 LEU n 
1 418 GLY n 
1 419 ALA n 
1 420 SER n 
1 421 GLN n 
1 422 ILE n 
1 423 THR n 
1 424 VAL n 
1 425 GLN n 
1 426 SER n 
1 427 GLY n 
1 428 VAL n 
1 429 ASP n 
1 430 GLY n 
1 431 LYS n 
1 432 GLU n 
1 433 TYR n 
1 434 ASN n 
1 435 PHE n 
1 436 CYS n 
1 437 SER n 
1 438 SER n 
1 439 ASP n 
1 440 THR n 
1 441 VAL n 
1 442 ARG n 
1 443 GLU n 
1 444 ASP n 
1 445 VAL n 
1 446 LEU n 
1 447 GLN n 
1 448 SER n 
1 449 LEU n 
1 450 TYR n 
1 451 PRO n 
1 452 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                PANCREAS 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               BACULOVIRUS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LIP2_RAT 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P54318 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1BU8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 452 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P54318 
_struct_ref_seq.db_align_beg                  17 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  468 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       449 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1BU8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.66 
_exptl_crystal.density_percent_sol   54.0 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.4 
_exptl_crystal_grow.pdbx_details    'PROTEIN WAS CRYSTALLIZED FROM 8% PEG 8000 WITH 0.1 M TRIS/HCL PH 8.4' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-09-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'LURE MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'LURE BEAMLINE DW32' 
_diffrn_source.pdbx_synchrotron_site       LURE 
_diffrn_source.pdbx_synchrotron_beamline   DW32 
_diffrn_source.pdbx_wavelength             0.97 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BU8 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             10.0 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   47899 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_Rsym_value              0.063 
_reflns.pdbx_netI_over_sigmaI        9.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.4 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.83 
_reflns_shell.percent_possible_all   81.9 
_reflns_shell.Rmerge_I_obs           0.42 
_reflns_shell.pdbx_Rsym_value        0.42 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        2.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1BU8 
_refine.ls_number_reflns_obs                     36060 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               750 
_refine.pdbx_data_cutoff_low_absF                50 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    97.3 
_refine.ls_R_factor_obs                          0.202 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.202 
_refine.ls_R_factor_R_free                       0.244 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5. 
_refine.ls_number_reflns_R_free                  1626 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               20.78 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1THG' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3518 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             295 
_refine_hist.number_atoms_total               3827 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.5  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.83 
_refine_ls_shell.number_reflns_R_work             792 
_refine_ls_shell.R_factor_R_work                  0.1774 
_refine_ls_shell.percent_reflns_obs               81.9 
_refine_ls_shell.R_factor_R_free                  0.2763 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5. 
_refine_ls_shell.number_reflns_R_free             42 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO   TOPH19X.PRO  'X-RAY DIFFRACTION' 
2 PARHCSDX.PRO   TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
3 PARAM3_MOD.CHO TOPH3.CHO    'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1BU8 
_struct.title                     'RAT PANCREATIC LIPASE RELATED PROTEIN 2' 
_struct.pdbx_descriptor           'PANCREATIC LIPASE RELATED PROTEIN 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BU8 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, LIPID DEGRADATION, PANCREATIC LIPASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 6   ? LEU A 8   ? GLY A 6   LEU A 8   5 ? 3  
HELX_P HELX_P2  2  PRO A 32  ? ILE A 35  ? PRO A 31  ILE A 34  1 ? 4  
HELX_P HELX_P3  3  PRO A 58  ? LYS A 62  ? PRO A 56  LYS A 60  5 ? 5  
HELX_P HELX_P4  4  ASP A 85  ? GLN A 97  ? ASP A 83  GLN A 95  5 ? 13 
HELX_P HELX_P5  5  ARG A 109 ? SER A 112 ? ARG A 107 SER A 110 1 ? 4  
HELX_P HELX_P6  6  TYR A 116 ? MET A 141 ? TYR A 114 MET A 139 1 ? 26 
HELX_P HELX_P7  7  PRO A 145 ? ASN A 147 ? PRO A 143 ASN A 145 5 ? 3  
HELX_P HELX_P8  8  SER A 154 ? ARG A 166 ? SER A 152 ARG A 164 5 ? 13 
HELX_P HELX_P9  9  GLU A 189 ? VAL A 191 ? GLU A 187 VAL A 189 5 ? 3  
HELX_P HELX_P10 10 PRO A 195 ? ASP A 197 ? PRO A 193 ASP A 195 5 ? 3  
HELX_P HELX_P11 11 ILE A 211 ? TYR A 214 ? ILE A 209 TYR A 212 1 ? 4  
HELX_P HELX_P12 12 PRO A 230 ? GLY A 232 ? PRO A 228 GLY A 230 5 ? 3  
HELX_P HELX_P13 13 ILE A 250 ? TRP A 254 ? ILE A 248 TRP A 252 1 ? 5  
HELX_P HELX_P14 14 CYS A 263 ? LEU A 277 ? CYS A 261 LEU A 275 1 ? 15 
HELX_P HELX_P15 15 PRO A 279 ? GLY A 281 ? PRO A 277 GLY A 279 5 ? 3  
HELX_P HELX_P16 16 TYR A 290 ? GLN A 295 ? TYR A 288 GLN A 293 1 ? 6  
HELX_P HELX_P17 17 HIS A 311 ? GLN A 315 ? HIS A 309 GLN A 313 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 4   SG  ? ? ? 1_555 A CYS 10  SG ? ? A CYS 4   A CYS 10  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf2 disulf ?   ? A CYS 92  SG  ? ? ? 1_555 A CYS 103 SG ? ? A CYS 90  A CYS 101 1_555 ? ? ? ? ? ? ? 2.021 ? ?               
disulf3 disulf ?   ? A CYS 239 SG  ? ? ? 1_555 A CYS 263 SG ? ? A CYS 237 A CYS 261 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf4 disulf ?   ? A CYS 287 SG  ? ? ? 1_555 A CYS 298 SG ? ? A CYS 285 A CYS 296 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf5 disulf ?   ? A CYS 301 SG  ? ? ? 1_555 A CYS 306 SG ? ? A CYS 299 A CYS 304 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf6 disulf ?   ? A CYS 436 SG  ? ? ? 1_555 A CYS 452 SG ? ? A CYS 433 A CYS 449 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
covale1 covale one ? A ASN 336 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 334 A NAG 451 1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 15  A . ? LYS 15  A PRO 16  A ? PRO 16  A 1 0.39 
2 ILE 212 A . ? ILE 210 A PRO 213 A ? PRO 211 A 1 1.07 
3 PHE 299 A . ? PHE 297 A PRO 300 A ? PRO 298 A 1 0.61 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
B 7 8 ? parallel      
B 8 9 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 2   ? CYS A 4   ? GLU A 2   CYS A 4   
A 2 CYS A 10  ? SER A 12  ? CYS A 10  SER A 12  
B 1 GLN A 51  ? ILE A 53  ? GLN A 50  ILE A 52  
B 2 ARG A 38  ? THR A 43  ? ARG A 37  THR A 42  
B 3 VAL A 101 ? ASP A 107 ? VAL A 99  ASP A 105 
B 4 LYS A 71  ? VAL A 76  ? LYS A 69  VAL A 74  
B 5 VAL A 148 ? HIS A 153 ? VAL A 146 HIS A 151 
B 6 ARG A 173 ? LEU A 177 ? ARG A 171 LEU A 175 
B 7 VAL A 201 ? ILE A 204 ? VAL A 199 ILE A 202 
B 8 LEU A 226 ? PRO A 230 ? LEU A 224 PRO A 228 
B 9 GLN A 325 ? LEU A 329 ? GLN A 323 LEU A 327 
C 1 ARG A 384 ? VAL A 391 ? ARG A 381 VAL A 388 
C 2 TRP A 340 ? SER A 349 ? TRP A 338 SER A 347 
C 3 GLY A 418 ? SER A 426 ? GLY A 416 SER A 424 
C 4 GLU A 432 ? CYS A 436 ? GLU A 429 CYS A 433 
D 1 GLN A 447 ? TYR A 450 ? GLN A 444 TYR A 447 
D 2 ILE A 398 ? ASN A 406 ? ILE A 395 ASN A 403 
D 3 LEU A 354 ? GLY A 364 ? LEU A 351 GLY A 361 
D 4 TYR A 372 ? LEU A 379 ? TYR A 369 LEU A 376 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 3   ? O VAL A 3   N PHE A 11  ? N PHE A 11  
B 1 2 O GLN A 51  ? O GLN A 50  N LEU A 41  ? N LEU A 40  
B 2 3 O ARG A 38  ? O ARG A 37  N ASP A 107 ? N ASP A 105 
B 3 4 O ASN A 102 ? O ASN A 100 N LYS A 71  ? N LYS A 69  
B 4 5 O THR A 72  ? O THR A 70  N HIS A 149 ? N HIS A 147 
B 5 6 O LEU A 150 ? O LEU A 148 N ARG A 173 ? N ARG A 171 
B 6 7 O ILE A 174 ? O ILE A 172 N ASP A 202 ? N ASP A 200 
B 7 8 O VAL A 203 ? O VAL A 201 N LEU A 226 ? N LEU A 224 
B 8 9 O ASP A 227 ? O ASP A 225 N GLN A 325 ? N GLN A 323 
C 1 2 O HIS A 385 ? O HIS A 382 N VAL A 346 ? N VAL A 344 
C 2 3 O LYS A 343 ? O LYS A 341 N GLN A 425 ? N GLN A 423 
C 3 4 O ILE A 422 ? O ILE A 420 N PHE A 435 ? N PHE A 432 
D 1 2 O GLN A 447 ? O GLN A 444 N PHE A 403 ? N PHE A 400 
D 2 3 O GLN A 399 ? O GLN A 396 N TYR A 363 ? N TYR A 360 
D 3 4 O LEU A 354 ? O LEU A 351 N LEU A 379 ? N LEU A 376 
# 
_database_PDB_matrix.entry_id          1BU8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BU8 
_atom_sites.fract_transf_matrix[1][1]   0.017424 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003727 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012637 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016781 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 1   ? -21.833 5.040   12.986 1.00 33.16 ? 1   LYS A N   1 
ATOM   2    C CA  . LYS A 1 1   ? -21.716 3.925   12.003 1.00 33.15 ? 1   LYS A CA  1 
ATOM   3    C C   . LYS A 1 1   ? -20.599 3.030   12.525 1.00 31.84 ? 1   LYS A C   1 
ATOM   4    O O   . LYS A 1 1   ? -19.942 3.382   13.506 1.00 29.55 ? 1   LYS A O   1 
ATOM   5    C CB  . LYS A 1 1   ? -21.316 4.466   10.628 1.00 35.04 ? 1   LYS A CB  1 
ATOM   6    C CG  . LYS A 1 1   ? -22.069 5.710   10.165 1.00 36.77 ? 1   LYS A CG  1 
ATOM   7    C CD  . LYS A 1 1   ? -23.525 5.428   9.867  1.00 38.50 ? 1   LYS A CD  1 
ATOM   8    C CE  . LYS A 1 1   ? -24.238 6.702   9.431  1.00 40.81 ? 1   LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 1   ? -25.659 6.437   9.081  1.00 42.81 ? 1   LYS A NZ  1 
ATOM   10   N N   . GLU A 1 2   ? -20.367 1.894   11.874 1.00 30.33 ? 2   GLU A N   1 
ATOM   11   C CA  . GLU A 1 2   ? -19.301 0.998   12.304 1.00 29.00 ? 2   GLU A CA  1 
ATOM   12   C C   . GLU A 1 2   ? -18.787 0.124   11.169 1.00 27.52 ? 2   GLU A C   1 
ATOM   13   O O   . GLU A 1 2   ? -19.505 -0.131  10.200 1.00 24.46 ? 2   GLU A O   1 
ATOM   14   C CB  . GLU A 1 2   ? -19.774 0.107   13.465 1.00 30.76 ? 2   GLU A CB  1 
ATOM   15   C CG  . GLU A 1 2   ? -20.909 -0.859  13.119 1.00 34.57 ? 2   GLU A CG  1 
ATOM   16   C CD  . GLU A 1 2   ? -21.313 -1.779  14.274 1.00 35.47 ? 2   GLU A CD  1 
ATOM   17   O OE1 . GLU A 1 2   ? -21.085 -1.434  15.454 1.00 37.74 ? 2   GLU A OE1 1 
ATOM   18   O OE2 . GLU A 1 2   ? -21.877 -2.857  13.993 1.00 36.83 ? 2   GLU A OE2 1 
ATOM   19   N N   . VAL A 1 3   ? -17.502 -0.205  11.232 1.00 23.71 ? 3   VAL A N   1 
ATOM   20   C CA  . VAL A 1 3   ? -16.889 -1.105  10.265 1.00 23.72 ? 3   VAL A CA  1 
ATOM   21   C C   . VAL A 1 3   ? -16.616 -2.368  11.076 1.00 24.98 ? 3   VAL A C   1 
ATOM   22   O O   . VAL A 1 3   ? -16.235 -2.285  12.251 1.00 21.33 ? 3   VAL A O   1 
ATOM   23   C CB  . VAL A 1 3   ? -15.557 -0.568  9.670  1.00 23.99 ? 3   VAL A CB  1 
ATOM   24   C CG1 . VAL A 1 3   ? -15.836 0.563   8.694  1.00 27.18 ? 3   VAL A CG1 1 
ATOM   25   C CG2 . VAL A 1 3   ? -14.594 -0.113  10.776 1.00 24.05 ? 3   VAL A CG2 1 
ATOM   26   N N   . CYS A 1 4   ? -16.878 -3.531  10.495 1.00 25.33 ? 4   CYS A N   1 
ATOM   27   C CA  . CYS A 1 4   ? -16.652 -4.780  11.213 1.00 24.84 ? 4   CYS A CA  1 
ATOM   28   C C   . CYS A 1 4   ? -15.538 -5.560  10.554 1.00 25.04 ? 4   CYS A C   1 
ATOM   29   O O   . CYS A 1 4   ? -15.513 -5.709  9.327  1.00 23.67 ? 4   CYS A O   1 
ATOM   30   C CB  . CYS A 1 4   ? -17.929 -5.608  11.271 1.00 24.65 ? 4   CYS A CB  1 
ATOM   31   S SG  . CYS A 1 4   ? -19.313 -4.782  12.110 1.00 24.92 ? 4   CYS A SG  1 
ATOM   32   N N   . TYR A 1 5   ? -14.596 -6.031  11.363 1.00 22.11 ? 5   TYR A N   1 
ATOM   33   C CA  . TYR A 1 5   ? -13.465 -6.775  10.844 1.00 23.24 ? 5   TYR A CA  1 
ATOM   34   C C   . TYR A 1 5   ? -13.401 -8.204  11.374 1.00 23.83 ? 5   TYR A C   1 
ATOM   35   O O   . TYR A 1 5   ? -12.525 -8.551  12.170 1.00 22.99 ? 5   TYR A O   1 
ATOM   36   C CB  . TYR A 1 5   ? -12.153 -6.048  11.131 1.00 23.09 ? 5   TYR A CB  1 
ATOM   37   C CG  . TYR A 1 5   ? -12.035 -4.663  10.516 1.00 25.67 ? 5   TYR A CG  1 
ATOM   38   C CD1 . TYR A 1 5   ? -12.202 -4.464  9.140  1.00 24.51 ? 5   TYR A CD1 1 
ATOM   39   C CD2 . TYR A 1 5   ? -11.736 -3.552  11.310 1.00 24.75 ? 5   TYR A CD2 1 
ATOM   40   C CE1 . TYR A 1 5   ? -12.070 -3.194  8.573  1.00 25.21 ? 5   TYR A CE1 1 
ATOM   41   C CE2 . TYR A 1 5   ? -11.599 -2.278  10.753 1.00 25.95 ? 5   TYR A CE2 1 
ATOM   42   C CZ  . TYR A 1 5   ? -11.768 -2.107  9.384  1.00 25.46 ? 5   TYR A CZ  1 
ATOM   43   O OH  . TYR A 1 5   ? -11.625 -0.855  8.830  1.00 25.77 ? 5   TYR A OH  1 
ATOM   44   N N   . GLY A 1 6   ? -14.358 -9.017  10.939 1.00 22.76 ? 6   GLY A N   1 
ATOM   45   C CA  . GLY A 1 6   ? -14.411 -10.413 11.328 1.00 23.48 ? 6   GLY A CA  1 
ATOM   46   C C   . GLY A 1 6   ? -14.285 -10.733 12.805 1.00 22.30 ? 6   GLY A C   1 
ATOM   47   O O   . GLY A 1 6   ? -15.060 -10.244 13.630 1.00 20.02 ? 6   GLY A O   1 
ATOM   48   N N   . HIS A 1 7   ? -13.276 -11.532 13.142 1.00 23.21 ? 7   HIS A N   1 
ATOM   49   C CA  . HIS A 1 7   ? -13.067 -11.962 14.525 1.00 23.62 ? 7   HIS A CA  1 
ATOM   50   C C   . HIS A 1 7   ? -12.613 -10.870 15.488 1.00 23.15 ? 7   HIS A C   1 
ATOM   51   O O   . HIS A 1 7   ? -12.530 -11.102 16.701 1.00 21.80 ? 7   HIS A O   1 
ATOM   52   C CB  . HIS A 1 7   ? -12.098 -13.148 14.579 1.00 22.32 ? 7   HIS A CB  1 
ATOM   53   C CG  . HIS A 1 7   ? -10.744 -12.847 14.022 1.00 22.10 ? 7   HIS A CG  1 
ATOM   54   N ND1 . HIS A 1 7   ? -10.459 -12.901 12.675 1.00 21.70 ? 7   HIS A ND1 1 
ATOM   55   C CD2 . HIS A 1 7   ? -9.594  -12.474 14.632 1.00 20.79 ? 7   HIS A CD2 1 
ATOM   56   C CE1 . HIS A 1 7   ? -9.196  -12.572 12.478 1.00 20.42 ? 7   HIS A CE1 1 
ATOM   57   N NE2 . HIS A 1 7   ? -8.650  -12.310 13.652 1.00 22.62 ? 7   HIS A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? -12.277 -9.700  14.954 1.00 21.27 ? 8   LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? -11.840 -8.591  15.792 1.00 17.91 ? 8   LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? -13.003 -7.672  16.124 1.00 20.59 ? 8   LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? -12.817 -6.618  16.731 1.00 20.20 ? 8   LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? -10.690 -7.829  15.133 1.00 16.41 ? 8   LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? -9.419  -8.643  14.906 1.00 17.81 ? 8   LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? -8.367  -7.763  14.281 1.00 18.07 ? 8   LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? -8.905  -9.253  16.219 1.00 17.07 ? 8   LEU A CD2 1 
ATOM   66   N N   . GLY A 1 9   ? -14.204 -8.083  15.713 1.00 17.29 ? 9   GLY A N   1 
ATOM   67   C CA  . GLY A 1 9   ? -15.399 -7.314  15.991 1.00 17.85 ? 9   GLY A CA  1 
ATOM   68   C C   . GLY A 1 9   ? -15.595 -6.056  15.158 1.00 16.14 ? 9   GLY A C   1 
ATOM   69   O O   . GLY A 1 9   ? -14.949 -5.846  14.127 1.00 19.65 ? 9   GLY A O   1 
ATOM   70   N N   . CYS A 1 10  ? -16.475 -5.199  15.640 1.00 17.71 ? 10  CYS A N   1 
ATOM   71   C CA  . CYS A 1 10  ? -16.796 -3.961  14.952 1.00 20.22 ? 10  CYS A CA  1 
ATOM   72   C C   . CYS A 1 10  ? -16.216 -2.742  15.654 1.00 21.50 ? 10  CYS A C   1 
ATOM   73   O O   . CYS A 1 10  ? -16.004 -2.745  16.874 1.00 18.22 ? 10  CYS A O   1 
ATOM   74   C CB  . CYS A 1 10  ? -18.307 -3.824  14.825 1.00 22.31 ? 10  CYS A CB  1 
ATOM   75   S SG  . CYS A 1 10  ? -19.089 -5.282  14.066 1.00 23.57 ? 10  CYS A SG  1 
ATOM   76   N N   . PHE A 1 11  ? -15.986 -1.696  14.868 1.00 20.39 ? 11  PHE A N   1 
ATOM   77   C CA  . PHE A 1 11  ? -15.408 -0.455  15.346 1.00 17.68 ? 11  PHE A CA  1 
ATOM   78   C C   . PHE A 1 11  ? -16.304 0.715   14.947 1.00 20.61 ? 11  PHE A C   1 
ATOM   79   O O   . PHE A 1 11  ? -16.398 1.076   13.769 1.00 21.49 ? 11  PHE A O   1 
ATOM   80   C CB  . PHE A 1 11  ? -13.998 -0.308  14.770 1.00 16.66 ? 11  PHE A CB  1 
ATOM   81   C CG  . PHE A 1 11  ? -13.069 -1.434  15.160 1.00 18.51 ? 11  PHE A CG  1 
ATOM   82   C CD1 . PHE A 1 11  ? -13.060 -2.631  14.447 1.00 19.72 ? 11  PHE A CD1 1 
ATOM   83   C CD2 . PHE A 1 11  ? -12.233 -1.309  16.264 1.00 18.45 ? 11  PHE A CD2 1 
ATOM   84   C CE1 . PHE A 1 11  ? -12.235 -3.693  14.831 1.00 19.56 ? 11  PHE A CE1 1 
ATOM   85   C CE2 . PHE A 1 11  ? -11.402 -2.358  16.659 1.00 17.26 ? 11  PHE A CE2 1 
ATOM   86   C CZ  . PHE A 1 11  ? -11.401 -3.556  15.941 1.00 21.10 ? 11  PHE A CZ  1 
ATOM   87   N N   . SER A 1 12  ? -17.008 1.248   15.939 1.00 19.45 ? 12  SER A N   1 
ATOM   88   C CA  . SER A 1 12  ? -17.934 2.363   15.777 1.00 21.80 ? 12  SER A CA  1 
ATOM   89   C C   . SER A 1 12  ? -17.195 3.696   15.686 1.00 21.99 ? 12  SER A C   1 
ATOM   90   O O   . SER A 1 12  ? -16.073 3.815   16.177 1.00 20.77 ? 12  SER A O   1 
ATOM   91   C CB  . SER A 1 12  ? -18.890 2.370   16.969 1.00 24.51 ? 12  SER A CB  1 
ATOM   92   O OG  . SER A 1 12  ? -19.724 3.510   16.987 1.00 23.50 ? 12  SER A OG  1 
ATOM   93   N N   . ASN A 1 13  ? -17.821 4.692   15.054 1.00 22.32 ? 13  ASN A N   1 
ATOM   94   C CA  . ASN A 1 13  ? -17.211 6.014   14.923 1.00 20.53 ? 13  ASN A CA  1 
ATOM   95   C C   . ASN A 1 13  ? -18.000 7.112   15.626 1.00 22.75 ? 13  ASN A C   1 
ATOM   96   O O   . ASN A 1 13  ? -17.737 8.301   15.422 1.00 24.41 ? 13  ASN A O   1 
ATOM   97   C CB  . ASN A 1 13  ? -16.980 6.392   13.454 1.00 19.57 ? 13  ASN A CB  1 
ATOM   98   C CG  . ASN A 1 13  ? -18.277 6.604   12.683 1.00 19.09 ? 13  ASN A CG  1 
ATOM   99   O OD1 . ASN A 1 13  ? -19.373 6.257   13.146 1.00 17.15 ? 13  ASN A OD1 1 
ATOM   100  N ND2 . ASN A 1 13  ? -18.156 7.175   11.498 1.00 20.34 ? 13  ASN A ND2 1 
ATOM   101  N N   . ASP A 1 14  ? -18.991 6.731   16.424 1.00 23.27 ? 14  ASP A N   1 
ATOM   102  C CA  . ASP A 1 14  ? -19.753 7.729   17.151 1.00 27.58 ? 14  ASP A CA  1 
ATOM   103  C C   . ASP A 1 14  ? -19.149 7.922   18.539 1.00 26.45 ? 14  ASP A C   1 
ATOM   104  O O   . ASP A 1 14  ? -18.213 7.210   18.923 1.00 24.70 ? 14  ASP A O   1 
ATOM   105  C CB  . ASP A 1 14  ? -21.245 7.369   17.229 1.00 33.00 ? 14  ASP A CB  1 
ATOM   106  C CG  . ASP A 1 14  ? -21.496 5.955   17.721 1.00 36.85 ? 14  ASP A CG  1 
ATOM   107  O OD1 . ASP A 1 14  ? -20.657 5.410   18.473 1.00 39.78 ? 14  ASP A OD1 1 
ATOM   108  O OD2 . ASP A 1 14  ? -22.553 5.390   17.361 1.00 38.09 ? 14  ASP A OD2 1 
ATOM   109  N N   . LYS A 1 15  ? -19.662 8.904   19.268 1.00 27.06 ? 15  LYS A N   1 
ATOM   110  C CA  . LYS A 1 15  ? -19.183 9.213   20.612 1.00 29.31 ? 15  LYS A CA  1 
ATOM   111  C C   . LYS A 1 15  ? -19.115 7.964   21.482 1.00 29.64 ? 15  LYS A C   1 
ATOM   112  O O   . LYS A 1 15  ? -20.075 7.185   21.540 1.00 28.27 ? 15  LYS A O   1 
ATOM   113  C CB  . LYS A 1 15  ? -20.116 10.226  21.276 1.00 30.96 ? 15  LYS A CB  1 
ATOM   114  C CG  . LYS A 1 15  ? -19.980 11.658  20.788 1.00 33.83 ? 15  LYS A CG  1 
ATOM   115  C CD  . LYS A 1 15  ? -21.155 12.495  21.290 1.00 34.57 ? 15  LYS A CD  1 
ATOM   116  C CE  . LYS A 1 15  ? -21.447 12.232  22.774 1.00 36.78 ? 15  LYS A CE  1 
ATOM   117  N NZ  . LYS A 1 15  ? -22.688 12.916  23.248 1.00 36.59 ? 15  LYS A NZ  1 
ATOM   118  N N   . PRO A 1 16  ? -18.026 7.814   22.259 1.00 29.36 ? 16  PRO A N   1 
ATOM   119  C CA  . PRO A 1 16  ? -16.883 8.727   22.376 1.00 27.65 ? 16  PRO A CA  1 
ATOM   120  C C   . PRO A 1 16  ? -15.672 8.373   21.512 1.00 26.45 ? 16  PRO A C   1 
ATOM   121  O O   . PRO A 1 16  ? -14.599 8.971   21.654 1.00 26.32 ? 16  PRO A O   1 
ATOM   122  C CB  . PRO A 1 16  ? -16.536 8.621   23.853 1.00 29.68 ? 16  PRO A CB  1 
ATOM   123  C CG  . PRO A 1 16  ? -16.744 7.164   24.112 1.00 28.77 ? 16  PRO A CG  1 
ATOM   124  C CD  . PRO A 1 16  ? -18.044 6.857   23.384 1.00 29.85 ? 16  PRO A CD  1 
ATOM   125  N N   . TRP A 1 17  ? -15.847 7.422   20.604 1.00 24.01 ? 17  TRP A N   1 
ATOM   126  C CA  . TRP A 1 17  ? -14.755 6.983   19.745 1.00 21.23 ? 17  TRP A CA  1 
ATOM   127  C C   . TRP A 1 17  ? -14.258 8.012   18.739 1.00 18.77 ? 17  TRP A C   1 
ATOM   128  O O   . TRP A 1 17  ? -13.086 8.005   18.348 1.00 17.25 ? 17  TRP A O   1 
ATOM   129  C CB  . TRP A 1 17  ? -15.163 5.695   19.045 1.00 22.09 ? 17  TRP A CB  1 
ATOM   130  C CG  . TRP A 1 17  ? -15.468 4.622   20.020 1.00 23.81 ? 17  TRP A CG  1 
ATOM   131  C CD1 . TRP A 1 17  ? -16.700 4.167   20.381 1.00 22.57 ? 17  TRP A CD1 1 
ATOM   132  C CD2 . TRP A 1 17  ? -14.516 3.859   20.777 1.00 22.50 ? 17  TRP A CD2 1 
ATOM   133  N NE1 . TRP A 1 17  ? -16.578 3.162   21.312 1.00 24.66 ? 17  TRP A NE1 1 
ATOM   134  C CE2 . TRP A 1 17  ? -15.249 2.952   21.567 1.00 23.14 ? 17  TRP A CE2 1 
ATOM   135  C CE3 . TRP A 1 17  ? -13.122 3.856   20.854 1.00 22.50 ? 17  TRP A CE3 1 
ATOM   136  C CZ2 . TRP A 1 17  ? -14.627 2.038   22.430 1.00 22.94 ? 17  TRP A CZ2 1 
ATOM   137  C CZ3 . TRP A 1 17  ? -12.501 2.946   21.715 1.00 22.87 ? 17  TRP A CZ3 1 
ATOM   138  C CH2 . TRP A 1 17  ? -13.258 2.050   22.485 1.00 21.40 ? 17  TRP A CH2 1 
ATOM   139  N N   . ALA A 1 18  ? -15.156 8.889   18.307 1.00 20.56 ? 18  ALA A N   1 
ATOM   140  C CA  . ALA A 1 18  ? -14.813 9.924   17.344 1.00 19.92 ? 18  ALA A CA  1 
ATOM   141  C C   . ALA A 1 18  ? -15.886 11.000  17.427 1.00 20.25 ? 18  ALA A C   1 
ATOM   142  O O   . ALA A 1 18  ? -16.935 10.787  18.046 1.00 22.29 ? 18  ALA A O   1 
ATOM   143  C CB  . ALA A 1 18  ? -14.737 9.334   15.935 1.00 20.84 ? 18  ALA A CB  1 
ATOM   144  N N   . GLY A 1 19  ? -15.626 12.151  16.817 1.00 22.72 ? 19  GLY A N   1 
ATOM   145  C CA  . GLY A 1 19  ? -16.592 13.235  16.862 1.00 24.04 ? 19  GLY A CA  1 
ATOM   146  C C   . GLY A 1 19  ? -16.632 13.904  18.227 1.00 27.09 ? 19  GLY A C   1 
ATOM   147  O O   . GLY A 1 19  ? -17.700 14.262  18.740 1.00 26.59 ? 19  GLY A O   1 
ATOM   148  N N   . MET A 1 20  ? -15.460 14.017  18.843 1.00 26.90 ? 20  MET A N   1 
ATOM   149  C CA  . MET A 1 20  ? -15.319 14.650  20.150 1.00 28.70 ? 20  MET A CA  1 
ATOM   150  C C   . MET A 1 20  ? -14.331 15.796  19.959 1.00 27.42 ? 20  MET A C   1 
ATOM   151  O O   . MET A 1 20  ? -13.593 15.828  18.972 1.00 26.17 ? 20  MET A O   1 
ATOM   152  C CB  . MET A 1 20  ? -14.746 13.659  21.178 1.00 29.84 ? 20  MET A CB  1 
ATOM   153  C CG  . MET A 1 20  ? -15.520 12.361  21.357 1.00 30.51 ? 20  MET A CG  1 
ATOM   154  S SD  . MET A 1 20  ? -17.094 12.525  22.212 1.00 35.07 ? 20  MET A SD  1 
ATOM   155  C CE  . MET A 1 20  ? -16.571 12.675  23.924 1.00 34.48 ? 20  MET A CE  1 
ATOM   156  N N   . LEU A 1 21  ? -14.228 16.667  20.957 1.00 29.51 ? 21  LEU A N   1 
ATOM   157  C CA  . LEU A 1 21  ? -13.325 17.814  20.886 1.00 27.17 ? 21  LEU A CA  1 
ATOM   158  C C   . LEU A 1 21  ? -11.869 17.403  20.632 1.00 26.73 ? 21  LEU A C   1 
ATOM   159  O O   . LEU A 1 21  ? -11.156 18.053  19.864 1.00 22.52 ? 21  LEU A O   1 
ATOM   160  C CB  . LEU A 1 21  ? -13.419 18.624  22.188 1.00 31.45 ? 21  LEU A CB  1 
ATOM   161  C CG  . LEU A 1 21  ? -14.820 18.906  22.753 1.00 32.54 ? 21  LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 21  ? -14.729 19.427  24.180 1.00 33.92 ? 21  LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 21  ? -15.572 19.887  21.868 1.00 33.60 ? 21  LEU A CD2 1 
ATOM   164  N N   . GLN A 1 22  ? -11.433 16.316  21.272 1.00 25.54 ? 22  GLN A N   1 
ATOM   165  C CA  . GLN A 1 22  ? -10.057 15.833  21.130 1.00 24.83 ? 22  GLN A CA  1 
ATOM   166  C C   . GLN A 1 22  ? -9.809  15.070  19.832 1.00 23.71 ? 22  GLN A C   1 
ATOM   167  O O   . GLN A 1 22  ? -8.659  14.924  19.398 1.00 24.11 ? 22  GLN A O   1 
ATOM   168  C CB  . GLN A 1 22  ? -9.677  14.928  22.310 1.00 26.01 ? 22  GLN A CB  1 
ATOM   169  C CG  . GLN A 1 22  ? -9.597  15.629  23.658 1.00 27.71 ? 22  GLN A CG  1 
ATOM   170  C CD  . GLN A 1 22  ? -10.923 15.690  24.384 1.00 29.92 ? 22  GLN A CD  1 
ATOM   171  O OE1 . GLN A 1 22  ? -11.989 15.716  23.766 1.00 30.64 ? 22  GLN A OE1 1 
ATOM   172  N NE2 . GLN A 1 22  ? -10.865 15.714  25.710 1.00 31.91 ? 22  GLN A NE2 1 
ATOM   173  N N   . ARG A 1 23  ? -10.892 14.600  19.220 1.00 24.16 ? 23  ARG A N   1 
ATOM   174  C CA  . ARG A 1 23  ? -10.832 13.827  17.979 1.00 23.78 ? 23  ARG A CA  1 
ATOM   175  C C   . ARG A 1 23  ? -12.148 14.047  17.229 1.00 23.57 ? 23  ARG A C   1 
ATOM   176  O O   . ARG A 1 23  ? -13.117 13.293  17.396 1.00 23.63 ? 23  ARG A O   1 
ATOM   177  C CB  . ARG A 1 23  ? -10.623 12.339  18.309 1.00 21.38 ? 23  ARG A CB  1 
ATOM   178  C CG  . ARG A 1 23  ? -11.502 11.837  19.454 1.00 21.29 ? 23  ARG A CG  1 
ATOM   179  C CD  . ARG A 1 23  ? -11.414 10.316  19.656 1.00 21.62 ? 23  ARG A CD  1 
ATOM   180  N NE  . ARG A 1 23  ? -10.071 9.844   20.001 1.00 19.67 ? 23  ARG A NE  1 
ATOM   181  C CZ  . ARG A 1 23  ? -9.698  8.564   19.983 1.00 21.46 ? 23  ARG A CZ  1 
ATOM   182  N NH1 . ARG A 1 23  ? -10.564 7.611   19.643 1.00 20.30 ? 23  ARG A NH1 1 
ATOM   183  N NH2 . ARG A 1 23  ? -8.455  8.230   20.306 1.00 18.36 ? 23  ARG A NH2 1 
ATOM   184  N N   . PRO A 1 24  ? -12.231 15.151  16.469 1.00 24.94 ? 24  PRO A N   1 
ATOM   185  C CA  . PRO A 1 24  ? -13.431 15.496  15.700 1.00 25.21 ? 24  PRO A CA  1 
ATOM   186  C C   . PRO A 1 24  ? -13.695 14.632  14.460 1.00 24.51 ? 24  PRO A C   1 
ATOM   187  O O   . PRO A 1 24  ? -14.847 14.315  14.167 1.00 25.34 ? 24  PRO A O   1 
ATOM   188  C CB  . PRO A 1 24  ? -13.187 16.964  15.346 1.00 24.73 ? 24  PRO A CB  1 
ATOM   189  C CG  . PRO A 1 24  ? -11.707 17.001  15.141 1.00 25.91 ? 24  PRO A CG  1 
ATOM   190  C CD  . PRO A 1 24  ? -11.183 16.172  16.301 1.00 24.04 ? 24  PRO A CD  1 
ATOM   191  N N   . LEU A 1 25  ? -12.636 14.268  13.740 1.00 24.22 ? 25  LEU A N   1 
ATOM   192  C CA  . LEU A 1 25  ? -12.748 13.451  12.529 1.00 26.07 ? 25  LEU A CA  1 
ATOM   193  C C   . LEU A 1 25  ? -13.491 12.141  12.791 1.00 25.84 ? 25  LEU A C   1 
ATOM   194  O O   . LEU A 1 25  ? -13.116 11.375  13.682 1.00 24.44 ? 25  LEU A O   1 
ATOM   195  C CB  . LEU A 1 25  ? -11.356 13.125  11.984 1.00 27.64 ? 25  LEU A CB  1 
ATOM   196  C CG  . LEU A 1 25  ? -11.076 13.417  10.509 1.00 29.66 ? 25  LEU A CG  1 
ATOM   197  C CD1 . LEU A 1 25  ? -9.809  12.705  10.073 1.00 29.60 ? 25  LEU A CD1 1 
ATOM   198  C CD2 . LEU A 1 25  ? -12.251 12.970  9.654  1.00 31.70 ? 25  LEU A CD2 1 
ATOM   199  N N   . LYS A 1 26  ? -14.537 11.872  12.014 1.00 25.60 ? 26  LYS A N   1 
ATOM   200  C CA  . LYS A 1 26  ? -15.292 10.639  12.197 1.00 22.68 ? 26  LYS A CA  1 
ATOM   201  C C   . LYS A 1 26  ? -14.881 9.482   11.289 1.00 20.46 ? 26  LYS A C   1 
ATOM   202  O O   . LYS A 1 26  ? -15.706 8.640   10.950 1.00 22.27 ? 26  LYS A O   1 
ATOM   203  C CB  . LYS A 1 26  ? -16.800 10.900  12.119 1.00 25.09 ? 26  LYS A CB  1 
ATOM   204  C CG  . LYS A 1 26  ? -17.343 11.561  13.376 1.00 26.99 ? 26  LYS A CG  1 
ATOM   205  C CD  . LYS A 1 26  ? -18.861 11.605  13.416 1.00 30.18 ? 26  LYS A CD  1 
ATOM   206  C CE  . LYS A 1 26  ? -19.345 11.925  14.833 1.00 33.35 ? 26  LYS A CE  1 
ATOM   207  N NZ  . LYS A 1 26  ? -18.843 10.924  15.840 1.00 31.42 ? 26  LYS A NZ  1 
ATOM   208  N N   . ILE A 1 27  ? -13.607 9.436   10.902 1.00 18.94 ? 27  ILE A N   1 
ATOM   209  C CA  . ILE A 1 27  ? -13.111 8.347   10.071 1.00 18.96 ? 27  ILE A CA  1 
ATOM   210  C C   . ILE A 1 27  ? -13.045 7.069   10.923 1.00 19.18 ? 27  ILE A C   1 
ATOM   211  O O   . ILE A 1 27  ? -13.248 7.118   12.138 1.00 18.16 ? 27  ILE A O   1 
ATOM   212  C CB  . ILE A 1 27  ? -11.710 8.635   9.475  1.00 19.01 ? 27  ILE A CB  1 
ATOM   213  C CG1 . ILE A 1 27  ? -10.728 9.032   10.576 1.00 20.11 ? 27  ILE A CG1 1 
ATOM   214  C CG2 . ILE A 1 27  ? -11.797 9.711   8.384  1.00 21.56 ? 27  ILE A CG2 1 
ATOM   215  C CD1 . ILE A 1 27  ? -9.290  9.026   10.126 1.00 19.72 ? 27  ILE A CD1 1 
ATOM   216  N N   . PHE A 1 28  ? -12.765 5.939   10.282 1.00 16.94 ? 28  PHE A N   1 
ATOM   217  C CA  . PHE A 1 28  ? -12.690 4.649   10.972 1.00 16.47 ? 28  PHE A CA  1 
ATOM   218  C C   . PHE A 1 28  ? -11.270 4.120   11.006 1.00 12.83 ? 28  PHE A C   1 
ATOM   219  O O   . PHE A 1 28  ? -10.415 4.556   10.236 1.00 11.44 ? 28  PHE A O   1 
ATOM   220  C CB  . PHE A 1 28  ? -13.501 3.589   10.205 1.00 15.96 ? 28  PHE A CB  1 
ATOM   221  C CG  . PHE A 1 28  ? -14.973 3.818   10.192 1.00 15.43 ? 28  PHE A CG  1 
ATOM   222  C CD1 . PHE A 1 28  ? -15.739 3.528   11.308 1.00 16.54 ? 28  PHE A CD1 1 
ATOM   223  C CD2 . PHE A 1 28  ? -15.610 4.268   9.030  1.00 16.05 ? 28  PHE A CD2 1 
ATOM   224  C CE1 . PHE A 1 28  ? -17.107 3.672   11.283 1.00 16.50 ? 28  PHE A CE1 1 
ATOM   225  C CE2 . PHE A 1 28  ? -16.989 4.416   8.996  1.00 14.99 ? 28  PHE A CE2 1 
ATOM   226  C CZ  . PHE A 1 28  ? -17.741 4.119   10.119 1.00 17.71 ? 28  PHE A CZ  1 
ATOM   227  N N   . PRO A 1 29  ? -10.986 3.173   11.927 1.00 15.26 ? 29  PRO A N   1 
ATOM   228  C CA  . PRO A 1 29  ? -9.641  2.600   11.993 1.00 15.80 ? 29  PRO A CA  1 
ATOM   229  C C   . PRO A 1 29  ? -9.448  1.802   10.690 1.00 14.85 ? 29  PRO A C   1 
ATOM   230  O O   . PRO A 1 29  ? -10.439 1.357   10.085 1.00 19.09 ? 29  PRO A O   1 
ATOM   231  C CB  . PRO A 1 29  ? -9.744  1.619   13.169 1.00 16.51 ? 29  PRO A CB  1 
ATOM   232  C CG  . PRO A 1 29  ? -10.765 2.223   14.042 1.00 14.85 ? 29  PRO A CG  1 
ATOM   233  C CD  . PRO A 1 29  ? -11.810 2.715   13.059 1.00 13.45 ? 29  PRO A CD  1 
ATOM   234  N N   . TRP A 1 30  ? -8.207  1.662   10.245 1.00 15.11 ? 30  TRP A N   1 
ATOM   235  C CA  . TRP A 1 30  ? -7.888  0.886   9.045  1.00 16.36 ? 30  TRP A CA  1 
ATOM   236  C C   . TRP A 1 30  ? -8.203  -0.593  9.308  1.00 18.60 ? 30  TRP A C   1 
ATOM   237  O O   . TRP A 1 30  ? -8.473  -0.991  10.448 1.00 20.83 ? 30  TRP A O   1 
ATOM   238  C CB  . TRP A 1 30  ? -6.398  0.998   8.722  1.00 15.46 ? 30  TRP A CB  1 
ATOM   239  C CG  . TRP A 1 30  ? -5.973  2.253   8.024  1.00 14.95 ? 30  TRP A CG  1 
ATOM   240  C CD1 . TRP A 1 30  ? -6.769  3.282   7.625  1.00 14.95 ? 30  TRP A CD1 1 
ATOM   241  C CD2 . TRP A 1 30  ? -4.646  2.587   7.616  1.00 15.67 ? 30  TRP A CD2 1 
ATOM   242  N NE1 . TRP A 1 30  ? -6.021  4.233   6.986  1.00 14.89 ? 30  TRP A NE1 1 
ATOM   243  C CE2 . TRP A 1 30  ? -4.713  3.835   6.965  1.00 14.73 ? 30  TRP A CE2 1 
ATOM   244  C CE3 . TRP A 1 30  ? -3.403  1.955   7.734  1.00 16.03 ? 30  TRP A CE3 1 
ATOM   245  C CZ2 . TRP A 1 30  ? -3.591  4.460   6.433  1.00 15.01 ? 30  TRP A CZ2 1 
ATOM   246  C CZ3 . TRP A 1 30  ? -2.281  2.580   7.203  1.00 15.61 ? 30  TRP A CZ3 1 
ATOM   247  C CH2 . TRP A 1 30  ? -2.386  3.819   6.559  1.00 15.93 ? 30  TRP A CH2 1 
ATOM   248  N N   . SER A 1 31  A -8.128  -1.415  8.268  1.00 19.34 ? 30  SER A N   1 
ATOM   249  C CA  . SER A 1 31  A -8.393  -2.846  8.410  1.00 18.70 ? 30  SER A CA  1 
ATOM   250  C C   . SER A 1 31  A -7.182  -3.517  9.055  1.00 16.96 ? 30  SER A C   1 
ATOM   251  O O   . SER A 1 31  A -6.062  -3.020  8.955  1.00 15.41 ? 30  SER A O   1 
ATOM   252  C CB  . SER A 1 31  A -8.617  -3.477  7.033  1.00 15.34 ? 30  SER A CB  1 
ATOM   253  O OG  . SER A 1 31  A -7.438  -3.357  6.255  1.00 16.41 ? 30  SER A OG  1 
ATOM   254  N N   . PRO A 1 32  ? -7.389  -4.680  9.703  1.00 16.72 ? 31  PRO A N   1 
ATOM   255  C CA  . PRO A 1 32  ? -6.274  -5.384  10.336 1.00 16.77 ? 31  PRO A CA  1 
ATOM   256  C C   . PRO A 1 32  ? -5.199  -5.670  9.298  1.00 17.24 ? 31  PRO A C   1 
ATOM   257  O O   . PRO A 1 32  ? -4.004  -5.620  9.587  1.00 18.46 ? 31  PRO A O   1 
ATOM   258  C CB  . PRO A 1 32  ? -6.925  -6.682  10.822 1.00 18.00 ? 31  PRO A CB  1 
ATOM   259  C CG  . PRO A 1 32  ? -8.321  -6.277  11.106 1.00 19.75 ? 31  PRO A CG  1 
ATOM   260  C CD  . PRO A 1 32  ? -8.672  -5.343  9.988  1.00 17.57 ? 31  PRO A CD  1 
ATOM   261  N N   . GLU A 1 33  ? -5.643  -5.942  8.073  1.00 17.35 ? 32  GLU A N   1 
ATOM   262  C CA  . GLU A 1 33  ? -4.750  -6.242  6.963  1.00 18.14 ? 32  GLU A CA  1 
ATOM   263  C C   . GLU A 1 33  ? -3.867  -5.045  6.617  1.00 15.47 ? 32  GLU A C   1 
ATOM   264  O O   . GLU A 1 33  ? -2.676  -5.199  6.360  1.00 18.98 ? 32  GLU A O   1 
ATOM   265  C CB  . GLU A 1 33  ? -5.562  -6.663  5.724  1.00 21.62 ? 32  GLU A CB  1 
ATOM   266  C CG  . GLU A 1 33  ? -6.292  -8.001  5.842  1.00 26.40 ? 32  GLU A CG  1 
ATOM   267  C CD  . GLU A 1 33  ? -7.330  -8.038  6.950  1.00 30.29 ? 32  GLU A CD  1 
ATOM   268  O OE1 . GLU A 1 33  ? -8.281  -7.228  6.929  1.00 28.78 ? 32  GLU A OE1 1 
ATOM   269  O OE2 . GLU A 1 33  ? -7.193  -8.898  7.852  1.00 35.68 ? 32  GLU A OE2 1 
ATOM   270  N N   . ASP A 1 34  ? -4.456  -3.857  6.594  1.00 17.50 ? 33  ASP A N   1 
ATOM   271  C CA  . ASP A 1 34  ? -3.700  -2.647  6.267  1.00 18.22 ? 33  ASP A CA  1 
ATOM   272  C C   . ASP A 1 34  ? -2.765  -2.166  7.381  1.00 17.84 ? 33  ASP A C   1 
ATOM   273  O O   . ASP A 1 34  ? -1.770  -1.501  7.108  1.00 17.57 ? 33  ASP A O   1 
ATOM   274  C CB  . ASP A 1 34  ? -4.637  -1.527  5.804  1.00 21.27 ? 33  ASP A CB  1 
ATOM   275  C CG  . ASP A 1 34  ? -5.169  -1.768  4.388  1.00 22.33 ? 33  ASP A CG  1 
ATOM   276  O OD1 . ASP A 1 34  ? -4.404  -2.308  3.565  1.00 22.73 ? 33  ASP A OD1 1 
ATOM   277  O OD2 . ASP A 1 34  ? -6.340  -1.439  4.109  1.00 23.18 ? 33  ASP A OD2 1 
ATOM   278  N N   . ILE A 1 35  ? -3.091  -2.498  8.627  1.00 20.34 ? 34  ILE A N   1 
ATOM   279  C CA  . ILE A 1 35  ? -2.250  -2.126  9.769  1.00 17.43 ? 34  ILE A CA  1 
ATOM   280  C C   . ILE A 1 35  ? -1.097  -3.137  9.862  1.00 19.05 ? 34  ILE A C   1 
ATOM   281  O O   . ILE A 1 35  ? 0.049   -2.773  10.166 1.00 21.51 ? 34  ILE A O   1 
ATOM   282  C CB  . ILE A 1 35  ? -3.087  -2.069  11.073 1.00 18.27 ? 34  ILE A CB  1 
ATOM   283  C CG1 . ILE A 1 35  ? -4.056  -0.882  11.001 1.00 13.04 ? 34  ILE A CG1 1 
ATOM   284  C CG2 . ILE A 1 35  ? -2.175  -1.924  12.303 1.00 15.88 ? 34  ILE A CG2 1 
ATOM   285  C CD1 . ILE A 1 35  ? -5.227  -0.940  11.965 1.00 10.80 ? 34  ILE A CD1 1 
ATOM   286  N N   . ASP A 1 36  ? -1.402  -4.391  9.532  1.00 18.46 ? 35  ASP A N   1 
ATOM   287  C CA  . ASP A 1 36  ? -0.429  -5.486  9.519  1.00 17.76 ? 35  ASP A CA  1 
ATOM   288  C C   . ASP A 1 36  ? 0.294   -5.674  10.858 1.00 17.29 ? 35  ASP A C   1 
ATOM   289  O O   . ASP A 1 36  ? 1.520   -5.628  10.911 1.00 19.43 ? 35  ASP A O   1 
ATOM   290  C CB  . ASP A 1 36  ? 0.595   -5.273  8.385  1.00 20.40 ? 35  ASP A CB  1 
ATOM   291  C CG  . ASP A 1 36  ? 1.344   -6.551  8.005  1.00 21.83 ? 35  ASP A CG  1 
ATOM   292  O OD1 . ASP A 1 36  ? 0.810   -7.648  8.254  1.00 22.92 ? 35  ASP A OD1 1 
ATOM   293  O OD2 . ASP A 1 36  ? 2.461   -6.460  7.445  1.00 23.70 ? 35  ASP A OD2 1 
ATOM   294  N N   . THR A 1 37  ? -0.473  -5.852  11.928 1.00 17.81 ? 36  THR A N   1 
ATOM   295  C CA  . THR A 1 37  ? 0.103   -6.061  13.261 1.00 18.75 ? 36  THR A CA  1 
ATOM   296  C C   . THR A 1 37  ? 0.916   -7.356  13.211 1.00 20.43 ? 36  THR A C   1 
ATOM   297  O O   . THR A 1 37  ? 0.468   -8.366  12.649 1.00 17.75 ? 36  THR A O   1 
ATOM   298  C CB  . THR A 1 37  ? -0.993  -6.182  14.343 1.00 20.26 ? 36  THR A CB  1 
ATOM   299  O OG1 . THR A 1 37  ? -1.784  -4.983  14.376 1.00 19.15 ? 36  THR A OG1 1 
ATOM   300  C CG2 . THR A 1 37  ? -0.374  -6.417  15.720 1.00 18.92 ? 36  THR A CG2 1 
ATOM   301  N N   . ARG A 1 38  ? 2.131   -7.304  13.735 1.00 19.85 ? 37  ARG A N   1 
ATOM   302  C CA  . ARG A 1 38  ? 3.001   -8.464  13.740 1.00 21.80 ? 37  ARG A CA  1 
ATOM   303  C C   . ARG A 1 38  ? 3.437   -8.729  15.176 1.00 22.13 ? 37  ARG A C   1 
ATOM   304  O O   . ARG A 1 38  ? 3.836   -7.802  15.888 1.00 19.58 ? 37  ARG A O   1 
ATOM   305  C CB  . ARG A 1 38  ? 4.225   -8.210  12.858 1.00 23.14 ? 37  ARG A CB  1 
ATOM   306  C CG  . ARG A 1 38  ? 3.894   -7.680  11.464 1.00 26.03 ? 37  ARG A CG  1 
ATOM   307  C CD  . ARG A 1 38  ? 5.063   -7.821  10.493 1.00 27.76 ? 37  ARG A CD  1 
ATOM   308  N NE  . ARG A 1 38  ? 6.282   -7.141  10.933 1.00 28.78 ? 37  ARG A NE  1 
ATOM   309  C CZ  . ARG A 1 38  ? 7.496   -7.689  10.913 1.00 27.84 ? 37  ARG A CZ  1 
ATOM   310  N NH1 . ARG A 1 38  ? 7.660   -8.939  10.496 1.00 25.80 ? 37  ARG A NH1 1 
ATOM   311  N NH2 . ARG A 1 38  ? 8.548   -6.994  11.328 1.00 26.42 ? 37  ARG A NH2 1 
ATOM   312  N N   . PHE A 1 39  ? 3.274   -9.972  15.620 1.00 20.18 ? 38  PHE A N   1 
ATOM   313  C CA  . PHE A 1 39  ? 3.665   -10.371 16.971 1.00 18.21 ? 38  PHE A CA  1 
ATOM   314  C C   . PHE A 1 39  ? 4.971   -11.128 16.823 1.00 19.03 ? 38  PHE A C   1 
ATOM   315  O O   . PHE A 1 39  ? 4.999   -12.251 16.319 1.00 19.24 ? 38  PHE A O   1 
ATOM   316  C CB  . PHE A 1 39  ? 2.595   -11.253 17.603 1.00 17.16 ? 38  PHE A CB  1 
ATOM   317  C CG  . PHE A 1 39  ? 1.304   -10.537 17.882 1.00 15.70 ? 38  PHE A CG  1 
ATOM   318  C CD1 . PHE A 1 39  ? 1.279   -9.381  18.666 1.00 17.22 ? 38  PHE A CD1 1 
ATOM   319  C CD2 . PHE A 1 39  ? 0.109   -11.022 17.366 1.00 16.36 ? 38  PHE A CD2 1 
ATOM   320  C CE1 . PHE A 1 39  ? 0.082   -8.722  18.929 1.00 16.36 ? 38  PHE A CE1 1 
ATOM   321  C CE2 . PHE A 1 39  ? -1.087  -10.376 17.619 1.00 15.18 ? 38  PHE A CE2 1 
ATOM   322  C CZ  . PHE A 1 39  ? -1.101  -9.220  18.405 1.00 16.55 ? 38  PHE A CZ  1 
ATOM   323  N N   . LEU A 1 40  ? 6.062   -10.484 17.214 1.00 18.43 ? 39  LEU A N   1 
ATOM   324  C CA  . LEU A 1 40  ? 7.379   -11.071 17.079 1.00 18.70 ? 39  LEU A CA  1 
ATOM   325  C C   . LEU A 1 40  ? 7.893   -11.637 18.398 1.00 20.22 ? 39  LEU A C   1 
ATOM   326  O O   . LEU A 1 40  ? 8.387   -10.901 19.256 1.00 18.67 ? 39  LEU A O   1 
ATOM   327  C CB  . LEU A 1 40  ? 8.340   -10.023 16.524 1.00 19.97 ? 39  LEU A CB  1 
ATOM   328  C CG  . LEU A 1 40  ? 7.819   -9.259  15.297 1.00 20.28 ? 39  LEU A CG  1 
ATOM   329  C CD1 . LEU A 1 40  ? 8.761   -8.128  14.941 1.00 19.94 ? 39  LEU A CD1 1 
ATOM   330  C CD2 . LEU A 1 40  ? 7.643   -10.212 14.115 1.00 20.55 ? 39  LEU A CD2 1 
ATOM   331  N N   . LEU A 1 41  ? 7.827   -12.957 18.530 1.00 19.58 ? 40  LEU A N   1 
ATOM   332  C CA  . LEU A 1 41  ? 8.266   -13.612 19.752 1.00 19.07 ? 40  LEU A CA  1 
ATOM   333  C C   . LEU A 1 41  ? 9.766   -13.848 19.876 1.00 19.96 ? 40  LEU A C   1 
ATOM   334  O O   . LEU A 1 41  ? 10.435  -14.353 18.959 1.00 17.31 ? 40  LEU A O   1 
ATOM   335  C CB  . LEU A 1 41  ? 7.517   -14.936 19.955 1.00 18.68 ? 40  LEU A CB  1 
ATOM   336  C CG  . LEU A 1 41  ? 8.008   -15.779 21.140 1.00 15.64 ? 40  LEU A CG  1 
ATOM   337  C CD1 . LEU A 1 41  ? 7.517   -15.164 22.441 1.00 13.11 ? 40  LEU A CD1 1 
ATOM   338  C CD2 . LEU A 1 41  ? 7.533   -17.223 20.997 1.00 15.72 ? 40  LEU A CD2 1 
ATOM   339  N N   . TYR A 1 42  ? 10.298  -13.435 21.021 1.00 20.07 ? 41  TYR A N   1 
ATOM   340  C CA  . TYR A 1 42  ? 11.698  -13.634 21.344 1.00 18.83 ? 41  TYR A CA  1 
ATOM   341  C C   . TYR A 1 42  ? 11.645  -14.299 22.715 1.00 16.56 ? 41  TYR A C   1 
ATOM   342  O O   . TYR A 1 42  ? 10.717  -14.050 23.485 1.00 13.69 ? 41  TYR A O   1 
ATOM   343  C CB  . TYR A 1 42  ? 12.448  -12.305 21.447 1.00 18.83 ? 41  TYR A CB  1 
ATOM   344  C CG  . TYR A 1 42  ? 12.595  -11.559 20.144 1.00 20.12 ? 41  TYR A CG  1 
ATOM   345  C CD1 . TYR A 1 42  ? 13.661  -11.824 19.286 1.00 19.04 ? 41  TYR A CD1 1 
ATOM   346  C CD2 . TYR A 1 42  ? 11.693  -10.556 19.788 1.00 19.19 ? 41  TYR A CD2 1 
ATOM   347  C CE1 . TYR A 1 42  ? 13.832  -11.102 18.105 1.00 20.27 ? 41  TYR A CE1 1 
ATOM   348  C CE2 . TYR A 1 42  ? 11.852  -9.828  18.609 1.00 18.21 ? 41  TYR A CE2 1 
ATOM   349  C CZ  . TYR A 1 42  ? 12.923  -10.106 17.778 1.00 18.82 ? 41  TYR A CZ  1 
ATOM   350  O OH  . TYR A 1 42  ? 13.099  -9.369  16.632 1.00 20.61 ? 41  TYR A OH  1 
ATOM   351  N N   . THR A 1 43  ? 12.548  -15.242 22.956 1.00 18.35 ? 42  THR A N   1 
ATOM   352  C CA  . THR A 1 43  ? 12.626  -15.931 24.241 1.00 18.94 ? 42  THR A CA  1 
ATOM   353  C C   . THR A 1 43  ? 14.108  -16.023 24.544 1.00 19.48 ? 42  THR A C   1 
ATOM   354  O O   . THR A 1 43  ? 14.948  -15.802 23.661 1.00 20.47 ? 42  THR A O   1 
ATOM   355  C CB  . THR A 1 43  ? 12.057  -17.382 24.201 1.00 18.21 ? 42  THR A CB  1 
ATOM   356  O OG1 . THR A 1 43  ? 12.806  -18.171 23.270 1.00 17.41 ? 42  THR A OG1 1 
ATOM   357  C CG2 . THR A 1 43  ? 10.571  -17.403 23.841 1.00 19.25 ? 42  THR A CG2 1 
ATOM   358  N N   . ASN A 1 44  ? 14.432  -16.355 25.791 1.00 21.28 ? 43  ASN A N   1 
ATOM   359  C CA  . ASN A 1 44  ? 15.822  -16.484 26.219 1.00 20.97 ? 43  ASN A CA  1 
ATOM   360  C C   . ASN A 1 44  ? 16.622  -17.347 25.248 1.00 22.61 ? 43  ASN A C   1 
ATOM   361  O O   . ASN A 1 44  ? 17.767  -17.031 24.929 1.00 21.64 ? 43  ASN A O   1 
ATOM   362  C CB  . ASN A 1 44  ? 15.889  -17.081 27.631 1.00 19.90 ? 43  ASN A CB  1 
ATOM   363  C CG  . ASN A 1 44  ? 15.088  -16.285 28.638 1.00 19.85 ? 43  ASN A CG  1 
ATOM   364  O OD1 . ASN A 1 44  ? 13.861  -16.222 28.559 1.00 17.08 ? 43  ASN A OD1 1 
ATOM   365  N ND2 . ASN A 1 44  ? 15.775  -15.687 29.606 1.00 18.70 ? 43  ASN A ND2 1 
ATOM   366  N N   . GLU A 1 45  ? 15.981  -18.392 24.728 1.00 25.23 ? 44  GLU A N   1 
ATOM   367  C CA  . GLU A 1 45  ? 16.614  -19.314 23.784 1.00 27.85 ? 44  GLU A CA  1 
ATOM   368  C C   . GLU A 1 45  ? 16.740  -18.741 22.373 1.00 28.83 ? 44  GLU A C   1 
ATOM   369  O O   . GLU A 1 45  ? 17.689  -19.074 21.658 1.00 31.51 ? 44  GLU A O   1 
ATOM   370  C CB  . GLU A 1 45  ? 15.873  -20.655 23.757 1.00 28.40 ? 44  GLU A CB  1 
ATOM   371  C CG  . GLU A 1 45  ? 15.899  -21.418 25.084 1.00 28.42 ? 44  GLU A CG  1 
ATOM   372  C CD  . GLU A 1 45  ? 14.959  -20.850 26.143 1.00 30.16 ? 44  GLU A CD  1 
ATOM   373  O OE1 . GLU A 1 45  ? 13.916  -20.262 25.779 1.00 29.26 ? 44  GLU A OE1 1 
ATOM   374  O OE2 . GLU A 1 45  ? 15.253  -21.015 27.349 1.00 29.05 ? 44  GLU A OE2 1 
ATOM   375  N N   . ASN A 1 46  ? 15.772  -17.921 21.956 1.00 28.20 ? 45  ASN A N   1 
ATOM   376  C CA  . ASN A 1 46  ? 15.824  -17.277 20.638 1.00 27.12 ? 45  ASN A CA  1 
ATOM   377  C C   . ASN A 1 46  ? 15.769  -15.749 20.816 1.00 24.66 ? 45  ASN A C   1 
ATOM   378  O O   . ASN A 1 46  ? 14.773  -15.102 20.513 1.00 26.41 ? 45  ASN A O   1 
ATOM   379  C CB  . ASN A 1 46  ? 14.745  -17.829 19.660 1.00 26.47 ? 45  ASN A CB  1 
ATOM   380  C CG  . ASN A 1 46  ? 13.315  -17.319 19.938 1.00 26.49 ? 45  ASN A CG  1 
ATOM   381  O OD1 . ASN A 1 46  ? 12.597  -17.863 20.779 1.00 24.42 ? 45  ASN A OD1 1 
ATOM   382  N ND2 . ASN A 1 46  ? 12.871  -16.334 19.149 1.00 25.70 ? 45  ASN A ND2 1 
ATOM   383  N N   . PRO A 1 47  ? 16.864  -15.151 21.315 1.00 25.04 ? 46  PRO A N   1 
ATOM   384  C CA  . PRO A 1 47  ? 16.936  -13.706 21.545 1.00 25.05 ? 46  PRO A CA  1 
ATOM   385  C C   . PRO A 1 47  ? 17.328  -12.831 20.347 1.00 25.76 ? 46  PRO A C   1 
ATOM   386  O O   . PRO A 1 47  ? 17.149  -11.614 20.395 1.00 27.43 ? 46  PRO A O   1 
ATOM   387  C CB  . PRO A 1 47  ? 17.970  -13.605 22.664 1.00 23.13 ? 46  PRO A CB  1 
ATOM   388  C CG  . PRO A 1 47  ? 18.955  -14.652 22.263 1.00 24.79 ? 46  PRO A CG  1 
ATOM   389  C CD  . PRO A 1 47  ? 18.077  -15.818 21.839 1.00 23.84 ? 46  PRO A CD  1 
ATOM   390  N N   . ASN A 1 48  ? 17.861  -13.436 19.288 1.00 26.75 ? 47  ASN A N   1 
ATOM   391  C CA  . ASN A 1 48  ? 18.286  -12.678 18.107 1.00 29.85 ? 47  ASN A CA  1 
ATOM   392  C C   . ASN A 1 48  ? 17.279  -12.670 16.955 1.00 29.00 ? 47  ASN A C   1 
ATOM   393  O O   . ASN A 1 48  ? 17.087  -11.643 16.304 1.00 30.41 ? 47  ASN A O   1 
ATOM   394  C CB  . ASN A 1 48  ? 19.622  -13.204 17.577 1.00 32.83 ? 47  ASN A CB  1 
ATOM   395  C CG  . ASN A 1 48  ? 20.728  -13.127 18.602 1.00 35.70 ? 47  ASN A CG  1 
ATOM   396  O OD1 . ASN A 1 48  ? 21.078  -14.131 19.224 1.00 36.18 ? 47  ASN A OD1 1 
ATOM   397  N ND2 . ASN A 1 48  ? 21.289  -11.937 18.786 1.00 37.02 ? 47  ASN A ND2 1 
ATOM   398  N N   . ASN A 1 49  ? 16.692  -13.830 16.670 1.00 27.99 ? 48  ASN A N   1 
ATOM   399  C CA  . ASN A 1 49  ? 15.718  -13.977 15.585 1.00 27.30 ? 48  ASN A CA  1 
ATOM   400  C C   . ASN A 1 49  ? 14.353  -14.227 16.180 1.00 25.12 ? 48  ASN A C   1 
ATOM   401  O O   . ASN A 1 49  ? 14.219  -15.064 17.076 1.00 25.36 ? 48  ASN A O   1 
ATOM   402  C CB  . ASN A 1 49  ? 16.076  -15.166 14.689 1.00 27.92 ? 48  ASN A CB  1 
ATOM   403  C CG  . ASN A 1 49  ? 17.412  -15.004 14.011 1.00 29.43 ? 48  ASN A CG  1 
ATOM   404  O OD1 . ASN A 1 49  ? 18.452  -15.328 14.583 1.00 32.59 ? 48  ASN A OD1 1 
ATOM   405  N ND2 . ASN A 1 49  ? 17.394  -14.511 12.778 1.00 30.26 ? 48  ASN A ND2 1 
ATOM   406  N N   . TYR A 1 50  ? 13.339  -13.525 15.680 1.00 21.52 ? 49  TYR A N   1 
ATOM   407  C CA  . TYR A 1 50  ? 11.988  -13.704 16.194 1.00 20.39 ? 49  TYR A CA  1 
ATOM   408  C C   . TYR A 1 50  ? 11.288  -14.906 15.591 1.00 21.05 ? 49  TYR A C   1 
ATOM   409  O O   . TYR A 1 50  ? 11.765  -15.506 14.623 1.00 21.19 ? 49  TYR A O   1 
ATOM   410  C CB  . TYR A 1 50  ? 11.126  -12.447 15.985 1.00 19.37 ? 49  TYR A CB  1 
ATOM   411  C CG  . TYR A 1 50  ? 10.796  -12.103 14.542 1.00 17.46 ? 49  TYR A CG  1 
ATOM   412  C CD1 . TYR A 1 50  ? 9.915   -12.894 13.797 1.00 20.07 ? 49  TYR A CD1 1 
ATOM   413  C CD2 . TYR A 1 50  ? 11.352  -10.977 13.927 1.00 19.92 ? 49  TYR A CD2 1 
ATOM   414  C CE1 . TYR A 1 50  ? 9.593   -12.576 12.472 1.00 19.48 ? 49  TYR A CE1 1 
ATOM   415  C CE2 . TYR A 1 50  ? 11.036  -10.645 12.598 1.00 22.57 ? 49  TYR A CE2 1 
ATOM   416  C CZ  . TYR A 1 50  ? 10.155  -11.452 11.880 1.00 22.04 ? 49  TYR A CZ  1 
ATOM   417  O OH  . TYR A 1 50  ? 9.838   -11.132 10.575 1.00 21.63 ? 49  TYR A OH  1 
ATOM   418  N N   . GLN A 1 51  ? 10.160  -15.250 16.195 1.00 22.77 ? 50  GLN A N   1 
ATOM   419  C CA  . GLN A 1 51  ? 9.316   -16.337 15.739 1.00 23.48 ? 50  GLN A CA  1 
ATOM   420  C C   . GLN A 1 51  ? 7.951   -15.687 15.645 1.00 23.52 ? 50  GLN A C   1 
ATOM   421  O O   . GLN A 1 51  ? 7.351   -15.343 16.664 1.00 21.79 ? 50  GLN A O   1 
ATOM   422  C CB  . GLN A 1 51  ? 9.299   -17.489 16.756 1.00 23.77 ? 50  GLN A CB  1 
ATOM   423  C CG  . GLN A 1 51  ? 10.651  -18.187 16.906 1.00 24.60 ? 50  GLN A CG  1 
ATOM   424  C CD  . GLN A 1 51  ? 10.615  -19.368 17.858 1.00 26.65 ? 50  GLN A CD  1 
ATOM   425  O OE1 . GLN A 1 51  ? 9.751   -19.459 18.731 1.00 25.77 ? 50  GLN A OE1 1 
ATOM   426  N NE2 . GLN A 1 51  ? 11.556  -20.282 17.691 1.00 28.70 ? 50  GLN A NE2 1 
ATOM   427  N N   . LYS A 1 52  ? 7.512   -15.409 14.420 1.00 21.89 ? 51  LYS A N   1 
ATOM   428  C CA  . LYS A 1 52  ? 6.218   -14.765 14.227 1.00 22.66 ? 51  LYS A CA  1 
ATOM   429  C C   . LYS A 1 52  ? 5.087   -15.669 14.680 1.00 23.88 ? 51  LYS A C   1 
ATOM   430  O O   . LYS A 1 52  ? 5.001   -16.831 14.263 1.00 26.03 ? 51  LYS A O   1 
ATOM   431  C CB  . LYS A 1 52  ? 6.022   -14.355 12.762 1.00 22.53 ? 51  LYS A CB  1 
ATOM   432  C CG  . LYS A 1 52  ? 4.774   -13.507 12.526 1.00 22.58 ? 51  LYS A CG  1 
ATOM   433  C CD  . LYS A 1 52  ? 4.687   -13.042 11.078 1.00 23.10 ? 51  LYS A CD  1 
ATOM   434  C CE  . LYS A 1 52  ? 3.532   -12.074 10.852 1.00 23.26 ? 51  LYS A CE  1 
ATOM   435  N NZ  . LYS A 1 52  ? 2.214   -12.674 11.203 1.00 26.61 ? 51  LYS A NZ  1 
ATOM   436  N N   . ILE A 1 53  ? 4.243   -15.152 15.565 1.00 23.93 ? 52  ILE A N   1 
ATOM   437  C CA  . ILE A 1 53  ? 3.124   -15.925 16.059 1.00 24.14 ? 52  ILE A CA  1 
ATOM   438  C C   . ILE A 1 53  ? 1.805   -15.291 15.655 1.00 23.61 ? 52  ILE A C   1 
ATOM   439  O O   . ILE A 1 53  ? 1.679   -14.065 15.589 1.00 23.42 ? 52  ILE A O   1 
ATOM   440  C CB  . ILE A 1 53  ? 3.206   -16.160 17.590 1.00 27.08 ? 52  ILE A CB  1 
ATOM   441  C CG1 . ILE A 1 53  ? 3.334   -14.836 18.346 1.00 27.42 ? 52  ILE A CG1 1 
ATOM   442  C CG2 . ILE A 1 53  ? 4.394   -17.072 17.911 1.00 27.08 ? 52  ILE A CG2 1 
ATOM   443  C CD1 . ILE A 1 53  ? 3.296   -15.006 19.855 1.00 30.18 ? 52  ILE A CD1 1 
ATOM   444  N N   . SER A 1 54  ? 0.824   -16.136 15.377 1.00 22.26 ? 53  SER A N   1 
ATOM   445  C CA  . SER A 1 54  ? -0.481  -15.685 14.945 1.00 23.11 ? 53  SER A CA  1 
ATOM   446  C C   . SER A 1 54  ? -1.590  -16.396 15.702 1.00 23.78 ? 53  SER A C   1 
ATOM   447  O O   . SER A 1 54  ? -1.582  -17.621 15.841 1.00 26.58 ? 53  SER A O   1 
ATOM   448  C CB  . SER A 1 54  ? -0.628  -15.903 13.434 1.00 24.76 ? 53  SER A CB  1 
ATOM   449  O OG  . SER A 1 54  ? -1.970  -15.741 13.010 1.00 26.41 ? 53  SER A OG  1 
ATOM   450  N N   . ALA A 1 55  ? -2.539  -15.614 16.201 1.00 20.67 ? 54  ALA A N   1 
ATOM   451  C CA  . ALA A 1 55  ? -3.661  -16.152 16.947 1.00 21.25 ? 54  ALA A CA  1 
ATOM   452  C C   . ALA A 1 55  ? -4.598  -16.960 16.051 1.00 22.22 ? 54  ALA A C   1 
ATOM   453  O O   . ALA A 1 55  ? -5.238  -17.895 16.512 1.00 22.38 ? 54  ALA A O   1 
ATOM   454  C CB  . ALA A 1 55  ? -4.418  -15.038 17.621 1.00 20.36 ? 54  ALA A CB  1 
ATOM   455  N N   . THR A 1 56  ? -4.664  -16.601 14.772 1.00 22.79 ? 55  THR A N   1 
ATOM   456  C CA  . THR A 1 56  ? -5.532  -17.294 13.814 1.00 23.06 ? 55  THR A CA  1 
ATOM   457  C C   . THR A 1 56  ? -4.935  -18.615 13.315 1.00 25.19 ? 55  THR A C   1 
ATOM   458  O O   . THR A 1 56  ? -5.655  -19.459 12.764 1.00 26.65 ? 55  THR A O   1 
ATOM   459  C CB  . THR A 1 56  ? -5.847  -16.399 12.596 1.00 21.05 ? 55  THR A CB  1 
ATOM   460  O OG1 . THR A 1 56  ? -4.627  -16.017 11.952 1.00 20.31 ? 55  THR A OG1 1 
ATOM   461  C CG2 . THR A 1 56  ? -6.596  -15.148 13.027 1.00 22.42 ? 55  THR A CG2 1 
ATOM   462  N N   . GLU A 1 57  A -3.620  -18.771 13.481 1.00 24.91 ? 55  GLU A N   1 
ATOM   463  C CA  . GLU A 1 57  A -2.890  -19.981 13.080 1.00 27.84 ? 55  GLU A CA  1 
ATOM   464  C C   . GLU A 1 57  A -2.141  -20.513 14.320 1.00 26.39 ? 55  GLU A C   1 
ATOM   465  O O   . GLU A 1 57  A -0.910  -20.435 14.391 1.00 26.11 ? 55  GLU A O   1 
ATOM   466  C CB  . GLU A 1 57  A -1.883  -19.647 11.965 1.00 30.73 ? 55  GLU A CB  1 
ATOM   467  C CG  . GLU A 1 57  A -2.502  -19.143 10.657 1.00 35.51 ? 55  GLU A CG  1 
ATOM   468  C CD  . GLU A 1 57  A -1.486  -18.458 9.744  1.00 39.19 ? 55  GLU A CD  1 
ATOM   469  O OE1 . GLU A 1 57  A -1.120  -17.296 10.028 1.00 43.16 ? 55  GLU A OE1 1 
ATOM   470  O OE2 . GLU A 1 57  A -1.054  -19.068 8.742  1.00 40.89 ? 55  GLU A OE2 1 
ATOM   471  N N   . PRO A 1 58  ? -2.862  -21.124 15.276 1.00 26.58 ? 56  PRO A N   1 
ATOM   472  C CA  . PRO A 1 58  ? -2.301  -21.675 16.519 1.00 27.78 ? 56  PRO A CA  1 
ATOM   473  C C   . PRO A 1 58  ? -1.003  -22.486 16.425 1.00 29.69 ? 56  PRO A C   1 
ATOM   474  O O   . PRO A 1 58  ? -0.241  -22.546 17.394 1.00 28.86 ? 56  PRO A O   1 
ATOM   475  C CB  . PRO A 1 58  ? -3.452  -22.511 17.073 1.00 28.83 ? 56  PRO A CB  1 
ATOM   476  C CG  . PRO A 1 58  ? -4.651  -21.744 16.626 1.00 27.31 ? 56  PRO A CG  1 
ATOM   477  C CD  . PRO A 1 58  ? -4.307  -21.423 15.195 1.00 25.82 ? 56  PRO A CD  1 
ATOM   478  N N   . ASP A 1 59  ? -0.752  -23.110 15.276 1.00 29.79 ? 57  ASP A N   1 
ATOM   479  C CA  . ASP A 1 59  ? 0.465   -23.897 15.098 1.00 29.61 ? 57  ASP A CA  1 
ATOM   480  C C   . ASP A 1 59  ? 1.730   -23.049 15.212 1.00 27.96 ? 57  ASP A C   1 
ATOM   481  O O   . ASP A 1 59  ? 2.763   -23.537 15.666 1.00 27.84 ? 57  ASP A O   1 
ATOM   482  C CB  . ASP A 1 59  ? 0.448   -24.650 13.764 1.00 32.04 ? 57  ASP A CB  1 
ATOM   483  C CG  . ASP A 1 59  ? -0.413  -25.913 13.806 1.00 35.22 ? 57  ASP A CG  1 
ATOM   484  O OD1 . ASP A 1 59  ? -1.279  -26.044 14.703 1.00 36.09 ? 57  ASP A OD1 1 
ATOM   485  O OD2 . ASP A 1 59  ? -0.220  -26.783 12.928 1.00 37.76 ? 57  ASP A OD2 1 
ATOM   486  N N   . THR A 1 60  ? 1.647   -21.775 14.836 1.00 25.49 ? 58  THR A N   1 
ATOM   487  C CA  . THR A 1 60  ? 2.808   -20.889 14.927 1.00 23.20 ? 58  THR A CA  1 
ATOM   488  C C   . THR A 1 60  ? 3.255   -20.812 16.393 1.00 21.97 ? 58  THR A C   1 
ATOM   489  O O   . THR A 1 60  ? 4.447   -20.786 16.692 1.00 23.94 ? 58  THR A O   1 
ATOM   490  C CB  . THR A 1 60  ? 2.498   -19.459 14.385 1.00 21.29 ? 58  THR A CB  1 
ATOM   491  O OG1 . THR A 1 60  ? 1.307   -18.952 15.001 1.00 18.90 ? 58  THR A OG1 1 
ATOM   492  C CG2 . THR A 1 60  ? 2.309   -19.484 12.871 1.00 21.70 ? 58  THR A CG2 1 
ATOM   493  N N   . ILE A 1 61  ? 2.283   -20.856 17.299 1.00 22.38 ? 59  ILE A N   1 
ATOM   494  C CA  . ILE A 1 61  ? 2.550   -20.804 18.729 1.00 23.36 ? 59  ILE A CA  1 
ATOM   495  C C   . ILE A 1 61  ? 3.016   -22.183 19.208 1.00 25.39 ? 59  ILE A C   1 
ATOM   496  O O   . ILE A 1 61  ? 4.032   -22.309 19.889 1.00 23.94 ? 59  ILE A O   1 
ATOM   497  C CB  . ILE A 1 61  ? 1.285   -20.402 19.513 1.00 22.81 ? 59  ILE A CB  1 
ATOM   498  C CG1 . ILE A 1 61  ? 0.809   -19.019 19.065 1.00 22.93 ? 59  ILE A CG1 1 
ATOM   499  C CG2 . ILE A 1 61  ? 1.562   -20.406 21.010 1.00 22.25 ? 59  ILE A CG2 1 
ATOM   500  C CD1 . ILE A 1 61  ? -0.613  -18.701 19.479 1.00 22.05 ? 59  ILE A CD1 1 
ATOM   501  N N   . LYS A 1 62  ? 2.282   -23.216 18.813 1.00 27.93 ? 60  LYS A N   1 
ATOM   502  C CA  . LYS A 1 62  ? 2.605   -24.585 19.198 1.00 29.53 ? 60  LYS A CA  1 
ATOM   503  C C   . LYS A 1 62  ? 4.034   -24.970 18.805 1.00 30.73 ? 60  LYS A C   1 
ATOM   504  O O   . LYS A 1 62  ? 4.748   -25.605 19.582 1.00 30.77 ? 60  LYS A O   1 
ATOM   505  C CB  . LYS A 1 62  ? 1.605   -25.546 18.558 1.00 30.97 ? 60  LYS A CB  1 
ATOM   506  C CG  . LYS A 1 62  ? 1.262   -26.754 19.410 1.00 34.88 ? 60  LYS A CG  1 
ATOM   507  C CD  . LYS A 1 62  ? 0.290   -27.679 18.691 1.00 35.30 ? 60  LYS A CD  1 
ATOM   508  C CE  . LYS A 1 62  ? -0.929  -26.917 18.185 1.00 36.73 ? 60  LYS A CE  1 
ATOM   509  N NZ  . LYS A 1 62  ? -1.739  -26.337 19.290 1.00 37.10 ? 60  LYS A NZ  1 
ATOM   510  N N   . PHE A 1 63  ? 4.462   -24.552 17.615 1.00 31.57 ? 61  PHE A N   1 
ATOM   511  C CA  . PHE A 1 63  ? 5.804   -24.866 17.129 1.00 32.77 ? 61  PHE A CA  1 
ATOM   512  C C   . PHE A 1 63  ? 6.881   -23.867 17.545 1.00 32.22 ? 61  PHE A C   1 
ATOM   513  O O   . PHE A 1 63  ? 8.057   -24.042 17.210 1.00 30.92 ? 61  PHE A O   1 
ATOM   514  C CB  . PHE A 1 63  ? 5.802   -25.012 15.605 1.00 34.73 ? 61  PHE A CB  1 
ATOM   515  C CG  . PHE A 1 63  ? 5.185   -26.294 15.121 1.00 37.79 ? 61  PHE A CG  1 
ATOM   516  C CD1 . PHE A 1 63  ? 3.804   -26.436 15.056 1.00 38.62 ? 61  PHE A CD1 1 
ATOM   517  C CD2 . PHE A 1 63  ? 5.989   -27.361 14.736 1.00 38.65 ? 61  PHE A CD2 1 
ATOM   518  C CE1 . PHE A 1 63  ? 3.228   -27.625 14.615 1.00 39.74 ? 61  PHE A CE1 1 
ATOM   519  C CE2 . PHE A 1 63  ? 5.426   -28.553 14.293 1.00 39.44 ? 61  PHE A CE2 1 
ATOM   520  C CZ  . PHE A 1 63  ? 4.041   -28.687 14.232 1.00 39.87 ? 61  PHE A CZ  1 
ATOM   521  N N   . SER A 1 64  ? 6.489   -22.822 18.267 1.00 30.54 ? 62  SER A N   1 
ATOM   522  C CA  . SER A 1 64  ? 7.451   -21.815 18.710 1.00 28.29 ? 62  SER A CA  1 
ATOM   523  C C   . SER A 1 64  ? 8.061   -22.238 20.039 1.00 26.80 ? 62  SER A C   1 
ATOM   524  O O   . SER A 1 64  ? 7.683   -23.261 20.609 1.00 26.72 ? 62  SER A O   1 
ATOM   525  C CB  . SER A 1 64  ? 6.768   -20.459 18.888 1.00 25.13 ? 62  SER A CB  1 
ATOM   526  O OG  . SER A 1 64  ? 5.970   -20.455 20.057 1.00 23.49 ? 62  SER A OG  1 
ATOM   527  N N   . ASN A 1 65  ? 8.958   -21.407 20.555 1.00 28.46 ? 63  ASN A N   1 
ATOM   528  C CA  . ASN A 1 65  ? 9.610   -21.674 21.826 1.00 27.93 ? 63  ASN A CA  1 
ATOM   529  C C   . ASN A 1 65  ? 8.864   -20.987 22.976 1.00 26.08 ? 63  ASN A C   1 
ATOM   530  O O   . ASN A 1 65  ? 9.435   -20.742 24.038 1.00 23.02 ? 63  ASN A O   1 
ATOM   531  C CB  . ASN A 1 65  ? 11.066  -21.215 21.780 1.00 30.61 ? 63  ASN A CB  1 
ATOM   532  C CG  . ASN A 1 65  ? 11.906  -21.843 22.878 1.00 34.00 ? 63  ASN A CG  1 
ATOM   533  O OD1 . ASN A 1 65  ? 12.470  -22.922 22.699 1.00 35.89 ? 63  ASN A OD1 1 
ATOM   534  N ND2 . ASN A 1 65  ? 11.983  -21.179 24.023 1.00 35.53 ? 63  ASN A ND2 1 
ATOM   535  N N   . PHE A 1 66  ? 7.594   -20.656 22.743 1.00 23.81 ? 64  PHE A N   1 
ATOM   536  C CA  . PHE A 1 66  ? 6.748   -20.024 23.751 1.00 22.33 ? 64  PHE A CA  1 
ATOM   537  C C   . PHE A 1 66  ? 6.585   -21.023 24.899 1.00 23.44 ? 64  PHE A C   1 
ATOM   538  O O   . PHE A 1 66  ? 6.163   -22.168 24.682 1.00 22.50 ? 64  PHE A O   1 
ATOM   539  C CB  . PHE A 1 66  ? 5.368   -19.685 23.157 1.00 18.01 ? 64  PHE A CB  1 
ATOM   540  C CG  . PHE A 1 66  ? 4.446   -18.968 24.108 1.00 18.94 ? 64  PHE A CG  1 
ATOM   541  C CD1 . PHE A 1 66  ? 3.667   -19.675 25.023 1.00 18.02 ? 64  PHE A CD1 1 
ATOM   542  C CD2 . PHE A 1 66  ? 4.370   -17.571 24.102 1.00 19.24 ? 64  PHE A CD2 1 
ATOM   543  C CE1 . PHE A 1 66  ? 2.828   -19.011 25.924 1.00 18.13 ? 64  PHE A CE1 1 
ATOM   544  C CE2 . PHE A 1 66  ? 3.537   -16.894 24.995 1.00 16.98 ? 64  PHE A CE2 1 
ATOM   545  C CZ  . PHE A 1 66  ? 2.761   -17.612 25.912 1.00 18.04 ? 64  PHE A CZ  1 
ATOM   546  N N   . GLN A 1 67  ? 6.923   -20.596 26.111 1.00 23.06 ? 65  GLN A N   1 
ATOM   547  C CA  . GLN A 1 67  ? 6.815   -21.466 27.277 1.00 22.34 ? 65  GLN A CA  1 
ATOM   548  C C   . GLN A 1 67  ? 5.599   -21.118 28.119 1.00 20.97 ? 65  GLN A C   1 
ATOM   549  O O   . GLN A 1 67  ? 5.505   -20.023 28.677 1.00 20.34 ? 65  GLN A O   1 
ATOM   550  C CB  . GLN A 1 67  ? 8.081   -21.373 28.130 1.00 22.16 ? 65  GLN A CB  1 
ATOM   551  C CG  . GLN A 1 67  ? 9.356   -21.769 27.406 1.00 24.22 ? 65  GLN A CG  1 
ATOM   552  C CD  . GLN A 1 67  ? 9.374   -23.234 27.017 1.00 28.00 ? 65  GLN A CD  1 
ATOM   553  O OE1 . GLN A 1 67  ? 9.665   -23.581 25.873 1.00 30.68 ? 65  GLN A OE1 1 
ATOM   554  N NE2 . GLN A 1 67  ? 9.066   -24.102 27.969 1.00 26.40 ? 65  GLN A NE2 1 
ATOM   555  N N   . LEU A 1 68  ? 4.696   -22.079 28.261 1.00 20.20 ? 66  LEU A N   1 
ATOM   556  C CA  . LEU A 1 68  ? 3.482   -21.888 29.046 1.00 19.15 ? 66  LEU A CA  1 
ATOM   557  C C   . LEU A 1 68  ? 3.747   -21.745 30.543 1.00 18.26 ? 66  LEU A C   1 
ATOM   558  O O   . LEU A 1 68  ? 2.845   -21.396 31.300 1.00 19.15 ? 66  LEU A O   1 
ATOM   559  C CB  . LEU A 1 68  ? 2.521   -23.053 28.812 1.00 20.16 ? 66  LEU A CB  1 
ATOM   560  C CG  . LEU A 1 68  ? 2.085   -23.294 27.364 1.00 21.36 ? 66  LEU A CG  1 
ATOM   561  C CD1 . LEU A 1 68  ? 1.287   -24.596 27.273 1.00 23.53 ? 66  LEU A CD1 1 
ATOM   562  C CD2 . LEU A 1 68  ? 1.270   -22.113 26.878 1.00 20.41 ? 66  LEU A CD2 1 
ATOM   563  N N   . ASP A 1 69  ? 4.963   -22.066 30.979 1.00 21.23 ? 67  ASP A N   1 
ATOM   564  C CA  . ASP A 1 69  ? 5.299   -21.966 32.397 1.00 23.01 ? 67  ASP A CA  1 
ATOM   565  C C   . ASP A 1 69  ? 6.155   -20.735 32.701 1.00 24.57 ? 67  ASP A C   1 
ATOM   566  O O   . ASP A 1 69  ? 6.864   -20.683 33.711 1.00 22.52 ? 67  ASP A O   1 
ATOM   567  C CB  . ASP A 1 69  ? 5.972   -23.262 32.895 1.00 25.89 ? 67  ASP A CB  1 
ATOM   568  C CG  . ASP A 1 69  ? 7.384   -23.461 32.349 1.00 28.74 ? 67  ASP A CG  1 
ATOM   569  O OD1 . ASP A 1 69  ? 7.763   -22.826 31.344 1.00 29.72 ? 67  ASP A OD1 1 
ATOM   570  O OD2 . ASP A 1 69  ? 8.130   -24.273 32.944 1.00 30.80 ? 67  ASP A OD2 1 
ATOM   571  N N   . ARG A 1 70  ? 6.109   -19.768 31.789 1.00 22.70 ? 68  ARG A N   1 
ATOM   572  C CA  . ARG A 1 70  ? 6.852   -18.523 31.920 1.00 23.10 ? 68  ARG A CA  1 
ATOM   573  C C   . ARG A 1 70  ? 5.887   -17.362 31.699 1.00 22.21 ? 68  ARG A C   1 
ATOM   574  O O   . ARG A 1 70  ? 4.846   -17.539 31.068 1.00 20.68 ? 68  ARG A O   1 
ATOM   575  C CB  . ARG A 1 70  ? 8.005   -18.480 30.907 1.00 23.38 ? 68  ARG A CB  1 
ATOM   576  C CG  . ARG A 1 70  ? 9.321   -19.008 31.470 1.00 26.86 ? 68  ARG A CG  1 
ATOM   577  C CD  . ARG A 1 70  ? 10.026  -20.014 30.578 1.00 26.81 ? 68  ARG A CD  1 
ATOM   578  N NE  . ARG A 1 70  ? 10.862  -19.403 29.550 1.00 31.42 ? 68  ARG A NE  1 
ATOM   579  C CZ  . ARG A 1 70  ? 11.996  -19.930 29.087 1.00 30.06 ? 68  ARG A CZ  1 
ATOM   580  N NH1 . ARG A 1 70  ? 12.453  -21.077 29.573 1.00 31.04 ? 68  ARG A NH1 1 
ATOM   581  N NH2 . ARG A 1 70  ? 12.686  -19.301 28.145 1.00 26.87 ? 68  ARG A NH2 1 
ATOM   582  N N   . LYS A 1 71  ? 6.186   -16.212 32.298 1.00 19.69 ? 69  LYS A N   1 
ATOM   583  C CA  . LYS A 1 71  ? 5.358   -15.018 32.144 1.00 20.16 ? 69  LYS A CA  1 
ATOM   584  C C   . LYS A 1 71  ? 5.530   -14.495 30.722 1.00 16.73 ? 69  LYS A C   1 
ATOM   585  O O   . LYS A 1 71  ? 6.524   -14.797 30.056 1.00 17.23 ? 69  LYS A O   1 
ATOM   586  C CB  . LYS A 1 71  ? 5.794   -13.924 33.133 1.00 22.58 ? 69  LYS A CB  1 
ATOM   587  C CG  . LYS A 1 71  ? 5.452   -14.210 34.592 1.00 26.42 ? 69  LYS A CG  1 
ATOM   588  C CD  . LYS A 1 71  ? 6.033   -13.162 35.547 1.00 29.63 ? 69  LYS A CD  1 
ATOM   589  C CE  . LYS A 1 71  ? 5.221   -11.871 35.592 1.00 31.54 ? 69  LYS A CE  1 
ATOM   590  N NZ  . LYS A 1 71  ? 3.851   -12.067 36.160 1.00 34.28 ? 69  LYS A NZ  1 
ATOM   591  N N   . THR A 1 72  ? 4.578   -13.690 30.269 1.00 15.33 ? 70  THR A N   1 
ATOM   592  C CA  . THR A 1 72  ? 4.656   -13.120 28.933 1.00 14.64 ? 70  THR A CA  1 
ATOM   593  C C   . THR A 1 72  ? 4.538   -11.596 28.994 1.00 13.84 ? 70  THR A C   1 
ATOM   594  O O   . THR A 1 72  ? 3.645   -11.063 29.650 1.00 14.17 ? 70  THR A O   1 
ATOM   595  C CB  . THR A 1 72  ? 3.522   -13.655 28.019 1.00 15.92 ? 70  THR A CB  1 
ATOM   596  O OG1 . THR A 1 72  ? 3.639   -15.080 27.879 1.00 14.23 ? 70  THR A OG1 1 
ATOM   597  C CG2 . THR A 1 72  ? 3.614   -13.020 26.635 1.00 15.37 ? 70  THR A CG2 1 
ATOM   598  N N   . ARG A 1 73  ? 5.458   -10.897 28.344 1.00 14.79 ? 71  ARG A N   1 
ATOM   599  C CA  . ARG A 1 73  ? 5.392   -9.439  28.321 1.00 14.76 ? 71  ARG A CA  1 
ATOM   600  C C   . ARG A 1 73  ? 5.368   -8.953  26.886 1.00 13.06 ? 71  ARG A C   1 
ATOM   601  O O   . ARG A 1 73  ? 6.253   -9.294  26.098 1.00 14.48 ? 71  ARG A O   1 
ATOM   602  C CB  . ARG A 1 73  ? 6.577   -8.802  29.052 1.00 13.13 ? 71  ARG A CB  1 
ATOM   603  C CG  . ARG A 1 73  ? 6.712   -9.257  30.498 1.00 13.23 ? 71  ARG A CG  1 
ATOM   604  C CD  . ARG A 1 73  ? 7.806   -8.473  31.204 1.00 13.80 ? 71  ARG A CD  1 
ATOM   605  N NE  . ARG A 1 73  ? 8.247   -9.185  32.400 1.00 15.51 ? 71  ARG A NE  1 
ATOM   606  C CZ  . ARG A 1 73  ? 7.643   -9.140  33.583 1.00 15.79 ? 71  ARG A CZ  1 
ATOM   607  N NH1 . ARG A 1 73  ? 6.559   -8.397  33.767 1.00 14.89 ? 71  ARG A NH1 1 
ATOM   608  N NH2 . ARG A 1 73  ? 8.099   -9.895  34.582 1.00 15.16 ? 71  ARG A NH2 1 
ATOM   609  N N   . PHE A 1 74  ? 4.304   -8.241  26.532 1.00 13.36 ? 72  PHE A N   1 
ATOM   610  C CA  . PHE A 1 74  ? 4.174   -7.664  25.192 1.00 13.13 ? 72  PHE A CA  1 
ATOM   611  C C   . PHE A 1 74  ? 4.788   -6.271  25.267 1.00 12.63 ? 72  PHE A C   1 
ATOM   612  O O   . PHE A 1 74  ? 4.598   -5.579  26.266 1.00 11.52 ? 72  PHE A O   1 
ATOM   613  C CB  . PHE A 1 74  ? 2.702   -7.498  24.812 1.00 12.23 ? 72  PHE A CB  1 
ATOM   614  C CG  . PHE A 1 74  ? 2.009   -8.778  24.435 1.00 15.09 ? 72  PHE A CG  1 
ATOM   615  C CD1 . PHE A 1 74  ? 1.773   -9.771  25.381 1.00 14.89 ? 72  PHE A CD1 1 
ATOM   616  C CD2 . PHE A 1 74  ? 1.545   -8.963  23.135 1.00 17.42 ? 72  PHE A CD2 1 
ATOM   617  C CE1 . PHE A 1 74  ? 1.072   -10.939 25.038 1.00 15.58 ? 72  PHE A CE1 1 
ATOM   618  C CE2 . PHE A 1 74  ? 0.848   -10.118 22.779 1.00 13.77 ? 72  PHE A CE2 1 
ATOM   619  C CZ  . PHE A 1 74  ? 0.608   -11.109 23.737 1.00 15.31 ? 72  PHE A CZ  1 
ATOM   620  N N   . ILE A 1 75  ? 5.526   -5.865  24.235 1.00 13.17 ? 73  ILE A N   1 
ATOM   621  C CA  . ILE A 1 75  ? 6.123   -4.531  24.201 1.00 14.60 ? 73  ILE A CA  1 
ATOM   622  C C   . ILE A 1 75  ? 5.600   -3.890  22.913 1.00 14.68 ? 73  ILE A C   1 
ATOM   623  O O   . ILE A 1 75  ? 5.829   -4.409  21.818 1.00 16.10 ? 73  ILE A O   1 
ATOM   624  C CB  . ILE A 1 75  ? 7.668   -4.571  24.226 1.00 14.67 ? 73  ILE A CB  1 
ATOM   625  C CG1 . ILE A 1 75  ? 8.160   -5.412  25.412 1.00 16.48 ? 73  ILE A CG1 1 
ATOM   626  C CG2 . ILE A 1 75  ? 8.209   -3.152  24.405 1.00 17.75 ? 73  ILE A CG2 1 
ATOM   627  C CD1 . ILE A 1 75  ? 9.663   -5.534  25.503 1.00 17.85 ? 73  ILE A CD1 1 
ATOM   628  N N   . VAL A 1 76  ? 4.884   -2.777  23.057 1.00 14.42 ? 74  VAL A N   1 
ATOM   629  C CA  . VAL A 1 76  ? 4.255   -2.097  21.930 1.00 14.54 ? 74  VAL A CA  1 
ATOM   630  C C   . VAL A 1 76  ? 4.805   -0.684  21.748 1.00 17.48 ? 74  VAL A C   1 
ATOM   631  O O   . VAL A 1 76  ? 4.862   0.103   22.700 1.00 15.81 ? 74  VAL A O   1 
ATOM   632  C CB  . VAL A 1 76  ? 2.715   -2.022  22.129 1.00 13.14 ? 74  VAL A CB  1 
ATOM   633  C CG1 . VAL A 1 76  ? 2.019   -1.524  20.831 1.00 13.70 ? 74  VAL A CG1 1 
ATOM   634  C CG2 . VAL A 1 76  ? 2.154   -3.378  22.566 1.00 12.86 ? 74  VAL A CG2 1 
ATOM   635  N N   . HIS A 1 77  ? 5.217   -0.371  20.523 1.00 16.58 ? 75  HIS A N   1 
ATOM   636  C CA  . HIS A 1 77  ? 5.765   0.944   20.220 1.00 15.87 ? 75  HIS A CA  1 
ATOM   637  C C   . HIS A 1 77  ? 4.684   1.978   19.930 1.00 15.42 ? 75  HIS A C   1 
ATOM   638  O O   . HIS A 1 77  ? 3.481   1.676   19.876 1.00 14.22 ? 75  HIS A O   1 
ATOM   639  C CB  . HIS A 1 77  ? 6.730   0.876   19.027 1.00 17.19 ? 75  HIS A CB  1 
ATOM   640  C CG  . HIS A 1 77  ? 6.044   0.671   17.708 1.00 18.94 ? 75  HIS A CG  1 
ATOM   641  N ND1 . HIS A 1 77  ? 6.046   -0.539  17.049 1.00 21.37 ? 75  HIS A ND1 1 
ATOM   642  C CD2 . HIS A 1 77  ? 5.307   1.514   16.943 1.00 19.97 ? 75  HIS A CD2 1 
ATOM   643  C CE1 . HIS A 1 77  ? 5.339   -0.434  15.937 1.00 22.44 ? 75  HIS A CE1 1 
ATOM   644  N NE2 . HIS A 1 77  ? 4.878   0.801   15.850 1.00 23.57 ? 75  HIS A NE2 1 
ATOM   645  N N   . GLY A 1 78  ? 5.159   3.193   19.699 1.00 17.44 ? 76  GLY A N   1 
ATOM   646  C CA  . GLY A 1 78  ? 4.321   4.321   19.358 1.00 14.79 ? 76  GLY A CA  1 
ATOM   647  C C   . GLY A 1 78  ? 5.280   5.144   18.520 1.00 18.64 ? 76  GLY A C   1 
ATOM   648  O O   . GLY A 1 78  ? 5.855   4.639   17.549 1.00 18.24 ? 76  GLY A O   1 
ATOM   649  N N   . PHE A 1 79  ? 5.522   6.381   18.931 1.00 19.31 ? 77  PHE A N   1 
ATOM   650  C CA  . PHE A 1 79  ? 6.452   7.253   18.222 1.00 22.60 ? 77  PHE A CA  1 
ATOM   651  C C   . PHE A 1 79  ? 7.832   6.586   18.158 1.00 24.30 ? 77  PHE A C   1 
ATOM   652  O O   . PHE A 1 79  ? 8.364   6.145   19.185 1.00 24.96 ? 77  PHE A O   1 
ATOM   653  C CB  . PHE A 1 79  ? 6.559   8.603   18.953 1.00 22.36 ? 77  PHE A CB  1 
ATOM   654  C CG  . PHE A 1 79  ? 7.433   9.602   18.250 1.00 23.84 ? 77  PHE A CG  1 
ATOM   655  C CD1 . PHE A 1 79  ? 8.813   9.603   18.444 1.00 24.27 ? 77  PHE A CD1 1 
ATOM   656  C CD2 . PHE A 1 79  ? 6.882   10.517  17.356 1.00 25.87 ? 77  PHE A CD2 1 
ATOM   657  C CE1 . PHE A 1 79  ? 9.635   10.500  17.753 1.00 25.42 ? 77  PHE A CE1 1 
ATOM   658  C CE2 . PHE A 1 79  ? 7.696   11.418  16.662 1.00 25.12 ? 77  PHE A CE2 1 
ATOM   659  C CZ  . PHE A 1 79  ? 9.071   11.408  16.859 1.00 24.14 ? 77  PHE A CZ  1 
ATOM   660  N N   . ILE A 1 80  ? 8.383   6.452   16.954 1.00 22.46 ? 78  ILE A N   1 
ATOM   661  C CA  . ILE A 1 80  ? 9.703   5.860   16.795 1.00 25.65 ? 78  ILE A CA  1 
ATOM   662  C C   . ILE A 1 80  ? 10.655  6.906   16.236 1.00 26.81 ? 78  ILE A C   1 
ATOM   663  O O   . ILE A 1 80  ? 10.527  7.338   15.088 1.00 26.39 ? 78  ILE A O   1 
ATOM   664  C CB  . ILE A 1 80  ? 9.708   4.609   15.874 1.00 27.12 ? 78  ILE A CB  1 
ATOM   665  C CG1 . ILE A 1 80  ? 8.753   3.537   16.418 1.00 27.54 ? 78  ILE A CG1 1 
ATOM   666  C CG2 . ILE A 1 80  ? 11.122  4.038   15.790 1.00 27.51 ? 78  ILE A CG2 1 
ATOM   667  C CD1 . ILE A 1 80  ? 8.778   2.227   15.640 1.00 29.44 ? 78  ILE A CD1 1 
ATOM   668  N N   . ASP A 1 81  ? 11.584  7.340   17.075 1.00 29.45 ? 79  ASP A N   1 
ATOM   669  C CA  . ASP A 1 81  ? 12.567  8.339   16.684 1.00 31.62 ? 79  ASP A CA  1 
ATOM   670  C C   . ASP A 1 81  ? 13.622  7.672   15.812 1.00 33.08 ? 79  ASP A C   1 
ATOM   671  O O   . ASP A 1 81  ? 13.795  6.448   15.849 1.00 31.77 ? 79  ASP A O   1 
ATOM   672  C CB  . ASP A 1 81  ? 13.217  8.956   17.930 1.00 32.82 ? 79  ASP A CB  1 
ATOM   673  C CG  . ASP A 1 81  ? 13.926  10.272  17.640 1.00 35.18 ? 79  ASP A CG  1 
ATOM   674  O OD1 . ASP A 1 81  ? 13.618  10.917  16.615 1.00 35.45 ? 79  ASP A OD1 1 
ATOM   675  O OD2 . ASP A 1 81  ? 14.791  10.669  18.450 1.00 35.37 ? 79  ASP A OD2 1 
ATOM   676  N N   . LYS A 1 82  ? 14.318  8.480   15.022 1.00 34.29 ? 80  LYS A N   1 
ATOM   677  C CA  . LYS A 1 82  ? 15.359  7.984   14.134 1.00 35.67 ? 80  LYS A CA  1 
ATOM   678  C C   . LYS A 1 82  ? 16.410  7.200   14.924 1.00 35.97 ? 80  LYS A C   1 
ATOM   679  O O   . LYS A 1 82  ? 16.917  7.672   15.946 1.00 36.17 ? 80  LYS A O   1 
ATOM   680  C CB  . LYS A 1 82  ? 16.009  9.156   13.382 1.00 36.82 ? 80  LYS A CB  1 
ATOM   681  C CG  . LYS A 1 82  ? 16.962  8.752   12.258 1.00 39.27 ? 80  LYS A CG  1 
ATOM   682  C CD  . LYS A 1 82  ? 16.464  9.198   10.879 1.00 41.81 ? 80  LYS A CD  1 
ATOM   683  C CE  . LYS A 1 82  ? 15.289  8.358   10.355 1.00 43.12 ? 80  LYS A CE  1 
ATOM   684  N NZ  . LYS A 1 82  ? 13.992  8.601   11.062 1.00 43.95 ? 80  LYS A NZ  1 
ATOM   685  N N   . GLY A 1 83  ? 16.670  5.971   14.484 1.00 32.90 ? 81  GLY A N   1 
ATOM   686  C CA  . GLY A 1 83  ? 17.661  5.130   15.134 1.00 31.53 ? 81  GLY A CA  1 
ATOM   687  C C   . GLY A 1 83  ? 17.182  4.358   16.351 1.00 30.79 ? 81  GLY A C   1 
ATOM   688  O O   . GLY A 1 83  ? 17.956  3.607   16.947 1.00 32.16 ? 81  GLY A O   1 
ATOM   689  N N   . GLU A 1 84  ? 15.915  4.515   16.717 1.00 29.67 ? 82  GLU A N   1 
ATOM   690  C CA  . GLU A 1 84  ? 15.366  3.821   17.882 1.00 31.25 ? 82  GLU A CA  1 
ATOM   691  C C   . GLU A 1 84  ? 14.497  2.623   17.510 1.00 31.10 ? 82  GLU A C   1 
ATOM   692  O O   . GLU A 1 84  ? 13.808  2.052   18.361 1.00 31.49 ? 82  GLU A O   1 
ATOM   693  C CB  . GLU A 1 84  ? 14.549  4.797   18.731 1.00 30.57 ? 82  GLU A CB  1 
ATOM   694  C CG  . GLU A 1 84  ? 15.378  5.893   19.374 1.00 31.04 ? 82  GLU A CG  1 
ATOM   695  C CD  . GLU A 1 84  ? 16.350  5.351   20.402 1.00 32.38 ? 82  GLU A CD  1 
ATOM   696  O OE1 . GLU A 1 84  ? 15.883  4.841   21.439 1.00 33.20 ? 82  GLU A OE1 1 
ATOM   697  O OE2 . GLU A 1 84  ? 17.577  5.419   20.170 1.00 32.25 ? 82  GLU A OE2 1 
ATOM   698  N N   . ASP A 1 85  ? 14.561  2.222   16.247 1.00 30.39 ? 83  ASP A N   1 
ATOM   699  C CA  . ASP A 1 85  ? 13.761  1.108   15.754 1.00 31.54 ? 83  ASP A CA  1 
ATOM   700  C C   . ASP A 1 85  ? 13.900  -0.155  16.601 1.00 30.61 ? 83  ASP A C   1 
ATOM   701  O O   . ASP A 1 85  ? 12.912  -0.840  16.874 1.00 31.34 ? 83  ASP A O   1 
ATOM   702  C CB  . ASP A 1 85  ? 14.124  0.809   14.297 1.00 33.93 ? 83  ASP A CB  1 
ATOM   703  C CG  . ASP A 1 85  ? 13.925  2.010   13.390 1.00 35.47 ? 83  ASP A CG  1 
ATOM   704  O OD1 . ASP A 1 85  ? 12.804  2.175   12.868 1.00 36.95 ? 83  ASP A OD1 1 
ATOM   705  O OD2 . ASP A 1 85  ? 14.886  2.792   13.211 1.00 36.21 ? 83  ASP A OD2 1 
ATOM   706  N N   . GLY A 1 86  ? 15.112  -0.419  17.070 1.00 30.42 ? 84  GLY A N   1 
ATOM   707  C CA  . GLY A 1 86  ? 15.355  -1.607  17.866 1.00 29.46 ? 84  GLY A CA  1 
ATOM   708  C C   . GLY A 1 86  ? 15.254  -1.484  19.374 1.00 28.23 ? 84  GLY A C   1 
ATOM   709  O O   . GLY A 1 86  ? 15.949  -2.217  20.087 1.00 29.62 ? 84  GLY A O   1 
ATOM   710  N N   . TRP A 1 87  ? 14.412  -0.590  19.887 1.00 25.38 ? 85  TRP A N   1 
ATOM   711  C CA  . TRP A 1 87  ? 14.299  -0.472  21.334 1.00 23.22 ? 85  TRP A CA  1 
ATOM   712  C C   . TRP A 1 87  ? 13.456  -1.571  21.981 1.00 24.54 ? 85  TRP A C   1 
ATOM   713  O O   . TRP A 1 87  ? 13.666  -1.904  23.154 1.00 22.51 ? 85  TRP A O   1 
ATOM   714  C CB  . TRP A 1 87  ? 13.838  0.927   21.769 1.00 21.42 ? 85  TRP A CB  1 
ATOM   715  C CG  . TRP A 1 87  ? 12.377  1.254   21.643 1.00 19.44 ? 85  TRP A CG  1 
ATOM   716  C CD1 . TRP A 1 87  ? 11.792  2.009   20.667 1.00 18.35 ? 85  TRP A CD1 1 
ATOM   717  C CD2 . TRP A 1 87  ? 11.327  0.927   22.576 1.00 16.57 ? 85  TRP A CD2 1 
ATOM   718  N NE1 . TRP A 1 87  ? 10.460  2.185   20.931 1.00 16.60 ? 85  TRP A NE1 1 
ATOM   719  C CE2 . TRP A 1 87  ? 10.145  1.530   22.097 1.00 15.61 ? 85  TRP A CE2 1 
ATOM   720  C CE3 . TRP A 1 87  ? 11.274  0.190   23.767 1.00 16.61 ? 85  TRP A CE3 1 
ATOM   721  C CZ2 . TRP A 1 87  ? 8.924   1.421   22.760 1.00 12.69 ? 85  TRP A CZ2 1 
ATOM   722  C CZ3 . TRP A 1 87  ? 10.059  0.079   24.429 1.00 12.84 ? 85  TRP A CZ3 1 
ATOM   723  C CH2 . TRP A 1 87  ? 8.899   0.693   23.926 1.00 16.72 ? 85  TRP A CH2 1 
ATOM   724  N N   . LEU A 1 88  ? 12.522  -2.150  21.230 1.00 23.36 ? 86  LEU A N   1 
ATOM   725  C CA  . LEU A 1 88  ? 11.673  -3.214  21.774 1.00 25.20 ? 86  LEU A CA  1 
ATOM   726  C C   . LEU A 1 88  ? 12.535  -4.448  22.067 1.00 25.07 ? 86  LEU A C   1 
ATOM   727  O O   . LEU A 1 88  ? 12.533  -4.974  23.188 1.00 23.36 ? 86  LEU A O   1 
ATOM   728  C CB  . LEU A 1 88  ? 10.542  -3.589  20.800 1.00 26.01 ? 86  LEU A CB  1 
ATOM   729  C CG  . LEU A 1 88  ? 9.526   -2.539  20.328 1.00 26.51 ? 86  LEU A CG  1 
ATOM   730  C CD1 . LEU A 1 88  ? 8.521   -3.183  19.396 1.00 26.80 ? 86  LEU A CD1 1 
ATOM   731  C CD2 . LEU A 1 88  ? 8.805   -1.927  21.471 1.00 26.63 ? 86  LEU A CD2 1 
ATOM   732  N N   . LEU A 1 89  ? 13.300  -4.875  21.065 1.00 22.71 ? 87  LEU A N   1 
ATOM   733  C CA  . LEU A 1 89  ? 14.169  -6.035  21.215 1.00 24.02 ? 87  LEU A CA  1 
ATOM   734  C C   . LEU A 1 89  ? 15.260  -5.757  22.246 1.00 24.31 ? 87  LEU A C   1 
ATOM   735  O O   . LEU A 1 89  ? 15.648  -6.650  22.998 1.00 24.53 ? 87  LEU A O   1 
ATOM   736  C CB  . LEU A 1 89  ? 14.791  -6.436  19.876 1.00 21.93 ? 87  LEU A CB  1 
ATOM   737  C CG  . LEU A 1 89  ? 15.749  -7.627  19.963 1.00 21.61 ? 87  LEU A CG  1 
ATOM   738  C CD1 . LEU A 1 89  ? 15.053  -8.802  20.638 1.00 20.80 ? 87  LEU A CD1 1 
ATOM   739  C CD2 . LEU A 1 89  ? 16.256  -8.010  18.581 1.00 21.50 ? 87  LEU A CD2 1 
ATOM   740  N N   . ASP A 1 90  ? 15.780  -4.532  22.264 1.00 24.93 ? 88  ASP A N   1 
ATOM   741  C CA  . ASP A 1 90  ? 16.797  -4.185  23.249 1.00 25.17 ? 88  ASP A CA  1 
ATOM   742  C C   . ASP A 1 90  ? 16.194  -4.413  24.640 1.00 23.65 ? 88  ASP A C   1 
ATOM   743  O O   . ASP A 1 90  ? 16.839  -5.002  25.510 1.00 20.04 ? 88  ASP A O   1 
ATOM   744  C CB  . ASP A 1 90  ? 17.239  -2.725  23.100 1.00 30.21 ? 88  ASP A CB  1 
ATOM   745  C CG  . ASP A 1 90  ? 18.202  -2.294  24.196 1.00 33.53 ? 88  ASP A CG  1 
ATOM   746  O OD1 . ASP A 1 90  ? 19.399  -2.649  24.118 1.00 37.50 ? 88  ASP A OD1 1 
ATOM   747  O OD2 . ASP A 1 90  ? 17.760  -1.608  25.142 1.00 36.03 ? 88  ASP A OD2 1 
ATOM   748  N N   . MET A 1 91  ? 14.942  -3.991  24.827 1.00 20.76 ? 89  MET A N   1 
ATOM   749  C CA  . MET A 1 91  ? 14.263  -4.164  26.110 1.00 21.55 ? 89  MET A CA  1 
ATOM   750  C C   . MET A 1 91  ? 14.092  -5.653  26.444 1.00 22.20 ? 89  MET A C   1 
ATOM   751  O O   . MET A 1 91  ? 14.297  -6.066  27.587 1.00 17.61 ? 89  MET A O   1 
ATOM   752  C CB  . MET A 1 91  ? 12.904  -3.448  26.129 1.00 21.92 ? 89  MET A CB  1 
ATOM   753  C CG  . MET A 1 91  ? 12.256  -3.455  27.512 1.00 22.80 ? 89  MET A CG  1 
ATOM   754  S SD  . MET A 1 91  ? 10.764  -2.459  27.743 1.00 27.37 ? 89  MET A SD  1 
ATOM   755  C CE  . MET A 1 91  ? 11.505  -0.834  27.999 1.00 27.03 ? 89  MET A CE  1 
ATOM   756  N N   . CYS A 1 92  ? 13.701  -6.457  25.458 1.00 20.12 ? 90  CYS A N   1 
ATOM   757  C CA  . CYS A 1 92  ? 13.552  -7.895  25.689 1.00 18.72 ? 90  CYS A CA  1 
ATOM   758  C C   . CYS A 1 92  ? 14.873  -8.485  26.184 1.00 16.55 ? 90  CYS A C   1 
ATOM   759  O O   . CYS A 1 92  ? 14.891  -9.255  27.145 1.00 18.62 ? 90  CYS A O   1 
ATOM   760  C CB  . CYS A 1 92  ? 13.148  -8.632  24.410 1.00 18.10 ? 90  CYS A CB  1 
ATOM   761  S SG  . CYS A 1 92  ? 11.445  -8.387  23.827 1.00 19.80 ? 90  CYS A SG  1 
ATOM   762  N N   . LYS A 1 93  ? 15.976  -8.112  25.535 1.00 18.66 ? 91  LYS A N   1 
ATOM   763  C CA  . LYS A 1 93  ? 17.295  -8.627  25.898 1.00 17.64 ? 91  LYS A CA  1 
ATOM   764  C C   . LYS A 1 93  ? 17.703  -8.286  27.320 1.00 20.56 ? 91  LYS A C   1 
ATOM   765  O O   . LYS A 1 93  ? 18.367  -9.085  27.975 1.00 18.71 ? 91  LYS A O   1 
ATOM   766  C CB  . LYS A 1 93  ? 18.362  -8.182  24.895 1.00 19.57 ? 91  LYS A CB  1 
ATOM   767  C CG  . LYS A 1 93  ? 18.163  -8.789  23.511 1.00 20.04 ? 91  LYS A CG  1 
ATOM   768  C CD  . LYS A 1 93  ? 19.252  -8.391  22.546 1.00 22.50 ? 91  LYS A CD  1 
ATOM   769  C CE  . LYS A 1 93  ? 18.958  -8.940  21.152 1.00 23.13 ? 91  LYS A CE  1 
ATOM   770  N NZ  . LYS A 1 93  ? 19.911  -8.431  20.125 1.00 25.56 ? 91  LYS A NZ  1 
ATOM   771  N N   . LYS A 1 94  ? 17.319  -7.104  27.800 1.00 22.03 ? 92  LYS A N   1 
ATOM   772  C CA  . LYS A 1 94  ? 17.638  -6.730  29.173 1.00 20.59 ? 92  LYS A CA  1 
ATOM   773  C C   . LYS A 1 94  ? 16.849  -7.628  30.123 1.00 21.11 ? 92  LYS A C   1 
ATOM   774  O O   . LYS A 1 94  ? 17.381  -8.093  31.136 1.00 18.83 ? 92  LYS A O   1 
ATOM   775  C CB  . LYS A 1 94  ? 17.346  -5.249  29.425 1.00 20.66 ? 92  LYS A CB  1 
ATOM   776  C CG  . LYS A 1 94  ? 18.351  -4.318  28.746 1.00 21.41 ? 92  LYS A CG  1 
ATOM   777  C CD  . LYS A 1 94  ? 18.006  -2.859  29.003 1.00 21.06 ? 92  LYS A CD  1 
ATOM   778  C CE  . LYS A 1 94  ? 18.908  -1.935  28.209 1.00 22.25 ? 92  LYS A CE  1 
ATOM   779  N NZ  . LYS A 1 94  ? 20.344  -2.121  28.525 1.00 24.57 ? 92  LYS A NZ  1 
ATOM   780  N N   . MET A 1 95  ? 15.586  -7.894  29.781 1.00 18.35 ? 93  MET A N   1 
ATOM   781  C CA  . MET A 1 95  ? 14.740  -8.769  30.590 1.00 18.40 ? 93  MET A CA  1 
ATOM   782  C C   . MET A 1 95  ? 15.357  -10.166 30.641 1.00 18.82 ? 93  MET A C   1 
ATOM   783  O O   . MET A 1 95  ? 15.405  -10.793 31.702 1.00 16.69 ? 93  MET A O   1 
ATOM   784  C CB  . MET A 1 95  ? 13.327  -8.883  29.999 1.00 18.20 ? 93  MET A CB  1 
ATOM   785  C CG  . MET A 1 95  ? 12.443  -7.641  30.120 1.00 18.63 ? 93  MET A CG  1 
ATOM   786  S SD  . MET A 1 95  ? 10.891  -7.815  29.190 1.00 20.52 ? 93  MET A SD  1 
ATOM   787  C CE  . MET A 1 95  ? 10.151  -6.206  29.440 1.00 18.29 ? 93  MET A CE  1 
ATOM   788  N N   . PHE A 1 96  ? 15.837  -10.641 29.491 1.00 20.74 ? 94  PHE A N   1 
ATOM   789  C CA  . PHE A 1 96  ? 16.454  -11.967 29.396 1.00 22.58 ? 94  PHE A CA  1 
ATOM   790  C C   . PHE A 1 96  ? 17.612  -12.125 30.381 1.00 23.06 ? 94  PHE A C   1 
ATOM   791  O O   . PHE A 1 96  ? 17.906  -13.233 30.825 1.00 25.07 ? 94  PHE A O   1 
ATOM   792  C CB  . PHE A 1 96  ? 16.964  -12.239 27.978 1.00 20.15 ? 94  PHE A CB  1 
ATOM   793  C CG  . PHE A 1 96  ? 15.871  -12.409 26.955 1.00 19.64 ? 94  PHE A CG  1 
ATOM   794  C CD1 . PHE A 1 96  ? 14.602  -12.838 27.332 1.00 19.79 ? 94  PHE A CD1 1 
ATOM   795  C CD2 . PHE A 1 96  ? 16.106  -12.108 25.621 1.00 20.93 ? 94  PHE A CD2 1 
ATOM   796  C CE1 . PHE A 1 96  ? 13.576  -12.966 26.381 1.00 19.90 ? 94  PHE A CE1 1 
ATOM   797  C CE2 . PHE A 1 96  ? 15.093  -12.232 24.671 1.00 18.38 ? 94  PHE A CE2 1 
ATOM   798  C CZ  . PHE A 1 96  ? 13.833  -12.656 25.052 1.00 18.33 ? 94  PHE A CZ  1 
ATOM   799  N N   . GLN A 1 97  ? 18.280  -11.018 30.689 1.00 25.00 ? 95  GLN A N   1 
ATOM   800  C CA  . GLN A 1 97  ? 19.406  -11.028 31.617 1.00 25.80 ? 95  GLN A CA  1 
ATOM   801  C C   . GLN A 1 97  ? 18.999  -11.335 33.052 1.00 24.70 ? 95  GLN A C   1 
ATOM   802  O O   . GLN A 1 97  ? 19.837  -11.757 33.851 1.00 27.35 ? 95  GLN A O   1 
ATOM   803  C CB  . GLN A 1 97  ? 20.131  -9.677  31.606 1.00 24.45 ? 95  GLN A CB  1 
ATOM   804  C CG  . GLN A 1 97  ? 20.930  -9.384  30.359 1.00 26.25 ? 95  GLN A CG  1 
ATOM   805  C CD  . GLN A 1 97  ? 21.600  -8.024  30.417 1.00 28.17 ? 95  GLN A CD  1 
ATOM   806  O OE1 . GLN A 1 97  ? 21.281  -7.132  29.638 1.00 30.90 ? 95  GLN A OE1 1 
ATOM   807  N NE2 . GLN A 1 97  ? 22.539  -7.864  31.337 1.00 27.71 ? 95  GLN A NE2 1 
ATOM   808  N N   . VAL A 1 98  ? 17.730  -11.126 33.390 1.00 24.99 ? 96  VAL A N   1 
ATOM   809  C CA  . VAL A 1 98  ? 17.276  -11.350 34.762 1.00 24.25 ? 96  VAL A CA  1 
ATOM   810  C C   . VAL A 1 98  ? 16.093  -12.298 34.961 1.00 23.35 ? 96  VAL A C   1 
ATOM   811  O O   . VAL A 1 98  ? 15.748  -12.626 36.100 1.00 22.62 ? 96  VAL A O   1 
ATOM   812  C CB  . VAL A 1 98  ? 16.935  -9.998  35.459 1.00 24.75 ? 96  VAL A CB  1 
ATOM   813  C CG1 . VAL A 1 98  ? 18.087  -9.015  35.297 1.00 26.23 ? 96  VAL A CG1 1 
ATOM   814  C CG2 . VAL A 1 98  ? 15.640  -9.402  34.891 1.00 26.60 ? 96  VAL A CG2 1 
ATOM   815  N N   . GLU A 1 99  ? 15.450  -12.730 33.881 1.00 20.46 ? 97  GLU A N   1 
ATOM   816  C CA  . GLU A 1 99  ? 14.304  -13.618 34.029 1.00 19.03 ? 97  GLU A CA  1 
ATOM   817  C C   . GLU A 1 99  ? 14.058  -14.425 32.761 1.00 20.83 ? 97  GLU A C   1 
ATOM   818  O O   . GLU A 1 99  ? 14.600  -14.103 31.703 1.00 21.32 ? 97  GLU A O   1 
ATOM   819  C CB  . GLU A 1 99  ? 13.050  -12.793 34.334 1.00 22.25 ? 97  GLU A CB  1 
ATOM   820  C CG  . GLU A 1 99  ? 12.680  -11.814 33.202 1.00 22.72 ? 97  GLU A CG  1 
ATOM   821  C CD  . GLU A 1 99  ? 11.294  -11.195 33.339 1.00 26.36 ? 97  GLU A CD  1 
ATOM   822  O OE1 . GLU A 1 99  ? 10.581  -11.475 34.329 1.00 28.36 ? 97  GLU A OE1 1 
ATOM   823  O OE2 . GLU A 1 99  ? 10.911  -10.418 32.439 1.00 24.76 ? 97  GLU A OE2 1 
ATOM   824  N N   . LYS A 1 100 ? 13.258  -15.481 32.892 1.00 20.13 ? 98  LYS A N   1 
ATOM   825  C CA  . LYS A 1 100 ? 12.879  -16.330 31.763 1.00 20.70 ? 98  LYS A CA  1 
ATOM   826  C C   . LYS A 1 100 ? 11.534  -15.755 31.352 1.00 16.86 ? 98  LYS A C   1 
ATOM   827  O O   . LYS A 1 100 ? 10.609  -15.709 32.161 1.00 19.62 ? 98  LYS A O   1 
ATOM   828  C CB  . LYS A 1 100 ? 12.701  -17.777 32.221 1.00 22.14 ? 98  LYS A CB  1 
ATOM   829  C CG  . LYS A 1 100 ? 13.993  -18.475 32.612 1.00 25.32 ? 98  LYS A CG  1 
ATOM   830  C CD  . LYS A 1 100 ? 14.906  -18.672 31.414 1.00 26.28 ? 98  LYS A CD  1 
ATOM   831  C CE  . LYS A 1 100 ? 16.051  -19.623 31.749 1.00 28.35 ? 98  LYS A CE  1 
ATOM   832  N NZ  . LYS A 1 100 ? 16.933  -19.052 32.794 1.00 29.92 ? 98  LYS A NZ  1 
ATOM   833  N N   . VAL A 1 101 ? 11.408  -15.326 30.105 1.00 19.62 ? 99  VAL A N   1 
ATOM   834  C CA  . VAL A 1 101 ? 10.163  -14.709 29.681 1.00 15.11 ? 99  VAL A CA  1 
ATOM   835  C C   . VAL A 1 101 ? 9.898   -14.828 28.186 1.00 11.62 ? 99  VAL A C   1 
ATOM   836  O O   . VAL A 1 101 ? 10.820  -14.949 27.383 1.00 13.88 ? 99  VAL A O   1 
ATOM   837  C CB  . VAL A 1 101 ? 10.179  -13.185 30.066 1.00 15.54 ? 99  VAL A CB  1 
ATOM   838  C CG1 . VAL A 1 101 ? 11.309  -12.450 29.326 1.00 15.95 ? 99  VAL A CG1 1 
ATOM   839  C CG2 . VAL A 1 101 ? 8.830   -12.523 29.775 1.00 18.84 ? 99  VAL A CG2 1 
ATOM   840  N N   . ASN A 1 102 ? 8.617   -14.865 27.849 1.00 13.67 ? 100 ASN A N   1 
ATOM   841  C CA  . ASN A 1 102 ? 8.161   -14.893 26.465 1.00 13.63 ? 100 ASN A CA  1 
ATOM   842  C C   . ASN A 1 102 ? 8.008   -13.399 26.176 1.00 12.56 ? 100 ASN A C   1 
ATOM   843  O O   . ASN A 1 102 ? 7.106   -12.759 26.710 1.00 15.61 ? 100 ASN A O   1 
ATOM   844  C CB  . ASN A 1 102 ? 6.796   -15.577 26.380 1.00 13.58 ? 100 ASN A CB  1 
ATOM   845  C CG  . ASN A 1 102 ? 6.836   -17.010 26.871 1.00 13.68 ? 100 ASN A CG  1 
ATOM   846  O OD1 . ASN A 1 102 ? 7.735   -17.769 26.502 1.00 16.32 ? 100 ASN A OD1 1 
ATOM   847  N ND2 . ASN A 1 102 ? 5.879   -17.383 27.707 1.00 13.51 ? 100 ASN A ND2 1 
ATOM   848  N N   . CYS A 1 103 ? 8.923   -12.842 25.397 1.00 13.89 ? 101 CYS A N   1 
ATOM   849  C CA  . CYS A 1 103 ? 8.884   -11.411 25.073 1.00 14.40 ? 101 CYS A CA  1 
ATOM   850  C C   . CYS A 1 103 ? 8.379   -11.192 23.644 1.00 13.84 ? 101 CYS A C   1 
ATOM   851  O O   . CYS A 1 103 ? 9.068   -11.529 22.675 1.00 14.79 ? 101 CYS A O   1 
ATOM   852  C CB  . CYS A 1 103 ? 10.273  -10.804 25.228 1.00 15.14 ? 101 CYS A CB  1 
ATOM   853  S SG  . CYS A 1 103 ? 10.238  -8.984  25.334 1.00 17.03 ? 101 CYS A SG  1 
ATOM   854  N N   . ILE A 1 104 ? 7.179   -10.635 23.531 1.00 12.24 ? 102 ILE A N   1 
ATOM   855  C CA  . ILE A 1 104 ? 6.560   -10.400 22.232 1.00 12.34 ? 102 ILE A CA  1 
ATOM   856  C C   . ILE A 1 104 ? 6.566   -8.919  21.863 1.00 12.44 ? 102 ILE A C   1 
ATOM   857  O O   . ILE A 1 104 ? 5.891   -8.115  22.507 1.00 18.01 ? 102 ILE A O   1 
ATOM   858  C CB  . ILE A 1 104 ? 5.105   -10.901 22.227 1.00 12.73 ? 102 ILE A CB  1 
ATOM   859  C CG1 . ILE A 1 104 ? 5.071   -12.401 22.533 1.00 8.61  ? 102 ILE A CG1 1 
ATOM   860  C CG2 . ILE A 1 104 ? 4.461   -10.655 20.863 1.00 13.59 ? 102 ILE A CG2 1 
ATOM   861  C CD1 . ILE A 1 104 ? 3.724   -12.903 22.889 1.00 7.31  ? 102 ILE A CD1 1 
ATOM   862  N N   . CYS A 1 105 ? 7.347   -8.575  20.848 1.00 13.26 ? 103 CYS A N   1 
ATOM   863  C CA  . CYS A 1 105 ? 7.423   -7.212  20.352 1.00 11.24 ? 103 CYS A CA  1 
ATOM   864  C C   . CYS A 1 105 ? 6.310   -7.055  19.332 1.00 16.45 ? 103 CYS A C   1 
ATOM   865  O O   . CYS A 1 105 ? 6.200   -7.865  18.399 1.00 15.16 ? 103 CYS A O   1 
ATOM   866  C CB  . CYS A 1 105 ? 8.767   -6.953  19.688 1.00 13.30 ? 103 CYS A CB  1 
ATOM   867  S SG  . CYS A 1 105 ? 10.211  -7.027  20.822 1.00 18.93 ? 103 CYS A SG  1 
ATOM   868  N N   . VAL A 1 106 ? 5.467   -6.054  19.539 1.00 16.40 ? 104 VAL A N   1 
ATOM   869  C CA  . VAL A 1 106 ? 4.351   -5.775  18.648 1.00 19.98 ? 104 VAL A CA  1 
ATOM   870  C C   . VAL A 1 106 ? 4.753   -4.706  17.640 1.00 21.25 ? 104 VAL A C   1 
ATOM   871  O O   . VAL A 1 106 ? 5.018   -3.551  17.992 1.00 22.35 ? 104 VAL A O   1 
ATOM   872  C CB  . VAL A 1 106 ? 3.117   -5.320  19.439 1.00 18.56 ? 104 VAL A CB  1 
ATOM   873  C CG1 . VAL A 1 106 ? 1.949   -5.027  18.501 1.00 21.20 ? 104 VAL A CG1 1 
ATOM   874  C CG2 . VAL A 1 106 ? 2.721   -6.390  20.443 1.00 19.98 ? 104 VAL A CG2 1 
ATOM   875  N N   . ASP A 1 107 ? 4.834   -5.112  16.381 1.00 20.69 ? 105 ASP A N   1 
ATOM   876  C CA  . ASP A 1 107 ? 5.196   -4.213  15.301 1.00 20.12 ? 105 ASP A CA  1 
ATOM   877  C C   . ASP A 1 107 ? 3.919   -3.881  14.543 1.00 21.23 ? 105 ASP A C   1 
ATOM   878  O O   . ASP A 1 107 ? 3.291   -4.769  13.981 1.00 20.48 ? 105 ASP A O   1 
ATOM   879  C CB  . ASP A 1 107 ? 6.210   -4.909  14.379 1.00 22.12 ? 105 ASP A CB  1 
ATOM   880  C CG  . ASP A 1 107 ? 6.695   -4.027  13.233 1.00 23.10 ? 105 ASP A CG  1 
ATOM   881  O OD1 . ASP A 1 107 ? 6.228   -2.876  13.085 1.00 22.12 ? 105 ASP A OD1 1 
ATOM   882  O OD2 . ASP A 1 107 ? 7.558   -4.503  12.468 1.00 22.67 ? 105 ASP A OD2 1 
ATOM   883  N N   . TRP A 1 108 ? 3.488   -2.623  14.616 1.00 17.86 ? 106 TRP A N   1 
ATOM   884  C CA  . TRP A 1 108 ? 2.297   -2.181  13.894 1.00 15.07 ? 106 TRP A CA  1 
ATOM   885  C C   . TRP A 1 108 ? 2.638   -0.921  13.101 1.00 13.83 ? 106 TRP A C   1 
ATOM   886  O O   . TRP A 1 108 ? 1.778   -0.078  12.855 1.00 15.49 ? 106 TRP A O   1 
ATOM   887  C CB  . TRP A 1 108 ? 1.111   -1.939  14.837 1.00 14.89 ? 106 TRP A CB  1 
ATOM   888  C CG  . TRP A 1 108 ? 1.296   -0.840  15.875 1.00 18.71 ? 106 TRP A CG  1 
ATOM   889  C CD1 . TRP A 1 108 ? 2.170   -0.847  16.932 1.00 18.55 ? 106 TRP A CD1 1 
ATOM   890  C CD2 . TRP A 1 108 ? 0.574   0.400   15.961 1.00 17.77 ? 106 TRP A CD2 1 
ATOM   891  N NE1 . TRP A 1 108 ? 2.027   0.310   17.670 1.00 16.48 ? 106 TRP A NE1 1 
ATOM   892  C CE2 . TRP A 1 108 ? 1.060   1.092   17.101 1.00 19.09 ? 106 TRP A CE2 1 
ATOM   893  C CE3 . TRP A 1 108 ? -0.444  0.996   15.195 1.00 19.73 ? 106 TRP A CE3 1 
ATOM   894  C CZ2 . TRP A 1 108 ? 0.570   2.347   17.481 1.00 18.88 ? 106 TRP A CZ2 1 
ATOM   895  C CZ3 . TRP A 1 108 ? -0.932  2.250   15.582 1.00 19.21 ? 106 TRP A CZ3 1 
ATOM   896  C CH2 . TRP A 1 108 ? -0.424  2.907   16.717 1.00 19.75 ? 106 TRP A CH2 1 
ATOM   897  N N   . ARG A 1 109 ? 3.882   -0.859  12.633 1.00 13.46 ? 107 ARG A N   1 
ATOM   898  C CA  . ARG A 1 109 ? 4.399   0.300   11.897 1.00 20.06 ? 107 ARG A CA  1 
ATOM   899  C C   . ARG A 1 109 ? 3.615   0.716   10.662 1.00 21.37 ? 107 ARG A C   1 
ATOM   900  O O   . ARG A 1 109 ? 3.530   1.906   10.349 1.00 18.73 ? 107 ARG A O   1 
ATOM   901  C CB  . ARG A 1 109 ? 5.869   0.097   11.531 1.00 22.35 ? 107 ARG A CB  1 
ATOM   902  C CG  . ARG A 1 109 ? 6.819   0.294   12.699 1.00 26.98 ? 107 ARG A CG  1 
ATOM   903  C CD  . ARG A 1 109 ? 8.263   0.072   12.298 1.00 30.14 ? 107 ARG A CD  1 
ATOM   904  N NE  . ARG A 1 109 ? 8.468   -1.275  11.774 1.00 35.28 ? 107 ARG A NE  1 
ATOM   905  C CZ  . ARG A 1 109 ? 9.573   -1.688  11.158 1.00 37.35 ? 107 ARG A CZ  1 
ATOM   906  N NH1 . ARG A 1 109 ? 10.599  -0.862  10.988 1.00 38.45 ? 107 ARG A NH1 1 
ATOM   907  N NH2 . ARG A 1 109 ? 9.655   -2.938  10.714 1.00 38.75 ? 107 ARG A NH2 1 
ATOM   908  N N   . ARG A 1 110 ? 3.044   -0.250  9.956  1.00 23.51 ? 108 ARG A N   1 
ATOM   909  C CA  . ARG A 1 110 ? 2.278   0.082   8.765  1.00 23.68 ? 108 ARG A CA  1 
ATOM   910  C C   . ARG A 1 110 ? 1.035   0.863   9.189  1.00 22.13 ? 108 ARG A C   1 
ATOM   911  O O   . ARG A 1 110 ? 0.556   1.738   8.468  1.00 25.22 ? 108 ARG A O   1 
ATOM   912  C CB  . ARG A 1 110 ? 1.900   -1.191  8.003  1.00 24.95 ? 108 ARG A CB  1 
ATOM   913  C CG  . ARG A 1 110 ? 1.718   -0.966  6.522  1.00 29.41 ? 108 ARG A CG  1 
ATOM   914  C CD  . ARG A 1 110 ? 1.379   -2.253  5.800  1.00 32.24 ? 108 ARG A CD  1 
ATOM   915  N NE  . ARG A 1 110 ? 1.280   -2.046  4.358  1.00 34.36 ? 108 ARG A NE  1 
ATOM   916  C CZ  . ARG A 1 110 ? 0.294   -1.389  3.754  1.00 36.94 ? 108 ARG A CZ  1 
ATOM   917  N NH1 . ARG A 1 110 ? -0.704  -0.859  4.455  1.00 36.07 ? 108 ARG A NH1 1 
ATOM   918  N NH2 . ARG A 1 110 ? 0.312   -1.253  2.437  1.00 37.77 ? 108 ARG A NH2 1 
ATOM   919  N N   . GLY A 1 111 ? 0.552   0.589   10.398 1.00 20.28 ? 109 GLY A N   1 
ATOM   920  C CA  . GLY A 1 111 ? -0.618  1.279   10.903 1.00 14.01 ? 109 GLY A CA  1 
ATOM   921  C C   . GLY A 1 111 ? -0.309  2.561   11.660 1.00 16.31 ? 109 GLY A C   1 
ATOM   922  O O   . GLY A 1 111 ? -1.185  3.412   11.814 1.00 16.69 ? 109 GLY A O   1 
ATOM   923  N N   . SER A 1 112 ? 0.915   2.684   12.165 1.00 17.20 ? 110 SER A N   1 
ATOM   924  C CA  . SER A 1 112 ? 1.311   3.875   12.907 1.00 19.30 ? 110 SER A CA  1 
ATOM   925  C C   . SER A 1 112 ? 1.952   4.945   12.020 1.00 18.96 ? 110 SER A C   1 
ATOM   926  O O   . SER A 1 112 ? 1.793   6.141   12.275 1.00 20.56 ? 110 SER A O   1 
ATOM   927  C CB  . SER A 1 112 ? 2.265   3.499   14.045 1.00 17.38 ? 110 SER A CB  1 
ATOM   928  O OG  . SER A 1 112 ? 3.536   3.102   13.560 1.00 19.28 ? 110 SER A OG  1 
ATOM   929  N N   . ARG A 1 113 ? 2.690   4.512   11.000 1.00 20.25 ? 111 ARG A N   1 
ATOM   930  C CA  . ARG A 1 113 ? 3.364   5.421   10.075 1.00 22.40 ? 111 ARG A CA  1 
ATOM   931  C C   . ARG A 1 113 ? 2.391   6.050   9.082  1.00 23.64 ? 111 ARG A C   1 
ATOM   932  O O   . ARG A 1 113 ? 2.517   5.872   7.872  1.00 25.57 ? 111 ARG A O   1 
ATOM   933  C CB  . ARG A 1 113 ? 4.484   4.697   9.322  1.00 26.35 ? 111 ARG A CB  1 
ATOM   934  C CG  . ARG A 1 113 ? 5.690   4.345   10.178 1.00 31.09 ? 111 ARG A CG  1 
ATOM   935  C CD  . ARG A 1 113 ? 6.680   3.469   9.428  1.00 34.32 ? 111 ARG A CD  1 
ATOM   936  N NE  . ARG A 1 113 ? 7.150   4.072   8.182  1.00 37.45 ? 111 ARG A NE  1 
ATOM   937  C CZ  . ARG A 1 113 ? 8.056   5.042   8.104  1.00 38.42 ? 111 ARG A CZ  1 
ATOM   938  N NH1 . ARG A 1 113 ? 8.610   5.541   9.203  1.00 39.24 ? 111 ARG A NH1 1 
ATOM   939  N NH2 . ARG A 1 113 ? 8.423   5.504   6.916  1.00 39.30 ? 111 ARG A NH2 1 
ATOM   940  N N   . THR A 1 114 ? 1.429   6.795   9.606  1.00 22.03 ? 112 THR A N   1 
ATOM   941  C CA  . THR A 1 114 ? 0.428   7.471   8.791  1.00 23.11 ? 112 THR A CA  1 
ATOM   942  C C   . THR A 1 114 ? 0.034   8.750   9.544  1.00 23.75 ? 112 THR A C   1 
ATOM   943  O O   . THR A 1 114 ? 0.667   9.094   10.548 1.00 22.26 ? 112 THR A O   1 
ATOM   944  C CB  . THR A 1 114 ? -0.802  6.556   8.550  1.00 24.13 ? 112 THR A CB  1 
ATOM   945  O OG1 . THR A 1 114 ? -1.686  7.172   7.600  1.00 24.80 ? 112 THR A OG1 1 
ATOM   946  C CG2 . THR A 1 114 ? -1.552  6.282   9.853  1.00 22.28 ? 112 THR A CG2 1 
ATOM   947  N N   . GLU A 1 115 ? -0.981  9.460   9.057  1.00 21.51 ? 113 GLU A N   1 
ATOM   948  C CA  . GLU A 1 115 ? -1.424  10.694  9.697  1.00 21.48 ? 113 GLU A CA  1 
ATOM   949  C C   . GLU A 1 115 ? -1.808  10.377  11.141 1.00 20.56 ? 113 GLU A C   1 
ATOM   950  O O   . GLU A 1 115 ? -2.463  9.367   11.405 1.00 15.68 ? 113 GLU A O   1 
ATOM   951  C CB  . GLU A 1 115 ? -2.592  11.311  8.921  1.00 20.80 ? 113 GLU A CB  1 
ATOM   952  C CG  . GLU A 1 115 ? -3.107  12.638  9.479  1.00 22.40 ? 113 GLU A CG  1 
ATOM   953  C CD  . GLU A 1 115 ? -4.142  12.482  10.590 1.00 21.28 ? 113 GLU A CD  1 
ATOM   954  O OE1 . GLU A 1 115 ? -4.870  11.462  10.628 1.00 24.26 ? 113 GLU A OE1 1 
ATOM   955  O OE2 . GLU A 1 115 ? -4.260  13.407  11.414 1.00 23.42 ? 113 GLU A OE2 1 
ATOM   956  N N   . TYR A 1 116 ? -1.415  11.246  12.068 1.00 19.41 ? 114 TYR A N   1 
ATOM   957  C CA  . TYR A 1 116 ? -1.679  11.023  13.492 1.00 17.32 ? 114 TYR A CA  1 
ATOM   958  C C   . TYR A 1 116 ? -3.068  10.566  13.917 1.00 17.70 ? 114 TYR A C   1 
ATOM   959  O O   . TYR A 1 116 ? -3.184  9.632   14.712 1.00 16.13 ? 114 TYR A O   1 
ATOM   960  C CB  . TYR A 1 116 ? -1.264  12.238  14.336 1.00 16.22 ? 114 TYR A CB  1 
ATOM   961  C CG  . TYR A 1 116 ? -1.261  11.928  15.819 1.00 15.39 ? 114 TYR A CG  1 
ATOM   962  C CD1 . TYR A 1 116 ? -0.181  11.276  16.410 1.00 15.76 ? 114 TYR A CD1 1 
ATOM   963  C CD2 . TYR A 1 116 ? -2.351  12.247  16.617 1.00 15.89 ? 114 TYR A CD2 1 
ATOM   964  C CE1 . TYR A 1 116 ? -0.195  10.943  17.772 1.00 17.03 ? 114 TYR A CE1 1 
ATOM   965  C CE2 . TYR A 1 116 ? -2.375  11.923  17.973 1.00 18.15 ? 114 TYR A CE2 1 
ATOM   966  C CZ  . TYR A 1 116 ? -1.290  11.272  18.539 1.00 15.60 ? 114 TYR A CZ  1 
ATOM   967  O OH  . TYR A 1 116 ? -1.315  10.982  19.887 1.00 20.20 ? 114 TYR A OH  1 
ATOM   968  N N   . THR A 1 117 ? -4.123  11.255  13.492 1.00 15.16 ? 115 THR A N   1 
ATOM   969  C CA  . THR A 1 117 ? -5.465  10.840  13.898 1.00 15.37 ? 115 THR A CA  1 
ATOM   970  C C   . THR A 1 117 ? -5.762  9.416   13.429 1.00 18.79 ? 115 THR A C   1 
ATOM   971  O O   . THR A 1 117 ? -6.367  8.628   14.166 1.00 14.49 ? 115 THR A O   1 
ATOM   972  C CB  . THR A 1 117 ? -6.576  11.803  13.400 1.00 18.61 ? 115 THR A CB  1 
ATOM   973  O OG1 . THR A 1 117 ? -6.273  13.142  13.824 1.00 22.19 ? 115 THR A OG1 1 
ATOM   974  C CG2 . THR A 1 117 ? -7.941  11.392  13.977 1.00 16.24 ? 115 THR A CG2 1 
ATOM   975  N N   . GLN A 1 118 ? -5.270  9.073   12.238 1.00 18.08 ? 116 GLN A N   1 
ATOM   976  C CA  . GLN A 1 118 ? -5.489  7.749   11.685 1.00 19.25 ? 116 GLN A CA  1 
ATOM   977  C C   . GLN A 1 118 ? -4.731  6.730   12.535 1.00 19.90 ? 116 GLN A C   1 
ATOM   978  O O   . GLN A 1 118 ? -5.303  5.717   12.930 1.00 19.73 ? 116 GLN A O   1 
ATOM   979  C CB  . GLN A 1 118 ? -5.045  7.678   10.222 1.00 19.66 ? 116 GLN A CB  1 
ATOM   980  C CG  . GLN A 1 118 ? -5.439  6.378   9.507  1.00 18.68 ? 116 GLN A CG  1 
ATOM   981  C CD  . GLN A 1 118 ? -6.939  6.115   9.515  1.00 20.02 ? 116 GLN A CD  1 
ATOM   982  O OE1 . GLN A 1 118 ? -7.688  6.674   8.706  1.00 19.95 ? 116 GLN A OE1 1 
ATOM   983  N NE2 . GLN A 1 118 ? -7.386  5.252   10.418 1.00 17.69 ? 116 GLN A NE2 1 
ATOM   984  N N   . ALA A 1 119 ? -3.477  7.039   12.863 1.00 16.72 ? 117 ALA A N   1 
ATOM   985  C CA  . ALA A 1 119 ? -2.666  6.149   13.688 1.00 17.96 ? 117 ALA A CA  1 
ATOM   986  C C   . ALA A 1 119 ? -3.342  5.955   15.044 1.00 18.27 ? 117 ALA A C   1 
ATOM   987  O O   . ALA A 1 119 ? -3.447  4.824   15.523 1.00 18.15 ? 117 ALA A O   1 
ATOM   988  C CB  . ALA A 1 119 ? -1.255  6.703   13.853 1.00 14.32 ? 117 ALA A CB  1 
ATOM   989  N N   . SER A 1 120 ? -3.863  7.043   15.619 1.00 17.78 ? 118 SER A N   1 
ATOM   990  C CA  . SER A 1 120 ? -4.551  7.002   16.914 1.00 16.50 ? 118 SER A CA  1 
ATOM   991  C C   . SER A 1 120 ? -5.762  6.071   16.861 1.00 16.73 ? 118 SER A C   1 
ATOM   992  O O   . SER A 1 120 ? -5.998  5.282   17.771 1.00 12.08 ? 118 SER A O   1 
ATOM   993  C CB  . SER A 1 120 ? -5.006  8.411   17.359 1.00 15.84 ? 118 SER A CB  1 
ATOM   994  O OG  . SER A 1 120 ? -3.904  9.263   17.656 1.00 16.06 ? 118 SER A OG  1 
ATOM   995  N N   . TYR A 1 121 ? -6.526  6.139   15.775 1.00 14.81 ? 119 TYR A N   1 
ATOM   996  C CA  . TYR A 1 121 ? -7.692  5.273   15.640 1.00 14.50 ? 119 TYR A CA  1 
ATOM   997  C C   . TYR A 1 121 ? -7.254  3.830   15.371 1.00 11.16 ? 119 TYR A C   1 
ATOM   998  O O   . TYR A 1 121 ? -7.927  2.885   15.779 1.00 13.84 ? 119 TYR A O   1 
ATOM   999  C CB  . TYR A 1 121 ? -8.605  5.768   14.501 1.00 14.72 ? 119 TYR A CB  1 
ATOM   1000 C CG  . TYR A 1 121 ? -9.352  7.060   14.799 1.00 16.24 ? 119 TYR A CG  1 
ATOM   1001 C CD1 . TYR A 1 121 ? -9.001  7.874   15.885 1.00 18.24 ? 119 TYR A CD1 1 
ATOM   1002 C CD2 . TYR A 1 121 ? -10.420 7.466   13.999 1.00 15.93 ? 119 TYR A CD2 1 
ATOM   1003 C CE1 . TYR A 1 121 ? -9.699  9.056   16.157 1.00 18.53 ? 119 TYR A CE1 1 
ATOM   1004 C CE2 . TYR A 1 121 ? -11.125 8.642   14.268 1.00 18.46 ? 119 TYR A CE2 1 
ATOM   1005 C CZ  . TYR A 1 121 ? -10.759 9.434   15.344 1.00 18.37 ? 119 TYR A CZ  1 
ATOM   1006 O OH  . TYR A 1 121 ? -11.455 10.597  15.600 1.00 15.99 ? 119 TYR A OH  1 
ATOM   1007 N N   . ASN A 1 122 ? -6.130  3.672   14.684 1.00 12.52 ? 120 ASN A N   1 
ATOM   1008 C CA  . ASN A 1 122 ? -5.621  2.351   14.353 1.00 12.37 ? 120 ASN A CA  1 
ATOM   1009 C C   . ASN A 1 122 ? -5.217  1.592   15.614 1.00 14.31 ? 120 ASN A C   1 
ATOM   1010 O O   . ASN A 1 122 ? -5.182  0.367   15.598 1.00 12.27 ? 120 ASN A O   1 
ATOM   1011 C CB  . ASN A 1 122 ? -4.440  2.433   13.385 1.00 9.89  ? 120 ASN A CB  1 
ATOM   1012 C CG  . ASN A 1 122 ? -4.870  2.820   11.964 1.00 10.19 ? 120 ASN A CG  1 
ATOM   1013 O OD1 . ASN A 1 122 ? -6.054  2.838   11.659 1.00 10.75 ? 120 ASN A OD1 1 
ATOM   1014 N ND2 . ASN A 1 122 ? -3.916  3.139   11.118 1.00 10.61 ? 120 ASN A ND2 1 
ATOM   1015 N N   . THR A 1 123 ? -4.939  2.315   16.705 1.00 12.31 ? 121 THR A N   1 
ATOM   1016 C CA  . THR A 1 123 ? -4.549  1.673   17.967 1.00 13.13 ? 121 THR A CA  1 
ATOM   1017 C C   . THR A 1 123 ? -5.640  0.711   18.410 1.00 16.14 ? 121 THR A C   1 
ATOM   1018 O O   . THR A 1 123 ? -5.360  -0.309  19.046 1.00 18.14 ? 121 THR A O   1 
ATOM   1019 C CB  . THR A 1 123 ? -4.306  2.701   19.119 1.00 9.37  ? 121 THR A CB  1 
ATOM   1020 O OG1 . THR A 1 123 ? -5.535  3.325   19.503 1.00 10.49 ? 121 THR A OG1 1 
ATOM   1021 C CG2 . THR A 1 123 ? -3.296  3.754   18.717 1.00 13.08 ? 121 THR A CG2 1 
ATOM   1022 N N   . ARG A 1 124 ? -6.889  1.056   18.100 1.00 15.83 ? 122 ARG A N   1 
ATOM   1023 C CA  . ARG A 1 124 ? -8.027  0.215   18.456 1.00 17.12 ? 122 ARG A CA  1 
ATOM   1024 C C   . ARG A 1 124 ? -7.940  -1.187  17.874 1.00 17.12 ? 122 ARG A C   1 
ATOM   1025 O O   . ARG A 1 124 ? -8.249  -2.165  18.555 1.00 14.04 ? 122 ARG A O   1 
ATOM   1026 C CB  . ARG A 1 124 ? -9.331  0.855   18.014 1.00 18.83 ? 122 ARG A CB  1 
ATOM   1027 C CG  . ARG A 1 124 ? -9.759  2.000   18.877 1.00 21.26 ? 122 ARG A CG  1 
ATOM   1028 C CD  . ARG A 1 124 ? -11.259 2.066   18.878 1.00 24.52 ? 122 ARG A CD  1 
ATOM   1029 N NE  . ARG A 1 124 ? -11.773 2.829   17.765 1.00 24.21 ? 122 ARG A NE  1 
ATOM   1030 C CZ  . ARG A 1 124 ? -13.023 2.767   17.316 1.00 24.61 ? 122 ARG A CZ  1 
ATOM   1031 N NH1 . ARG A 1 124 ? -13.914 1.934   17.849 1.00 22.64 ? 122 ARG A NH1 1 
ATOM   1032 N NH2 . ARG A 1 124 ? -13.369 3.531   16.301 1.00 26.00 ? 122 ARG A NH2 1 
ATOM   1033 N N   . VAL A 1 125 ? -7.525  -1.275  16.614 1.00 17.38 ? 123 VAL A N   1 
ATOM   1034 C CA  . VAL A 1 125 ? -7.392  -2.561  15.926 1.00 15.53 ? 123 VAL A CA  1 
ATOM   1035 C C   . VAL A 1 125 ? -6.177  -3.336  16.446 1.00 16.95 ? 123 VAL A C   1 
ATOM   1036 O O   . VAL A 1 125 ? -6.241  -4.567  16.601 1.00 15.21 ? 123 VAL A O   1 
ATOM   1037 C CB  . VAL A 1 125 ? -7.278  -2.381  14.394 1.00 14.35 ? 123 VAL A CB  1 
ATOM   1038 C CG1 . VAL A 1 125 ? -7.122  -3.760  13.697 1.00 13.36 ? 123 VAL A CG1 1 
ATOM   1039 C CG2 . VAL A 1 125 ? -8.508  -1.672  13.869 1.00 15.07 ? 123 VAL A CG2 1 
ATOM   1040 N N   . VAL A 1 126 ? -5.068  -2.638  16.695 1.00 14.02 ? 124 VAL A N   1 
ATOM   1041 C CA  . VAL A 1 126 ? -3.889  -3.315  17.216 1.00 15.39 ? 124 VAL A CA  1 
ATOM   1042 C C   . VAL A 1 126 ? -4.264  -3.868  18.599 1.00 14.87 ? 124 VAL A C   1 
ATOM   1043 O O   . VAL A 1 126 ? -3.922  -5.005  18.931 1.00 16.72 ? 124 VAL A O   1 
ATOM   1044 C CB  . VAL A 1 126 ? -2.658  -2.383  17.322 1.00 15.87 ? 124 VAL A CB  1 
ATOM   1045 C CG1 . VAL A 1 126 ? -1.440  -3.169  17.780 1.00 15.66 ? 124 VAL A CG1 1 
ATOM   1046 C CG2 . VAL A 1 126 ? -2.383  -1.705  15.971 1.00 15.03 ? 124 VAL A CG2 1 
ATOM   1047 N N   . GLY A 1 127 ? -5.014  -3.084  19.369 1.00 9.77  ? 125 GLY A N   1 
ATOM   1048 C CA  . GLY A 1 127 ? -5.460  -3.523  20.680 1.00 15.09 ? 125 GLY A CA  1 
ATOM   1049 C C   . GLY A 1 127 ? -6.336  -4.761  20.571 1.00 15.47 ? 125 GLY A C   1 
ATOM   1050 O O   . GLY A 1 127 ? -6.271  -5.658  21.412 1.00 12.87 ? 125 GLY A O   1 
ATOM   1051 N N   . ALA A 1 128 ? -7.191  -4.801  19.551 1.00 12.36 ? 126 ALA A N   1 
ATOM   1052 C CA  . ALA A 1 128 ? -8.048  -5.963  19.350 1.00 12.48 ? 126 ALA A CA  1 
ATOM   1053 C C   . ALA A 1 128 ? -7.188  -7.167  18.992 1.00 10.14 ? 126 ALA A C   1 
ATOM   1054 O O   . ALA A 1 128 ? -7.468  -8.287  19.449 1.00 12.95 ? 126 ALA A O   1 
ATOM   1055 C CB  . ALA A 1 128 ? -9.078  -5.695  18.253 1.00 9.62  ? 126 ALA A CB  1 
ATOM   1056 N N   . GLU A 1 129 ? -6.113  -6.936  18.238 1.00 9.62  ? 127 GLU A N   1 
ATOM   1057 C CA  . GLU A 1 129 ? -5.213  -8.017  17.831 1.00 11.63 ? 127 GLU A CA  1 
ATOM   1058 C C   . GLU A 1 129 ? -4.575  -8.643  19.071 1.00 14.45 ? 127 GLU A C   1 
ATOM   1059 O O   . GLU A 1 129 ? -4.524  -9.874  19.213 1.00 10.20 ? 127 GLU A O   1 
ATOM   1060 C CB  . GLU A 1 129 ? -4.128  -7.514  16.877 1.00 11.50 ? 127 GLU A CB  1 
ATOM   1061 C CG  . GLU A 1 129 ? -4.631  -7.097  15.470 1.00 10.78 ? 127 GLU A CG  1 
ATOM   1062 C CD  . GLU A 1 129 ? -4.838  -8.267  14.503 1.00 14.85 ? 127 GLU A CD  1 
ATOM   1063 O OE1 . GLU A 1 129 ? -5.158  -9.391  14.954 1.00 12.88 ? 127 GLU A OE1 1 
ATOM   1064 O OE2 . GLU A 1 129 ? -4.673  -8.052  13.278 1.00 14.81 ? 127 GLU A OE2 1 
ATOM   1065 N N   . ILE A 1 130 ? -4.104  -7.789  19.976 1.00 13.91 ? 128 ILE A N   1 
ATOM   1066 C CA  . ILE A 1 130 ? -3.490  -8.285  21.209 1.00 10.82 ? 128 ILE A CA  1 
ATOM   1067 C C   . ILE A 1 130 ? -4.488  -9.060  22.056 1.00 11.12 ? 128 ILE A C   1 
ATOM   1068 O O   . ILE A 1 130 ? -4.190  -10.179 22.478 1.00 15.15 ? 128 ILE A O   1 
ATOM   1069 C CB  . ILE A 1 130 ? -2.854  -7.158  22.057 1.00 9.81  ? 128 ILE A CB  1 
ATOM   1070 C CG1 . ILE A 1 130 ? -1.653  -6.563  21.319 1.00 8.72  ? 128 ILE A CG1 1 
ATOM   1071 C CG2 . ILE A 1 130 ? -2.352  -7.751  23.384 1.00 9.40  ? 128 ILE A CG2 1 
ATOM   1072 C CD1 . ILE A 1 130 ? -1.097  -5.260  21.944 1.00 11.82 ? 128 ILE A CD1 1 
ATOM   1073 N N   . ALA A 1 131 ? -5.657  -8.475  22.304 1.00 9.50  ? 129 ALA A N   1 
ATOM   1074 C CA  . ALA A 1 131 ? -6.702  -9.115  23.083 1.00 13.67 ? 129 ALA A CA  1 
ATOM   1075 C C   . ALA A 1 131 ? -7.056  -10.499 22.527 1.00 17.23 ? 129 ALA A C   1 
ATOM   1076 O O   . ALA A 1 131 ? -7.260  -11.449 23.297 1.00 13.50 ? 129 ALA A O   1 
ATOM   1077 C CB  . ALA A 1 131 ? -7.934  -8.239  23.117 1.00 12.55 ? 129 ALA A CB  1 
ATOM   1078 N N   . PHE A 1 132 ? -7.126  -10.609 21.198 1.00 16.93 ? 130 PHE A N   1 
ATOM   1079 C CA  . PHE A 1 132 ? -7.455  -11.886 20.552 1.00 15.90 ? 130 PHE A CA  1 
ATOM   1080 C C   . PHE A 1 132 ? -6.364  -12.937 20.798 1.00 15.87 ? 130 PHE A C   1 
ATOM   1081 O O   . PHE A 1 132 ? -6.680  -14.087 21.107 1.00 16.51 ? 130 PHE A O   1 
ATOM   1082 C CB  . PHE A 1 132 ? -7.710  -11.702 19.043 1.00 16.69 ? 130 PHE A CB  1 
ATOM   1083 C CG  . PHE A 1 132 ? -8.274  -12.938 18.364 1.00 14.22 ? 130 PHE A CG  1 
ATOM   1084 C CD1 . PHE A 1 132 ? -9.544  -13.407 18.677 1.00 16.69 ? 130 PHE A CD1 1 
ATOM   1085 C CD2 . PHE A 1 132 ? -7.507  -13.658 17.466 1.00 17.22 ? 130 PHE A CD2 1 
ATOM   1086 C CE1 . PHE A 1 132 ? -10.040 -14.594 18.102 1.00 15.06 ? 130 PHE A CE1 1 
ATOM   1087 C CE2 . PHE A 1 132 ? -7.990  -14.842 16.892 1.00 15.77 ? 130 PHE A CE2 1 
ATOM   1088 C CZ  . PHE A 1 132 ? -9.254  -15.304 17.215 1.00 15.04 ? 130 PHE A CZ  1 
ATOM   1089 N N   . LEU A 1 133 ? -5.094  -12.553 20.665 1.00 14.64 ? 131 LEU A N   1 
ATOM   1090 C CA  . LEU A 1 133 ? -3.995  -13.485 20.907 1.00 12.78 ? 131 LEU A CA  1 
ATOM   1091 C C   . LEU A 1 133 ? -4.050  -13.969 22.352 1.00 14.79 ? 131 LEU A C   1 
ATOM   1092 O O   . LEU A 1 133 ? -3.942  -15.175 22.611 1.00 12.94 ? 131 LEU A O   1 
ATOM   1093 C CB  . LEU A 1 133 ? -2.633  -12.857 20.614 1.00 11.61 ? 131 LEU A CB  1 
ATOM   1094 C CG  . LEU A 1 133 ? -1.397  -13.733 20.886 1.00 12.59 ? 131 LEU A CG  1 
ATOM   1095 C CD1 . LEU A 1 133 ? -1.530  -15.113 20.194 1.00 16.17 ? 131 LEU A CD1 1 
ATOM   1096 C CD2 . LEU A 1 133 ? -0.133  -13.049 20.414 1.00 12.69 ? 131 LEU A CD2 1 
ATOM   1097 N N   . VAL A 1 134 ? -4.238  -13.034 23.284 1.00 14.41 ? 132 VAL A N   1 
ATOM   1098 C CA  . VAL A 1 134 ? -4.329  -13.385 24.708 1.00 13.28 ? 132 VAL A CA  1 
ATOM   1099 C C   . VAL A 1 134 ? -5.507  -14.315 24.966 1.00 15.89 ? 132 VAL A C   1 
ATOM   1100 O O   . VAL A 1 134 ? -5.392  -15.262 25.758 1.00 15.82 ? 132 VAL A O   1 
ATOM   1101 C CB  . VAL A 1 134 ? -4.426  -12.135 25.614 1.00 12.72 ? 132 VAL A CB  1 
ATOM   1102 C CG1 . VAL A 1 134 ? -4.652  -12.544 27.069 1.00 13.64 ? 132 VAL A CG1 1 
ATOM   1103 C CG2 . VAL A 1 134 ? -3.155  -11.315 25.492 1.00 14.00 ? 132 VAL A CG2 1 
ATOM   1104 N N   . GLN A 1 135 ? -6.616  -14.080 24.263 1.00 14.04 ? 133 GLN A N   1 
ATOM   1105 C CA  . GLN A 1 135 ? -7.807  -14.908 24.394 1.00 14.38 ? 133 GLN A CA  1 
ATOM   1106 C C   . GLN A 1 135 ? -7.541  -16.323 23.858 1.00 13.48 ? 133 GLN A C   1 
ATOM   1107 O O   . GLN A 1 135 ? -7.978  -17.294 24.465 1.00 13.13 ? 133 GLN A O   1 
ATOM   1108 C CB  . GLN A 1 135 ? -9.014  -14.272 23.680 1.00 15.82 ? 133 GLN A CB  1 
ATOM   1109 C CG  . GLN A 1 135 ? -9.752  -13.210 24.511 1.00 18.44 ? 133 GLN A CG  1 
ATOM   1110 C CD  . GLN A 1 135 ? -10.662 -12.317 23.669 1.00 18.81 ? 133 GLN A CD  1 
ATOM   1111 O OE1 . GLN A 1 135 ? -10.728 -12.458 22.447 1.00 19.67 ? 133 GLN A OE1 1 
ATOM   1112 N NE2 . GLN A 1 135 ? -11.349 -11.383 24.320 1.00 17.37 ? 133 GLN A NE2 1 
ATOM   1113 N N   . VAL A 1 136 ? -6.796  -16.445 22.759 1.00 13.65 ? 134 VAL A N   1 
ATOM   1114 C CA  . VAL A 1 136 ? -6.478  -17.767 22.202 1.00 15.71 ? 134 VAL A CA  1 
ATOM   1115 C C   . VAL A 1 136 ? -5.630  -18.536 23.210 1.00 17.23 ? 134 VAL A C   1 
ATOM   1116 O O   . VAL A 1 136 ? -5.982  -19.652 23.607 1.00 17.17 ? 134 VAL A O   1 
ATOM   1117 C CB  . VAL A 1 136 ? -5.738  -17.665 20.845 1.00 17.19 ? 134 VAL A CB  1 
ATOM   1118 C CG1 . VAL A 1 136 ? -5.103  -19.022 20.454 1.00 16.94 ? 134 VAL A CG1 1 
ATOM   1119 C CG2 . VAL A 1 136 ? -6.721  -17.236 19.769 1.00 16.84 ? 134 VAL A CG2 1 
ATOM   1120 N N   . LEU A 1 137 ? -4.539  -17.914 23.644 1.00 17.15 ? 135 LEU A N   1 
ATOM   1121 C CA  . LEU A 1 137 ? -3.635  -18.509 24.630 1.00 18.70 ? 135 LEU A CA  1 
ATOM   1122 C C   . LEU A 1 137 ? -4.398  -19.018 25.849 1.00 17.66 ? 135 LEU A C   1 
ATOM   1123 O O   . LEU A 1 137 ? -4.115  -20.102 26.369 1.00 18.28 ? 135 LEU A O   1 
ATOM   1124 C CB  . LEU A 1 137 ? -2.596  -17.478 25.089 1.00 16.78 ? 135 LEU A CB  1 
ATOM   1125 C CG  . LEU A 1 137 ? -1.507  -17.051 24.108 1.00 16.47 ? 135 LEU A CG  1 
ATOM   1126 C CD1 . LEU A 1 137 ? -0.679  -15.912 24.725 1.00 16.08 ? 135 LEU A CD1 1 
ATOM   1127 C CD2 . LEU A 1 137 ? -0.620  -18.235 23.756 1.00 14.91 ? 135 LEU A CD2 1 
ATOM   1128 N N   . SER A 1 138 ? -5.372  -18.231 26.290 1.00 18.58 ? 136 SER A N   1 
ATOM   1129 C CA  . SER A 1 138 ? -6.180  -18.556 27.449 1.00 19.34 ? 136 SER A CA  1 
ATOM   1130 C C   . SER A 1 138 ? -7.230  -19.655 27.232 1.00 19.19 ? 136 SER A C   1 
ATOM   1131 O O   . SER A 1 138 ? -7.234  -20.663 27.936 1.00 19.38 ? 136 SER A O   1 
ATOM   1132 C CB  . SER A 1 138 ? -6.863  -17.284 27.963 1.00 20.01 ? 136 SER A CB  1 
ATOM   1133 O OG  . SER A 1 138 ? -7.661  -17.556 29.094 1.00 22.78 ? 136 SER A OG  1 
ATOM   1134 N N   . THR A 1 139 ? -8.118  -19.459 26.266 1.00 20.48 ? 137 THR A N   1 
ATOM   1135 C CA  . THR A 1 139 ? -9.192  -20.417 26.005 1.00 19.83 ? 137 THR A CA  1 
ATOM   1136 C C   . THR A 1 139 ? -8.722  -21.739 25.411 1.00 17.36 ? 137 THR A C   1 
ATOM   1137 O O   . THR A 1 139 ? -9.232  -22.800 25.759 1.00 16.64 ? 137 THR A O   1 
ATOM   1138 C CB  . THR A 1 139 ? -10.280 -19.822 25.063 1.00 21.55 ? 137 THR A CB  1 
ATOM   1139 O OG1 . THR A 1 139 ? -9.690  -19.477 23.806 1.00 25.38 ? 137 THR A OG1 1 
ATOM   1140 C CG2 . THR A 1 139 ? -10.909 -18.571 25.671 1.00 20.69 ? 137 THR A CG2 1 
ATOM   1141 N N   . GLU A 1 140 ? -7.742  -21.670 24.525 1.00 18.27 ? 138 GLU A N   1 
ATOM   1142 C CA  . GLU A 1 140 ? -7.252  -22.859 23.862 1.00 20.96 ? 138 GLU A CA  1 
ATOM   1143 C C   . GLU A 1 140 ? -6.054  -23.530 24.507 1.00 20.43 ? 138 GLU A C   1 
ATOM   1144 O O   . GLU A 1 140 ? -5.928  -24.751 24.445 1.00 19.10 ? 138 GLU A O   1 
ATOM   1145 C CB  . GLU A 1 140 ? -6.980  -22.555 22.389 1.00 23.90 ? 138 GLU A CB  1 
ATOM   1146 C CG  . GLU A 1 140 ? -8.249  -22.165 21.627 1.00 26.23 ? 138 GLU A CG  1 
ATOM   1147 C CD  . GLU A 1 140 ? -8.015  -21.919 20.148 1.00 30.55 ? 138 GLU A CD  1 
ATOM   1148 O OE1 . GLU A 1 140 ? -7.212  -22.652 19.526 1.00 33.36 ? 138 GLU A OE1 1 
ATOM   1149 O OE2 . GLU A 1 140 ? -8.651  -20.992 19.600 1.00 31.99 ? 138 GLU A OE2 1 
ATOM   1150 N N   . MET A 1 141 ? -5.180  -22.757 25.142 1.00 19.77 ? 139 MET A N   1 
ATOM   1151 C CA  . MET A 1 141 ? -4.004  -23.356 25.766 1.00 20.57 ? 139 MET A CA  1 
ATOM   1152 C C   . MET A 1 141 ? -3.972  -23.295 27.288 1.00 18.65 ? 139 MET A C   1 
ATOM   1153 O O   . MET A 1 141 ? -3.013  -23.763 27.907 1.00 18.37 ? 139 MET A O   1 
ATOM   1154 C CB  . MET A 1 141 ? -2.733  -22.762 25.169 1.00 21.85 ? 139 MET A CB  1 
ATOM   1155 C CG  . MET A 1 141 ? -2.640  -22.993 23.665 1.00 26.26 ? 139 MET A CG  1 
ATOM   1156 S SD  . MET A 1 141 ? -1.146  -22.357 22.969 1.00 31.50 ? 139 MET A SD  1 
ATOM   1157 C CE  . MET A 1 141 ? -0.033  -23.741 23.245 1.00 31.12 ? 139 MET A CE  1 
ATOM   1158 N N   . GLY A 1 142 ? -5.054  -22.804 27.880 1.00 16.51 ? 140 GLY A N   1 
ATOM   1159 C CA  . GLY A 1 142 ? -5.139  -22.701 29.324 1.00 16.42 ? 140 GLY A CA  1 
ATOM   1160 C C   . GLY A 1 142 ? -4.114  -21.764 29.947 1.00 16.95 ? 140 GLY A C   1 
ATOM   1161 O O   . GLY A 1 142 ? -3.800  -21.887 31.134 1.00 17.53 ? 140 GLY A O   1 
ATOM   1162 N N   . TYR A 1 143 ? -3.619  -20.804 29.172 1.00 15.57 ? 141 TYR A N   1 
ATOM   1163 C CA  . TYR A 1 143 ? -2.633  -19.847 29.681 1.00 14.14 ? 141 TYR A CA  1 
ATOM   1164 C C   . TYR A 1 143 ? -3.376  -18.592 30.161 1.00 16.69 ? 141 TYR A C   1 
ATOM   1165 O O   . TYR A 1 143 ? -3.849  -17.782 29.355 1.00 15.66 ? 141 TYR A O   1 
ATOM   1166 C CB  . TYR A 1 143 ? -1.614  -19.532 28.586 1.00 13.60 ? 141 TYR A CB  1 
ATOM   1167 C CG  . TYR A 1 143 ? -0.445  -18.682 29.024 1.00 14.37 ? 141 TYR A CG  1 
ATOM   1168 C CD1 . TYR A 1 143 ? 0.654   -19.248 29.675 1.00 15.30 ? 141 TYR A CD1 1 
ATOM   1169 C CD2 . TYR A 1 143 ? -0.424  -17.308 28.766 1.00 15.58 ? 141 TYR A CD2 1 
ATOM   1170 C CE1 . TYR A 1 143 ? 1.747   -18.462 30.066 1.00 14.65 ? 141 TYR A CE1 1 
ATOM   1171 C CE2 . TYR A 1 143 ? 0.657   -16.521 29.146 1.00 15.28 ? 141 TYR A CE2 1 
ATOM   1172 C CZ  . TYR A 1 143 ? 1.737   -17.100 29.793 1.00 13.86 ? 141 TYR A CZ  1 
ATOM   1173 O OH  . TYR A 1 143 ? 2.801   -16.313 30.179 1.00 14.52 ? 141 TYR A OH  1 
ATOM   1174 N N   . SER A 1 144 ? -3.521  -18.462 31.477 1.00 15.28 ? 142 SER A N   1 
ATOM   1175 C CA  . SER A 1 144 ? -4.231  -17.336 32.078 1.00 15.70 ? 142 SER A CA  1 
ATOM   1176 C C   . SER A 1 144 ? -3.660  -15.959 31.727 1.00 13.57 ? 142 SER A C   1 
ATOM   1177 O O   . SER A 1 144 ? -2.437  -15.775 31.677 1.00 13.26 ? 142 SER A O   1 
ATOM   1178 C CB  . SER A 1 144 ? -4.257  -17.483 33.602 1.00 16.62 ? 142 SER A CB  1 
ATOM   1179 O OG  . SER A 1 144 ? -4.968  -16.423 34.219 1.00 14.38 ? 142 SER A OG  1 
ATOM   1180 N N   . PRO A 1 145 ? -4.543  -14.983 31.466 1.00 12.84 ? 143 PRO A N   1 
ATOM   1181 C CA  . PRO A 1 145 ? -4.119  -13.620 31.126 1.00 13.25 ? 143 PRO A CA  1 
ATOM   1182 C C   . PRO A 1 145 ? -3.374  -12.984 32.320 1.00 12.53 ? 143 PRO A C   1 
ATOM   1183 O O   . PRO A 1 145 ? -2.723  -11.959 32.173 1.00 14.40 ? 143 PRO A O   1 
ATOM   1184 C CB  . PRO A 1 145 ? -5.440  -12.897 30.860 1.00 13.39 ? 143 PRO A CB  1 
ATOM   1185 C CG  . PRO A 1 145 ? -6.356  -13.982 30.391 1.00 16.96 ? 143 PRO A CG  1 
ATOM   1186 C CD  . PRO A 1 145 ? -6.010  -15.120 31.326 1.00 13.82 ? 143 PRO A CD  1 
ATOM   1187 N N   . GLU A 1 146 ? -3.485  -13.594 33.501 1.00 15.74 ? 144 GLU A N   1 
ATOM   1188 C CA  . GLU A 1 146 ? -2.801  -13.092 34.698 1.00 15.51 ? 144 GLU A CA  1 
ATOM   1189 C C   . GLU A 1 146 ? -1.286  -13.173 34.527 1.00 15.78 ? 144 GLU A C   1 
ATOM   1190 O O   . GLU A 1 146 ? -0.539  -12.425 35.160 1.00 16.13 ? 144 GLU A O   1 
ATOM   1191 C CB  . GLU A 1 146 ? -3.232  -13.869 35.948 1.00 18.75 ? 144 GLU A CB  1 
ATOM   1192 C CG  . GLU A 1 146 ? -4.700  -13.717 36.309 1.00 26.69 ? 144 GLU A CG  1 
ATOM   1193 C CD  . GLU A 1 146 ? -5.033  -14.271 37.688 1.00 30.14 ? 144 GLU A CD  1 
ATOM   1194 O OE1 . GLU A 1 146 ? -4.144  -14.887 38.323 1.00 31.10 ? 144 GLU A OE1 1 
ATOM   1195 O OE2 . GLU A 1 146 ? -6.187  -14.074 38.140 1.00 33.04 ? 144 GLU A OE2 1 
ATOM   1196 N N   . ASN A 1 147 ? -0.837  -14.033 33.614 1.00 12.81 ? 145 ASN A N   1 
ATOM   1197 C CA  . ASN A 1 147 ? 0.590   -14.204 33.337 1.00 15.20 ? 145 ASN A CA  1 
ATOM   1198 C C   . ASN A 1 147 ? 1.070   -13.189 32.307 1.00 13.81 ? 145 ASN A C   1 
ATOM   1199 O O   . ASN A 1 147 ? 2.244   -13.191 31.942 1.00 14.54 ? 145 ASN A O   1 
ATOM   1200 C CB  . ASN A 1 147 ? 0.868   -15.581 32.717 1.00 14.85 ? 145 ASN A CB  1 
ATOM   1201 C CG  . ASN A 1 147 ? 0.357   -16.719 33.549 1.00 19.33 ? 145 ASN A CG  1 
ATOM   1202 O OD1 . ASN A 1 147 ? -0.416  -17.551 33.074 1.00 18.42 ? 145 ASN A OD1 1 
ATOM   1203 N ND2 . ASN A 1 147 ? 0.821   -16.799 34.782 1.00 16.50 ? 145 ASN A ND2 1 
ATOM   1204 N N   . VAL A 1 148 ? 0.165   -12.332 31.848 1.00 14.82 ? 146 VAL A N   1 
ATOM   1205 C CA  . VAL A 1 148 ? 0.486   -11.374 30.800 1.00 12.97 ? 146 VAL A CA  1 
ATOM   1206 C C   . VAL A 1 148 ? 0.681   -9.930  31.252 1.00 9.03  ? 146 VAL A C   1 
ATOM   1207 O O   . VAL A 1 148 ? -0.134  -9.387  31.988 1.00 10.07 ? 146 VAL A O   1 
ATOM   1208 C CB  . VAL A 1 148 ? -0.601  -11.390 29.697 1.00 13.90 ? 146 VAL A CB  1 
ATOM   1209 C CG1 . VAL A 1 148 ? -0.188  -10.466 28.560 1.00 11.34 ? 146 VAL A CG1 1 
ATOM   1210 C CG2 . VAL A 1 148 ? -0.824  -12.826 29.177 1.00 12.73 ? 146 VAL A CG2 1 
ATOM   1211 N N   . HIS A 1 149 ? 1.739   -9.319  30.743 1.00 9.08  ? 147 HIS A N   1 
ATOM   1212 C CA  . HIS A 1 149 ? 2.086   -7.934  31.050 1.00 10.70 ? 147 HIS A CA  1 
ATOM   1213 C C   . HIS A 1 149 ? 2.151   -7.205  29.715 1.00 7.82  ? 147 HIS A C   1 
ATOM   1214 O O   . HIS A 1 149 ? 2.889   -7.606  28.826 1.00 13.15 ? 147 HIS A O   1 
ATOM   1215 C CB  . HIS A 1 149 ? 3.463   -7.893  31.711 1.00 12.03 ? 147 HIS A CB  1 
ATOM   1216 C CG  . HIS A 1 149 ? 3.953   -6.514  32.049 1.00 12.37 ? 147 HIS A CG  1 
ATOM   1217 N ND1 . HIS A 1 149 ? 5.282   -6.253  32.318 1.00 13.66 ? 147 HIS A ND1 1 
ATOM   1218 C CD2 . HIS A 1 149 ? 3.302   -5.338  32.202 1.00 12.41 ? 147 HIS A CD2 1 
ATOM   1219 C CE1 . HIS A 1 149 ? 5.424   -4.977  32.624 1.00 14.18 ? 147 HIS A CE1 1 
ATOM   1220 N NE2 . HIS A 1 149 ? 4.238   -4.398  32.563 1.00 14.28 ? 147 HIS A NE2 1 
ATOM   1221 N N   . LEU A 1 150 ? 1.389   -6.132  29.578 1.00 11.30 ? 148 LEU A N   1 
ATOM   1222 C CA  . LEU A 1 150 ? 1.408   -5.361  28.342 1.00 10.87 ? 148 LEU A CA  1 
ATOM   1223 C C   . LEU A 1 150 ? 2.115   -4.020  28.585 1.00 8.57  ? 148 LEU A C   1 
ATOM   1224 O O   . LEU A 1 150 ? 1.689   -3.242  29.436 1.00 12.08 ? 148 LEU A O   1 
ATOM   1225 C CB  . LEU A 1 150 ? -0.023  -5.132  27.857 1.00 10.49 ? 148 LEU A CB  1 
ATOM   1226 C CG  . LEU A 1 150 ? -0.950  -6.341  27.768 1.00 12.95 ? 148 LEU A CG  1 
ATOM   1227 C CD1 . LEU A 1 150 ? -2.327  -5.906  27.326 1.00 10.09 ? 148 LEU A CD1 1 
ATOM   1228 C CD2 . LEU A 1 150 ? -0.371  -7.383  26.836 1.00 9.16  ? 148 LEU A CD2 1 
ATOM   1229 N N   . ILE A 1 151 ? 3.238   -3.801  27.915 1.00 9.31  ? 149 ILE A N   1 
ATOM   1230 C CA  . ILE A 1 151 ? 3.981   -2.547  28.041 1.00 12.02 ? 149 ILE A CA  1 
ATOM   1231 C C   . ILE A 1 151 ? 3.745   -1.768  26.749 1.00 12.55 ? 149 ILE A C   1 
ATOM   1232 O O   . ILE A 1 151 ? 4.080   -2.255  25.668 1.00 11.61 ? 149 ILE A O   1 
ATOM   1233 C CB  . ILE A 1 151 ? 5.496   -2.768  28.180 1.00 13.12 ? 149 ILE A CB  1 
ATOM   1234 C CG1 . ILE A 1 151 ? 5.807   -3.574  29.439 1.00 11.79 ? 149 ILE A CG1 1 
ATOM   1235 C CG2 . ILE A 1 151 ? 6.232   -1.410  28.230 1.00 13.56 ? 149 ILE A CG2 1 
ATOM   1236 C CD1 . ILE A 1 151 ? 7.206   -4.155  29.450 1.00 11.90 ? 149 ILE A CD1 1 
ATOM   1237 N N   . GLY A 1 152 ? 3.153   -0.583  26.868 1.00 10.16 ? 150 GLY A N   1 
ATOM   1238 C CA  . GLY A 1 152 ? 2.888   0.252   25.706 1.00 14.21 ? 150 GLY A CA  1 
ATOM   1239 C C   . GLY A 1 152 ? 3.456   1.657   25.881 1.00 13.89 ? 150 GLY A C   1 
ATOM   1240 O O   . GLY A 1 152 ? 3.199   2.318   26.891 1.00 13.39 ? 150 GLY A O   1 
ATOM   1241 N N   . HIS A 1 153 ? 4.244   2.104   24.913 1.00 12.38 ? 151 HIS A N   1 
ATOM   1242 C CA  . HIS A 1 153 ? 4.849   3.438   24.950 1.00 16.16 ? 151 HIS A CA  1 
ATOM   1243 C C   . HIS A 1 153 ? 4.136   4.366   23.974 1.00 18.13 ? 151 HIS A C   1 
ATOM   1244 O O   . HIS A 1 153 ? 3.761   3.936   22.883 1.00 16.47 ? 151 HIS A O   1 
ATOM   1245 C CB  . HIS A 1 153 ? 6.323   3.350   24.549 1.00 15.46 ? 151 HIS A CB  1 
ATOM   1246 C CG  . HIS A 1 153 ? 6.981   4.678   24.319 1.00 19.56 ? 151 HIS A CG  1 
ATOM   1247 N ND1 . HIS A 1 153 ? 7.378   5.108   23.070 1.00 18.12 ? 151 HIS A ND1 1 
ATOM   1248 C CD2 . HIS A 1 153 ? 7.340   5.657   25.185 1.00 18.38 ? 151 HIS A CD2 1 
ATOM   1249 C CE1 . HIS A 1 153 ? 7.961   6.289   23.178 1.00 21.03 ? 151 HIS A CE1 1 
ATOM   1250 N NE2 . HIS A 1 153 ? 7.950   6.645   24.451 1.00 17.53 ? 151 HIS A NE2 1 
ATOM   1251 N N   . SER A 1 154 ? 3.973   5.636   24.344 1.00 17.19 ? 152 SER A N   1 
ATOM   1252 C CA  . SER A 1 154 ? 3.352   6.605   23.443 1.00 16.85 ? 152 SER A CA  1 
ATOM   1253 C C   . SER A 1 154 ? 1.958   6.142   23.012 1.00 12.72 ? 152 SER A C   1 
ATOM   1254 O O   . SER A 1 154 ? 1.103   5.853   23.844 1.00 11.92 ? 152 SER A O   1 
ATOM   1255 C CB  . SER A 1 154 ? 4.267   6.786   22.226 1.00 17.46 ? 152 SER A CB  1 
ATOM   1256 O OG  . SER A 1 154 ? 3.883   7.858   21.380 1.00 19.18 ? 152 SER A OG  1 
ATOM   1257 N N   . LEU A 1 155 ? 1.714   6.096   21.705 1.00 15.02 ? 153 LEU A N   1 
ATOM   1258 C CA  . LEU A 1 155 ? 0.426   5.656   21.189 1.00 14.34 ? 153 LEU A CA  1 
ATOM   1259 C C   . LEU A 1 155 ? 0.200   4.202   21.637 1.00 13.39 ? 153 LEU A C   1 
ATOM   1260 O O   . LEU A 1 155 ? -0.927  3.782   21.873 1.00 11.60 ? 153 LEU A O   1 
ATOM   1261 C CB  . LEU A 1 155 ? 0.433   5.777   19.653 1.00 16.21 ? 153 LEU A CB  1 
ATOM   1262 C CG  . LEU A 1 155 ? -0.748  6.488   18.982 1.00 18.54 ? 153 LEU A CG  1 
ATOM   1263 C CD1 . LEU A 1 155 ? -1.129  7.715   19.747 1.00 17.26 ? 153 LEU A CD1 1 
ATOM   1264 C CD2 . LEU A 1 155 ? -0.427  6.823   17.511 1.00 16.17 ? 153 LEU A CD2 1 
ATOM   1265 N N   . GLY A 1 156 ? 1.303   3.485   21.837 1.00 15.10 ? 154 GLY A N   1 
ATOM   1266 C CA  . GLY A 1 156 ? 1.250   2.101   22.262 1.00 14.99 ? 154 GLY A CA  1 
ATOM   1267 C C   . GLY A 1 156 ? 0.614   1.899   23.616 1.00 14.90 ? 154 GLY A C   1 
ATOM   1268 O O   . GLY A 1 156 ? 0.162   0.794   23.919 1.00 11.73 ? 154 GLY A O   1 
ATOM   1269 N N   . ALA A 1 157 ? 0.598   2.940   24.450 1.00 14.31 ? 155 ALA A N   1 
ATOM   1270 C CA  . ALA A 1 157 ? -0.017  2.850   25.770 1.00 11.14 ? 155 ALA A CA  1 
ATOM   1271 C C   . ALA A 1 157 ? -1.523  2.720   25.637 1.00 9.66  ? 155 ALA A C   1 
ATOM   1272 O O   . ALA A 1 157 ? -2.175  2.038   26.433 1.00 9.29  ? 155 ALA A O   1 
ATOM   1273 C CB  . ALA A 1 157 ? 0.344   4.096   26.626 1.00 10.99 ? 155 ALA A CB  1 
ATOM   1274 N N   . HIS A 1 158 ? -2.091  3.358   24.613 1.00 10.88 ? 156 HIS A N   1 
ATOM   1275 C CA  . HIS A 1 158 ? -3.525  3.274   24.391 1.00 10.79 ? 156 HIS A CA  1 
ATOM   1276 C C   . HIS A 1 158 ? -3.857  1.974   23.661 1.00 8.96  ? 156 HIS A C   1 
ATOM   1277 O O   . HIS A 1 158 ? -4.962  1.452   23.800 1.00 12.51 ? 156 HIS A O   1 
ATOM   1278 C CB  . HIS A 1 158 ? -3.999  4.503   23.629 1.00 10.71 ? 156 HIS A CB  1 
ATOM   1279 C CG  . HIS A 1 158 ? -3.624  5.777   24.316 1.00 12.86 ? 156 HIS A CG  1 
ATOM   1280 N ND1 . HIS A 1 158 ? -4.109  6.111   25.563 1.00 10.90 ? 156 HIS A ND1 1 
ATOM   1281 C CD2 . HIS A 1 158 ? -2.754  6.754   23.975 1.00 12.28 ? 156 HIS A CD2 1 
ATOM   1282 C CE1 . HIS A 1 158 ? -3.553  7.242   25.961 1.00 10.97 ? 156 HIS A CE1 1 
ATOM   1283 N NE2 . HIS A 1 158 ? -2.728  7.653   25.014 1.00 14.00 ? 156 HIS A NE2 1 
ATOM   1284 N N   . VAL A 1 159 ? -2.912  1.482   22.869 1.00 8.98  ? 157 VAL A N   1 
ATOM   1285 C CA  . VAL A 1 159 ? -3.089  0.193   22.196 1.00 11.09 ? 157 VAL A CA  1 
ATOM   1286 C C   . VAL A 1 159 ? -3.299  -0.835  23.313 1.00 13.34 ? 157 VAL A C   1 
ATOM   1287 O O   . VAL A 1 159 ? -4.315  -1.533  23.352 1.00 13.80 ? 157 VAL A O   1 
ATOM   1288 C CB  . VAL A 1 159 ? -1.828  -0.230  21.405 1.00 10.30 ? 157 VAL A CB  1 
ATOM   1289 C CG1 . VAL A 1 159 ? -1.885  -1.724  21.079 1.00 10.97 ? 157 VAL A CG1 1 
ATOM   1290 C CG2 . VAL A 1 159 ? -1.695  0.587   20.107 1.00 11.58 ? 157 VAL A CG2 1 
ATOM   1291 N N   . VAL A 1 160 ? -2.351  -0.893  24.249 1.00 11.99 ? 158 VAL A N   1 
ATOM   1292 C CA  . VAL A 1 160 ? -2.463  -1.847  25.353 1.00 11.74 ? 158 VAL A CA  1 
ATOM   1293 C C   . VAL A 1 160 ? -3.663  -1.574  26.231 1.00 10.15 ? 158 VAL A C   1 
ATOM   1294 O O   . VAL A 1 160 ? -4.285  -2.500  26.735 1.00 11.99 ? 158 VAL A O   1 
ATOM   1295 C CB  . VAL A 1 160 ? -1.167  -1.977  26.181 1.00 11.65 ? 158 VAL A CB  1 
ATOM   1296 C CG1 . VAL A 1 160 ? -0.004  -2.408  25.275 1.00 10.09 ? 158 VAL A CG1 1 
ATOM   1297 C CG2 . VAL A 1 160 ? -0.840  -0.674  26.922 1.00 11.39 ? 158 VAL A CG2 1 
ATOM   1298 N N   . GLY A 1 161 ? -4.001  -0.304  26.430 1.00 9.52  ? 159 GLY A N   1 
ATOM   1299 C CA  . GLY A 1 161 ? -5.190  -0.005  27.201 1.00 7.65  ? 159 GLY A CA  1 
ATOM   1300 C C   . GLY A 1 161 ? -6.434  -0.601  26.540 1.00 9.05  ? 159 GLY A C   1 
ATOM   1301 O O   . GLY A 1 161 ? -7.345  -1.109  27.210 1.00 5.69  ? 159 GLY A O   1 
ATOM   1302 N N   . GLU A 1 162 ? -6.495  -0.535  25.214 1.00 11.69 ? 160 GLU A N   1 
ATOM   1303 C CA  . GLU A 1 162 ? -7.640  -1.098  24.488 1.00 10.86 ? 160 GLU A CA  1 
ATOM   1304 C C   . GLU A 1 162 ? -7.675  -2.627  24.658 1.00 8.19  ? 160 GLU A C   1 
ATOM   1305 O O   . GLU A 1 162 ? -8.737  -3.218  24.868 1.00 8.57  ? 160 GLU A O   1 
ATOM   1306 C CB  . GLU A 1 162 ? -7.566  -0.742  22.999 1.00 12.35 ? 160 GLU A CB  1 
ATOM   1307 C CG  . GLU A 1 162 ? -8.576  -1.491  22.117 1.00 13.67 ? 160 GLU A CG  1 
ATOM   1308 C CD  . GLU A 1 162 ? -10.018 -1.095  22.362 1.00 14.15 ? 160 GLU A CD  1 
ATOM   1309 O OE1 . GLU A 1 162 ? -10.303 -0.275  23.266 1.00 13.10 ? 160 GLU A OE1 1 
ATOM   1310 O OE2 . GLU A 1 162 ? -10.892 -1.612  21.637 1.00 16.55 ? 160 GLU A OE2 1 
ATOM   1311 N N   . ALA A 1 163 ? -6.513  -3.253  24.555 1.00 13.54 ? 161 ALA A N   1 
ATOM   1312 C CA  . ALA A 1 163 ? -6.414  -4.699  24.729 1.00 11.81 ? 161 ALA A CA  1 
ATOM   1313 C C   . ALA A 1 163 ? -6.963  -5.072  26.103 1.00 12.59 ? 161 ALA A C   1 
ATOM   1314 O O   . ALA A 1 163 ? -7.741  -6.016  26.232 1.00 11.92 ? 161 ALA A O   1 
ATOM   1315 C CB  . ALA A 1 163 ? -4.978  -5.145  24.583 1.00 11.54 ? 161 ALA A CB  1 
ATOM   1316 N N   . GLY A 1 164 ? -6.608  -4.281  27.118 1.00 14.04 ? 162 GLY A N   1 
ATOM   1317 C CA  . GLY A 1 164 ? -7.078  -4.532  28.469 1.00 9.87  ? 162 GLY A CA  1 
ATOM   1318 C C   . GLY A 1 164 ? -8.576  -4.436  28.632 1.00 11.02 ? 162 GLY A C   1 
ATOM   1319 O O   . GLY A 1 164 ? -9.194  -5.292  29.265 1.00 12.11 ? 162 GLY A O   1 
ATOM   1320 N N   . ARG A 1 165 ? -9.179  -3.411  28.036 1.00 9.90  ? 163 ARG A N   1 
ATOM   1321 C CA  . ARG A 1 165 ? -10.614 -3.218  28.108 1.00 8.80  ? 163 ARG A CA  1 
ATOM   1322 C C   . ARG A 1 165 ? -11.311 -4.444  27.508 1.00 7.05  ? 163 ARG A C   1 
ATOM   1323 O O   . ARG A 1 165 ? -12.301 -4.939  28.053 1.00 7.68  ? 163 ARG A O   1 
ATOM   1324 C CB  . ARG A 1 165 ? -11.020 -1.974  27.300 1.00 9.87  ? 163 ARG A CB  1 
ATOM   1325 C CG  . ARG A 1 165 ? -12.486 -1.570  27.469 1.00 13.35 ? 163 ARG A CG  1 
ATOM   1326 C CD  . ARG A 1 165 ? -12.861 -0.423  26.518 1.00 14.38 ? 163 ARG A CD  1 
ATOM   1327 N NE  . ARG A 1 165 ? -12.764 -0.817  25.111 1.00 16.33 ? 163 ARG A NE  1 
ATOM   1328 C CZ  . ARG A 1 165 ? -13.653 -1.589  24.489 1.00 15.64 ? 163 ARG A CZ  1 
ATOM   1329 N NH1 . ARG A 1 165 ? -14.716 -2.046  25.140 1.00 17.01 ? 163 ARG A NH1 1 
ATOM   1330 N NH2 . ARG A 1 165 ? -13.463 -1.932  23.224 1.00 14.65 ? 163 ARG A NH2 1 
ATOM   1331 N N   . ARG A 1 166 ? -10.777 -4.924  26.389 1.00 11.63 ? 164 ARG A N   1 
ATOM   1332 C CA  . ARG A 1 166 ? -11.353 -6.075  25.688 1.00 12.99 ? 164 ARG A CA  1 
ATOM   1333 C C   . ARG A 1 166 ? -11.256 -7.336  26.531 1.00 14.80 ? 164 ARG A C   1 
ATOM   1334 O O   . ARG A 1 166 ? -12.101 -8.221  26.436 1.00 16.69 ? 164 ARG A O   1 
ATOM   1335 C CB  . ARG A 1 166 ? -10.671 -6.267  24.337 1.00 15.50 ? 164 ARG A CB  1 
ATOM   1336 C CG  . ARG A 1 166 ? -11.131 -5.249  23.311 1.00 15.66 ? 164 ARG A CG  1 
ATOM   1337 C CD  . ARG A 1 166 ? -10.296 -5.284  22.054 1.00 18.94 ? 164 ARG A CD  1 
ATOM   1338 N NE  . ARG A 1 166 ? -10.818 -4.323  21.087 1.00 18.95 ? 164 ARG A NE  1 
ATOM   1339 C CZ  . ARG A 1 166 ? -11.802 -4.578  20.227 1.00 20.84 ? 164 ARG A CZ  1 
ATOM   1340 N NH1 . ARG A 1 166 ? -12.325 -5.794  20.143 1.00 17.84 ? 164 ARG A NH1 1 
ATOM   1341 N NH2 . ARG A 1 166 ? -12.220 -3.624  19.403 1.00 18.38 ? 164 ARG A NH2 1 
ATOM   1342 N N   . LEU A 1 167 ? -10.225 -7.392  27.365 1.00 15.31 ? 165 LEU A N   1 
ATOM   1343 C CA  . LEU A 1 167 ? -10.001 -8.519  28.262 1.00 16.15 ? 165 LEU A CA  1 
ATOM   1344 C C   . LEU A 1 167 ? -10.739 -8.296  29.588 1.00 17.15 ? 165 LEU A C   1 
ATOM   1345 O O   . LEU A 1 167 ? -10.556 -9.041  30.560 1.00 18.46 ? 165 LEU A O   1 
ATOM   1346 C CB  . LEU A 1 167 ? -8.497  -8.712  28.472 1.00 16.61 ? 165 LEU A CB  1 
ATOM   1347 C CG  . LEU A 1 167 ? -7.727  -9.140  27.218 1.00 17.76 ? 165 LEU A CG  1 
ATOM   1348 C CD1 . LEU A 1 167 ? -6.227  -9.015  27.420 1.00 17.48 ? 165 LEU A CD1 1 
ATOM   1349 C CD2 . LEU A 1 167 ? -8.107  -10.571 26.828 1.00 18.36 ? 165 LEU A CD2 1 
ATOM   1350 N N   . GLU A 1 168 ? -11.595 -7.280  29.611 1.00 14.90 ? 166 GLU A N   1 
ATOM   1351 C CA  . GLU A 1 168 ? -12.396 -6.934  30.777 1.00 16.57 ? 166 GLU A CA  1 
ATOM   1352 C C   . GLU A 1 168 ? -11.587 -6.674  32.055 1.00 14.46 ? 166 GLU A C   1 
ATOM   1353 O O   . GLU A 1 168 ? -12.049 -6.952  33.159 1.00 15.17 ? 166 GLU A O   1 
ATOM   1354 C CB  . GLU A 1 168 ? -13.472 -7.993  31.000 1.00 20.48 ? 166 GLU A CB  1 
ATOM   1355 C CG  . GLU A 1 168 ? -14.508 -8.012  29.874 1.00 26.73 ? 166 GLU A CG  1 
ATOM   1356 C CD  . GLU A 1 168 ? -15.434 -9.204  29.920 1.00 29.40 ? 166 GLU A CD  1 
ATOM   1357 O OE1 . GLU A 1 168 ? -16.062 -9.446  30.973 1.00 32.76 ? 166 GLU A OE1 1 
ATOM   1358 O OE2 . GLU A 1 168 ? -15.549 -9.893  28.886 1.00 34.79 ? 166 GLU A OE2 1 
ATOM   1359 N N   . GLY A 1 169 ? -10.385 -6.147  31.880 1.00 16.22 ? 167 GLY A N   1 
ATOM   1360 C CA  . GLY A 1 169 ? -9.522  -5.814  33.006 1.00 16.39 ? 167 GLY A CA  1 
ATOM   1361 C C   . GLY A 1 169 ? -8.820  -6.990  33.659 1.00 17.39 ? 167 GLY A C   1 
ATOM   1362 O O   . GLY A 1 169 ? -8.206  -6.832  34.719 1.00 18.16 ? 167 GLY A O   1 
ATOM   1363 N N   . HIS A 1 170 ? -8.875  -8.163  33.030 1.00 17.63 ? 168 HIS A N   1 
ATOM   1364 C CA  . HIS A 1 170 ? -8.229  -9.346  33.603 1.00 19.18 ? 168 HIS A CA  1 
ATOM   1365 C C   . HIS A 1 170 ? -6.783  -9.617  33.244 1.00 17.61 ? 168 HIS A C   1 
ATOM   1366 O O   . HIS A 1 170 ? -6.181  -10.558 33.767 1.00 19.66 ? 168 HIS A O   1 
ATOM   1367 C CB  . HIS A 1 170 ? -9.088  -10.590 33.382 1.00 21.02 ? 168 HIS A CB  1 
ATOM   1368 C CG  . HIS A 1 170 ? -10.309 -10.606 34.238 1.00 21.54 ? 168 HIS A CG  1 
ATOM   1369 N ND1 . HIS A 1 170 ? -10.334 -11.205 35.479 1.00 22.94 ? 168 HIS A ND1 1 
ATOM   1370 C CD2 . HIS A 1 170 ? -11.510 -9.999  34.088 1.00 22.42 ? 168 HIS A CD2 1 
ATOM   1371 C CE1 . HIS A 1 170 ? -11.494 -10.959 36.060 1.00 21.68 ? 168 HIS A CE1 1 
ATOM   1372 N NE2 . HIS A 1 170 ? -12.225 -10.228 35.239 1.00 21.92 ? 168 HIS A NE2 1 
ATOM   1373 N N   . VAL A 1 171 ? -6.209  -8.807  32.366 1.00 14.81 ? 169 VAL A N   1 
ATOM   1374 C CA  . VAL A 1 171 ? -4.819  -8.997  32.001 1.00 13.01 ? 169 VAL A CA  1 
ATOM   1375 C C   . VAL A 1 171 ? -4.047  -8.639  33.282 1.00 14.16 ? 169 VAL A C   1 
ATOM   1376 O O   . VAL A 1 171 ? -4.473  -7.755  34.041 1.00 12.05 ? 169 VAL A O   1 
ATOM   1377 C CB  . VAL A 1 171 ? -4.403  -8.118  30.798 1.00 13.73 ? 169 VAL A CB  1 
ATOM   1378 C CG1 . VAL A 1 171 ? -4.218  -6.660  31.210 1.00 13.04 ? 169 VAL A CG1 1 
ATOM   1379 C CG2 . VAL A 1 171 ? -3.154  -8.667  30.159 1.00 12.29 ? 169 VAL A CG2 1 
ATOM   1380 N N   . GLY A 1 172 ? -2.987  -9.381  33.548 1.00 13.58 ? 170 GLY A N   1 
ATOM   1381 C CA  . GLY A 1 172 ? -2.206  -9.177  34.759 1.00 12.42 ? 170 GLY A CA  1 
ATOM   1382 C C   . GLY A 1 172 ? -1.724  -7.767  35.028 1.00 11.67 ? 170 GLY A C   1 
ATOM   1383 O O   . GLY A 1 172 ? -1.952  -7.223  36.121 1.00 12.88 ? 170 GLY A O   1 
ATOM   1384 N N   . ARG A 1 173 ? -1.086  -7.153  34.038 1.00 13.06 ? 171 ARG A N   1 
ATOM   1385 C CA  . ARG A 1 173 ? -0.553  -5.808  34.227 1.00 12.03 ? 171 ARG A CA  1 
ATOM   1386 C C   . ARG A 1 173 ? -0.386  -5.032  32.927 1.00 11.95 ? 171 ARG A C   1 
ATOM   1387 O O   . ARG A 1 173 ? -0.181  -5.617  31.859 1.00 9.98  ? 171 ARG A O   1 
ATOM   1388 C CB  . ARG A 1 173 ? 0.816   -5.938  34.912 1.00 13.18 ? 171 ARG A CB  1 
ATOM   1389 C CG  . ARG A 1 173 ? 1.580   -4.655  35.180 1.00 13.86 ? 171 ARG A CG  1 
ATOM   1390 C CD  . ARG A 1 173 ? 2.993   -4.971  35.635 1.00 12.89 ? 171 ARG A CD  1 
ATOM   1391 N NE  . ARG A 1 173 ? 3.781   -3.768  35.882 1.00 12.88 ? 171 ARG A NE  1 
ATOM   1392 C CZ  . ARG A 1 173 ? 5.084   -3.765  36.147 1.00 13.26 ? 171 ARG A CZ  1 
ATOM   1393 N NH1 . ARG A 1 173 ? 5.773   -4.900  36.200 1.00 10.07 ? 171 ARG A NH1 1 
ATOM   1394 N NH2 . ARG A 1 173 ? 5.707   -2.618  36.348 1.00 12.01 ? 171 ARG A NH2 1 
ATOM   1395 N N   . ILE A 1 174 ? -0.501  -3.710  33.029 1.00 12.36 ? 172 ILE A N   1 
ATOM   1396 C CA  . ILE A 1 174 ? -0.273  -2.812  31.907 1.00 12.54 ? 172 ILE A CA  1 
ATOM   1397 C C   . ILE A 1 174 ? 0.651   -1.722  32.438 1.00 11.56 ? 172 ILE A C   1 
ATOM   1398 O O   . ILE A 1 174 ? 0.409   -1.185  33.530 1.00 10.33 ? 172 ILE A O   1 
ATOM   1399 C CB  . ILE A 1 174 ? -1.568  -2.111  31.394 1.00 10.54 ? 172 ILE A CB  1 
ATOM   1400 C CG1 . ILE A 1 174 ? -2.404  -3.058  30.522 1.00 9.96  ? 172 ILE A CG1 1 
ATOM   1401 C CG2 . ILE A 1 174 ? -1.190  -0.901  30.527 1.00 11.59 ? 172 ILE A CG2 1 
ATOM   1402 C CD1 . ILE A 1 174 ? -3.801  -2.534  30.248 1.00 10.58 ? 172 ILE A CD1 1 
ATOM   1403 N N   . THR A 1 175 ? 1.702   -1.424  31.681 1.00 11.80 ? 173 THR A N   1 
ATOM   1404 C CA  . THR A 1 175 ? 2.641   -0.354  32.013 1.00 13.33 ? 173 THR A CA  1 
ATOM   1405 C C   . THR A 1 175 ? 2.556   0.640   30.856 1.00 13.69 ? 173 THR A C   1 
ATOM   1406 O O   . THR A 1 175 ? 2.747   0.267   29.684 1.00 13.08 ? 173 THR A O   1 
ATOM   1407 C CB  . THR A 1 175 ? 4.100   -0.858  32.112 1.00 10.44 ? 173 THR A CB  1 
ATOM   1408 O OG1 . THR A 1 175 ? 4.193   -1.813  33.175 1.00 15.88 ? 173 THR A OG1 1 
ATOM   1409 C CG2 . THR A 1 175 ? 5.070   0.303   32.428 1.00 10.02 ? 173 THR A CG2 1 
ATOM   1410 N N   . GLY A 1 176 ? 2.176   1.870   31.174 1.00 11.11 ? 174 GLY A N   1 
ATOM   1411 C CA  . GLY A 1 176 ? 2.102   2.908   30.160 1.00 11.86 ? 174 GLY A CA  1 
ATOM   1412 C C   . GLY A 1 176 ? 3.356   3.761   30.230 1.00 11.20 ? 174 GLY A C   1 
ATOM   1413 O O   . GLY A 1 176 ? 3.674   4.328   31.294 1.00 10.57 ? 174 GLY A O   1 
ATOM   1414 N N   . LEU A 1 177 ? 4.122   3.789   29.148 1.00 11.69 ? 175 LEU A N   1 
ATOM   1415 C CA  . LEU A 1 177 ? 5.341   4.583   29.093 1.00 7.94  ? 175 LEU A CA  1 
ATOM   1416 C C   . LEU A 1 177 ? 5.023   5.871   28.329 1.00 14.19 ? 175 LEU A C   1 
ATOM   1417 O O   . LEU A 1 177 ? 4.824   5.859   27.102 1.00 11.95 ? 175 LEU A O   1 
ATOM   1418 C CB  . LEU A 1 177 ? 6.480   3.806   28.434 1.00 8.63  ? 175 LEU A CB  1 
ATOM   1419 C CG  . LEU A 1 177 ? 6.866   2.512   29.174 1.00 9.35  ? 175 LEU A CG  1 
ATOM   1420 C CD1 . LEU A 1 177 ? 7.981   1.831   28.443 1.00 6.31  ? 175 LEU A CD1 1 
ATOM   1421 C CD2 . LEU A 1 177 ? 7.282   2.831   30.604 1.00 8.88  ? 175 LEU A CD2 1 
ATOM   1422 N N   . ASP A 1 178 ? 4.892   6.954   29.087 1.00 12.64 ? 176 ASP A N   1 
ATOM   1423 C CA  . ASP A 1 178 ? 4.548   8.283   28.564 1.00 13.22 ? 176 ASP A CA  1 
ATOM   1424 C C   . ASP A 1 178 ? 3.430   8.189   27.521 1.00 11.51 ? 176 ASP A C   1 
ATOM   1425 O O   . ASP A 1 178 ? 3.663   8.416   26.334 1.00 14.47 ? 176 ASP A O   1 
ATOM   1426 C CB  . ASP A 1 178 ? 5.784   9.008   28.003 1.00 12.49 ? 176 ASP A CB  1 
ATOM   1427 C CG  . ASP A 1 178 ? 5.664   10.535  28.095 1.00 15.15 ? 176 ASP A CG  1 
ATOM   1428 O OD1 . ASP A 1 178 ? 5.243   11.042  29.152 1.00 13.25 ? 176 ASP A OD1 1 
ATOM   1429 O OD2 . ASP A 1 178 ? 5.990   11.236  27.109 1.00 14.55 ? 176 ASP A OD2 1 
ATOM   1430 N N   . PRO A 1 179 ? 2.208   7.827   27.960 1.00 11.94 ? 177 PRO A N   1 
ATOM   1431 C CA  . PRO A 1 179 ? 1.038   7.696   27.076 1.00 12.56 ? 177 PRO A CA  1 
ATOM   1432 C C   . PRO A 1 179 ? 0.771   8.970   26.269 1.00 14.84 ? 177 PRO A C   1 
ATOM   1433 O O   . PRO A 1 179 ? 0.730   10.070  26.817 1.00 11.74 ? 177 PRO A O   1 
ATOM   1434 C CB  . PRO A 1 179 ? -0.108  7.435   28.046 1.00 12.21 ? 177 PRO A CB  1 
ATOM   1435 C CG  . PRO A 1 179 ? 0.562   6.752   29.203 1.00 13.19 ? 177 PRO A CG  1 
ATOM   1436 C CD  . PRO A 1 179 ? 1.838   7.546   29.356 1.00 13.78 ? 177 PRO A CD  1 
ATOM   1437 N N   . ALA A 1 180 ? 0.512   8.798   24.976 1.00 12.54 ? 178 ALA A N   1 
ATOM   1438 C CA  . ALA A 1 180 ? 0.269   9.943   24.099 1.00 12.15 ? 178 ALA A CA  1 
ATOM   1439 C C   . ALA A 1 180 ? -0.913  10.788  24.534 1.00 9.51  ? 178 ALA A C   1 
ATOM   1440 O O   . ALA A 1 180 ? -1.971  10.262  24.888 1.00 13.15 ? 178 ALA A O   1 
ATOM   1441 C CB  . ALA A 1 180 ? 0.100   9.475   22.650 1.00 11.05 ? 178 ALA A CB  1 
ATOM   1442 N N   . GLU A 1 181 ? -0.708  12.108  24.568 1.00 11.09 ? 179 GLU A N   1 
ATOM   1443 C CA  . GLU A 1 181 ? -1.758  13.031  24.946 1.00 9.98  ? 179 GLU A CA  1 
ATOM   1444 C C   . GLU A 1 181 ? -2.722  13.376  23.803 1.00 11.72 ? 179 GLU A C   1 
ATOM   1445 O O   . GLU A 1 181 ? -3.924  13.188  23.936 1.00 10.13 ? 179 GLU A O   1 
ATOM   1446 C CB  . GLU A 1 181 ? -1.183  14.349  25.501 1.00 13.89 ? 179 GLU A CB  1 
ATOM   1447 C CG  . GLU A 1 181 ? -2.280  15.366  25.849 1.00 14.67 ? 179 GLU A CG  1 
ATOM   1448 C CD  . GLU A 1 181 ? -1.834  16.821  25.778 1.00 15.90 ? 179 GLU A CD  1 
ATOM   1449 O OE1 . GLU A 1 181 ? -0.629  17.083  25.619 1.00 14.89 ? 179 GLU A OE1 1 
ATOM   1450 O OE2 . GLU A 1 181 ? -2.711  17.708  25.859 1.00 17.32 ? 179 GLU A OE2 1 
ATOM   1451 N N   . PRO A 1 182 ? -2.202  13.879  22.672 1.00 11.54 ? 180 PRO A N   1 
ATOM   1452 C CA  . PRO A 1 182 ? -3.082  14.244  21.556 1.00 14.50 ? 180 PRO A CA  1 
ATOM   1453 C C   . PRO A 1 182 ? -4.058  13.138  21.162 1.00 16.42 ? 180 PRO A C   1 
ATOM   1454 O O   . PRO A 1 182 ? -3.651  11.990  20.971 1.00 17.27 ? 180 PRO A O   1 
ATOM   1455 C CB  . PRO A 1 182 ? -2.096  14.539  20.431 1.00 11.26 ? 180 PRO A CB  1 
ATOM   1456 C CG  . PRO A 1 182 ? -0.861  14.918  21.113 1.00 14.94 ? 180 PRO A CG  1 
ATOM   1457 C CD  . PRO A 1 182 ? -0.797  13.937  22.243 1.00 9.98  ? 180 PRO A CD  1 
ATOM   1458 N N   . CYS A 1 183 ? -5.341  13.489  21.129 1.00 16.38 ? 181 CYS A N   1 
ATOM   1459 C CA  . CYS A 1 183 ? -6.443  12.592  20.762 1.00 19.89 ? 181 CYS A CA  1 
ATOM   1460 C C   . CYS A 1 183 ? -6.884  11.600  21.839 1.00 19.26 ? 181 CYS A C   1 
ATOM   1461 O O   . CYS A 1 183 ? -7.756  10.768  21.581 1.00 18.43 ? 181 CYS A O   1 
ATOM   1462 C CB  . CYS A 1 183 ? -6.144  11.831  19.458 1.00 21.37 ? 181 CYS A CB  1 
ATOM   1463 S SG  . CYS A 1 183 ? -5.932  12.856  17.972 1.00 24.77 ? 181 CYS A SG  1 
ATOM   1464 N N   . PHE A 1 184 ? -6.354  11.738  23.057 1.00 16.20 ? 182 PHE A N   1 
ATOM   1465 C CA  . PHE A 1 184 ? -6.701  10.826  24.153 1.00 13.77 ? 182 PHE A CA  1 
ATOM   1466 C C   . PHE A 1 184 ? -6.968  11.494  25.508 1.00 9.79  ? 182 PHE A C   1 
ATOM   1467 O O   . PHE A 1 184 ? -7.966  11.196  26.170 1.00 10.35 ? 182 PHE A O   1 
ATOM   1468 C CB  . PHE A 1 184 ? -5.597  9.792   24.338 1.00 13.77 ? 182 PHE A CB  1 
ATOM   1469 C CG  . PHE A 1 184 ? -5.462  8.844   23.190 1.00 12.65 ? 182 PHE A CG  1 
ATOM   1470 C CD1 . PHE A 1 184 ? -6.258  7.704   23.117 1.00 14.02 ? 182 PHE A CD1 1 
ATOM   1471 C CD2 . PHE A 1 184 ? -4.554  9.096   22.175 1.00 10.99 ? 182 PHE A CD2 1 
ATOM   1472 C CE1 . PHE A 1 184 ? -6.141  6.830   22.036 1.00 9.95  ? 182 PHE A CE1 1 
ATOM   1473 C CE2 . PHE A 1 184 ? -4.433  8.227   21.087 1.00 12.76 ? 182 PHE A CE2 1 
ATOM   1474 C CZ  . PHE A 1 184 ? -5.219  7.099   21.019 1.00 12.65 ? 182 PHE A CZ  1 
ATOM   1475 N N   . GLN A 1 185 ? -6.074  12.380  25.934 1.00 14.98 ? 183 GLN A N   1 
ATOM   1476 C CA  . GLN A 1 185 ? -6.271  13.038  27.224 1.00 12.65 ? 183 GLN A CA  1 
ATOM   1477 C C   . GLN A 1 185 ? -7.611  13.751  27.299 1.00 13.88 ? 183 GLN A C   1 
ATOM   1478 O O   . GLN A 1 185 ? -8.012  14.447  26.348 1.00 14.81 ? 183 GLN A O   1 
ATOM   1479 C CB  . GLN A 1 185 ? -5.136  14.016  27.510 1.00 14.94 ? 183 GLN A CB  1 
ATOM   1480 C CG  . GLN A 1 185 ? -5.261  14.702  28.870 1.00 15.37 ? 183 GLN A CG  1 
ATOM   1481 C CD  . GLN A 1 185 ? -3.936  15.216  29.362 1.00 16.75 ? 183 GLN A CD  1 
ATOM   1482 O OE1 . GLN A 1 185 ? -3.002  14.446  29.587 1.00 14.69 ? 183 GLN A OE1 1 
ATOM   1483 N NE2 . GLN A 1 185 ? -3.830  16.526  29.510 1.00 18.85 ? 183 GLN A NE2 1 
ATOM   1484 N N   . GLY A 1 186 ? -8.332  13.533  28.397 1.00 11.37 ? 184 GLY A N   1 
ATOM   1485 C CA  . GLY A 1 186 ? -9.618  14.180  28.579 1.00 10.73 ? 184 GLY A CA  1 
ATOM   1486 C C   . GLY A 1 186 ? -10.839 13.420  28.105 1.00 12.50 ? 184 GLY A C   1 
ATOM   1487 O O   . GLY A 1 186 ? -11.975 13.791  28.422 1.00 12.20 ? 184 GLY A O   1 
ATOM   1488 N N   . LEU A 1 187 ? -10.614 12.351  27.349 1.00 14.30 ? 185 LEU A N   1 
ATOM   1489 C CA  . LEU A 1 187 ? -11.699 11.525  26.821 1.00 14.34 ? 185 LEU A CA  1 
ATOM   1490 C C   . LEU A 1 187 ? -12.161 10.475  27.840 1.00 15.56 ? 185 LEU A C   1 
ATOM   1491 O O   . LEU A 1 187 ? -11.474 10.236  28.838 1.00 14.99 ? 185 LEU A O   1 
ATOM   1492 C CB  . LEU A 1 187 ? -11.215 10.851  25.533 1.00 15.33 ? 185 LEU A CB  1 
ATOM   1493 C CG  . LEU A 1 187 ? -11.163 11.725  24.276 1.00 13.82 ? 185 LEU A CG  1 
ATOM   1494 C CD1 . LEU A 1 187 ? -10.336 11.073  23.175 1.00 12.84 ? 185 LEU A CD1 1 
ATOM   1495 C CD2 . LEU A 1 187 ? -12.586 11.974  23.799 1.00 15.75 ? 185 LEU A CD2 1 
ATOM   1496 N N   . PRO A 1 188 ? -13.347 9.861   27.627 1.00 13.11 ? 186 PRO A N   1 
ATOM   1497 C CA  . PRO A 1 188 ? -13.843 8.843   28.566 1.00 14.24 ? 186 PRO A CA  1 
ATOM   1498 C C   . PRO A 1 188 ? -12.857 7.673   28.677 1.00 14.04 ? 186 PRO A C   1 
ATOM   1499 O O   . PRO A 1 188 ? -12.021 7.472   27.802 1.00 13.91 ? 186 PRO A O   1 
ATOM   1500 C CB  . PRO A 1 188 ? -15.160 8.405   27.918 1.00 13.92 ? 186 PRO A CB  1 
ATOM   1501 C CG  . PRO A 1 188 ? -15.612 9.647   27.209 1.00 13.13 ? 186 PRO A CG  1 
ATOM   1502 C CD  . PRO A 1 188 ? -14.332 10.079  26.553 1.00 11.57 ? 186 PRO A CD  1 
ATOM   1503 N N   . GLU A 1 189 ? -12.954 6.904   29.755 1.00 16.66 ? 187 GLU A N   1 
ATOM   1504 C CA  . GLU A 1 189 ? -12.048 5.780   29.967 1.00 17.55 ? 187 GLU A CA  1 
ATOM   1505 C C   . GLU A 1 189 ? -12.103 4.705   28.875 1.00 15.11 ? 187 GLU A C   1 
ATOM   1506 O O   . GLU A 1 189 ? -11.101 4.056   28.577 1.00 12.67 ? 187 GLU A O   1 
ATOM   1507 C CB  . GLU A 1 189 ? -12.317 5.160   31.340 1.00 19.90 ? 187 GLU A CB  1 
ATOM   1508 C CG  . GLU A 1 189 ? -11.954 6.098   32.501 1.00 20.72 ? 187 GLU A CG  1 
ATOM   1509 C CD  . GLU A 1 189 ? -12.383 5.572   33.869 1.00 23.95 ? 187 GLU A CD  1 
ATOM   1510 O OE1 . GLU A 1 189 ? -13.284 4.707   33.942 1.00 24.77 ? 187 GLU A OE1 1 
ATOM   1511 O OE2 . GLU A 1 189 ? -11.825 6.045   34.888 1.00 22.69 ? 187 GLU A OE2 1 
ATOM   1512 N N   . GLU A 1 190 ? -13.263 4.541   28.258 1.00 16.19 ? 188 GLU A N   1 
ATOM   1513 C CA  . GLU A 1 190 ? -13.430 3.521   27.222 1.00 18.13 ? 188 GLU A CA  1 
ATOM   1514 C C   . GLU A 1 190 ? -12.469 3.678   26.040 1.00 15.83 ? 188 GLU A C   1 
ATOM   1515 O O   . GLU A 1 190 ? -12.014 2.691   25.457 1.00 16.52 ? 188 GLU A O   1 
ATOM   1516 C CB  . GLU A 1 190 ? -14.885 3.531   26.738 1.00 25.10 ? 188 GLU A CB  1 
ATOM   1517 C CG  . GLU A 1 190 ? -15.293 2.320   25.909 1.00 31.49 ? 188 GLU A CG  1 
ATOM   1518 C CD  . GLU A 1 190 ? -16.696 2.448   25.326 1.00 36.24 ? 188 GLU A CD  1 
ATOM   1519 O OE1 . GLU A 1 190 ? -17.162 3.594   25.123 1.00 39.82 ? 188 GLU A OE1 1 
ATOM   1520 O OE2 . GLU A 1 190 ? -17.333 1.402   25.067 1.00 37.75 ? 188 GLU A OE2 1 
ATOM   1521 N N   . VAL A 1 191 ? -12.067 4.912   25.759 1.00 15.64 ? 189 VAL A N   1 
ATOM   1522 C CA  . VAL A 1 191 ? -11.205 5.195   24.612 1.00 13.19 ? 189 VAL A CA  1 
ATOM   1523 C C   . VAL A 1 191 ? -9.719  5.403   24.876 1.00 12.93 ? 189 VAL A C   1 
ATOM   1524 O O   . VAL A 1 191 ? -8.947  5.654   23.946 1.00 9.92  ? 189 VAL A O   1 
ATOM   1525 C CB  . VAL A 1 191 ? -11.763 6.422   23.818 1.00 16.21 ? 189 VAL A CB  1 
ATOM   1526 C CG1 . VAL A 1 191 ? -13.249 6.237   23.554 1.00 19.22 ? 189 VAL A CG1 1 
ATOM   1527 C CG2 . VAL A 1 191 ? -11.548 7.685   24.596 1.00 17.45 ? 189 VAL A CG2 1 
ATOM   1528 N N   . ARG A 1 192 ? -9.293  5.213   26.123 1.00 13.10 ? 190 ARG A N   1 
ATOM   1529 C CA  . ARG A 1 192 ? -7.889  5.417   26.467 1.00 10.78 ? 190 ARG A CA  1 
ATOM   1530 C C   . ARG A 1 192 ? -7.440  4.483   27.593 1.00 5.77  ? 190 ARG A C   1 
ATOM   1531 O O   . ARG A 1 192 ? -8.251  3.781   28.194 1.00 14.14 ? 190 ARG A O   1 
ATOM   1532 C CB  . ARG A 1 192 ? -7.678  6.863   26.943 1.00 11.40 ? 190 ARG A CB  1 
ATOM   1533 C CG  . ARG A 1 192 ? -8.519  7.230   28.163 1.00 15.08 ? 190 ARG A CG  1 
ATOM   1534 C CD  . ARG A 1 192 ? -8.154  8.607   28.730 1.00 13.25 ? 190 ARG A CD  1 
ATOM   1535 N NE  . ARG A 1 192 ? -9.100  9.019   29.769 1.00 14.57 ? 190 ARG A NE  1 
ATOM   1536 C CZ  . ARG A 1 192 ? -9.026  8.651   31.047 1.00 16.29 ? 190 ARG A CZ  1 
ATOM   1537 N NH1 . ARG A 1 192 ? -8.026  7.888   31.464 1.00 13.14 ? 190 ARG A NH1 1 
ATOM   1538 N NH2 . ARG A 1 192 ? -9.938  9.071   31.915 1.00 14.86 ? 190 ARG A NH2 1 
ATOM   1539 N N   . LEU A 1 193 ? -6.154  4.540   27.907 1.00 12.16 ? 191 LEU A N   1 
ATOM   1540 C CA  . LEU A 1 193 ? -5.597  3.747   28.999 1.00 10.75 ? 191 LEU A CA  1 
ATOM   1541 C C   . LEU A 1 193 ? -6.152  4.368   30.280 1.00 13.50 ? 191 LEU A C   1 
ATOM   1542 O O   . LEU A 1 193 ? -6.291  5.592   30.355 1.00 11.51 ? 191 LEU A O   1 
ATOM   1543 C CB  . LEU A 1 193 ? -4.072  3.859   28.990 1.00 8.37  ? 191 LEU A CB  1 
ATOM   1544 C CG  . LEU A 1 193 ? -3.286  3.224   30.154 1.00 4.37  ? 191 LEU A CG  1 
ATOM   1545 C CD1 . LEU A 1 193 ? -3.589  1.729   30.235 1.00 5.21  ? 191 LEU A CD1 1 
ATOM   1546 C CD2 . LEU A 1 193 ? -1.802  3.480   29.952 1.00 6.30  ? 191 LEU A CD2 1 
ATOM   1547 N N   . ASP A 1 194 ? -6.533  3.527   31.246 1.00 11.71 ? 192 ASP A N   1 
ATOM   1548 C CA  . ASP A 1 194 ? -7.043  3.971   32.543 1.00 12.86 ? 192 ASP A CA  1 
ATOM   1549 C C   . ASP A 1 194 ? -6.826  2.795   33.509 1.00 14.60 ? 192 ASP A C   1 
ATOM   1550 O O   . ASP A 1 194 ? -6.590  1.676   33.049 1.00 10.29 ? 192 ASP A O   1 
ATOM   1551 C CB  . ASP A 1 194 ? -8.510  4.438   32.485 1.00 12.01 ? 192 ASP A CB  1 
ATOM   1552 C CG  . ASP A 1 194 ? -9.511  3.306   32.554 1.00 14.41 ? 192 ASP A CG  1 
ATOM   1553 O OD1 . ASP A 1 194 ? -9.753  2.661   31.521 1.00 16.62 ? 192 ASP A OD1 1 
ATOM   1554 O OD2 . ASP A 1 194 ? -10.107 3.092   33.618 1.00 13.91 ? 192 ASP A OD2 1 
ATOM   1555 N N   . PRO A 1 195 ? -6.945  3.017   34.841 1.00 15.24 ? 193 PRO A N   1 
ATOM   1556 C CA  . PRO A 1 195 ? -6.732  1.930   35.815 1.00 15.87 ? 193 PRO A CA  1 
ATOM   1557 C C   . PRO A 1 195 ? -7.536  0.632   35.645 1.00 17.51 ? 193 PRO A C   1 
ATOM   1558 O O   . PRO A 1 195 ? -7.047  -0.450  35.979 1.00 18.53 ? 193 PRO A O   1 
ATOM   1559 C CB  . PRO A 1 195 ? -7.055  2.606   37.156 1.00 17.30 ? 193 PRO A CB  1 
ATOM   1560 C CG  . PRO A 1 195 ? -6.733  4.074   36.895 1.00 16.33 ? 193 PRO A CG  1 
ATOM   1561 C CD  . PRO A 1 195 ? -7.354  4.250   35.533 1.00 15.75 ? 193 PRO A CD  1 
ATOM   1562 N N   . SER A 1 196 ? -8.751  0.724   35.124 1.00 15.71 ? 194 SER A N   1 
ATOM   1563 C CA  . SER A 1 196 ? -9.593  -0.459  34.963 1.00 15.73 ? 194 SER A CA  1 
ATOM   1564 C C   . SER A 1 196 ? -9.160  -1.390  33.827 1.00 15.69 ? 194 SER A C   1 
ATOM   1565 O O   . SER A 1 196 ? -9.706  -2.492  33.683 1.00 16.79 ? 194 SER A O   1 
ATOM   1566 C CB  . SER A 1 196 ? -11.047 -0.037  34.745 1.00 18.01 ? 194 SER A CB  1 
ATOM   1567 O OG  . SER A 1 196 ? -11.189 0.575   33.471 1.00 16.60 ? 194 SER A OG  1 
ATOM   1568 N N   . ASP A 1 197 ? -8.189  -0.960  33.027 1.00 12.79 ? 195 ASP A N   1 
ATOM   1569 C CA  . ASP A 1 197 ? -7.727  -1.762  31.895 1.00 12.32 ? 195 ASP A CA  1 
ATOM   1570 C C   . ASP A 1 197 ? -6.927  -3.015  32.244 1.00 12.80 ? 195 ASP A C   1 
ATOM   1571 O O   . ASP A 1 197 ? -6.751  -3.887  31.395 1.00 12.35 ? 195 ASP A O   1 
ATOM   1572 C CB  . ASP A 1 197 ? -6.941  -0.908  30.891 1.00 9.64  ? 195 ASP A CB  1 
ATOM   1573 C CG  . ASP A 1 197 ? -7.832  0.089   30.132 1.00 9.49  ? 195 ASP A CG  1 
ATOM   1574 O OD1 . ASP A 1 197 ? -9.060  -0.145  30.035 1.00 11.59 ? 195 ASP A OD1 1 
ATOM   1575 O OD2 . ASP A 1 197 ? -7.286  1.108   29.652 1.00 9.19  ? 195 ASP A OD2 1 
ATOM   1576 N N   . ALA A 1 198 ? -6.436  -3.114  33.478 1.00 12.10 ? 196 ALA A N   1 
ATOM   1577 C CA  . ALA A 1 198 ? -5.659  -4.284  33.890 1.00 10.82 ? 196 ALA A CA  1 
ATOM   1578 C C   . ALA A 1 198 ? -5.759  -4.445  35.403 1.00 11.53 ? 196 ALA A C   1 
ATOM   1579 O O   . ALA A 1 198 ? -6.141  -3.505  36.115 1.00 12.28 ? 196 ALA A O   1 
ATOM   1580 C CB  . ALA A 1 198 ? -4.197  -4.128  33.477 1.00 11.17 ? 196 ALA A CB  1 
ATOM   1581 N N   . MET A 1 199 ? -5.439  -5.638  35.890 1.00 11.66 ? 197 MET A N   1 
ATOM   1582 C CA  . MET A 1 199 ? -5.472  -5.910  37.328 1.00 13.97 ? 197 MET A CA  1 
ATOM   1583 C C   . MET A 1 199 ? -4.574  -4.914  38.064 1.00 11.66 ? 197 MET A C   1 
ATOM   1584 O O   . MET A 1 199 ? -4.833  -4.568  39.225 1.00 14.16 ? 197 MET A O   1 
ATOM   1585 C CB  . MET A 1 199 ? -5.004  -7.340  37.603 1.00 15.55 ? 197 MET A CB  1 
ATOM   1586 C CG  . MET A 1 199 ? -5.963  -8.403  37.070 1.00 20.20 ? 197 MET A CG  1 
ATOM   1587 S SD  . MET A 1 199 ? -5.241  -10.051 37.157 1.00 26.26 ? 197 MET A SD  1 
ATOM   1588 C CE  . MET A 1 199 ? -5.349  -10.368 38.917 1.00 25.70 ? 197 MET A CE  1 
ATOM   1589 N N   . PHE A 1 200 ? -3.542  -4.455  37.363 1.00 13.16 ? 198 PHE A N   1 
ATOM   1590 C CA  . PHE A 1 200 ? -2.581  -3.494  37.864 1.00 13.03 ? 198 PHE A CA  1 
ATOM   1591 C C   . PHE A 1 200 ? -2.023  -2.657  36.707 1.00 14.12 ? 198 PHE A C   1 
ATOM   1592 O O   . PHE A 1 200 ? -1.444  -3.190  35.760 1.00 13.75 ? 198 PHE A O   1 
ATOM   1593 C CB  . PHE A 1 200 ? -1.434  -4.215  38.564 1.00 14.67 ? 198 PHE A CB  1 
ATOM   1594 C CG  . PHE A 1 200 ? -0.281  -3.322  38.914 1.00 11.29 ? 198 PHE A CG  1 
ATOM   1595 C CD1 . PHE A 1 200 ? -0.487  -2.123  39.601 1.00 10.53 ? 198 PHE A CD1 1 
ATOM   1596 C CD2 . PHE A 1 200 ? 1.010   -3.681  38.568 1.00 9.96  ? 198 PHE A CD2 1 
ATOM   1597 C CE1 . PHE A 1 200 ? 0.584   -1.312  39.929 1.00 9.49  ? 198 PHE A CE1 1 
ATOM   1598 C CE2 . PHE A 1 200 ? 2.093   -2.865  38.899 1.00 12.77 ? 198 PHE A CE2 1 
ATOM   1599 C CZ  . PHE A 1 200 ? 1.874   -1.686  39.577 1.00 10.08 ? 198 PHE A CZ  1 
ATOM   1600 N N   . VAL A 1 201 ? -2.074  -1.336  36.866 1.00 12.83 ? 199 VAL A N   1 
ATOM   1601 C CA  . VAL A 1 201 ? -1.582  -0.427  35.837 1.00 11.57 ? 199 VAL A CA  1 
ATOM   1602 C C   . VAL A 1 201 ? -0.571  0.576   36.421 1.00 9.32  ? 199 VAL A C   1 
ATOM   1603 O O   . VAL A 1 201 ? -0.910  1.290   37.368 1.00 13.00 ? 199 VAL A O   1 
ATOM   1604 C CB  . VAL A 1 201 ? -2.757  0.379   35.219 1.00 12.32 ? 199 VAL A CB  1 
ATOM   1605 C CG1 . VAL A 1 201 ? -2.238  1.328   34.166 1.00 10.37 ? 199 VAL A CG1 1 
ATOM   1606 C CG2 . VAL A 1 201 ? -3.830  -0.567  34.648 1.00 10.75 ? 199 VAL A CG2 1 
ATOM   1607 N N   . ASP A 1 202 ? 0.640   0.619   35.882 1.00 9.41  ? 200 ASP A N   1 
ATOM   1608 C CA  . ASP A 1 202 ? 1.652   1.571   36.346 1.00 12.49 ? 200 ASP A CA  1 
ATOM   1609 C C   . ASP A 1 202 ? 2.066   2.440   35.161 1.00 13.99 ? 200 ASP A C   1 
ATOM   1610 O O   . ASP A 1 202 ? 2.266   1.952   34.037 1.00 12.85 ? 200 ASP A O   1 
ATOM   1611 C CB  . ASP A 1 202 ? 2.856   0.889   37.018 1.00 11.44 ? 200 ASP A CB  1 
ATOM   1612 C CG  . ASP A 1 202 ? 3.603   -0.053  36.102 1.00 11.68 ? 200 ASP A CG  1 
ATOM   1613 O OD1 . ASP A 1 202 ? 2.977   -0.950  35.509 1.00 14.96 ? 200 ASP A OD1 1 
ATOM   1614 O OD2 . ASP A 1 202 ? 4.830   0.075   35.997 1.00 14.99 ? 200 ASP A OD2 1 
ATOM   1615 N N   . VAL A 1 203 ? 2.192   3.733   35.411 1.00 13.64 ? 201 VAL A N   1 
ATOM   1616 C CA  . VAL A 1 203 ? 2.496   4.688   34.352 1.00 11.74 ? 201 VAL A CA  1 
ATOM   1617 C C   . VAL A 1 203 ? 3.700   5.546   34.686 1.00 15.87 ? 201 VAL A C   1 
ATOM   1618 O O   . VAL A 1 203 ? 3.825   6.021   35.818 1.00 15.55 ? 201 VAL A O   1 
ATOM   1619 C CB  . VAL A 1 203 ? 1.298   5.658   34.182 1.00 12.79 ? 201 VAL A CB  1 
ATOM   1620 C CG1 . VAL A 1 203 ? 1.475   6.565   32.954 1.00 10.23 ? 201 VAL A CG1 1 
ATOM   1621 C CG2 . VAL A 1 203 ? -0.016  4.899   34.131 1.00 13.07 ? 201 VAL A CG2 1 
ATOM   1622 N N   . ILE A 1 204 ? 4.567   5.761   33.703 1.00 12.73 ? 202 ILE A N   1 
ATOM   1623 C CA  . ILE A 1 204 ? 5.726   6.624   33.882 1.00 12.31 ? 202 ILE A CA  1 
ATOM   1624 C C   . ILE A 1 204 ? 5.479   7.835   32.985 1.00 12.99 ? 202 ILE A C   1 
ATOM   1625 O O   . ILE A 1 204 ? 5.307   7.680   31.781 1.00 11.26 ? 202 ILE A O   1 
ATOM   1626 C CB  . ILE A 1 204 ? 7.028   5.938   33.465 1.00 11.32 ? 202 ILE A CB  1 
ATOM   1627 C CG1 . ILE A 1 204 ? 7.252   4.682   34.317 1.00 10.09 ? 202 ILE A CG1 1 
ATOM   1628 C CG2 . ILE A 1 204 ? 8.203   6.892   33.602 1.00 14.22 ? 202 ILE A CG2 1 
ATOM   1629 C CD1 . ILE A 1 204 ? 8.528   3.966   34.001 1.00 12.86 ? 202 ILE A CD1 1 
ATOM   1630 N N   . HIS A 1 205 ? 5.431   9.023   33.584 1.00 13.92 ? 203 HIS A N   1 
ATOM   1631 C CA  . HIS A 1 205 ? 5.187   10.278  32.855 1.00 14.34 ? 203 HIS A CA  1 
ATOM   1632 C C   . HIS A 1 205 ? 6.507   11.019  32.689 1.00 16.27 ? 203 HIS A C   1 
ATOM   1633 O O   . HIS A 1 205 ? 7.165   11.358  33.680 1.00 14.98 ? 203 HIS A O   1 
ATOM   1634 C CB  . HIS A 1 205 ? 4.233   11.179  33.625 1.00 13.25 ? 203 HIS A CB  1 
ATOM   1635 C CG  . HIS A 1 205 ? 2.895   10.574  33.911 1.00 13.36 ? 203 HIS A CG  1 
ATOM   1636 N ND1 . HIS A 1 205 ? 1.743   10.978  33.267 1.00 11.13 ? 203 HIS A ND1 1 
ATOM   1637 C CD2 . HIS A 1 205 ? 2.502   9.671   34.841 1.00 11.50 ? 203 HIS A CD2 1 
ATOM   1638 C CE1 . HIS A 1 205 ? 0.703   10.365  33.794 1.00 11.27 ? 203 HIS A CE1 1 
ATOM   1639 N NE2 . HIS A 1 205 ? 1.139   9.563   34.755 1.00 12.02 ? 203 HIS A NE2 1 
ATOM   1640 N N   . THR A 1 206 ? 6.886   11.292  31.444 1.00 14.44 ? 204 THR A N   1 
ATOM   1641 C CA  . THR A 1 206 ? 8.152   11.966  31.167 1.00 14.88 ? 204 THR A CA  1 
ATOM   1642 C C   . THR A 1 206 ? 8.101   13.189  30.232 1.00 13.93 ? 204 THR A C   1 
ATOM   1643 O O   . THR A 1 206 ? 9.107   13.872  30.073 1.00 14.02 ? 204 THR A O   1 
ATOM   1644 C CB  . THR A 1 206 ? 9.172   10.971  30.599 1.00 15.49 ? 204 THR A CB  1 
ATOM   1645 O OG1 . THR A 1 206 ? 8.601   10.320  29.455 1.00 15.98 ? 204 THR A OG1 1 
ATOM   1646 C CG2 . THR A 1 206 ? 9.561   9.906   31.652 1.00 16.03 ? 204 THR A CG2 1 
ATOM   1647 N N   . ASP A 1 207 ? 6.954   13.465  29.611 1.00 15.55 ? 205 ASP A N   1 
ATOM   1648 C CA  . ASP A 1 207 ? 6.851   14.613  28.690 1.00 14.82 ? 205 ASP A CA  1 
ATOM   1649 C C   . ASP A 1 207 ? 5.425   15.120  28.804 1.00 13.85 ? 205 ASP A C   1 
ATOM   1650 O O   . ASP A 1 207 ? 4.754   15.354  27.794 1.00 15.78 ? 205 ASP A O   1 
ATOM   1651 C CB  . ASP A 1 207 ? 7.151   14.148  27.250 1.00 16.67 ? 205 ASP A CB  1 
ATOM   1652 C CG  . ASP A 1 207 ? 7.509   15.302  26.296 1.00 19.17 ? 205 ASP A CG  1 
ATOM   1653 O OD1 . ASP A 1 207 ? 7.981   16.361  26.756 1.00 17.97 ? 205 ASP A OD1 1 
ATOM   1654 O OD2 . ASP A 1 207 ? 7.364   15.129  25.070 1.00 17.01 ? 205 ASP A OD2 1 
ATOM   1655 N N   . SER A 1 208 ? 4.970   15.297  30.040 1.00 11.14 ? 206 SER A N   1 
ATOM   1656 C CA  . SER A 1 208 ? 3.612   15.698  30.316 1.00 13.96 ? 206 SER A CA  1 
ATOM   1657 C C   . SER A 1 208 ? 3.217   17.164  30.179 1.00 13.84 ? 206 SER A C   1 
ATOM   1658 O O   . SER A 1 208 ? 2.082   17.513  30.501 1.00 15.65 ? 206 SER A O   1 
ATOM   1659 C CB  . SER A 1 208 ? 3.170   15.147  31.670 1.00 14.69 ? 206 SER A CB  1 
ATOM   1660 O OG  . SER A 1 208 ? 4.096   15.478  32.678 1.00 17.74 ? 206 SER A OG  1 
ATOM   1661 N N   . ALA A 1 209 ? 4.124   18.021  29.714 1.00 20.33 ? 207 ALA A N   1 
ATOM   1662 C CA  . ALA A 1 209 ? 3.779   19.440  29.515 1.00 19.41 ? 207 ALA A CA  1 
ATOM   1663 C C   . ALA A 1 209 ? 2.743   19.445  28.383 1.00 24.11 ? 207 ALA A C   1 
ATOM   1664 O O   . ALA A 1 209 ? 2.788   18.577  27.513 1.00 23.15 ? 207 ALA A O   1 
ATOM   1665 C CB  . ALA A 1 209 ? 5.005   20.231  29.103 1.00 21.16 ? 207 ALA A CB  1 
ATOM   1666 N N   . PRO A 1 210 ? 1.789   20.396  28.388 1.00 23.48 ? 208 PRO A N   1 
ATOM   1667 C CA  . PRO A 1 210 ? 0.798   20.396  27.303 1.00 22.81 ? 208 PRO A CA  1 
ATOM   1668 C C   . PRO A 1 210 ? 1.403   20.409  25.897 1.00 20.01 ? 208 PRO A C   1 
ATOM   1669 O O   . PRO A 1 210 ? 2.399   21.082  25.635 1.00 19.56 ? 208 PRO A O   1 
ATOM   1670 C CB  . PRO A 1 210 ? -0.054  21.639  27.597 1.00 23.42 ? 208 PRO A CB  1 
ATOM   1671 C CG  . PRO A 1 210 ? 0.805   22.477  28.518 1.00 25.81 ? 208 PRO A CG  1 
ATOM   1672 C CD  . PRO A 1 210 ? 1.498   21.455  29.371 1.00 22.96 ? 208 PRO A CD  1 
ATOM   1673 N N   . ILE A 1 211 ? 0.829   19.600  25.011 1.00 19.39 ? 209 ILE A N   1 
ATOM   1674 C CA  . ILE A 1 211 ? 1.305   19.509  23.633 1.00 18.84 ? 209 ILE A CA  1 
ATOM   1675 C C   . ILE A 1 211 ? 1.267   20.905  22.991 1.00 16.89 ? 209 ILE A C   1 
ATOM   1676 O O   . ILE A 1 211 ? 2.155   21.265  22.227 1.00 19.80 ? 209 ILE A O   1 
ATOM   1677 C CB  . ILE A 1 211 ? 0.462   18.475  22.807 1.00 18.21 ? 209 ILE A CB  1 
ATOM   1678 C CG1 . ILE A 1 211 ? 1.020   18.354  21.397 1.00 21.70 ? 209 ILE A CG1 1 
ATOM   1679 C CG2 . ILE A 1 211 ? -1.010  18.858  22.771 1.00 20.92 ? 209 ILE A CG2 1 
ATOM   1680 C CD1 . ILE A 1 211 ? 2.357   17.672  21.321 1.00 20.31 ? 209 ILE A CD1 1 
ATOM   1681 N N   . ILE A 1 212 ? 0.252   21.684  23.341 1.00 19.73 ? 210 ILE A N   1 
ATOM   1682 C CA  . ILE A 1 212 ? 0.099   23.055  22.852 1.00 21.73 ? 210 ILE A CA  1 
ATOM   1683 C C   . ILE A 1 212 ? 0.037   23.889  24.128 1.00 21.68 ? 210 ILE A C   1 
ATOM   1684 O O   . ILE A 1 212 ? -0.861  23.697  24.941 1.00 22.41 ? 210 ILE A O   1 
ATOM   1685 C CB  . ILE A 1 212 ? -1.229  23.245  22.082 1.00 23.25 ? 210 ILE A CB  1 
ATOM   1686 C CG1 . ILE A 1 212 ? -1.246  22.368  20.830 1.00 23.30 ? 210 ILE A CG1 1 
ATOM   1687 C CG2 . ILE A 1 212 ? -1.424  24.723  21.697 1.00 23.37 ? 210 ILE A CG2 1 
ATOM   1688 C CD1 . ILE A 1 212 ? -2.621  22.239  20.213 1.00 26.52 ? 210 ILE A CD1 1 
ATOM   1689 N N   . PRO A 1 213 ? 0.967   24.842  24.311 1.00 24.07 ? 211 PRO A N   1 
ATOM   1690 C CA  . PRO A 1 213 ? 2.075   25.263  23.459 1.00 23.87 ? 211 PRO A CA  1 
ATOM   1691 C C   . PRO A 1 213 ? 3.453   24.645  23.730 1.00 25.26 ? 211 PRO A C   1 
ATOM   1692 O O   . PRO A 1 213 ? 4.412   24.946  23.019 1.00 23.26 ? 211 PRO A O   1 
ATOM   1693 C CB  . PRO A 1 213 ? 2.127   26.766  23.730 1.00 24.83 ? 211 PRO A CB  1 
ATOM   1694 C CG  . PRO A 1 213 ? 1.907   26.820  25.186 1.00 25.32 ? 211 PRO A CG  1 
ATOM   1695 C CD  . PRO A 1 213 ? 0.785   25.810  25.416 1.00 24.10 ? 211 PRO A CD  1 
ATOM   1696 N N   . TYR A 1 214 ? 3.554   23.770  24.722 1.00 26.46 ? 212 TYR A N   1 
ATOM   1697 C CA  . TYR A 1 214 ? 4.850   23.201  25.086 1.00 26.30 ? 212 TYR A CA  1 
ATOM   1698 C C   . TYR A 1 214 ? 5.440   22.019  24.333 1.00 25.39 ? 212 TYR A C   1 
ATOM   1699 O O   . TYR A 1 214 ? 6.596   21.660  24.567 1.00 25.96 ? 212 TYR A O   1 
ATOM   1700 C CB  . TYR A 1 214 ? 4.889   22.954  26.594 1.00 28.89 ? 212 TYR A CB  1 
ATOM   1701 C CG  . TYR A 1 214 ? 4.857   24.250  27.362 1.00 30.14 ? 212 TYR A CG  1 
ATOM   1702 C CD1 . TYR A 1 214 ? 5.997   25.050  27.445 1.00 31.34 ? 212 TYR A CD1 1 
ATOM   1703 C CD2 . TYR A 1 214 ? 3.679   24.714  27.949 1.00 30.75 ? 212 TYR A CD2 1 
ATOM   1704 C CE1 . TYR A 1 214 ? 5.967   26.284  28.089 1.00 33.25 ? 212 TYR A CE1 1 
ATOM   1705 C CE2 . TYR A 1 214 ? 3.637   25.952  28.599 1.00 32.01 ? 212 TYR A CE2 1 
ATOM   1706 C CZ  . TYR A 1 214 ? 4.791   26.729  28.664 1.00 33.05 ? 212 TYR A CZ  1 
ATOM   1707 O OH  . TYR A 1 214 ? 4.785   27.946  29.313 1.00 34.43 ? 212 TYR A OH  1 
ATOM   1708 N N   . LEU A 1 215 ? 4.692   21.452  23.394 1.00 23.48 ? 213 LEU A N   1 
ATOM   1709 C CA  . LEU A 1 215 ? 5.183   20.311  22.630 1.00 21.45 ? 213 LEU A CA  1 
ATOM   1710 C C   . LEU A 1 215 ? 5.477   19.095  23.512 1.00 19.76 ? 213 LEU A C   1 
ATOM   1711 O O   . LEU A 1 215 ? 6.429   18.356  23.253 1.00 19.88 ? 213 LEU A O   1 
ATOM   1712 C CB  . LEU A 1 215 ? 6.431   20.672  21.800 1.00 24.46 ? 213 LEU A CB  1 
ATOM   1713 C CG  . LEU A 1 215 ? 6.260   21.437  20.481 1.00 28.06 ? 213 LEU A CG  1 
ATOM   1714 C CD1 . LEU A 1 215 ? 5.927   22.895  20.747 1.00 29.20 ? 213 LEU A CD1 1 
ATOM   1715 C CD2 . LEU A 1 215 ? 7.538   21.332  19.662 1.00 28.16 ? 213 LEU A CD2 1 
ATOM   1716 N N   . GLY A 1 216 ? 4.691   18.913  24.570 1.00 17.03 ? 214 GLY A N   1 
ATOM   1717 C CA  . GLY A 1 216 ? 4.875   17.755  25.434 1.00 16.17 ? 214 GLY A CA  1 
ATOM   1718 C C   . GLY A 1 216 ? 3.964   16.658  24.905 1.00 13.72 ? 214 GLY A C   1 
ATOM   1719 O O   . GLY A 1 216 ? 2.754   16.765  25.002 1.00 17.47 ? 214 GLY A O   1 
ATOM   1720 N N   . PHE A 1 217 ? 4.529   15.613  24.321 1.00 14.69 ? 215 PHE A N   1 
ATOM   1721 C CA  . PHE A 1 217 ? 3.707   14.542  23.759 1.00 16.07 ? 215 PHE A CA  1 
ATOM   1722 C C   . PHE A 1 217 ? 2.992   13.620  24.752 1.00 16.09 ? 215 PHE A C   1 
ATOM   1723 O O   . PHE A 1 217 ? 1.996   12.981  24.398 1.00 14.84 ? 215 PHE A O   1 
ATOM   1724 C CB  . PHE A 1 217 ? 4.527   13.723  22.760 1.00 16.51 ? 215 PHE A CB  1 
ATOM   1725 C CG  . PHE A 1 217 ? 3.788   13.413  21.481 1.00 20.29 ? 215 PHE A CG  1 
ATOM   1726 C CD1 . PHE A 1 217 ? 2.898   12.343  21.419 1.00 20.01 ? 215 PHE A CD1 1 
ATOM   1727 C CD2 . PHE A 1 217 ? 3.965   14.206  20.345 1.00 20.00 ? 215 PHE A CD2 1 
ATOM   1728 C CE1 . PHE A 1 217 ? 2.196   12.065  20.250 1.00 20.62 ? 215 PHE A CE1 1 
ATOM   1729 C CE2 . PHE A 1 217 ? 3.265   13.935  19.169 1.00 20.75 ? 215 PHE A CE2 1 
ATOM   1730 C CZ  . PHE A 1 217 ? 2.378   12.865  19.118 1.00 19.21 ? 215 PHE A CZ  1 
ATOM   1731 N N   . GLY A 1 218 ? 3.470   13.563  25.996 1.00 16.68 ? 216 GLY A N   1 
ATOM   1732 C CA  . GLY A 1 218 ? 2.845   12.682  26.978 1.00 13.16 ? 216 GLY A CA  1 
ATOM   1733 C C   . GLY A 1 218 ? 1.691   13.261  27.770 1.00 15.15 ? 216 GLY A C   1 
ATOM   1734 O O   . GLY A 1 218 ? 1.536   14.481  27.848 1.00 13.40 ? 216 GLY A O   1 
ATOM   1735 N N   . MET A 1 219 ? 0.893   12.389  28.384 1.00 12.07 ? 217 MET A N   1 
ATOM   1736 C CA  . MET A 1 219 ? -0.248  12.807  29.177 1.00 12.21 ? 217 MET A CA  1 
ATOM   1737 C C   . MET A 1 219 ? 0.159   13.273  30.556 1.00 14.93 ? 217 MET A C   1 
ATOM   1738 O O   . MET A 1 219 ? 1.105   12.745  31.146 1.00 12.26 ? 217 MET A O   1 
ATOM   1739 C CB  . MET A 1 219 ? -1.254  11.667  29.345 1.00 13.96 ? 217 MET A CB  1 
ATOM   1740 C CG  . MET A 1 219 ? -1.987  11.285  28.065 1.00 16.53 ? 217 MET A CG  1 
ATOM   1741 S SD  . MET A 1 219 ? -3.106  9.917   28.334 1.00 18.33 ? 217 MET A SD  1 
ATOM   1742 C CE  . MET A 1 219 ? -4.329  10.651  29.349 1.00 15.30 ? 217 MET A CE  1 
ATOM   1743 N N   . SER A 1 220 ? -0.543  14.287  31.047 1.00 15.45 ? 218 SER A N   1 
ATOM   1744 C CA  . SER A 1 220 ? -0.317  14.819  32.379 1.00 15.27 ? 218 SER A CA  1 
ATOM   1745 C C   . SER A 1 220 ? -1.370  14.170  33.271 1.00 15.77 ? 218 SER A C   1 
ATOM   1746 O O   . SER A 1 220 ? -1.154  13.969  34.470 1.00 16.92 ? 218 SER A O   1 
ATOM   1747 C CB  . SER A 1 220 ? -0.483  16.344  32.376 1.00 16.38 ? 218 SER A CB  1 
ATOM   1748 O OG  . SER A 1 220 ? -1.779  16.714  31.942 1.00 16.70 ? 218 SER A OG  1 
ATOM   1749 N N   . GLN A 1 221 ? -2.509  13.831  32.668 1.00 13.37 ? 219 GLN A N   1 
ATOM   1750 C CA  . GLN A 1 221 ? -3.624  13.195  33.362 1.00 11.99 ? 219 GLN A CA  1 
ATOM   1751 C C   . GLN A 1 221 ? -3.165  11.830  33.885 1.00 12.25 ? 219 GLN A C   1 
ATOM   1752 O O   . GLN A 1 221 ? -2.372  11.143  33.232 1.00 13.54 ? 219 GLN A O   1 
ATOM   1753 C CB  . GLN A 1 221 ? -4.800  13.018  32.387 1.00 14.12 ? 219 GLN A CB  1 
ATOM   1754 C CG  . GLN A 1 221 ? -6.022  12.289  32.936 1.00 14.54 ? 219 GLN A CG  1 
ATOM   1755 C CD  . GLN A 1 221 ? -7.157  12.275  31.923 1.00 13.44 ? 219 GLN A CD  1 
ATOM   1756 O OE1 . GLN A 1 221 ? -6.922  12.405  30.725 1.00 16.16 ? 219 GLN A OE1 1 
ATOM   1757 N NE2 . GLN A 1 221 ? -8.380  12.182  32.397 1.00 15.12 ? 219 GLN A NE2 1 
ATOM   1758 N N   . LYS A 1 222 ? -3.602  11.495  35.091 1.00 13.90 ? 220 LYS A N   1 
ATOM   1759 C CA  . LYS A 1 222 ? -3.243  10.238  35.734 1.00 15.17 ? 220 LYS A CA  1 
ATOM   1760 C C   . LYS A 1 222 ? -4.128  9.123   35.200 1.00 11.74 ? 220 LYS A C   1 
ATOM   1761 O O   . LYS A 1 222 ? -5.345  9.231   35.224 1.00 14.56 ? 220 LYS A O   1 
ATOM   1762 C CB  . LYS A 1 222 ? -3.372  10.372  37.258 1.00 15.64 ? 220 LYS A CB  1 
ATOM   1763 C CG  . LYS A 1 222 ? -2.404  11.413  37.854 1.00 19.30 ? 220 LYS A CG  1 
ATOM   1764 C CD  . LYS A 1 222 ? -2.636  11.637  39.342 1.00 19.07 ? 220 LYS A CD  1 
ATOM   1765 C CE  . LYS A 1 222 ? -3.987  12.266  39.613 1.00 22.89 ? 220 LYS A CE  1 
ATOM   1766 N NZ  . LYS A 1 222 ? -4.119  13.613  38.973 1.00 22.10 ? 220 LYS A NZ  1 
ATOM   1767 N N   . VAL A 1 223 ? -3.503  8.036   34.759 1.00 14.75 ? 221 VAL A N   1 
ATOM   1768 C CA  . VAL A 1 223 ? -4.241  6.911   34.183 1.00 13.40 ? 221 VAL A CA  1 
ATOM   1769 C C   . VAL A 1 223 ? -3.876  5.527   34.710 1.00 14.26 ? 221 VAL A C   1 
ATOM   1770 O O   . VAL A 1 223 ? -4.182  4.518   34.072 1.00 9.95  ? 221 VAL A O   1 
ATOM   1771 C CB  . VAL A 1 223 ? -4.080  6.884   32.645 1.00 11.60 ? 221 VAL A CB  1 
ATOM   1772 C CG1 . VAL A 1 223 ? -4.676  8.147   32.029 1.00 13.18 ? 221 VAL A CG1 1 
ATOM   1773 C CG2 . VAL A 1 223 ? -2.618  6.727   32.247 1.00 10.29 ? 221 VAL A CG2 1 
ATOM   1774 N N   . GLY A 1 224 ? -3.239  5.454   35.872 1.00 11.32 ? 222 GLY A N   1 
ATOM   1775 C CA  . GLY A 1 224 ? -2.878  4.141   36.374 1.00 12.49 ? 222 GLY A CA  1 
ATOM   1776 C C   . GLY A 1 224 ? -3.172  4.017   37.842 1.00 11.16 ? 222 GLY A C   1 
ATOM   1777 O O   . GLY A 1 224 ? -3.812  4.892   38.420 1.00 12.26 ? 222 GLY A O   1 
ATOM   1778 N N   . HIS A 1 225 ? -2.852  2.857   38.407 1.00 13.35 ? 223 HIS A N   1 
ATOM   1779 C CA  . HIS A 1 225 ? -3.016  2.660   39.845 1.00 13.14 ? 223 HIS A CA  1 
ATOM   1780 C C   . HIS A 1 225 ? -1.862  3.464   40.451 1.00 12.37 ? 223 HIS A C   1 
ATOM   1781 O O   . HIS A 1 225 ? -2.016  4.107   41.495 1.00 14.68 ? 223 HIS A O   1 
ATOM   1782 C CB  . HIS A 1 225 ? -2.899  1.178   40.208 1.00 13.10 ? 223 HIS A CB  1 
ATOM   1783 C CG  . HIS A 1 225 ? -4.100  0.372   39.826 1.00 10.76 ? 223 HIS A CG  1 
ATOM   1784 N ND1 . HIS A 1 225 ? -4.139  -0.416  38.691 1.00 11.68 ? 223 HIS A ND1 1 
ATOM   1785 C CD2 . HIS A 1 225 ? -5.305  0.232   40.421 1.00 11.68 ? 223 HIS A CD2 1 
ATOM   1786 C CE1 . HIS A 1 225 ? -5.316  -1.013  38.616 1.00 11.98 ? 223 HIS A CE1 1 
ATOM   1787 N NE2 . HIS A 1 225 ? -6.044  -0.632  39.652 1.00 13.41 ? 223 HIS A NE2 1 
ATOM   1788 N N   . LEU A 1 226 ? -0.713  3.431   39.777 1.00 14.98 ? 224 LEU A N   1 
ATOM   1789 C CA  . LEU A 1 226 ? 0.456   4.190   40.198 1.00 12.78 ? 224 LEU A CA  1 
ATOM   1790 C C   . LEU A 1 226 ? 0.870   5.086   39.040 1.00 14.02 ? 224 LEU A C   1 
ATOM   1791 O O   . LEU A 1 226 ? 1.078   4.609   37.925 1.00 12.90 ? 224 LEU A O   1 
ATOM   1792 C CB  . LEU A 1 226 ? 1.637   3.278   40.528 1.00 13.80 ? 224 LEU A CB  1 
ATOM   1793 C CG  . LEU A 1 226 ? 1.482   2.277   41.669 1.00 12.95 ? 224 LEU A CG  1 
ATOM   1794 C CD1 . LEU A 1 226 ? 2.777   1.485   41.778 1.00 13.27 ? 224 LEU A CD1 1 
ATOM   1795 C CD2 . LEU A 1 226 ? 1.150   3.000   42.968 1.00 14.98 ? 224 LEU A CD2 1 
ATOM   1796 N N   . ASP A 1 227 ? 0.976   6.382   39.300 1.00 14.23 ? 225 ASP A N   1 
ATOM   1797 C CA  . ASP A 1 227 ? 1.398   7.331   38.281 1.00 13.81 ? 225 ASP A CA  1 
ATOM   1798 C C   . ASP A 1 227 ? 2.701   7.985   38.734 1.00 11.55 ? 225 ASP A C   1 
ATOM   1799 O O   . ASP A 1 227 ? 2.698   8.846   39.623 1.00 14.89 ? 225 ASP A O   1 
ATOM   1800 C CB  . ASP A 1 227 ? 0.308   8.386   38.042 1.00 13.06 ? 225 ASP A CB  1 
ATOM   1801 C CG  . ASP A 1 227 ? -0.817  7.866   37.175 1.00 13.16 ? 225 ASP A CG  1 
ATOM   1802 O OD1 . ASP A 1 227 ? -0.709  7.998   35.939 1.00 13.42 ? 225 ASP A OD1 1 
ATOM   1803 O OD2 . ASP A 1 227 ? -1.790  7.304   37.709 1.00 13.90 ? 225 ASP A OD2 1 
ATOM   1804 N N   . PHE A 1 228 ? 3.804   7.540   38.144 1.00 12.27 ? 226 PHE A N   1 
ATOM   1805 C CA  . PHE A 1 228 ? 5.140   8.043   38.451 1.00 14.10 ? 226 PHE A CA  1 
ATOM   1806 C C   . PHE A 1 228 ? 5.486   9.273   37.635 1.00 14.83 ? 226 PHE A C   1 
ATOM   1807 O O   . PHE A 1 228 ? 5.340   9.282   36.409 1.00 12.35 ? 226 PHE A O   1 
ATOM   1808 C CB  . PHE A 1 228 ? 6.215   6.990   38.167 1.00 12.01 ? 226 PHE A CB  1 
ATOM   1809 C CG  . PHE A 1 228 ? 6.104   5.752   39.011 1.00 12.63 ? 226 PHE A CG  1 
ATOM   1810 C CD1 . PHE A 1 228 ? 5.213   4.736   38.673 1.00 16.07 ? 226 PHE A CD1 1 
ATOM   1811 C CD2 . PHE A 1 228 ? 6.926   5.584   40.128 1.00 15.10 ? 226 PHE A CD2 1 
ATOM   1812 C CE1 . PHE A 1 228 ? 5.150   3.564   39.435 1.00 16.91 ? 226 PHE A CE1 1 
ATOM   1813 C CE2 . PHE A 1 228 ? 6.866   4.418   40.889 1.00 15.41 ? 226 PHE A CE2 1 
ATOM   1814 C CZ  . PHE A 1 228 ? 5.985   3.411   40.548 1.00 15.78 ? 226 PHE A CZ  1 
ATOM   1815 N N   . PHE A 1 229 ? 6.005   10.289  38.309 1.00 14.25 ? 227 PHE A N   1 
ATOM   1816 C CA  . PHE A 1 229 ? 6.411   11.517  37.635 1.00 16.10 ? 227 PHE A CA  1 
ATOM   1817 C C   . PHE A 1 229 ? 7.881   11.776  37.944 1.00 16.10 ? 227 PHE A C   1 
ATOM   1818 O O   . PHE A 1 229 ? 8.222   12.666  38.738 1.00 20.49 ? 227 PHE A O   1 
ATOM   1819 C CB  . PHE A 1 229 ? 5.541   12.699  38.087 1.00 14.11 ? 227 PHE A CB  1 
ATOM   1820 C CG  . PHE A 1 229 ? 4.116   12.630  37.619 1.00 15.43 ? 227 PHE A CG  1 
ATOM   1821 C CD1 . PHE A 1 229 ? 3.149   11.944  38.356 1.00 12.68 ? 227 PHE A CD1 1 
ATOM   1822 C CD2 . PHE A 1 229 ? 3.721   13.303  36.460 1.00 14.59 ? 227 PHE A CD2 1 
ATOM   1823 C CE1 . PHE A 1 229 ? 1.817   11.933  37.954 1.00 14.75 ? 227 PHE A CE1 1 
ATOM   1824 C CE2 . PHE A 1 229 ? 2.385   13.297  36.051 1.00 13.43 ? 227 PHE A CE2 1 
ATOM   1825 C CZ  . PHE A 1 229 ? 1.435   12.617  36.796 1.00 13.97 ? 227 PHE A CZ  1 
ATOM   1826 N N   . PRO A 1 230 ? 8.783   10.994  37.330 1.00 15.47 ? 228 PRO A N   1 
ATOM   1827 C CA  . PRO A 1 230 ? 10.211  11.190  37.580 1.00 13.83 ? 228 PRO A CA  1 
ATOM   1828 C C   . PRO A 1 230 ? 10.625  12.598  37.171 1.00 16.85 ? 228 PRO A C   1 
ATOM   1829 O O   . PRO A 1 230 ? 10.190  13.111  36.136 1.00 12.98 ? 228 PRO A O   1 
ATOM   1830 C CB  . PRO A 1 230 ? 10.864  10.133  36.698 1.00 13.63 ? 228 PRO A CB  1 
ATOM   1831 C CG  . PRO A 1 230 ? 9.882   9.993   35.554 1.00 11.45 ? 228 PRO A CG  1 
ATOM   1832 C CD  . PRO A 1 230 ? 8.567   9.988   36.269 1.00 12.58 ? 228 PRO A CD  1 
ATOM   1833 N N   . ASN A 1 231 ? 11.355  13.262  38.058 1.00 14.45 ? 229 ASN A N   1 
ATOM   1834 C CA  . ASN A 1 231 ? 11.849  14.614  37.816 1.00 15.87 ? 229 ASN A CA  1 
ATOM   1835 C C   . ASN A 1 231 ? 10.742  15.650  37.625 1.00 14.55 ? 229 ASN A C   1 
ATOM   1836 O O   . ASN A 1 231 ? 11.007  16.752  37.149 1.00 15.11 ? 229 ASN A O   1 
ATOM   1837 C CB  . ASN A 1 231 ? 12.778  14.647  36.595 1.00 15.67 ? 229 ASN A CB  1 
ATOM   1838 C CG  . ASN A 1 231 ? 13.894  13.621  36.661 1.00 19.46 ? 229 ASN A CG  1 
ATOM   1839 O OD1 . ASN A 1 231 ? 14.826  13.727  37.463 1.00 18.14 ? 229 ASN A OD1 1 
ATOM   1840 N ND2 . ASN A 1 231 ? 13.838  12.653  35.769 1.00 16.09 ? 229 ASN A ND2 1 
ATOM   1841 N N   . GLY A 1 232 ? 9.521   15.330  38.040 1.00 13.72 ? 230 GLY A N   1 
ATOM   1842 C CA  . GLY A 1 232 ? 8.409   16.257  37.874 1.00 16.80 ? 230 GLY A CA  1 
ATOM   1843 C C   . GLY A 1 232 ? 7.480   15.866  36.731 1.00 16.66 ? 230 GLY A C   1 
ATOM   1844 O O   . GLY A 1 232 ? 6.348   16.350  36.637 1.00 17.25 ? 230 GLY A O   1 
ATOM   1845 N N   . GLY A 1 233 ? 7.983   15.027  35.833 1.00 18.17 ? 231 GLY A N   1 
ATOM   1846 C CA  . GLY A 1 233 ? 7.183   14.542  34.719 1.00 16.97 ? 231 GLY A CA  1 
ATOM   1847 C C   . GLY A 1 233 ? 7.097   15.402  33.471 1.00 19.29 ? 231 GLY A C   1 
ATOM   1848 O O   . GLY A 1 233 ? 6.527   14.966  32.453 1.00 15.93 ? 231 GLY A O   1 
ATOM   1849 N N   . LYS A 1 234 ? 7.701   16.587  33.499 1.00 18.50 ? 232 LYS A N   1 
ATOM   1850 C CA  . LYS A 1 234 ? 7.625   17.475  32.347 1.00 20.03 ? 232 LYS A CA  1 
ATOM   1851 C C   . LYS A 1 234 ? 8.951   17.738  31.662 1.00 20.80 ? 232 LYS A C   1 
ATOM   1852 O O   . LYS A 1 234 ? 9.001   17.888  30.441 1.00 20.53 ? 232 LYS A O   1 
ATOM   1853 C CB  . LYS A 1 234 ? 6.957   18.794  32.737 1.00 21.92 ? 232 LYS A CB  1 
ATOM   1854 C CG  . LYS A 1 234 ? 5.549   18.618  33.277 1.00 23.10 ? 232 LYS A CG  1 
ATOM   1855 C CD  . LYS A 1 234 ? 4.867   19.947  33.544 1.00 26.58 ? 232 LYS A CD  1 
ATOM   1856 C CE  . LYS A 1 234 ? 5.657   20.809  34.515 1.00 28.64 ? 232 LYS A CE  1 
ATOM   1857 N NZ  . LYS A 1 234 ? 4.906   22.049  34.851 1.00 30.88 ? 232 LYS A NZ  1 
ATOM   1858 N N   . GLU A 1 235 ? 10.021  17.836  32.443 1.00 20.16 ? 233 GLU A N   1 
ATOM   1859 C CA  . GLU A 1 235 ? 11.349  18.080  31.898 1.00 19.31 ? 233 GLU A CA  1 
ATOM   1860 C C   . GLU A 1 235 ? 12.330  17.120  32.536 1.00 20.37 ? 233 GLU A C   1 
ATOM   1861 O O   . GLU A 1 235 ? 12.522  17.147  33.758 1.00 17.95 ? 233 GLU A O   1 
ATOM   1862 C CB  . GLU A 1 235 ? 11.798  19.519  32.182 1.00 23.88 ? 233 GLU A CB  1 
ATOM   1863 C CG  . GLU A 1 235 ? 10.968  20.584  31.488 1.00 25.76 ? 233 GLU A CG  1 
ATOM   1864 C CD  . GLU A 1 235 ? 11.351  21.984  31.921 1.00 28.14 ? 233 GLU A CD  1 
ATOM   1865 O OE1 . GLU A 1 235 ? 12.550  22.327  31.847 1.00 29.15 ? 233 GLU A OE1 1 
ATOM   1866 O OE2 . GLU A 1 235 ? 10.452  22.734  32.349 1.00 29.40 ? 233 GLU A OE2 1 
ATOM   1867 N N   . MET A 1 236 ? 12.956  16.283  31.716 1.00 18.39 ? 234 MET A N   1 
ATOM   1868 C CA  . MET A 1 236 ? 13.915  15.302  32.203 1.00 18.56 ? 234 MET A CA  1 
ATOM   1869 C C   . MET A 1 236 ? 15.341  15.799  32.067 1.00 19.06 ? 234 MET A C   1 
ATOM   1870 O O   . MET A 1 236 ? 15.679  16.481  31.102 1.00 19.00 ? 234 MET A O   1 
ATOM   1871 C CB  . MET A 1 236 ? 13.775  13.987  31.426 1.00 18.21 ? 234 MET A CB  1 
ATOM   1872 C CG  . MET A 1 236 ? 12.377  13.424  31.403 1.00 16.15 ? 234 MET A CG  1 
ATOM   1873 S SD  . MET A 1 236 ? 11.752  12.948  33.005 1.00 15.55 ? 234 MET A SD  1 
ATOM   1874 C CE  . MET A 1 236 ? 10.537  14.143  33.270 1.00 10.30 ? 234 MET A CE  1 
ATOM   1875 N N   . PRO A 1 237 ? 16.197  15.481  33.053 1.00 20.08 ? 235 PRO A N   1 
ATOM   1876 C CA  . PRO A 1 237 ? 17.599  15.902  33.016 1.00 19.80 ? 235 PRO A CA  1 
ATOM   1877 C C   . PRO A 1 237 ? 18.273  15.262  31.808 1.00 22.06 ? 235 PRO A C   1 
ATOM   1878 O O   . PRO A 1 237 ? 18.079  14.072  31.548 1.00 22.54 ? 235 PRO A O   1 
ATOM   1879 C CB  . PRO A 1 237 ? 18.157  15.330  34.322 1.00 19.61 ? 235 PRO A CB  1 
ATOM   1880 C CG  . PRO A 1 237 ? 16.976  15.341  35.236 1.00 18.53 ? 235 PRO A CG  1 
ATOM   1881 C CD  . PRO A 1 237 ? 15.881  14.826  34.333 1.00 20.49 ? 235 PRO A CD  1 
ATOM   1882 N N   . GLY A 1 238 ? 19.056  16.048  31.075 1.00 21.26 ? 236 GLY A N   1 
ATOM   1883 C CA  . GLY A 1 238 ? 19.757  15.535  29.914 1.00 22.66 ? 236 GLY A CA  1 
ATOM   1884 C C   . GLY A 1 238 ? 19.026  15.670  28.590 1.00 23.37 ? 236 GLY A C   1 
ATOM   1885 O O   . GLY A 1 238 ? 19.588  15.356  27.540 1.00 26.06 ? 236 GLY A O   1 
ATOM   1886 N N   . CYS A 1 239 ? 17.784  16.139  28.632 1.00 24.96 ? 237 CYS A N   1 
ATOM   1887 C CA  . CYS A 1 239 ? 16.983  16.322  27.427 1.00 27.48 ? 237 CYS A CA  1 
ATOM   1888 C C   . CYS A 1 239 ? 16.782  17.786  27.078 1.00 30.04 ? 237 CYS A C   1 
ATOM   1889 O O   . CYS A 1 239 ? 16.405  18.592  27.934 1.00 30.90 ? 237 CYS A O   1 
ATOM   1890 C CB  . CYS A 1 239 ? 15.600  15.693  27.598 1.00 25.79 ? 237 CYS A CB  1 
ATOM   1891 S SG  . CYS A 1 239 ? 15.571  13.879  27.559 1.00 25.47 ? 237 CYS A SG  1 
ATOM   1892 N N   . GLN A 1 240 ? 17.004  18.124  25.813 1.00 32.84 ? 238 GLN A N   1 
ATOM   1893 C CA  . GLN A 1 240 ? 16.798  19.490  25.358 1.00 32.87 ? 238 GLN A CA  1 
ATOM   1894 C C   . GLN A 1 240 ? 15.292  19.746  25.358 1.00 32.64 ? 238 GLN A C   1 
ATOM   1895 O O   . GLN A 1 240 ? 14.515  18.915  24.880 1.00 32.88 ? 238 GLN A O   1 
ATOM   1896 C CB  . GLN A 1 240 ? 17.337  19.680  23.940 1.00 35.25 ? 238 GLN A CB  1 
ATOM   1897 C CG  . GLN A 1 240 ? 17.084  21.073  23.386 1.00 38.17 ? 238 GLN A CG  1 
ATOM   1898 C CD  . GLN A 1 240 ? 17.508  21.222  21.944 1.00 40.41 ? 238 GLN A CD  1 
ATOM   1899 O OE1 . GLN A 1 240 ? 18.580  20.764  21.548 1.00 41.66 ? 238 GLN A OE1 1 
ATOM   1900 N NE2 . GLN A 1 240 ? 16.665  21.870  21.144 1.00 39.96 ? 238 GLN A NE2 1 
ATOM   1901 N N   . LYS A 1 241 ? 14.878  20.860  25.946 1.00 32.36 ? 239 LYS A N   1 
ATOM   1902 C CA  . LYS A 1 241 ? 13.466  21.215  25.988 1.00 32.54 ? 239 LYS A CA  1 
ATOM   1903 C C   . LYS A 1 241 ? 13.043  21.595  24.573 1.00 32.47 ? 239 LYS A C   1 
ATOM   1904 O O   . LYS A 1 241 ? 13.880  21.972  23.745 1.00 30.53 ? 239 LYS A O   1 
ATOM   1905 C CB  . LYS A 1 241 ? 13.243  22.426  26.894 1.00 34.30 ? 239 LYS A CB  1 
ATOM   1906 C CG  . LYS A 1 241 ? 13.538  22.201  28.360 1.00 36.15 ? 239 LYS A CG  1 
ATOM   1907 C CD  . LYS A 1 241 ? 13.529  23.543  29.085 1.00 39.15 ? 239 LYS A CD  1 
ATOM   1908 C CE  . LYS A 1 241 ? 12.196  24.271  28.907 1.00 40.17 ? 239 LYS A CE  1 
ATOM   1909 N NZ  . LYS A 1 241 ? 12.251  25.659  29.452 1.00 42.24 ? 239 LYS A NZ  1 
ATOM   1910 N N   . ASN A 1 242 ? 11.749  21.497  24.298 1.00 32.59 ? 240 ASN A N   1 
ATOM   1911 C CA  . ASN A 1 242 ? 11.225  21.852  22.987 1.00 32.82 ? 240 ASN A CA  1 
ATOM   1912 C C   . ASN A 1 242 ? 10.923  23.331  22.911 1.00 34.12 ? 240 ASN A C   1 
ATOM   1913 O O   . ASN A 1 242 ? 10.467  23.938  23.903 1.00 32.78 ? 240 ASN A O   1 
ATOM   1914 C CB  . ASN A 1 242 ? 9.964   21.049  22.662 1.00 30.63 ? 240 ASN A CB  1 
ATOM   1915 C CG  . ASN A 1 242 ? 10.265  19.799  21.880 1.00 30.22 ? 240 ASN A CG  1 
ATOM   1916 O OD1 . ASN A 1 242 ? 10.779  19.858  20.759 1.00 29.64 ? 240 ASN A OD1 1 
ATOM   1917 N ND2 . ASN A 1 242 ? 9.972   18.654  22.467 1.00 29.76 ? 240 ASN A ND2 1 
ATOM   1918 N N   . ILE A 1 243 ? 11.205  23.929  21.756 1.00 37.09 ? 241 ILE A N   1 
ATOM   1919 C CA  . ILE A 1 243 ? 10.949  25.351  21.550 1.00 39.95 ? 241 ILE A CA  1 
ATOM   1920 C C   . ILE A 1 243 ? 9.456   25.640  21.698 1.00 41.14 ? 241 ILE A C   1 
ATOM   1921 O O   . ILE A 1 243 ? 8.627   24.737  21.527 1.00 42.60 ? 241 ILE A O   1 
ATOM   1922 C CB  . ILE A 1 243 ? 11.550  25.837  20.189 1.00 40.98 ? 241 ILE A CB  1 
ATOM   1923 C CG1 . ILE A 1 243 ? 11.244  24.849  19.047 1.00 41.57 ? 241 ILE A CG1 1 
ATOM   1924 C CG2 . ILE A 1 243 ? 13.063  25.957  20.315 1.00 40.36 ? 241 ILE A CG2 1 
ATOM   1925 C CD1 . ILE A 1 243 ? 9.818   24.871  18.570 1.00 42.97 ? 241 ILE A CD1 1 
ATOM   1926 N N   . LEU A 1 244 ? 8.641   26.310  23.020 1.00 42.65 ? 242 LEU A N   1 
ATOM   1927 C CA  . LEU A 1 244 ? 7.323   26.837  23.434 1.00 44.05 ? 242 LEU A CA  1 
ATOM   1928 C C   . LEU A 1 244 ? 6.605   27.438  22.240 1.00 45.05 ? 242 LEU A C   1 
ATOM   1929 O O   . LEU A 1 244 ? 6.145   28.564  22.254 1.00 46.76 ? 242 LEU A O   1 
ATOM   1930 C CB  . LEU A 1 244 ? 7.537   27.991  24.460 1.00 43.57 ? 242 LEU A CB  1 
ATOM   1931 C CG  . LEU A 1 244 ? 6.300   28.890  24.628 1.00 43.06 ? 242 LEU A CG  1 
ATOM   1932 C CD1 . LEU A 1 244 ? 5.242   28.252  25.515 1.00 43.10 ? 242 LEU A CD1 1 
ATOM   1933 C CD2 . LEU A 1 244 ? 6.600   30.261  25.265 1.00 44.13 ? 242 LEU A CD2 1 
ATOM   1934 N N   . SER A 1 245 ? 6.387   26.778  21.115 1.00 45.34 ? 243 SER A N   1 
ATOM   1935 C CA  . SER A 1 245 ? 5.857   27.655  20.041 1.00 45.71 ? 243 SER A CA  1 
ATOM   1936 C C   . SER A 1 245 ? 4.392   27.335  19.410 1.00 46.87 ? 243 SER A C   1 
ATOM   1937 O O   . SER A 1 245 ? 3.488   26.840  20.066 1.00 47.98 ? 243 SER A O   1 
ATOM   1938 C CB  . SER A 1 245 ? 6.976   27.732  19.063 1.00 46.28 ? 243 SER A CB  1 
ATOM   1939 O OG  . SER A 1 245 ? 8.052   28.439  19.750 1.00 45.33 ? 243 SER A OG  1 
ATOM   1940 N N   . THR A 1 246 ? 4.120   27.642  18.076 1.00 20.00 ? 244 THR A N   1 
ATOM   1941 C CA  . THR A 1 246 ? 2.641   27.593  17.516 1.00 20.00 ? 244 THR A CA  1 
ATOM   1942 C C   . THR A 1 246 ? 2.100   26.257  17.022 1.00 20.00 ? 244 THR A C   1 
ATOM   1943 O O   . THR A 1 246 ? 2.691   25.636  16.070 1.00 20.00 ? 244 THR A O   1 
ATOM   1944 C CB  . THR A 1 246 ? 2.451   28.562  16.391 1.00 20.00 ? 244 THR A CB  1 
ATOM   1945 N N   . ILE A 1 247 ? 0.925   25.992  17.729 1.00 41.06 ? 245 ILE A N   1 
ATOM   1946 C CA  . ILE A 1 247 ? 0.273   24.715  17.693 1.00 39.37 ? 245 ILE A CA  1 
ATOM   1947 C C   . ILE A 1 247 ? 1.268   23.972  17.173 1.00 38.91 ? 245 ILE A C   1 
ATOM   1948 O O   . ILE A 1 247 ? 2.203   24.468  16.548 1.00 39.59 ? 245 ILE A O   1 
ATOM   1949 C CB  . ILE A 1 247 ? -1.091  24.416  16.977 1.00 40.33 ? 245 ILE A CB  1 
ATOM   1950 C CG1 . ILE A 1 247 ? -0.998  23.942  15.525 1.00 39.47 ? 245 ILE A CG1 1 
ATOM   1951 C CG2 . ILE A 1 247 ? -2.074  25.555  16.953 1.00 39.32 ? 245 ILE A CG2 1 
ATOM   1952 C CD1 . ILE A 1 247 ? -1.772  22.617  15.299 1.00 39.16 ? 245 ILE A CD1 1 
ATOM   1953 N N   . VAL A 1 248 ? 1.150   22.907  17.380 1.00 36.37 ? 246 VAL A N   1 
ATOM   1954 C CA  . VAL A 1 248 ? 2.128   22.137  17.047 1.00 34.97 ? 246 VAL A CA  1 
ATOM   1955 C C   . VAL A 1 248 ? 2.132   21.884  15.533 1.00 34.14 ? 246 VAL A C   1 
ATOM   1956 O O   . VAL A 1 248 ? 2.812   22.574  14.766 1.00 37.39 ? 246 VAL A O   1 
ATOM   1957 C CB  . VAL A 1 248 ? 1.906   20.982  17.954 1.00 33.05 ? 246 VAL A CB  1 
ATOM   1958 C CG1 . VAL A 1 248 ? 0.416   20.617  18.072 1.00 32.83 ? 246 VAL A CG1 1 
ATOM   1959 C CG2 . VAL A 1 248 ? 2.642   19.762  17.534 1.00 33.47 ? 246 VAL A CG2 1 
ATOM   1960 N N   . ASP A 1 249 ? 1.398   20.963  15.200 1.00 31.33 ? 247 ASP A N   1 
ATOM   1961 C CA  . ASP A 1 249 ? 1.276   20.395  13.880 1.00 29.04 ? 247 ASP A CA  1 
ATOM   1962 C C   . ASP A 1 249 ? 1.636   19.034  14.180 1.00 25.33 ? 247 ASP A C   1 
ATOM   1963 O O   . ASP A 1 249 ? 2.557   18.474  13.564 1.00 26.52 ? 247 ASP A O   1 
ATOM   1964 C CB  . ASP A 1 249 ? 2.195   20.977  12.799 1.00 29.17 ? 247 ASP A CB  1 
ATOM   1965 C CG  . ASP A 1 249 ? 1.966   20.215  11.461 1.00 29.84 ? 247 ASP A CG  1 
ATOM   1966 O OD1 . ASP A 1 249 ? 0.925   19.458  11.328 1.00 31.09 ? 247 ASP A OD1 1 
ATOM   1967 O OD2 . ASP A 1 249 ? 2.794   20.316  10.472 1.00 31.81 ? 247 ASP A OD2 1 
ATOM   1968 N N   . ILE A 1 250 ? 0.875   18.680  15.146 1.00 25.90 ? 248 ILE A N   1 
ATOM   1969 C CA  . ILE A 1 250 ? 0.876   17.434  15.788 1.00 26.00 ? 248 ILE A CA  1 
ATOM   1970 C C   . ILE A 1 250 ? 1.093   16.344  14.765 1.00 25.75 ? 248 ILE A C   1 
ATOM   1971 O O   . ILE A 1 250 ? 2.063   15.587  14.857 1.00 27.51 ? 248 ILE A O   1 
ATOM   1972 C CB  . ILE A 1 250 ? -0.468  17.295  16.472 1.00 26.41 ? 248 ILE A CB  1 
ATOM   1973 C CG1 . ILE A 1 250 ? -0.696  18.377  17.540 1.00 24.87 ? 248 ILE A CG1 1 
ATOM   1974 C CG2 . ILE A 1 250 ? -0.640  15.962  17.172 1.00 26.85 ? 248 ILE A CG2 1 
ATOM   1975 C CD1 . ILE A 1 250 ? -2.025  18.219  18.280 1.00 27.34 ? 248 ILE A CD1 1 
ATOM   1976 N N   . ASN A 1 251 ? 0.621   16.609  13.604 1.00 25.36 ? 249 ASN A N   1 
ATOM   1977 C CA  . ASN A 1 251 ? 0.911   15.584  12.610 1.00 24.81 ? 249 ASN A CA  1 
ATOM   1978 C C   . ASN A 1 251 ? 2.304   15.739  12.014 1.00 25.07 ? 249 ASN A C   1 
ATOM   1979 O O   . ASN A 1 251 ? 2.972   14.751  11.708 1.00 24.09 ? 249 ASN A O   1 
ATOM   1980 C CB  . ASN A 1 251 ? -0.121  15.594  11.489 1.00 25.63 ? 249 ASN A CB  1 
ATOM   1981 C CG  . ASN A 1 251 ? 0.101   14.464  10.511 1.00 27.94 ? 249 ASN A CG  1 
ATOM   1982 O OD1 . ASN A 1 251 ? 0.079   13.294  10.892 1.00 24.72 ? 249 ASN A OD1 1 
ATOM   1983 N ND2 . ASN A 1 251 ? 0.351   14.804  9.253  1.00 25.93 ? 249 ASN A ND2 1 
ATOM   1984 N N   . GLY A 1 252 ? 2.738   16.981  11.822 1.00 26.30 ? 250 GLY A N   1 
ATOM   1985 C CA  . GLY A 1 252 ? 4.065   17.215  11.278 1.00 26.78 ? 250 GLY A CA  1 
ATOM   1986 C C   . GLY A 1 252 ? 5.114   16.653  12.225 1.00 27.51 ? 250 GLY A C   1 
ATOM   1987 O O   . GLY A 1 252 ? 6.189   16.207  11.809 1.00 31.50 ? 250 GLY A O   1 
ATOM   1988 N N   . ILE A 1 253 ? 4.811   16.711  13.516 1.00 29.98 ? 251 ILE A N   1 
ATOM   1989 C CA  . ILE A 1 253 ? 5.701   16.177  14.542 1.00 28.37 ? 251 ILE A CA  1 
ATOM   1990 C C   . ILE A 1 253 ? 5.711   14.657  14.403 1.00 27.71 ? 251 ILE A C   1 
ATOM   1991 O O   . ILE A 1 253 ? 6.757   14.048  14.170 1.00 28.49 ? 251 ILE A O   1 
ATOM   1992 C CB  . ILE A 1 253 ? 5.220   16.574  15.963 1.00 30.17 ? 251 ILE A CB  1 
ATOM   1993 C CG1 . ILE A 1 253 ? 5.558   18.044  16.228 1.00 29.64 ? 251 ILE A CG1 1 
ATOM   1994 C CG2 . ILE A 1 253 ? 5.829   15.660  17.022 1.00 27.67 ? 251 ILE A CG2 1 
ATOM   1995 C CD1 . ILE A 1 253 ? 5.488   18.438  17.681 1.00 29.31 ? 251 ILE A CD1 1 
ATOM   1996 N N   . TRP A 1 254 ? 4.523   14.071  14.484 1.00 28.87 ? 252 TRP A N   1 
ATOM   1997 C CA  . TRP A 1 254 ? 4.335   12.628  14.373 1.00 30.53 ? 252 TRP A CA  1 
ATOM   1998 C C   . TRP A 1 254 ? 5.025   12.036  13.148 1.00 30.87 ? 252 TRP A C   1 
ATOM   1999 O O   . TRP A 1 254 ? 5.703   11.011  13.242 1.00 32.20 ? 252 TRP A O   1 
ATOM   2000 C CB  . TRP A 1 254 ? 2.835   12.305  14.320 1.00 28.91 ? 252 TRP A CB  1 
ATOM   2001 C CG  . TRP A 1 254 ? 2.540   10.834  14.246 1.00 29.81 ? 252 TRP A CG  1 
ATOM   2002 C CD1 . TRP A 1 254 ? 2.062   10.143  13.165 1.00 31.11 ? 252 TRP A CD1 1 
ATOM   2003 C CD2 . TRP A 1 254 ? 2.744   9.868   15.283 1.00 30.69 ? 252 TRP A CD2 1 
ATOM   2004 N NE1 . TRP A 1 254 ? 1.967   8.804   13.467 1.00 31.56 ? 252 TRP A NE1 1 
ATOM   2005 C CE2 . TRP A 1 254 ? 2.377   8.605   14.759 1.00 30.91 ? 252 TRP A CE2 1 
ATOM   2006 C CE3 . TRP A 1 254 ? 3.206   9.944   16.605 1.00 30.03 ? 252 TRP A CE3 1 
ATOM   2007 C CZ2 . TRP A 1 254 ? 2.458   7.429   15.513 1.00 30.89 ? 252 TRP A CZ2 1 
ATOM   2008 C CZ3 . TRP A 1 254 ? 3.286   8.771   17.356 1.00 30.95 ? 252 TRP A CZ3 1 
ATOM   2009 C CH2 . TRP A 1 254 ? 2.914   7.530   16.805 1.00 31.17 ? 252 TRP A CH2 1 
ATOM   2010 N N   . GLU A 1 255 ? 4.862   12.691  12.004 1.00 32.05 ? 253 GLU A N   1 
ATOM   2011 C CA  . GLU A 1 255 ? 5.445   12.203  10.761 1.00 33.77 ? 253 GLU A CA  1 
ATOM   2012 C C   . GLU A 1 255 ? 6.849   12.693  10.409 1.00 34.95 ? 253 GLU A C   1 
ATOM   2013 O O   . GLU A 1 255 ? 7.329   12.460  9.298  1.00 36.76 ? 253 GLU A O   1 
ATOM   2014 C CB  . GLU A 1 255 ? 4.469   12.418  9.600  1.00 33.40 ? 253 GLU A CB  1 
ATOM   2015 C CG  . GLU A 1 255 ? 3.150   11.678  9.804  1.00 35.33 ? 253 GLU A CG  1 
ATOM   2016 C CD  . GLU A 1 255 ? 2.361   11.492  8.522  1.00 37.10 ? 253 GLU A CD  1 
ATOM   2017 O OE1 . GLU A 1 255 ? 1.650   12.436  8.113  1.00 36.69 ? 253 GLU A OE1 1 
ATOM   2018 O OE2 . GLU A 1 255 ? 2.440   10.392  7.932  1.00 37.31 ? 253 GLU A OE2 1 
ATOM   2019 N N   . GLY A 1 256 ? 7.499   13.373  11.349 1.00 35.04 ? 254 GLY A N   1 
ATOM   2020 C CA  . GLY A 1 256 ? 8.860   13.839  11.132 1.00 35.97 ? 254 GLY A CA  1 
ATOM   2021 C C   . GLY A 1 256 ? 9.121   15.000  10.186 1.00 36.75 ? 254 GLY A C   1 
ATOM   2022 O O   . GLY A 1 256 ? 10.260  15.191  9.752  1.00 35.03 ? 254 GLY A O   1 
ATOM   2023 N N   . THR A 1 257 ? 8.099   15.784  9.862  1.00 37.67 ? 255 THR A N   1 
ATOM   2024 C CA  . THR A 1 257 ? 8.295   16.921  8.969  1.00 38.75 ? 255 THR A CA  1 
ATOM   2025 C C   . THR A 1 257 ? 8.504   18.216  9.755  1.00 40.40 ? 255 THR A C   1 
ATOM   2026 O O   . THR A 1 257 ? 8.872   19.245  9.186  1.00 41.54 ? 255 THR A O   1 
ATOM   2027 C CB  . THR A 1 257 ? 7.121   17.076  7.979  1.00 37.61 ? 255 THR A CB  1 
ATOM   2028 O OG1 . THR A 1 257 ? 5.878   17.083  8.690  1.00 37.41 ? 255 THR A OG1 1 
ATOM   2029 C CG2 . THR A 1 257 ? 7.123   15.930  6.980  1.00 38.13 ? 255 THR A CG2 1 
ATOM   2030 N N   . GLN A 1 258 ? 8.258   18.155  11.062 1.00 39.67 ? 256 GLN A N   1 
ATOM   2031 C CA  . GLN A 1 258 ? 8.418   19.298  11.958 1.00 39.49 ? 256 GLN A CA  1 
ATOM   2032 C C   . GLN A 1 258 ? 9.496   18.974  12.978 1.00 39.25 ? 256 GLN A C   1 
ATOM   2033 O O   . GLN A 1 258 ? 9.620   17.825  13.406 1.00 39.37 ? 256 GLN A O   1 
ATOM   2034 C CB  . GLN A 1 258 ? 7.113   19.574  12.702 1.00 39.96 ? 256 GLN A CB  1 
ATOM   2035 C CG  . GLN A 1 258 ? 5.966   20.003  11.816 1.00 42.35 ? 256 GLN A CG  1 
ATOM   2036 C CD  . GLN A 1 258 ? 6.034   21.466  11.454 1.00 42.72 ? 256 GLN A CD  1 
ATOM   2037 O OE1 . GLN A 1 258 ? 5.593   22.324  12.218 1.00 44.09 ? 256 GLN A OE1 1 
ATOM   2038 N NE2 . GLN A 1 258 ? 6.599   21.764  10.297 1.00 42.78 ? 256 GLN A NE2 1 
ATOM   2039 N N   . ASN A 1 259 ? 10.250  19.991  13.386 1.00 38.58 ? 257 ASN A N   1 
ATOM   2040 C CA  . ASN A 1 259 ? 11.319  19.818  14.369 1.00 36.74 ? 257 ASN A CA  1 
ATOM   2041 C C   . ASN A 1 259 ? 10.732  19.425  15.711 1.00 34.19 ? 257 ASN A C   1 
ATOM   2042 O O   . ASN A 1 259 ? 9.714   19.970  16.138 1.00 33.24 ? 257 ASN A O   1 
ATOM   2043 C CB  . ASN A 1 259 ? 12.121  21.108  14.533 1.00 37.85 ? 257 ASN A CB  1 
ATOM   2044 C CG  . ASN A 1 259 ? 13.018  21.393  13.350 1.00 39.76 ? 257 ASN A CG  1 
ATOM   2045 O OD1 . ASN A 1 259 ? 13.411  20.483  12.618 1.00 41.66 ? 257 ASN A OD1 1 
ATOM   2046 N ND2 . ASN A 1 259 ? 13.360  22.662  13.161 1.00 39.95 ? 257 ASN A ND2 1 
ATOM   2047 N N   . PHE A 1 260 ? 11.380  18.484  16.382 1.00 33.37 ? 258 PHE A N   1 
ATOM   2048 C CA  . PHE A 1 260 ? 10.893  18.027  17.673 1.00 31.42 ? 258 PHE A CA  1 
ATOM   2049 C C   . PHE A 1 260 ? 11.953  17.200  18.372 1.00 29.84 ? 258 PHE A C   1 
ATOM   2050 O O   . PHE A 1 260 ? 12.510  16.267  17.790 1.00 26.82 ? 258 PHE A O   1 
ATOM   2051 C CB  . PHE A 1 260 ? 9.621   17.191  17.481 1.00 30.68 ? 258 PHE A CB  1 
ATOM   2052 C CG  . PHE A 1 260 ? 9.028   16.676  18.763 1.00 31.27 ? 258 PHE A CG  1 
ATOM   2053 C CD1 . PHE A 1 260 ? 8.319   17.522  19.608 1.00 29.96 ? 258 PHE A CD1 1 
ATOM   2054 C CD2 . PHE A 1 260 ? 9.170   15.338  19.119 1.00 30.84 ? 258 PHE A CD2 1 
ATOM   2055 C CE1 . PHE A 1 260 ? 7.763   17.044  20.789 1.00 30.89 ? 258 PHE A CE1 1 
ATOM   2056 C CE2 . PHE A 1 260 ? 8.616   14.852  20.301 1.00 30.84 ? 258 PHE A CE2 1 
ATOM   2057 C CZ  . PHE A 1 260 ? 7.912   15.708  21.136 1.00 30.90 ? 258 PHE A CZ  1 
ATOM   2058 N N   . VAL A 1 261 ? 12.281  17.581  19.600 1.00 28.28 ? 259 VAL A N   1 
ATOM   2059 C CA  . VAL A 1 261 ? 13.257  16.821  20.363 1.00 26.45 ? 259 VAL A CA  1 
ATOM   2060 C C   . VAL A 1 261 ? 12.436  15.782  21.129 1.00 24.21 ? 259 VAL A C   1 
ATOM   2061 O O   . VAL A 1 261 ? 11.640  16.118  22.007 1.00 26.26 ? 259 VAL A O   1 
ATOM   2062 C CB  . VAL A 1 261 ? 14.111  17.726  21.291 1.00 27.33 ? 259 VAL A CB  1 
ATOM   2063 C CG1 . VAL A 1 261 ? 13.239  18.501  22.240 1.00 29.18 ? 259 VAL A CG1 1 
ATOM   2064 C CG2 . VAL A 1 261 ? 15.127  16.904  22.042 1.00 26.72 ? 259 VAL A CG2 1 
ATOM   2065 N N   . ALA A 1 262 ? 12.540  14.535  20.687 1.00 22.04 ? 260 ALA A N   1 
ATOM   2066 C CA  . ALA A 1 262 ? 11.798  13.430  21.287 1.00 20.71 ? 260 ALA A CA  1 
ATOM   2067 C C   . ALA A 1 262 ? 12.406  12.888  22.584 1.00 20.63 ? 260 ALA A C   1 
ATOM   2068 O O   . ALA A 1 262 ? 11.840  11.996  23.217 1.00 19.08 ? 260 ALA A O   1 
ATOM   2069 C CB  . ALA A 1 262 ? 11.642  12.312  20.273 1.00 20.25 ? 260 ALA A CB  1 
ATOM   2070 N N   . CYS A 1 263 ? 13.530  13.453  22.998 1.00 20.12 ? 261 CYS A N   1 
ATOM   2071 C CA  . CYS A 1 263 ? 14.213  13.018  24.212 1.00 21.46 ? 261 CYS A CA  1 
ATOM   2072 C C   . CYS A 1 263 ? 13.304  12.784  25.432 1.00 19.18 ? 261 CYS A C   1 
ATOM   2073 O O   . CYS A 1 263 ? 13.277  11.679  25.975 1.00 20.28 ? 261 CYS A O   1 
ATOM   2074 C CB  . CYS A 1 263 ? 15.334  14.000  24.549 1.00 22.82 ? 261 CYS A CB  1 
ATOM   2075 S SG  . CYS A 1 263 ? 16.511  13.429  25.817 1.00 25.93 ? 261 CYS A SG  1 
ATOM   2076 N N   . ASN A 1 264 ? 12.532  13.790  25.841 1.00 18.97 ? 262 ASN A N   1 
ATOM   2077 C CA  . ASN A 1 264 ? 11.652  13.643  27.001 1.00 19.09 ? 262 ASN A CA  1 
ATOM   2078 C C   . ASN A 1 264 ? 10.622  12.526  26.833 1.00 18.60 ? 262 ASN A C   1 
ATOM   2079 O O   . ASN A 1 264 ? 10.327  11.792  27.779 1.00 14.81 ? 262 ASN A O   1 
ATOM   2080 C CB  . ASN A 1 264 ? 10.920  14.958  27.314 1.00 17.85 ? 262 ASN A CB  1 
ATOM   2081 C CG  . ASN A 1 264 ? 11.806  15.992  28.008 1.00 20.17 ? 262 ASN A CG  1 
ATOM   2082 O OD1 . ASN A 1 264 ? 12.563  15.676  28.928 1.00 19.27 ? 262 ASN A OD1 1 
ATOM   2083 N ND2 . ASN A 1 264 ? 11.685  17.238  27.589 1.00 18.74 ? 262 ASN A ND2 1 
ATOM   2084 N N   . HIS A 1 265 ? 10.040  12.429  25.637 1.00 16.93 ? 263 HIS A N   1 
ATOM   2085 C CA  . HIS A 1 265 ? 9.022   11.418  25.339 1.00 16.39 ? 263 HIS A CA  1 
ATOM   2086 C C   . HIS A 1 265 ? 9.611   10.005  25.418 1.00 14.66 ? 263 HIS A C   1 
ATOM   2087 O O   . HIS A 1 265 ? 8.938   9.084   25.873 1.00 15.62 ? 263 HIS A O   1 
ATOM   2088 C CB  . HIS A 1 265 ? 8.427   11.681  23.931 1.00 16.24 ? 263 HIS A CB  1 
ATOM   2089 C CG  . HIS A 1 265 ? 7.217   10.856  23.585 1.00 13.33 ? 263 HIS A CG  1 
ATOM   2090 N ND1 . HIS A 1 265 ? 6.173   10.638  24.458 1.00 13.49 ? 263 HIS A ND1 1 
ATOM   2091 C CD2 . HIS A 1 265 ? 6.855   10.257  22.425 1.00 15.10 ? 263 HIS A CD2 1 
ATOM   2092 C CE1 . HIS A 1 265 ? 5.224   9.945   23.856 1.00 15.31 ? 263 HIS A CE1 1 
ATOM   2093 N NE2 . HIS A 1 265 ? 5.613   9.703   22.619 1.00 14.14 ? 263 HIS A NE2 1 
ATOM   2094 N N   . LEU A 1 266 ? 10.851  9.844   24.966 1.00 15.03 ? 264 LEU A N   1 
ATOM   2095 C CA  . LEU A 1 266 ? 11.518  8.545   24.965 1.00 18.40 ? 264 LEU A CA  1 
ATOM   2096 C C   . LEU A 1 266 ? 12.129  8.141   26.306 1.00 19.99 ? 264 LEU A C   1 
ATOM   2097 O O   . LEU A 1 266 ? 12.408  6.958   26.536 1.00 19.44 ? 264 LEU A O   1 
ATOM   2098 C CB  . LEU A 1 266 ? 12.611  8.504   23.891 1.00 19.87 ? 264 LEU A CB  1 
ATOM   2099 C CG  . LEU A 1 266 ? 12.263  8.995   22.484 1.00 20.95 ? 264 LEU A CG  1 
ATOM   2100 C CD1 . LEU A 1 266 ? 13.353  8.554   21.532 1.00 19.71 ? 264 LEU A CD1 1 
ATOM   2101 C CD2 . LEU A 1 266 ? 10.902  8.481   22.041 1.00 19.89 ? 264 LEU A CD2 1 
ATOM   2102 N N   . ARG A 1 267 ? 12.344  9.112   27.187 1.00 18.92 ? 265 ARG A N   1 
ATOM   2103 C CA  . ARG A 1 267 ? 12.929  8.824   28.492 1.00 18.92 ? 265 ARG A CA  1 
ATOM   2104 C C   . ARG A 1 267 ? 12.152  7.784   29.284 1.00 17.46 ? 265 ARG A C   1 
ATOM   2105 O O   . ARG A 1 267 ? 12.755  6.986   30.006 1.00 18.99 ? 265 ARG A O   1 
ATOM   2106 C CB  . ARG A 1 267 ? 13.095  10.103  29.313 1.00 18.36 ? 265 ARG A CB  1 
ATOM   2107 C CG  . ARG A 1 267 ? 14.391  10.845  29.044 1.00 17.71 ? 265 ARG A CG  1 
ATOM   2108 C CD  . ARG A 1 267 ? 15.613  9.985   29.391 1.00 19.49 ? 265 ARG A CD  1 
ATOM   2109 N NE  . ARG A 1 267 ? 16.804  10.793  29.648 1.00 20.50 ? 265 ARG A NE  1 
ATOM   2110 C CZ  . ARG A 1 267 ? 17.757  11.048  28.756 1.00 20.66 ? 265 ARG A CZ  1 
ATOM   2111 N NH1 . ARG A 1 267 ? 17.680  10.567  27.517 1.00 19.11 ? 265 ARG A NH1 1 
ATOM   2112 N NH2 . ARG A 1 267 ? 18.792  11.794  29.100 1.00 20.42 ? 265 ARG A NH2 1 
ATOM   2113 N N   . SER A 1 268 ? 10.830  7.770   29.122 1.00 19.34 ? 266 SER A N   1 
ATOM   2114 C CA  . SER A 1 268 ? 9.970   6.803   29.799 1.00 18.37 ? 266 SER A CA  1 
ATOM   2115 C C   . SER A 1 268 ? 10.487  5.376   29.556 1.00 19.59 ? 266 SER A C   1 
ATOM   2116 O O   . SER A 1 268 ? 10.749  4.633   30.510 1.00 16.09 ? 266 SER A O   1 
ATOM   2117 C CB  . SER A 1 268 ? 8.525   6.936   29.308 1.00 18.41 ? 266 SER A CB  1 
ATOM   2118 O OG  . SER A 1 268 ? 8.446   6.771   27.899 1.00 17.35 ? 266 SER A OG  1 
ATOM   2119 N N   . TYR A 1 269 ? 10.674  4.992   28.292 1.00 16.84 ? 267 TYR A N   1 
ATOM   2120 C CA  . TYR A 1 269 ? 11.190  3.650   28.043 1.00 18.29 ? 267 TYR A CA  1 
ATOM   2121 C C   . TYR A 1 269 ? 12.668  3.466   28.391 1.00 17.53 ? 267 TYR A C   1 
ATOM   2122 O O   . TYR A 1 269 ? 13.083  2.367   28.753 1.00 16.28 ? 267 TYR A O   1 
ATOM   2123 C CB  . TYR A 1 269 ? 10.828  3.097   26.647 1.00 15.47 ? 267 TYR A CB  1 
ATOM   2124 C CG  . TYR A 1 269 ? 11.439  3.728   25.413 1.00 15.00 ? 267 TYR A CG  1 
ATOM   2125 C CD1 . TYR A 1 269 ? 12.785  3.543   25.095 1.00 13.63 ? 267 TYR A CD1 1 
ATOM   2126 C CD2 . TYR A 1 269 ? 10.625  4.381   24.476 1.00 15.55 ? 267 TYR A CD2 1 
ATOM   2127 C CE1 . TYR A 1 269 ? 13.306  3.975   23.875 1.00 17.36 ? 267 TYR A CE1 1 
ATOM   2128 C CE2 . TYR A 1 269 ? 11.137  4.807   23.259 1.00 16.83 ? 267 TYR A CE2 1 
ATOM   2129 C CZ  . TYR A 1 269 ? 12.470  4.600   22.961 1.00 17.26 ? 267 TYR A CZ  1 
ATOM   2130 O OH  . TYR A 1 269 ? 12.950  4.975   21.719 1.00 21.42 ? 267 TYR A OH  1 
ATOM   2131 N N   . LYS A 1 270 ? 13.446  4.546   28.348 1.00 16.87 ? 268 LYS A N   1 
ATOM   2132 C CA  . LYS A 1 270 ? 14.864  4.483   28.698 1.00 18.86 ? 268 LYS A CA  1 
ATOM   2133 C C   . LYS A 1 270 ? 14.972  4.160   30.197 1.00 16.97 ? 268 LYS A C   1 
ATOM   2134 O O   . LYS A 1 270 ? 15.823  3.367   30.622 1.00 14.72 ? 268 LYS A O   1 
ATOM   2135 C CB  . LYS A 1 270 ? 15.548  5.830   28.422 1.00 20.56 ? 268 LYS A CB  1 
ATOM   2136 C CG  . LYS A 1 270 ? 15.474  6.317   26.979 1.00 25.03 ? 268 LYS A CG  1 
ATOM   2137 C CD  . LYS A 1 270 ? 16.375  5.519   26.067 1.00 27.87 ? 268 LYS A CD  1 
ATOM   2138 C CE  . LYS A 1 270 ? 16.423  6.138   24.679 1.00 31.25 ? 268 LYS A CE  1 
ATOM   2139 N NZ  . LYS A 1 270 ? 17.356  5.385   23.802 1.00 33.93 ? 268 LYS A NZ  1 
ATOM   2140 N N   . TYR A 1 271 ? 14.110  4.785   30.995 1.00 16.05 ? 269 TYR A N   1 
ATOM   2141 C CA  . TYR A 1 271 ? 14.102  4.543   32.438 1.00 14.00 ? 269 TYR A CA  1 
ATOM   2142 C C   . TYR A 1 271 ? 13.596  3.128   32.696 1.00 14.07 ? 269 TYR A C   1 
ATOM   2143 O O   . TYR A 1 271 ? 14.093  2.449   33.582 1.00 9.55  ? 269 TYR A O   1 
ATOM   2144 C CB  . TYR A 1 271 ? 13.185  5.509   33.184 1.00 14.50 ? 269 TYR A CB  1 
ATOM   2145 C CG  . TYR A 1 271 ? 13.562  6.974   33.144 1.00 13.73 ? 269 TYR A CG  1 
ATOM   2146 C CD1 . TYR A 1 271 ? 14.881  7.389   32.950 1.00 15.26 ? 269 TYR A CD1 1 
ATOM   2147 C CD2 . TYR A 1 271 ? 12.579  7.950   33.334 1.00 16.57 ? 269 TYR A CD2 1 
ATOM   2148 C CE1 . TYR A 1 271 ? 15.209  8.766   32.948 1.00 14.59 ? 269 TYR A CE1 1 
ATOM   2149 C CE2 . TYR A 1 271 ? 12.886  9.304   33.327 1.00 14.46 ? 269 TYR A CE2 1 
ATOM   2150 C CZ  . TYR A 1 271 ? 14.197  9.706   33.141 1.00 14.83 ? 269 TYR A CZ  1 
ATOM   2151 O OH  . TYR A 1 271 ? 14.470  11.056  33.157 1.00 16.56 ? 269 TYR A OH  1 
ATOM   2152 N N   . TYR A 1 272 ? 12.580  2.695   31.955 1.00 14.54 ? 270 TYR A N   1 
ATOM   2153 C CA  . TYR A 1 272 ? 12.060  1.346   32.165 1.00 14.96 ? 270 TYR A CA  1 
ATOM   2154 C C   . TYR A 1 272 ? 13.161  0.344   31.891 1.00 12.95 ? 270 TYR A C   1 
ATOM   2155 O O   . TYR A 1 272 ? 13.382  -0.561  32.705 1.00 18.03 ? 270 TYR A O   1 
ATOM   2156 C CB  . TYR A 1 272 ? 10.834  1.045   31.291 1.00 14.86 ? 270 TYR A CB  1 
ATOM   2157 C CG  . TYR A 1 272 ? 10.172  -0.265  31.669 1.00 11.46 ? 270 TYR A CG  1 
ATOM   2158 C CD1 . TYR A 1 272 ? 10.727  -1.492  31.288 1.00 13.45 ? 270 TYR A CD1 1 
ATOM   2159 C CD2 . TYR A 1 272 ? 9.042   -0.282  32.477 1.00 11.29 ? 270 TYR A CD2 1 
ATOM   2160 C CE1 . TYR A 1 272 ? 10.160  -2.714  31.711 1.00 11.81 ? 270 TYR A CE1 1 
ATOM   2161 C CE2 . TYR A 1 272 ? 8.472   -1.492  32.914 1.00 12.80 ? 270 TYR A CE2 1 
ATOM   2162 C CZ  . TYR A 1 272 ? 9.043   -2.699  32.522 1.00 11.61 ? 270 TYR A CZ  1 
ATOM   2163 O OH  . TYR A 1 272 ? 8.481   -3.875  32.966 1.00 12.58 ? 270 TYR A OH  1 
ATOM   2164 N N   . ALA A 1 273 ? 13.876  0.525   30.780 1.00 15.96 ? 271 ALA A N   1 
ATOM   2165 C CA  . ALA A 1 273 ? 14.969  -0.358  30.397 1.00 17.24 ? 271 ALA A CA  1 
ATOM   2166 C C   . ALA A 1 273 ? 15.994  -0.494  31.529 1.00 20.56 ? 271 ALA A C   1 
ATOM   2167 O O   . ALA A 1 273 ? 16.398  -1.599  31.884 1.00 21.65 ? 271 ALA A O   1 
ATOM   2168 C CB  . ALA A 1 273 ? 15.648  0.156   29.129 1.00 14.64 ? 271 ALA A CB  1 
ATOM   2169 N N   . SER A 1 274 ? 16.408  0.634   32.099 1.00 22.10 ? 272 SER A N   1 
ATOM   2170 C CA  . SER A 1 274 ? 17.372  0.614   33.190 1.00 21.23 ? 272 SER A CA  1 
ATOM   2171 C C   . SER A 1 274 ? 16.809  -0.014  34.462 1.00 19.77 ? 272 SER A C   1 
ATOM   2172 O O   . SER A 1 274 ? 17.525  -0.746  35.158 1.00 20.03 ? 272 SER A O   1 
ATOM   2173 C CB  . SER A 1 274 ? 17.866  2.029   33.505 1.00 21.68 ? 272 SER A CB  1 
ATOM   2174 O OG  . SER A 1 274 ? 18.895  1.992   34.485 1.00 18.59 ? 272 SER A OG  1 
ATOM   2175 N N   . SER A 1 275 ? 15.535  0.245   34.755 1.00 17.82 ? 273 SER A N   1 
ATOM   2176 C CA  . SER A 1 275 ? 14.910  -0.282  35.959 1.00 17.93 ? 273 SER A CA  1 
ATOM   2177 C C   . SER A 1 275 ? 14.876  -1.808  35.980 1.00 19.36 ? 273 SER A C   1 
ATOM   2178 O O   . SER A 1 275 ? 14.739  -2.411  37.043 1.00 20.69 ? 273 SER A O   1 
ATOM   2179 C CB  . SER A 1 275 ? 13.508  0.288   36.150 1.00 16.65 ? 273 SER A CB  1 
ATOM   2180 O OG  . SER A 1 275 ? 12.545  -0.374  35.346 1.00 19.76 ? 273 SER A OG  1 
ATOM   2181 N N   . ILE A 1 276 ? 15.011  -2.428  34.809 1.00 19.31 ? 274 ILE A N   1 
ATOM   2182 C CA  . ILE A 1 276 ? 15.013  -3.887  34.715 1.00 19.52 ? 274 ILE A CA  1 
ATOM   2183 C C   . ILE A 1 276 ? 16.230  -4.455  35.449 1.00 18.80 ? 274 ILE A C   1 
ATOM   2184 O O   . ILE A 1 276 ? 16.115  -5.434  36.184 1.00 21.84 ? 274 ILE A O   1 
ATOM   2185 C CB  . ILE A 1 276 ? 15.042  -4.367  33.229 1.00 17.04 ? 274 ILE A CB  1 
ATOM   2186 C CG1 . ILE A 1 276 ? 13.725  -3.989  32.529 1.00 17.39 ? 274 ILE A CG1 1 
ATOM   2187 C CG2 . ILE A 1 276 ? 15.293  -5.879  33.163 1.00 18.12 ? 274 ILE A CG2 1 
ATOM   2188 C CD1 . ILE A 1 276 ? 13.758  -4.073  31.008 1.00 17.21 ? 274 ILE A CD1 1 
ATOM   2189 N N   . LEU A 1 277 ? 17.373  -3.806  35.271 1.00 21.15 ? 275 LEU A N   1 
ATOM   2190 C CA  . LEU A 1 277 ? 18.618  -4.247  35.878 1.00 23.28 ? 275 LEU A CA  1 
ATOM   2191 C C   . LEU A 1 277 ? 18.956  -3.523  37.188 1.00 25.07 ? 275 LEU A C   1 
ATOM   2192 O O   . LEU A 1 277 ? 19.588  -4.105  38.068 1.00 25.92 ? 275 LEU A O   1 
ATOM   2193 C CB  . LEU A 1 277 ? 19.762  -4.074  34.871 1.00 23.19 ? 275 LEU A CB  1 
ATOM   2194 C CG  . LEU A 1 277 ? 19.509  -4.568  33.437 1.00 23.42 ? 275 LEU A CG  1 
ATOM   2195 C CD1 . LEU A 1 277 ? 20.660  -4.179  32.522 1.00 24.57 ? 275 LEU A CD1 1 
ATOM   2196 C CD2 . LEU A 1 277 ? 19.300  -6.076  33.421 1.00 26.11 ? 275 LEU A CD2 1 
ATOM   2197 N N   . ASN A 1 278 ? 18.485  -2.282  37.343 1.00 24.54 ? 276 ASN A N   1 
ATOM   2198 C CA  . ASN A 1 278 ? 18.785  -1.476  38.542 1.00 22.68 ? 276 ASN A CA  1 
ATOM   2199 C C   . ASN A 1 278 ? 17.551  -0.882  39.238 1.00 18.86 ? 276 ASN A C   1 
ATOM   2200 O O   . ASN A 1 278 ? 17.511  0.326   39.496 1.00 21.26 ? 276 ASN A O   1 
ATOM   2201 C CB  . ASN A 1 278 ? 19.702  -0.305  38.152 1.00 22.67 ? 276 ASN A CB  1 
ATOM   2202 C CG  . ASN A 1 278 ? 20.782  -0.696  37.165 1.00 24.36 ? 276 ASN A CG  1 
ATOM   2203 O OD1 . ASN A 1 278 ? 21.692  -1.448  37.490 1.00 21.44 ? 276 ASN A OD1 1 
ATOM   2204 N ND2 . ASN A 1 278 ? 20.690  -0.174  35.948 1.00 22.44 ? 276 ASN A ND2 1 
ATOM   2205 N N   . PRO A 1 279 ? 16.595  -1.719  39.672 1.00 17.09 ? 277 PRO A N   1 
ATOM   2206 C CA  . PRO A 1 279 ? 15.399  -1.179  40.325 1.00 18.89 ? 277 PRO A CA  1 
ATOM   2207 C C   . PRO A 1 279 ? 15.632  -0.405  41.627 1.00 20.04 ? 277 PRO A C   1 
ATOM   2208 O O   . PRO A 1 279 ? 14.866  0.503   41.974 1.00 19.63 ? 277 PRO A O   1 
ATOM   2209 C CB  . PRO A 1 279 ? 14.547  -2.431  40.541 1.00 16.80 ? 277 PRO A CB  1 
ATOM   2210 C CG  . PRO A 1 279 ? 15.569  -3.483  40.792 1.00 17.38 ? 277 PRO A CG  1 
ATOM   2211 C CD  . PRO A 1 279 ? 16.605  -3.194  39.742 1.00 15.22 ? 277 PRO A CD  1 
ATOM   2212 N N   . ASP A 1 280 ? 16.696  -0.752  42.341 1.00 21.63 ? 278 ASP A N   1 
ATOM   2213 C CA  . ASP A 1 280 ? 17.008  -0.072  43.599 1.00 21.82 ? 278 ASP A CA  1 
ATOM   2214 C C   . ASP A 1 280 ? 17.437  1.380   43.383 1.00 22.19 ? 278 ASP A C   1 
ATOM   2215 O O   . ASP A 1 280 ? 17.508  2.166   44.335 1.00 20.60 ? 278 ASP A O   1 
ATOM   2216 C CB  . ASP A 1 280 ? 18.085  -0.844  44.357 1.00 23.63 ? 278 ASP A CB  1 
ATOM   2217 C CG  . ASP A 1 280 ? 17.565  -2.147  44.948 1.00 26.20 ? 278 ASP A CG  1 
ATOM   2218 O OD1 . ASP A 1 280 ? 16.379  -2.204  45.339 1.00 27.30 ? 278 ASP A OD1 1 
ATOM   2219 O OD2 . ASP A 1 280 ? 18.348  -3.115  45.038 1.00 30.16 ? 278 ASP A OD2 1 
ATOM   2220 N N   . GLY A 1 281 ? 17.750  1.717   42.135 1.00 19.83 ? 279 GLY A N   1 
ATOM   2221 C CA  . GLY A 1 281 ? 18.146  3.070   41.797 1.00 19.70 ? 279 GLY A CA  1 
ATOM   2222 C C   . GLY A 1 281 ? 16.966  3.927   41.377 1.00 18.68 ? 279 GLY A C   1 
ATOM   2223 O O   . GLY A 1 281 ? 17.160  5.056   40.932 1.00 16.92 ? 279 GLY A O   1 
ATOM   2224 N N   . PHE A 1 282 ? 15.755  3.386   41.496 1.00 15.40 ? 280 PHE A N   1 
ATOM   2225 C CA  . PHE A 1 282 ? 14.546  4.099   41.118 1.00 14.44 ? 280 PHE A CA  1 
ATOM   2226 C C   . PHE A 1 282 ? 13.465  3.989   42.186 1.00 16.02 ? 280 PHE A C   1 
ATOM   2227 O O   . PHE A 1 282 ? 12.309  3.701   41.879 1.00 14.24 ? 280 PHE A O   1 
ATOM   2228 C CB  . PHE A 1 282 ? 13.998  3.579   39.767 1.00 14.06 ? 280 PHE A CB  1 
ATOM   2229 C CG  . PHE A 1 282 ? 14.930  3.779   38.602 1.00 13.65 ? 280 PHE A CG  1 
ATOM   2230 C CD1 . PHE A 1 282 ? 15.006  5.005   37.954 1.00 15.41 ? 280 PHE A CD1 1 
ATOM   2231 C CD2 . PHE A 1 282 ? 15.730  2.734   38.143 1.00 13.34 ? 280 PHE A CD2 1 
ATOM   2232 C CE1 . PHE A 1 282 ? 15.862  5.186   36.877 1.00 13.37 ? 280 PHE A CE1 1 
ATOM   2233 C CE2 . PHE A 1 282 ? 16.586  2.904   37.073 1.00 13.93 ? 280 PHE A CE2 1 
ATOM   2234 C CZ  . PHE A 1 282 ? 16.658  4.130   36.435 1.00 15.32 ? 280 PHE A CZ  1 
ATOM   2235 N N   . LEU A 1 283 ? 13.818  4.229   43.449 1.00 14.05 ? 281 LEU A N   1 
ATOM   2236 C CA  . LEU A 1 283 ? 12.811  4.155   44.496 1.00 14.78 ? 281 LEU A CA  1 
ATOM   2237 C C   . LEU A 1 283 ? 11.892  5.362   44.365 1.00 14.23 ? 281 LEU A C   1 
ATOM   2238 O O   . LEU A 1 283 ? 12.366  6.491   44.216 1.00 13.11 ? 281 LEU A O   1 
ATOM   2239 C CB  . LEU A 1 283 ? 13.445  4.151   45.891 1.00 17.04 ? 281 LEU A CB  1 
ATOM   2240 C CG  . LEU A 1 283 ? 14.433  3.036   46.255 1.00 20.67 ? 281 LEU A CG  1 
ATOM   2241 C CD1 . LEU A 1 283 ? 14.636  3.072   47.760 1.00 22.35 ? 281 LEU A CD1 1 
ATOM   2242 C CD2 . LEU A 1 283 ? 13.913  1.667   45.834 1.00 20.74 ? 281 LEU A CD2 1 
ATOM   2243 N N   . GLY A 1 284 ? 10.589  5.114   44.406 1.00 11.36 ? 282 GLY A N   1 
ATOM   2244 C CA  . GLY A 1 284 ? 9.619   6.182   44.284 1.00 15.29 ? 282 GLY A CA  1 
ATOM   2245 C C   . GLY A 1 284 ? 8.927   6.496   45.590 1.00 16.23 ? 282 GLY A C   1 
ATOM   2246 O O   . GLY A 1 284 ? 8.548   5.595   46.343 1.00 18.20 ? 282 GLY A O   1 
ATOM   2247 N N   . TYR A 1 285 ? 8.740   7.784   45.860 1.00 12.73 ? 283 TYR A N   1 
ATOM   2248 C CA  . TYR A 1 285 ? 8.095   8.218   47.089 1.00 14.09 ? 283 TYR A CA  1 
ATOM   2249 C C   . TYR A 1 285 ? 6.697   8.800   46.871 1.00 14.24 ? 283 TYR A C   1 
ATOM   2250 O O   . TYR A 1 285 ? 6.557   9.856   46.238 1.00 14.66 ? 283 TYR A O   1 
ATOM   2251 C CB  . TYR A 1 285 ? 8.999   9.249   47.811 1.00 12.32 ? 283 TYR A CB  1 
ATOM   2252 C CG  . TYR A 1 285 ? 10.408  8.749   48.068 1.00 14.13 ? 283 TYR A CG  1 
ATOM   2253 C CD1 . TYR A 1 285 ? 11.362  8.725   47.044 1.00 13.28 ? 283 TYR A CD1 1 
ATOM   2254 C CD2 . TYR A 1 285 ? 10.764  8.223   49.314 1.00 14.75 ? 283 TYR A CD2 1 
ATOM   2255 C CE1 . TYR A 1 285 ? 12.629  8.180   47.247 1.00 15.62 ? 283 TYR A CE1 1 
ATOM   2256 C CE2 . TYR A 1 285 ? 12.032  7.676   49.530 1.00 15.05 ? 283 TYR A CE2 1 
ATOM   2257 C CZ  . TYR A 1 285 ? 12.956  7.650   48.502 1.00 14.22 ? 283 TYR A CZ  1 
ATOM   2258 O OH  . TYR A 1 285 ? 14.194  7.087   48.717 1.00 13.75 ? 283 TYR A OH  1 
ATOM   2259 N N   . PRO A 1 286 ? 5.639   8.083   47.306 1.00 14.78 ? 284 PRO A N   1 
ATOM   2260 C CA  . PRO A 1 286 ? 4.258   8.568   47.158 1.00 15.78 ? 284 PRO A CA  1 
ATOM   2261 C C   . PRO A 1 286 ? 4.163   9.922   47.880 1.00 20.98 ? 284 PRO A C   1 
ATOM   2262 O O   . PRO A 1 286 ? 4.660   10.062  49.006 1.00 21.26 ? 284 PRO A O   1 
ATOM   2263 C CB  . PRO A 1 286 ? 3.437   7.516   47.904 1.00 13.10 ? 284 PRO A CB  1 
ATOM   2264 C CG  . PRO A 1 286 ? 4.224   6.258   47.722 1.00 14.64 ? 284 PRO A CG  1 
ATOM   2265 C CD  . PRO A 1 286 ? 5.662   6.723   47.885 1.00 14.60 ? 284 PRO A CD  1 
ATOM   2266 N N   . CYS A 1 287 ? 3.501   10.897  47.266 1.00 21.22 ? 285 CYS A N   1 
ATOM   2267 C CA  . CYS A 1 287 ? 3.400   12.228  47.853 1.00 21.47 ? 285 CYS A CA  1 
ATOM   2268 C C   . CYS A 1 287 ? 2.255   12.986  47.189 1.00 21.66 ? 285 CYS A C   1 
ATOM   2269 O O   . CYS A 1 287 ? 1.900   12.693  46.045 1.00 17.40 ? 285 CYS A O   1 
ATOM   2270 C CB  . CYS A 1 287 ? 4.718   12.961  47.602 1.00 20.66 ? 285 CYS A CB  1 
ATOM   2271 S SG  . CYS A 1 287 ? 5.047   14.389  48.681 1.00 21.82 ? 285 CYS A SG  1 
ATOM   2272 N N   . SER A 1 288 ? 1.674   13.956  47.892 1.00 20.79 ? 286 SER A N   1 
ATOM   2273 C CA  . SER A 1 288 ? 0.570   14.731  47.327 1.00 21.72 ? 286 SER A CA  1 
ATOM   2274 C C   . SER A 1 288 ? 0.971   15.635  46.151 1.00 22.41 ? 286 SER A C   1 
ATOM   2275 O O   . SER A 1 288 ? 0.109   16.062  45.381 1.00 24.53 ? 286 SER A O   1 
ATOM   2276 C CB  . SER A 1 288 ? -0.137  15.552  48.418 1.00 24.09 ? 286 SER A CB  1 
ATOM   2277 O OG  . SER A 1 288 ? 0.774   16.392  49.110 1.00 23.15 ? 286 SER A OG  1 
ATOM   2278 N N   . SER A 1 289 ? 2.261   15.944  46.025 1.00 21.53 ? 287 SER A N   1 
ATOM   2279 C CA  . SER A 1 289 ? 2.754   16.793  44.939 1.00 20.52 ? 287 SER A CA  1 
ATOM   2280 C C   . SER A 1 289 ? 4.270   16.756  44.820 1.00 20.14 ? 287 SER A C   1 
ATOM   2281 O O   . SER A 1 289 ? 4.972   16.393  45.762 1.00 18.97 ? 287 SER A O   1 
ATOM   2282 C CB  . SER A 1 289 ? 2.318   18.253  45.132 1.00 23.40 ? 287 SER A CB  1 
ATOM   2283 O OG  . SER A 1 289 ? 3.043   18.872  46.187 1.00 24.32 ? 287 SER A OG  1 
ATOM   2284 N N   . TYR A 1 290 ? 4.773   17.184  43.669 1.00 18.10 ? 288 TYR A N   1 
ATOM   2285 C CA  . TYR A 1 290 ? 6.199   17.217  43.421 1.00 17.23 ? 288 TYR A CA  1 
ATOM   2286 C C   . TYR A 1 290 ? 6.871   18.324  44.225 1.00 19.30 ? 288 TYR A C   1 
ATOM   2287 O O   . TYR A 1 290 ? 7.986   18.146  44.700 1.00 18.81 ? 288 TYR A O   1 
ATOM   2288 C CB  . TYR A 1 290 ? 6.487   17.420  41.942 1.00 16.10 ? 288 TYR A CB  1 
ATOM   2289 C CG  . TYR A 1 290 ? 7.948   17.333  41.596 1.00 15.48 ? 288 TYR A CG  1 
ATOM   2290 C CD1 . TYR A 1 290 ? 8.675   16.160  41.826 1.00 14.04 ? 288 TYR A CD1 1 
ATOM   2291 C CD2 . TYR A 1 290 ? 8.601   18.402  40.988 1.00 15.22 ? 288 TYR A CD2 1 
ATOM   2292 C CE1 . TYR A 1 290 ? 10.013  16.062  41.460 1.00 13.18 ? 288 TYR A CE1 1 
ATOM   2293 C CE2 . TYR A 1 290 ? 9.939   18.309  40.616 1.00 15.41 ? 288 TYR A CE2 1 
ATOM   2294 C CZ  . TYR A 1 290 ? 10.634  17.134  40.851 1.00 16.13 ? 288 TYR A CZ  1 
ATOM   2295 O OH  . TYR A 1 290 ? 11.939  17.023  40.454 1.00 13.89 ? 288 TYR A OH  1 
ATOM   2296 N N   . GLU A 1 291 ? 6.217   19.472  44.358 1.00 21.55 ? 289 GLU A N   1 
ATOM   2297 C CA  . GLU A 1 291 ? 6.817   20.557  45.135 1.00 24.86 ? 289 GLU A CA  1 
ATOM   2298 C C   . GLU A 1 291 ? 6.987   20.120  46.596 1.00 24.29 ? 289 GLU A C   1 
ATOM   2299 O O   . GLU A 1 291 ? 8.003   20.416  47.224 1.00 26.82 ? 289 GLU A O   1 
ATOM   2300 C CB  . GLU A 1 291 ? 5.983   21.839  45.049 1.00 28.08 ? 289 GLU A CB  1 
ATOM   2301 C CG  . GLU A 1 291 ? 6.619   23.037  45.777 1.00 32.62 ? 289 GLU A CG  1 
ATOM   2302 C CD  . GLU A 1 291 ? 8.021   23.384  45.270 1.00 35.37 ? 289 GLU A CD  1 
ATOM   2303 O OE1 . GLU A 1 291 ? 8.160   23.796  44.100 1.00 38.75 ? 289 GLU A OE1 1 
ATOM   2304 O OE2 . GLU A 1 291 ? 8.990   23.257  46.048 1.00 38.36 ? 289 GLU A OE2 1 
ATOM   2305 N N   . LYS A 1 292 ? 6.000   19.401  47.122 1.00 23.48 ? 290 LYS A N   1 
ATOM   2306 C CA  . LYS A 1 292 ? 6.049   18.907  48.496 1.00 23.78 ? 290 LYS A CA  1 
ATOM   2307 C C   . LYS A 1 292 ? 7.259   17.980  48.647 1.00 23.07 ? 290 LYS A C   1 
ATOM   2308 O O   . LYS A 1 292 ? 8.056   18.117  49.580 1.00 21.30 ? 290 LYS A O   1 
ATOM   2309 C CB  . LYS A 1 292 ? 4.749   18.177  48.833 1.00 25.12 ? 290 LYS A CB  1 
ATOM   2310 C CG  . LYS A 1 292 ? 4.633   17.674  50.259 1.00 27.64 ? 290 LYS A CG  1 
ATOM   2311 C CD  . LYS A 1 292 ? 3.200   17.260  50.550 1.00 31.60 ? 290 LYS A CD  1 
ATOM   2312 C CE  . LYS A 1 292 ? 3.051   16.612  51.917 1.00 33.02 ? 290 LYS A CE  1 
ATOM   2313 N NZ  . LYS A 1 292 ? 1.642   16.201  52.152 1.00 34.99 ? 290 LYS A NZ  1 
ATOM   2314 N N   . PHE A 1 293 ? 7.416   17.073  47.688 1.00 20.70 ? 291 PHE A N   1 
ATOM   2315 C CA  . PHE A 1 293 ? 8.533   16.138  47.673 1.00 20.23 ? 291 PHE A CA  1 
ATOM   2316 C C   . PHE A 1 293 ? 9.861   16.913  47.605 1.00 20.08 ? 291 PHE A C   1 
ATOM   2317 O O   . PHE A 1 293 ? 10.786  16.641  48.369 1.00 20.84 ? 291 PHE A O   1 
ATOM   2318 C CB  . PHE A 1 293 ? 8.368   15.181  46.479 1.00 17.82 ? 291 PHE A CB  1 
ATOM   2319 C CG  . PHE A 1 293 ? 9.567   14.315  46.201 1.00 15.40 ? 291 PHE A CG  1 
ATOM   2320 C CD1 . PHE A 1 293 ? 9.815   13.166  46.959 1.00 15.08 ? 291 PHE A CD1 1 
ATOM   2321 C CD2 . PHE A 1 293 ? 10.431  14.630  45.166 1.00 14.54 ? 291 PHE A CD2 1 
ATOM   2322 C CE1 . PHE A 1 293 ? 10.909  12.352  46.680 1.00 14.30 ? 291 PHE A CE1 1 
ATOM   2323 C CE2 . PHE A 1 293 ? 11.531  13.823  44.878 1.00 14.27 ? 291 PHE A CE2 1 
ATOM   2324 C CZ  . PHE A 1 293 ? 11.769  12.675  45.642 1.00 13.08 ? 291 PHE A CZ  1 
ATOM   2325 N N   . GLN A 1 294 ? 9.929   17.912  46.729 1.00 17.02 ? 292 GLN A N   1 
ATOM   2326 C CA  . GLN A 1 294 ? 11.135  18.721  46.567 1.00 18.96 ? 292 GLN A CA  1 
ATOM   2327 C C   . GLN A 1 294 ? 11.422  19.576  47.799 1.00 18.20 ? 292 GLN A C   1 
ATOM   2328 O O   . GLN A 1 294 ? 12.519  20.104  47.942 1.00 19.70 ? 292 GLN A O   1 
ATOM   2329 C CB  . GLN A 1 294 ? 11.018  19.623  45.335 1.00 20.61 ? 292 GLN A CB  1 
ATOM   2330 C CG  . GLN A 1 294 ? 11.035  18.870  44.013 1.00 18.90 ? 292 GLN A CG  1 
ATOM   2331 C CD  . GLN A 1 294 ? 12.426  18.443  43.593 1.00 20.63 ? 292 GLN A CD  1 
ATOM   2332 O OE1 . GLN A 1 294 ? 13.184  19.229  43.021 1.00 24.34 ? 292 GLN A OE1 1 
ATOM   2333 N NE2 . GLN A 1 294 ? 12.771  17.197  43.873 1.00 21.18 ? 292 GLN A NE2 1 
ATOM   2334 N N   . GLN A 1 295 ? 10.419  19.756  48.650 1.00 19.62 ? 293 GLN A N   1 
ATOM   2335 C CA  . GLN A 1 295 ? 10.599  20.528  49.874 1.00 22.37 ? 293 GLN A CA  1 
ATOM   2336 C C   . GLN A 1 295 ? 10.949  19.615  51.046 1.00 22.07 ? 293 GLN A C   1 
ATOM   2337 O O   . GLN A 1 295 ? 10.674  19.934  52.203 1.00 22.06 ? 293 GLN A O   1 
ATOM   2338 C CB  . GLN A 1 295 ? 9.359   21.355  50.182 1.00 24.79 ? 293 GLN A CB  1 
ATOM   2339 C CG  . GLN A 1 295 ? 9.238   22.578  49.309 1.00 27.13 ? 293 GLN A CG  1 
ATOM   2340 C CD  . GLN A 1 295 ? 7.895   23.249  49.443 1.00 30.62 ? 293 GLN A CD  1 
ATOM   2341 O OE1 . GLN A 1 295 ? 7.037   22.799  50.198 1.00 34.14 ? 293 GLN A OE1 1 
ATOM   2342 N NE2 . GLN A 1 295 ? 7.693   24.323  48.692 1.00 32.24 ? 293 GLN A NE2 1 
ATOM   2343 N N   . ASN A 1 296 ? 11.513  18.455  50.725 1.00 22.46 ? 294 ASN A N   1 
ATOM   2344 C CA  . ASN A 1 296 ? 11.953  17.486  51.724 1.00 23.43 ? 294 ASN A CA  1 
ATOM   2345 C C   . ASN A 1 296 ? 10.861  16.756  52.501 1.00 24.47 ? 294 ASN A C   1 
ATOM   2346 O O   . ASN A 1 296 ? 11.084  16.308  53.636 1.00 25.63 ? 294 ASN A O   1 
ATOM   2347 C CB  . ASN A 1 296 ? 12.945  18.159  52.686 1.00 23.33 ? 294 ASN A CB  1 
ATOM   2348 C CG  . ASN A 1 296 ? 14.097  18.825  51.956 1.00 20.01 ? 294 ASN A CG  1 
ATOM   2349 O OD1 . ASN A 1 296 ? 14.740  18.218  51.102 1.00 21.15 ? 294 ASN A OD1 1 
ATOM   2350 N ND2 . ASN A 1 296 ? 14.355  20.081  52.277 1.00 23.26 ? 294 ASN A ND2 1 
ATOM   2351 N N   . ASP A 1 297 ? 9.685   16.614  51.895 1.00 23.83 ? 295 ASP A N   1 
ATOM   2352 C CA  . ASP A 1 297 ? 8.590   15.910  52.549 1.00 23.09 ? 295 ASP A CA  1 
ATOM   2353 C C   . ASP A 1 297 ? 8.430   14.550  51.879 1.00 20.79 ? 295 ASP A C   1 
ATOM   2354 O O   . ASP A 1 297 ? 9.154   14.237  50.925 1.00 19.64 ? 295 ASP A O   1 
ATOM   2355 C CB  . ASP A 1 297 ? 7.290   16.709  52.444 1.00 26.21 ? 295 ASP A CB  1 
ATOM   2356 C CG  . ASP A 1 297 ? 6.333   16.438  53.594 1.00 29.48 ? 295 ASP A CG  1 
ATOM   2357 O OD1 . ASP A 1 297 ? 6.471   15.416  54.299 1.00 30.99 ? 295 ASP A OD1 1 
ATOM   2358 O OD2 . ASP A 1 297 ? 5.426   17.264  53.803 1.00 33.48 ? 295 ASP A OD2 1 
ATOM   2359 N N   . CYS A 1 298 ? 7.521   13.737  52.417 1.00 18.92 ? 296 CYS A N   1 
ATOM   2360 C CA  . CYS A 1 298 ? 7.224   12.403  51.901 1.00 19.69 ? 296 CYS A CA  1 
ATOM   2361 C C   . CYS A 1 298 ? 8.453   11.489  51.878 1.00 19.90 ? 296 CYS A C   1 
ATOM   2362 O O   . CYS A 1 298 ? 8.647   10.692  50.953 1.00 18.69 ? 296 CYS A O   1 
ATOM   2363 C CB  . CYS A 1 298 ? 6.584   12.527  50.512 1.00 18.27 ? 296 CYS A CB  1 
ATOM   2364 S SG  . CYS A 1 298 ? 5.071   13.537  50.525 1.00 20.89 ? 296 CYS A SG  1 
ATOM   2365 N N   . PHE A 1 299 ? 9.267   11.600  52.928 1.00 19.73 ? 297 PHE A N   1 
ATOM   2366 C CA  . PHE A 1 299 ? 10.476  10.809  53.094 1.00 18.94 ? 297 PHE A CA  1 
ATOM   2367 C C   . PHE A 1 299 ? 10.498  10.380  54.568 1.00 19.71 ? 297 PHE A C   1 
ATOM   2368 O O   . PHE A 1 299 ? 9.975   11.089  55.428 1.00 18.78 ? 297 PHE A O   1 
ATOM   2369 C CB  . PHE A 1 299 ? 11.712  11.665  52.777 1.00 17.33 ? 297 PHE A CB  1 
ATOM   2370 C CG  . PHE A 1 299 ? 12.983  10.879  52.667 1.00 17.20 ? 297 PHE A CG  1 
ATOM   2371 C CD1 . PHE A 1 299 ? 13.738  10.575  53.800 1.00 15.91 ? 297 PHE A CD1 1 
ATOM   2372 C CD2 . PHE A 1 299 ? 13.417  10.414  51.434 1.00 17.02 ? 297 PHE A CD2 1 
ATOM   2373 C CE1 . PHE A 1 299 ? 14.900  9.814   53.699 1.00 18.19 ? 297 PHE A CE1 1 
ATOM   2374 C CE2 . PHE A 1 299 ? 14.578  9.656   51.327 1.00 17.15 ? 297 PHE A CE2 1 
ATOM   2375 C CZ  . PHE A 1 299 ? 15.320  9.355   52.462 1.00 19.15 ? 297 PHE A CZ  1 
ATOM   2376 N N   . PRO A 1 300 ? 10.983  9.154   54.881 1.00 20.72 ? 298 PRO A N   1 
ATOM   2377 C CA  . PRO A 1 300 ? 11.529  8.127   53.977 1.00 20.40 ? 298 PRO A CA  1 
ATOM   2378 C C   . PRO A 1 300 ? 10.363  7.358   53.361 1.00 19.82 ? 298 PRO A C   1 
ATOM   2379 O O   . PRO A 1 300 ? 9.223   7.826   53.392 1.00 22.16 ? 298 PRO A O   1 
ATOM   2380 C CB  . PRO A 1 300 ? 12.307  7.247   54.952 1.00 20.79 ? 298 PRO A CB  1 
ATOM   2381 C CG  . PRO A 1 300 ? 11.380  7.218   56.134 1.00 21.74 ? 298 PRO A CG  1 
ATOM   2382 C CD  . PRO A 1 300 ? 10.965  8.678   56.265 1.00 22.18 ? 298 PRO A CD  1 
ATOM   2383 N N   . CYS A 1 301 ? 10.637  6.181   52.805 1.00 20.61 ? 299 CYS A N   1 
ATOM   2384 C CA  . CYS A 1 301 ? 9.567   5.374   52.224 1.00 21.64 ? 299 CYS A CA  1 
ATOM   2385 C C   . CYS A 1 301 ? 8.503   5.140   53.280 1.00 23.93 ? 299 CYS A C   1 
ATOM   2386 O O   . CYS A 1 301 ? 8.806   5.097   54.480 1.00 23.71 ? 299 CYS A O   1 
ATOM   2387 C CB  . CYS A 1 301 ? 10.102  4.021   51.756 1.00 19.22 ? 299 CYS A CB  1 
ATOM   2388 S SG  . CYS A 1 301 ? 11.278  4.182   50.401 1.00 19.97 ? 299 CYS A SG  1 
ATOM   2389 N N   . PRO A 1 302 ? 7.233   5.070   52.862 1.00 24.45 ? 300 PRO A N   1 
ATOM   2390 C CA  . PRO A 1 302 ? 6.152   4.840   53.819 1.00 26.59 ? 300 PRO A CA  1 
ATOM   2391 C C   . PRO A 1 302 ? 6.252   3.409   54.347 1.00 25.84 ? 300 PRO A C   1 
ATOM   2392 O O   . PRO A 1 302 ? 7.078   2.629   53.874 1.00 24.72 ? 300 PRO A O   1 
ATOM   2393 C CB  . PRO A 1 302 ? 4.898   5.053   52.970 1.00 25.92 ? 300 PRO A CB  1 
ATOM   2394 C CG  . PRO A 1 302 ? 5.336   4.629   51.604 1.00 26.01 ? 300 PRO A CG  1 
ATOM   2395 C CD  . PRO A 1 302 ? 6.704   5.243   51.496 1.00 27.44 ? 300 PRO A CD  1 
ATOM   2396 N N   . GLU A 1 303 ? 5.401   3.064   55.307 1.00 29.03 ? 301 GLU A N   1 
ATOM   2397 C CA  . GLU A 1 303 ? 5.404   1.728   55.899 1.00 32.89 ? 301 GLU A CA  1 
ATOM   2398 C C   . GLU A 1 303 ? 5.226   0.592   54.890 1.00 32.79 ? 301 GLU A C   1 
ATOM   2399 O O   . GLU A 1 303 ? 5.728   -0.510  55.098 1.00 32.77 ? 301 GLU A O   1 
ATOM   2400 C CB  . GLU A 1 303 ? 4.335   1.622   56.986 1.00 35.97 ? 301 GLU A CB  1 
ATOM   2401 C CG  . GLU A 1 303 ? 4.577   2.509   58.191 1.00 39.91 ? 301 GLU A CG  1 
ATOM   2402 C CD  . GLU A 1 303 ? 3.581   2.259   59.307 1.00 42.30 ? 301 GLU A CD  1 
ATOM   2403 O OE1 . GLU A 1 303 ? 2.358   2.252   59.040 1.00 43.35 ? 301 GLU A OE1 1 
ATOM   2404 O OE2 . GLU A 1 303 ? 4.026   2.068   60.457 1.00 43.95 ? 301 GLU A OE2 1 
ATOM   2405 N N   . GLU A 1 304 ? 4.546   0.873   53.782 1.00 33.39 ? 302 GLU A N   1 
ATOM   2406 C CA  . GLU A 1 304 ? 4.318   -0.142  52.757 1.00 32.40 ? 302 GLU A CA  1 
ATOM   2407 C C   . GLU A 1 304 ? 5.534   -0.266  51.846 1.00 31.08 ? 302 GLU A C   1 
ATOM   2408 O O   . GLU A 1 304 ? 5.527   -1.058  50.909 1.00 32.24 ? 302 GLU A O   1 
ATOM   2409 C CB  . GLU A 1 304 ? 3.094   0.201   51.897 1.00 34.77 ? 302 GLU A CB  1 
ATOM   2410 C CG  . GLU A 1 304 ? 1.924   0.830   52.633 1.00 37.31 ? 302 GLU A CG  1 
ATOM   2411 C CD  . GLU A 1 304 ? 2.119   2.316   52.881 1.00 38.61 ? 302 GLU A CD  1 
ATOM   2412 O OE1 . GLU A 1 304 ? 2.121   3.093   51.900 1.00 39.74 ? 302 GLU A OE1 1 
ATOM   2413 O OE2 . GLU A 1 304 ? 2.278   2.705   54.056 1.00 38.29 ? 302 GLU A OE2 1 
ATOM   2414 N N   . GLY A 1 305 ? 6.581   0.500   52.133 1.00 26.31 ? 303 GLY A N   1 
ATOM   2415 C CA  . GLY A 1 305 ? 7.770   0.472   51.305 1.00 21.68 ? 303 GLY A CA  1 
ATOM   2416 C C   . GLY A 1 305 ? 7.591   1.429   50.132 1.00 18.11 ? 303 GLY A C   1 
ATOM   2417 O O   . GLY A 1 305 ? 6.539   2.045   49.983 1.00 19.47 ? 303 GLY A O   1 
ATOM   2418 N N   . CYS A 1 306 ? 8.642   1.621   49.352 1.00 17.34 ? 304 CYS A N   1 
ATOM   2419 C CA  . CYS A 1 306 ? 8.553   2.497   48.185 1.00 17.33 ? 304 CYS A CA  1 
ATOM   2420 C C   . CYS A 1 306 ? 8.381   1.668   46.940 1.00 16.78 ? 304 CYS A C   1 
ATOM   2421 O O   . CYS A 1 306 ? 9.029   0.628   46.796 1.00 17.58 ? 304 CYS A O   1 
ATOM   2422 C CB  . CYS A 1 306 ? 9.843   3.277   47.958 1.00 18.63 ? 304 CYS A CB  1 
ATOM   2423 S SG  . CYS A 1 306 ? 10.091  4.820   48.874 1.00 17.29 ? 304 CYS A SG  1 
ATOM   2424 N N   . PRO A 1 307 ? 7.451   2.065   46.055 1.00 17.90 ? 305 PRO A N   1 
ATOM   2425 C CA  . PRO A 1 307 ? 7.305   1.283   44.824 1.00 17.71 ? 305 PRO A CA  1 
ATOM   2426 C C   . PRO A 1 307 ? 8.563   1.594   44.027 1.00 18.49 ? 305 PRO A C   1 
ATOM   2427 O O   . PRO A 1 307 ? 9.105   2.709   44.115 1.00 21.78 ? 305 PRO A O   1 
ATOM   2428 C CB  . PRO A 1 307 ? 6.054   1.888   44.167 1.00 17.47 ? 305 PRO A CB  1 
ATOM   2429 C CG  . PRO A 1 307 ? 5.946   3.266   44.749 1.00 18.73 ? 305 PRO A CG  1 
ATOM   2430 C CD  . PRO A 1 307 ? 6.361   3.044   46.199 1.00 17.02 ? 305 PRO A CD  1 
ATOM   2431 N N   . LYS A 1 308 ? 9.090   0.609   43.316 1.00 15.88 ? 306 LYS A N   1 
ATOM   2432 C CA  . LYS A 1 308 ? 10.283  0.834   42.534 1.00 15.27 ? 306 LYS A CA  1 
ATOM   2433 C C   . LYS A 1 308 ? 9.737   1.140   41.150 1.00 19.71 ? 306 LYS A C   1 
ATOM   2434 O O   . LYS A 1 308 ? 8.926   0.378   40.615 1.00 17.53 ? 306 LYS A O   1 
ATOM   2435 C CB  . LYS A 1 308 ? 11.180  -0.409  42.532 1.00 20.96 ? 306 LYS A CB  1 
ATOM   2436 C CG  . LYS A 1 308 ? 11.721  -0.755  43.924 1.00 23.45 ? 306 LYS A CG  1 
ATOM   2437 C CD  . LYS A 1 308 ? 12.621  -1.986  43.916 1.00 27.40 ? 306 LYS A CD  1 
ATOM   2438 C CE  . LYS A 1 308 ? 12.996  -2.404  45.338 1.00 28.96 ? 306 LYS A CE  1 
ATOM   2439 N NZ  . LYS A 1 308 ? 13.799  -3.666  45.363 1.00 30.14 ? 306 LYS A NZ  1 
ATOM   2440 N N   . MET A 1 309 ? 10.096  2.293   40.608 1.00 15.98 ? 307 MET A N   1 
ATOM   2441 C CA  . MET A 1 309 ? 9.575   2.653   39.296 1.00 16.57 ? 307 MET A CA  1 
ATOM   2442 C C   . MET A 1 309 ? 10.078  1.692   38.233 1.00 14.51 ? 307 MET A C   1 
ATOM   2443 O O   . MET A 1 309 ? 11.235  1.270   38.243 1.00 16.20 ? 307 MET A O   1 
ATOM   2444 C CB  . MET A 1 309 ? 9.969   4.076   38.913 1.00 16.03 ? 307 MET A CB  1 
ATOM   2445 C CG  . MET A 1 309 ? 9.257   4.580   37.644 1.00 13.71 ? 307 MET A CG  1 
ATOM   2446 S SD  . MET A 1 309 ? 9.730   6.253   37.212 1.00 14.04 ? 307 MET A SD  1 
ATOM   2447 C CE  . MET A 1 309 ? 11.228  6.014   36.497 1.00 6.10  ? 307 MET A CE  1 
ATOM   2448 N N   . GLY A 1 310 ? 9.206   1.362   37.298 1.00 15.50 ? 308 GLY A N   1 
ATOM   2449 C CA  . GLY A 1 310 ? 9.619   0.482   36.238 1.00 12.78 ? 308 GLY A CA  1 
ATOM   2450 C C   . GLY A 1 310 ? 9.249   -0.978  36.415 1.00 9.77  ? 308 GLY A C   1 
ATOM   2451 O O   . GLY A 1 310 ? 8.206   -1.332  36.961 1.00 10.20 ? 308 GLY A O   1 
ATOM   2452 N N   . HIS A 1 311 ? 10.155  -1.814  35.942 1.00 12.61 ? 309 HIS A N   1 
ATOM   2453 C CA  . HIS A 1 311 ? 9.987   -3.255  35.932 1.00 15.66 ? 309 HIS A CA  1 
ATOM   2454 C C   . HIS A 1 311 ? 9.447   -3.875  37.216 1.00 15.11 ? 309 HIS A C   1 
ATOM   2455 O O   . HIS A 1 311 ? 8.454   -4.609  37.183 1.00 14.88 ? 309 HIS A O   1 
ATOM   2456 C CB  . HIS A 1 311 ? 11.309  -3.903  35.515 1.00 14.87 ? 309 HIS A CB  1 
ATOM   2457 C CG  . HIS A 1 311 ? 11.163  -5.310  35.016 1.00 16.33 ? 309 HIS A CG  1 
ATOM   2458 N ND1 . HIS A 1 311 ? 10.399  -5.633  33.914 1.00 17.31 ? 309 HIS A ND1 1 
ATOM   2459 C CD2 . HIS A 1 311 ? 11.663  -6.477  35.484 1.00 17.55 ? 309 HIS A CD2 1 
ATOM   2460 C CE1 . HIS A 1 311 ? 10.431  -6.943  33.730 1.00 18.18 ? 309 HIS A CE1 1 
ATOM   2461 N NE2 . HIS A 1 311 ? 11.190  -7.477  34.669 1.00 18.12 ? 309 HIS A NE2 1 
ATOM   2462 N N   . TYR A 1 312 ? 10.043  -3.520  38.352 1.00 17.62 ? 310 TYR A N   1 
ATOM   2463 C CA  . TYR A 1 312 ? 9.633   -4.090  39.636 1.00 16.69 ? 310 TYR A CA  1 
ATOM   2464 C C   . TYR A 1 312 ? 8.526   -3.383  40.407 1.00 16.35 ? 310 TYR A C   1 
ATOM   2465 O O   . TYR A 1 312 ? 8.331   -3.643  41.605 1.00 12.90 ? 310 TYR A O   1 
ATOM   2466 C CB  . TYR A 1 312 ? 10.864  -4.288  40.529 1.00 20.19 ? 310 TYR A CB  1 
ATOM   2467 C CG  . TYR A 1 312 ? 11.883  -5.227  39.927 1.00 20.53 ? 310 TYR A CG  1 
ATOM   2468 C CD1 . TYR A 1 312 ? 12.744  -4.795  38.926 1.00 22.66 ? 310 TYR A CD1 1 
ATOM   2469 C CD2 . TYR A 1 312 ? 11.972  -6.558  40.344 1.00 24.52 ? 310 TYR A CD2 1 
ATOM   2470 C CE1 . TYR A 1 312 ? 13.664  -5.649  38.350 1.00 23.38 ? 310 TYR A CE1 1 
ATOM   2471 C CE2 . TYR A 1 312 ? 12.895  -7.430  39.768 1.00 24.92 ? 310 TYR A CE2 1 
ATOM   2472 C CZ  . TYR A 1 312 ? 13.738  -6.964  38.771 1.00 25.75 ? 310 TYR A CZ  1 
ATOM   2473 O OH  . TYR A 1 312 ? 14.661  -7.800  38.182 1.00 27.59 ? 310 TYR A OH  1 
ATOM   2474 N N   . ALA A 1 313 ? 7.783   -2.502  39.743 1.00 14.17 ? 311 ALA A N   1 
ATOM   2475 C CA  . ALA A 1 313 ? 6.684   -1.809  40.414 1.00 10.87 ? 311 ALA A CA  1 
ATOM   2476 C C   . ALA A 1 313 ? 5.628   -2.783  40.898 1.00 9.89  ? 311 ALA A C   1 
ATOM   2477 O O   . ALA A 1 313 ? 4.859   -2.478  41.812 1.00 12.96 ? 311 ALA A O   1 
ATOM   2478 C CB  . ALA A 1 313 ? 6.044   -0.777  39.488 1.00 14.48 ? 311 ALA A CB  1 
ATOM   2479 N N   . ASP A 1 314 ? 5.543   -3.953  40.264 1.00 13.17 ? 312 ASP A N   1 
ATOM   2480 C CA  . ASP A 1 314 ? 4.532   -4.919  40.675 1.00 14.04 ? 312 ASP A CA  1 
ATOM   2481 C C   . ASP A 1 314 ? 4.784   -5.486  42.077 1.00 16.64 ? 312 ASP A C   1 
ATOM   2482 O O   . ASP A 1 314 ? 3.908   -6.101  42.666 1.00 13.55 ? 312 ASP A O   1 
ATOM   2483 C CB  . ASP A 1 314 ? 4.361   -6.043  39.635 1.00 17.32 ? 312 ASP A CB  1 
ATOM   2484 C CG  . ASP A 1 314 ? 5.619   -6.876  39.427 1.00 17.75 ? 312 ASP A CG  1 
ATOM   2485 O OD1 . ASP A 1 314 ? 6.737   -6.446  39.786 1.00 17.72 ? 312 ASP A OD1 1 
ATOM   2486 O OD2 . ASP A 1 314 ? 5.487   -7.979  38.848 1.00 18.32 ? 312 ASP A OD2 1 
ATOM   2487 N N   . GLN A 1 315 ? 5.979   -5.260  42.605 1.00 16.36 ? 313 GLN A N   1 
ATOM   2488 C CA  . GLN A 1 315 ? 6.302   -5.744  43.949 1.00 20.14 ? 313 GLN A CA  1 
ATOM   2489 C C   . GLN A 1 315 ? 5.737   -4.828  45.046 1.00 20.06 ? 313 GLN A C   1 
ATOM   2490 O O   . GLN A 1 315 ? 5.714   -5.199  46.231 1.00 20.21 ? 313 GLN A O   1 
ATOM   2491 C CB  . GLN A 1 315 ? 7.815   -5.862  44.117 1.00 19.83 ? 313 GLN A CB  1 
ATOM   2492 C CG  . GLN A 1 315 ? 8.454   -6.949  43.274 1.00 21.66 ? 313 GLN A CG  1 
ATOM   2493 C CD  . GLN A 1 315 ? 9.964   -7.063  43.465 1.00 22.90 ? 313 GLN A CD  1 
ATOM   2494 O OE1 . GLN A 1 315 ? 10.593  -7.976  42.925 1.00 25.46 ? 313 GLN A OE1 1 
ATOM   2495 N NE2 . GLN A 1 315 ? 10.553  -6.135  44.214 1.00 21.27 ? 313 GLN A NE2 1 
ATOM   2496 N N   . PHE A 1 316 ? 5.305   -3.626  44.666 1.00 19.08 ? 314 PHE A N   1 
ATOM   2497 C CA  . PHE A 1 316 ? 4.774   -2.681  45.642 1.00 18.99 ? 314 PHE A CA  1 
ATOM   2498 C C   . PHE A 1 316 ? 3.527   -3.171  46.357 1.00 20.27 ? 314 PHE A C   1 
ATOM   2499 O O   . PHE A 1 316 ? 2.496   -3.435  45.741 1.00 21.83 ? 314 PHE A O   1 
ATOM   2500 C CB  . PHE A 1 316 ? 4.507   -1.308  45.001 1.00 17.01 ? 314 PHE A CB  1 
ATOM   2501 C CG  . PHE A 1 316 ? 4.005   -0.270  45.972 1.00 17.37 ? 314 PHE A CG  1 
ATOM   2502 C CD1 . PHE A 1 316 ? 4.666   -0.052  47.182 1.00 19.79 ? 314 PHE A CD1 1 
ATOM   2503 C CD2 . PHE A 1 316 ? 2.861   0.476   45.694 1.00 18.18 ? 314 PHE A CD2 1 
ATOM   2504 C CE1 . PHE A 1 316 ? 4.197   0.894   48.096 1.00 18.59 ? 314 PHE A CE1 1 
ATOM   2505 C CE2 . PHE A 1 316 ? 2.382   1.427   46.600 1.00 18.54 ? 314 PHE A CE2 1 
ATOM   2506 C CZ  . PHE A 1 316 ? 3.052   1.631   47.808 1.00 20.11 ? 314 PHE A CZ  1 
ATOM   2507 N N   . GLU A 1 317 ? 3.618   -3.217  47.684 1.00 19.89 ? 315 GLU A N   1 
ATOM   2508 C CA  . GLU A 1 317 ? 2.533   -3.649  48.555 1.00 20.93 ? 315 GLU A CA  1 
ATOM   2509 C C   . GLU A 1 317 ? 1.190   -2.934  48.310 1.00 21.99 ? 315 GLU A C   1 
ATOM   2510 O O   . GLU A 1 317 ? 0.141   -3.576  48.216 1.00 20.79 ? 315 GLU A O   1 
ATOM   2511 C CB  . GLU A 1 317 ? 2.989   -3.453  50.007 1.00 21.80 ? 315 GLU A CB  1 
ATOM   2512 C CG  . GLU A 1 317 ? 2.086   -4.021  51.071 1.00 23.42 ? 315 GLU A CG  1 
ATOM   2513 C CD  . GLU A 1 317 ? 2.721   -3.908  52.454 1.00 22.61 ? 315 GLU A CD  1 
ATOM   2514 O OE1 . GLU A 1 317 ? 3.883   -4.338  52.618 1.00 22.42 ? 315 GLU A OE1 1 
ATOM   2515 O OE2 . GLU A 1 317 ? 2.070   -3.359  53.355 1.00 20.35 ? 315 GLU A OE2 1 
ATOM   2516 N N   . GLY A 1 318 ? 1.213   -1.610  48.199 1.00 19.46 ? 316 GLY A N   1 
ATOM   2517 C CA  . GLY A 1 318 ? -0.027  -0.885  47.978 1.00 21.05 ? 316 GLY A CA  1 
ATOM   2518 C C   . GLY A 1 318 ? -0.317  -0.551  46.525 1.00 21.53 ? 316 GLY A C   1 
ATOM   2519 O O   . GLY A 1 318 ? -1.067  0.383   46.237 1.00 22.61 ? 316 GLY A O   1 
ATOM   2520 N N   . LYS A 1 319 ? 0.208   -1.352  45.610 1.00 21.41 ? 317 LYS A N   1 
ATOM   2521 C CA  . LYS A 1 319 ? 0.026   -1.092  44.184 1.00 20.42 ? 317 LYS A CA  1 
ATOM   2522 C C   . LYS A 1 319 ? -1.403  -0.876  43.682 1.00 19.64 ? 317 LYS A C   1 
ATOM   2523 O O   . LYS A 1 319 ? -1.611  -0.075  42.777 1.00 20.30 ? 317 LYS A O   1 
ATOM   2524 C CB  . LYS A 1 319 ? 0.754   -2.142  43.344 1.00 20.84 ? 317 LYS A CB  1 
ATOM   2525 C CG  . LYS A 1 319 ? 0.209   -3.552  43.446 1.00 21.37 ? 317 LYS A CG  1 
ATOM   2526 C CD  . LYS A 1 319 ? 1.073   -4.495  42.628 1.00 21.73 ? 317 LYS A CD  1 
ATOM   2527 C CE  . LYS A 1 319 ? 0.475   -5.896  42.610 1.00 23.60 ? 317 LYS A CE  1 
ATOM   2528 N NZ  . LYS A 1 319 ? 1.389   -6.847  41.939 1.00 25.87 ? 317 LYS A NZ  1 
ATOM   2529 N N   . THR A 1 320 ? -2.382  -1.575  44.251 1.00 16.70 ? 318 THR A N   1 
ATOM   2530 C CA  . THR A 1 320 ? -3.768  -1.405  43.821 1.00 19.67 ? 318 THR A CA  1 
ATOM   2531 C C   . THR A 1 320 ? -4.704  -0.988  44.951 1.00 20.38 ? 318 THR A C   1 
ATOM   2532 O O   . THR A 1 320 ? -5.927  -1.102  44.828 1.00 22.52 ? 318 THR A O   1 
ATOM   2533 C CB  . THR A 1 320 ? -4.336  -2.683  43.138 1.00 19.26 ? 318 THR A CB  1 
ATOM   2534 O OG1 . THR A 1 320 ? -4.207  -3.803  44.020 1.00 20.29 ? 318 THR A OG1 1 
ATOM   2535 C CG2 . THR A 1 320 ? -3.596  -2.977  41.848 1.00 19.53 ? 318 THR A CG2 1 
ATOM   2536 N N   . ALA A 1 321 ? -4.139  -0.452  46.032 1.00 23.00 ? 319 ALA A N   1 
ATOM   2537 C CA  . ALA A 1 321 ? -4.947  -0.025  47.171 1.00 23.51 ? 319 ALA A CA  1 
ATOM   2538 C C   . ALA A 1 321 ? -5.922  1.084   46.754 1.00 22.95 ? 319 ALA A C   1 
ATOM   2539 O O   . ALA A 1 321 ? -7.041  1.155   47.260 1.00 23.46 ? 319 ALA A O   1 
ATOM   2540 C CB  . ALA A 1 321 ? -4.047  0.436   48.316 1.00 23.52 ? 319 ALA A CB  1 
ATOM   2541 N N   . THR A 1 322 ? -5.483  1.936   45.831 1.00 23.43 ? 320 THR A N   1 
ATOM   2542 C CA  . THR A 1 322 ? -6.288  3.031   45.290 1.00 22.89 ? 320 THR A CA  1 
ATOM   2543 C C   . THR A 1 322 ? -5.791  3.289   43.864 1.00 21.78 ? 320 THR A C   1 
ATOM   2544 O O   . THR A 1 322 ? -4.901  2.589   43.374 1.00 19.93 ? 320 THR A O   1 
ATOM   2545 C CB  . THR A 1 322 ? -6.136  4.350   46.116 1.00 23.94 ? 320 THR A CB  1 
ATOM   2546 O OG1 . THR A 1 322 ? -4.748  4.659   46.292 1.00 23.34 ? 320 THR A OG1 1 
ATOM   2547 C CG2 . THR A 1 322 ? -6.791  4.228   47.473 1.00 24.96 ? 320 THR A CG2 1 
ATOM   2548 N N   . VAL A 1 323 ? -6.383  4.264   43.181 1.00 21.04 ? 321 VAL A N   1 
ATOM   2549 C CA  . VAL A 1 323 ? -5.960  4.587   41.822 1.00 18.74 ? 321 VAL A CA  1 
ATOM   2550 C C   . VAL A 1 323 ? -5.345  5.981   41.785 1.00 16.66 ? 321 VAL A C   1 
ATOM   2551 O O   . VAL A 1 323 ? -5.536  6.787   42.709 1.00 17.25 ? 321 VAL A O   1 
ATOM   2552 C CB  . VAL A 1 323 ? -7.146  4.535   40.789 1.00 21.01 ? 321 VAL A CB  1 
ATOM   2553 C CG1 . VAL A 1 323 ? -7.794  3.150   40.769 1.00 20.92 ? 321 VAL A CG1 1 
ATOM   2554 C CG2 . VAL A 1 323 ? -8.182  5.620   41.077 1.00 18.16 ? 321 VAL A CG2 1 
ATOM   2555 N N   . GLU A 1 324 ? -4.543  6.230   40.758 1.00 16.68 ? 322 GLU A N   1 
ATOM   2556 C CA  . GLU A 1 324 ? -3.925  7.532   40.549 1.00 17.53 ? 322 GLU A CA  1 
ATOM   2557 C C   . GLU A 1 324 ? -2.996  7.965   41.689 1.00 17.98 ? 322 GLU A C   1 
ATOM   2558 O O   . GLU A 1 324 ? -2.933  9.148   42.048 1.00 15.09 ? 322 GLU A O   1 
ATOM   2559 C CB  . GLU A 1 324 ? -5.022  8.577   40.320 1.00 19.44 ? 322 GLU A CB  1 
ATOM   2560 C CG  . GLU A 1 324 ? -6.017  8.192   39.214 1.00 21.61 ? 322 GLU A CG  1 
ATOM   2561 C CD  . GLU A 1 324 ? -7.066  9.261   38.963 1.00 25.41 ? 322 GLU A CD  1 
ATOM   2562 O OE1 . GLU A 1 324 ? -6.754  10.456  39.114 1.00 27.93 ? 322 GLU A OE1 1 
ATOM   2563 O OE2 . GLU A 1 324 ? -8.206  8.911   38.610 1.00 27.00 ? 322 GLU A OE2 1 
ATOM   2564 N N   . GLN A 1 325 ? -2.287  7.004   42.271 1.00 15.25 ? 323 GLN A N   1 
ATOM   2565 C CA  . GLN A 1 325 ? -1.365  7.315   43.355 1.00 14.65 ? 323 GLN A CA  1 
ATOM   2566 C C   . GLN A 1 325 ? -0.169  8.029   42.738 1.00 13.72 ? 323 GLN A C   1 
ATOM   2567 O O   . GLN A 1 325 ? 0.473   7.499   41.840 1.00 14.97 ? 323 GLN A O   1 
ATOM   2568 C CB  . GLN A 1 325 ? -0.927  6.015   44.050 1.00 16.42 ? 323 GLN A CB  1 
ATOM   2569 C CG  . GLN A 1 325 ? -2.089  5.214   44.615 1.00 18.79 ? 323 GLN A CG  1 
ATOM   2570 C CD  . GLN A 1 325 ? -1.670  3.848   45.136 1.00 23.62 ? 323 GLN A CD  1 
ATOM   2571 O OE1 . GLN A 1 325 ? -2.199  2.816   44.713 1.00 23.47 ? 323 GLN A OE1 1 
ATOM   2572 N NE2 . GLN A 1 325 ? -0.721  3.835   46.062 1.00 21.84 ? 323 GLN A NE2 1 
ATOM   2573 N N   . THR A 1 326 ? 0.090   9.268   43.163 1.00 13.61 ? 324 THR A N   1 
ATOM   2574 C CA  . THR A 1 326 ? 1.215   10.030  42.628 1.00 13.27 ? 324 THR A CA  1 
ATOM   2575 C C   . THR A 1 326 ? 2.513   9.662   43.320 1.00 15.03 ? 324 THR A C   1 
ATOM   2576 O O   . THR A 1 326 ? 2.631   9.741   44.547 1.00 17.84 ? 324 THR A O   1 
ATOM   2577 C CB  . THR A 1 326 ? 0.972   11.539  42.730 1.00 13.55 ? 324 THR A CB  1 
ATOM   2578 O OG1 . THR A 1 326 ? 0.441   11.852  44.025 1.00 13.97 ? 324 THR A OG1 1 
ATOM   2579 C CG2 . THR A 1 326 ? -0.023  11.966  41.675 1.00 16.32 ? 324 THR A CG2 1 
ATOM   2580 N N   . VAL A 1 327 ? 3.492   9.272   42.521 1.00 13.15 ? 325 VAL A N   1 
ATOM   2581 C CA  . VAL A 1 327 ? 4.772   8.839   43.041 1.00 15.04 ? 325 VAL A CA  1 
ATOM   2582 C C   . VAL A 1 327 ? 5.888   9.658   42.399 1.00 16.35 ? 325 VAL A C   1 
ATOM   2583 O O   . VAL A 1 327 ? 5.960   9.796   41.168 1.00 16.20 ? 325 VAL A O   1 
ATOM   2584 C CB  . VAL A 1 327 ? 4.949   7.310   42.796 1.00 13.36 ? 325 VAL A CB  1 
ATOM   2585 C CG1 . VAL A 1 327 ? 6.278   6.815   43.353 1.00 14.99 ? 325 VAL A CG1 1 
ATOM   2586 C CG2 . VAL A 1 327 ? 3.791   6.544   43.433 1.00 16.16 ? 325 VAL A CG2 1 
ATOM   2587 N N   . TYR A 1 328 ? 6.768   10.203  43.237 1.00 14.89 ? 326 TYR A N   1 
ATOM   2588 C CA  . TYR A 1 328 ? 7.859   11.038  42.751 1.00 15.86 ? 326 TYR A CA  1 
ATOM   2589 C C   . TYR A 1 328 ? 9.253   10.545  43.100 1.00 15.56 ? 326 TYR A C   1 
ATOM   2590 O O   . TYR A 1 328 ? 9.456   9.776   44.058 1.00 13.37 ? 326 TYR A O   1 
ATOM   2591 C CB  . TYR A 1 328 ? 7.673   12.480  43.249 1.00 16.45 ? 326 TYR A CB  1 
ATOM   2592 C CG  . TYR A 1 328 ? 6.306   13.045  42.955 1.00 15.37 ? 326 TYR A CG  1 
ATOM   2593 C CD1 . TYR A 1 328 ? 6.029   13.655  41.728 1.00 17.08 ? 326 TYR A CD1 1 
ATOM   2594 C CD2 . TYR A 1 328 ? 5.283   12.957  43.892 1.00 15.52 ? 326 TYR A CD2 1 
ATOM   2595 C CE1 . TYR A 1 328 ? 4.757   14.158  41.450 1.00 15.96 ? 326 TYR A CE1 1 
ATOM   2596 C CE2 . TYR A 1 328 ? 4.014   13.455  43.625 1.00 15.82 ? 326 TYR A CE2 1 
ATOM   2597 C CZ  . TYR A 1 328 ? 3.764   14.055  42.397 1.00 15.22 ? 326 TYR A CZ  1 
ATOM   2598 O OH  . TYR A 1 328 ? 2.511   14.554  42.136 1.00 19.20 ? 326 TYR A OH  1 
ATOM   2599 N N   . LEU A 1 329 ? 10.200  10.963  42.279 1.00 15.10 ? 327 LEU A N   1 
ATOM   2600 C CA  . LEU A 1 329 ? 11.607  10.615  42.422 1.00 18.00 ? 327 LEU A CA  1 
ATOM   2601 C C   . LEU A 1 329 ? 12.370  11.414  41.373 1.00 19.11 ? 327 LEU A C   1 
ATOM   2602 O O   . LEU A 1 329 ? 11.772  11.912  40.417 1.00 19.41 ? 327 LEU A O   1 
ATOM   2603 C CB  . LEU A 1 329 ? 11.829  9.116   42.163 1.00 16.52 ? 327 LEU A CB  1 
ATOM   2604 C CG  . LEU A 1 329 ? 11.528  8.560   40.762 1.00 17.41 ? 327 LEU A CG  1 
ATOM   2605 C CD1 . LEU A 1 329 ? 12.188  7.198   40.583 1.00 15.57 ? 327 LEU A CD1 1 
ATOM   2606 C CD2 . LEU A 1 329 ? 10.017  8.471   40.535 1.00 14.31 ? 327 LEU A CD2 1 
ATOM   2607 N N   . ASN A 1 330 ? 13.675  11.561  41.559 1.00 17.92 ? 328 ASN A N   1 
ATOM   2608 C CA  . ASN A 1 330 ? 14.516  12.268  40.598 1.00 17.57 ? 328 ASN A CA  1 
ATOM   2609 C C   . ASN A 1 330 ? 15.520  11.273  40.043 1.00 17.40 ? 328 ASN A C   1 
ATOM   2610 O O   . ASN A 1 330 ? 15.854  10.287  40.719 1.00 19.98 ? 328 ASN A O   1 
ATOM   2611 C CB  . ASN A 1 330 ? 15.215  13.463  41.256 1.00 18.30 ? 328 ASN A CB  1 
ATOM   2612 C CG  . ASN A 1 330 ? 14.228  14.523  41.712 1.00 18.63 ? 328 ASN A CG  1 
ATOM   2613 O OD1 . ASN A 1 330 ? 14.363  15.109  42.793 1.00 21.59 ? 328 ASN A OD1 1 
ATOM   2614 N ND2 . ASN A 1 330 ? 13.211  14.761  40.897 1.00 15.93 ? 328 ASN A ND2 1 
ATOM   2615 N N   . THR A 1 331 ? 15.975  11.499  38.813 1.00 15.62 ? 329 THR A N   1 
ATOM   2616 C CA  . THR A 1 331 ? 16.925  10.607  38.166 1.00 16.01 ? 329 THR A CA  1 
ATOM   2617 C C   . THR A 1 331 ? 18.138  11.361  37.644 1.00 16.61 ? 329 THR A C   1 
ATOM   2618 O O   . THR A 1 331 ? 18.180  12.598  37.664 1.00 18.01 ? 329 THR A O   1 
ATOM   2619 C CB  . THR A 1 331 ? 16.275  9.906   36.942 1.00 16.45 ? 329 THR A CB  1 
ATOM   2620 O OG1 . THR A 1 331 ? 15.983  10.889  35.940 1.00 18.02 ? 329 THR A OG1 1 
ATOM   2621 C CG2 . THR A 1 331 ? 14.987  9.221   37.327 1.00 14.58 ? 329 THR A CG2 1 
ATOM   2622 N N   . GLY A 1 332 ? 19.113  10.597  37.163 1.00 15.84 ? 330 GLY A N   1 
ATOM   2623 C CA  . GLY A 1 332 ? 20.316  11.154  36.586 1.00 18.27 ? 330 GLY A CA  1 
ATOM   2624 C C   . GLY A 1 332 ? 20.011  11.600  35.170 1.00 20.43 ? 330 GLY A C   1 
ATOM   2625 O O   . GLY A 1 332 ? 18.926  11.323  34.658 1.00 18.79 ? 330 GLY A O   1 
ATOM   2626 N N   . ASP A 1 333 ? 20.974  12.246  34.524 1.00 22.76 ? 331 ASP A N   1 
ATOM   2627 C CA  . ASP A 1 333 ? 20.790  12.743  33.161 1.00 25.75 ? 331 ASP A CA  1 
ATOM   2628 C C   . ASP A 1 333 ? 21.343  11.845  32.048 1.00 25.57 ? 331 ASP A C   1 
ATOM   2629 O O   . ASP A 1 333 ? 21.227  12.178  30.871 1.00 25.09 ? 331 ASP A O   1 
ATOM   2630 C CB  . ASP A 1 333 ? 21.387  14.155  33.041 1.00 26.96 ? 331 ASP A CB  1 
ATOM   2631 C CG  . ASP A 1 333 ? 22.917  14.164  33.053 1.00 28.58 ? 331 ASP A CG  1 
ATOM   2632 O OD1 . ASP A 1 333 ? 23.550  13.225  33.583 1.00 30.43 ? 331 ASP A OD1 1 
ATOM   2633 O OD2 . ASP A 1 333 ? 23.489  15.132  32.515 1.00 29.90 ? 331 ASP A OD2 1 
ATOM   2634 N N   . SER A 1 334 ? 21.950  10.720  32.417 1.00 26.68 ? 332 SER A N   1 
ATOM   2635 C CA  . SER A 1 334 ? 22.532  9.803   31.439 1.00 26.84 ? 332 SER A CA  1 
ATOM   2636 C C   . SER A 1 334 ? 22.892  8.463   32.076 1.00 26.24 ? 332 SER A C   1 
ATOM   2637 O O   . SER A 1 334 ? 22.681  8.254   33.276 1.00 25.18 ? 332 SER A O   1 
ATOM   2638 C CB  . SER A 1 334 ? 23.792  10.427  30.835 1.00 29.52 ? 332 SER A CB  1 
ATOM   2639 O OG  . SER A 1 334 ? 24.699  10.801  31.860 1.00 28.90 ? 332 SER A OG  1 
ATOM   2640 N N   . GLY A 1 335 ? 23.456  7.569   31.272 1.00 26.35 ? 333 GLY A N   1 
ATOM   2641 C CA  . GLY A 1 335 ? 23.840  6.261   31.764 1.00 27.57 ? 333 GLY A CA  1 
ATOM   2642 C C   . GLY A 1 335 ? 22.656  5.489   32.298 1.00 26.90 ? 333 GLY A C   1 
ATOM   2643 O O   . GLY A 1 335 ? 21.633  5.365   31.626 1.00 26.87 ? 333 GLY A O   1 
ATOM   2644 N N   . ASN A 1 336 ? 22.785  5.010   33.530 1.00 25.71 ? 334 ASN A N   1 
ATOM   2645 C CA  . ASN A 1 336 ? 21.740  4.237   34.194 1.00 23.98 ? 334 ASN A CA  1 
ATOM   2646 C C   . ASN A 1 336 ? 20.581  5.070   34.738 1.00 20.92 ? 334 ASN A C   1 
ATOM   2647 O O   . ASN A 1 336 ? 19.547  4.515   35.104 1.00 21.26 ? 334 ASN A O   1 
ATOM   2648 C CB  . ASN A 1 336 ? 22.340  3.409   35.340 1.00 28.50 ? 334 ASN A CB  1 
ATOM   2649 C CG  . ASN A 1 336 ? 23.159  2.222   34.850 1.00 31.03 ? 334 ASN A CG  1 
ATOM   2650 O OD1 . ASN A 1 336 ? 23.070  1.828   33.685 1.00 30.87 ? 334 ASN A OD1 1 
ATOM   2651 N ND2 . ASN A 1 336 ? 23.978  1.665   35.741 1.00 33.53 ? 334 ASN A ND2 1 
ATOM   2652 N N   . PHE A 1 337 ? 20.776  6.385   34.843 1.00 19.87 ? 335 PHE A N   1 
ATOM   2653 C CA  . PHE A 1 337 ? 19.763  7.312   35.361 1.00 16.92 ? 335 PHE A CA  1 
ATOM   2654 C C   . PHE A 1 337 ? 19.420  7.118   36.845 1.00 18.02 ? 335 PHE A C   1 
ATOM   2655 O O   . PHE A 1 337 ? 18.558  7.821   37.376 1.00 18.12 ? 335 PHE A O   1 
ATOM   2656 C CB  . PHE A 1 337 ? 18.451  7.205   34.567 1.00 18.19 ? 335 PHE A CB  1 
ATOM   2657 C CG  . PHE A 1 337 ? 18.621  7.302   33.072 1.00 19.48 ? 335 PHE A CG  1 
ATOM   2658 C CD1 . PHE A 1 337 ? 18.998  8.500   32.473 1.00 18.09 ? 335 PHE A CD1 1 
ATOM   2659 C CD2 . PHE A 1 337 ? 18.388  6.189   32.265 1.00 20.22 ? 335 PHE A CD2 1 
ATOM   2660 C CE1 . PHE A 1 337 ? 19.138  8.590   31.085 1.00 21.62 ? 335 PHE A CE1 1 
ATOM   2661 C CE2 . PHE A 1 337 ? 18.525  6.269   30.881 1.00 21.63 ? 335 PHE A CE2 1 
ATOM   2662 C CZ  . PHE A 1 337 ? 18.902  7.471   30.290 1.00 20.44 ? 335 PHE A CZ  1 
ATOM   2663 N N   . THR A 1 338 ? 20.098  6.194   37.515 1.00 17.87 ? 336 THR A N   1 
ATOM   2664 C CA  . THR A 1 338 ? 19.818  5.880   38.915 1.00 16.39 ? 336 THR A CA  1 
ATOM   2665 C C   . THR A 1 338 ? 20.196  6.951   39.946 1.00 15.28 ? 336 THR A C   1 
ATOM   2666 O O   . THR A 1 338 ? 21.143  7.706   39.747 1.00 13.77 ? 336 THR A O   1 
ATOM   2667 C CB  . THR A 1 338 ? 20.523  4.572   39.300 1.00 15.55 ? 336 THR A CB  1 
ATOM   2668 O OG1 . THR A 1 338 ? 21.891  4.646   38.883 1.00 16.52 ? 336 THR A OG1 1 
ATOM   2669 C CG2 . THR A 1 338 ? 19.876  3.385   38.605 1.00 18.04 ? 336 THR A CG2 1 
ATOM   2670 N N   . ARG A 1 339 ? 19.438  6.995   41.041 1.00 18.67 ? 337 ARG A N   1 
ATOM   2671 C CA  . ARG A 1 339 ? 19.667  7.929   42.151 1.00 18.41 ? 337 ARG A CA  1 
ATOM   2672 C C   . ARG A 1 339 ? 19.225  7.244   43.437 1.00 21.55 ? 337 ARG A C   1 
ATOM   2673 O O   . ARG A 1 339 ? 18.347  6.373   43.421 1.00 19.00 ? 337 ARG A O   1 
ATOM   2674 C CB  . ARG A 1 339 ? 18.839  9.215   42.000 1.00 16.76 ? 337 ARG A CB  1 
ATOM   2675 C CG  . ARG A 1 339 ? 19.381  10.246  41.017 1.00 14.82 ? 337 ARG A CG  1 
ATOM   2676 C CD  . ARG A 1 339 ? 20.805  10.636  41.345 1.00 17.67 ? 337 ARG A CD  1 
ATOM   2677 N NE  . ARG A 1 339 ? 21.352  11.648  40.444 1.00 15.23 ? 337 ARG A NE  1 
ATOM   2678 C CZ  . ARG A 1 339 ? 22.171  11.392  39.427 1.00 16.50 ? 337 ARG A CZ  1 
ATOM   2679 N NH1 . ARG A 1 339 ? 22.542  10.151  39.153 1.00 16.70 ? 337 ARG A NH1 1 
ATOM   2680 N NH2 . ARG A 1 339 ? 22.671  12.391  38.712 1.00 15.98 ? 337 ARG A NH2 1 
ATOM   2681 N N   . TRP A 1 340 ? 19.830  7.648   44.552 1.00 22.32 ? 338 TRP A N   1 
ATOM   2682 C CA  . TRP A 1 340 ? 19.497  7.109   45.865 1.00 20.40 ? 338 TRP A CA  1 
ATOM   2683 C C   . TRP A 1 340 ? 19.277  8.319   46.757 1.00 17.57 ? 338 TRP A C   1 
ATOM   2684 O O   . TRP A 1 340 ? 20.197  9.101   46.978 1.00 19.68 ? 338 TRP A O   1 
ATOM   2685 C CB  . TRP A 1 340 ? 20.633  6.220   46.381 1.00 21.30 ? 338 TRP A CB  1 
ATOM   2686 C CG  . TRP A 1 340 ? 20.722  4.908   45.647 1.00 21.28 ? 338 TRP A CG  1 
ATOM   2687 C CD1 . TRP A 1 340 ? 20.120  3.732   46.000 1.00 21.25 ? 338 TRP A CD1 1 
ATOM   2688 C CD2 . TRP A 1 340 ? 21.422  4.648   44.422 1.00 20.43 ? 338 TRP A CD2 1 
ATOM   2689 N NE1 . TRP A 1 340 ? 20.402  2.764   45.073 1.00 20.90 ? 338 TRP A NE1 1 
ATOM   2690 C CE2 . TRP A 1 340 ? 21.196  3.294   44.092 1.00 20.97 ? 338 TRP A CE2 1 
ATOM   2691 C CE3 . TRP A 1 340 ? 22.217  5.429   43.571 1.00 20.95 ? 338 TRP A CE3 1 
ATOM   2692 C CZ2 . TRP A 1 340 ? 21.736  2.701   42.947 1.00 21.68 ? 338 TRP A CZ2 1 
ATOM   2693 C CZ3 . TRP A 1 340 ? 22.757  4.836   42.427 1.00 22.65 ? 338 TRP A CZ3 1 
ATOM   2694 C CH2 . TRP A 1 340 ? 22.510  3.484   42.128 1.00 21.74 ? 338 TRP A CH2 1 
ATOM   2695 N N   . ARG A 1 341 ? 18.049  8.493   47.231 1.00 17.89 ? 339 ARG A N   1 
ATOM   2696 C CA  . ARG A 1 341 ? 17.704  9.647   48.048 1.00 17.15 ? 339 ARG A CA  1 
ATOM   2697 C C   . ARG A 1 341 ? 18.038  9.441   49.512 1.00 18.22 ? 339 ARG A C   1 
ATOM   2698 O O   . ARG A 1 341 ? 17.785  8.371   50.063 1.00 15.46 ? 339 ARG A O   1 
ATOM   2699 C CB  . ARG A 1 341 ? 16.218  9.969   47.899 1.00 19.67 ? 339 ARG A CB  1 
ATOM   2700 C CG  . ARG A 1 341 ? 15.815  11.373  48.357 1.00 16.51 ? 339 ARG A CG  1 
ATOM   2701 C CD  . ARG A 1 341 ? 14.348  11.580  48.036 1.00 17.00 ? 339 ARG A CD  1 
ATOM   2702 N NE  . ARG A 1 341 ? 13.838  12.914  48.337 1.00 19.76 ? 339 ARG A NE  1 
ATOM   2703 C CZ  . ARG A 1 341 ? 14.120  14.013  47.634 1.00 14.58 ? 339 ARG A CZ  1 
ATOM   2704 N NH1 . ARG A 1 341 ? 14.991  13.967  46.645 1.00 15.36 ? 339 ARG A NH1 1 
ATOM   2705 N NH2 . ARG A 1 341 ? 13.578  15.173  47.972 1.00 17.91 ? 339 ARG A NH2 1 
ATOM   2706 N N   . TYR A 1 342 ? 18.603  10.474  50.131 1.00 17.87 ? 340 TYR A N   1 
ATOM   2707 C CA  . TYR A 1 342 ? 18.973  10.430  51.546 1.00 18.57 ? 340 TYR A CA  1 
ATOM   2708 C C   . TYR A 1 342 ? 18.552  11.745  52.210 1.00 17.74 ? 340 TYR A C   1 
ATOM   2709 O O   . TYR A 1 342 ? 18.693  12.818  51.612 1.00 19.14 ? 340 TYR A O   1 
ATOM   2710 C CB  . TYR A 1 342 ? 20.495  10.287  51.694 1.00 18.85 ? 340 TYR A CB  1 
ATOM   2711 C CG  . TYR A 1 342 ? 21.091  8.972   51.229 1.00 18.86 ? 340 TYR A CG  1 
ATOM   2712 C CD1 . TYR A 1 342 ? 21.496  8.794   49.905 1.00 20.37 ? 340 TYR A CD1 1 
ATOM   2713 C CD2 . TYR A 1 342 ? 21.302  7.922   52.129 1.00 19.40 ? 340 TYR A CD2 1 
ATOM   2714 C CE1 . TYR A 1 342 ? 22.101  7.611   49.485 1.00 20.63 ? 340 TYR A CE1 1 
ATOM   2715 C CE2 . TYR A 1 342 ? 21.910  6.732   51.719 1.00 21.73 ? 340 TYR A CE2 1 
ATOM   2716 C CZ  . TYR A 1 342 ? 22.309  6.584   50.399 1.00 21.30 ? 340 TYR A CZ  1 
ATOM   2717 O OH  . TYR A 1 342 ? 22.943  5.428   49.999 1.00 21.24 ? 340 TYR A OH  1 
ATOM   2718 N N   . LYS A 1 343 ? 17.990  11.669  53.413 1.00 16.93 ? 341 LYS A N   1 
ATOM   2719 C CA  . LYS A 1 343 ? 17.616  12.879  54.140 1.00 16.52 ? 341 LYS A CA  1 
ATOM   2720 C C   . LYS A 1 343 ? 18.787  13.190  55.065 1.00 18.26 ? 341 LYS A C   1 
ATOM   2721 O O   . LYS A 1 343 ? 19.132  12.371  55.923 1.00 14.63 ? 341 LYS A O   1 
ATOM   2722 C CB  . LYS A 1 343 ? 16.349  12.673  54.961 1.00 17.16 ? 341 LYS A CB  1 
ATOM   2723 C CG  . LYS A 1 343 ? 16.011  13.870  55.838 1.00 19.28 ? 341 LYS A CG  1 
ATOM   2724 C CD  . LYS A 1 343 ? 14.703  13.700  56.588 1.00 19.74 ? 341 LYS A CD  1 
ATOM   2725 C CE  . LYS A 1 343 ? 13.512  13.729  55.646 1.00 21.41 ? 341 LYS A CE  1 
ATOM   2726 N NZ  . LYS A 1 343 ? 13.343  15.085  55.041 1.00 16.93 ? 341 LYS A NZ  1 
ATOM   2727 N N   . VAL A 1 344 ? 19.412  14.348  54.867 1.00 17.65 ? 342 VAL A N   1 
ATOM   2728 C CA  . VAL A 1 344 ? 20.566  14.738  55.667 1.00 18.14 ? 342 VAL A CA  1 
ATOM   2729 C C   . VAL A 1 344 ? 20.212  15.893  56.603 1.00 18.14 ? 342 VAL A C   1 
ATOM   2730 O O   . VAL A 1 344 ? 19.656  16.915  56.172 1.00 14.29 ? 342 VAL A O   1 
ATOM   2731 C CB  . VAL A 1 344 ? 21.772  15.125  54.763 1.00 18.21 ? 342 VAL A CB  1 
ATOM   2732 C CG1 . VAL A 1 344 ? 22.974  15.575  55.611 1.00 17.45 ? 342 VAL A CG1 1 
ATOM   2733 C CG2 . VAL A 1 344 ? 22.188  13.938  53.885 1.00 16.72 ? 342 VAL A CG2 1 
ATOM   2734 N N   . SER A 1 345 ? 20.488  15.702  57.892 1.00 17.24 ? 343 SER A N   1 
ATOM   2735 C CA  . SER A 1 345 ? 20.225  16.720  58.899 1.00 17.00 ? 343 SER A CA  1 
ATOM   2736 C C   . SER A 1 345 ? 21.560  17.095  59.536 1.00 18.03 ? 343 SER A C   1 
ATOM   2737 O O   . SER A 1 345 ? 22.343  16.212  59.909 1.00 12.25 ? 343 SER A O   1 
ATOM   2738 C CB  . SER A 1 345 ? 19.250  16.190  59.946 1.00 21.08 ? 343 SER A CB  1 
ATOM   2739 O OG  . SER A 1 345 ? 18.007  15.861  59.350 1.00 23.34 ? 343 SER A OG  1 
ATOM   2740 N N   . VAL A 1 346 ? 21.830  18.396  59.630 1.00 16.58 ? 344 VAL A N   1 
ATOM   2741 C CA  . VAL A 1 346 ? 23.090  18.893  60.183 1.00 18.13 ? 344 VAL A CA  1 
ATOM   2742 C C   . VAL A 1 346 ? 22.851  19.903  61.298 1.00 18.40 ? 344 VAL A C   1 
ATOM   2743 O O   . VAL A 1 346 ? 22.066  20.839  61.130 1.00 18.51 ? 344 VAL A O   1 
ATOM   2744 C CB  . VAL A 1 346 ? 23.929  19.600  59.079 1.00 19.75 ? 344 VAL A CB  1 
ATOM   2745 C CG1 . VAL A 1 346 ? 25.283  20.053  59.621 1.00 16.38 ? 344 VAL A CG1 1 
ATOM   2746 C CG2 . VAL A 1 346 ? 24.128  18.679  57.886 1.00 17.89 ? 344 VAL A CG2 1 
ATOM   2747 N N   . THR A 1 347 ? 23.497  19.695  62.446 1.00 19.02 ? 345 THR A N   1 
ATOM   2748 C CA  . THR A 1 347 ? 23.383  20.631  63.564 1.00 18.10 ? 345 THR A CA  1 
ATOM   2749 C C   . THR A 1 347 ? 24.742  21.320  63.595 1.00 16.64 ? 345 THR A C   1 
ATOM   2750 O O   . THR A 1 347 ? 25.773  20.667  63.715 1.00 15.12 ? 345 THR A O   1 
ATOM   2751 C CB  . THR A 1 347 ? 23.080  19.919  64.910 1.00 18.70 ? 345 THR A CB  1 
ATOM   2752 O OG1 . THR A 1 347 ? 21.802  19.271  64.830 1.00 16.71 ? 345 THR A OG1 1 
ATOM   2753 C CG2 . THR A 1 347 ? 23.023  20.946  66.052 1.00 17.23 ? 345 THR A CG2 1 
ATOM   2754 N N   . LEU A 1 348 ? 24.750  22.634  63.400 1.00 15.20 ? 346 LEU A N   1 
ATOM   2755 C CA  . LEU A 1 348 ? 25.992  23.383  63.354 1.00 15.09 ? 346 LEU A CA  1 
ATOM   2756 C C   . LEU A 1 348 ? 26.590  23.610  64.730 1.00 15.62 ? 346 LEU A C   1 
ATOM   2757 O O   . LEU A 1 348 ? 25.872  23.599  65.735 1.00 17.62 ? 346 LEU A O   1 
ATOM   2758 C CB  . LEU A 1 348 ? 25.765  24.730  62.671 1.00 16.68 ? 346 LEU A CB  1 
ATOM   2759 C CG  . LEU A 1 348 ? 25.352  24.657  61.197 1.00 16.75 ? 346 LEU A CG  1 
ATOM   2760 C CD1 . LEU A 1 348 ? 24.939  26.039  60.706 1.00 18.76 ? 346 LEU A CD1 1 
ATOM   2761 C CD2 . LEU A 1 348 ? 26.513  24.131  60.364 1.00 15.83 ? 346 LEU A CD2 1 
ATOM   2762 N N   . SER A 1 349 ? 27.895  23.837  64.753 1.00 17.54 ? 347 SER A N   1 
ATOM   2763 C CA  . SER A 1 349 ? 28.615  24.092  65.992 1.00 19.35 ? 347 SER A CA  1 
ATOM   2764 C C   . SER A 1 349 ? 29.681  25.139  65.708 1.00 19.35 ? 347 SER A C   1 
ATOM   2765 O O   . SER A 1 349 ? 30.134  25.293  64.566 1.00 18.48 ? 347 SER A O   1 
ATOM   2766 C CB  . SER A 1 349 ? 29.274  22.808  66.491 1.00 18.17 ? 347 SER A CB  1 
ATOM   2767 O OG  . SER A 1 349 ? 30.350  22.440  65.645 1.00 18.38 ? 347 SER A OG  1 
ATOM   2768 N N   . GLY A 1 350 ? 30.060  25.893  66.731 1.00 18.81 ? 348 GLY A N   1 
ATOM   2769 C CA  . GLY A 1 350 ? 31.083  26.894  66.522 1.00 16.48 ? 348 GLY A CA  1 
ATOM   2770 C C   . GLY A 1 350 ? 30.889  28.047  67.476 1.00 16.77 ? 348 GLY A C   1 
ATOM   2771 O O   . GLY A 1 350 ? 29.938  28.048  68.254 1.00 15.75 ? 348 GLY A O   1 
ATOM   2772 N N   . ALA A 1 351 A 31.755  29.044  67.362 1.00 19.76 ? 348 ALA A N   1 
ATOM   2773 C CA  . ALA A 1 351 A 31.704  30.217  68.218 1.00 22.91 ? 348 ALA A CA  1 
ATOM   2774 C C   . ALA A 1 351 A 31.174  31.473  67.523 1.00 24.90 ? 348 ALA A C   1 
ATOM   2775 O O   . ALA A 1 351 A 30.739  32.402  68.195 1.00 23.20 ? 348 ALA A O   1 
ATOM   2776 C CB  . ALA A 1 351 A 33.084  30.486  68.790 1.00 24.22 ? 348 ALA A CB  1 
ATOM   2777 N N   . LYS A 1 352 ? 31.192  31.499  66.189 1.00 25.32 ? 349 LYS A N   1 
ATOM   2778 C CA  . LYS A 1 352 ? 30.738  32.679  65.446 1.00 26.65 ? 349 LYS A CA  1 
ATOM   2779 C C   . LYS A 1 352 ? 29.638  32.397  64.432 1.00 27.12 ? 349 LYS A C   1 
ATOM   2780 O O   . LYS A 1 352 ? 29.590  31.326  63.820 1.00 24.65 ? 349 LYS A O   1 
ATOM   2781 C CB  . LYS A 1 352 ? 31.905  33.316  64.683 1.00 30.01 ? 349 LYS A CB  1 
ATOM   2782 C CG  . LYS A 1 352 ? 33.177  33.524  65.476 1.00 34.66 ? 349 LYS A CG  1 
ATOM   2783 C CD  . LYS A 1 352 ? 33.050  34.649  66.487 1.00 37.33 ? 349 LYS A CD  1 
ATOM   2784 C CE  . LYS A 1 352 ? 34.296  34.734  67.364 1.00 38.85 ? 349 LYS A CE  1 
ATOM   2785 N NZ  . LYS A 1 352 ? 34.193  35.831  68.366 1.00 40.81 ? 349 LYS A NZ  1 
ATOM   2786 N N   . LYS A 1 353 ? 28.765  33.382  64.246 1.00 27.39 ? 350 LYS A N   1 
ATOM   2787 C CA  . LYS A 1 353 ? 27.696  33.270  63.264 1.00 27.04 ? 350 LYS A CA  1 
ATOM   2788 C C   . LYS A 1 353 ? 28.392  33.656  61.966 1.00 26.14 ? 350 LYS A C   1 
ATOM   2789 O O   . LYS A 1 353 ? 29.202  34.594  61.939 1.00 23.70 ? 350 LYS A O   1 
ATOM   2790 C CB  . LYS A 1 353 ? 26.571  34.248  63.580 1.00 29.79 ? 350 LYS A CB  1 
ATOM   2791 C CG  . LYS A 1 353 ? 25.322  34.002  62.776 1.00 32.73 ? 350 LYS A CG  1 
ATOM   2792 C CD  . LYS A 1 353 ? 24.211  34.949  63.165 1.00 35.79 ? 350 LYS A CD  1 
ATOM   2793 C CE  . LYS A 1 353 ? 24.445  36.341  62.621 1.00 36.79 ? 350 LYS A CE  1 
ATOM   2794 N NZ  . LYS A 1 353 ? 23.311  37.223  62.993 1.00 38.76 ? 350 LYS A NZ  1 
ATOM   2795 N N   . LEU A 1 354 ? 28.119  32.921  60.900 1.00 22.97 ? 351 LEU A N   1 
ATOM   2796 C CA  . LEU A 1 354 ? 28.770  33.195  59.632 1.00 21.17 ? 351 LEU A CA  1 
ATOM   2797 C C   . LEU A 1 354 ? 27.775  33.237  58.474 1.00 18.75 ? 351 LEU A C   1 
ATOM   2798 O O   . LEU A 1 354 ? 26.567  33.128  58.675 1.00 16.91 ? 351 LEU A O   1 
ATOM   2799 C CB  . LEU A 1 354 ? 29.838  32.126  59.376 1.00 20.65 ? 351 LEU A CB  1 
ATOM   2800 C CG  . LEU A 1 354 ? 30.835  31.850  60.507 1.00 22.76 ? 351 LEU A CG  1 
ATOM   2801 C CD1 . LEU A 1 354 ? 31.678  30.640  60.191 1.00 22.83 ? 351 LEU A CD1 1 
ATOM   2802 C CD2 . LEU A 1 354 ? 31.718  33.066  60.721 1.00 21.96 ? 351 LEU A CD2 1 
ATOM   2803 N N   . SER A 1 355 ? 28.292  33.508  57.283 1.00 22.08 ? 352 SER A N   1 
ATOM   2804 C CA  . SER A 1 355 ? 27.500  33.540  56.054 1.00 23.45 ? 352 SER A CA  1 
ATOM   2805 C C   . SER A 1 355 ? 28.187  32.583  55.097 1.00 19.32 ? 352 SER A C   1 
ATOM   2806 O O   . SER A 1 355 ? 29.410  32.640  54.932 1.00 20.31 ? 352 SER A O   1 
ATOM   2807 C CB  . SER A 1 355 ? 27.503  34.939  55.418 1.00 25.48 ? 352 SER A CB  1 
ATOM   2808 O OG  . SER A 1 355 ? 26.509  35.777  55.980 1.00 31.84 ? 352 SER A OG  1 
ATOM   2809 N N   . GLY A 1 356 ? 27.413  31.711  54.462 1.00 20.33 ? 353 GLY A N   1 
ATOM   2810 C CA  . GLY A 1 356 ? 28.010  30.787  53.521 1.00 18.70 ? 353 GLY A CA  1 
ATOM   2811 C C   . GLY A 1 356 ? 27.153  29.603  53.124 1.00 14.45 ? 353 GLY A C   1 
ATOM   2812 O O   . GLY A 1 356 ? 25.933  29.635  53.221 1.00 16.33 ? 353 GLY A O   1 
ATOM   2813 N N   . TYR A 1 357 ? 27.829  28.541  52.711 1.00 15.82 ? 354 TYR A N   1 
ATOM   2814 C CA  . TYR A 1 357 ? 27.199  27.311  52.272 1.00 19.31 ? 354 TYR A CA  1 
ATOM   2815 C C   . TYR A 1 357 ? 27.768  26.139  53.071 1.00 14.95 ? 354 TYR A C   1 
ATOM   2816 O O   . TYR A 1 357 ? 28.965  26.120  53.378 1.00 17.61 ? 354 TYR A O   1 
ATOM   2817 C CB  . TYR A 1 357 ? 27.528  27.071  50.794 1.00 22.14 ? 354 TYR A CB  1 
ATOM   2818 C CG  . TYR A 1 357 ? 27.253  28.249  49.878 1.00 26.21 ? 354 TYR A CG  1 
ATOM   2819 C CD1 . TYR A 1 357 ? 28.065  29.382  49.897 1.00 27.60 ? 354 TYR A CD1 1 
ATOM   2820 C CD2 . TYR A 1 357 ? 26.190  28.219  48.973 1.00 28.29 ? 354 TYR A CD2 1 
ATOM   2821 C CE1 . TYR A 1 357 ? 27.829  30.457  49.042 1.00 28.51 ? 354 TYR A CE1 1 
ATOM   2822 C CE2 . TYR A 1 357 ? 25.946  29.292  48.109 1.00 30.09 ? 354 TYR A CE2 1 
ATOM   2823 C CZ  . TYR A 1 357 ? 26.770  30.405  48.150 1.00 30.47 ? 354 TYR A CZ  1 
ATOM   2824 O OH  . TYR A 1 357 ? 26.540  31.467  47.298 1.00 32.57 ? 354 TYR A OH  1 
ATOM   2825 N N   . ILE A 1 358 ? 26.910  25.185  53.415 1.00 14.91 ? 355 ILE A N   1 
ATOM   2826 C CA  . ILE A 1 358 ? 27.340  23.974  54.126 1.00 15.00 ? 355 ILE A CA  1 
ATOM   2827 C C   . ILE A 1 358 ? 27.046  22.782  53.214 1.00 14.42 ? 355 ILE A C   1 
ATOM   2828 O O   . ILE A 1 358 ? 25.961  22.695  52.623 1.00 15.17 ? 355 ILE A O   1 
ATOM   2829 C CB  . ILE A 1 358 ? 26.638  23.776  55.507 1.00 16.20 ? 355 ILE A CB  1 
ATOM   2830 C CG1 . ILE A 1 358 ? 25.115  23.820  55.376 1.00 15.19 ? 355 ILE A CG1 1 
ATOM   2831 C CG2 . ILE A 1 358 ? 27.154  24.816  56.510 1.00 15.24 ? 355 ILE A CG2 1 
ATOM   2832 C CD1 . ILE A 1 358 ? 24.355  23.401  56.645 1.00 14.88 ? 355 ILE A CD1 1 
ATOM   2833 N N   . LEU A 1 359 ? 28.011  21.875  53.111 1.00 14.31 ? 356 LEU A N   1 
ATOM   2834 C CA  . LEU A 1 359 ? 27.910  20.693  52.265 1.00 14.43 ? 356 LEU A CA  1 
ATOM   2835 C C   . LEU A 1 359 ? 28.280  19.437  53.048 1.00 15.94 ? 356 LEU A C   1 
ATOM   2836 O O   . LEU A 1 359 ? 29.084  19.501  53.979 1.00 12.57 ? 356 LEU A O   1 
ATOM   2837 C CB  . LEU A 1 359 ? 28.861  20.819  51.075 1.00 14.57 ? 356 LEU A CB  1 
ATOM   2838 C CG  . LEU A 1 359 ? 28.725  22.051  50.174 1.00 14.41 ? 356 LEU A CG  1 
ATOM   2839 C CD1 . LEU A 1 359 ? 29.705  23.137  50.604 1.00 13.08 ? 356 LEU A CD1 1 
ATOM   2840 C CD2 . LEU A 1 359 ? 28.994  21.639  48.735 1.00 15.79 ? 356 LEU A CD2 1 
ATOM   2841 N N   . VAL A 1 360 ? 27.746  18.297  52.621 1.00 13.55 ? 357 VAL A N   1 
ATOM   2842 C CA  . VAL A 1 360 ? 28.005  17.010  53.280 1.00 14.38 ? 357 VAL A CA  1 
ATOM   2843 C C   . VAL A 1 360 ? 28.311  15.924  52.247 1.00 18.34 ? 357 VAL A C   1 
ATOM   2844 O O   . VAL A 1 360 ? 27.684  15.890  51.184 1.00 17.11 ? 357 VAL A O   1 
ATOM   2845 C CB  . VAL A 1 360 ? 26.760  16.550  54.102 1.00 15.67 ? 357 VAL A CB  1 
ATOM   2846 C CG1 . VAL A 1 360 ? 26.987  15.162  54.723 1.00 14.01 ? 357 VAL A CG1 1 
ATOM   2847 C CG2 . VAL A 1 360 ? 26.410  17.565  55.177 1.00 15.31 ? 357 VAL A CG2 1 
ATOM   2848 N N   . ALA A 1 361 ? 29.300  15.076  52.538 1.00 16.61 ? 358 ALA A N   1 
ATOM   2849 C CA  . ALA A 1 361 ? 29.672  13.955  51.668 1.00 19.29 ? 358 ALA A CA  1 
ATOM   2850 C C   . ALA A 1 361 ? 29.495  12.686  52.505 1.00 20.04 ? 358 ALA A C   1 
ATOM   2851 O O   . ALA A 1 361 ? 29.821  12.681  53.703 1.00 16.96 ? 358 ALA A O   1 
ATOM   2852 C CB  . ALA A 1 361 ? 31.108  14.084  51.196 1.00 19.57 ? 358 ALA A CB  1 
ATOM   2853 N N   . LEU A 1 362 ? 28.967  11.630  51.888 1.00 18.11 ? 359 LEU A N   1 
ATOM   2854 C CA  . LEU A 1 362 ? 28.703  10.363  52.579 1.00 18.81 ? 359 LEU A CA  1 
ATOM   2855 C C   . LEU A 1 362 ? 29.758  9.313   52.248 1.00 20.19 ? 359 LEU A C   1 
ATOM   2856 O O   . LEU A 1 362 ? 30.171  9.185   51.092 1.00 18.95 ? 359 LEU A O   1 
ATOM   2857 C CB  . LEU A 1 362 ? 27.332  9.814   52.177 1.00 20.53 ? 359 LEU A CB  1 
ATOM   2858 C CG  . LEU A 1 362 ? 26.097  10.715  52.126 1.00 20.92 ? 359 LEU A CG  1 
ATOM   2859 C CD1 . LEU A 1 362 ? 24.936  9.925   51.557 1.00 18.60 ? 359 LEU A CD1 1 
ATOM   2860 C CD2 . LEU A 1 362 ? 25.761  11.248  53.508 1.00 21.70 ? 359 LEU A CD2 1 
ATOM   2861 N N   . TYR A 1 363 ? 30.184  8.557   53.259 1.00 19.27 ? 360 TYR A N   1 
ATOM   2862 C CA  . TYR A 1 363 ? 31.191  7.517   53.073 1.00 22.61 ? 360 TYR A CA  1 
ATOM   2863 C C   . TYR A 1 363 ? 30.665  6.195   53.613 1.00 24.48 ? 360 TYR A C   1 
ATOM   2864 O O   . TYR A 1 363 ? 30.287  6.098   54.787 1.00 24.59 ? 360 TYR A O   1 
ATOM   2865 C CB  . TYR A 1 363 ? 32.505  7.893   53.771 1.00 23.32 ? 360 TYR A CB  1 
ATOM   2866 C CG  . TYR A 1 363 ? 33.280  9.012   53.102 1.00 23.20 ? 360 TYR A CG  1 
ATOM   2867 C CD1 . TYR A 1 363 ? 32.780  10.316  53.070 1.00 22.96 ? 360 TYR A CD1 1 
ATOM   2868 C CD2 . TYR A 1 363 ? 34.510  8.766   52.495 1.00 24.08 ? 360 TYR A CD2 1 
ATOM   2869 C CE1 . TYR A 1 363 ? 33.486  11.346  52.451 1.00 21.91 ? 360 TYR A CE1 1 
ATOM   2870 C CE2 . TYR A 1 363 ? 35.224  9.791   51.873 1.00 24.35 ? 360 TYR A CE2 1 
ATOM   2871 C CZ  . TYR A 1 363 ? 34.704  11.075  51.856 1.00 22.92 ? 360 TYR A CZ  1 
ATOM   2872 O OH  . TYR A 1 363 ? 35.406  12.088  51.245 1.00 26.85 ? 360 TYR A OH  1 
ATOM   2873 N N   . GLY A 1 364 ? 30.634  5.182   52.752 1.00 24.29 ? 361 GLY A N   1 
ATOM   2874 C CA  . GLY A 1 364 ? 30.138  3.881   53.155 1.00 23.70 ? 361 GLY A CA  1 
ATOM   2875 C C   . GLY A 1 364 ? 30.968  2.734   52.616 1.00 23.33 ? 361 GLY A C   1 
ATOM   2876 O O   . GLY A 1 364 ? 31.944  2.946   51.896 1.00 23.12 ? 361 GLY A O   1 
ATOM   2877 N N   . ASN A 1 365 ? 30.572  1.508   52.943 1.00 25.59 ? 362 ASN A N   1 
ATOM   2878 C CA  . ASN A 1 365 ? 31.322  0.337   52.491 1.00 28.11 ? 362 ASN A CA  1 
ATOM   2879 C C   . ASN A 1 365 ? 31.246  0.089   50.993 1.00 29.10 ? 362 ASN A C   1 
ATOM   2880 O O   . ASN A 1 365 ? 32.082  -0.622  50.437 1.00 29.18 ? 362 ASN A O   1 
ATOM   2881 C CB  . ASN A 1 365 ? 30.950  -0.925  53.291 1.00 30.92 ? 362 ASN A CB  1 
ATOM   2882 C CG  . ASN A 1 365 ? 29.459  -1.238  53.275 1.00 31.27 ? 362 ASN A CG  1 
ATOM   2883 O OD1 . ASN A 1 365 ? 28.673  -0.616  52.557 1.00 32.20 ? 362 ASN A OD1 1 
ATOM   2884 N ND2 . ASN A 1 365 ? 29.062  -2.216  54.086 1.00 31.93 ? 362 ASN A ND2 1 
ATOM   2885 N N   . ASN A 1 366 ? 30.277  0.721   50.337 1.00 30.31 ? 363 ASN A N   1 
ATOM   2886 C CA  . ASN A 1 366 ? 30.098  0.583   48.896 1.00 31.37 ? 363 ASN A CA  1 
ATOM   2887 C C   . ASN A 1 366 ? 30.836  1.708   48.152 1.00 31.54 ? 363 ASN A C   1 
ATOM   2888 O O   . ASN A 1 366 ? 30.914  1.696   46.924 1.00 32.17 ? 363 ASN A O   1 
ATOM   2889 C CB  . ASN A 1 366 ? 28.603  0.630   48.563 1.00 33.29 ? 363 ASN A CB  1 
ATOM   2890 C CG  . ASN A 1 366 ? 28.242  -0.203  47.355 1.00 36.36 ? 363 ASN A CG  1 
ATOM   2891 O OD1 . ASN A 1 366 ? 28.152  -1.431  47.444 1.00 38.83 ? 363 ASN A OD1 1 
ATOM   2892 N ND2 . ASN A 1 366 ? 27.978  0.455   46.232 1.00 36.35 ? 363 ASN A ND2 1 
ATOM   2893 N N   . GLY A 1 367 ? 31.376  2.671   48.899 1.00 28.24 ? 364 GLY A N   1 
ATOM   2894 C CA  . GLY A 1 367 ? 32.084  3.788   48.291 1.00 27.80 ? 364 GLY A CA  1 
ATOM   2895 C C   . GLY A 1 367 ? 31.615  5.114   48.871 1.00 24.35 ? 364 GLY A C   1 
ATOM   2896 O O   . GLY A 1 367 ? 30.827  5.124   49.816 1.00 23.10 ? 364 GLY A O   1 
ATOM   2897 N N   . ASN A 1 368 ? 32.095  6.229   48.326 1.00 25.25 ? 365 ASN A N   1 
ATOM   2898 C CA  . ASN A 1 368 ? 31.690  7.539   48.834 1.00 26.15 ? 365 ASN A CA  1 
ATOM   2899 C C   . ASN A 1 368 ? 31.050  8.444   47.786 1.00 25.29 ? 365 ASN A C   1 
ATOM   2900 O O   . ASN A 1 368 ? 31.216  8.244   46.575 1.00 25.04 ? 365 ASN A O   1 
ATOM   2901 C CB  . ASN A 1 368 ? 32.862  8.254   49.527 1.00 25.57 ? 365 ASN A CB  1 
ATOM   2902 C CG  . ASN A 1 368 ? 33.891  8.786   48.553 1.00 26.73 ? 365 ASN A CG  1 
ATOM   2903 O OD1 . ASN A 1 368 ? 34.867  8.104   48.232 1.00 26.04 ? 365 ASN A OD1 1 
ATOM   2904 N ND2 . ASN A 1 368 ? 33.696  10.021  48.094 1.00 26.53 ? 365 ASN A ND2 1 
ATOM   2905 N N   . SER A 1 369 ? 30.307  9.432   48.266 1.00 23.47 ? 366 SER A N   1 
ATOM   2906 C CA  . SER A 1 369 ? 29.617  10.374  47.402 1.00 23.61 ? 366 SER A CA  1 
ATOM   2907 C C   . SER A 1 369 ? 30.419  11.655  47.248 1.00 24.53 ? 366 SER A C   1 
ATOM   2908 O O   . SER A 1 369 ? 31.477  11.832  47.873 1.00 21.99 ? 366 SER A O   1 
ATOM   2909 C CB  . SER A 1 369 ? 28.246  10.713  47.997 1.00 23.44 ? 366 SER A CB  1 
ATOM   2910 O OG  . SER A 1 369 ? 28.364  11.614  49.093 1.00 22.48 ? 366 SER A OG  1 
ATOM   2911 N N   . LYS A 1 370 ? 29.908  12.536  46.392 1.00 22.92 ? 367 LYS A N   1 
ATOM   2912 C CA  . LYS A 1 370 ? 30.498  13.841  46.165 1.00 20.15 ? 367 LYS A CA  1 
ATOM   2913 C C   . LYS A 1 370 ? 29.877  14.703  47.277 1.00 18.22 ? 367 LYS A C   1 
ATOM   2914 O O   . LYS A 1 370 ? 29.061  14.213  48.067 1.00 16.19 ? 367 LYS A O   1 
ATOM   2915 C CB  . LYS A 1 370 ? 30.071  14.380  44.796 1.00 22.94 ? 367 LYS A CB  1 
ATOM   2916 C CG  . LYS A 1 370 ? 30.274  13.406  43.630 1.00 23.98 ? 367 LYS A CG  1 
ATOM   2917 C CD  . LYS A 1 370 ? 29.724  13.997  42.325 1.00 27.18 ? 367 LYS A CD  1 
ATOM   2918 C CE  . LYS A 1 370 ? 29.728  12.993  41.182 1.00 27.95 ? 367 LYS A CE  1 
ATOM   2919 N NZ  . LYS A 1 370 ? 31.082  12.467  40.879 1.00 29.55 ? 367 LYS A NZ  1 
ATOM   2920 N N   . GLN A 1 371 ? 30.250  15.974  47.347 1.00 18.51 ? 368 GLN A N   1 
ATOM   2921 C CA  . GLN A 1 371 ? 29.695  16.864  48.366 1.00 17.63 ? 368 GLN A CA  1 
ATOM   2922 C C   . GLN A 1 371 ? 28.377  17.464  47.868 1.00 17.07 ? 368 GLN A C   1 
ATOM   2923 O O   . GLN A 1 371 ? 28.265  17.834  46.692 1.00 18.83 ? 368 GLN A O   1 
ATOM   2924 C CB  . GLN A 1 371 ? 30.701  17.968  48.688 1.00 17.52 ? 368 GLN A CB  1 
ATOM   2925 C CG  . GLN A 1 371 ? 32.085  17.449  49.048 1.00 16.83 ? 368 GLN A CG  1 
ATOM   2926 C CD  . GLN A 1 371 ? 33.116  18.556  49.114 1.00 17.76 ? 368 GLN A CD  1 
ATOM   2927 O OE1 . GLN A 1 371 ? 32.779  19.714  49.373 1.00 21.63 ? 368 GLN A OE1 1 
ATOM   2928 N NE2 . GLN A 1 371 ? 34.374  18.216  48.863 1.00 18.01 ? 368 GLN A NE2 1 
ATOM   2929 N N   . TYR A 1 372 ? 27.372  17.502  48.740 1.00 16.17 ? 369 TYR A N   1 
ATOM   2930 C CA  . TYR A 1 372 ? 26.055  18.047  48.415 1.00 18.37 ? 369 TYR A CA  1 
ATOM   2931 C C   . TYR A 1 372 ? 25.690  19.249  49.295 1.00 19.65 ? 369 TYR A C   1 
ATOM   2932 O O   . TYR A 1 372 ? 25.849  19.197  50.520 1.00 17.69 ? 369 TYR A O   1 
ATOM   2933 C CB  . TYR A 1 372 ? 24.991  16.958  48.566 1.00 17.86 ? 369 TYR A CB  1 
ATOM   2934 C CG  . TYR A 1 372 ? 25.079  15.885  47.498 1.00 17.78 ? 369 TYR A CG  1 
ATOM   2935 C CD1 . TYR A 1 372 ? 26.117  14.948  47.502 1.00 17.95 ? 369 TYR A CD1 1 
ATOM   2936 C CD2 . TYR A 1 372 ? 24.160  15.847  46.449 1.00 19.73 ? 369 TYR A CD2 1 
ATOM   2937 C CE1 . TYR A 1 372 ? 26.243  13.998  46.484 1.00 16.71 ? 369 TYR A CE1 1 
ATOM   2938 C CE2 . TYR A 1 372 ? 24.277  14.905  45.427 1.00 17.85 ? 369 TYR A CE2 1 
ATOM   2939 C CZ  . TYR A 1 372 ? 25.315  13.992  45.449 1.00 16.91 ? 369 TYR A CZ  1 
ATOM   2940 O OH  . TYR A 1 372 ? 25.435  13.066  44.445 1.00 18.10 ? 369 TYR A OH  1 
ATOM   2941 N N   . GLU A 1 373 ? 25.194  20.326  48.684 1.00 16.88 ? 370 GLU A N   1 
ATOM   2942 C CA  . GLU A 1 373 ? 24.817  21.510  49.451 1.00 17.18 ? 370 GLU A CA  1 
ATOM   2943 C C   . GLU A 1 373 ? 23.569  21.209  50.268 1.00 16.47 ? 370 GLU A C   1 
ATOM   2944 O O   . GLU A 1 373 ? 22.585  20.682  49.739 1.00 18.77 ? 370 GLU A O   1 
ATOM   2945 C CB  . GLU A 1 373 ? 24.567  22.714  48.525 1.00 17.47 ? 370 GLU A CB  1 
ATOM   2946 C CG  . GLU A 1 373 ? 24.047  23.959  49.245 1.00 18.52 ? 370 GLU A CG  1 
ATOM   2947 C CD  . GLU A 1 373 ? 23.665  25.089  48.287 1.00 19.86 ? 370 GLU A CD  1 
ATOM   2948 O OE1 . GLU A 1 373 ? 24.548  25.614  47.589 1.00 23.31 ? 370 GLU A OE1 1 
ATOM   2949 O OE2 . GLU A 1 373 ? 22.482  25.468  48.254 1.00 21.41 ? 370 GLU A OE2 1 
ATOM   2950 N N   . ILE A 1 374 ? 23.633  21.475  51.573 1.00 14.83 ? 371 ILE A N   1 
ATOM   2951 C CA  . ILE A 1 374 ? 22.491  21.234  52.444 1.00 11.91 ? 371 ILE A CA  1 
ATOM   2952 C C   . ILE A 1 374 ? 21.751  22.536  52.754 1.00 13.16 ? 371 ILE A C   1 
ATOM   2953 O O   . ILE A 1 374 ? 20.521  22.546  52.889 1.00 18.91 ? 371 ILE A O   1 
ATOM   2954 C CB  . ILE A 1 374 ? 22.902  20.543  53.790 1.00 13.07 ? 371 ILE A CB  1 
ATOM   2955 C CG1 . ILE A 1 374 ? 23.694  19.256  53.524 1.00 12.08 ? 371 ILE A CG1 1 
ATOM   2956 C CG2 . ILE A 1 374 ? 21.661  20.237  54.629 1.00 12.79 ? 371 ILE A CG2 1 
ATOM   2957 C CD1 . ILE A 1 374 ? 22.888  18.148  52.795 1.00 13.36 ? 371 ILE A CD1 1 
ATOM   2958 N N   . PHE A 1 375 ? 22.493  23.634  52.856 1.00 16.37 ? 372 PHE A N   1 
ATOM   2959 C CA  . PHE A 1 375 ? 21.901  24.934  53.180 1.00 16.66 ? 372 PHE A CA  1 
ATOM   2960 C C   . PHE A 1 375 ? 22.861  26.061  52.830 1.00 16.69 ? 372 PHE A C   1 
ATOM   2961 O O   . PHE A 1 375 ? 24.077  25.852  52.739 1.00 15.44 ? 372 PHE A O   1 
ATOM   2962 C CB  . PHE A 1 375 ? 21.553  24.998  54.681 1.00 15.75 ? 372 PHE A CB  1 
ATOM   2963 C CG  . PHE A 1 375 ? 21.033  26.340  55.144 1.00 16.81 ? 372 PHE A CG  1 
ATOM   2964 C CD1 . PHE A 1 375 ? 19.693  26.670  54.991 1.00 18.14 ? 372 PHE A CD1 1 
ATOM   2965 C CD2 . PHE A 1 375 ? 21.883  27.258  55.764 1.00 18.67 ? 372 PHE A CD2 1 
ATOM   2966 C CE1 . PHE A 1 375 ? 19.198  27.895  55.450 1.00 18.77 ? 372 PHE A CE1 1 
ATOM   2967 C CE2 . PHE A 1 375 ? 21.401  28.486  56.225 1.00 17.34 ? 372 PHE A CE2 1 
ATOM   2968 C CZ  . PHE A 1 375 ? 20.054  28.800  56.066 1.00 17.78 ? 372 PHE A CZ  1 
ATOM   2969 N N   . LYS A 1 376 ? 22.299  27.234  52.550 1.00 18.21 ? 373 LYS A N   1 
ATOM   2970 C CA  . LYS A 1 376 ? 23.102  28.411  52.241 1.00 18.63 ? 373 LYS A CA  1 
ATOM   2971 C C   . LYS A 1 376 ? 22.375  29.618  52.818 1.00 18.33 ? 373 LYS A C   1 
ATOM   2972 O O   . LYS A 1 376 ? 21.143  29.694  52.761 1.00 18.47 ? 373 LYS A O   1 
ATOM   2973 C CB  . LYS A 1 376 ? 23.337  28.558  50.733 1.00 20.15 ? 373 LYS A CB  1 
ATOM   2974 C CG  . LYS A 1 376 ? 22.104  28.881  49.929 1.00 23.90 ? 373 LYS A CG  1 
ATOM   2975 C CD  . LYS A 1 376 ? 22.454  29.111  48.471 1.00 26.82 ? 373 LYS A CD  1 
ATOM   2976 C CE  . LYS A 1 376 ? 21.203  29.415  47.663 1.00 28.93 ? 373 LYS A CE  1 
ATOM   2977 N NZ  . LYS A 1 376 ? 21.533  29.585  46.224 1.00 30.64 ? 373 LYS A NZ  1 
ATOM   2978 N N   . GLY A 1 377 ? 23.133  30.492  53.476 1.00 18.37 ? 374 GLY A N   1 
ATOM   2979 C CA  . GLY A 1 377 ? 22.566  31.678  54.101 1.00 17.97 ? 374 GLY A CA  1 
ATOM   2980 C C   . GLY A 1 377 ? 23.333  31.934  55.394 1.00 16.85 ? 374 GLY A C   1 
ATOM   2981 O O   . GLY A 1 377 ? 24.540  31.720  55.439 1.00 14.40 ? 374 GLY A O   1 
ATOM   2982 N N   . SER A 1 378 ? 22.653  32.400  56.433 1.00 19.33 ? 375 SER A N   1 
ATOM   2983 C CA  . SER A 1 378 ? 23.327  32.639  57.705 1.00 19.43 ? 375 SER A CA  1 
ATOM   2984 C C   . SER A 1 378 ? 23.564  31.292  58.396 1.00 17.79 ? 375 SER A C   1 
ATOM   2985 O O   . SER A 1 378 ? 22.649  30.468  58.513 1.00 19.41 ? 375 SER A O   1 
ATOM   2986 C CB  . SER A 1 378 ? 22.509  33.586  58.593 1.00 22.76 ? 375 SER A CB  1 
ATOM   2987 O OG  . SER A 1 378 ? 21.164  33.156  58.726 1.00 28.16 ? 375 SER A OG  1 
ATOM   2988 N N   . LEU A 1 379 ? 24.800  31.067  58.817 1.00 19.22 ? 376 LEU A N   1 
ATOM   2989 C CA  . LEU A 1 379 ? 25.192  29.833  59.478 1.00 16.89 ? 376 LEU A CA  1 
ATOM   2990 C C   . LEU A 1 379 ? 25.384  30.083  60.975 1.00 18.42 ? 376 LEU A C   1 
ATOM   2991 O O   . LEU A 1 379 ? 26.438  30.548  61.398 1.00 18.90 ? 376 LEU A O   1 
ATOM   2992 C CB  . LEU A 1 379 ? 26.499  29.324  58.875 1.00 17.28 ? 376 LEU A CB  1 
ATOM   2993 C CG  . LEU A 1 379 ? 26.573  29.218  57.348 1.00 18.60 ? 376 LEU A CG  1 
ATOM   2994 C CD1 . LEU A 1 379 ? 27.934  28.715  56.944 1.00 18.22 ? 376 LEU A CD1 1 
ATOM   2995 C CD2 . LEU A 1 379 ? 25.460  28.309  56.812 1.00 17.42 ? 376 LEU A CD2 1 
ATOM   2996 N N   . LYS A 1 380 ? 24.374  29.734  61.762 1.00 18.86 ? 377 LYS A N   1 
ATOM   2997 C CA  . LYS A 1 380 ? 24.403  29.926  63.207 1.00 20.29 ? 377 LYS A CA  1 
ATOM   2998 C C   . LYS A 1 380 ? 24.706  28.658  64.011 1.00 21.92 ? 377 LYS A C   1 
ATOM   2999 O O   . LYS A 1 380 ? 24.058  27.622  63.828 1.00 18.16 ? 377 LYS A O   1 
ATOM   3000 C CB  . LYS A 1 380 ? 23.052  30.469  63.687 1.00 21.77 ? 377 LYS A CB  1 
ATOM   3001 C CG  . LYS A 1 380 ? 22.624  31.794  63.079 1.00 25.97 ? 377 LYS A CG  1 
ATOM   3002 C CD  . LYS A 1 380 ? 21.339  32.276  63.734 1.00 28.06 ? 377 LYS A CD  1 
ATOM   3003 C CE  . LYS A 1 380 ? 20.880  33.627  63.196 1.00 31.66 ? 377 LYS A CE  1 
ATOM   3004 N NZ  . LYS A 1 380 ? 20.637  33.586  61.731 1.00 35.71 ? 377 LYS A NZ  1 
ATOM   3005 N N   . PRO A 1 381 ? 25.714  28.711  64.893 1.00 20.39 ? 378 PRO A N   1 
ATOM   3006 C CA  . PRO A 1 381 ? 26.005  27.516  65.691 1.00 20.52 ? 378 PRO A CA  1 
ATOM   3007 C C   . PRO A 1 381 ? 24.726  27.131  66.433 1.00 17.27 ? 378 PRO A C   1 
ATOM   3008 O O   . PRO A 1 381 ? 23.932  28.001  66.802 1.00 19.76 ? 378 PRO A O   1 
ATOM   3009 C CB  . PRO A 1 381 ? 27.086  28.009  66.642 1.00 21.00 ? 378 PRO A CB  1 
ATOM   3010 C CG  . PRO A 1 381 ? 27.884  28.919  65.744 1.00 21.15 ? 378 PRO A CG  1 
ATOM   3011 C CD  . PRO A 1 381 ? 26.791  29.712  65.037 1.00 22.15 ? 378 PRO A CD  1 
ATOM   3012 N N   . GLU A 1 382 ? 24.494  25.824  66.550 1.00 17.84 ? 379 GLU A N   1 
ATOM   3013 C CA  . GLU A 1 382 ? 23.323  25.238  67.204 1.00 18.18 ? 379 GLU A CA  1 
ATOM   3014 C C   . GLU A 1 382 ? 22.056  25.190  66.337 1.00 20.47 ? 379 GLU A C   1 
ATOM   3015 O O   . GLU A 1 382 ? 21.027  24.651  66.762 1.00 19.25 ? 379 GLU A O   1 
ATOM   3016 C CB  . GLU A 1 382 ? 23.038  25.893  68.565 1.00 23.55 ? 379 GLU A CB  1 
ATOM   3017 C CG  . GLU A 1 382 ? 24.276  25.945  69.455 1.00 25.25 ? 379 GLU A CG  1 
ATOM   3018 C CD  . GLU A 1 382 ? 23.971  26.136  70.931 1.00 28.54 ? 379 GLU A CD  1 
ATOM   3019 O OE1 . GLU A 1 382 ? 22.805  26.403  71.296 1.00 29.52 ? 379 GLU A OE1 1 
ATOM   3020 O OE2 . GLU A 1 382 ? 24.919  26.006  71.731 1.00 30.82 ? 379 GLU A OE2 1 
ATOM   3021 N N   . ALA A 1 383 ? 22.115  25.772  65.138 1.00 19.35 ? 380 ALA A N   1 
ATOM   3022 C CA  . ALA A 1 383 ? 20.963  25.738  64.232 1.00 20.03 ? 380 ALA A CA  1 
ATOM   3023 C C   . ALA A 1 383 ? 21.023  24.394  63.511 1.00 18.07 ? 380 ALA A C   1 
ATOM   3024 O O   . ALA A 1 383 ? 22.115  23.857  63.308 1.00 18.65 ? 380 ALA A O   1 
ATOM   3025 C CB  . ALA A 1 383 ? 21.043  26.884  63.224 1.00 20.92 ? 380 ALA A CB  1 
ATOM   3026 N N   . ARG A 1 384 ? 19.863  23.839  63.163 1.00 19.64 ? 381 ARG A N   1 
ATOM   3027 C CA  . ARG A 1 384 ? 19.795  22.558  62.463 1.00 21.09 ? 381 ARG A CA  1 
ATOM   3028 C C   . ARG A 1 384 ? 19.176  22.779  61.082 1.00 18.48 ? 381 ARG A C   1 
ATOM   3029 O O   . ARG A 1 384 ? 18.209  23.527  60.947 1.00 18.49 ? 381 ARG A O   1 
ATOM   3030 C CB  . ARG A 1 384 ? 18.959  21.554  63.256 1.00 23.66 ? 381 ARG A CB  1 
ATOM   3031 C CG  . ARG A 1 384 ? 19.114  20.105  62.783 1.00 28.32 ? 381 ARG A CG  1 
ATOM   3032 C CD  . ARG A 1 384 ? 18.358  19.145  63.694 1.00 31.86 ? 381 ARG A CD  1 
ATOM   3033 N NE  . ARG A 1 384 ? 16.914  19.347  63.622 1.00 35.81 ? 381 ARG A NE  1 
ATOM   3034 C CZ  . ARG A 1 384 ? 16.113  18.718  62.765 1.00 36.92 ? 381 ARG A CZ  1 
ATOM   3035 N NH1 . ARG A 1 384 ? 16.610  17.839  61.904 1.00 38.64 ? 381 ARG A NH1 1 
ATOM   3036 N NH2 . ARG A 1 384 ? 14.811  18.963  62.774 1.00 38.89 ? 381 ARG A NH2 1 
ATOM   3037 N N   . HIS A 1 385 ? 19.734  22.118  60.076 1.00 18.98 ? 382 HIS A N   1 
ATOM   3038 C CA  . HIS A 1 385 ? 19.279  22.237  58.688 1.00 19.38 ? 382 HIS A CA  1 
ATOM   3039 C C   . HIS A 1 385 ? 19.079  20.850  58.086 1.00 18.54 ? 382 HIS A C   1 
ATOM   3040 O O   . HIS A 1 385 ? 19.846  19.932  58.382 1.00 20.91 ? 382 HIS A O   1 
ATOM   3041 C CB  . HIS A 1 385 ? 20.320  23.005  57.878 1.00 17.19 ? 382 HIS A CB  1 
ATOM   3042 C CG  . HIS A 1 385 ? 20.565  24.388  58.395 1.00 19.85 ? 382 HIS A CG  1 
ATOM   3043 N ND1 . HIS A 1 385 ? 19.608  25.375  58.337 1.00 22.18 ? 382 HIS A ND1 1 
ATOM   3044 C CD2 . HIS A 1 385 ? 21.618  24.917  59.063 1.00 20.62 ? 382 HIS A CD2 1 
ATOM   3045 C CE1 . HIS A 1 385 ? 20.056  26.456  58.956 1.00 22.82 ? 382 HIS A CE1 1 
ATOM   3046 N NE2 . HIS A 1 385 ? 21.271  26.204  59.403 1.00 21.43 ? 382 HIS A NE2 1 
ATOM   3047 N N   . VAL A 1 386 ? 18.071  20.709  57.226 1.00 20.43 ? 383 VAL A N   1 
ATOM   3048 C CA  . VAL A 1 386 ? 17.755  19.422  56.603 1.00 17.15 ? 383 VAL A CA  1 
ATOM   3049 C C   . VAL A 1 386 ? 17.519  19.565  55.089 1.00 17.82 ? 383 VAL A C   1 
ATOM   3050 O O   . VAL A 1 386 ? 16.936  20.554  54.641 1.00 16.02 ? 383 VAL A O   1 
ATOM   3051 C CB  . VAL A 1 386 ? 16.444  18.828  57.202 1.00 19.93 ? 383 VAL A CB  1 
ATOM   3052 C CG1 . VAL A 1 386 ? 16.209  17.415  56.681 1.00 19.68 ? 383 VAL A CG1 1 
ATOM   3053 C CG2 . VAL A 1 386 ? 16.481  18.836  58.731 1.00 21.48 ? 383 VAL A CG2 1 
ATOM   3054 N N   . ARG A 1 387 ? 18.045  18.620  54.316 1.00 16.35 ? 384 ARG A N   1 
ATOM   3055 C CA  . ARG A 1 387 ? 17.827  18.583  52.868 1.00 17.21 ? 384 ARG A CA  1 
ATOM   3056 C C   . ARG A 1 387 ? 17.895  17.131  52.405 1.00 18.56 ? 384 ARG A C   1 
ATOM   3057 O O   . ARG A 1 387 ? 18.727  16.348  52.874 1.00 18.78 ? 384 ARG A O   1 
ATOM   3058 C CB  . ARG A 1 387 ? 18.847  19.403  52.081 1.00 15.21 ? 384 ARG A CB  1 
ATOM   3059 C CG  . ARG A 1 387 ? 18.425  19.609  50.617 1.00 17.93 ? 384 ARG A CG  1 
ATOM   3060 C CD  . ARG A 1 387 ? 19.522  20.212  49.764 1.00 18.41 ? 384 ARG A CD  1 
ATOM   3061 N NE  . ARG A 1 387 ? 19.029  20.554  48.430 1.00 19.49 ? 384 ARG A NE  1 
ATOM   3062 C CZ  . ARG A 1 387 ? 19.780  20.614  47.334 1.00 20.41 ? 384 ARG A CZ  1 
ATOM   3063 N NH1 . ARG A 1 387 ? 21.079  20.358  47.393 1.00 18.76 ? 384 ARG A NH1 1 
ATOM   3064 N NH2 . ARG A 1 387 ? 19.213  20.884  46.157 1.00 21.47 ? 384 ARG A NH2 1 
ATOM   3065 N N   . ASP A 1 388 ? 16.977  16.764  51.525 1.00 19.11 ? 385 ASP A N   1 
ATOM   3066 C CA  . ASP A 1 388 ? 16.947  15.417  50.978 1.00 18.62 ? 385 ASP A CA  1 
ATOM   3067 C C   . ASP A 1 388 ? 17.701  15.534  49.667 1.00 18.96 ? 385 ASP A C   1 
ATOM   3068 O O   . ASP A 1 388 ? 17.396  16.394  48.829 1.00 18.03 ? 385 ASP A O   1 
ATOM   3069 C CB  . ASP A 1 388 ? 15.505  14.947  50.789 1.00 18.61 ? 385 ASP A CB  1 
ATOM   3070 C CG  . ASP A 1 388 ? 14.720  14.955  52.093 1.00 17.66 ? 385 ASP A CG  1 
ATOM   3071 O OD1 . ASP A 1 388 ? 15.292  15.330  53.141 1.00 17.50 ? 385 ASP A OD1 1 
ATOM   3072 O OD2 . ASP A 1 388 ? 13.530  14.597  52.086 1.00 15.56 ? 385 ASP A OD2 1 
ATOM   3073 N N   . ILE A 1 389 ? 18.755  14.741  49.547 1.00 18.85 ? 386 ILE A N   1 
ATOM   3074 C CA  . ILE A 1 389 ? 19.619  14.769  48.381 1.00 17.58 ? 386 ILE A CA  1 
ATOM   3075 C C   . ILE A 1 389 ? 19.556  13.493  47.559 1.00 19.16 ? 386 ILE A C   1 
ATOM   3076 O O   . ILE A 1 389 ? 19.467  12.386  48.101 1.00 18.25 ? 386 ILE A O   1 
ATOM   3077 C CB  . ILE A 1 389 ? 21.080  15.001  48.797 1.00 17.59 ? 386 ILE A CB  1 
ATOM   3078 C CG1 . ILE A 1 389 ? 21.474  13.998  49.895 1.00 17.27 ? 386 ILE A CG1 1 
ATOM   3079 C CG2 . ILE A 1 389 ? 21.271  16.443  49.260 1.00 14.90 ? 386 ILE A CG2 1 
ATOM   3080 C CD1 . ILE A 1 389 ? 22.962  13.963  50.216 1.00 14.83 ? 386 ILE A CD1 1 
ATOM   3081 N N   . ASP A 1 390 ? 19.601  13.650  46.242 1.00 18.37 ? 387 ASP A N   1 
ATOM   3082 C CA  . ASP A 1 390 ? 19.561  12.507  45.346 1.00 17.47 ? 387 ASP A CA  1 
ATOM   3083 C C   . ASP A 1 390 ? 20.991  12.221  44.950 1.00 17.37 ? 387 ASP A C   1 
ATOM   3084 O O   . ASP A 1 390 ? 21.578  12.920  44.119 1.00 17.67 ? 387 ASP A O   1 
ATOM   3085 C CB  . ASP A 1 390 ? 18.691  12.819  44.125 1.00 16.76 ? 387 ASP A CB  1 
ATOM   3086 C CG  . ASP A 1 390 ? 17.253  13.066  44.499 1.00 17.55 ? 387 ASP A CG  1 
ATOM   3087 O OD1 . ASP A 1 390 ? 16.667  12.209  45.185 1.00 18.45 ? 387 ASP A OD1 1 
ATOM   3088 O OD2 . ASP A 1 390 ? 16.696  14.116  44.117 1.00 18.44 ? 387 ASP A OD2 1 
ATOM   3089 N N   . VAL A 1 391 ? 21.570  11.225  45.610 1.00 16.55 ? 388 VAL A N   1 
ATOM   3090 C CA  . VAL A 1 391 ? 22.948  10.834  45.378 1.00 17.33 ? 388 VAL A CA  1 
ATOM   3091 C C   . VAL A 1 391 ? 23.075  9.905   44.177 1.00 17.26 ? 388 VAL A C   1 
ATOM   3092 O O   . VAL A 1 391 ? 22.191  9.093   43.911 1.00 17.92 ? 388 VAL A O   1 
ATOM   3093 C CB  . VAL A 1 391 ? 23.543  10.152  46.635 1.00 19.08 ? 388 VAL A CB  1 
ATOM   3094 C CG1 . VAL A 1 391 ? 25.054  10.056  46.515 1.00 19.89 ? 388 VAL A CG1 1 
ATOM   3095 C CG2 . VAL A 1 391 ? 23.146  10.928  47.882 1.00 16.09 ? 388 VAL A CG2 1 
ATOM   3096 N N   . ASP A 1 392 ? 24.190  10.012  43.473 1.00 17.14 ? 389 ASP A N   1 
ATOM   3097 C CA  . ASP A 1 392 ? 24.419  9.199   42.282 1.00 20.86 ? 389 ASP A CA  1 
ATOM   3098 C C   . ASP A 1 392 ? 25.093  7.853   42.530 1.00 22.27 ? 389 ASP A C   1 
ATOM   3099 O O   . ASP A 1 392 ? 25.615  7.229   41.599 1.00 22.36 ? 389 ASP A O   1 
ATOM   3100 C CB  . ASP A 1 392 ? 25.189  10.005  41.227 1.00 21.13 ? 389 ASP A CB  1 
ATOM   3101 C CG  . ASP A 1 392 ? 26.622  10.358  41.646 1.00 24.30 ? 389 ASP A CG  1 
ATOM   3102 O OD1 . ASP A 1 392 ? 27.107  9.930   42.723 1.00 24.78 ? 389 ASP A OD1 1 
ATOM   3103 O OD2 . ASP A 1 392 ? 27.281  11.071  40.865 1.00 24.76 ? 389 ASP A OD2 1 
ATOM   3104 N N   . ILE A 1 393 ? 25.094  7.416   43.786 1.00 24.15 ? 390 ILE A N   1 
ATOM   3105 C CA  . ILE A 1 393 ? 25.708  6.153   44.160 1.00 23.97 ? 390 ILE A CA  1 
ATOM   3106 C C   . ILE A 1 393 ? 25.049  5.641   45.428 1.00 23.34 ? 390 ILE A C   1 
ATOM   3107 O O   . ILE A 1 393 ? 24.417  6.404   46.163 1.00 22.43 ? 390 ILE A O   1 
ATOM   3108 C CB  . ILE A 1 393 ? 27.252  6.308   44.380 1.00 26.22 ? 390 ILE A CB  1 
ATOM   3109 C CG1 . ILE A 1 393 ? 27.891  4.961   44.727 1.00 27.89 ? 390 ILE A CG1 1 
ATOM   3110 C CG2 . ILE A 1 393 ? 27.553  7.333   45.482 1.00 26.59 ? 390 ILE A CG2 1 
ATOM   3111 C CD1 . ILE A 1 393 ? 29.381  5.025   44.983 1.00 28.24 ? 390 ILE A CD1 1 
ATOM   3112 N N   . ASN A 1 394 ? 25.094  4.332   45.628 1.00 22.07 ? 391 ASN A N   1 
ATOM   3113 C CA  . ASN A 1 394 ? 24.538  3.747   46.838 1.00 22.53 ? 391 ASN A CA  1 
ATOM   3114 C C   . ASN A 1 394 ? 25.786  3.471   47.648 1.00 22.74 ? 391 ASN A C   1 
ATOM   3115 O O   . ASN A 1 394 ? 26.620  2.654   47.244 1.00 20.18 ? 391 ASN A O   1 
ATOM   3116 C CB  . ASN A 1 394 ? 23.801  2.439   46.549 1.00 24.87 ? 391 ASN A CB  1 
ATOM   3117 C CG  . ASN A 1 394 ? 23.135  1.858   47.786 1.00 24.04 ? 391 ASN A CG  1 
ATOM   3118 O OD1 . ASN A 1 394 ? 23.425  2.259   48.916 1.00 24.55 ? 391 ASN A OD1 1 
ATOM   3119 N ND2 . ASN A 1 394 ? 22.218  0.921   47.577 1.00 23.81 ? 391 ASN A ND2 1 
ATOM   3120 N N   . VAL A 1 395 ? 25.967  4.242   48.717 1.00 22.17 ? 392 VAL A N   1 
ATOM   3121 C CA  . VAL A 1 395 ? 27.140  4.112   49.579 1.00 21.74 ? 392 VAL A CA  1 
ATOM   3122 C C   . VAL A 1 395 ? 27.088  2.874   50.468 1.00 21.44 ? 392 VAL A C   1 
ATOM   3123 O O   . VAL A 1 395 ? 28.113  2.461   51.012 1.00 22.26 ? 392 VAL A O   1 
ATOM   3124 C CB  . VAL A 1 395 ? 27.366  5.385   50.461 1.00 21.82 ? 392 VAL A CB  1 
ATOM   3125 C CG1 . VAL A 1 395 ? 27.661  6.591   49.575 1.00 21.32 ? 392 VAL A CG1 1 
ATOM   3126 C CG2 . VAL A 1 395 ? 26.158  5.655   51.332 1.00 20.30 ? 392 VAL A CG2 1 
ATOM   3127 N N   . GLY A 1 396 ? 25.914  2.254   50.559 1.00 21.33 ? 393 GLY A N   1 
ATOM   3128 C CA  . GLY A 1 396 ? 25.762  1.069   51.384 1.00 23.67 ? 393 GLY A CA  1 
ATOM   3129 C C   . GLY A 1 396 ? 25.680  1.455   52.848 1.00 22.90 ? 393 GLY A C   1 
ATOM   3130 O O   . GLY A 1 396 ? 25.000  2.419   53.208 1.00 22.40 ? 393 GLY A O   1 
ATOM   3131 N N   . GLU A 1 397 ? 26.347  0.696   53.707 1.00 24.03 ? 394 GLU A N   1 
ATOM   3132 C CA  . GLU A 1 397 ? 26.339  1.011   55.133 1.00 24.75 ? 394 GLU A CA  1 
ATOM   3133 C C   . GLU A 1 397 ? 27.162  2.288   55.287 1.00 20.80 ? 394 GLU A C   1 
ATOM   3134 O O   . GLU A 1 397 ? 28.345  2.313   54.931 1.00 21.21 ? 394 GLU A O   1 
ATOM   3135 C CB  . GLU A 1 397 ? 26.975  -0.128  55.939 1.00 27.49 ? 394 GLU A CB  1 
ATOM   3136 C CG  . GLU A 1 397 ? 27.091  0.157   57.439 1.00 32.54 ? 394 GLU A CG  1 
ATOM   3137 C CD  . GLU A 1 397 ? 28.111  -0.737  58.137 1.00 34.62 ? 394 GLU A CD  1 
ATOM   3138 O OE1 . GLU A 1 397 ? 29.326  -0.634  57.830 1.00 36.00 ? 394 GLU A OE1 1 
ATOM   3139 O OE2 . GLU A 1 397 ? 27.701  -1.537  59.002 1.00 37.13 ? 394 GLU A OE2 1 
ATOM   3140 N N   . ILE A 1 398 ? 26.526  3.358   55.752 1.00 21.34 ? 395 ILE A N   1 
ATOM   3141 C CA  . ILE A 1 398 ? 27.222  4.629   55.921 1.00 19.22 ? 395 ILE A CA  1 
ATOM   3142 C C   . ILE A 1 398 ? 28.080  4.530   57.177 1.00 19.72 ? 395 ILE A C   1 
ATOM   3143 O O   . ILE A 1 398 ? 27.561  4.372   58.279 1.00 18.70 ? 395 ILE A O   1 
ATOM   3144 C CB  . ILE A 1 398 ? 26.245  5.816   56.017 1.00 20.33 ? 395 ILE A CB  1 
ATOM   3145 C CG1 . ILE A 1 398 ? 25.298  5.809   54.804 1.00 20.86 ? 395 ILE A CG1 1 
ATOM   3146 C CG2 . ILE A 1 398 ? 27.038  7.131   56.027 1.00 21.27 ? 395 ILE A CG2 1 
ATOM   3147 C CD1 . ILE A 1 398 ? 24.117  6.745   54.913 1.00 21.42 ? 395 ILE A CD1 1 
ATOM   3148 N N   . GLN A 1 399 ? 29.389  4.600   56.988 1.00 18.82 ? 396 GLN A N   1 
ATOM   3149 C CA  . GLN A 1 399 ? 30.354  4.471   58.078 1.00 21.01 ? 396 GLN A CA  1 
ATOM   3150 C C   . GLN A 1 399 ? 30.855  5.800   58.645 1.00 21.75 ? 396 GLN A C   1 
ATOM   3151 O O   . GLN A 1 399 ? 31.318  5.857   59.786 1.00 19.73 ? 396 GLN A O   1 
ATOM   3152 C CB  . GLN A 1 399 ? 31.514  3.595   57.609 1.00 21.33 ? 396 GLN A CB  1 
ATOM   3153 C CG  . GLN A 1 399 ? 31.039  2.212   57.170 1.00 25.32 ? 396 GLN A CG  1 
ATOM   3154 C CD  . GLN A 1 399 ? 32.087  1.434   56.412 1.00 27.39 ? 396 GLN A CD  1 
ATOM   3155 O OE1 . GLN A 1 399 ? 32.811  1.985   55.587 1.00 29.89 ? 396 GLN A OE1 1 
ATOM   3156 N NE2 . GLN A 1 399 ? 32.168  0.139   56.681 1.00 29.10 ? 396 GLN A NE2 1 
ATOM   3157 N N   . LYS A 1 400 ? 30.787  6.856   57.843 1.00 20.45 ? 397 LYS A N   1 
ATOM   3158 C CA  . LYS A 1 400 ? 31.194  8.187   58.285 1.00 22.08 ? 397 LYS A CA  1 
ATOM   3159 C C   . LYS A 1 400 ? 30.720  9.215   57.264 1.00 22.06 ? 397 LYS A C   1 
ATOM   3160 O O   . LYS A 1 400 ? 30.329  8.845   56.146 1.00 19.26 ? 397 LYS A O   1 
ATOM   3161 C CB  . LYS A 1 400 ? 32.717  8.293   58.477 1.00 22.91 ? 397 LYS A CB  1 
ATOM   3162 C CG  . LYS A 1 400 ? 33.541  8.291   57.209 1.00 23.38 ? 397 LYS A CG  1 
ATOM   3163 C CD  . LYS A 1 400 ? 35.017  8.474   57.516 1.00 25.71 ? 397 LYS A CD  1 
ATOM   3164 C CE  . LYS A 1 400 ? 35.851  8.296   56.263 1.00 24.61 ? 397 LYS A CE  1 
ATOM   3165 N NZ  . LYS A 1 400 ? 37.317  8.331   56.518 1.00 26.39 ? 397 LYS A NZ  1 
ATOM   3166 N N   . VAL A 1 401 ? 30.691  10.483  57.670 1.00 20.08 ? 398 VAL A N   1 
ATOM   3167 C CA  . VAL A 1 401 ? 30.280  11.577  56.787 1.00 19.30 ? 398 VAL A CA  1 
ATOM   3168 C C   . VAL A 1 401 ? 31.303  12.694  56.953 1.00 22.56 ? 398 VAL A C   1 
ATOM   3169 O O   . VAL A 1 401 ? 32.057  12.715  57.936 1.00 21.67 ? 398 VAL A O   1 
ATOM   3170 C CB  . VAL A 1 401 ? 28.865  12.147  57.132 1.00 20.21 ? 398 VAL A CB  1 
ATOM   3171 C CG1 . VAL A 1 401 ? 27.788  11.070  57.035 1.00 19.93 ? 398 VAL A CG1 1 
ATOM   3172 C CG2 . VAL A 1 401 ? 28.852  12.782  58.516 1.00 18.14 ? 398 VAL A CG2 1 
ATOM   3173 N N   . LYS A 1 402 ? 31.348  13.602  55.985 1.00 21.03 ? 399 LYS A N   1 
ATOM   3174 C CA  . LYS A 1 402 ? 32.258  14.733  56.049 1.00 18.39 ? 399 LYS A CA  1 
ATOM   3175 C C   . LYS A 1 402 ? 31.463  16.003  55.824 1.00 19.00 ? 399 LYS A C   1 
ATOM   3176 O O   . LYS A 1 402 ? 30.535  16.033  55.007 1.00 15.80 ? 399 LYS A O   1 
ATOM   3177 C CB  . LYS A 1 402 ? 33.390  14.605  55.024 1.00 18.41 ? 399 LYS A CB  1 
ATOM   3178 C CG  . LYS A 1 402 ? 34.329  13.435  55.301 1.00 17.57 ? 399 LYS A CG  1 
ATOM   3179 C CD  . LYS A 1 402 ? 35.519  13.420  54.368 1.00 19.21 ? 399 LYS A CD  1 
ATOM   3180 C CE  . LYS A 1 402 ? 36.466  12.300  54.740 1.00 22.96 ? 399 LYS A CE  1 
ATOM   3181 N NZ  . LYS A 1 402 ? 37.662  12.294  53.863 1.00 24.59 ? 399 LYS A NZ  1 
ATOM   3182 N N   . PHE A 1 403 ? 31.787  17.021  56.614 1.00 15.43 ? 400 PHE A N   1 
ATOM   3183 C CA  . PHE A 1 403 ? 31.141  18.317  56.565 1.00 15.64 ? 400 PHE A CA  1 
ATOM   3184 C C   . PHE A 1 403 ? 32.140  19.316  55.985 1.00 17.31 ? 400 PHE A C   1 
ATOM   3185 O O   . PHE A 1 403 ? 33.357  19.209  56.216 1.00 12.99 ? 400 PHE A O   1 
ATOM   3186 C CB  . PHE A 1 403 ? 30.695  18.706  57.984 1.00 15.33 ? 400 PHE A CB  1 
ATOM   3187 C CG  . PHE A 1 403 ? 30.248  20.136  58.126 1.00 14.85 ? 400 PHE A CG  1 
ATOM   3188 C CD1 . PHE A 1 403 ? 28.931  20.492  57.879 1.00 11.82 ? 400 PHE A CD1 1 
ATOM   3189 C CD2 . PHE A 1 403 ? 31.137  21.112  58.558 1.00 15.58 ? 400 PHE A CD2 1 
ATOM   3190 C CE1 . PHE A 1 403 ? 28.492  21.804  58.065 1.00 13.32 ? 400 PHE A CE1 1 
ATOM   3191 C CE2 . PHE A 1 403 ? 30.710  22.433  58.748 1.00 14.36 ? 400 PHE A CE2 1 
ATOM   3192 C CZ  . PHE A 1 403 ? 29.389  22.777  58.502 1.00 12.60 ? 400 PHE A CZ  1 
ATOM   3193 N N   . LEU A 1 404 ? 31.638  20.290  55.234 1.00 15.98 ? 401 LEU A N   1 
ATOM   3194 C CA  . LEU A 1 404 ? 32.494  21.286  54.601 1.00 17.77 ? 401 LEU A CA  1 
ATOM   3195 C C   . LEU A 1 404 ? 31.699  22.582  54.504 1.00 17.63 ? 401 LEU A C   1 
ATOM   3196 O O   . LEU A 1 404 ? 30.479  22.548  54.346 1.00 16.33 ? 401 LEU A O   1 
ATOM   3197 C CB  . LEU A 1 404 ? 32.863  20.781  53.192 1.00 19.72 ? 401 LEU A CB  1 
ATOM   3198 C CG  . LEU A 1 404 ? 33.763  21.455  52.141 1.00 19.78 ? 401 LEU A CG  1 
ATOM   3199 C CD1 . LEU A 1 404 ? 33.196  22.796  51.668 1.00 19.53 ? 401 LEU A CD1 1 
ATOM   3200 C CD2 . LEU A 1 404 ? 35.161  21.611  52.647 1.00 21.55 ? 401 LEU A CD2 1 
ATOM   3201 N N   . TRP A 1 405 ? 32.359  23.723  54.674 1.00 18.19 ? 402 TRP A N   1 
ATOM   3202 C CA  . TRP A 1 405 ? 31.637  24.981  54.536 1.00 19.86 ? 402 TRP A CA  1 
ATOM   3203 C C   . TRP A 1 405 ? 32.453  25.995  53.746 1.00 18.83 ? 402 TRP A C   1 
ATOM   3204 O O   . TRP A 1 405 ? 33.674  25.867  53.615 1.00 18.07 ? 402 TRP A O   1 
ATOM   3205 C CB  . TRP A 1 405 ? 31.190  25.544  55.898 1.00 20.33 ? 402 TRP A CB  1 
ATOM   3206 C CG  . TRP A 1 405 ? 32.278  26.164  56.720 1.00 20.54 ? 402 TRP A CG  1 
ATOM   3207 C CD1 . TRP A 1 405 ? 33.189  25.515  57.496 1.00 21.72 ? 402 TRP A CD1 1 
ATOM   3208 C CD2 . TRP A 1 405 ? 32.576  27.563  56.831 1.00 22.43 ? 402 TRP A CD2 1 
ATOM   3209 N NE1 . TRP A 1 405 ? 34.045  26.419  58.083 1.00 21.12 ? 402 TRP A NE1 1 
ATOM   3210 C CE2 . TRP A 1 405 ? 33.688  27.685  57.696 1.00 21.96 ? 402 TRP A CE2 1 
ATOM   3211 C CE3 . TRP A 1 405 ? 32.008  28.726  56.288 1.00 22.32 ? 402 TRP A CE3 1 
ATOM   3212 C CZ2 . TRP A 1 405 ? 34.256  28.924  58.023 1.00 23.55 ? 402 TRP A CZ2 1 
ATOM   3213 C CZ3 . TRP A 1 405 ? 32.575  29.965  56.614 1.00 23.38 ? 402 TRP A CZ3 1 
ATOM   3214 C CH2 . TRP A 1 405 ? 33.685  30.048  57.477 1.00 22.89 ? 402 TRP A CH2 1 
ATOM   3215 N N   . ASN A 1 406 ? 31.763  26.953  53.145 1.00 21.79 ? 403 ASN A N   1 
ATOM   3216 C CA  . ASN A 1 406 ? 32.431  27.997  52.390 1.00 24.30 ? 403 ASN A CA  1 
ATOM   3217 C C   . ASN A 1 406 ? 31.544  29.221  52.214 1.00 25.89 ? 403 ASN A C   1 
ATOM   3218 O O   . ASN A 1 406 ? 30.429  29.257  52.733 1.00 22.76 ? 403 ASN A O   1 
ATOM   3219 C CB  . ASN A 1 406 ? 33.000  27.478  51.056 1.00 26.63 ? 403 ASN A CB  1 
ATOM   3220 C CG  . ASN A 1 406 ? 31.982  26.734  50.197 1.00 25.60 ? 403 ASN A CG  1 
ATOM   3221 O OD1 . ASN A 1 406 ? 30.830  27.137  50.060 1.00 29.20 ? 403 ASN A OD1 1 
ATOM   3222 N ND2 . ASN A 1 406 ? 32.429  25.659  49.581 1.00 26.89 ? 403 ASN A ND2 1 
ATOM   3223 N N   . ASN A 1 407 ? 32.067  30.253  51.561 1.00 32.21 ? 404 ASN A N   1 
ATOM   3224 C CA  . ASN A 1 407 ? 31.298  31.476  51.338 1.00 34.56 ? 404 ASN A CA  1 
ATOM   3225 C C   . ASN A 1 407 ? 31.041  31.737  49.850 1.00 36.78 ? 404 ASN A C   1 
ATOM   3226 O O   . ASN A 1 407 ? 31.930  32.296  49.166 1.00 39.92 ? 404 ASN A O   1 
ATOM   3227 C CB  . ASN A 1 407 ? 31.998  32.673  51.991 1.00 32.72 ? 404 ASN A CB  1 
ATOM   3228 N N   . ARG A 1 414 ? 40.107  34.221  59.995 1.00 31.36 ? 412 ARG A N   1 
ATOM   3229 C CA  . ARG A 1 414 ? 40.114  32.740  59.771 1.00 31.41 ? 412 ARG A CA  1 
ATOM   3230 C C   . ARG A 1 414 ? 39.049  32.075  60.642 1.00 29.89 ? 412 ARG A C   1 
ATOM   3231 O O   . ARG A 1 414 ? 39.363  31.353  61.589 1.00 29.66 ? 412 ARG A O   1 
ATOM   3232 C CB  . ARG A 1 414 ? 41.491  32.167  60.086 1.00 29.84 ? 412 ARG A CB  1 
ATOM   3233 N N   . PRO A 1 415 ? 37.770  32.326  60.338 1.00 28.87 ? 413 PRO A N   1 
ATOM   3234 C CA  . PRO A 1 415 ? 36.669  31.746  61.107 1.00 27.00 ? 413 PRO A CA  1 
ATOM   3235 C C   . PRO A 1 415 ? 36.582  30.229  60.937 1.00 26.14 ? 413 PRO A C   1 
ATOM   3236 O O   . PRO A 1 415 ? 37.068  29.676  59.947 1.00 25.52 ? 413 PRO A O   1 
ATOM   3237 C CB  . PRO A 1 415 ? 35.451  32.439  60.508 1.00 29.03 ? 413 PRO A CB  1 
ATOM   3238 C CG  . PRO A 1 415 ? 35.835  32.561  59.064 1.00 27.94 ? 413 PRO A CG  1 
ATOM   3239 C CD  . PRO A 1 415 ? 37.260  33.057  59.163 1.00 29.38 ? 413 PRO A CD  1 
ATOM   3240 N N   . THR A 1 416 ? 35.972  29.564  61.914 1.00 24.60 ? 414 THR A N   1 
ATOM   3241 C CA  . THR A 1 416 ? 35.807  28.117  61.866 1.00 20.41 ? 414 THR A CA  1 
ATOM   3242 C C   . THR A 1 416 ? 34.363  27.789  62.165 1.00 19.30 ? 414 THR A C   1 
ATOM   3243 O O   . THR A 1 416 ? 33.684  28.519  62.891 1.00 18.46 ? 414 THR A O   1 
ATOM   3244 C CB  . THR A 1 416 ? 36.694  27.372  62.884 1.00 19.81 ? 414 THR A CB  1 
ATOM   3245 O OG1 . THR A 1 416 ? 36.307  27.729  64.216 1.00 19.13 ? 414 THR A OG1 1 
ATOM   3246 C CG2 . THR A 1 416 ? 38.150  27.673  62.647 1.00 20.74 ? 414 THR A CG2 1 
ATOM   3247 N N   . LEU A 1 417 ? 33.907  26.670  61.621 1.00 17.85 ? 415 LEU A N   1 
ATOM   3248 C CA  . LEU A 1 417 ? 32.542  26.230  61.807 1.00 14.99 ? 415 LEU A CA  1 
ATOM   3249 C C   . LEU A 1 417 ? 32.567  24.712  61.717 1.00 13.02 ? 415 LEU A C   1 
ATOM   3250 O O   . LEU A 1 417 ? 33.471  24.140  61.111 1.00 13.90 ? 415 LEU A O   1 
ATOM   3251 C CB  . LEU A 1 417 ? 31.667  26.780  60.670 1.00 15.65 ? 415 LEU A CB  1 
ATOM   3252 C CG  . LEU A 1 417 ? 30.168  26.512  60.795 1.00 15.85 ? 415 LEU A CG  1 
ATOM   3253 C CD1 . LEU A 1 417 ? 29.568  27.447  61.815 1.00 14.58 ? 415 LEU A CD1 1 
ATOM   3254 C CD2 . LEU A 1 417 ? 29.479  26.685  59.439 1.00 15.21 ? 415 LEU A CD2 1 
ATOM   3255 N N   . GLY A 1 418 ? 31.577  24.061  62.305 1.00 16.04 ? 416 GLY A N   1 
ATOM   3256 C CA  . GLY A 1 418 ? 31.529  22.617  62.231 1.00 16.31 ? 416 GLY A CA  1 
ATOM   3257 C C   . GLY A 1 418 ? 30.115  22.119  62.387 1.00 15.91 ? 416 GLY A C   1 
ATOM   3258 O O   . GLY A 1 418 ? 29.172  22.901  62.424 1.00 16.94 ? 416 GLY A O   1 
ATOM   3259 N N   . ALA A 1 419 ? 29.970  20.799  62.383 1.00 15.21 ? 417 ALA A N   1 
ATOM   3260 C CA  . ALA A 1 419 ? 28.690  20.159  62.592 1.00 13.71 ? 417 ALA A CA  1 
ATOM   3261 C C   . ALA A 1 419 ? 28.991  19.283  63.803 1.00 15.07 ? 417 ALA A C   1 
ATOM   3262 O O   . ALA A 1 419 ? 29.987  18.575  63.808 1.00 14.07 ? 417 ALA A O   1 
ATOM   3263 C CB  . ALA A 1 419 ? 28.319  19.291  61.408 1.00 14.93 ? 417 ALA A CB  1 
ATOM   3264 N N   . SER A 1 420 ? 28.192  19.403  64.848 1.00 16.07 ? 418 SER A N   1 
ATOM   3265 C CA  . SER A 1 420 ? 28.406  18.585  66.039 1.00 18.83 ? 418 SER A CA  1 
ATOM   3266 C C   . SER A 1 420 ? 27.779  17.210  65.819 1.00 18.92 ? 418 SER A C   1 
ATOM   3267 O O   . SER A 1 420 ? 28.252  16.202  66.357 1.00 19.00 ? 418 SER A O   1 
ATOM   3268 C CB  . SER A 1 420 ? 27.792  19.252  67.259 1.00 15.88 ? 418 SER A CB  1 
ATOM   3269 O OG  . SER A 1 420 ? 26.459  19.647  66.998 1.00 17.72 ? 418 SER A OG  1 
ATOM   3270 N N   . GLN A 1 421 ? 26.713  17.184  65.022 1.00 18.28 ? 419 GLN A N   1 
ATOM   3271 C CA  . GLN A 1 421 ? 26.002  15.956  64.708 1.00 17.21 ? 419 GLN A CA  1 
ATOM   3272 C C   . GLN A 1 421 ? 25.316  16.052  63.351 1.00 17.66 ? 419 GLN A C   1 
ATOM   3273 O O   . GLN A 1 421 ? 24.739  17.090  62.996 1.00 14.59 ? 419 GLN A O   1 
ATOM   3274 C CB  . GLN A 1 421 ? 24.943  15.656  65.768 1.00 21.12 ? 419 GLN A CB  1 
ATOM   3275 C CG  . GLN A 1 421 ? 24.284  14.291  65.597 1.00 24.90 ? 419 GLN A CG  1 
ATOM   3276 C CD  . GLN A 1 421 ? 23.153  14.036  66.573 1.00 28.02 ? 419 GLN A CD  1 
ATOM   3277 O OE1 . GLN A 1 421 ? 22.172  13.371  66.237 1.00 30.21 ? 419 GLN A OE1 1 
ATOM   3278 N NE2 . GLN A 1 421 ? 23.278  14.556  67.780 1.00 30.31 ? 419 GLN A NE2 1 
ATOM   3279 N N   . ILE A 1 422 ? 25.370  14.954  62.609 1.00 14.76 ? 420 ILE A N   1 
ATOM   3280 C CA  . ILE A 1 422 ? 24.718  14.855  61.308 1.00 14.34 ? 420 ILE A CA  1 
ATOM   3281 C C   . ILE A 1 422 ? 24.003  13.507  61.268 1.00 17.16 ? 420 ILE A C   1 
ATOM   3282 O O   . ILE A 1 422 ? 24.576  12.481  61.646 1.00 17.67 ? 420 ILE A O   1 
ATOM   3283 C CB  . ILE A 1 422 ? 25.726  14.924  60.140 1.00 12.33 ? 420 ILE A CB  1 
ATOM   3284 C CG1 . ILE A 1 422 ? 26.297  16.337  60.011 1.00 14.21 ? 420 ILE A CG1 1 
ATOM   3285 C CG2 . ILE A 1 422 ? 25.046  14.504  58.822 1.00 14.58 ? 420 ILE A CG2 1 
ATOM   3286 C CD1 . ILE A 1 422 ? 27.361  16.464  58.946 1.00 14.43 ? 420 ILE A CD1 1 
ATOM   3287 N N   . THR A 1 423 ? 22.737  13.525  60.864 1.00 19.12 ? 421 THR A N   1 
ATOM   3288 C CA  . THR A 1 423 ? 21.927  12.320  60.751 1.00 17.42 ? 421 THR A CA  1 
ATOM   3289 C C   . THR A 1 423 ? 21.696  12.121  59.248 1.00 19.24 ? 421 THR A C   1 
ATOM   3290 O O   . THR A 1 423 ? 21.511  13.098  58.523 1.00 18.81 ? 421 THR A O   1 
ATOM   3291 C CB  . THR A 1 423 ? 20.552  12.505  61.427 1.00 18.90 ? 421 THR A CB  1 
ATOM   3292 O OG1 . THR A 1 423 ? 20.717  12.713  62.841 1.00 19.45 ? 421 THR A OG1 1 
ATOM   3293 C CG2 . THR A 1 423 ? 19.670  11.286  61.197 1.00 19.08 ? 421 THR A CG2 1 
ATOM   3294 N N   . VAL A 1 424 ? 21.791  10.880  58.781 1.00 16.65 ? 422 VAL A N   1 
ATOM   3295 C CA  . VAL A 1 424 ? 21.561  10.559  57.373 1.00 18.63 ? 422 VAL A CA  1 
ATOM   3296 C C   . VAL A 1 424 ? 20.586  9.386   57.404 1.00 20.75 ? 422 VAL A C   1 
ATOM   3297 O O   . VAL A 1 424 ? 20.846  8.370   58.049 1.00 21.72 ? 422 VAL A O   1 
ATOM   3298 C CB  . VAL A 1 424 ? 22.871  10.162  56.641 1.00 19.32 ? 422 VAL A CB  1 
ATOM   3299 C CG1 . VAL A 1 424 ? 22.602  9.931   55.149 1.00 18.54 ? 422 VAL A CG1 1 
ATOM   3300 C CG2 . VAL A 1 424 ? 23.926  11.256  56.803 1.00 19.18 ? 422 VAL A CG2 1 
ATOM   3301 N N   . GLN A 1 425 ? 19.435  9.551   56.763 1.00 18.76 ? 423 GLN A N   1 
ATOM   3302 C CA  . GLN A 1 425 ? 18.420  8.514   56.750 1.00 17.88 ? 423 GLN A CA  1 
ATOM   3303 C C   . GLN A 1 425 ? 18.297  7.962   55.342 1.00 21.16 ? 423 GLN A C   1 
ATOM   3304 O O   . GLN A 1 425 ? 18.256  8.736   54.381 1.00 17.88 ? 423 GLN A O   1 
ATOM   3305 C CB  . GLN A 1 425 ? 17.081  9.106   57.205 1.00 17.99 ? 423 GLN A CB  1 
ATOM   3306 C CG  . GLN A 1 425 ? 15.933  8.116   57.323 1.00 17.00 ? 423 GLN A CG  1 
ATOM   3307 C CD  . GLN A 1 425 ? 14.654  8.728   57.879 1.00 20.12 ? 423 GLN A CD  1 
ATOM   3308 O OE1 . GLN A 1 425 ? 13.882  8.062   58.573 1.00 20.45 ? 423 GLN A OE1 1 
ATOM   3309 N NE2 . GLN A 1 425 ? 14.405  9.991   57.555 1.00 18.52 ? 423 GLN A NE2 1 
ATOM   3310 N N   . SER A 1 426 ? 18.320  6.637   55.211 1.00 19.41 ? 424 SER A N   1 
ATOM   3311 C CA  . SER A 1 426 ? 18.176  6.019   53.898 1.00 19.69 ? 424 SER A CA  1 
ATOM   3312 C C   . SER A 1 426 ? 16.682  5.857   53.630 1.00 17.17 ? 424 SER A C   1 
ATOM   3313 O O   . SER A 1 426 ? 15.895  5.593   54.539 1.00 15.32 ? 424 SER A O   1 
ATOM   3314 C CB  . SER A 1 426 ? 18.918  4.680   53.842 1.00 22.82 ? 424 SER A CB  1 
ATOM   3315 O OG  . SER A 1 426 ? 18.623  3.891   54.974 1.00 25.62 ? 424 SER A OG  1 
ATOM   3316 N N   . GLY A 1 427 ? 16.270  6.066   52.387 1.00 19.72 ? 425 GLY A N   1 
ATOM   3317 C CA  . GLY A 1 427 ? 14.859  5.950   52.074 1.00 20.83 ? 425 GLY A CA  1 
ATOM   3318 C C   . GLY A 1 427 ? 14.198  4.586   52.146 1.00 21.35 ? 425 GLY A C   1 
ATOM   3319 O O   . GLY A 1 427 ? 13.098  4.479   52.683 1.00 19.03 ? 425 GLY A O   1 
ATOM   3320 N N   . VAL A 1 428 ? 14.874  3.552   51.646 1.00 23.76 ? 426 VAL A N   1 
ATOM   3321 C CA  . VAL A 1 428 ? 14.329  2.193   51.596 1.00 26.84 ? 426 VAL A CA  1 
ATOM   3322 C C   . VAL A 1 428 ? 13.686  1.649   52.868 1.00 29.15 ? 426 VAL A C   1 
ATOM   3323 O O   . VAL A 1 428 ? 12.666  0.972   52.792 1.00 29.08 ? 426 VAL A O   1 
ATOM   3324 C CB  . VAL A 1 428 ? 15.376  1.168   51.043 1.00 27.98 ? 426 VAL A CB  1 
ATOM   3325 C CG1 . VAL A 1 428 ? 16.443  0.863   52.081 1.00 29.54 ? 426 VAL A CG1 1 
ATOM   3326 C CG2 . VAL A 1 428 ? 14.677  -0.123  50.565 1.00 28.45 ? 426 VAL A CG2 1 
ATOM   3327 N N   . ASP A 1 429 ? 14.249  1.984   54.030 1.00 28.67 ? 427 ASP A N   1 
ATOM   3328 C CA  . ASP A 1 429 ? 13.724  1.498   55.307 1.00 27.68 ? 427 ASP A CA  1 
ATOM   3329 C C   . ASP A 1 429 ? 13.675  2.532   56.437 1.00 26.45 ? 427 ASP A C   1 
ATOM   3330 O O   . ASP A 1 429 ? 13.325  2.197   57.574 1.00 23.92 ? 427 ASP A O   1 
ATOM   3331 C CB  . ASP A 1 429 ? 14.504  0.257   55.769 1.00 29.47 ? 427 ASP A CB  1 
ATOM   3332 C CG  . ASP A 1 429 ? 16.018  0.450   55.737 1.00 29.83 ? 427 ASP A CG  1 
ATOM   3333 O OD1 . ASP A 1 429 ? 16.507  1.594   55.586 1.00 30.85 ? 427 ASP A OD1 1 
ATOM   3334 O OD2 . ASP A 1 429 ? 16.731  -0.566  55.863 1.00 32.04 ? 427 ASP A OD2 1 
ATOM   3335 N N   . GLY A 1 430 A 14.026  3.778   56.133 1.00 23.27 ? 427 GLY A N   1 
ATOM   3336 C CA  . GLY A 1 430 A 13.997  4.816   57.151 1.00 22.39 ? 427 GLY A CA  1 
ATOM   3337 C C   . GLY A 1 430 A 15.112  4.718   58.179 1.00 21.01 ? 427 GLY A C   1 
ATOM   3338 O O   . GLY A 1 430 A 15.074  5.397   59.205 1.00 22.52 ? 427 GLY A O   1 
ATOM   3339 N N   . LYS A 1 431 ? 16.124  3.908   57.880 1.00 22.04 ? 428 LYS A N   1 
ATOM   3340 C CA  . LYS A 1 431 ? 17.267  3.707   58.776 1.00 24.73 ? 428 LYS A CA  1 
ATOM   3341 C C   . LYS A 1 431 ? 18.054  5.006   58.990 1.00 26.21 ? 428 LYS A C   1 
ATOM   3342 O O   . LYS A 1 431 ? 18.533  5.627   58.034 1.00 25.49 ? 428 LYS A O   1 
ATOM   3343 C CB  . LYS A 1 431 ? 18.184  2.631   58.187 1.00 25.92 ? 428 LYS A CB  1 
ATOM   3344 C CG  . LYS A 1 431 ? 19.482  2.378   58.933 1.00 28.52 ? 428 LYS A CG  1 
ATOM   3345 C CD  . LYS A 1 431 ? 19.314  1.423   60.095 1.00 28.22 ? 428 LYS A CD  1 
ATOM   3346 C CE  . LYS A 1 431 ? 20.676  1.055   60.691 1.00 30.86 ? 428 LYS A CE  1 
ATOM   3347 N NZ  . LYS A 1 431 ? 21.571  0.390   59.693 1.00 32.00 ? 428 LYS A NZ  1 
ATOM   3348 N N   . GLU A 1 432 ? 18.181  5.413   60.246 1.00 25.43 ? 429 GLU A N   1 
ATOM   3349 C CA  . GLU A 1 432 ? 18.913  6.625   60.582 1.00 25.23 ? 429 GLU A CA  1 
ATOM   3350 C C   . GLU A 1 432 ? 20.314  6.316   61.076 1.00 24.07 ? 429 GLU A C   1 
ATOM   3351 O O   . GLU A 1 432 ? 20.506  5.459   61.938 1.00 25.16 ? 429 GLU A O   1 
ATOM   3352 C CB  . GLU A 1 432 ? 18.156  7.437   61.632 1.00 27.62 ? 429 GLU A CB  1 
ATOM   3353 C CG  . GLU A 1 432 ? 16.836  7.998   61.128 1.00 29.92 ? 429 GLU A CG  1 
ATOM   3354 C CD  . GLU A 1 432 ? 16.132  8.857   62.155 1.00 31.80 ? 429 GLU A CD  1 
ATOM   3355 O OE1 . GLU A 1 432 ? 15.654  8.308   63.170 1.00 34.69 ? 429 GLU A OE1 1 
ATOM   3356 O OE2 . GLU A 1 432 ? 16.051  10.085  61.947 1.00 33.81 ? 429 GLU A OE2 1 
ATOM   3357 N N   . TYR A 1 433 ? 21.293  6.963   60.460 1.00 21.00 ? 430 TYR A N   1 
ATOM   3358 C CA  . TYR A 1 433 ? 22.687  6.813   60.829 1.00 22.87 ? 430 TYR A CA  1 
ATOM   3359 C C   . TYR A 1 433 ? 23.095  8.159   61.433 1.00 23.84 ? 430 TYR A C   1 
ATOM   3360 O O   . TYR A 1 433 ? 22.842  9.217   60.838 1.00 23.14 ? 430 TYR A O   1 
ATOM   3361 C CB  . TYR A 1 433 ? 23.545  6.524   59.598 1.00 21.98 ? 430 TYR A CB  1 
ATOM   3362 C CG  . TYR A 1 433 ? 23.220  5.242   58.863 1.00 24.32 ? 430 TYR A CG  1 
ATOM   3363 C CD1 . TYR A 1 433 ? 22.135  5.173   57.982 1.00 24.06 ? 430 TYR A CD1 1 
ATOM   3364 C CD2 . TYR A 1 433 ? 24.030  4.114   58.997 1.00 24.46 ? 430 TYR A CD2 1 
ATOM   3365 C CE1 . TYR A 1 433 ? 21.872  4.013   57.251 1.00 24.97 ? 430 TYR A CE1 1 
ATOM   3366 C CE2 . TYR A 1 433 ? 23.776  2.948   58.269 1.00 24.96 ? 430 TYR A CE2 1 
ATOM   3367 C CZ  . TYR A 1 433 ? 22.696  2.906   57.396 1.00 26.21 ? 430 TYR A CZ  1 
ATOM   3368 O OH  . TYR A 1 433 ? 22.444  1.765   56.663 1.00 26.85 ? 430 TYR A OH  1 
ATOM   3369 N N   . ASN A 1 434 ? 23.719  8.128   62.607 1.00 21.50 ? 431 ASN A N   1 
ATOM   3370 C CA  . ASN A 1 434 ? 24.135  9.356   63.272 1.00 22.18 ? 431 ASN A CA  1 
ATOM   3371 C C   . ASN A 1 434 ? 25.642  9.442   63.370 1.00 20.91 ? 431 ASN A C   1 
ATOM   3372 O O   . ASN A 1 434 ? 26.323  8.430   63.577 1.00 21.34 ? 431 ASN A O   1 
ATOM   3373 C CB  . ASN A 1 434 ? 23.522  9.449   64.665 1.00 23.32 ? 431 ASN A CB  1 
ATOM   3374 C CG  . ASN A 1 434 ? 22.018  9.373   64.636 1.00 26.55 ? 431 ASN A CG  1 
ATOM   3375 O OD1 . ASN A 1 434 ? 21.431  8.314   64.859 1.00 29.14 ? 431 ASN A OD1 1 
ATOM   3376 N ND2 . ASN A 1 434 ? 21.380  10.491  64.362 1.00 26.45 ? 431 ASN A ND2 1 
ATOM   3377 N N   . PHE A 1 435 ? 26.163  10.654  63.205 1.00 18.46 ? 432 PHE A N   1 
ATOM   3378 C CA  . PHE A 1 435 ? 27.594  10.885  63.259 1.00 17.93 ? 432 PHE A CA  1 
ATOM   3379 C C   . PHE A 1 435 ? 27.826  12.099  64.139 1.00 18.76 ? 432 PHE A C   1 
ATOM   3380 O O   . PHE A 1 435 ? 27.007  13.011  64.170 1.00 18.55 ? 432 PHE A O   1 
ATOM   3381 C CB  . PHE A 1 435 ? 28.153  11.065  61.850 1.00 15.95 ? 432 PHE A CB  1 
ATOM   3382 C CG  . PHE A 1 435 ? 27.860  9.894   60.952 1.00 16.74 ? 432 PHE A CG  1 
ATOM   3383 C CD1 . PHE A 1 435 ? 28.719  8.803   60.915 1.00 17.28 ? 432 PHE A CD1 1 
ATOM   3384 C CD2 . PHE A 1 435 ? 26.671  9.839   60.225 1.00 17.51 ? 432 PHE A CD2 1 
ATOM   3385 C CE1 . PHE A 1 435 ? 28.400  7.668   60.178 1.00 19.63 ? 432 PHE A CE1 1 
ATOM   3386 C CE2 . PHE A 1 435 ? 26.345  8.706   59.483 1.00 17.13 ? 432 PHE A CE2 1 
ATOM   3387 C CZ  . PHE A 1 435 ? 27.211  7.617   59.462 1.00 16.81 ? 432 PHE A CZ  1 
ATOM   3388 N N   . CYS A 1 436 ? 28.943  12.106  64.850 1.00 17.29 ? 433 CYS A N   1 
ATOM   3389 C CA  . CYS A 1 436 ? 29.228  13.187  65.787 1.00 19.03 ? 433 CYS A CA  1 
ATOM   3390 C C   . CYS A 1 436 ? 30.677  13.669  65.727 1.00 18.47 ? 433 CYS A C   1 
ATOM   3391 O O   . CYS A 1 436 ? 31.574  12.956  65.246 1.00 19.75 ? 433 CYS A O   1 
ATOM   3392 C CB  . CYS A 1 436 ? 28.895  12.707  67.214 1.00 16.91 ? 433 CYS A CB  1 
ATOM   3393 S SG  . CYS A 1 436 ? 27.142  12.393  67.611 1.00 18.12 ? 433 CYS A SG  1 
ATOM   3394 N N   . SER A 1 437 ? 30.899  14.899  66.184 1.00 18.94 ? 434 SER A N   1 
ATOM   3395 C CA  . SER A 1 437 ? 32.230  15.489  66.206 1.00 17.94 ? 434 SER A CA  1 
ATOM   3396 C C   . SER A 1 437 ? 32.200  16.687  67.140 1.00 18.65 ? 434 SER A C   1 
ATOM   3397 O O   . SER A 1 437 ? 31.157  17.328  67.317 1.00 18.23 ? 434 SER A O   1 
ATOM   3398 C CB  . SER A 1 437 ? 32.654  15.947  64.809 1.00 19.51 ? 434 SER A CB  1 
ATOM   3399 O OG  . SER A 1 437 ? 34.037  16.267  64.763 1.00 21.35 ? 434 SER A OG  1 
ATOM   3400 N N   . SER A 1 438 ? 33.339  16.963  67.763 1.00 18.93 ? 435 SER A N   1 
ATOM   3401 C CA  . SER A 1 438 ? 33.464  18.089  68.673 1.00 20.90 ? 435 SER A CA  1 
ATOM   3402 C C   . SER A 1 438 ? 34.363  19.163  68.067 1.00 22.92 ? 435 SER A C   1 
ATOM   3403 O O   . SER A 1 438 ? 34.646  20.178  68.712 1.00 22.99 ? 435 SER A O   1 
ATOM   3404 C CB  . SER A 1 438 ? 34.042  17.617  70.020 1.00 22.11 ? 435 SER A CB  1 
ATOM   3405 O OG  . SER A 1 438 ? 33.102  16.831  70.737 1.00 25.22 ? 435 SER A OG  1 
ATOM   3406 N N   . ASP A 1 439 ? 34.754  18.969  66.808 1.00 22.70 ? 436 ASP A N   1 
ATOM   3407 C CA  . ASP A 1 439 ? 35.645  19.896  66.126 1.00 22.88 ? 436 ASP A CA  1 
ATOM   3408 C C   . ASP A 1 439 ? 34.962  20.916  65.220 1.00 22.10 ? 436 ASP A C   1 
ATOM   3409 O O   . ASP A 1 439 ? 33.742  20.883  65.018 1.00 18.27 ? 436 ASP A O   1 
ATOM   3410 C CB  . ASP A 1 439 ? 36.680  19.117  65.309 1.00 26.92 ? 436 ASP A CB  1 
ATOM   3411 C CG  . ASP A 1 439 ? 37.685  18.386  66.185 1.00 31.06 ? 436 ASP A CG  1 
ATOM   3412 O OD1 . ASP A 1 439 ? 38.476  19.061  66.881 1.00 32.94 ? 436 ASP A OD1 1 
ATOM   3413 O OD2 . ASP A 1 439 ? 37.693  17.138  66.165 1.00 30.80 ? 436 ASP A OD2 1 
ATOM   3414 N N   . THR A 1 440 ? 35.766  21.868  64.753 1.00 22.38 ? 437 THR A N   1 
ATOM   3415 C CA  . THR A 1 440 ? 35.330  22.906  63.830 1.00 19.46 ? 437 THR A CA  1 
ATOM   3416 C C   . THR A 1 440 ? 36.504  23.052  62.871 1.00 19.56 ? 437 THR A C   1 
ATOM   3417 O O   . THR A 1 440 ? 37.646  22.746  63.223 1.00 18.61 ? 437 THR A O   1 
ATOM   3418 C CB  . THR A 1 440 ? 35.020  24.278  64.517 1.00 19.12 ? 437 THR A CB  1 
ATOM   3419 O OG1 . THR A 1 440 ? 36.191  24.785  65.165 1.00 16.53 ? 437 THR A OG1 1 
ATOM   3420 C CG2 . THR A 1 440 ? 33.875  24.154  65.524 1.00 17.08 ? 437 THR A CG2 1 
ATOM   3421 N N   . VAL A 1 441 ? 36.225  23.464  61.641 1.00 18.73 ? 438 VAL A N   1 
ATOM   3422 C CA  . VAL A 1 441 ? 37.275  23.614  60.647 1.00 17.02 ? 438 VAL A CA  1 
ATOM   3423 C C   . VAL A 1 441 ? 37.190  24.946  59.930 1.00 17.46 ? 438 VAL A C   1 
ATOM   3424 O O   . VAL A 1 441 ? 36.169  25.630  59.991 1.00 16.63 ? 438 VAL A O   1 
ATOM   3425 C CB  . VAL A 1 441 ? 37.186  22.529  59.561 1.00 18.06 ? 438 VAL A CB  1 
ATOM   3426 C CG1 . VAL A 1 441 ? 37.699  21.189  60.088 1.00 18.95 ? 438 VAL A CG1 1 
ATOM   3427 C CG2 . VAL A 1 441 ? 35.747  22.409  59.067 1.00 14.74 ? 438 VAL A CG2 1 
ATOM   3428 N N   . ARG A 1 442 ? 38.292  25.305  59.283 1.00 19.19 ? 439 ARG A N   1 
ATOM   3429 C CA  . ARG A 1 442 ? 38.384  26.516  58.488 1.00 23.00 ? 439 ARG A CA  1 
ATOM   3430 C C   . ARG A 1 442 ? 37.516  26.252  57.261 1.00 24.12 ? 439 ARG A C   1 
ATOM   3431 O O   . ARG A 1 442 ? 37.047  25.126  57.044 1.00 21.27 ? 439 ARG A O   1 
ATOM   3432 C CB  . ARG A 1 442 ? 39.826  26.726  58.029 1.00 25.86 ? 439 ARG A CB  1 
ATOM   3433 C CG  . ARG A 1 442 ? 40.773  27.241  59.103 1.00 30.51 ? 439 ARG A CG  1 
ATOM   3434 C CD  . ARG A 1 442 ? 40.694  28.756  59.235 1.00 32.78 ? 439 ARG A CD  1 
ATOM   3435 N NE  . ARG A 1 442 ? 41.052  29.432  57.988 1.00 34.81 ? 439 ARG A NE  1 
ATOM   3436 C CZ  . ARG A 1 442 ? 40.175  29.998  57.160 1.00 35.27 ? 439 ARG A CZ  1 
ATOM   3437 N NH1 . ARG A 1 442 ? 38.875  29.972  57.445 1.00 35.22 ? 439 ARG A NH1 1 
ATOM   3438 N NH2 . ARG A 1 442 ? 40.599  30.599  56.052 1.00 34.35 ? 439 ARG A NH2 1 
ATOM   3439 N N   . GLU A 1 443 ? 37.295  27.287  56.465 1.00 22.55 ? 440 GLU A N   1 
ATOM   3440 C CA  . GLU A 1 443 ? 36.497  27.150  55.257 1.00 22.88 ? 440 GLU A CA  1 
ATOM   3441 C C   . GLU A 1 443 ? 37.243  26.252  54.280 1.00 19.50 ? 440 GLU A C   1 
ATOM   3442 O O   . GLU A 1 443 ? 38.473  26.198  54.299 1.00 21.81 ? 440 GLU A O   1 
ATOM   3443 C CB  . GLU A 1 443 ? 36.282  28.532  54.636 1.00 24.38 ? 440 GLU A CB  1 
ATOM   3444 C CG  . GLU A 1 443 ? 37.577  29.315  54.438 1.00 31.37 ? 440 GLU A CG  1 
ATOM   3445 C CD  . GLU A 1 443 ? 37.351  30.812  54.345 1.00 35.57 ? 440 GLU A CD  1 
ATOM   3446 O OE1 . GLU A 1 443 ? 37.289  31.471  55.409 1.00 37.36 ? 440 GLU A OE1 1 
ATOM   3447 O OE2 . GLU A 1 443 ? 37.234  31.332  53.213 1.00 38.29 ? 440 GLU A OE2 1 
ATOM   3448 N N   . ASP A 1 444 ? 36.495  25.513  53.470 1.00 22.37 ? 441 ASP A N   1 
ATOM   3449 C CA  . ASP A 1 444 ? 37.070  24.640  52.456 1.00 22.95 ? 441 ASP A CA  1 
ATOM   3450 C C   . ASP A 1 444 ? 37.945  23.493  52.965 1.00 23.16 ? 441 ASP A C   1 
ATOM   3451 O O   . ASP A 1 444 ? 38.799  22.987  52.239 1.00 24.52 ? 441 ASP A O   1 
ATOM   3452 C CB  . ASP A 1 444 ? 37.810  25.485  51.410 1.00 25.92 ? 441 ASP A CB  1 
ATOM   3453 C CG  . ASP A 1 444 ? 36.876  26.442  50.675 1.00 27.66 ? 441 ASP A CG  1 
ATOM   3454 O OD1 . ASP A 1 444 ? 35.825  25.977  50.188 1.00 28.17 ? 441 ASP A OD1 1 
ATOM   3455 O OD2 . ASP A 1 444 ? 37.177  27.655  50.595 1.00 26.06 ? 441 ASP A OD2 1 
ATOM   3456 N N   . VAL A 1 445 ? 37.685  23.061  54.194 1.00 24.25 ? 442 VAL A N   1 
ATOM   3457 C CA  . VAL A 1 445 ? 38.409  21.951  54.821 1.00 22.95 ? 442 VAL A CA  1 
ATOM   3458 C C   . VAL A 1 445 ? 37.367  20.909  55.243 1.00 22.22 ? 442 VAL A C   1 
ATOM   3459 O O   . VAL A 1 445 ? 36.308  21.258  55.769 1.00 23.96 ? 442 VAL A O   1 
ATOM   3460 C CB  . VAL A 1 445 ? 39.215  22.420  56.060 1.00 24.46 ? 442 VAL A CB  1 
ATOM   3461 C CG1 . VAL A 1 445 ? 39.721  21.213  56.856 1.00 24.76 ? 442 VAL A CG1 1 
ATOM   3462 C CG2 . VAL A 1 445 ? 40.391  23.277  55.627 1.00 23.58 ? 442 VAL A CG2 1 
ATOM   3463 N N   . LEU A 1 446 ? 37.640  19.638  54.966 1.00 22.20 ? 443 LEU A N   1 
ATOM   3464 C CA  . LEU A 1 446 ? 36.706  18.572  55.313 1.00 22.17 ? 443 LEU A CA  1 
ATOM   3465 C C   . LEU A 1 446 ? 36.782  18.135  56.780 1.00 20.34 ? 443 LEU A C   1 
ATOM   3466 O O   . LEU A 1 446 ? 37.858  17.833  57.291 1.00 21.33 ? 443 LEU A O   1 
ATOM   3467 C CB  . LEU A 1 446 ? 36.937  17.364  54.402 1.00 21.89 ? 443 LEU A CB  1 
ATOM   3468 C CG  . LEU A 1 446 ? 36.499  17.540  52.944 1.00 22.96 ? 443 LEU A CG  1 
ATOM   3469 C CD1 . LEU A 1 446 ? 37.247  16.560  52.051 1.00 21.74 ? 443 LEU A CD1 1 
ATOM   3470 C CD2 . LEU A 1 446 ? 34.997  17.366  52.839 1.00 20.67 ? 443 LEU A CD2 1 
ATOM   3471 N N   . GLN A 1 447 ? 35.642  18.161  57.458 1.00 19.54 ? 444 GLN A N   1 
ATOM   3472 C CA  . GLN A 1 447 ? 35.547  17.733  58.846 1.00 18.60 ? 444 GLN A CA  1 
ATOM   3473 C C   . GLN A 1 447 ? 34.931  16.334  58.830 1.00 21.19 ? 444 GLN A C   1 
ATOM   3474 O O   . GLN A 1 447 ? 33.847  16.142  58.274 1.00 21.14 ? 444 GLN A O   1 
ATOM   3475 C CB  . GLN A 1 447 ? 34.620  18.660  59.635 1.00 19.62 ? 444 GLN A CB  1 
ATOM   3476 C CG  . GLN A 1 447 ? 34.345  18.171  61.047 1.00 20.05 ? 444 GLN A CG  1 
ATOM   3477 C CD  . GLN A 1 447 ? 33.116  18.780  61.683 1.00 21.83 ? 444 GLN A CD  1 
ATOM   3478 O OE1 . GLN A 1 447 ? 32.808  18.494  62.837 1.00 25.23 ? 444 GLN A OE1 1 
ATOM   3479 N NE2 . GLN A 1 447 ? 32.410  19.630  60.947 1.00 19.80 ? 444 GLN A NE2 1 
ATOM   3480 N N   . SER A 1 448 ? 35.602  15.359  59.425 1.00 19.62 ? 445 SER A N   1 
ATOM   3481 C CA  . SER A 1 448 ? 35.045  14.013  59.453 1.00 20.98 ? 445 SER A CA  1 
ATOM   3482 C C   . SER A 1 448 ? 34.205  13.821  60.713 1.00 19.98 ? 445 SER A C   1 
ATOM   3483 O O   . SER A 1 448 ? 34.557  14.324  61.786 1.00 20.81 ? 445 SER A O   1 
ATOM   3484 C CB  . SER A 1 448 ? 36.154  12.957  59.409 1.00 20.52 ? 445 SER A CB  1 
ATOM   3485 O OG  . SER A 1 448 ? 36.897  13.013  58.203 1.00 23.70 ? 445 SER A OG  1 
ATOM   3486 N N   . LEU A 1 449 ? 33.067  13.150  60.567 1.00 16.79 ? 446 LEU A N   1 
ATOM   3487 C CA  . LEU A 1 449 ? 32.182  12.853  61.683 1.00 17.05 ? 446 LEU A CA  1 
ATOM   3488 C C   . LEU A 1 449 ? 32.014  11.338  61.723 1.00 21.27 ? 446 LEU A C   1 
ATOM   3489 O O   . LEU A 1 449 ? 31.711  10.703  60.704 1.00 18.57 ? 446 LEU A O   1 
ATOM   3490 C CB  . LEU A 1 449 ? 30.831  13.554  61.550 1.00 17.26 ? 446 LEU A CB  1 
ATOM   3491 C CG  . LEU A 1 449 ? 30.776  15.057  61.849 1.00 14.70 ? 446 LEU A CG  1 
ATOM   3492 C CD1 . LEU A 1 449 ? 31.117  15.860  60.613 1.00 17.17 ? 446 LEU A CD1 1 
ATOM   3493 C CD2 . LEU A 1 449 ? 29.395  15.398  62.331 1.00 14.44 ? 446 LEU A CD2 1 
ATOM   3494 N N   . TYR A 1 450 ? 32.179  10.771  62.913 1.00 20.40 ? 447 TYR A N   1 
ATOM   3495 C CA  . TYR A 1 450 ? 32.116  9.326   63.102 1.00 21.58 ? 447 TYR A CA  1 
ATOM   3496 C C   . TYR A 1 450 ? 30.866  8.851   63.830 1.00 19.84 ? 447 TYR A C   1 
ATOM   3497 O O   . TYR A 1 450 ? 30.203  9.633   64.521 1.00 17.93 ? 447 TYR A O   1 
ATOM   3498 C CB  . TYR A 1 450 ? 33.396  8.861   63.814 1.00 21.60 ? 447 TYR A CB  1 
ATOM   3499 C CG  . TYR A 1 450 ? 34.653  9.177   63.029 1.00 23.98 ? 447 TYR A CG  1 
ATOM   3500 C CD1 . TYR A 1 450 ? 35.113  8.314   62.036 1.00 25.23 ? 447 TYR A CD1 1 
ATOM   3501 C CD2 . TYR A 1 450 ? 35.361  10.359  63.249 1.00 25.59 ? 447 TYR A CD2 1 
ATOM   3502 C CE1 . TYR A 1 450 ? 36.242  8.624   61.277 1.00 27.23 ? 447 TYR A CE1 1 
ATOM   3503 C CE2 . TYR A 1 450 ? 36.492  10.679  62.497 1.00 26.42 ? 447 TYR A CE2 1 
ATOM   3504 C CZ  . TYR A 1 450 ? 36.923  9.806   61.513 1.00 27.28 ? 447 TYR A CZ  1 
ATOM   3505 O OH  . TYR A 1 450 ? 38.022  10.117  60.743 1.00 29.16 ? 447 TYR A OH  1 
ATOM   3506 N N   . PRO A 1 451 ? 30.536  7.546   63.706 1.00 19.81 ? 448 PRO A N   1 
ATOM   3507 C CA  . PRO A 1 451 ? 29.358  6.943   64.337 1.00 18.96 ? 448 PRO A CA  1 
ATOM   3508 C C   . PRO A 1 451 ? 29.104  7.299   65.799 1.00 22.47 ? 448 PRO A C   1 
ATOM   3509 O O   . PRO A 1 451 ? 30.026  7.298   66.627 1.00 21.14 ? 448 PRO A O   1 
ATOM   3510 C CB  . PRO A 1 451 ? 29.615  5.446   64.180 1.00 19.51 ? 448 PRO A CB  1 
ATOM   3511 C CG  . PRO A 1 451 ? 30.335  5.373   62.889 1.00 19.69 ? 448 PRO A CG  1 
ATOM   3512 C CD  . PRO A 1 451 ? 31.309  6.525   62.971 1.00 16.82 ? 448 PRO A CD  1 
ATOM   3513 N N   . CYS A 1 452 ? 27.844  7.600   66.093 1.00 19.74 ? 449 CYS A N   1 
ATOM   3514 C CA  . CYS A 1 452 ? 27.394  7.936   67.436 1.00 20.34 ? 449 CYS A CA  1 
ATOM   3515 C C   . CYS A 1 452 ? 25.909  7.655   67.534 1.00 19.51 ? 449 CYS A C   1 
ATOM   3516 O O   . CYS A 1 452 ? 25.335  7.898   68.622 1.00 21.50 ? 449 CYS A O   1 
ATOM   3517 C CB  . CYS A 1 452 ? 27.677  9.405   67.758 1.00 22.24 ? 449 CYS A CB  1 
ATOM   3518 S SG  . CYS A 1 452 ? 26.730  10.597  66.754 1.00 18.65 ? 449 CYS A SG  1 
HETATM 3519 C C1  . NAG B 2 .   ? 24.792  0.513   35.386 1.00 38.18 ? 451 NAG A C1  1 
HETATM 3520 C C2  . NAG B 2 .   ? 25.930  0.342   36.405 1.00 40.34 ? 451 NAG A C2  1 
HETATM 3521 C C3  . NAG B 2 .   ? 26.728  -0.921  36.090 1.00 41.77 ? 451 NAG A C3  1 
HETATM 3522 C C4  . NAG B 2 .   ? 25.789  -2.121  36.045 1.00 41.00 ? 451 NAG A C4  1 
HETATM 3523 C C5  . NAG B 2 .   ? 24.716  -1.855  34.993 1.00 39.62 ? 451 NAG A C5  1 
HETATM 3524 C C6  . NAG B 2 .   ? 23.719  -2.992  34.852 1.00 38.38 ? 451 NAG A C6  1 
HETATM 3525 C C7  . NAG B 2 .   ? 26.810  2.380   37.363 1.00 43.89 ? 451 NAG A C7  1 
HETATM 3526 C C8  . NAG B 2 .   ? 27.779  3.546   37.232 1.00 44.15 ? 451 NAG A C8  1 
HETATM 3527 N N2  . NAG B 2 .   ? 26.816  1.492   36.371 1.00 42.55 ? 451 NAG A N2  1 
HETATM 3528 O O3  . NAG B 2 .   ? 27.722  -1.127  37.079 1.00 42.85 ? 451 NAG A O3  1 
HETATM 3529 O O4  . NAG B 2 .   ? 26.521  -3.297  35.722 1.00 42.96 ? 451 NAG A O4  1 
HETATM 3530 O O5  . NAG B 2 .   ? 23.974  -0.670  35.349 1.00 39.19 ? 451 NAG A O5  1 
HETATM 3531 O O6  . NAG B 2 .   ? 23.071  -3.262  36.086 1.00 36.79 ? 451 NAG A O6  1 
HETATM 3532 O O7  . NAG B 2 .   ? 26.066  2.281   38.341 1.00 44.62 ? 451 NAG A O7  1 
HETATM 3533 O O   . HOH C 3 .   ? -14.323 -4.733  17.879 1.00 19.37 ? 452 HOH A O   1 
HETATM 3534 O O   . HOH C 3 .   ? -13.425 5.678   14.426 1.00 15.24 ? 453 HOH A O   1 
HETATM 3535 O O   . HOH C 3 .   ? -11.269 -8.457  21.275 1.00 21.65 ? 454 HOH A O   1 
HETATM 3536 O O   . HOH C 3 .   ? -12.359 -9.986  19.382 1.00 32.26 ? 455 HOH A O   1 
HETATM 3537 O O   . HOH C 3 .   ? -16.000 14.035  10.905 1.00 28.64 ? 456 HOH A O   1 
HETATM 3538 O O   . HOH C 3 .   ? -8.130  -0.098  5.711  1.00 23.43 ? 457 HOH A O   1 
HETATM 3539 O O   . HOH C 3 .   ? -9.732  -9.092  9.345  1.00 46.81 ? 458 HOH A O   1 
HETATM 3540 O O   . HOH C 3 .   ? 3.097   -3.436  10.472 1.00 20.48 ? 459 HOH A O   1 
HETATM 3541 O O   . HOH C 3 .   ? -3.455  -5.702  12.272 1.00 16.16 ? 460 HOH A O   1 
HETATM 3542 O O   . HOH C 3 .   ? 20.495  -10.652 26.975 1.00 21.61 ? 461 HOH A O   1 
HETATM 3543 O O   . HOH C 3 .   ? 13.375  -15.537 12.301 1.00 20.09 ? 462 HOH A O   1 
HETATM 3544 O O   . HOH C 3 .   ? 1.846   -15.990 11.119 1.00 37.17 ? 463 HOH A O   1 
HETATM 3545 O O   . HOH C 3 .   ? -2.375  -12.711 15.567 1.00 24.36 ? 464 HOH A O   1 
HETATM 3546 O O   . HOH C 3 .   ? -4.569  -11.347 16.887 1.00 15.57 ? 465 HOH A O   1 
HETATM 3547 O O   . HOH C 3 .   ? 4.926   -7.720  35.977 1.00 16.49 ? 466 HOH A O   1 
HETATM 3548 O O   . HOH C 3 .   ? 2.299   -9.346  35.389 1.00 28.96 ? 467 HOH A O   1 
HETATM 3549 O O   . HOH C 3 .   ? 16.450  2.292   24.207 1.00 24.81 ? 468 HOH A O   1 
HETATM 3550 O O   . HOH C 3 .   ? 17.659  -15.206 33.390 1.00 45.93 ? 469 HOH A O   1 
HETATM 3551 O O   . HOH C 3 .   ? 10.482  -17.723 27.038 1.00 21.50 ? 470 HOH A O   1 
HETATM 3552 O O   . HOH C 3 .   ? -9.343  4.768   21.483 1.00 31.48 ? 471 HOH A O   1 
HETATM 3553 O O   . HOH C 3 .   ? -7.168  3.072   24.235 1.00 21.20 ? 472 HOH A O   1 
HETATM 3554 O O   . HOH C 3 .   ? -7.499  2.741   21.340 1.00 23.36 ? 473 HOH A O   1 
HETATM 3555 O O   . HOH C 3 .   ? 7.868   3.937   20.389 1.00 20.22 ? 474 HOH A O   1 
HETATM 3556 O O   . HOH C 3 .   ? 11.362  5.859   19.611 1.00 16.97 ? 475 HOH A O   1 
HETATM 3557 O O   . HOH C 3 .   ? 6.404   2.064   36.774 1.00 16.18 ? 476 HOH A O   1 
HETATM 3558 O O   . HOH C 3 .   ? 2.969   10.727  30.410 1.00 18.69 ? 477 HOH A O   1 
HETATM 3559 O O   . HOH C 3 .   ? 1.350   16.677  27.033 1.00 13.26 ? 478 HOH A O   1 
HETATM 3560 O O   . HOH C 3 .   ? -2.364  20.509  24.875 1.00 26.36 ? 479 HOH A O   1 
HETATM 3561 O O   . HOH C 3 .   ? -5.976  16.063  22.201 1.00 32.10 ? 480 HOH A O   1 
HETATM 3562 O O   . HOH C 3 .   ? -8.222  -2.311  38.393 1.00 36.02 ? 481 HOH A O   1 
HETATM 3563 O O   . HOH C 3 .   ? -11.735 1.270   29.439 1.00 18.04 ? 482 HOH A O   1 
HETATM 3564 O O   . HOH C 3 .   ? -11.502 -0.958  31.224 1.00 14.91 ? 483 HOH A O   1 
HETATM 3565 O O   . HOH C 3 .   ? -14.376 -3.989  29.350 1.00 26.03 ? 484 HOH A O   1 
HETATM 3566 O O   . HOH C 3 .   ? -12.526 -3.386  31.404 1.00 20.14 ? 485 HOH A O   1 
HETATM 3567 O O   . HOH C 3 .   ? 17.005  11.709  32.601 1.00 17.01 ? 486 HOH A O   1 
HETATM 3568 O O   . HOH C 3 .   ? 9.637   18.084  35.226 1.00 15.93 ? 487 HOH A O   1 
HETATM 3569 O O   . HOH C 3 .   ? 25.347  -1.706  48.370 1.00 41.22 ? 488 HOH A O   1 
HETATM 3570 O O   . HOH C 3 .   ? 16.505  4.842   44.779 1.00 17.58 ? 489 HOH A O   1 
HETATM 3571 O O   . HOH C 3 .   ? 15.984  6.904   46.366 1.00 13.47 ? 490 HOH A O   1 
HETATM 3572 O O   . HOH C 3 .   ? 14.627  10.728  44.084 1.00 15.77 ? 491 HOH A O   1 
HETATM 3573 O O   . HOH C 3 .   ? 14.701  7.927   44.229 1.00 16.78 ? 492 HOH A O   1 
HETATM 3574 O O   . HOH C 3 .   ? 6.698   8.789   50.688 1.00 22.72 ? 493 HOH A O   1 
HETATM 3575 O O   . HOH C 3 .   ? -3.706  13.421  47.015 1.00 45.51 ? 494 HOH A O   1 
HETATM 3576 O O   . HOH C 3 .   ? 4.152   20.518  42.457 1.00 27.49 ? 495 HOH A O   1 
HETATM 3577 O O   . HOH C 3 .   ? 14.602  16.714  45.756 1.00 18.43 ? 496 HOH A O   1 
HETATM 3578 O O   . HOH C 3 .   ? 17.804  16.481  43.552 1.00 28.82 ? 497 HOH A O   1 
HETATM 3579 O O   . HOH C 3 .   ? 10.964  0.488   50.538 1.00 27.83 ? 498 HOH A O   1 
HETATM 3580 O O   . HOH C 3 .   ? 11.442  -0.424  48.083 1.00 37.20 ? 499 HOH A O   1 
HETATM 3581 O O   . HOH C 3 .   ? 8.449   -2.272  46.427 1.00 29.51 ? 500 HOH A O   1 
HETATM 3582 O O   . HOH C 3 .   ? 11.706  -1.371  38.958 1.00 20.06 ? 501 HOH A O   1 
HETATM 3583 O O   . HOH C 3 .   ? -3.008  -6.918  41.300 1.00 32.78 ? 502 HOH A O   1 
HETATM 3584 O O   . HOH C 3 .   ? 25.919  22.248  68.012 1.00 22.71 ? 503 HOH A O   1 
HETATM 3585 O O   . HOH C 3 .   ? 24.152  18.166  68.538 1.00 36.75 ? 504 HOH A O   1 
HETATM 3586 O O   . HOH C 3 .   ? 24.959  33.017  50.875 1.00 40.90 ? 505 HOH A O   1 
HETATM 3587 O O   . HOH C 3 .   ? 33.372  5.492   51.945 1.00 39.20 ? 506 HOH A O   1 
HETATM 3588 O O   . HOH C 3 .   ? 27.870  11.382  44.874 1.00 23.15 ? 507 HOH A O   1 
HETATM 3589 O O   . HOH C 3 .   ? 24.929  20.203  45.755 1.00 22.50 ? 508 HOH A O   1 
HETATM 3590 O O   . HOH C 3 .   ? 23.965  13.473  42.346 1.00 18.92 ? 509 HOH A O   1 
HETATM 3591 O O   . HOH C 3 .   ? 21.969  28.690  60.463 1.00 19.25 ? 510 HOH A O   1 
HETATM 3592 O O   . HOH C 3 .   ? 19.606  16.726  45.429 1.00 18.39 ? 511 HOH A O   1 
HETATM 3593 O O   . HOH C 3 .   ? 31.460  20.088  66.534 1.00 22.63 ? 512 HOH A O   1 
HETATM 3594 O O   . HOH C 3 .   ? 35.708  15.665  67.475 1.00 28.85 ? 513 HOH A O   1 
HETATM 3595 O O   . HOH C 3 .   ? 37.850  16.025  61.065 1.00 27.06 ? 514 HOH A O   1 
HETATM 3596 O O   . HOH C 3 .   ? 40.662  23.813  59.774 1.00 24.49 ? 515 HOH A O   1 
HETATM 3597 O O   . HOH C 3 .   ? -12.433 -0.407  19.630 1.00 20.75 ? 516 HOH A O   1 
HETATM 3598 O O   . HOH C 3 .   ? -11.809 6.248   16.725 1.00 18.61 ? 517 HOH A O   1 
HETATM 3599 O O   . HOH C 3 .   ? -6.231  -11.259 13.392 1.00 27.71 ? 518 HOH A O   1 
HETATM 3600 O O   . HOH C 3 .   ? -1.505  18.133  12.736 1.00 41.75 ? 519 HOH A O   1 
HETATM 3601 O O   . HOH C 3 .   ? 19.229  -15.104 26.657 1.00 34.99 ? 520 HOH A O   1 
HETATM 3602 O O   . HOH C 3 .   ? 14.802  -11.885 12.915 1.00 27.49 ? 521 HOH A O   1 
HETATM 3603 O O   . HOH C 3 .   ? 5.451   -24.660 26.965 1.00 28.01 ? 522 HOH A O   1 
HETATM 3604 O O   . HOH C 3 .   ? 8.866   -1.434  15.534 1.00 39.23 ? 523 HOH A O   1 
HETATM 3605 O O   . HOH C 3 .   ? 7.065   7.612   14.629 1.00 33.68 ? 524 HOH A O   1 
HETATM 3606 O O   . HOH C 3 .   ? -9.371  1.203   27.019 1.00 11.25 ? 525 HOH A O   1 
HETATM 3607 O O   . HOH C 3 .   ? 7.901   -1.849  43.827 1.00 16.49 ? 526 HOH A O   1 
HETATM 3608 O O   . HOH C 3 .   ? 6.915   17.799  28.720 1.00 17.48 ? 527 HOH A O   1 
HETATM 3609 O O   . HOH C 3 .   ? -7.301  -4.718  40.612 1.00 39.81 ? 528 HOH A O   1 
HETATM 3610 O O   . HOH C 3 .   ? 15.265  -0.107  25.024 1.00 50.05 ? 529 HOH A O   1 
HETATM 3611 O O   . HOH C 3 .   ? 21.159  1.771   50.604 1.00 47.84 ? 530 HOH A O   1 
HETATM 3612 O O   . HOH C 3 .   ? 15.603  7.605   41.747 1.00 18.43 ? 531 HOH A O   1 
HETATM 3613 O O   . HOH C 3 .   ? 0.449   6.059   47.480 1.00 28.20 ? 532 HOH A O   1 
HETATM 3614 O O   . HOH C 3 .   ? -0.281  12.071  49.933 1.00 46.10 ? 533 HOH A O   1 
HETATM 3615 O O   . HOH C 3 .   ? 17.511  23.661  56.257 1.00 28.96 ? 534 HOH A O   1 
HETATM 3616 O O   . HOH C 3 .   ? 35.752  14.053  64.720 1.00 30.91 ? 535 HOH A O   1 
HETATM 3617 O O   . HOH C 3 .   ? -12.147 20.140  13.765 1.00 41.96 ? 536 HOH A O   1 
HETATM 3618 O O   . HOH C 3 .   ? -3.306  16.125  14.013 1.00 43.74 ? 537 HOH A O   1 
HETATM 3619 O O   . HOH C 3 .   ? -3.389  -8.961  9.984  1.00 41.58 ? 538 HOH A O   1 
HETATM 3620 O O   . HOH C 3 .   ? 2.068   -11.872 13.906 1.00 21.58 ? 539 HOH A O   1 
HETATM 3621 O O   . HOH C 3 .   ? -1.410  -8.228  38.807 1.00 20.37 ? 540 HOH A O   1 
HETATM 3622 O O   . HOH C 3 .   ? 1.042   -7.322  38.993 1.00 36.91 ? 541 HOH A O   1 
HETATM 3623 O O   . HOH C 3 .   ? 8.760   10.744  13.098 1.00 41.59 ? 542 HOH A O   1 
HETATM 3624 O O   . HOH C 3 .   ? 13.858  -20.330 38.743 1.00 42.83 ? 543 HOH A O   1 
HETATM 3625 O O   . HOH C 3 .   ? -9.514  1.909   24.488 1.00 15.47 ? 544 HOH A O   1 
HETATM 3626 O O   . HOH C 3 .   ? -14.188 1.725   30.429 1.00 32.53 ? 545 HOH A O   1 
HETATM 3627 O O   . HOH C 3 .   ? -5.347  13.213  36.544 1.00 17.31 ? 546 HOH A O   1 
HETATM 3628 O O   . HOH C 3 .   ? -7.012  11.090  36.205 1.00 19.68 ? 547 HOH A O   1 
HETATM 3629 O O   . HOH C 3 .   ? 1.901   17.423  34.562 1.00 38.99 ? 548 HOH A O   1 
HETATM 3630 O O   . HOH C 3 .   ? -5.348  18.887  28.292 1.00 37.99 ? 549 HOH A O   1 
HETATM 3631 O O   . HOH C 3 .   ? -5.166  17.278  19.706 1.00 46.75 ? 550 HOH A O   1 
HETATM 3632 O O   . HOH C 3 .   ? -9.687  -7.866  37.257 1.00 47.71 ? 551 HOH A O   1 
HETATM 3633 O O   . HOH C 3 .   ? 15.406  16.462  38.581 1.00 24.22 ? 552 HOH A O   1 
HETATM 3634 O O   . HOH C 3 .   ? 15.278  9.695   25.897 1.00 16.86 ? 553 HOH A O   1 
HETATM 3635 O O   . HOH C 3 .   ? 14.056  18.804  29.249 1.00 25.45 ? 554 HOH A O   1 
HETATM 3636 O O   . HOH C 3 .   ? -0.943  2.711   48.774 1.00 32.01 ? 555 HOH A O   1 
HETATM 3637 O O   . HOH C 3 .   ? 20.374  25.086  50.114 1.00 29.25 ? 556 HOH A O   1 
HETATM 3638 O O   . HOH C 3 .   ? 19.103  26.967  51.686 1.00 23.57 ? 557 HOH A O   1 
HETATM 3639 O O   . HOH C 3 .   ? 9.226   -9.952  41.119 1.00 27.16 ? 558 HOH A O   1 
HETATM 3640 O O   . HOH C 3 .   ? 22.913  3.455   51.978 1.00 17.17 ? 559 HOH A O   1 
HETATM 3641 O O   . HOH C 3 .   ? 21.135  16.771  63.187 1.00 35.84 ? 560 HOH A O   1 
HETATM 3642 O O   . HOH C 3 .   ? 30.924  34.401  57.243 1.00 33.67 ? 561 HOH A O   1 
HETATM 3643 O O   . HOH C 3 .   ? 33.291  13.946  48.593 1.00 33.35 ? 562 HOH A O   1 
HETATM 3644 O O   . HOH C 3 .   ? 38.246  6.172   54.536 1.00 51.86 ? 563 HOH A O   1 
HETATM 3645 O O   . HOH C 3 .   ? 34.018  11.882  65.481 1.00 58.84 ? 564 HOH A O   1 
HETATM 3646 O O   . HOH C 3 .   ? 38.161  15.225  57.425 1.00 29.24 ? 565 HOH A O   1 
HETATM 3647 O O   . HOH C 3 .   ? 12.776  16.418  24.644 1.00 22.33 ? 566 HOH A O   1 
HETATM 3648 O O   . HOH C 3 .   ? 10.353  19.854  26.125 1.00 21.60 ? 567 HOH A O   1 
HETATM 3649 O O   . HOH C 3 .   ? 9.941   14.934  23.896 1.00 24.50 ? 568 HOH A O   1 
HETATM 3650 O O   . HOH C 3 .   ? 20.182  1.536   54.801 1.00 34.72 ? 569 HOH A O   1 
HETATM 3651 O O   . HOH C 3 .   ? 32.453  -2.547  63.791 1.00 46.40 ? 570 HOH A O   1 
HETATM 3652 O O   . HOH C 3 .   ? -13.007 -9.280  23.190 1.00 25.04 ? 571 HOH A O   1 
HETATM 3653 O O   . HOH C 3 .   ? 25.779  5.628   62.576 1.00 22.69 ? 572 HOH A O   1 
HETATM 3654 O O   . HOH C 3 .   ? 32.208  5.772   66.879 1.00 20.92 ? 573 HOH A O   1 
HETATM 3655 O O   . HOH C 3 .   ? -6.146  10.926  8.118  1.00 32.60 ? 574 HOH A O   1 
HETATM 3656 O O   . HOH C 3 .   ? 9.954   -3.880  14.740 1.00 58.49 ? 575 HOH A O   1 
HETATM 3657 O O   . HOH C 3 .   ? 18.652  -5.433  20.183 1.00 42.41 ? 576 HOH A O   1 
HETATM 3658 O O   . HOH C 3 .   ? 15.063  -10.341 15.115 1.00 36.18 ? 577 HOH A O   1 
HETATM 3659 O O   . HOH C 3 .   ? 11.503  -5.967  16.958 1.00 31.54 ? 578 HOH A O   1 
HETATM 3660 O O   . HOH C 3 .   ? 10.482  -8.460  10.268 1.00 42.26 ? 579 HOH A O   1 
HETATM 3661 O O   . HOH C 3 .   ? 35.144  23.663  55.638 1.00 18.92 ? 580 HOH A O   1 
HETATM 3662 O O   . HOH C 3 .   ? 34.751  33.256  55.600 1.00 30.63 ? 581 HOH A O   1 
HETATM 3663 O O   . HOH C 3 .   ? 35.514  29.751  51.773 1.00 30.77 ? 582 HOH A O   1 
HETATM 3664 O O   . HOH C 3 .   ? 32.071  35.960  53.013 1.00 44.61 ? 583 HOH A O   1 
HETATM 3665 O O   . HOH C 3 .   ? 31.595  29.389  64.092 1.00 31.76 ? 584 HOH A O   1 
HETATM 3666 O O   . HOH C 3 .   ? 35.330  31.100  64.260 1.00 38.41 ? 585 HOH A O   1 
HETATM 3667 O O   . HOH C 3 .   ? 34.184  28.590  65.844 1.00 29.48 ? 586 HOH A O   1 
HETATM 3668 O O   . HOH C 3 .   ? 28.216  25.323  69.176 1.00 34.87 ? 587 HOH A O   1 
HETATM 3669 O O   . HOH C 3 .   ? 15.178  30.857  67.747 1.00 50.59 ? 588 HOH A O   1 
HETATM 3670 O O   . HOH C 3 .   ? 10.767  -23.543 18.453 1.00 30.64 ? 589 HOH A O   1 
HETATM 3671 O O   . HOH C 3 .   ? -1.993  -20.140 33.437 1.00 26.73 ? 590 HOH A O   1 
HETATM 3672 O O   . HOH C 3 .   ? -0.205  -21.944 32.224 1.00 21.98 ? 591 HOH A O   1 
HETATM 3673 O O   . HOH C 3 .   ? -3.723  -15.364 28.232 1.00 17.78 ? 592 HOH A O   1 
HETATM 3674 O O   . HOH C 3 .   ? 11.584  -9.885  36.433 1.00 33.52 ? 593 HOH A O   1 
HETATM 3675 O O   . HOH C 3 .   ? 17.361  0.882   21.931 1.00 36.42 ? 594 HOH A O   1 
HETATM 3676 O O   . HOH C 3 .   ? -13.734 -14.226 28.095 1.00 54.21 ? 595 HOH A O   1 
HETATM 3677 O O   . HOH C 3 .   ? -0.345  17.061  29.049 1.00 22.93 ? 596 HOH A O   1 
HETATM 3678 O O   . HOH C 3 .   ? -9.999  -0.176  38.482 1.00 32.46 ? 597 HOH A O   1 
HETATM 3679 O O   . HOH C 3 .   ? 21.803  -0.311  44.932 1.00 27.66 ? 598 HOH A O   1 
HETATM 3680 O O   . HOH C 3 .   ? 18.862  -2.742  41.974 1.00 27.86 ? 599 HOH A O   1 
HETATM 3681 O O   . HOH C 3 .   ? 25.634  2.560   43.422 1.00 38.16 ? 600 HOH A O   1 
HETATM 3682 O O   . HOH C 3 .   ? 23.534  2.315   38.616 1.00 27.42 ? 601 HOH A O   1 
HETATM 3683 O O   . HOH C 3 .   ? 11.804  13.718  50.189 1.00 23.86 ? 602 HOH A O   1 
HETATM 3684 O O   . HOH C 3 .   ? 1.864   13.866  50.798 1.00 28.61 ? 603 HOH A O   1 
HETATM 3685 O O   . HOH C 3 .   ? 7.073   5.815   56.985 1.00 44.60 ? 604 HOH A O   1 
HETATM 3686 O O   . HOH C 3 .   ? 6.110   -2.704  49.045 1.00 20.19 ? 605 HOH A O   1 
HETATM 3687 O O   . HOH C 3 .   ? 16.044  11.796  59.596 1.00 23.30 ? 606 HOH A O   1 
HETATM 3688 O O   . HOH C 3 .   ? 12.748  16.738  57.258 1.00 32.22 ? 607 HOH A O   1 
HETATM 3689 O O   . HOH C 3 .   ? 9.835   14.017  54.929 1.00 37.59 ? 608 HOH A O   1 
HETATM 3690 O O   . HOH C 3 .   ? 15.978  13.937  61.637 1.00 46.04 ? 609 HOH A O   1 
HETATM 3691 O O   . HOH C 3 .   ? 39.221  14.524  54.929 1.00 33.83 ? 610 HOH A O   1 
HETATM 3692 O O   . HOH C 3 .   ? 32.243  16.882  45.512 1.00 26.93 ? 611 HOH A O   1 
HETATM 3693 O O   . HOH C 3 .   ? 30.362  17.649  71.083 1.00 46.26 ? 612 HOH A O   1 
HETATM 3694 O O   . HOH C 3 .   ? 3.088   26.056  35.073 1.00 56.99 ? 613 HOH A O   1 
HETATM 3695 O O   . HOH C 3 .   ? -10.381 10.498  39.064 1.00 39.58 ? 614 HOH A O   1 
HETATM 3696 O O   . HOH C 3 .   ? -2.765  16.173  8.975  1.00 41.21 ? 615 HOH A O   1 
HETATM 3697 O O   . HOH C 3 .   ? 27.915  7.020   37.094 1.00 50.13 ? 616 HOH A O   1 
HETATM 3698 O O   . HOH C 3 .   ? 26.189  5.089   65.060 1.00 33.39 ? 617 HOH A O   1 
HETATM 3699 O O   . HOH C 3 .   ? -20.223 3.789   24.830 1.00 48.22 ? 618 HOH A O   1 
HETATM 3700 O O   . HOH C 3 .   ? -22.574 7.764   20.790 1.00 50.29 ? 619 HOH A O   1 
HETATM 3701 O O   . HOH C 3 .   ? -17.456 -3.545  7.629  1.00 32.48 ? 620 HOH A O   1 
HETATM 3702 O O   . HOH C 3 .   ? -15.851 -13.680 14.385 1.00 49.84 ? 621 HOH A O   1 
HETATM 3703 O O   . HOH C 3 .   ? -10.198 -16.596 13.314 1.00 46.78 ? 622 HOH A O   1 
HETATM 3704 O O   . HOH C 3 .   ? -7.686  -19.757 16.925 1.00 40.48 ? 623 HOH A O   1 
HETATM 3705 O O   . HOH C 3 .   ? -11.191 2.281   6.354  1.00 49.77 ? 624 HOH A O   1 
HETATM 3706 O O   . HOH C 3 .   ? 30.509  20.525  44.307 1.00 44.25 ? 625 HOH A O   1 
HETATM 3707 O O   . HOH C 3 .   ? 12.484  -16.353 35.510 1.00 20.16 ? 626 HOH A O   1 
HETATM 3708 O O   . HOH C 3 .   ? 8.688   -25.738 24.402 1.00 38.61 ? 627 HOH A O   1 
HETATM 3709 O O   . HOH C 3 .   ? -16.066 5.371   29.546 1.00 35.84 ? 628 HOH A O   1 
HETATM 3710 O O   . HOH C 3 .   ? 14.889  13.459  18.668 1.00 31.88 ? 629 HOH A O   1 
HETATM 3711 O O   . HOH C 3 .   ? -5.390  16.662  24.719 1.00 35.29 ? 630 HOH A O   1 
HETATM 3712 O O   . HOH C 3 .   ? 5.215   18.710  38.800 1.00 46.61 ? 631 HOH A O   1 
HETATM 3713 O O   . HOH C 3 .   ? -16.748 -15.812 28.263 1.00 38.90 ? 632 HOH A O   1 
HETATM 3714 O O   . HOH C 3 .   ? 3.229   18.040  41.548 1.00 28.70 ? 633 HOH A O   1 
HETATM 3715 O O   . HOH C 3 .   ? 18.963  0.207   46.989 1.00 48.77 ? 634 HOH A O   1 
HETATM 3716 O O   . HOH C 3 .   ? -2.172  -3.390  46.650 1.00 23.68 ? 635 HOH A O   1 
HETATM 3717 O O   . HOH C 3 .   ? -4.403  11.312  43.059 1.00 31.42 ? 636 HOH A O   1 
HETATM 3718 O O   . HOH C 3 .   ? 0.274   10.690  5.347  1.00 40.23 ? 637 HOH A O   1 
HETATM 3719 O O   . HOH C 3 .   ? -11.793 16.287  29.941 1.00 17.05 ? 638 HOH A O   1 
HETATM 3720 O O   . HOH C 3 .   ? 19.741  18.696  32.105 1.00 46.05 ? 639 HOH A O   1 
HETATM 3721 O O   . HOH C 3 .   ? 8.728   18.077  24.832 1.00 25.10 ? 640 HOH A O   1 
HETATM 3722 O O   . HOH C 3 .   ? 33.310  3.070   63.107 1.00 47.02 ? 641 HOH A O   1 
HETATM 3723 O O   . HOH C 3 .   ? 12.673  -3.204  18.400 1.00 33.06 ? 642 HOH A O   1 
HETATM 3724 O O   . HOH C 3 .   ? 18.072  13.212  58.887 1.00 22.96 ? 643 HOH A O   1 
HETATM 3725 O O   . HOH C 3 .   ? 3.457   -23.224 22.973 1.00 48.37 ? 644 HOH A O   1 
HETATM 3726 O O   . HOH C 3 .   ? 17.514  0.939   17.278 1.00 23.49 ? 645 HOH A O   1 
HETATM 3727 O O   . HOH C 3 .   ? 23.165  -9.998  33.113 1.00 50.69 ? 646 HOH A O   1 
HETATM 3728 O O   . HOH C 3 .   ? 7.360   -0.731  6.316  1.00 39.28 ? 647 HOH A O   1 
HETATM 3729 O O   . HOH C 3 .   ? -3.427  -27.450 24.398 1.00 33.98 ? 648 HOH A O   1 
HETATM 3730 O O   . HOH C 3 .   ? -7.311  -6.537  30.932 1.00 25.43 ? 649 HOH A O   1 
HETATM 3731 O O   . HOH C 3 .   ? -15.409 -6.313  23.765 1.00 37.36 ? 650 HOH A O   1 
HETATM 3732 O O   . HOH C 3 .   ? -11.894 -11.769 27.064 1.00 31.92 ? 651 HOH A O   1 
HETATM 3733 O O   . HOH C 3 .   ? -15.861 -1.522  27.627 1.00 30.72 ? 652 HOH A O   1 
HETATM 3734 O O   . HOH C 3 .   ? -8.081  5.577   19.248 1.00 34.13 ? 653 HOH A O   1 
HETATM 3735 O O   . HOH C 3 .   ? -3.619  -2.675  -0.573 1.00 46.56 ? 654 HOH A O   1 
HETATM 3736 O O   . HOH C 3 .   ? 13.746  -27.050 21.687 1.00 47.26 ? 655 HOH A O   1 
HETATM 3737 O O   . HOH C 3 .   ? 18.552  -15.950 29.086 1.00 37.33 ? 656 HOH A O   1 
HETATM 3738 O O   . HOH C 3 .   ? 21.389  -15.930 14.750 1.00 35.10 ? 657 HOH A O   1 
HETATM 3739 O O   . HOH C 3 .   ? 39.499  29.060  51.168 1.00 46.08 ? 658 HOH A O   1 
HETATM 3740 O O   . HOH C 3 .   ? -7.497  -10.237 10.603 1.00 37.87 ? 659 HOH A O   1 
HETATM 3741 O O   . HOH C 3 .   ? 2.954   -9.326  38.873 1.00 27.28 ? 660 HOH A O   1 
HETATM 3742 O O   . HOH C 3 .   ? 1.589   19.206  32.277 1.00 25.81 ? 661 HOH A O   1 
HETATM 3743 O O   . HOH C 3 .   ? -2.715  19.040  28.712 1.00 37.97 ? 662 HOH A O   1 
HETATM 3744 O O   . HOH C 3 .   ? -8.408  14.711  14.619 1.00 36.29 ? 663 HOH A O   1 
HETATM 3745 O O   . HOH C 3 .   ? 20.655  12.188  26.308 1.00 34.12 ? 664 HOH A O   1 
HETATM 3746 O O   . HOH C 3 .   ? 18.333  16.184  23.928 1.00 28.38 ? 665 HOH A O   1 
HETATM 3747 O O   . HOH C 3 .   ? 15.958  18.949  34.765 1.00 45.38 ? 666 HOH A O   1 
HETATM 3748 O O   . HOH C 3 .   ? 13.301  18.913  35.863 1.00 38.36 ? 667 HOH A O   1 
HETATM 3749 O O   . HOH C 3 .   ? 19.070  -0.792  49.387 1.00 39.68 ? 668 HOH A O   1 
HETATM 3750 O O   . HOH C 3 .   ? -1.745  12.572  52.155 1.00 38.63 ? 669 HOH A O   1 
HETATM 3751 O O   . HOH C 3 .   ? 11.715  22.018  42.115 1.00 40.34 ? 670 HOH A O   1 
HETATM 3752 O O   . HOH C 3 .   ? 27.770  22.959  70.291 1.00 30.70 ? 671 HOH A O   1 
HETATM 3753 O O   . HOH C 3 .   ? 19.030  31.200  53.719 1.00 29.68 ? 672 HOH A O   1 
HETATM 3754 O O   . HOH C 3 .   ? 19.782  32.547  56.069 1.00 28.60 ? 673 HOH A O   1 
HETATM 3755 O O   . HOH C 3 .   ? 38.473  9.375   53.952 1.00 36.55 ? 674 HOH A O   1 
HETATM 3756 O O   . HOH C 3 .   ? 26.733  17.298  44.268 1.00 34.53 ? 675 HOH A O   1 
HETATM 3757 O O   . HOH C 3 .   ? 19.567  29.639  61.331 1.00 32.28 ? 676 HOH A O   1 
HETATM 3758 O O   . HOH C 3 .   ? 31.237  20.599  69.808 1.00 42.91 ? 677 HOH A O   1 
HETATM 3759 O O   . HOH C 3 .   ? 38.626  11.030  57.434 1.00 30.64 ? 678 HOH A O   1 
HETATM 3760 O O   . HOH C 3 .   ? 18.223  23.779  53.730 1.00 19.55 ? 679 HOH A O   1 
HETATM 3761 O O   . HOH C 3 .   ? 16.368  22.030  52.354 1.00 36.17 ? 680 HOH A O   1 
HETATM 3762 O O   . HOH C 3 .   ? 16.804  25.713  58.065 1.00 37.33 ? 681 HOH A O   1 
HETATM 3763 O O   . HOH C 3 .   ? 18.844  24.826  47.969 1.00 40.69 ? 682 HOH A O   1 
HETATM 3764 O O   . HOH C 3 .   ? 15.757  13.974  21.174 1.00 33.53 ? 683 HOH A O   1 
HETATM 3765 O O   . HOH C 3 .   ? 23.793  6.152   65.978 1.00 43.42 ? 684 HOH A O   1 
HETATM 3766 O O   . HOH C 3 .   ? 22.779  9.229   68.676 1.00 34.06 ? 685 HOH A O   1 
HETATM 3767 O O   . HOH C 3 .   ? 17.198  3.961   62.562 1.00 23.91 ? 686 HOH A O   1 
HETATM 3768 O O   . HOH C 3 .   ? 29.189  37.042  63.451 1.00 26.51 ? 687 HOH A O   1 
HETATM 3769 O O   . HOH C 3 .   ? 38.484  36.413  59.115 1.00 44.63 ? 688 HOH A O   1 
HETATM 3770 O O   . HOH C 3 .   ? 35.640  36.506  59.106 1.00 33.90 ? 689 HOH A O   1 
HETATM 3771 O O   . HOH C 3 .   ? 36.185  37.313  56.583 1.00 28.01 ? 690 HOH A O   1 
HETATM 3772 O O   . HOH C 3 .   ? 40.808  36.499  60.653 1.00 47.26 ? 691 HOH A O   1 
HETATM 3773 O O   . HOH C 3 .   ? 29.442  32.349  72.951 1.00 36.95 ? 692 HOH A O   1 
HETATM 3774 O O   . HOH C 3 .   ? 6.189   20.230  53.344 1.00 39.90 ? 693 HOH A O   1 
HETATM 3775 O O   . HOH C 3 .   ? 7.217   23.641  35.831 1.00 43.63 ? 694 HOH A O   1 
HETATM 3776 O O   . HOH C 3 .   ? -6.807  6.723   4.871  1.00 32.10 ? 695 HOH A O   1 
HETATM 3777 O O   . HOH C 3 .   ? -15.407 -6.111  26.641 1.00 29.55 ? 696 HOH A O   1 
HETATM 3778 O O   . HOH C 3 .   ? -3.686  1.460   3.357  1.00 35.78 ? 697 HOH A O   1 
HETATM 3779 O O   . HOH C 3 .   ? -9.818  6.001   7.019  1.00 41.01 ? 698 HOH A O   1 
HETATM 3780 O O   . HOH C 3 .   ? 4.405   -4.722  5.377  1.00 31.04 ? 699 HOH A O   1 
HETATM 3781 O O   . HOH C 3 .   ? 7.487   -5.213  6.393  1.00 26.16 ? 700 HOH A O   1 
HETATM 3782 O O   . HOH C 3 .   ? -1.531  -3.774  3.480  1.00 45.59 ? 701 HOH A O   1 
HETATM 3783 O O   . HOH C 3 .   ? 1.441   -9.603  10.119 1.00 27.76 ? 702 HOH A O   1 
HETATM 3784 O O   . HOH C 3 .   ? 16.620  10.790  23.468 1.00 39.25 ? 703 HOH A O   1 
HETATM 3785 O O   . HOH C 3 .   ? 11.193  -21.778 32.991 1.00 38.86 ? 704 HOH A O   1 
HETATM 3786 O O   . HOH C 3 .   ? 14.866  -15.592 38.162 1.00 43.88 ? 705 HOH A O   1 
HETATM 3787 O O   . HOH C 3 .   ? 25.277  5.147   34.771 1.00 27.18 ? 706 HOH A O   1 
HETATM 3788 O O   . HOH C 3 .   ? 33.160  5.637   45.661 1.00 33.47 ? 707 HOH A O   1 
HETATM 3789 O O   . HOH C 3 .   ? 31.474  10.364  43.049 1.00 38.72 ? 708 HOH A O   1 
HETATM 3790 O O   . HOH C 3 .   ? 35.121  5.913   49.851 1.00 40.20 ? 709 HOH A O   1 
HETATM 3791 O O   . HOH C 3 .   ? 25.633  13.691  40.268 1.00 42.51 ? 710 HOH A O   1 
HETATM 3792 O O   . HOH C 3 .   ? 16.242  21.014  44.896 1.00 28.36 ? 711 HOH A O   1 
HETATM 3793 O O   . HOH C 3 .   ? 24.392  30.764  67.503 1.00 29.12 ? 712 HOH A O   1 
HETATM 3794 O O   . HOH C 3 .   ? 40.032  18.976  53.524 1.00 31.21 ? 713 HOH A O   1 
HETATM 3795 O O   . HOH C 3 .   ? 1.344   20.539  38.106 1.00 39.36 ? 714 HOH A O   1 
HETATM 3796 O O   . HOH C 3 .   ? 34.216  31.448  53.724 1.00 35.55 ? 715 HOH A O   1 
HETATM 3797 O O   . HOH C 3 .   ? 32.175  33.484  55.118 1.00 33.63 ? 716 HOH A O   1 
HETATM 3798 O O   . HOH C 3 .   ? 27.520  4.037   60.935 1.00 28.73 ? 717 HOH A O   1 
HETATM 3799 O O   . HOH C 3 .   ? 9.405   -13.628 35.785 1.00 35.64 ? 718 HOH A O   1 
HETATM 3800 O O   . HOH C 3 .   ? -0.411  27.136  28.154 1.00 41.33 ? 719 HOH A O   1 
HETATM 3801 O O   . HOH C 3 .   ? 3.841   15.601  7.304  1.00 45.75 ? 720 HOH A O   1 
HETATM 3802 O O   . HOH C 3 .   ? 14.751  -3.543  48.951 1.00 33.76 ? 721 HOH A O   1 
HETATM 3803 O O   . HOH C 3 .   ? 13.753  -6.367  43.618 1.00 31.73 ? 722 HOH A O   1 
HETATM 3804 O O   . HOH C 3 .   ? -14.879 11.139  30.901 1.00 33.69 ? 723 HOH A O   1 
HETATM 3805 O O   . HOH C 3 .   ? -13.982 8.466   33.769 1.00 38.29 ? 724 HOH A O   1 
HETATM 3806 O O   . HOH C 3 .   ? -15.309 -4.132  22.347 1.00 28.71 ? 725 HOH A O   1 
HETATM 3807 O O   . HOH C 3 .   ? 17.201  -7.232  38.411 1.00 33.77 ? 726 HOH A O   1 
HETATM 3808 O O   . HOH C 3 .   ? 2.470   15.523  39.550 1.00 38.26 ? 727 HOH A O   1 
HETATM 3809 O O   . HOH C 3 .   ? -2.642  14.892  41.858 1.00 33.29 ? 728 HOH A O   1 
HETATM 3810 O O   . HOH C 3 .   ? 1.179   19.007  47.935 1.00 34.43 ? 729 HOH A O   1 
HETATM 3811 O O   . HOH C 3 .   ? -14.720 -8.663  19.514 1.00 36.56 ? 730 HOH A O   1 
HETATM 3812 O O   . HOH C 3 .   ? -18.454 -5.747  18.398 1.00 35.64 ? 731 HOH A O   1 
HETATM 3813 O O   . HOH C 3 .   ? 11.142  -17.304 11.601 1.00 34.32 ? 732 HOH A O   1 
HETATM 3814 O O   . HOH C 3 .   ? -0.249  -22.197 10.278 1.00 39.25 ? 733 HOH A O   1 
HETATM 3815 O O   . HOH C 3 .   ? 0.125   -9.786  42.613 1.00 36.78 ? 734 HOH A O   1 
HETATM 3816 O O   . HOH C 3 .   ? 21.935  -1.548  20.936 1.00 37.96 ? 735 HOH A O   1 
HETATM 3817 O O   . HOH C 3 .   ? -10.562 -3.571  36.060 1.00 35.30 ? 736 HOH A O   1 
HETATM 3818 O O   . HOH C 3 .   ? -14.022 -2.959  33.509 1.00 42.66 ? 737 HOH A O   1 
HETATM 3819 O O   . HOH C 3 .   ? 18.424  18.922  36.420 1.00 34.64 ? 738 HOH A O   1 
HETATM 3820 O O   . HOH C 3 .   ? 19.624  14.408  40.760 1.00 32.33 ? 739 HOH A O   1 
HETATM 3821 O O   . HOH C 3 .   ? 5.179   8.093   52.775 1.00 36.76 ? 740 HOH A O   1 
HETATM 3822 O O   . HOH C 3 .   ? -5.011  8.567   45.145 1.00 39.68 ? 741 HOH A O   1 
HETATM 3823 O O   . HOH C 3 .   ? -8.123  -3.413  45.530 1.00 39.36 ? 742 HOH A O   1 
HETATM 3824 O O   . HOH C 3 .   ? 20.328  12.223  67.626 1.00 41.82 ? 743 HOH A O   1 
HETATM 3825 O O   . HOH C 3 .   ? 37.654  9.098   47.147 1.00 36.29 ? 744 HOH A O   1 
HETATM 3826 O O   . HOH C 3 .   ? 17.332  26.423  61.797 1.00 34.91 ? 745 HOH A O   1 
HETATM 3827 O O   . HOH C 3 .   ? 8.781   -16.257 33.752 1.00 20.00 ? 746 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   1   1   LYS LYS A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   CYS 4   4   4   CYS CYS A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   GLY 6   6   6   GLY GLY A . n 
A 1 7   HIS 7   7   7   HIS HIS A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  CYS 10  10  10  CYS CYS A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  TRP 17  17  17  TRP TRP A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  MET 20  20  20  MET MET A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  TRP 30  30  30  TRP TRP A . n 
A 1 31  SER 31  30  30  SER SER A A n 
A 1 32  PRO 32  31  31  PRO PRO A . n 
A 1 33  GLU 33  32  32  GLU GLU A . n 
A 1 34  ASP 34  33  33  ASP ASP A . n 
A 1 35  ILE 35  34  34  ILE ILE A . n 
A 1 36  ASP 36  35  35  ASP ASP A . n 
A 1 37  THR 37  36  36  THR THR A . n 
A 1 38  ARG 38  37  37  ARG ARG A . n 
A 1 39  PHE 39  38  38  PHE PHE A . n 
A 1 40  LEU 40  39  39  LEU LEU A . n 
A 1 41  LEU 41  40  40  LEU LEU A . n 
A 1 42  TYR 42  41  41  TYR TYR A . n 
A 1 43  THR 43  42  42  THR THR A . n 
A 1 44  ASN 44  43  43  ASN ASN A . n 
A 1 45  GLU 45  44  44  GLU GLU A . n 
A 1 46  ASN 46  45  45  ASN ASN A . n 
A 1 47  PRO 47  46  46  PRO PRO A . n 
A 1 48  ASN 48  47  47  ASN ASN A . n 
A 1 49  ASN 49  48  48  ASN ASN A . n 
A 1 50  TYR 50  49  49  TYR TYR A . n 
A 1 51  GLN 51  50  50  GLN GLN A . n 
A 1 52  LYS 52  51  51  LYS LYS A . n 
A 1 53  ILE 53  52  52  ILE ILE A . n 
A 1 54  SER 54  53  53  SER SER A . n 
A 1 55  ALA 55  54  54  ALA ALA A . n 
A 1 56  THR 56  55  55  THR THR A . n 
A 1 57  GLU 57  55  55  GLU GLU A A n 
A 1 58  PRO 58  56  56  PRO PRO A . n 
A 1 59  ASP 59  57  57  ASP ASP A . n 
A 1 60  THR 60  58  58  THR THR A . n 
A 1 61  ILE 61  59  59  ILE ILE A . n 
A 1 62  LYS 62  60  60  LYS LYS A . n 
A 1 63  PHE 63  61  61  PHE PHE A . n 
A 1 64  SER 64  62  62  SER SER A . n 
A 1 65  ASN 65  63  63  ASN ASN A . n 
A 1 66  PHE 66  64  64  PHE PHE A . n 
A 1 67  GLN 67  65  65  GLN GLN A . n 
A 1 68  LEU 68  66  66  LEU LEU A . n 
A 1 69  ASP 69  67  67  ASP ASP A . n 
A 1 70  ARG 70  68  68  ARG ARG A . n 
A 1 71  LYS 71  69  69  LYS LYS A . n 
A 1 72  THR 72  70  70  THR THR A . n 
A 1 73  ARG 73  71  71  ARG ARG A . n 
A 1 74  PHE 74  72  72  PHE PHE A . n 
A 1 75  ILE 75  73  73  ILE ILE A . n 
A 1 76  VAL 76  74  74  VAL VAL A . n 
A 1 77  HIS 77  75  75  HIS HIS A . n 
A 1 78  GLY 78  76  76  GLY GLY A . n 
A 1 79  PHE 79  77  77  PHE PHE A . n 
A 1 80  ILE 80  78  78  ILE ILE A . n 
A 1 81  ASP 81  79  79  ASP ASP A . n 
A 1 82  LYS 82  80  80  LYS LYS A . n 
A 1 83  GLY 83  81  81  GLY GLY A . n 
A 1 84  GLU 84  82  82  GLU GLU A . n 
A 1 85  ASP 85  83  83  ASP ASP A . n 
A 1 86  GLY 86  84  84  GLY GLY A . n 
A 1 87  TRP 87  85  85  TRP TRP A . n 
A 1 88  LEU 88  86  86  LEU LEU A . n 
A 1 89  LEU 89  87  87  LEU LEU A . n 
A 1 90  ASP 90  88  88  ASP ASP A . n 
A 1 91  MET 91  89  89  MET MET A . n 
A 1 92  CYS 92  90  90  CYS CYS A . n 
A 1 93  LYS 93  91  91  LYS LYS A . n 
A 1 94  LYS 94  92  92  LYS LYS A . n 
A 1 95  MET 95  93  93  MET MET A . n 
A 1 96  PHE 96  94  94  PHE PHE A . n 
A 1 97  GLN 97  95  95  GLN GLN A . n 
A 1 98  VAL 98  96  96  VAL VAL A . n 
A 1 99  GLU 99  97  97  GLU GLU A . n 
A 1 100 LYS 100 98  98  LYS LYS A . n 
A 1 101 VAL 101 99  99  VAL VAL A . n 
A 1 102 ASN 102 100 100 ASN ASN A . n 
A 1 103 CYS 103 101 101 CYS CYS A . n 
A 1 104 ILE 104 102 102 ILE ILE A . n 
A 1 105 CYS 105 103 103 CYS CYS A . n 
A 1 106 VAL 106 104 104 VAL VAL A . n 
A 1 107 ASP 107 105 105 ASP ASP A . n 
A 1 108 TRP 108 106 106 TRP TRP A . n 
A 1 109 ARG 109 107 107 ARG ARG A . n 
A 1 110 ARG 110 108 108 ARG ARG A . n 
A 1 111 GLY 111 109 109 GLY GLY A . n 
A 1 112 SER 112 110 110 SER SER A . n 
A 1 113 ARG 113 111 111 ARG ARG A . n 
A 1 114 THR 114 112 112 THR THR A . n 
A 1 115 GLU 115 113 113 GLU GLU A . n 
A 1 116 TYR 116 114 114 TYR TYR A . n 
A 1 117 THR 117 115 115 THR THR A . n 
A 1 118 GLN 118 116 116 GLN GLN A . n 
A 1 119 ALA 119 117 117 ALA ALA A . n 
A 1 120 SER 120 118 118 SER SER A . n 
A 1 121 TYR 121 119 119 TYR TYR A . n 
A 1 122 ASN 122 120 120 ASN ASN A . n 
A 1 123 THR 123 121 121 THR THR A . n 
A 1 124 ARG 124 122 122 ARG ARG A . n 
A 1 125 VAL 125 123 123 VAL VAL A . n 
A 1 126 VAL 126 124 124 VAL VAL A . n 
A 1 127 GLY 127 125 125 GLY GLY A . n 
A 1 128 ALA 128 126 126 ALA ALA A . n 
A 1 129 GLU 129 127 127 GLU GLU A . n 
A 1 130 ILE 130 128 128 ILE ILE A . n 
A 1 131 ALA 131 129 129 ALA ALA A . n 
A 1 132 PHE 132 130 130 PHE PHE A . n 
A 1 133 LEU 133 131 131 LEU LEU A . n 
A 1 134 VAL 134 132 132 VAL VAL A . n 
A 1 135 GLN 135 133 133 GLN GLN A . n 
A 1 136 VAL 136 134 134 VAL VAL A . n 
A 1 137 LEU 137 135 135 LEU LEU A . n 
A 1 138 SER 138 136 136 SER SER A . n 
A 1 139 THR 139 137 137 THR THR A . n 
A 1 140 GLU 140 138 138 GLU GLU A . n 
A 1 141 MET 141 139 139 MET MET A . n 
A 1 142 GLY 142 140 140 GLY GLY A . n 
A 1 143 TYR 143 141 141 TYR TYR A . n 
A 1 144 SER 144 142 142 SER SER A . n 
A 1 145 PRO 145 143 143 PRO PRO A . n 
A 1 146 GLU 146 144 144 GLU GLU A . n 
A 1 147 ASN 147 145 145 ASN ASN A . n 
A 1 148 VAL 148 146 146 VAL VAL A . n 
A 1 149 HIS 149 147 147 HIS HIS A . n 
A 1 150 LEU 150 148 148 LEU LEU A . n 
A 1 151 ILE 151 149 149 ILE ILE A . n 
A 1 152 GLY 152 150 150 GLY GLY A . n 
A 1 153 HIS 153 151 151 HIS HIS A . n 
A 1 154 SER 154 152 152 SER SER A . n 
A 1 155 LEU 155 153 153 LEU LEU A . n 
A 1 156 GLY 156 154 154 GLY GLY A . n 
A 1 157 ALA 157 155 155 ALA ALA A . n 
A 1 158 HIS 158 156 156 HIS HIS A . n 
A 1 159 VAL 159 157 157 VAL VAL A . n 
A 1 160 VAL 160 158 158 VAL VAL A . n 
A 1 161 GLY 161 159 159 GLY GLY A . n 
A 1 162 GLU 162 160 160 GLU GLU A . n 
A 1 163 ALA 163 161 161 ALA ALA A . n 
A 1 164 GLY 164 162 162 GLY GLY A . n 
A 1 165 ARG 165 163 163 ARG ARG A . n 
A 1 166 ARG 166 164 164 ARG ARG A . n 
A 1 167 LEU 167 165 165 LEU LEU A . n 
A 1 168 GLU 168 166 166 GLU GLU A . n 
A 1 169 GLY 169 167 167 GLY GLY A . n 
A 1 170 HIS 170 168 168 HIS HIS A . n 
A 1 171 VAL 171 169 169 VAL VAL A . n 
A 1 172 GLY 172 170 170 GLY GLY A . n 
A 1 173 ARG 173 171 171 ARG ARG A . n 
A 1 174 ILE 174 172 172 ILE ILE A . n 
A 1 175 THR 175 173 173 THR THR A . n 
A 1 176 GLY 176 174 174 GLY GLY A . n 
A 1 177 LEU 177 175 175 LEU LEU A . n 
A 1 178 ASP 178 176 176 ASP ASP A . n 
A 1 179 PRO 179 177 177 PRO PRO A . n 
A 1 180 ALA 180 178 178 ALA ALA A . n 
A 1 181 GLU 181 179 179 GLU GLU A . n 
A 1 182 PRO 182 180 180 PRO PRO A . n 
A 1 183 CYS 183 181 181 CYS CYS A . n 
A 1 184 PHE 184 182 182 PHE PHE A . n 
A 1 185 GLN 185 183 183 GLN GLN A . n 
A 1 186 GLY 186 184 184 GLY GLY A . n 
A 1 187 LEU 187 185 185 LEU LEU A . n 
A 1 188 PRO 188 186 186 PRO PRO A . n 
A 1 189 GLU 189 187 187 GLU GLU A . n 
A 1 190 GLU 190 188 188 GLU GLU A . n 
A 1 191 VAL 191 189 189 VAL VAL A . n 
A 1 192 ARG 192 190 190 ARG ARG A . n 
A 1 193 LEU 193 191 191 LEU LEU A . n 
A 1 194 ASP 194 192 192 ASP ASP A . n 
A 1 195 PRO 195 193 193 PRO PRO A . n 
A 1 196 SER 196 194 194 SER SER A . n 
A 1 197 ASP 197 195 195 ASP ASP A . n 
A 1 198 ALA 198 196 196 ALA ALA A . n 
A 1 199 MET 199 197 197 MET MET A . n 
A 1 200 PHE 200 198 198 PHE PHE A . n 
A 1 201 VAL 201 199 199 VAL VAL A . n 
A 1 202 ASP 202 200 200 ASP ASP A . n 
A 1 203 VAL 203 201 201 VAL VAL A . n 
A 1 204 ILE 204 202 202 ILE ILE A . n 
A 1 205 HIS 205 203 203 HIS HIS A . n 
A 1 206 THR 206 204 204 THR THR A . n 
A 1 207 ASP 207 205 205 ASP ASP A . n 
A 1 208 SER 208 206 206 SER SER A . n 
A 1 209 ALA 209 207 207 ALA ALA A . n 
A 1 210 PRO 210 208 208 PRO PRO A . n 
A 1 211 ILE 211 209 209 ILE ILE A . n 
A 1 212 ILE 212 210 210 ILE ILE A . n 
A 1 213 PRO 213 211 211 PRO PRO A . n 
A 1 214 TYR 214 212 212 TYR TYR A . n 
A 1 215 LEU 215 213 213 LEU LEU A . n 
A 1 216 GLY 216 214 214 GLY GLY A . n 
A 1 217 PHE 217 215 215 PHE PHE A . n 
A 1 218 GLY 218 216 216 GLY GLY A . n 
A 1 219 MET 219 217 217 MET MET A . n 
A 1 220 SER 220 218 218 SER SER A . n 
A 1 221 GLN 221 219 219 GLN GLN A . n 
A 1 222 LYS 222 220 220 LYS LYS A . n 
A 1 223 VAL 223 221 221 VAL VAL A . n 
A 1 224 GLY 224 222 222 GLY GLY A . n 
A 1 225 HIS 225 223 223 HIS HIS A . n 
A 1 226 LEU 226 224 224 LEU LEU A . n 
A 1 227 ASP 227 225 225 ASP ASP A . n 
A 1 228 PHE 228 226 226 PHE PHE A . n 
A 1 229 PHE 229 227 227 PHE PHE A . n 
A 1 230 PRO 230 228 228 PRO PRO A . n 
A 1 231 ASN 231 229 229 ASN ASN A . n 
A 1 232 GLY 232 230 230 GLY GLY A . n 
A 1 233 GLY 233 231 231 GLY GLY A . n 
A 1 234 LYS 234 232 232 LYS LYS A . n 
A 1 235 GLU 235 233 233 GLU GLU A . n 
A 1 236 MET 236 234 234 MET MET A . n 
A 1 237 PRO 237 235 235 PRO PRO A . n 
A 1 238 GLY 238 236 236 GLY GLY A . n 
A 1 239 CYS 239 237 237 CYS CYS A . n 
A 1 240 GLN 240 238 238 GLN GLN A . n 
A 1 241 LYS 241 239 239 LYS LYS A . n 
A 1 242 ASN 242 240 240 ASN ASN A . n 
A 1 243 ILE 243 241 241 ILE ILE A . n 
A 1 244 LEU 244 242 242 LEU LEU A . n 
A 1 245 SER 245 243 243 SER SER A . n 
A 1 246 THR 246 244 244 THR ALA A . n 
A 1 247 ILE 247 245 245 ILE ILE A . n 
A 1 248 VAL 248 246 246 VAL VAL A . n 
A 1 249 ASP 249 247 247 ASP ASP A . n 
A 1 250 ILE 250 248 248 ILE ILE A . n 
A 1 251 ASN 251 249 249 ASN ASN A . n 
A 1 252 GLY 252 250 250 GLY GLY A . n 
A 1 253 ILE 253 251 251 ILE ILE A . n 
A 1 254 TRP 254 252 252 TRP TRP A . n 
A 1 255 GLU 255 253 253 GLU GLU A . n 
A 1 256 GLY 256 254 254 GLY GLY A . n 
A 1 257 THR 257 255 255 THR THR A . n 
A 1 258 GLN 258 256 256 GLN GLN A . n 
A 1 259 ASN 259 257 257 ASN ASN A . n 
A 1 260 PHE 260 258 258 PHE PHE A . n 
A 1 261 VAL 261 259 259 VAL VAL A . n 
A 1 262 ALA 262 260 260 ALA ALA A . n 
A 1 263 CYS 263 261 261 CYS CYS A . n 
A 1 264 ASN 264 262 262 ASN ASN A . n 
A 1 265 HIS 265 263 263 HIS HIS A . n 
A 1 266 LEU 266 264 264 LEU LEU A . n 
A 1 267 ARG 267 265 265 ARG ARG A . n 
A 1 268 SER 268 266 266 SER SER A . n 
A 1 269 TYR 269 267 267 TYR TYR A . n 
A 1 270 LYS 270 268 268 LYS LYS A . n 
A 1 271 TYR 271 269 269 TYR TYR A . n 
A 1 272 TYR 272 270 270 TYR TYR A . n 
A 1 273 ALA 273 271 271 ALA ALA A . n 
A 1 274 SER 274 272 272 SER SER A . n 
A 1 275 SER 275 273 273 SER SER A . n 
A 1 276 ILE 276 274 274 ILE ILE A . n 
A 1 277 LEU 277 275 275 LEU LEU A . n 
A 1 278 ASN 278 276 276 ASN ASN A . n 
A 1 279 PRO 279 277 277 PRO PRO A . n 
A 1 280 ASP 280 278 278 ASP ASP A . n 
A 1 281 GLY 281 279 279 GLY GLY A . n 
A 1 282 PHE 282 280 280 PHE PHE A . n 
A 1 283 LEU 283 281 281 LEU LEU A . n 
A 1 284 GLY 284 282 282 GLY GLY A . n 
A 1 285 TYR 285 283 283 TYR TYR A . n 
A 1 286 PRO 286 284 284 PRO PRO A . n 
A 1 287 CYS 287 285 285 CYS CYS A . n 
A 1 288 SER 288 286 286 SER SER A . n 
A 1 289 SER 289 287 287 SER SER A . n 
A 1 290 TYR 290 288 288 TYR TYR A . n 
A 1 291 GLU 291 289 289 GLU GLU A . n 
A 1 292 LYS 292 290 290 LYS LYS A . n 
A 1 293 PHE 293 291 291 PHE PHE A . n 
A 1 294 GLN 294 292 292 GLN GLN A . n 
A 1 295 GLN 295 293 293 GLN GLN A . n 
A 1 296 ASN 296 294 294 ASN ASN A . n 
A 1 297 ASP 297 295 295 ASP ASP A . n 
A 1 298 CYS 298 296 296 CYS CYS A . n 
A 1 299 PHE 299 297 297 PHE PHE A . n 
A 1 300 PRO 300 298 298 PRO PRO A . n 
A 1 301 CYS 301 299 299 CYS CYS A . n 
A 1 302 PRO 302 300 300 PRO PRO A . n 
A 1 303 GLU 303 301 301 GLU GLU A . n 
A 1 304 GLU 304 302 302 GLU GLU A . n 
A 1 305 GLY 305 303 303 GLY GLY A . n 
A 1 306 CYS 306 304 304 CYS CYS A . n 
A 1 307 PRO 307 305 305 PRO PRO A . n 
A 1 308 LYS 308 306 306 LYS LYS A . n 
A 1 309 MET 309 307 307 MET MET A . n 
A 1 310 GLY 310 308 308 GLY GLY A . n 
A 1 311 HIS 311 309 309 HIS HIS A . n 
A 1 312 TYR 312 310 310 TYR TYR A . n 
A 1 313 ALA 313 311 311 ALA ALA A . n 
A 1 314 ASP 314 312 312 ASP ASP A . n 
A 1 315 GLN 315 313 313 GLN GLN A . n 
A 1 316 PHE 316 314 314 PHE PHE A . n 
A 1 317 GLU 317 315 315 GLU GLU A . n 
A 1 318 GLY 318 316 316 GLY GLY A . n 
A 1 319 LYS 319 317 317 LYS LYS A . n 
A 1 320 THR 320 318 318 THR THR A . n 
A 1 321 ALA 321 319 319 ALA ALA A . n 
A 1 322 THR 322 320 320 THR THR A . n 
A 1 323 VAL 323 321 321 VAL VAL A . n 
A 1 324 GLU 324 322 322 GLU GLU A . n 
A 1 325 GLN 325 323 323 GLN GLN A . n 
A 1 326 THR 326 324 324 THR THR A . n 
A 1 327 VAL 327 325 325 VAL VAL A . n 
A 1 328 TYR 328 326 326 TYR TYR A . n 
A 1 329 LEU 329 327 327 LEU LEU A . n 
A 1 330 ASN 330 328 328 ASN ASN A . n 
A 1 331 THR 331 329 329 THR THR A . n 
A 1 332 GLY 332 330 330 GLY GLY A . n 
A 1 333 ASP 333 331 331 ASP ASP A . n 
A 1 334 SER 334 332 332 SER SER A . n 
A 1 335 GLY 335 333 333 GLY GLY A . n 
A 1 336 ASN 336 334 334 ASN ASN A . n 
A 1 337 PHE 337 335 335 PHE PHE A . n 
A 1 338 THR 338 336 336 THR THR A . n 
A 1 339 ARG 339 337 337 ARG ARG A . n 
A 1 340 TRP 340 338 338 TRP TRP A . n 
A 1 341 ARG 341 339 339 ARG ARG A . n 
A 1 342 TYR 342 340 340 TYR TYR A . n 
A 1 343 LYS 343 341 341 LYS LYS A . n 
A 1 344 VAL 344 342 342 VAL VAL A . n 
A 1 345 SER 345 343 343 SER SER A . n 
A 1 346 VAL 346 344 344 VAL VAL A . n 
A 1 347 THR 347 345 345 THR THR A . n 
A 1 348 LEU 348 346 346 LEU LEU A . n 
A 1 349 SER 349 347 347 SER SER A . n 
A 1 350 GLY 350 348 348 GLY GLY A . n 
A 1 351 ALA 351 348 348 ALA ALA A A n 
A 1 352 LYS 352 349 349 LYS LYS A . n 
A 1 353 LYS 353 350 350 LYS LYS A . n 
A 1 354 LEU 354 351 351 LEU LEU A . n 
A 1 355 SER 355 352 352 SER SER A . n 
A 1 356 GLY 356 353 353 GLY GLY A . n 
A 1 357 TYR 357 354 354 TYR TYR A . n 
A 1 358 ILE 358 355 355 ILE ILE A . n 
A 1 359 LEU 359 356 356 LEU LEU A . n 
A 1 360 VAL 360 357 357 VAL VAL A . n 
A 1 361 ALA 361 358 358 ALA ALA A . n 
A 1 362 LEU 362 359 359 LEU LEU A . n 
A 1 363 TYR 363 360 360 TYR TYR A . n 
A 1 364 GLY 364 361 361 GLY GLY A . n 
A 1 365 ASN 365 362 362 ASN ASN A . n 
A 1 366 ASN 366 363 363 ASN ASN A . n 
A 1 367 GLY 367 364 364 GLY GLY A . n 
A 1 368 ASN 368 365 365 ASN ASN A . n 
A 1 369 SER 369 366 366 SER SER A . n 
A 1 370 LYS 370 367 367 LYS LYS A . n 
A 1 371 GLN 371 368 368 GLN GLN A . n 
A 1 372 TYR 372 369 369 TYR TYR A . n 
A 1 373 GLU 373 370 370 GLU GLU A . n 
A 1 374 ILE 374 371 371 ILE ILE A . n 
A 1 375 PHE 375 372 372 PHE PHE A . n 
A 1 376 LYS 376 373 373 LYS LYS A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 SER 378 375 375 SER SER A . n 
A 1 379 LEU 379 376 376 LEU LEU A . n 
A 1 380 LYS 380 377 377 LYS LYS A . n 
A 1 381 PRO 381 378 378 PRO PRO A . n 
A 1 382 GLU 382 379 379 GLU GLU A . n 
A 1 383 ALA 383 380 380 ALA ALA A . n 
A 1 384 ARG 384 381 381 ARG ARG A . n 
A 1 385 HIS 385 382 382 HIS HIS A . n 
A 1 386 VAL 386 383 383 VAL VAL A . n 
A 1 387 ARG 387 384 384 ARG ARG A . n 
A 1 388 ASP 388 385 385 ASP ASP A . n 
A 1 389 ILE 389 386 386 ILE ILE A . n 
A 1 390 ASP 390 387 387 ASP ASP A . n 
A 1 391 VAL 391 388 388 VAL VAL A . n 
A 1 392 ASP 392 389 389 ASP ASP A . n 
A 1 393 ILE 393 390 390 ILE ILE A . n 
A 1 394 ASN 394 391 391 ASN ASN A . n 
A 1 395 VAL 395 392 392 VAL VAL A . n 
A 1 396 GLY 396 393 393 GLY GLY A . n 
A 1 397 GLU 397 394 394 GLU GLU A . n 
A 1 398 ILE 398 395 395 ILE ILE A . n 
A 1 399 GLN 399 396 396 GLN GLN A . n 
A 1 400 LYS 400 397 397 LYS LYS A . n 
A 1 401 VAL 401 398 398 VAL VAL A . n 
A 1 402 LYS 402 399 399 LYS LYS A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 LEU 404 401 401 LEU LEU A . n 
A 1 405 TRP 405 402 402 TRP TRP A . n 
A 1 406 ASN 406 403 403 ASN ASN A . n 
A 1 407 ASN 407 404 404 ASN ALA A . n 
A 1 408 LYS 408 406 ?   ?   ?   A . n 
A 1 409 VAL 409 407 ?   ?   ?   A . n 
A 1 410 ILE 410 408 ?   ?   ?   A . n 
A 1 411 ASN 411 409 ?   ?   ?   A . n 
A 1 412 LEU 412 410 ?   ?   ?   A . n 
A 1 413 PHE 413 411 ?   ?   ?   A . n 
A 1 414 ARG 414 412 412 ARG ALA A . n 
A 1 415 PRO 415 413 413 PRO PRO A . n 
A 1 416 THR 416 414 414 THR THR A . n 
A 1 417 LEU 417 415 415 LEU LEU A . n 
A 1 418 GLY 418 416 416 GLY GLY A . n 
A 1 419 ALA 419 417 417 ALA ALA A . n 
A 1 420 SER 420 418 418 SER SER A . n 
A 1 421 GLN 421 419 419 GLN GLN A . n 
A 1 422 ILE 422 420 420 ILE ILE A . n 
A 1 423 THR 423 421 421 THR THR A . n 
A 1 424 VAL 424 422 422 VAL VAL A . n 
A 1 425 GLN 425 423 423 GLN GLN A . n 
A 1 426 SER 426 424 424 SER SER A . n 
A 1 427 GLY 427 425 425 GLY GLY A . n 
A 1 428 VAL 428 426 426 VAL VAL A . n 
A 1 429 ASP 429 427 427 ASP ASP A . n 
A 1 430 GLY 430 427 427 GLY GLY A A n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 GLU 432 429 429 GLU GLU A . n 
A 1 433 TYR 433 430 430 TYR TYR A . n 
A 1 434 ASN 434 431 431 ASN ASN A . n 
A 1 435 PHE 435 432 432 PHE PHE A . n 
A 1 436 CYS 436 433 433 CYS CYS A . n 
A 1 437 SER 437 434 434 SER SER A . n 
A 1 438 SER 438 435 435 SER SER A . n 
A 1 439 ASP 439 436 436 ASP ASP A . n 
A 1 440 THR 440 437 437 THR THR A . n 
A 1 441 VAL 441 438 438 VAL VAL A . n 
A 1 442 ARG 442 439 439 ARG ARG A . n 
A 1 443 GLU 443 440 440 GLU GLU A . n 
A 1 444 ASP 444 441 441 ASP ASP A . n 
A 1 445 VAL 445 442 442 VAL VAL A . n 
A 1 446 LEU 446 443 443 LEU LEU A . n 
A 1 447 GLN 447 444 444 GLN GLN A . n 
A 1 448 SER 448 445 445 SER SER A . n 
A 1 449 LEU 449 446 446 LEU LEU A . n 
A 1 450 TYR 450 447 447 TYR TYR A . n 
A 1 451 PRO 451 448 448 PRO PRO A . n 
A 1 452 CYS 452 449 449 CYS CYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   451 451 NAG NAG A . 
C 3 HOH 1   452 1   HOH HOH A . 
C 3 HOH 2   453 2   HOH HOH A . 
C 3 HOH 3   454 3   HOH HOH A . 
C 3 HOH 4   455 4   HOH HOH A . 
C 3 HOH 5   456 5   HOH HOH A . 
C 3 HOH 6   457 6   HOH HOH A . 
C 3 HOH 7   458 7   HOH HOH A . 
C 3 HOH 8   459 8   HOH HOH A . 
C 3 HOH 9   460 9   HOH HOH A . 
C 3 HOH 10  461 10  HOH HOH A . 
C 3 HOH 11  462 11  HOH HOH A . 
C 3 HOH 12  463 12  HOH HOH A . 
C 3 HOH 13  464 13  HOH HOH A . 
C 3 HOH 14  465 14  HOH HOH A . 
C 3 HOH 15  466 15  HOH HOH A . 
C 3 HOH 16  467 16  HOH HOH A . 
C 3 HOH 17  468 17  HOH HOH A . 
C 3 HOH 18  469 18  HOH HOH A . 
C 3 HOH 19  470 19  HOH HOH A . 
C 3 HOH 20  471 20  HOH HOH A . 
C 3 HOH 21  472 21  HOH HOH A . 
C 3 HOH 22  473 22  HOH HOH A . 
C 3 HOH 23  474 23  HOH HOH A . 
C 3 HOH 24  475 24  HOH HOH A . 
C 3 HOH 25  476 25  HOH HOH A . 
C 3 HOH 26  477 26  HOH HOH A . 
C 3 HOH 27  478 27  HOH HOH A . 
C 3 HOH 28  479 28  HOH HOH A . 
C 3 HOH 29  480 29  HOH HOH A . 
C 3 HOH 30  481 30  HOH HOH A . 
C 3 HOH 31  482 31  HOH HOH A . 
C 3 HOH 32  483 32  HOH HOH A . 
C 3 HOH 33  484 33  HOH HOH A . 
C 3 HOH 34  485 34  HOH HOH A . 
C 3 HOH 35  486 35  HOH HOH A . 
C 3 HOH 36  487 36  HOH HOH A . 
C 3 HOH 37  488 37  HOH HOH A . 
C 3 HOH 38  489 38  HOH HOH A . 
C 3 HOH 39  490 39  HOH HOH A . 
C 3 HOH 40  491 40  HOH HOH A . 
C 3 HOH 41  492 41  HOH HOH A . 
C 3 HOH 42  493 42  HOH HOH A . 
C 3 HOH 43  494 43  HOH HOH A . 
C 3 HOH 44  495 44  HOH HOH A . 
C 3 HOH 45  496 45  HOH HOH A . 
C 3 HOH 46  497 46  HOH HOH A . 
C 3 HOH 47  498 47  HOH HOH A . 
C 3 HOH 48  499 48  HOH HOH A . 
C 3 HOH 49  500 49  HOH HOH A . 
C 3 HOH 50  501 50  HOH HOH A . 
C 3 HOH 51  502 51  HOH HOH A . 
C 3 HOH 52  503 52  HOH HOH A . 
C 3 HOH 53  504 53  HOH HOH A . 
C 3 HOH 54  505 54  HOH HOH A . 
C 3 HOH 55  506 55  HOH HOH A . 
C 3 HOH 56  507 56  HOH HOH A . 
C 3 HOH 57  508 57  HOH HOH A . 
C 3 HOH 58  509 58  HOH HOH A . 
C 3 HOH 59  510 59  HOH HOH A . 
C 3 HOH 60  511 60  HOH HOH A . 
C 3 HOH 61  512 61  HOH HOH A . 
C 3 HOH 62  513 62  HOH HOH A . 
C 3 HOH 63  514 63  HOH HOH A . 
C 3 HOH 64  515 64  HOH HOH A . 
C 3 HOH 65  516 65  HOH HOH A . 
C 3 HOH 66  517 66  HOH HOH A . 
C 3 HOH 67  518 67  HOH HOH A . 
C 3 HOH 68  519 68  HOH HOH A . 
C 3 HOH 69  520 69  HOH HOH A . 
C 3 HOH 70  521 70  HOH HOH A . 
C 3 HOH 71  522 71  HOH HOH A . 
C 3 HOH 72  523 72  HOH HOH A . 
C 3 HOH 73  524 73  HOH HOH A . 
C 3 HOH 74  525 74  HOH HOH A . 
C 3 HOH 75  526 75  HOH HOH A . 
C 3 HOH 76  527 76  HOH HOH A . 
C 3 HOH 77  528 77  HOH HOH A . 
C 3 HOH 78  529 78  HOH HOH A . 
C 3 HOH 79  530 79  HOH HOH A . 
C 3 HOH 80  531 80  HOH HOH A . 
C 3 HOH 81  532 81  HOH HOH A . 
C 3 HOH 82  533 82  HOH HOH A . 
C 3 HOH 83  534 83  HOH HOH A . 
C 3 HOH 84  535 84  HOH HOH A . 
C 3 HOH 85  536 85  HOH HOH A . 
C 3 HOH 86  537 86  HOH HOH A . 
C 3 HOH 87  538 87  HOH HOH A . 
C 3 HOH 88  539 88  HOH HOH A . 
C 3 HOH 89  540 89  HOH HOH A . 
C 3 HOH 90  541 90  HOH HOH A . 
C 3 HOH 91  542 91  HOH HOH A . 
C 3 HOH 92  543 92  HOH HOH A . 
C 3 HOH 93  544 93  HOH HOH A . 
C 3 HOH 94  545 94  HOH HOH A . 
C 3 HOH 95  546 95  HOH HOH A . 
C 3 HOH 96  547 96  HOH HOH A . 
C 3 HOH 97  548 97  HOH HOH A . 
C 3 HOH 98  549 98  HOH HOH A . 
C 3 HOH 99  550 99  HOH HOH A . 
C 3 HOH 100 551 100 HOH HOH A . 
C 3 HOH 101 552 101 HOH HOH A . 
C 3 HOH 102 553 102 HOH HOH A . 
C 3 HOH 103 554 103 HOH HOH A . 
C 3 HOH 104 555 104 HOH HOH A . 
C 3 HOH 105 556 105 HOH HOH A . 
C 3 HOH 106 557 106 HOH HOH A . 
C 3 HOH 107 558 107 HOH HOH A . 
C 3 HOH 108 559 108 HOH HOH A . 
C 3 HOH 109 560 109 HOH HOH A . 
C 3 HOH 110 561 110 HOH HOH A . 
C 3 HOH 111 562 111 HOH HOH A . 
C 3 HOH 112 563 112 HOH HOH A . 
C 3 HOH 113 564 113 HOH HOH A . 
C 3 HOH 114 565 114 HOH HOH A . 
C 3 HOH 115 566 115 HOH HOH A . 
C 3 HOH 116 567 116 HOH HOH A . 
C 3 HOH 117 568 117 HOH HOH A . 
C 3 HOH 118 569 118 HOH HOH A . 
C 3 HOH 119 570 119 HOH HOH A . 
C 3 HOH 120 571 120 HOH HOH A . 
C 3 HOH 121 572 121 HOH HOH A . 
C 3 HOH 122 573 122 HOH HOH A . 
C 3 HOH 123 574 123 HOH HOH A . 
C 3 HOH 124 575 124 HOH HOH A . 
C 3 HOH 125 576 125 HOH HOH A . 
C 3 HOH 126 577 126 HOH HOH A . 
C 3 HOH 127 578 127 HOH HOH A . 
C 3 HOH 128 579 128 HOH HOH A . 
C 3 HOH 129 580 129 HOH HOH A . 
C 3 HOH 130 581 130 HOH HOH A . 
C 3 HOH 131 582 131 HOH HOH A . 
C 3 HOH 132 583 132 HOH HOH A . 
C 3 HOH 133 584 133 HOH HOH A . 
C 3 HOH 134 585 134 HOH HOH A . 
C 3 HOH 135 586 135 HOH HOH A . 
C 3 HOH 136 587 136 HOH HOH A . 
C 3 HOH 137 588 137 HOH HOH A . 
C 3 HOH 138 589 138 HOH HOH A . 
C 3 HOH 139 590 139 HOH HOH A . 
C 3 HOH 140 591 140 HOH HOH A . 
C 3 HOH 141 592 141 HOH HOH A . 
C 3 HOH 142 593 142 HOH HOH A . 
C 3 HOH 143 594 143 HOH HOH A . 
C 3 HOH 144 595 144 HOH HOH A . 
C 3 HOH 145 596 145 HOH HOH A . 
C 3 HOH 146 597 146 HOH HOH A . 
C 3 HOH 147 598 147 HOH HOH A . 
C 3 HOH 148 599 148 HOH HOH A . 
C 3 HOH 149 600 149 HOH HOH A . 
C 3 HOH 150 601 150 HOH HOH A . 
C 3 HOH 151 602 151 HOH HOH A . 
C 3 HOH 152 603 152 HOH HOH A . 
C 3 HOH 153 604 153 HOH HOH A . 
C 3 HOH 154 605 154 HOH HOH A . 
C 3 HOH 155 606 155 HOH HOH A . 
C 3 HOH 156 607 156 HOH HOH A . 
C 3 HOH 157 608 157 HOH HOH A . 
C 3 HOH 158 609 158 HOH HOH A . 
C 3 HOH 159 610 159 HOH HOH A . 
C 3 HOH 160 611 160 HOH HOH A . 
C 3 HOH 161 612 161 HOH HOH A . 
C 3 HOH 162 613 162 HOH HOH A . 
C 3 HOH 163 614 163 HOH HOH A . 
C 3 HOH 164 615 164 HOH HOH A . 
C 3 HOH 165 616 165 HOH HOH A . 
C 3 HOH 166 617 166 HOH HOH A . 
C 3 HOH 167 618 167 HOH HOH A . 
C 3 HOH 168 619 168 HOH HOH A . 
C 3 HOH 169 620 169 HOH HOH A . 
C 3 HOH 170 621 170 HOH HOH A . 
C 3 HOH 171 622 171 HOH HOH A . 
C 3 HOH 172 623 172 HOH HOH A . 
C 3 HOH 173 624 173 HOH HOH A . 
C 3 HOH 174 625 174 HOH HOH A . 
C 3 HOH 175 626 175 HOH HOH A . 
C 3 HOH 176 627 176 HOH HOH A . 
C 3 HOH 177 628 177 HOH HOH A . 
C 3 HOH 178 629 178 HOH HOH A . 
C 3 HOH 179 630 179 HOH HOH A . 
C 3 HOH 180 631 180 HOH HOH A . 
C 3 HOH 181 632 181 HOH HOH A . 
C 3 HOH 182 633 182 HOH HOH A . 
C 3 HOH 183 634 183 HOH HOH A . 
C 3 HOH 184 635 184 HOH HOH A . 
C 3 HOH 185 636 185 HOH HOH A . 
C 3 HOH 186 637 186 HOH HOH A . 
C 3 HOH 187 638 187 HOH HOH A . 
C 3 HOH 188 639 188 HOH HOH A . 
C 3 HOH 189 640 189 HOH HOH A . 
C 3 HOH 190 641 190 HOH HOH A . 
C 3 HOH 191 642 191 HOH HOH A . 
C 3 HOH 192 643 192 HOH HOH A . 
C 3 HOH 193 644 193 HOH HOH A . 
C 3 HOH 194 645 194 HOH HOH A . 
C 3 HOH 195 646 195 HOH HOH A . 
C 3 HOH 196 647 196 HOH HOH A . 
C 3 HOH 197 648 197 HOH HOH A . 
C 3 HOH 198 649 198 HOH HOH A . 
C 3 HOH 199 650 199 HOH HOH A . 
C 3 HOH 200 651 200 HOH HOH A . 
C 3 HOH 201 652 201 HOH HOH A . 
C 3 HOH 202 653 202 HOH HOH A . 
C 3 HOH 203 654 203 HOH HOH A . 
C 3 HOH 204 655 204 HOH HOH A . 
C 3 HOH 205 656 205 HOH HOH A . 
C 3 HOH 206 657 206 HOH HOH A . 
C 3 HOH 207 658 207 HOH HOH A . 
C 3 HOH 208 659 208 HOH HOH A . 
C 3 HOH 209 660 209 HOH HOH A . 
C 3 HOH 210 661 210 HOH HOH A . 
C 3 HOH 211 662 211 HOH HOH A . 
C 3 HOH 212 663 212 HOH HOH A . 
C 3 HOH 213 664 213 HOH HOH A . 
C 3 HOH 214 665 214 HOH HOH A . 
C 3 HOH 215 666 215 HOH HOH A . 
C 3 HOH 216 667 216 HOH HOH A . 
C 3 HOH 217 668 217 HOH HOH A . 
C 3 HOH 218 669 218 HOH HOH A . 
C 3 HOH 219 670 219 HOH HOH A . 
C 3 HOH 220 671 220 HOH HOH A . 
C 3 HOH 221 672 221 HOH HOH A . 
C 3 HOH 222 673 222 HOH HOH A . 
C 3 HOH 223 674 223 HOH HOH A . 
C 3 HOH 224 675 224 HOH HOH A . 
C 3 HOH 225 676 225 HOH HOH A . 
C 3 HOH 226 677 226 HOH HOH A . 
C 3 HOH 227 678 227 HOH HOH A . 
C 3 HOH 228 679 228 HOH HOH A . 
C 3 HOH 229 680 229 HOH HOH A . 
C 3 HOH 230 681 230 HOH HOH A . 
C 3 HOH 231 682 231 HOH HOH A . 
C 3 HOH 232 683 232 HOH HOH A . 
C 3 HOH 233 684 233 HOH HOH A . 
C 3 HOH 234 685 234 HOH HOH A . 
C 3 HOH 235 686 235 HOH HOH A . 
C 3 HOH 236 687 236 HOH HOH A . 
C 3 HOH 237 688 237 HOH HOH A . 
C 3 HOH 238 689 238 HOH HOH A . 
C 3 HOH 239 690 239 HOH HOH A . 
C 3 HOH 240 691 240 HOH HOH A . 
C 3 HOH 241 692 241 HOH HOH A . 
C 3 HOH 242 693 242 HOH HOH A . 
C 3 HOH 243 694 243 HOH HOH A . 
C 3 HOH 244 695 244 HOH HOH A . 
C 3 HOH 245 696 245 HOH HOH A . 
C 3 HOH 246 697 246 HOH HOH A . 
C 3 HOH 247 698 247 HOH HOH A . 
C 3 HOH 248 699 248 HOH HOH A . 
C 3 HOH 249 700 249 HOH HOH A . 
C 3 HOH 250 701 250 HOH HOH A . 
C 3 HOH 251 702 251 HOH HOH A . 
C 3 HOH 252 703 252 HOH HOH A . 
C 3 HOH 253 704 253 HOH HOH A . 
C 3 HOH 254 705 254 HOH HOH A . 
C 3 HOH 255 706 255 HOH HOH A . 
C 3 HOH 256 707 256 HOH HOH A . 
C 3 HOH 257 708 257 HOH HOH A . 
C 3 HOH 258 709 258 HOH HOH A . 
C 3 HOH 259 710 259 HOH HOH A . 
C 3 HOH 260 711 260 HOH HOH A . 
C 3 HOH 261 712 261 HOH HOH A . 
C 3 HOH 262 713 262 HOH HOH A . 
C 3 HOH 263 714 263 HOH HOH A . 
C 3 HOH 264 715 264 HOH HOH A . 
C 3 HOH 265 716 265 HOH HOH A . 
C 3 HOH 266 717 266 HOH HOH A . 
C 3 HOH 267 718 267 HOH HOH A . 
C 3 HOH 268 719 268 HOH HOH A . 
C 3 HOH 269 720 269 HOH HOH A . 
C 3 HOH 270 721 270 HOH HOH A . 
C 3 HOH 271 722 271 HOH HOH A . 
C 3 HOH 272 723 272 HOH HOH A . 
C 3 HOH 273 724 273 HOH HOH A . 
C 3 HOH 274 725 274 HOH HOH A . 
C 3 HOH 275 726 275 HOH HOH A . 
C 3 HOH 276 727 276 HOH HOH A . 
C 3 HOH 277 728 277 HOH HOH A . 
C 3 HOH 278 729 278 HOH HOH A . 
C 3 HOH 279 730 279 HOH HOH A . 
C 3 HOH 280 731 280 HOH HOH A . 
C 3 HOH 281 732 281 HOH HOH A . 
C 3 HOH 282 733 282 HOH HOH A . 
C 3 HOH 283 734 283 HOH HOH A . 
C 3 HOH 284 735 284 HOH HOH A . 
C 3 HOH 285 736 285 HOH HOH A . 
C 3 HOH 286 737 286 HOH HOH A . 
C 3 HOH 287 738 287 HOH HOH A . 
C 3 HOH 288 739 288 HOH HOH A . 
C 3 HOH 289 740 289 HOH HOH A . 
C 3 HOH 290 741 290 HOH HOH A . 
C 3 HOH 291 742 291 HOH HOH A . 
C 3 HOH 292 743 292 HOH HOH A . 
C 3 HOH 293 744 293 HOH HOH A . 
C 3 HOH 294 745 294 HOH HOH A . 
C 3 HOH 295 746 295 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    ASN 
_pdbx_struct_mod_residue.label_seq_id     336 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     ASN 
_pdbx_struct_mod_residue.auth_seq_id      334 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   ASN 
_pdbx_struct_mod_residue.details          'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-12-23 
2 'Structure model' 1 1 2008-04-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' entity                    
3 4 'Structure model' pdbx_chem_comp_identifier 
4 4 'Structure model' pdbx_entity_nonpoly       
5 4 'Structure model' struct_conn               
6 4 'Structure model' struct_site               
7 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_chem_comp.name'                     
2  4 'Structure model' '_chem_comp.type'                     
3  4 'Structure model' '_entity.pdbx_description'            
4  4 'Structure model' '_pdbx_entity_nonpoly.name'           
5  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6  4 'Structure model' '_struct_conn.pdbx_role'              
7  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
8  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
9  4 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
10 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
11 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
12 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
13 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
14 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
15 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
16 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
17 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
18 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .     ? 1 
SCALEPACK 'data scaling'   .     ? 2 
AMoRE     phasing          .     ? 3 
X-PLOR    refinement       3.843 ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   THR 
_pdbx_validate_close_contact.auth_seq_id_1    244 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ILE 
_pdbx_validate_close_contact.auth_seq_id_2    245 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.35 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 N  A THR 244 ? ? CA A THR 244 ? ? 1.582 1.459 0.123  0.020 N 
2 1 CA A ILE 245 ? ? C  A ILE 245 ? ? 1.346 1.525 -0.179 0.026 N 
3 1 C  A ILE 245 ? ? N  A VAL 246 ? ? 1.091 1.336 -0.245 0.023 Y 
4 1 N  A VAL 246 ? ? CA A VAL 246 ? ? 1.289 1.459 -0.170 0.020 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N A ILE 245 ? ? CA A ILE 245 ? ? CB A ILE 245 ? ? 125.19 110.80 14.39 2.30 N 
2 1 O A ASP 247 ? ? C  A ASP 247 ? ? N  A ILE 248 ? ? 133.70 122.70 11.00 1.60 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 5   ? ? -118.19 69.04   
2  1 ARG A 23  ? ? -152.55 83.70   
3  1 SER A 152 ? ? 56.73   -126.73 
4  1 PHE A 182 ? ? -136.32 -48.68  
5  1 ASP A 205 ? ? -148.03 48.34   
6  1 SER A 243 ? ? -119.01 -148.88 
7  1 ILE A 245 ? ? 15.30   159.00  
8  1 VAL A 246 ? ? -77.03  -85.06  
9  1 ASP A 247 ? ? 121.09  52.77   
10 1 ILE A 248 ? ? -38.81  -31.18  
11 1 GLU A 379 ? ? 81.09   -5.18   
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             ILE 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              248 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -15.11 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 C A ILE 241 ? ? N A LEU 242 ? ? 1.69 
2 1 C A ILE 245 ? ? N A VAL 246 ? ? 1.09 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A THR 244 ? OG1 ? A THR 246 OG1 
2  1 Y 1 A THR 244 ? CG2 ? A THR 246 CG2 
3  1 Y 1 A ASN 404 ? CG  ? A ASN 407 CG  
4  1 Y 1 A ASN 404 ? OD1 ? A ASN 407 OD1 
5  1 Y 1 A ASN 404 ? ND2 ? A ASN 407 ND2 
6  1 Y 1 A ARG 412 ? CG  ? A ARG 414 CG  
7  1 Y 1 A ARG 412 ? CD  ? A ARG 414 CD  
8  1 Y 1 A ARG 412 ? NE  ? A ARG 414 NE  
9  1 Y 1 A ARG 412 ? CZ  ? A ARG 414 CZ  
10 1 Y 1 A ARG 412 ? NH1 ? A ARG 414 NH1 
11 1 Y 1 A ARG 412 ? NH2 ? A ARG 414 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 406 ? A LYS 408 
2 1 Y 1 A VAL 407 ? A VAL 409 
3 1 Y 1 A ILE 408 ? A ILE 410 
4 1 Y 1 A ASN 409 ? A ASN 411 
5 1 Y 1 A LEU 410 ? A LEU 412 
6 1 Y 1 A PHE 411 ? A PHE 413 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 water                                    HOH 
#