data_1BV1
# 
_entry.id   1BV1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BV1         
WWPDB D_1000172104 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BV1 
_pdbx_database_status.recvd_initial_deposition_date   1997-07-08 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gajhede, M.'     1 
'Osmark, P.'      2 
'Poulsen, F.M.'   3 
'Ipsen, H.'       4 
'Larson, J.N.'    5 
'Joostvan, R.J.'  6 
'Schou, C.'       7 
'Lowenstein, H.'  8 
'Spangfort, M.D.' 9 
# 
_citation.id                        primary 
_citation.title                     'X-ray and NMR structure of Bet v 1, the origin of birch pollen allergy.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            3 
_citation.page_first                1040 
_citation.page_last                 1045 
_citation.year                      1996 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8946858 
_citation.pdbx_database_id_DOI      10.1038/nsb1296-1040 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gajhede, M.'             1 
primary 'Osmark, P.'              2 
primary 'Poulsen, F.M.'           3 
primary 'Ipsen, H.'               4 
primary 'Larsen, J.N.'            5 
primary 'Joost van Neerven, R.J.' 6 
primary 'Schou, C.'               7 
primary 'Lowenstein, H.'          8 
primary 'Spangfort, M.D.'         9 
# 
_cell.entry_id           1BV1 
_cell.length_a           32.160 
_cell.length_b           74.240 
_cell.length_c           118.120 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BV1 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'BET V 1' 17427.576 1  ? ? ? ? 
2 water   nat water     18.015    84 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MAJOR POLLEN ALLERGEN BET V 1-A' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGLPFKYVKDRVDEVDHTNFK
YNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGLPFKYVKDRVDEVDHTNFK
YNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   VAL n 
1 3   PHE n 
1 4   ASN n 
1 5   TYR n 
1 6   GLU n 
1 7   THR n 
1 8   GLU n 
1 9   THR n 
1 10  THR n 
1 11  SER n 
1 12  VAL n 
1 13  ILE n 
1 14  PRO n 
1 15  ALA n 
1 16  ALA n 
1 17  ARG n 
1 18  LEU n 
1 19  PHE n 
1 20  LYS n 
1 21  ALA n 
1 22  PHE n 
1 23  ILE n 
1 24  LEU n 
1 25  ASP n 
1 26  GLY n 
1 27  ASP n 
1 28  ASN n 
1 29  LEU n 
1 30  PHE n 
1 31  PRO n 
1 32  LYS n 
1 33  VAL n 
1 34  ALA n 
1 35  PRO n 
1 36  GLN n 
1 37  ALA n 
1 38  ILE n 
1 39  SER n 
1 40  SER n 
1 41  VAL n 
1 42  GLU n 
1 43  ASN n 
1 44  ILE n 
1 45  GLU n 
1 46  GLY n 
1 47  ASN n 
1 48  GLY n 
1 49  GLY n 
1 50  PRO n 
1 51  GLY n 
1 52  THR n 
1 53  ILE n 
1 54  LYS n 
1 55  LYS n 
1 56  ILE n 
1 57  SER n 
1 58  PHE n 
1 59  PRO n 
1 60  GLU n 
1 61  GLY n 
1 62  LEU n 
1 63  PRO n 
1 64  PHE n 
1 65  LYS n 
1 66  TYR n 
1 67  VAL n 
1 68  LYS n 
1 69  ASP n 
1 70  ARG n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  VAL n 
1 75  ASP n 
1 76  HIS n 
1 77  THR n 
1 78  ASN n 
1 79  PHE n 
1 80  LYS n 
1 81  TYR n 
1 82  ASN n 
1 83  TYR n 
1 84  SER n 
1 85  VAL n 
1 86  ILE n 
1 87  GLU n 
1 88  GLY n 
1 89  GLY n 
1 90  PRO n 
1 91  ILE n 
1 92  GLY n 
1 93  ASP n 
1 94  THR n 
1 95  LEU n 
1 96  GLU n 
1 97  LYS n 
1 98  ILE n 
1 99  SER n 
1 100 ASN n 
1 101 GLU n 
1 102 ILE n 
1 103 LYS n 
1 104 ILE n 
1 105 VAL n 
1 106 ALA n 
1 107 THR n 
1 108 PRO n 
1 109 ASP n 
1 110 GLY n 
1 111 GLY n 
1 112 SER n 
1 113 ILE n 
1 114 LEU n 
1 115 LYS n 
1 116 ILE n 
1 117 SER n 
1 118 ASN n 
1 119 LYS n 
1 120 TYR n 
1 121 HIS n 
1 122 THR n 
1 123 LYS n 
1 124 GLY n 
1 125 ASP n 
1 126 HIS n 
1 127 GLU n 
1 128 VAL n 
1 129 LYS n 
1 130 ALA n 
1 131 GLU n 
1 132 GLN n 
1 133 VAL n 
1 134 LYS n 
1 135 ALA n 
1 136 SER n 
1 137 LYS n 
1 138 GLU n 
1 139 MET n 
1 140 GLY n 
1 141 GLU n 
1 142 THR n 
1 143 LEU n 
1 144 LEU n 
1 145 ARG n 
1 146 ALA n 
1 147 VAL n 
1 148 GLU n 
1 149 SER n 
1 150 TYR n 
1 151 LEU n 
1 152 LEU n 
1 153 ALA n 
1 154 HIS n 
1 155 SER n 
1 156 ASP n 
1 157 ALA n 
1 158 TYR n 
1 159 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'European white birch' 
_entity_src_gen.gene_src_genus                     Betula 
_entity_src_gen.pdbx_gene_src_gene                 'BET V 1 1.2801' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Betula pendula' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3505 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 POLLEN 
_entity_src_gen.pdbx_gene_src_cellular_location    CYTOPLASM 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 'MALE-BET V 1' 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DH5-ALPHA 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    CYTOPLASM 
_entity_src_gen.pdbx_host_org_vector_type          'PROTEIN FUSION' 
_entity_src_gen.pdbx_host_org_vector               P-MALC 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PMALC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'COMMERCIALLY AVAILABLE POLLEN FROM ALLERGEN, SWEDEN' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BEV1A_BETVE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P15494 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGLPFKYVKDRVDEVDHTNF
KYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN

;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1BV1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 159 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P15494 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  160 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       159 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1BV1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.08 
_exptl_crystal.density_percent_sol   41. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.3 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'PROTEIN WAS CRYSTALLIZED BY MIXING 5 MG/ML PROTEIN SOLUTION WITH EQUAL AMOUNT OF 2.0 M AMS, 100 MM SODIUM CITRATE, PH 6.3' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           287 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1996-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BV1 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30. 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   9554 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.8 
_reflns.pdbx_Rmerge_I_obs            0.0680000 
_reflns.pdbx_Rsym_value              0.0680000 
_reflns.pdbx_netI_over_sigmaI        14.6 
_reflns.B_iso_Wilson_estimate        14.6 
_reflns.pdbx_redundancy              4.8 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   84.2 
_reflns_shell.Rmerge_I_obs           0.3600000 
_reflns_shell.pdbx_Rsym_value        0.3600000 
_reflns_shell.meanI_over_sigI_obs    2.8 
_reflns_shell.pdbx_redundancy        3.2 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1BV1 
_refine.ls_number_reflns_obs                     9509 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               1000000. 
_refine.pdbx_data_cutoff_low_absF                0.00001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    95.9 
_refine.ls_R_factor_obs                          0.1980000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1980000 
_refine.ls_R_factor_R_free                       0.2670000 
_refine.ls_R_factor_R_free_error                 0.022 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.4 
_refine.ls_number_reflns_R_free                  986 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               25.2 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT CORRECTION' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1BV1 
_refine_analyze.Luzzati_coordinate_error_obs    0.31 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           40.0 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1230 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             84 
_refine_hist.number_atoms_total               1314 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        40.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.006 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.2   ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.7  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.12  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             2.17  1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            3.17  2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             4.5   2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            6.97  2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.09 
_refine_ls_shell.number_reflns_R_work             955 
_refine_ls_shell.R_factor_R_work                  0.2630000 
_refine_ls_shell.percent_reflns_obs               78. 
_refine_ls_shell.R_factor_R_free                  0.3110000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            9.5 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.SOL    TOPH19.SOL   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1BV1 
_struct.title                     'BIRCH POLLEN ALLERGEN BET V 1' 
_struct.pdbx_descriptor           'BET V 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BV1 
_struct_keywords.pdbx_keywords   ALLERGEN 
_struct_keywords.text            'ALLERGEN, PATHOGENESIS-RELATED PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 15  ? PHE A 22  ? ALA A 15  PHE A 22  1 ? 8  
HELX_P HELX_P2 2 GLY A 26  ? VAL A 33  ? GLY A 26  VAL A 33  1 ? 8  
HELX_P HELX_P3 3 ALA A 130 ? ALA A 153 ? ALA A 130 ALA A 153 1 ? 24 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 2   ? SER A 11  ? VAL A 2   SER A 11  
A 2 SER A 112 ? THR A 122 ? SER A 112 THR A 122 
A 3 LEU A 95  ? ALA A 106 ? LEU A 95  ALA A 106 
A 4 LYS A 80  ? VAL A 85  ? LYS A 80  VAL A 85  
A 5 GLU A 73  ? ASP A 75  ? GLU A 73  ASP A 75  
B 1 SER A 40  ? GLU A 45  ? SER A 40  GLU A 45  
B 2 ILE A 53  ? SER A 57  ? ILE A 53  SER A 57  
B 3 TYR A 66  ? VAL A 71  ? TYR A 66  VAL A 71  
B 4 TYR A 83  ? GLY A 88  ? TYR A 83  GLY A 88  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 3   ? O PHE A 3   N TYR A 120 ? N TYR A 120 
A 2 3 O ILE A 113 ? O ILE A 113 N VAL A 105 ? N VAL A 105 
A 3 4 O ILE A 98  ? O ILE A 98  N VAL A 85  ? N VAL A 85  
A 4 5 O LYS A 80  ? O LYS A 80  N ASP A 75  ? N ASP A 75  
B 1 2 O SER A 40  ? O SER A 40  N SER A 57  ? N SER A 57  
B 2 3 O LYS A 54  ? O LYS A 54  N ASP A 69  ? N ASP A 69  
B 3 4 O LYS A 68  ? O LYS A 68  N GLU A 87  ? N GLU A 87  
# 
_database_PDB_matrix.entry_id          1BV1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BV1 
_atom_sites.fract_transf_matrix[1][1]   0.031095 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013470 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008466 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? -12.729 17.234 25.570 1.00 13.95 ? 1   GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? -13.314 18.484 26.131 1.00 11.42 ? 1   GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? -12.829 19.694 25.365 1.00 15.30 ? 1   GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? -12.208 19.557 24.312 1.00 10.50 ? 1   GLY A O   1 
ATOM   5    N N   . VAL A 1 2   ? -13.151 20.881 25.869 1.00 17.48 ? 2   VAL A N   1 
ATOM   6    C CA  . VAL A 1 2   ? -12.725 22.125 25.239 1.00 19.30 ? 2   VAL A CA  1 
ATOM   7    C C   . VAL A 1 2   ? -11.966 22.976 26.255 1.00 19.70 ? 2   VAL A C   1 
ATOM   8    O O   . VAL A 1 2   ? -12.447 23.221 27.364 1.00 20.89 ? 2   VAL A O   1 
ATOM   9    C CB  . VAL A 1 2   ? -13.912 22.945 24.679 1.00 21.49 ? 2   VAL A CB  1 
ATOM   10   C CG1 . VAL A 1 2   ? -13.397 24.263 24.136 1.00 21.36 ? 2   VAL A CG1 1 
ATOM   11   C CG2 . VAL A 1 2   ? -14.625 22.182 23.571 1.00 20.95 ? 2   VAL A CG2 1 
ATOM   12   N N   . PHE A 1 3   ? -10.787 23.438 25.861 1.00 16.24 ? 3   PHE A N   1 
ATOM   13   C CA  . PHE A 1 3   ? -9.959  24.247 26.737 1.00 17.82 ? 3   PHE A CA  1 
ATOM   14   C C   . PHE A 1 3   ? -9.606  25.584 26.108 1.00 19.25 ? 3   PHE A C   1 
ATOM   15   O O   . PHE A 1 3   ? -9.066  25.644 25.009 1.00 17.38 ? 3   PHE A O   1 
ATOM   16   C CB  . PHE A 1 3   ? -8.703  23.467 27.108 1.00 15.82 ? 3   PHE A CB  1 
ATOM   17   C CG  . PHE A 1 3   ? -8.996  22.176 27.804 1.00 24.18 ? 3   PHE A CG  1 
ATOM   18   C CD1 . PHE A 1 3   ? -9.281  22.158 29.171 1.00 25.16 ? 3   PHE A CD1 1 
ATOM   19   C CD2 . PHE A 1 3   ? -9.021  20.979 27.095 1.00 21.37 ? 3   PHE A CD2 1 
ATOM   20   C CE1 . PHE A 1 3   ? -9.587  20.962 29.821 1.00 25.54 ? 3   PHE A CE1 1 
ATOM   21   C CE2 . PHE A 1 3   ? -9.326  19.779 27.731 1.00 24.33 ? 3   PHE A CE2 1 
ATOM   22   C CZ  . PHE A 1 3   ? -9.610  19.768 29.098 1.00 30.04 ? 3   PHE A CZ  1 
ATOM   23   N N   . ASN A 1 4   ? -9.923  26.656 26.823 1.00 20.20 ? 4   ASN A N   1 
ATOM   24   C CA  . ASN A 1 4   ? -9.663  28.010 26.354 1.00 23.11 ? 4   ASN A CA  1 
ATOM   25   C C   . ASN A 1 4   ? -8.459  28.635 27.066 1.00 19.15 ? 4   ASN A C   1 
ATOM   26   O O   . ASN A 1 4   ? -8.339  28.568 28.290 1.00 21.43 ? 4   ASN A O   1 
ATOM   27   C CB  . ASN A 1 4   ? -10.919 28.871 26.561 1.00 28.73 ? 4   ASN A CB  1 
ATOM   28   C CG  . ASN A 1 4   ? -10.809 30.244 25.912 1.00 39.37 ? 4   ASN A CG  1 
ATOM   29   O OD1 . ASN A 1 4   ? -9.864  30.523 25.175 1.00 46.71 ? 4   ASN A OD1 1 
ATOM   30   N ND2 . ASN A 1 4   ? -11.784 31.106 26.179 1.00 45.70 ? 4   ASN A ND2 1 
ATOM   31   N N   . TYR A 1 5   ? -7.551  29.211 26.285 1.00 18.01 ? 5   TYR A N   1 
ATOM   32   C CA  . TYR A 1 5   ? -6.359  29.864 26.822 1.00 19.76 ? 5   TYR A CA  1 
ATOM   33   C C   . TYR A 1 5   ? -6.293  31.237 26.190 1.00 20.75 ? 5   TYR A C   1 
ATOM   34   O O   . TYR A 1 5   ? -6.442  31.373 24.982 1.00 19.25 ? 5   TYR A O   1 
ATOM   35   C CB  . TYR A 1 5   ? -5.097  29.053 26.505 1.00 19.59 ? 5   TYR A CB  1 
ATOM   36   C CG  . TYR A 1 5   ? -5.130  27.677 27.127 1.00 22.64 ? 5   TYR A CG  1 
ATOM   37   C CD1 . TYR A 1 5   ? -4.670  27.467 28.427 1.00 22.82 ? 5   TYR A CD1 1 
ATOM   38   C CD2 . TYR A 1 5   ? -5.718  26.605 26.457 1.00 22.98 ? 5   TYR A CD2 1 
ATOM   39   C CE1 . TYR A 1 5   ? -4.806  26.228 29.044 1.00 21.97 ? 5   TYR A CE1 1 
ATOM   40   C CE2 . TYR A 1 5   ? -5.858  25.365 27.067 1.00 19.42 ? 5   TYR A CE2 1 
ATOM   41   C CZ  . TYR A 1 5   ? -5.406  25.187 28.354 1.00 20.18 ? 5   TYR A CZ  1 
ATOM   42   O OH  . TYR A 1 5   ? -5.575  23.970 28.959 1.00 22.81 ? 5   TYR A OH  1 
ATOM   43   N N   . GLU A 1 6   ? -6.108  32.262 27.012 1.00 24.89 ? 6   GLU A N   1 
ATOM   44   C CA  . GLU A 1 6   ? -6.062  33.631 26.515 1.00 27.75 ? 6   GLU A CA  1 
ATOM   45   C C   . GLU A 1 6   ? -4.761  34.358 26.810 1.00 26.65 ? 6   GLU A C   1 
ATOM   46   O O   . GLU A 1 6   ? -4.027  34.011 27.738 1.00 28.52 ? 6   GLU A O   1 
ATOM   47   C CB  . GLU A 1 6   ? -7.236  34.423 27.081 1.00 30.08 ? 6   GLU A CB  1 
ATOM   48   C CG  . GLU A 1 6   ? -8.581  33.845 26.699 1.00 41.45 ? 6   GLU A CG  1 
ATOM   49   C CD  . GLU A 1 6   ? -9.693  34.290 27.619 1.00 48.13 ? 6   GLU A CD  1 
ATOM   50   O OE1 . GLU A 1 6   ? -9.470  34.319 28.850 1.00 54.98 ? 6   GLU A OE1 1 
ATOM   51   O OE2 . GLU A 1 6   ? -10.794 34.600 27.114 1.00 52.87 ? 6   GLU A OE2 1 
ATOM   52   N N   . THR A 1 7   ? -4.481  35.366 25.993 1.00 23.84 ? 7   THR A N   1 
ATOM   53   C CA  . THR A 1 7   ? -3.284  36.174 26.138 1.00 26.49 ? 7   THR A CA  1 
ATOM   54   C C   . THR A 1 7   ? -3.565  37.538 25.545 1.00 24.24 ? 7   THR A C   1 
ATOM   55   O O   . THR A 1 7   ? -4.510  37.715 24.779 1.00 26.11 ? 7   THR A O   1 
ATOM   56   C CB  . THR A 1 7   ? -2.102  35.597 25.346 1.00 27.49 ? 7   THR A CB  1 
ATOM   57   O OG1 . THR A 1 7   ? -2.150  34.173 25.392 1.00 37.42 ? 7   THR A OG1 1 
ATOM   58   C CG2 . THR A 1 7   ? -0.774  36.072 25.942 1.00 29.20 ? 7   THR A CG2 1 
ATOM   59   N N   . GLU A 1 8   ? -2.743  38.499 25.932 1.00 24.52 ? 8   GLU A N   1 
ATOM   60   C CA  . GLU A 1 8   ? -2.828  39.853 25.428 1.00 26.01 ? 8   GLU A CA  1 
ATOM   61   C C   . GLU A 1 8   ? -1.396  40.302 25.247 1.00 27.07 ? 8   GLU A C   1 
ATOM   62   O O   . GLU A 1 8   ? -0.536  40.020 26.083 1.00 26.19 ? 8   GLU A O   1 
ATOM   63   C CB  . GLU A 1 8   ? -3.540  40.775 26.408 1.00 30.30 ? 8   GLU A CB  1 
ATOM   64   C CG  . GLU A 1 8   ? -5.050  40.714 26.324 1.00 38.15 ? 8   GLU A CG  1 
ATOM   65   C CD  . GLU A 1 8   ? -5.730  41.675 27.284 1.00 44.22 ? 8   GLU A CD  1 
ATOM   66   O OE1 . GLU A 1 8   ? -5.087  42.662 27.711 1.00 46.16 ? 8   GLU A OE1 1 
ATOM   67   O OE2 . GLU A 1 8   ? -6.913  41.440 27.610 1.00 44.32 ? 8   GLU A OE2 1 
ATOM   68   N N   . THR A 1 9   ? -1.128  40.941 24.121 1.00 22.56 ? 9   THR A N   1 
ATOM   69   C CA  . THR A 1 9   ? 0.206   41.420 23.831 1.00 24.01 ? 9   THR A CA  1 
ATOM   70   C C   . THR A 1 9   ? 0.099   42.863 23.339 1.00 21.31 ? 9   THR A C   1 
ATOM   71   O O   . THR A 1 9   ? -0.907  43.257 22.749 1.00 21.70 ? 9   THR A O   1 
ATOM   72   C CB  . THR A 1 9   ? 0.911   40.484 22.815 1.00 26.40 ? 9   THR A CB  1 
ATOM   73   O OG1 . THR A 1 9   ? 2.190   41.021 22.455 1.00 32.99 ? 9   THR A OG1 1 
ATOM   74   C CG2 . THR A 1 9   ? 0.059   40.278 21.582 1.00 27.76 ? 9   THR A CG2 1 
ATOM   75   N N   . THR A 1 10  ? 1.120   43.657 23.628 1.00 17.78 ? 10  THR A N   1 
ATOM   76   C CA  . THR A 1 10  ? 1.125   45.062 23.251 1.00 16.90 ? 10  THR A CA  1 
ATOM   77   C C   . THR A 1 10  ? 1.869   45.360 21.959 1.00 14.32 ? 10  THR A C   1 
ATOM   78   O O   . THR A 1 10  ? 2.825   44.675 21.610 1.00 19.23 ? 10  THR A O   1 
ATOM   79   C CB  . THR A 1 10  ? 1.720   45.901 24.396 1.00 17.39 ? 10  THR A CB  1 
ATOM   80   O OG1 . THR A 1 10  ? 0.950   45.677 25.583 1.00 23.98 ? 10  THR A OG1 1 
ATOM   81   C CG2 . THR A 1 10  ? 1.704   47.383 24.064 1.00 18.16 ? 10  THR A CG2 1 
ATOM   82   N N   . SER A 1 11  ? 1.423   46.401 21.260 1.00 17.13 ? 11  SER A N   1 
ATOM   83   C CA  . SER A 1 11  ? 2.044   46.836 20.010 1.00 15.79 ? 11  SER A CA  1 
ATOM   84   C C   . SER A 1 11  ? 2.064   48.366 19.935 1.00 14.77 ? 11  SER A C   1 
ATOM   85   O O   . SER A 1 11  ? 1.103   49.014 20.354 1.00 16.03 ? 11  SER A O   1 
ATOM   86   C CB  . SER A 1 11  ? 1.265   46.281 18.818 1.00 15.62 ? 11  SER A CB  1 
ATOM   87   O OG  . SER A 1 11  ? 1.840   46.719 17.598 1.00 18.25 ? 11  SER A OG  1 
ATOM   88   N N   . VAL A 1 12  ? 3.150   48.938 19.408 1.00 16.07 ? 12  VAL A N   1 
ATOM   89   C CA  . VAL A 1 12  ? 3.277   50.399 19.264 1.00 18.30 ? 12  VAL A CA  1 
ATOM   90   C C   . VAL A 1 12  ? 2.440   50.890 18.083 1.00 17.61 ? 12  VAL A C   1 
ATOM   91   O O   . VAL A 1 12  ? 2.095   52.066 18.003 1.00 20.56 ? 12  VAL A O   1 
ATOM   92   C CB  . VAL A 1 12  ? 4.747   50.857 18.966 1.00 21.26 ? 12  VAL A CB  1 
ATOM   93   C CG1 . VAL A 1 12  ? 5.703   50.204 19.864 1.00 25.80 ? 12  VAL A CG1 1 
ATOM   94   C CG2 . VAL A 1 12  ? 5.148   50.535 17.540 1.00 27.64 ? 12  VAL A CG2 1 
ATOM   95   N N   . ILE A 1 13  ? 2.172   49.987 17.143 1.00 19.77 ? 13  ILE A N   1 
ATOM   96   C CA  . ILE A 1 13  ? 1.416   50.300 15.935 1.00 15.41 ? 13  ILE A CA  1 
ATOM   97   C C   . ILE A 1 13  ? -0.079  50.489 16.193 1.00 17.62 ? 13  ILE A C   1 
ATOM   98   O O   . ILE A 1 13  ? -0.679  49.743 16.967 1.00 17.21 ? 13  ILE A O   1 
ATOM   99   C CB  . ILE A 1 13  ? 1.569   49.172 14.886 1.00 12.19 ? 13  ILE A CB  1 
ATOM   100  C CG1 . ILE A 1 13  ? 3.050   48.891 14.602 1.00 11.39 ? 13  ILE A CG1 1 
ATOM   101  C CG2 . ILE A 1 13  ? 0.822   49.529 13.608 1.00 6.95  ? 13  ILE A CG2 1 
ATOM   102  C CD1 . ILE A 1 13  ? 3.784   50.018 13.911 1.00 15.08 ? 13  ILE A CD1 1 
ATOM   103  N N   . PRO A 1 14  ? -0.676  51.545 15.606 1.00 15.19 ? 14  PRO A N   1 
ATOM   104  C CA  . PRO A 1 14  ? -2.108  51.812 15.767 1.00 13.88 ? 14  PRO A CA  1 
ATOM   105  C C   . PRO A 1 14  ? -2.922  50.675 15.135 1.00 16.07 ? 14  PRO A C   1 
ATOM   106  O O   . PRO A 1 14  ? -2.497  50.072 14.138 1.00 12.39 ? 14  PRO A O   1 
ATOM   107  C CB  . PRO A 1 14  ? -2.305  53.145 15.032 1.00 16.22 ? 14  PRO A CB  1 
ATOM   108  C CG  . PRO A 1 14  ? -1.057  53.321 14.196 1.00 14.87 ? 14  PRO A CG  1 
ATOM   109  C CD  . PRO A 1 14  ? 0.013   52.708 15.028 1.00 14.43 ? 14  PRO A CD  1 
ATOM   110  N N   . ALA A 1 15  ? -4.096  50.417 15.710 1.00 16.22 ? 15  ALA A N   1 
ATOM   111  C CA  . ALA A 1 15  ? -5.001  49.337 15.296 1.00 15.48 ? 15  ALA A CA  1 
ATOM   112  C C   . ALA A 1 15  ? -5.289  49.132 13.820 1.00 14.50 ? 15  ALA A C   1 
ATOM   113  O O   . ALA A 1 15  ? -5.193  48.010 13.331 1.00 18.06 ? 15  ALA A O   1 
ATOM   114  C CB  . ALA A 1 15  ? -6.309  49.426 16.070 1.00 14.95 ? 15  ALA A CB  1 
ATOM   115  N N   . ALA A 1 16  ? -5.666  50.193 13.116 1.00 15.56 ? 16  ALA A N   1 
ATOM   116  C CA  . ALA A 1 16  ? -5.991  50.088 11.691 1.00 15.59 ? 16  ALA A CA  1 
ATOM   117  C C   . ALA A 1 16  ? -4.844  49.582 10.823 1.00 14.73 ? 16  ALA A C   1 
ATOM   118  O O   . ALA A 1 16  ? -5.024  48.663 10.019 1.00 14.40 ? 16  ALA A O   1 
ATOM   119  C CB  . ALA A 1 16  ? -6.494  51.426 11.163 1.00 13.63 ? 16  ALA A CB  1 
ATOM   120  N N   . ARG A 1 17  ? -3.668  50.181 11.003 1.00 14.96 ? 17  ARG A N   1 
ATOM   121  C CA  . ARG A 1 17  ? -2.478  49.819 10.239 1.00 15.50 ? 17  ARG A CA  1 
ATOM   122  C C   . ARG A 1 17  ? -2.001  48.407 10.575 1.00 14.72 ? 17  ARG A C   1 
ATOM   123  O O   . ARG A 1 17  ? -1.559  47.664 9.700  1.00 13.45 ? 17  ARG A O   1 
ATOM   124  C CB  . ARG A 1 17  ? -1.362  50.829 10.514 1.00 12.89 ? 17  ARG A CB  1 
ATOM   125  C CG  . ARG A 1 17  ? -0.127  50.627 9.666  1.00 14.79 ? 17  ARG A CG  1 
ATOM   126  C CD  . ARG A 1 17  ? 0.885   51.740 9.896  1.00 15.25 ? 17  ARG A CD  1 
ATOM   127  N NE  . ARG A 1 17  ? 2.023   51.617 8.989  1.00 16.95 ? 17  ARG A NE  1 
ATOM   128  C CZ  . ARG A 1 17  ? 3.270   51.966 9.289  1.00 12.63 ? 17  ARG A CZ  1 
ATOM   129  N NH1 . ARG A 1 17  ? 3.559   52.472 10.479 1.00 9.28  ? 17  ARG A NH1 1 
ATOM   130  N NH2 . ARG A 1 17  ? 4.237   51.766 8.408  1.00 13.44 ? 17  ARG A NH2 1 
ATOM   131  N N   . LEU A 1 18  ? -2.083  48.049 11.852 1.00 18.71 ? 18  LEU A N   1 
ATOM   132  C CA  . LEU A 1 18  ? -1.663  46.730 12.301 1.00 16.70 ? 18  LEU A CA  1 
ATOM   133  C C   . LEU A 1 18  ? -2.578  45.670 11.717 1.00 15.13 ? 18  LEU A C   1 
ATOM   134  O O   . LEU A 1 18  ? -2.107  44.656 11.220 1.00 15.02 ? 18  LEU A O   1 
ATOM   135  C CB  . LEU A 1 18  ? -1.677  46.636 13.824 1.00 13.25 ? 18  LEU A CB  1 
ATOM   136  C CG  . LEU A 1 18  ? -0.988  45.394 14.392 1.00 10.23 ? 18  LEU A CG  1 
ATOM   137  C CD1 . LEU A 1 18  ? 0.429   45.292 13.843 1.00 7.80  ? 18  LEU A CD1 1 
ATOM   138  C CD2 . LEU A 1 18  ? -0.971  45.470 15.910 1.00 13.54 ? 18  LEU A CD2 1 
ATOM   139  N N   . PHE A 1 19  ? -3.881  45.931 11.741 1.00 13.36 ? 19  PHE A N   1 
ATOM   140  C CA  . PHE A 1 19  ? -4.856  44.988 11.213 1.00 13.75 ? 19  PHE A CA  1 
ATOM   141  C C   . PHE A 1 19  ? -4.602  44.680 9.738  1.00 15.87 ? 19  PHE A C   1 
ATOM   142  O O   . PHE A 1 19  ? -4.648  43.523 9.319  1.00 14.23 ? 19  PHE A O   1 
ATOM   143  C CB  . PHE A 1 19  ? -6.288  45.515 11.396 1.00 13.31 ? 19  PHE A CB  1 
ATOM   144  C CG  . PHE A 1 19  ? -7.351  44.525 10.995 1.00 13.34 ? 19  PHE A CG  1 
ATOM   145  C CD1 . PHE A 1 19  ? -7.689  43.468 11.841 1.00 17.18 ? 19  PHE A CD1 1 
ATOM   146  C CD2 . PHE A 1 19  ? -7.992  44.627 9.762  1.00 15.09 ? 19  PHE A CD2 1 
ATOM   147  C CE1 . PHE A 1 19  ? -8.649  42.524 11.460 1.00 15.79 ? 19  PHE A CE1 1 
ATOM   148  C CE2 . PHE A 1 19  ? -8.953  43.689 9.372  1.00 14.20 ? 19  PHE A CE2 1 
ATOM   149  C CZ  . PHE A 1 19  ? -9.281  42.635 10.223 1.00 14.23 ? 19  PHE A CZ  1 
ATOM   150  N N   . LYS A 1 20  ? -4.314  45.720 8.963  1.00 16.69 ? 20  LYS A N   1 
ATOM   151  C CA  . LYS A 1 20  ? -4.057  45.576 7.535  1.00 15.29 ? 20  LYS A CA  1 
ATOM   152  C C   . LYS A 1 20  ? -2.798  44.776 7.221  1.00 15.11 ? 20  LYS A C   1 
ATOM   153  O O   . LYS A 1 20  ? -2.824  43.886 6.376  1.00 17.36 ? 20  LYS A O   1 
ATOM   154  C CB  . LYS A 1 20  ? -3.984  46.956 6.879  1.00 18.50 ? 20  LYS A CB  1 
ATOM   155  C CG  . LYS A 1 20  ? -5.243  47.776 7.097  1.00 23.00 ? 20  LYS A CG  1 
ATOM   156  C CD  . LYS A 1 20  ? -5.084  49.199 6.619  1.00 30.87 ? 20  LYS A CD  1 
ATOM   157  C CE  . LYS A 1 20  ? -4.879  49.255 5.126  1.00 34.42 ? 20  LYS A CE  1 
ATOM   158  N NZ  . LYS A 1 20  ? -4.925  50.656 4.627  1.00 41.10 ? 20  LYS A NZ  1 
ATOM   159  N N   . ALA A 1 21  ? -1.714  45.053 7.937  1.00 13.36 ? 21  ALA A N   1 
ATOM   160  C CA  . ALA A 1 21  ? -0.447  44.365 7.701  1.00 14.52 ? 21  ALA A CA  1 
ATOM   161  C C   . ALA A 1 21  ? -0.322  42.979 8.339  1.00 14.88 ? 21  ALA A C   1 
ATOM   162  O O   . ALA A 1 21  ? 0.083   42.020 7.680  1.00 17.18 ? 21  ALA A O   1 
ATOM   163  C CB  . ALA A 1 21  ? 0.718   45.251 8.139  1.00 13.60 ? 21  ALA A CB  1 
ATOM   164  N N   . PHE A 1 22  ? -0.647  42.890 9.624  1.00 13.47 ? 22  PHE A N   1 
ATOM   165  C CA  . PHE A 1 22  ? -0.552  41.645 10.378 1.00 15.15 ? 22  PHE A CA  1 
ATOM   166  C C   . PHE A 1 22  ? -1.635  40.622 10.035 1.00 16.27 ? 22  PHE A C   1 
ATOM   167  O O   . PHE A 1 22  ? -1.334  39.456 9.812  1.00 18.85 ? 22  PHE A O   1 
ATOM   168  C CB  . PHE A 1 22  ? -0.578  41.962 11.880 1.00 18.95 ? 22  PHE A CB  1 
ATOM   169  C CG  . PHE A 1 22  ? -0.258  40.787 12.771 1.00 22.99 ? 22  PHE A CG  1 
ATOM   170  C CD1 . PHE A 1 22  ? 0.995   40.182 12.729 1.00 19.46 ? 22  PHE A CD1 1 
ATOM   171  C CD2 . PHE A 1 22  ? -1.196  40.319 13.686 1.00 21.31 ? 22  PHE A CD2 1 
ATOM   172  C CE1 . PHE A 1 22  ? 1.308   39.132 13.591 1.00 21.80 ? 22  PHE A CE1 1 
ATOM   173  C CE2 . PHE A 1 22  ? -0.889  39.269 14.553 1.00 22.25 ? 22  PHE A CE2 1 
ATOM   174  C CZ  . PHE A 1 22  ? 0.367   38.677 14.502 1.00 19.83 ? 22  PHE A CZ  1 
ATOM   175  N N   . ILE A 1 23  ? -2.889  41.066 10.004 1.00 16.10 ? 23  ILE A N   1 
ATOM   176  C CA  . ILE A 1 23  ? -4.022  40.191 9.707  1.00 17.22 ? 23  ILE A CA  1 
ATOM   177  C C   . ILE A 1 23  ? -4.319  40.036 8.216  1.00 19.13 ? 23  ILE A C   1 
ATOM   178  O O   . ILE A 1 23  ? -4.168  38.951 7.664  1.00 22.31 ? 23  ILE A O   1 
ATOM   179  C CB  . ILE A 1 23  ? -5.311  40.677 10.431 1.00 17.65 ? 23  ILE A CB  1 
ATOM   180  C CG1 . ILE A 1 23  ? -5.113  40.634 11.951 1.00 19.28 ? 23  ILE A CG1 1 
ATOM   181  C CG2 . ILE A 1 23  ? -6.522  39.851 10.005 1.00 18.70 ? 23  ILE A CG2 1 
ATOM   182  C CD1 . ILE A 1 23  ? -4.766  39.272 12.490 1.00 18.99 ? 23  ILE A CD1 1 
ATOM   183  N N   . LEU A 1 24  ? -4.735  41.121 7.567  1.00 18.45 ? 24  LEU A N   1 
ATOM   184  C CA  . LEU A 1 24  ? -5.075  41.070 6.148  1.00 21.08 ? 24  LEU A CA  1 
ATOM   185  C C   . LEU A 1 24  ? -3.915  40.711 5.227  1.00 24.05 ? 24  LEU A C   1 
ATOM   186  O O   . LEU A 1 24  ? -4.136  40.167 4.145  1.00 30.58 ? 24  LEU A O   1 
ATOM   187  C CB  . LEU A 1 24  ? -5.714  42.385 5.679  1.00 20.41 ? 24  LEU A CB  1 
ATOM   188  C CG  . LEU A 1 24  ? -7.075  42.822 6.238  1.00 22.57 ? 24  LEU A CG  1 
ATOM   189  C CD1 . LEU A 1 24  ? -7.489  44.139 5.587  1.00 23.31 ? 24  LEU A CD1 1 
ATOM   190  C CD2 . LEU A 1 24  ? -8.132  41.755 5.989  1.00 23.11 ? 24  LEU A CD2 1 
ATOM   191  N N   . ASP A 1 25  ? -2.685  41.005 5.639  1.00 21.21 ? 25  ASP A N   1 
ATOM   192  C CA  . ASP A 1 25  ? -1.531  40.695 4.801  1.00 19.37 ? 25  ASP A CA  1 
ATOM   193  C C   . ASP A 1 25  ? -0.493  39.795 5.455  1.00 19.77 ? 25  ASP A C   1 
ATOM   194  O O   . ASP A 1 25  ? 0.604   39.615 4.913  1.00 19.06 ? 25  ASP A O   1 
ATOM   195  C CB  . ASP A 1 25  ? -0.866  41.982 4.287  1.00 18.35 ? 25  ASP A CB  1 
ATOM   196  C CG  . ASP A 1 25  ? -1.110  42.217 2.799  1.00 21.32 ? 25  ASP A CG  1 
ATOM   197  O OD1 . ASP A 1 25  ? -1.745  41.364 2.146  1.00 24.89 ? 25  ASP A OD1 1 
ATOM   198  O OD2 . ASP A 1 25  ? -0.660  43.257 2.277  1.00 17.81 ? 25  ASP A OD2 1 
ATOM   199  N N   . GLY A 1 26  ? -0.850  39.209 6.597  1.00 18.06 ? 26  GLY A N   1 
ATOM   200  C CA  . GLY A 1 26  ? 0.069   38.333 7.302  1.00 20.69 ? 26  GLY A CA  1 
ATOM   201  C C   . GLY A 1 26  ? 0.663   37.221 6.450  1.00 25.54 ? 26  GLY A C   1 
ATOM   202  O O   . GLY A 1 26  ? 1.868   36.982 6.487  1.00 24.35 ? 26  GLY A O   1 
ATOM   203  N N   . ASP A 1 27  ? -0.174  36.570 5.649  1.00 28.78 ? 27  ASP A N   1 
ATOM   204  C CA  . ASP A 1 27  ? 0.265   35.471 4.789  1.00 33.26 ? 27  ASP A CA  1 
ATOM   205  C C   . ASP A 1 27  ? 1.378   35.877 3.825  1.00 33.60 ? 27  ASP A C   1 
ATOM   206  O O   . ASP A 1 27  ? 2.324   35.127 3.591  1.00 35.13 ? 27  ASP A O   1 
ATOM   207  C CB  . ASP A 1 27  ? -0.921  34.928 3.990  1.00 39.67 ? 27  ASP A CB  1 
ATOM   208  C CG  . ASP A 1 27  ? -2.122  34.611 4.863  1.00 44.86 ? 27  ASP A CG  1 
ATOM   209  O OD1 . ASP A 1 27  ? -1.946  34.172 6.023  1.00 46.76 ? 27  ASP A OD1 1 
ATOM   210  O OD2 . ASP A 1 27  ? -3.255  34.806 4.379  1.00 54.52 ? 27  ASP A OD2 1 
ATOM   211  N N   . ASN A 1 28  ? 1.239   37.061 3.250  1.00 32.15 ? 28  ASN A N   1 
ATOM   212  C CA  . ASN A 1 28  ? 2.216   37.589 2.311  1.00 28.64 ? 28  ASN A CA  1 
ATOM   213  C C   . ASN A 1 28  ? 3.487   38.001 3.069  1.00 25.19 ? 28  ASN A C   1 
ATOM   214  O O   . ASN A 1 28  ? 4.597   37.660 2.668  1.00 22.98 ? 28  ASN A O   1 
ATOM   215  C CB  . ASN A 1 28  ? 1.576   38.780 1.580  1.00 32.70 ? 28  ASN A CB  1 
ATOM   216  C CG  . ASN A 1 28  ? 2.494   39.427 0.551  1.00 41.01 ? 28  ASN A CG  1 
ATOM   217  O OD1 . ASN A 1 28  ? 3.138   38.752 -0.258 1.00 43.55 ? 28  ASN A OD1 1 
ATOM   218  N ND2 . ASN A 1 28  ? 2.513   40.757 0.549  1.00 39.53 ? 28  ASN A ND2 1 
ATOM   219  N N   . LEU A 1 29  ? 3.299   38.634 4.226  1.00 22.04 ? 29  LEU A N   1 
ATOM   220  C CA  . LEU A 1 29  ? 4.395   39.140 5.057  1.00 22.53 ? 29  LEU A CA  1 
ATOM   221  C C   . LEU A 1 29  ? 5.269   38.154 5.843  1.00 22.16 ? 29  LEU A C   1 
ATOM   222  O O   . LEU A 1 29  ? 6.497   38.226 5.779  1.00 19.97 ? 29  LEU A O   1 
ATOM   223  C CB  . LEU A 1 29  ? 3.848   40.200 6.030  1.00 22.89 ? 29  LEU A CB  1 
ATOM   224  C CG  . LEU A 1 29  ? 4.167   41.685 5.820  1.00 20.64 ? 29  LEU A CG  1 
ATOM   225  C CD1 . LEU A 1 29  ? 3.925   42.109 4.394  1.00 18.79 ? 29  LEU A CD1 1 
ATOM   226  C CD2 . LEU A 1 29  ? 3.321   42.510 6.765  1.00 22.83 ? 29  LEU A CD2 1 
ATOM   227  N N   . PHE A 1 30  ? 4.639   37.276 6.620  1.00 22.08 ? 30  PHE A N   1 
ATOM   228  C CA  . PHE A 1 30  ? 5.351   36.309 7.462  1.00 23.65 ? 30  PHE A CA  1 
ATOM   229  C C   . PHE A 1 30  ? 6.578   35.626 6.859  1.00 23.80 ? 30  PHE A C   1 
ATOM   230  O O   . PHE A 1 30  ? 7.658   35.696 7.435  1.00 24.44 ? 30  PHE A O   1 
ATOM   231  C CB  . PHE A 1 30  ? 4.383   35.270 8.047  1.00 22.43 ? 30  PHE A CB  1 
ATOM   232  C CG  . PHE A 1 30  ? 3.296   35.866 8.897  1.00 23.99 ? 30  PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 30  ? 3.484   37.087 9.542  1.00 21.44 ? 30  PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 30  ? 2.073   35.221 9.034  1.00 24.28 ? 30  PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 30  ? 2.469   37.652 10.311 1.00 26.30 ? 30  PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 30  ? 1.049   35.780 9.802  1.00 23.17 ? 30  PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 30  ? 1.247   36.996 10.438 1.00 21.60 ? 30  PHE A CZ  1 
ATOM   238  N N   . PRO A 1 31  ? 6.444   34.996 5.677  1.00 25.08 ? 31  PRO A N   1 
ATOM   239  C CA  . PRO A 1 31  ? 7.611   34.334 5.086  1.00 26.16 ? 31  PRO A CA  1 
ATOM   240  C C   . PRO A 1 31  ? 8.751   35.300 4.771  1.00 27.91 ? 31  PRO A C   1 
ATOM   241  O O   . PRO A 1 31  ? 9.913   34.896 4.706  1.00 28.51 ? 31  PRO A O   1 
ATOM   242  C CB  . PRO A 1 31  ? 7.047   33.710 3.806  1.00 24.96 ? 31  PRO A CB  1 
ATOM   243  C CG  . PRO A 1 31  ? 5.608   33.502 4.125  1.00 27.31 ? 31  PRO A CG  1 
ATOM   244  C CD  . PRO A 1 31  ? 5.254   34.782 4.838  1.00 26.08 ? 31  PRO A CD  1 
ATOM   245  N N   . LYS A 1 32  ? 8.418   36.573 4.578  1.00 27.60 ? 32  LYS A N   1 
ATOM   246  C CA  . LYS A 1 32  ? 9.425   37.577 4.263  1.00 24.67 ? 32  LYS A CA  1 
ATOM   247  C C   . LYS A 1 32  ? 10.082  38.183 5.502  1.00 24.12 ? 32  LYS A C   1 
ATOM   248  O O   . LYS A 1 32  ? 11.311  38.227 5.598  1.00 24.30 ? 32  LYS A O   1 
ATOM   249  C CB  . LYS A 1 32  ? 8.820   38.690 3.401  1.00 26.51 ? 32  LYS A CB  1 
ATOM   250  C CG  . LYS A 1 32  ? 8.267   38.232 2.044  1.00 32.50 ? 32  LYS A CG  1 
ATOM   251  C CD  . LYS A 1 32  ? 7.895   39.432 1.157  1.00 35.87 ? 32  LYS A CD  1 
ATOM   252  C CE  . LYS A 1 32  ? 7.468   39.016 -0.255 1.00 31.97 ? 32  LYS A CE  1 
ATOM   253  N NZ  . LYS A 1 32  ? 6.097   38.438 -0.301 1.00 32.38 ? 32  LYS A NZ  1 
ATOM   254  N N   . VAL A 1 33  ? 9.264   38.614 6.462  1.00 24.67 ? 33  VAL A N   1 
ATOM   255  C CA  . VAL A 1 33  ? 9.765   39.253 7.681  1.00 23.51 ? 33  VAL A CA  1 
ATOM   256  C C   . VAL A 1 33  ? 10.201  38.328 8.820  1.00 24.50 ? 33  VAL A C   1 
ATOM   257  O O   . VAL A 1 33  ? 10.962  38.746 9.700  1.00 24.50 ? 33  VAL A O   1 
ATOM   258  C CB  . VAL A 1 33  ? 8.767   40.320 8.220  1.00 22.17 ? 33  VAL A CB  1 
ATOM   259  C CG1 . VAL A 1 33  ? 8.516   41.376 7.159  1.00 18.63 ? 33  VAL A CG1 1 
ATOM   260  C CG2 . VAL A 1 33  ? 7.454   39.671 8.650  1.00 23.10 ? 33  VAL A CG2 1 
ATOM   261  N N   . ALA A 1 34  ? 9.727   37.082 8.804  1.00 22.22 ? 34  ALA A N   1 
ATOM   262  C CA  . ALA A 1 34  ? 10.087  36.108 9.841  1.00 22.51 ? 34  ALA A CA  1 
ATOM   263  C C   . ALA A 1 34  ? 10.364  34.737 9.214  1.00 23.72 ? 34  ALA A C   1 
ATOM   264  O O   . ALA A 1 34  ? 9.673   33.756 9.495  1.00 20.29 ? 34  ALA A O   1 
ATOM   265  C CB  . ALA A 1 34  ? 8.980   36.009 10.882 1.00 20.19 ? 34  ALA A CB  1 
ATOM   266  N N   . PRO A 1 35  ? 11.416  34.649 8.379  1.00 25.04 ? 35  PRO A N   1 
ATOM   267  C CA  . PRO A 1 35  ? 11.816  33.418 7.689  1.00 23.90 ? 35  PRO A CA  1 
ATOM   268  C C   . PRO A 1 35  ? 12.223  32.280 8.617  1.00 25.18 ? 35  PRO A C   1 
ATOM   269  O O   . PRO A 1 35  ? 12.150  31.110 8.245  1.00 25.94 ? 35  PRO A O   1 
ATOM   270  C CB  . PRO A 1 35  ? 12.987  33.881 6.824  1.00 24.48 ? 35  PRO A CB  1 
ATOM   271  C CG  . PRO A 1 35  ? 13.587  34.989 7.634  1.00 28.26 ? 35  PRO A CG  1 
ATOM   272  C CD  . PRO A 1 35  ? 12.366  35.739 8.091  1.00 24.38 ? 35  PRO A CD  1 
ATOM   273  N N   . GLN A 1 36  ? 12.654  32.633 9.820  1.00 24.34 ? 36  GLN A N   1 
ATOM   274  C CA  . GLN A 1 36  ? 13.068  31.645 10.804 1.00 27.11 ? 36  GLN A CA  1 
ATOM   275  C C   . GLN A 1 36  ? 11.860  30.998 11.490 1.00 28.05 ? 36  GLN A C   1 
ATOM   276  O O   . GLN A 1 36  ? 12.014  30.068 12.281 1.00 29.23 ? 36  GLN A O   1 
ATOM   277  C CB  . GLN A 1 36  ? 13.988  32.283 11.855 1.00 28.62 ? 36  GLN A CB  1 
ATOM   278  C CG  . GLN A 1 36  ? 13.305  33.263 12.815 1.00 29.63 ? 36  GLN A CG  1 
ATOM   279  C CD  . GLN A 1 36  ? 12.960  34.604 12.183 1.00 31.09 ? 36  GLN A CD  1 
ATOM   280  O OE1 . GLN A 1 36  ? 13.326  34.890 11.043 1.00 30.92 ? 36  GLN A OE1 1 
ATOM   281  N NE2 . GLN A 1 36  ? 12.272  35.445 12.939 1.00 29.29 ? 36  GLN A NE2 1 
ATOM   282  N N   . ALA A 1 37  ? 10.663  31.491 11.175 1.00 27.13 ? 37  ALA A N   1 
ATOM   283  C CA  . ALA A 1 37  ? 9.431   30.972 11.763 1.00 24.54 ? 37  ALA A CA  1 
ATOM   284  C C   . ALA A 1 37  ? 8.487   30.395 10.712 1.00 21.41 ? 37  ALA A C   1 
ATOM   285  O O   . ALA A 1 37  ? 7.929   29.317 10.894 1.00 23.56 ? 37  ALA A O   1 
ATOM   286  C CB  . ALA A 1 37  ? 8.729   32.071 12.556 1.00 24.45 ? 37  ALA A CB  1 
ATOM   287  N N   . ILE A 1 38  ? 8.303   31.126 9.620  1.00 20.68 ? 38  ILE A N   1 
ATOM   288  C CA  . ILE A 1 38  ? 7.424   30.699 8.544  1.00 21.06 ? 38  ILE A CA  1 
ATOM   289  C C   . ILE A 1 38  ? 8.245   30.657 7.264  1.00 21.32 ? 38  ILE A C   1 
ATOM   290  O O   . ILE A 1 38  ? 8.858   31.653 6.890  1.00 23.28 ? 38  ILE A O   1 
ATOM   291  C CB  . ILE A 1 38  ? 6.260   31.701 8.349  1.00 21.36 ? 38  ILE A CB  1 
ATOM   292  C CG1 . ILE A 1 38  ? 5.500   31.909 9.660  1.00 22.06 ? 38  ILE A CG1 1 
ATOM   293  C CG2 . ILE A 1 38  ? 5.309   31.202 7.279  1.00 20.80 ? 38  ILE A CG2 1 
ATOM   294  C CD1 . ILE A 1 38  ? 4.797   30.682 10.167 1.00 25.57 ? 38  ILE A CD1 1 
ATOM   295  N N   . SER A 1 39  ? 8.277   29.504 6.603  1.00 22.27 ? 39  SER A N   1 
ATOM   296  C CA  . SER A 1 39  ? 9.040   29.373 5.364  1.00 22.21 ? 39  SER A CA  1 
ATOM   297  C C   . SER A 1 39  ? 8.185   29.715 4.166  1.00 21.50 ? 39  SER A C   1 
ATOM   298  O O   . SER A 1 39  ? 8.664   30.322 3.212  1.00 24.28 ? 39  SER A O   1 
ATOM   299  C CB  . SER A 1 39  ? 9.620   27.967 5.211  1.00 24.17 ? 39  SER A CB  1 
ATOM   300  O OG  . SER A 1 39  ? 8.605   26.982 5.275  1.00 32.45 ? 39  SER A OG  1 
ATOM   301  N N   . SER A 1 40  ? 6.916   29.321 4.216  1.00 20.81 ? 40  SER A N   1 
ATOM   302  C CA  . SER A 1 40  ? 5.996   29.604 3.123  1.00 19.40 ? 40  SER A CA  1 
ATOM   303  C C   . SER A 1 40  ? 4.549   29.466 3.545  1.00 18.50 ? 40  SER A C   1 
ATOM   304  O O   . SER A 1 40  ? 4.228   28.732 4.472  1.00 14.34 ? 40  SER A O   1 
ATOM   305  C CB  . SER A 1 40  ? 6.239   28.656 1.948  1.00 23.99 ? 40  SER A CB  1 
ATOM   306  O OG  . SER A 1 40  ? 5.687   27.375 2.206  1.00 24.60 ? 40  SER A OG  1 
ATOM   307  N N   . VAL A 1 41  ? 3.685   30.205 2.863  1.00 18.17 ? 41  VAL A N   1 
ATOM   308  C CA  . VAL A 1 41  ? 2.255   30.149 3.103  1.00 20.67 ? 41  VAL A CA  1 
ATOM   309  C C   . VAL A 1 41  ? 1.692   29.911 1.718  1.00 25.00 ? 41  VAL A C   1 
ATOM   310  O O   . VAL A 1 41  ? 1.958   30.666 0.782  1.00 27.09 ? 41  VAL A O   1 
ATOM   311  C CB  . VAL A 1 41  ? 1.695   31.457 3.686  1.00 21.77 ? 41  VAL A CB  1 
ATOM   312  C CG1 . VAL A 1 41  ? 0.180   31.359 3.812  1.00 18.22 ? 41  VAL A CG1 1 
ATOM   313  C CG2 . VAL A 1 41  ? 2.314   31.730 5.054  1.00 17.69 ? 41  VAL A CG2 1 
ATOM   314  N N   . GLU A 1 42  ? 0.924   28.842 1.599  1.00 25.48 ? 42  GLU A N   1 
ATOM   315  C CA  . GLU A 1 42  ? 0.345   28.428 0.340  1.00 23.98 ? 42  GLU A CA  1 
ATOM   316  C C   . GLU A 1 42  ? -1.174  28.480 0.435  1.00 24.60 ? 42  GLU A C   1 
ATOM   317  O O   . GLU A 1 42  ? -1.760  28.040 1.418  1.00 26.43 ? 42  GLU A O   1 
ATOM   318  C CB  . GLU A 1 42  ? 0.821   26.998 0.080  1.00 28.56 ? 42  GLU A CB  1 
ATOM   319  C CG  . GLU A 1 42  ? 0.530   26.415 -1.273 1.00 28.10 ? 42  GLU A CG  1 
ATOM   320  C CD  . GLU A 1 42  ? 1.039   24.990 -1.389 1.00 28.43 ? 42  GLU A CD  1 
ATOM   321  O OE1 . GLU A 1 42  ? 2.268   24.785 -1.317 1.00 29.46 ? 42  GLU A OE1 1 
ATOM   322  O OE2 . GLU A 1 42  ? 0.210   24.072 -1.554 1.00 31.96 ? 42  GLU A OE2 1 
ATOM   323  N N   . ASN A 1 43  ? -1.817  29.048 -0.570 1.00 25.28 ? 43  ASN A N   1 
ATOM   324  C CA  . ASN A 1 43  ? -3.265  29.117 -0.557 1.00 26.62 ? 43  ASN A CA  1 
ATOM   325  C C   . ASN A 1 43  ? -3.776  27.840 -1.177 1.00 24.31 ? 43  ASN A C   1 
ATOM   326  O O   . ASN A 1 43  ? -3.360  27.469 -2.269 1.00 27.04 ? 43  ASN A O   1 
ATOM   327  C CB  . ASN A 1 43  ? -3.758  30.302 -1.373 1.00 31.09 ? 43  ASN A CB  1 
ATOM   328  C CG  . ASN A 1 43  ? -5.225  30.569 -1.167 1.00 37.85 ? 43  ASN A CG  1 
ATOM   329  O OD1 . ASN A 1 43  ? -5.615  31.217 -0.190 1.00 36.58 ? 43  ASN A OD1 1 
ATOM   330  N ND2 . ASN A 1 43  ? -6.055  30.073 -2.086 1.00 41.11 ? 43  ASN A ND2 1 
ATOM   331  N N   . ILE A 1 44  ? -4.658  27.154 -0.468 1.00 24.68 ? 44  ILE A N   1 
ATOM   332  C CA  . ILE A 1 44  ? -5.220  25.907 -0.965 1.00 26.64 ? 44  ILE A CA  1 
ATOM   333  C C   . ILE A 1 44  ? -6.621  26.104 -1.552 1.00 27.88 ? 44  ILE A C   1 
ATOM   334  O O   . ILE A 1 44  ? -6.968  25.485 -2.559 1.00 30.10 ? 44  ILE A O   1 
ATOM   335  C CB  . ILE A 1 44  ? -5.238  24.832 0.144  1.00 25.89 ? 44  ILE A CB  1 
ATOM   336  C CG1 . ILE A 1 44  ? -3.806  24.454 0.510  1.00 27.18 ? 44  ILE A CG1 1 
ATOM   337  C CG2 . ILE A 1 44  ? -6.013  23.600 -0.297 1.00 28.52 ? 44  ILE A CG2 1 
ATOM   338  C CD1 . ILE A 1 44  ? -3.717  23.284 1.457  1.00 34.60 ? 44  ILE A CD1 1 
ATOM   339  N N   . GLU A 1 45  ? -7.403  26.995 -0.950 1.00 28.17 ? 45  GLU A N   1 
ATOM   340  C CA  . GLU A 1 45  ? -8.762  27.263 -1.419 1.00 27.52 ? 45  GLU A CA  1 
ATOM   341  C C   . GLU A 1 45  ? -9.266  28.609 -0.919 1.00 25.61 ? 45  GLU A C   1 
ATOM   342  O O   . GLU A 1 45  ? -8.994  28.992 0.218  1.00 22.24 ? 45  GLU A O   1 
ATOM   343  C CB  . GLU A 1 45  ? -9.709  26.168 -0.927 1.00 32.22 ? 45  GLU A CB  1 
ATOM   344  C CG  . GLU A 1 45  ? -11.162 26.388 -1.317 1.00 42.32 ? 45  GLU A CG  1 
ATOM   345  C CD  . GLU A 1 45  ? -12.123 25.611 -0.442 1.00 47.44 ? 45  GLU A CD  1 
ATOM   346  O OE1 . GLU A 1 45  ? -11.846 24.426 -0.158 1.00 51.75 ? 45  GLU A OE1 1 
ATOM   347  O OE2 . GLU A 1 45  ? -13.153 26.190 -0.033 1.00 50.43 ? 45  GLU A OE2 1 
ATOM   348  N N   . GLY A 1 46  ? -10.020 29.309 -1.762 1.00 21.99 ? 46  GLY A N   1 
ATOM   349  C CA  . GLY A 1 46  ? -10.562 30.601 -1.374 1.00 23.37 ? 46  GLY A CA  1 
ATOM   350  C C   . GLY A 1 46  ? -9.759  31.806 -1.835 1.00 25.36 ? 46  GLY A C   1 
ATOM   351  O O   . GLY A 1 46  ? -8.668  31.663 -2.398 1.00 24.61 ? 46  GLY A O   1 
ATOM   352  N N   . ASN A 1 47  ? -10.299 32.996 -1.566 1.00 28.07 ? 47  ASN A N   1 
ATOM   353  C CA  . ASN A 1 47  ? -9.681  34.270 -1.949 1.00 30.71 ? 47  ASN A CA  1 
ATOM   354  C C   . ASN A 1 47  ? -8.943  34.962 -0.806 1.00 31.59 ? 47  ASN A C   1 
ATOM   355  O O   . ASN A 1 47  ? -8.162  35.894 -1.028 1.00 33.88 ? 47  ASN A O   1 
ATOM   356  C CB  . ASN A 1 47  ? -10.752 35.239 -2.470 1.00 33.60 ? 47  ASN A CB  1 
ATOM   357  C CG  . ASN A 1 47  ? -11.474 34.721 -3.698 1.00 36.06 ? 47  ASN A CG  1 
ATOM   358  O OD1 . ASN A 1 47  ? -10.860 34.171 -4.611 1.00 39.65 ? 47  ASN A OD1 1 
ATOM   359  N ND2 . ASN A 1 47  ? -12.784 34.916 -3.734 1.00 36.30 ? 47  ASN A ND2 1 
ATOM   360  N N   . GLY A 1 48  ? -9.232  34.536 0.418  1.00 28.07 ? 48  GLY A N   1 
ATOM   361  C CA  . GLY A 1 48  ? -8.611  35.140 1.577  1.00 23.62 ? 48  GLY A CA  1 
ATOM   362  C C   . GLY A 1 48  ? -9.654  35.392 2.648  1.00 24.69 ? 48  GLY A C   1 
ATOM   363  O O   . GLY A 1 48  ? -9.309  35.636 3.805  1.00 26.30 ? 48  GLY A O   1 
ATOM   364  N N   . GLY A 1 49  ? -10.930 35.341 2.263  1.00 21.23 ? 49  GLY A N   1 
ATOM   365  C CA  . GLY A 1 49  ? -12.007 35.554 3.213  1.00 21.05 ? 49  GLY A CA  1 
ATOM   366  C C   . GLY A 1 49  ? -12.486 34.260 3.853  1.00 21.73 ? 49  GLY A C   1 
ATOM   367  O O   . GLY A 1 49  ? -11.875 33.207 3.667  1.00 18.82 ? 49  GLY A O   1 
ATOM   368  N N   . PRO A 1 50  ? -13.577 34.307 4.630  1.00 23.65 ? 50  PRO A N   1 
ATOM   369  C CA  . PRO A 1 50  ? -14.118 33.113 5.291  1.00 23.83 ? 50  PRO A CA  1 
ATOM   370  C C   . PRO A 1 50  ? -14.223 31.910 4.351  1.00 22.85 ? 50  PRO A C   1 
ATOM   371  O O   . PRO A 1 50  ? -14.602 32.050 3.187  1.00 24.02 ? 50  PRO A O   1 
ATOM   372  C CB  . PRO A 1 50  ? -15.483 33.592 5.774  1.00 26.63 ? 50  PRO A CB  1 
ATOM   373  C CG  . PRO A 1 50  ? -15.200 35.032 6.152  1.00 26.41 ? 50  PRO A CG  1 
ATOM   374  C CD  . PRO A 1 50  ? -14.340 35.516 4.998  1.00 24.86 ? 50  PRO A CD  1 
ATOM   375  N N   . GLY A 1 51  ? -13.840 30.739 4.856  1.00 21.46 ? 51  GLY A N   1 
ATOM   376  C CA  . GLY A 1 51  ? -13.876 29.524 4.058  1.00 23.65 ? 51  GLY A CA  1 
ATOM   377  C C   . GLY A 1 51  ? -12.544 29.182 3.406  1.00 22.77 ? 51  GLY A C   1 
ATOM   378  O O   . GLY A 1 51  ? -12.363 28.079 2.890  1.00 26.24 ? 51  GLY A O   1 
ATOM   379  N N   . THR A 1 52  ? -11.608 30.126 3.438  1.00 20.29 ? 52  THR A N   1 
ATOM   380  C CA  . THR A 1 52  ? -10.286 29.946 2.851  1.00 18.42 ? 52  THR A CA  1 
ATOM   381  C C   . THR A 1 52  ? -9.407  28.975 3.644  1.00 18.69 ? 52  THR A C   1 
ATOM   382  O O   . THR A 1 52  ? -9.375  29.026 4.870  1.00 12.76 ? 52  THR A O   1 
ATOM   383  C CB  . THR A 1 52  ? -9.556  31.307 2.751  1.00 18.12 ? 52  THR A CB  1 
ATOM   384  O OG1 . THR A 1 52  ? -10.271 32.164 1.857  1.00 14.56 ? 52  THR A OG1 1 
ATOM   385  C CG2 . THR A 1 52  ? -8.121  31.136 2.253  1.00 15.46 ? 52  THR A CG2 1 
ATOM   386  N N   . ILE A 1 53  ? -8.692  28.099 2.935  1.00 19.81 ? 53  ILE A N   1 
ATOM   387  C CA  . ILE A 1 53  ? -7.792  27.139 3.577  1.00 19.49 ? 53  ILE A CA  1 
ATOM   388  C C   . ILE A 1 53  ? -6.372  27.447 3.115  1.00 19.08 ? 53  ILE A C   1 
ATOM   389  O O   . ILE A 1 53  ? -6.128  27.603 1.918  1.00 18.35 ? 53  ILE A O   1 
ATOM   390  C CB  . ILE A 1 53  ? -8.099  25.675 3.176  1.00 20.29 ? 53  ILE A CB  1 
ATOM   391  C CG1 . ILE A 1 53  ? -9.597  25.374 3.306  1.00 22.26 ? 53  ILE A CG1 1 
ATOM   392  C CG2 . ILE A 1 53  ? -7.263  24.706 4.029  1.00 18.97 ? 53  ILE A CG2 1 
ATOM   393  C CD1 . ILE A 1 53  ? -10.132 25.443 4.710  1.00 24.60 ? 53  ILE A CD1 1 
ATOM   394  N N   . LYS A 1 54  ? -5.440  27.529 4.060  1.00 17.94 ? 54  LYS A N   1 
ATOM   395  C CA  . LYS A 1 54  ? -4.047  27.817 3.739  1.00 17.79 ? 54  LYS A CA  1 
ATOM   396  C C   . LYS A 1 54  ? -3.104  26.805 4.376  1.00 18.89 ? 54  LYS A C   1 
ATOM   397  O O   . LYS A 1 54  ? -3.343  26.314 5.482  1.00 22.24 ? 54  LYS A O   1 
ATOM   398  C CB  . LYS A 1 54  ? -3.658  29.216 4.214  1.00 16.23 ? 54  LYS A CB  1 
ATOM   399  C CG  . LYS A 1 54  ? -4.692  30.277 3.929  1.00 25.03 ? 54  LYS A CG  1 
ATOM   400  C CD  . LYS A 1 54  ? -4.091  31.659 3.992  1.00 29.78 ? 54  LYS A CD  1 
ATOM   401  C CE  . LYS A 1 54  ? -3.109  31.872 2.846  1.00 36.65 ? 54  LYS A CE  1 
ATOM   402  N NZ  . LYS A 1 54  ? -3.757  31.860 1.497  1.00 36.00 ? 54  LYS A NZ  1 
ATOM   403  N N   . LYS A 1 55  ? -2.040  26.482 3.656  1.00 19.94 ? 55  LYS A N   1 
ATOM   404  C CA  . LYS A 1 55  ? -1.026  25.556 4.136  1.00 20.87 ? 55  LYS A CA  1 
ATOM   405  C C   . LYS A 1 55  ? 0.181   26.390 4.541  1.00 19.27 ? 55  LYS A C   1 
ATOM   406  O O   . LYS A 1 55  ? 0.746   27.113 3.720  1.00 17.44 ? 55  LYS A O   1 
ATOM   407  C CB  . LYS A 1 55  ? -0.645  24.566 3.032  1.00 21.28 ? 55  LYS A CB  1 
ATOM   408  C CG  . LYS A 1 55  ? 0.376   23.500 3.431  1.00 28.23 ? 55  LYS A CG  1 
ATOM   409  C CD  . LYS A 1 55  ? 0.483   22.441 2.339  1.00 35.49 ? 55  LYS A CD  1 
ATOM   410  C CE  . LYS A 1 55  ? 1.498   21.351 2.663  1.00 41.85 ? 55  LYS A CE  1 
ATOM   411  N NZ  . LYS A 1 55  ? 2.898   21.846 2.568  1.00 50.81 ? 55  LYS A NZ  1 
ATOM   412  N N   . ILE A 1 56  ? 0.498   26.365 5.830  1.00 17.62 ? 56  ILE A N   1 
ATOM   413  C CA  . ILE A 1 56  ? 1.638   27.094 6.362  1.00 19.17 ? 56  ILE A CA  1 
ATOM   414  C C   . ILE A 1 56  ? 2.767   26.100 6.586  1.00 20.62 ? 56  ILE A C   1 
ATOM   415  O O   . ILE A 1 56  ? 2.601   25.126 7.317  1.00 24.45 ? 56  ILE A O   1 
ATOM   416  C CB  . ILE A 1 56  ? 1.327   27.745 7.728  1.00 20.27 ? 56  ILE A CB  1 
ATOM   417  C CG1 . ILE A 1 56  ? 0.193   28.760 7.605  1.00 22.33 ? 56  ILE A CG1 1 
ATOM   418  C CG2 . ILE A 1 56  ? 2.576   28.399 8.296  1.00 20.13 ? 56  ILE A CG2 1 
ATOM   419  C CD1 . ILE A 1 56  ? -1.177  28.146 7.630  1.00 28.46 ? 56  ILE A CD1 1 
ATOM   420  N N   . SER A 1 57  ? 3.903   26.326 5.939  1.00 20.47 ? 57  SER A N   1 
ATOM   421  C CA  . SER A 1 57  ? 5.052   25.451 6.114  1.00 20.64 ? 57  SER A CA  1 
ATOM   422  C C   . SER A 1 57  ? 6.084   26.113 7.005  1.00 19.80 ? 57  SER A C   1 
ATOM   423  O O   . SER A 1 57  ? 6.266   27.328 6.974  1.00 21.59 ? 57  SER A O   1 
ATOM   424  C CB  . SER A 1 57  ? 5.674   25.079 4.773  1.00 19.68 ? 57  SER A CB  1 
ATOM   425  O OG  . SER A 1 57  ? 4.764   24.314 4.014  1.00 20.92 ? 57  SER A OG  1 
ATOM   426  N N   . PHE A 1 58  ? 6.764   25.294 7.793  1.00 20.92 ? 58  PHE A N   1 
ATOM   427  C CA  . PHE A 1 58  ? 7.777   25.771 8.719  1.00 24.50 ? 58  PHE A CA  1 
ATOM   428  C C   . PHE A 1 58  ? 9.168   25.369 8.230  1.00 26.06 ? 58  PHE A C   1 
ATOM   429  O O   . PHE A 1 58  ? 9.352   24.270 7.704  1.00 29.08 ? 58  PHE A O   1 
ATOM   430  C CB  . PHE A 1 58  ? 7.496   25.193 10.106 1.00 24.07 ? 58  PHE A CB  1 
ATOM   431  C CG  . PHE A 1 58  ? 6.088   25.440 10.593 1.00 27.32 ? 58  PHE A CG  1 
ATOM   432  C CD1 . PHE A 1 58  ? 5.705   26.688 11.067 1.00 25.96 ? 58  PHE A CD1 1 
ATOM   433  C CD2 . PHE A 1 58  ? 5.151   24.415 10.592 1.00 30.14 ? 58  PHE A CD2 1 
ATOM   434  C CE1 . PHE A 1 58  ? 4.414   26.912 11.540 1.00 25.98 ? 58  PHE A CE1 1 
ATOM   435  C CE2 . PHE A 1 58  ? 3.850   24.629 11.064 1.00 28.24 ? 58  PHE A CE2 1 
ATOM   436  C CZ  . PHE A 1 58  ? 3.485   25.884 11.539 1.00 24.09 ? 58  PHE A CZ  1 
ATOM   437  N N   . PRO A 1 59  ? 10.165  26.261 8.381  1.00 26.92 ? 59  PRO A N   1 
ATOM   438  C CA  . PRO A 1 59  ? 11.532  25.963 7.938  1.00 29.90 ? 59  PRO A CA  1 
ATOM   439  C C   . PRO A 1 59  ? 12.140  24.724 8.613  1.00 34.98 ? 59  PRO A C   1 
ATOM   440  O O   . PRO A 1 59  ? 11.787  24.395 9.750  1.00 31.85 ? 59  PRO A O   1 
ATOM   441  C CB  . PRO A 1 59  ? 12.295  27.249 8.268  1.00 24.94 ? 59  PRO A CB  1 
ATOM   442  C CG  . PRO A 1 59  ? 11.509  27.864 9.370  1.00 21.87 ? 59  PRO A CG  1 
ATOM   443  C CD  . PRO A 1 59  ? 10.087  27.599 8.990  1.00 24.87 ? 59  PRO A CD  1 
ATOM   444  N N   A GLU A 1 60  ? 12.866  23.955 7.804  0.45 36.51 ? 60  GLU A N   1 
ATOM   445  N N   B GLU A 1 60  ? 13.172  24.167 7.975  0.38 39.25 ? 60  GLU A N   1 
ATOM   446  C CA  A GLU A 1 60  ? 13.525  22.702 8.192  0.45 39.79 ? 60  GLU A CA  1 
ATOM   447  C CA  B GLU A 1 60  ? 13.893  22.985 8.468  0.38 44.12 ? 60  GLU A CA  1 
ATOM   448  C C   A GLU A 1 60  ? 13.644  22.341 9.676  0.45 39.42 ? 60  GLU A C   1 
ATOM   449  C C   B GLU A 1 60  ? 14.297  23.137 9.937  0.38 44.62 ? 60  GLU A C   1 
ATOM   450  O O   A GLU A 1 60  ? 13.230  21.254 10.083 0.45 39.25 ? 60  GLU A O   1 
ATOM   451  O O   B GLU A 1 60  ? 14.466  24.259 10.428 0.38 44.35 ? 60  GLU A O   1 
ATOM   452  C CB  A GLU A 1 60  ? 14.902  22.595 7.521  0.45 42.98 ? 60  GLU A CB  1 
ATOM   453  C CB  B GLU A 1 60  ? 15.130  22.695 7.605  0.38 47.84 ? 60  GLU A CB  1 
ATOM   454  C CG  A GLU A 1 60  ? 15.868  23.754 7.798  0.45 49.67 ? 60  GLU A CG  1 
ATOM   455  C CG  B GLU A 1 60  ? 16.215  23.773 7.613  0.38 54.88 ? 60  GLU A CG  1 
ATOM   456  C CD  A GLU A 1 60  ? 15.482  25.053 7.096  0.45 53.90 ? 60  GLU A CD  1 
ATOM   457  C CD  B GLU A 1 60  ? 15.803  25.051 6.901  0.38 58.93 ? 60  GLU A CD  1 
ATOM   458  O OE1 A GLU A 1 60  ? 14.971  24.997 5.953  0.45 56.56 ? 60  GLU A OE1 1 
ATOM   459  O OE1 B GLU A 1 60  ? 15.420  24.974 5.712  0.38 61.65 ? 60  GLU A OE1 1 
ATOM   460  O OE2 A GLU A 1 60  ? 15.697  26.132 7.691  0.45 54.92 ? 60  GLU A OE2 1 
ATOM   461  O OE2 B GLU A 1 60  ? 15.860  26.128 7.534  0.38 60.14 ? 60  GLU A OE2 1 
ATOM   462  N N   A GLY A 1 61  ? 14.187  23.260 10.472 0.45 40.09 ? 61  GLY A N   1 
ATOM   463  N N   B GLY A 1 61  ? 14.520  22.010 10.614 0.38 45.62 ? 61  GLY A N   1 
ATOM   464  C CA  A GLY A 1 61  ? 14.376  23.015 11.893 0.45 40.09 ? 61  GLY A CA  1 
ATOM   465  C CA  B GLY A 1 61  ? 14.837  22.054 12.029 0.38 45.75 ? 61  GLY A CA  1 
ATOM   466  C C   A GLY A 1 61  ? 13.168  22.944 12.814 0.45 40.39 ? 61  GLY A C   1 
ATOM   467  C C   B GLY A 1 61  ? 13.516  22.533 12.592 0.38 45.62 ? 61  GLY A C   1 
ATOM   468  O O   A GLY A 1 61  ? 13.162  22.130 13.742 0.45 40.18 ? 61  GLY A O   1 
ATOM   469  O O   B GLY A 1 61  ? 13.439  23.521 13.327 0.38 46.98 ? 61  GLY A O   1 
ATOM   470  N N   A LEU A 1 62  ? 12.163  23.786 12.589 0.45 39.28 ? 62  LEU A N   1 
ATOM   471  N N   B LEU A 1 62  ? 12.474  21.814 12.198 0.38 44.06 ? 62  LEU A N   1 
ATOM   472  C CA  A LEU A 1 62  ? 10.975  23.803 13.449 0.45 37.85 ? 62  LEU A CA  1 
ATOM   473  C CA  B LEU A 1 62  ? 11.104  22.145 12.542 0.38 42.39 ? 62  LEU A CA  1 
ATOM   474  C C   A LEU A 1 62  ? 10.338  22.421 13.635 0.45 37.10 ? 62  LEU A C   1 
ATOM   475  C C   B LEU A 1 62  ? 10.389  21.209 13.491 0.38 42.39 ? 62  LEU A C   1 
ATOM   476  O O   A LEU A 1 62  ? 10.282  21.623 12.693 0.45 37.72 ? 62  LEU A O   1 
ATOM   477  O O   B LEU A 1 62  ? 10.529  19.985 13.400 0.38 43.82 ? 62  LEU A O   1 
ATOM   478  C CB  A LEU A 1 62  ? 9.935   24.787 12.915 0.45 37.48 ? 62  LEU A CB  1 
ATOM   479  C CB  B LEU A 1 62  ? 10.283  22.250 11.248 0.38 38.16 ? 62  LEU A CB  1 
ATOM   480  C CG  A LEU A 1 62  ? 9.057   25.359 14.029 0.45 39.50 ? 62  LEU A CG  1 
ATOM   481  C CG  B LEU A 1 62  ? 10.542  21.170 10.183 0.38 34.55 ? 62  LEU A CG  1 
ATOM   482  C CD1 A LEU A 1 62  ? 9.868   26.349 14.854 0.45 39.25 ? 62  LEU A CD1 1 
ATOM   483  C CD1 B LEU A 1 62  ? 9.862   19.855 10.533 0.38 32.72 ? 62  LEU A CD1 1 
ATOM   484  C CD2 A LEU A 1 62  ? 7.845   26.025 13.453 0.45 39.20 ? 62  LEU A CD2 1 
ATOM   485  C CD2 B LEU A 1 62  ? 10.061  21.645 8.835  0.38 31.73 ? 62  LEU A CD2 1 
ATOM   486  N N   A PRO A 1 63  ? 9.865   22.118 14.863 0.45 36.49 ? 63  PRO A N   1 
ATOM   487  N N   B PRO A 1 63  ? 9.645   21.780 14.453 0.38 41.66 ? 63  PRO A N   1 
ATOM   488  C CA  A PRO A 1 63  ? 9.231   20.842 15.230 0.45 35.61 ? 63  PRO A CA  1 
ATOM   489  C CA  B PRO A 1 63  ? 8.914   20.935 15.391 0.38 40.49 ? 63  PRO A CA  1 
ATOM   490  C C   A PRO A 1 63  ? 8.169   20.307 14.278 0.45 34.26 ? 63  PRO A C   1 
ATOM   491  C C   B PRO A 1 63  ? 7.762   20.333 14.576 0.38 38.46 ? 63  PRO A C   1 
ATOM   492  O O   A PRO A 1 63  ? 7.997   19.093 14.166 0.45 34.41 ? 63  PRO A O   1 
ATOM   493  O O   B PRO A 1 63  ? 7.334   19.208 14.816 0.38 38.68 ? 63  PRO A O   1 
ATOM   494  C CB  A PRO A 1 63  ? 8.648   21.125 16.626 0.45 36.34 ? 63  PRO A CB  1 
ATOM   495  C CB  B PRO A 1 63  ? 8.414   21.934 16.441 0.38 41.20 ? 63  PRO A CB  1 
ATOM   496  C CG  A PRO A 1 63  ? 8.719   22.624 16.786 0.45 36.24 ? 63  PRO A CG  1 
ATOM   497  C CG  B PRO A 1 63  ? 9.342   23.122 16.316 0.38 41.71 ? 63  PRO A CG  1 
ATOM   498  C CD  A PRO A 1 63  ? 9.958   22.996 16.038 0.45 36.54 ? 63  PRO A CD  1 
ATOM   499  C CD  B PRO A 1 63  ? 9.605   23.196 14.852 0.38 41.51 ? 63  PRO A CD  1 
ATOM   500  N N   A PHE A 1 64  ? 7.462   21.199 13.586 0.33 32.29 ? 64  PHE A N   1 
ATOM   501  N N   B PHE A 1 64  ? 7.274   21.100 13.598 0.68 35.97 ? 64  PHE A N   1 
ATOM   502  C CA  A PHE A 1 64  ? 6.426   20.763 12.658 0.33 30.53 ? 64  PHE A CA  1 
ATOM   503  C CA  B PHE A 1 64  ? 6.204   20.661 12.707 0.68 33.19 ? 64  PHE A CA  1 
ATOM   504  C C   A PHE A 1 64  ? 6.768   20.983 11.190 0.33 29.48 ? 64  PHE A C   1 
ATOM   505  C C   B PHE A 1 64  ? 6.576   20.943 11.264 0.68 31.75 ? 64  PHE A C   1 
ATOM   506  O O   A PHE A 1 64  ? 7.512   21.897 10.835 0.33 29.47 ? 64  PHE A O   1 
ATOM   507  O O   B PHE A 1 64  ? 7.244   21.929 10.965 0.68 31.33 ? 64  PHE A O   1 
ATOM   508  C CB  A PHE A 1 64  ? 5.092   21.433 12.989 0.33 29.40 ? 64  PHE A CB  1 
ATOM   509  C CB  B PHE A 1 64  ? 4.885   21.356 13.031 0.68 30.85 ? 64  PHE A CB  1 
ATOM   510  C CG  A PHE A 1 64  ? 4.579   21.107 14.361 0.33 29.15 ? 64  PHE A CG  1 
ATOM   511  C CG  B PHE A 1 64  ? 4.399   21.106 14.416 0.68 31.34 ? 64  PHE A CG  1 
ATOM   512  C CD1 A PHE A 1 64  ? 4.477   19.784 14.786 0.33 28.69 ? 64  PHE A CD1 1 
ATOM   513  C CD1 B PHE A 1 64  ? 4.296   19.807 14.907 0.68 30.10 ? 64  PHE A CD1 1 
ATOM   514  C CD2 A PHE A 1 64  ? 4.200   22.121 15.231 0.33 29.37 ? 64  PHE A CD2 1 
ATOM   515  C CD2 B PHE A 1 64  ? 4.071   22.167 15.244 0.68 32.15 ? 64  PHE A CD2 1 
ATOM   516  C CE1 A PHE A 1 64  ? 4.004   19.480 16.055 0.33 28.29 ? 64  PHE A CE1 1 
ATOM   517  C CE1 B PHE A 1 64  ? 3.875   19.571 16.203 0.68 30.82 ? 64  PHE A CE1 1 
ATOM   518  C CE2 A PHE A 1 64  ? 3.724   21.828 16.504 0.33 29.40 ? 64  PHE A CE2 1 
ATOM   519  C CE2 B PHE A 1 64  ? 3.648   21.944 16.542 0.68 32.45 ? 64  PHE A CE2 1 
ATOM   520  C CZ  A PHE A 1 64  ? 3.626   20.503 16.917 0.33 30.49 ? 64  PHE A CZ  1 
ATOM   521  C CZ  B PHE A 1 64  ? 3.550   20.646 17.027 0.68 34.60 ? 64  PHE A CZ  1 
ATOM   522  N N   A LYS A 1 65  ? 6.213   20.119 10.347 0.33 28.92 ? 65  LYS A N   1 
ATOM   523  N N   B LYS A 1 65  ? 6.144   20.054 10.379 0.68 30.93 ? 65  LYS A N   1 
ATOM   524  C CA  A LYS A 1 65  ? 6.424   20.180 8.910  0.33 28.89 ? 65  LYS A CA  1 
ATOM   525  C CA  B LYS A 1 65  ? 6.411   20.171 8.954  0.68 30.82 ? 65  LYS A CA  1 
ATOM   526  C C   A LYS A 1 65  ? 5.489   21.216 8.286  0.33 27.45 ? 65  LYS A C   1 
ATOM   527  C C   B LYS A 1 65  ? 5.495   21.221 8.321  0.68 28.66 ? 65  LYS A C   1 
ATOM   528  O O   A LYS A 1 65  ? 5.930   22.086 7.535  0.33 25.41 ? 65  LYS A O   1 
ATOM   529  O O   B LYS A 1 65  ? 5.956   22.104 7.595  0.68 24.64 ? 65  LYS A O   1 
ATOM   530  C CB  A LYS A 1 65  ? 6.174   18.804 8.291  0.33 32.74 ? 65  LYS A CB  1 
ATOM   531  C CB  B LYS A 1 65  ? 6.198   18.804 8.299  0.68 37.62 ? 65  LYS A CB  1 
ATOM   532  C CG  A LYS A 1 65  ? 6.267   18.749 6.775  0.33 36.81 ? 65  LYS A CG  1 
ATOM   533  C CG  B LYS A 1 65  ? 6.276   18.778 6.783  0.68 44.64 ? 65  LYS A CG  1 
ATOM   534  C CD  A LYS A 1 65  ? 5.888   17.367 6.270  0.33 39.92 ? 65  LYS A CD  1 
ATOM   535  C CD  B LYS A 1 65  ? 5.912   17.392 6.276  0.68 49.78 ? 65  LYS A CD  1 
ATOM   536  C CE  A LYS A 1 65  ? 5.853   17.309 4.751  0.33 42.75 ? 65  LYS A CE  1 
ATOM   537  C CE  B LYS A 1 65  ? 5.780   17.348 4.765  0.68 54.30 ? 65  LYS A CE  1 
ATOM   538  N NZ  A LYS A 1 65  ? 5.472   15.949 4.267  0.33 45.34 ? 65  LYS A NZ  1 
ATOM   539  N NZ  B LYS A 1 65  ? 5.432   15.973 4.299  0.68 58.54 ? 65  LYS A NZ  1 
ATOM   540  N N   . TYR A 1 66  ? 4.204   21.125 8.615  1.00 25.82 ? 66  TYR A N   1 
ATOM   541  C CA  . TYR A 1 66  ? 3.211   22.054 8.081  1.00 24.32 ? 66  TYR A CA  1 
ATOM   542  C C   . TYR A 1 66  ? 1.958   22.054 8.946  1.00 21.86 ? 66  TYR A C   1 
ATOM   543  O O   . TYR A 1 66  ? 1.771   21.178 9.792  1.00 19.58 ? 66  TYR A O   1 
ATOM   544  C CB  . TYR A 1 66  ? 2.803   21.636 6.662  1.00 26.18 ? 66  TYR A CB  1 
ATOM   545  C CG  . TYR A 1 66  ? 1.811   20.496 6.643  1.00 29.23 ? 66  TYR A CG  1 
ATOM   546  C CD1 . TYR A 1 66  ? 2.226   19.180 6.846  1.00 30.02 ? 66  TYR A CD1 1 
ATOM   547  C CD2 . TYR A 1 66  ? 0.446   20.744 6.494  1.00 27.55 ? 66  TYR A CD2 1 
ATOM   548  C CE1 . TYR A 1 66  ? 1.303   18.137 6.909  1.00 31.57 ? 66  TYR A CE1 1 
ATOM   549  C CE2 . TYR A 1 66  ? -0.486  19.715 6.557  1.00 33.16 ? 66  TYR A CE2 1 
ATOM   550  C CZ  . TYR A 1 66  ? -0.053  18.412 6.767  1.00 33.86 ? 66  TYR A CZ  1 
ATOM   551  O OH  . TYR A 1 66  ? -0.981  17.399 6.853  1.00 34.01 ? 66  TYR A OH  1 
ATOM   552  N N   . VAL A 1 67  ? 1.067   22.998 8.653  1.00 17.17 ? 67  VAL A N   1 
ATOM   553  C CA  . VAL A 1 67  ? -0.203  23.124 9.349  1.00 16.76 ? 67  VAL A CA  1 
ATOM   554  C C   . VAL A 1 67  ? -1.240  23.701 8.380  1.00 17.79 ? 67  VAL A C   1 
ATOM   555  O O   . VAL A 1 67  ? -0.892  24.443 7.459  1.00 17.66 ? 67  VAL A O   1 
ATOM   556  C CB  . VAL A 1 67  ? -0.064  24.013 10.610 1.00 16.85 ? 67  VAL A CB  1 
ATOM   557  C CG1 . VAL A 1 67  ? -0.385  25.467 10.308 1.00 16.57 ? 67  VAL A CG1 1 
ATOM   558  C CG2 . VAL A 1 67  ? -0.919  23.480 11.719 1.00 21.78 ? 67  VAL A CG2 1 
ATOM   559  N N   . LYS A 1 68  ? -2.498  23.299 8.534  1.00 16.27 ? 68  LYS A N   1 
ATOM   560  C CA  . LYS A 1 68  ? -3.566  23.816 7.681  1.00 16.50 ? 68  LYS A CA  1 
ATOM   561  C C   . LYS A 1 68  ? -4.563  24.617 8.502  1.00 16.33 ? 68  LYS A C   1 
ATOM   562  O O   . LYS A 1 68  ? -5.077  24.140 9.510  1.00 13.92 ? 68  LYS A O   1 
ATOM   563  C CB  . LYS A 1 68  ? -4.274  22.694 6.919  1.00 13.37 ? 68  LYS A CB  1 
ATOM   564  C CG  . LYS A 1 68  ? -3.548  22.306 5.653  1.00 18.09 ? 68  LYS A CG  1 
ATOM   565  C CD  . LYS A 1 68  ? -4.191  21.140 4.947  1.00 18.60 ? 68  LYS A CD  1 
ATOM   566  C CE  . LYS A 1 68  ? -3.208  20.547 3.950  1.00 25.44 ? 68  LYS A CE  1 
ATOM   567  N NZ  . LYS A 1 68  ? -3.709  19.284 3.348  1.00 26.99 ? 68  LYS A NZ  1 
ATOM   568  N N   . ASP A 1 69  ? -4.794  25.855 8.081  1.00 16.39 ? 69  ASP A N   1 
ATOM   569  C CA  . ASP A 1 69  ? -5.720  26.744 8.763  1.00 17.06 ? 69  ASP A CA  1 
ATOM   570  C C   . ASP A 1 69  ? -6.909  27.080 7.887  1.00 18.47 ? 69  ASP A C   1 
ATOM   571  O O   . ASP A 1 69  ? -6.805  27.112 6.657  1.00 18.47 ? 69  ASP A O   1 
ATOM   572  C CB  . ASP A 1 69  ? -5.027  28.052 9.144  1.00 22.32 ? 69  ASP A CB  1 
ATOM   573  C CG  . ASP A 1 69  ? -3.862  27.850 10.090 1.00 30.66 ? 69  ASP A CG  1 
ATOM   574  O OD1 . ASP A 1 69  ? -3.729  26.751 10.679 1.00 34.34 ? 69  ASP A OD1 1 
ATOM   575  O OD2 . ASP A 1 69  ? -3.076  28.809 10.251 1.00 35.53 ? 69  ASP A OD2 1 
ATOM   576  N N   . ARG A 1 70  ? -8.029  27.373 8.533  1.00 15.77 ? 70  ARG A N   1 
ATOM   577  C CA  . ARG A 1 70  ? -9.243  27.748 7.831  1.00 15.98 ? 70  ARG A CA  1 
ATOM   578  C C   . ARG A 1 70  ? -9.628  29.112 8.374  1.00 14.98 ? 70  ARG A C   1 
ATOM   579  O O   . ARG A 1 70  ? -9.580  29.329 9.571  1.00 14.95 ? 70  ARG A O   1 
ATOM   580  C CB  . ARG A 1 70  ? -10.374 26.759 8.128  1.00 16.36 ? 70  ARG A CB  1 
ATOM   581  C CG  . ARG A 1 70  ? -11.657 27.052 7.349  1.00 22.24 ? 70  ARG A CG  1 
ATOM   582  C CD  . ARG A 1 70  ? -12.912 26.687 8.124  1.00 22.22 ? 70  ARG A CD  1 
ATOM   583  N NE  . ARG A 1 70  ? -12.984 25.266 8.444  1.00 28.92 ? 70  ARG A NE  1 
ATOM   584  C CZ  . ARG A 1 70  ? -13.229 24.781 9.659  1.00 33.98 ? 70  ARG A CZ  1 
ATOM   585  N NH1 . ARG A 1 70  ? -13.426 25.603 10.685 1.00 35.62 ? 70  ARG A NH1 1 
ATOM   586  N NH2 . ARG A 1 70  ? -13.297 23.468 9.846  1.00 35.12 ? 70  ARG A NH2 1 
ATOM   587  N N   . VAL A 1 71  ? -9.929  30.053 7.490  1.00 16.89 ? 71  VAL A N   1 
ATOM   588  C CA  . VAL A 1 71  ? -10.343 31.377 7.924  1.00 16.30 ? 71  VAL A CA  1 
ATOM   589  C C   . VAL A 1 71  ? -11.832 31.254 8.194  1.00 14.47 ? 71  VAL A C   1 
ATOM   590  O O   . VAL A 1 71  ? -12.594 30.891 7.310  1.00 14.56 ? 71  VAL A O   1 
ATOM   591  C CB  . VAL A 1 71  ? -10.135 32.433 6.830  1.00 17.40 ? 71  VAL A CB  1 
ATOM   592  C CG1 . VAL A 1 71  ? -10.674 33.777 7.304  1.00 14.87 ? 71  VAL A CG1 1 
ATOM   593  C CG2 . VAL A 1 71  ? -8.663  32.535 6.469  1.00 16.47 ? 71  VAL A CG2 1 
ATOM   594  N N   . ASP A 1 72  ? -12.236 31.518 9.426  1.00 12.47 ? 72  ASP A N   1 
ATOM   595  C CA  . ASP A 1 72  ? -13.638 31.418 9.790  1.00 14.99 ? 72  ASP A CA  1 
ATOM   596  C C   . ASP A 1 72  ? -14.369 32.745 9.675  1.00 19.38 ? 72  ASP A C   1 
ATOM   597  O O   . ASP A 1 72  ? -15.524 32.793 9.237  1.00 19.53 ? 72  ASP A O   1 
ATOM   598  C CB  . ASP A 1 72  ? -13.768 30.871 11.212 1.00 15.49 ? 72  ASP A CB  1 
ATOM   599  C CG  . ASP A 1 72  ? -13.126 29.508 11.372 1.00 15.61 ? 72  ASP A CG  1 
ATOM   600  O OD1 . ASP A 1 72  ? -13.368 28.628 10.517 1.00 19.44 ? 72  ASP A OD1 1 
ATOM   601  O OD2 . ASP A 1 72  ? -12.373 29.318 12.342 1.00 13.52 ? 72  ASP A OD2 1 
ATOM   602  N N   . GLU A 1 73  ? -13.691 33.823 10.053 1.00 18.49 ? 73  GLU A N   1 
ATOM   603  C CA  . GLU A 1 73  ? -14.304 35.139 10.004 1.00 22.09 ? 73  GLU A CA  1 
ATOM   604  C C   . GLU A 1 73  ? -13.290 36.273 9.943  1.00 19.67 ? 73  GLU A C   1 
ATOM   605  O O   . GLU A 1 73  ? -12.236 36.209 10.573 1.00 17.74 ? 73  GLU A O   1 
ATOM   606  C CB  . GLU A 1 73  ? -15.199 35.325 11.227 1.00 24.31 ? 73  GLU A CB  1 
ATOM   607  C CG  . GLU A 1 73  ? -15.982 36.624 11.252 1.00 33.76 ? 73  GLU A CG  1 
ATOM   608  C CD  . GLU A 1 73  ? -16.606 36.903 12.606 1.00 39.49 ? 73  GLU A CD  1 
ATOM   609  O OE1 . GLU A 1 73  ? -16.535 36.028 13.501 1.00 42.90 ? 73  GLU A OE1 1 
ATOM   610  O OE2 . GLU A 1 73  ? -17.163 38.007 12.781 1.00 45.65 ? 73  GLU A OE2 1 
ATOM   611  N N   . VAL A 1 74  ? -13.607 37.288 9.143  1.00 21.79 ? 74  VAL A N   1 
ATOM   612  C CA  . VAL A 1 74  ? -12.769 38.479 8.998  1.00 24.21 ? 74  VAL A CA  1 
ATOM   613  C C   . VAL A 1 74  ? -13.667 39.707 9.156  1.00 24.39 ? 74  VAL A C   1 
ATOM   614  O O   . VAL A 1 74  ? -14.411 40.074 8.244  1.00 25.89 ? 74  VAL A O   1 
ATOM   615  C CB  . VAL A 1 74  ? -12.067 38.550 7.624  1.00 28.34 ? 74  VAL A CB  1 
ATOM   616  C CG1 . VAL A 1 74  ? -11.154 39.774 7.578  1.00 27.61 ? 74  VAL A CG1 1 
ATOM   617  C CG2 . VAL A 1 74  ? -11.265 37.274 7.362  1.00 28.65 ? 74  VAL A CG2 1 
ATOM   618  N N   . ASP A 1 75  ? -13.600 40.322 10.329 1.00 23.41 ? 75  ASP A N   1 
ATOM   619  C CA  . ASP A 1 75  ? -14.401 41.492 10.649 1.00 22.37 ? 75  ASP A CA  1 
ATOM   620  C C   . ASP A 1 75  ? -13.542 42.762 10.588 1.00 23.34 ? 75  ASP A C   1 
ATOM   621  O O   . ASP A 1 75  ? -12.906 43.135 11.575 1.00 22.46 ? 75  ASP A O   1 
ATOM   622  C CB  . ASP A 1 75  ? -14.990 41.311 12.052 1.00 23.10 ? 75  ASP A CB  1 
ATOM   623  C CG  . ASP A 1 75  ? -16.104 42.290 12.360 1.00 27.33 ? 75  ASP A CG  1 
ATOM   624  O OD1 . ASP A 1 75  ? -16.259 43.303 11.643 1.00 28.28 ? 75  ASP A OD1 1 
ATOM   625  O OD2 . ASP A 1 75  ? -16.837 42.037 13.334 1.00 28.55 ? 75  ASP A OD2 1 
ATOM   626  N N   . HIS A 1 76  ? -13.548 43.424 9.431  1.00 23.94 ? 76  HIS A N   1 
ATOM   627  C CA  . HIS A 1 76  ? -12.775 44.656 9.203  1.00 28.52 ? 76  HIS A CA  1 
ATOM   628  C C   . HIS A 1 76  ? -13.264 45.771 10.112 1.00 28.25 ? 76  HIS A C   1 
ATOM   629  O O   . HIS A 1 76  ? -12.486 46.590 10.602 1.00 31.18 ? 76  HIS A O   1 
ATOM   630  C CB  . HIS A 1 76  ? -12.930 45.139 7.757  1.00 29.71 ? 76  HIS A CB  1 
ATOM   631  C CG  . HIS A 1 76  ? -12.886 44.043 6.742  1.00 37.64 ? 76  HIS A CG  1 
ATOM   632  N ND1 . HIS A 1 76  ? -11.720 43.646 6.126  1.00 41.89 ? 76  HIS A ND1 1 
ATOM   633  C CD2 . HIS A 1 76  ? -13.868 43.264 6.229  1.00 39.46 ? 76  HIS A CD2 1 
ATOM   634  C CE1 . HIS A 1 76  ? -11.983 42.672 5.274  1.00 43.55 ? 76  HIS A CE1 1 
ATOM   635  N NE2 . HIS A 1 76  ? -13.279 42.421 5.317  1.00 44.82 ? 76  HIS A NE2 1 
ATOM   636  N N   . THR A 1 77  ? -14.575 45.805 10.297 1.00 26.21 ? 77  THR A N   1 
ATOM   637  C CA  . THR A 1 77  ? -15.222 46.804 11.119 1.00 27.81 ? 77  THR A CA  1 
ATOM   638  C C   . THR A 1 77  ? -14.759 46.770 12.575 1.00 27.43 ? 77  THR A C   1 
ATOM   639  O O   . THR A 1 77  ? -14.459 47.813 13.155 1.00 30.33 ? 77  THR A O   1 
ATOM   640  C CB  . THR A 1 77  ? -16.748 46.626 11.053 1.00 28.05 ? 77  THR A CB  1 
ATOM   641  O OG1 . THR A 1 77  ? -17.145 46.532 9.683  1.00 29.78 ? 77  THR A OG1 1 
ATOM   642  C CG2 . THR A 1 77  ? -17.456 47.804 11.684 1.00 28.33 ? 77  THR A CG2 1 
ATOM   643  N N   . ASN A 1 78  ? -14.656 45.574 13.148 1.00 26.38 ? 78  ASN A N   1 
ATOM   644  C CA  . ASN A 1 78  ? -14.250 45.435 14.544 1.00 24.70 ? 78  ASN A CA  1 
ATOM   645  C C   . ASN A 1 78  ? -12.829 44.909 14.775 1.00 21.79 ? 78  ASN A C   1 
ATOM   646  O O   . ASN A 1 78  ? -12.445 44.619 15.914 1.00 24.01 ? 78  ASN A O   1 
ATOM   647  C CB  . ASN A 1 78  ? -15.267 44.563 15.288 1.00 28.36 ? 78  ASN A CB  1 
ATOM   648  C CG  . ASN A 1 78  ? -16.675 45.125 15.219 1.00 32.59 ? 78  ASN A CG  1 
ATOM   649  O OD1 . ASN A 1 78  ? -17.133 45.800 16.140 1.00 39.31 ? 78  ASN A OD1 1 
ATOM   650  N ND2 . ASN A 1 78  ? -17.359 44.873 14.110 1.00 37.83 ? 78  ASN A ND2 1 
ATOM   651  N N   . PHE A 1 79  ? -12.039 44.831 13.708 1.00 18.15 ? 79  PHE A N   1 
ATOM   652  C CA  . PHE A 1 79  ? -10.666 44.332 13.793 1.00 19.00 ? 79  PHE A CA  1 
ATOM   653  C C   . PHE A 1 79  ? -10.603 42.970 14.501 1.00 17.92 ? 79  PHE A C   1 
ATOM   654  O O   . PHE A 1 79  ? -9.801  42.770 15.413 1.00 18.12 ? 79  PHE A O   1 
ATOM   655  C CB  . PHE A 1 79  ? -9.760  45.338 14.516 1.00 19.34 ? 79  PHE A CB  1 
ATOM   656  C CG  . PHE A 1 79  ? -9.643  46.670 13.822 1.00 20.44 ? 79  PHE A CG  1 
ATOM   657  C CD1 . PHE A 1 79  ? -9.684  46.759 12.434 1.00 20.42 ? 79  PHE A CD1 1 
ATOM   658  C CD2 . PHE A 1 79  ? -9.481  47.838 14.562 1.00 20.15 ? 79  PHE A CD2 1 
ATOM   659  C CE1 . PHE A 1 79  ? -9.568  47.991 11.793 1.00 20.89 ? 79  PHE A CE1 1 
ATOM   660  C CE2 . PHE A 1 79  ? -9.364  49.072 13.929 1.00 17.60 ? 79  PHE A CE2 1 
ATOM   661  C CZ  . PHE A 1 79  ? -9.407  49.147 12.543 1.00 16.42 ? 79  PHE A CZ  1 
ATOM   662  N N   . LYS A 1 80  ? -11.471 42.049 14.088 1.00 18.31 ? 80  LYS A N   1 
ATOM   663  C CA  . LYS A 1 80  ? -11.525 40.708 14.669 1.00 15.42 ? 80  LYS A CA  1 
ATOM   664  C C   . LYS A 1 80  ? -11.207 39.687 13.576 1.00 19.69 ? 80  LYS A C   1 
ATOM   665  O O   . LYS A 1 80  ? -11.632 39.839 12.429 1.00 19.04 ? 80  LYS A O   1 
ATOM   666  C CB  . LYS A 1 80  ? -12.909 40.450 15.260 1.00 13.11 ? 80  LYS A CB  1 
ATOM   667  C CG  . LYS A 1 80  ? -12.994 39.216 16.136 1.00 26.51 ? 80  LYS A CG  1 
ATOM   668  C CD  . LYS A 1 80  ? -14.245 39.247 17.007 1.00 36.90 ? 80  LYS A CD  1 
ATOM   669  C CE  . LYS A 1 80  ? -15.520 39.085 16.184 1.00 45.55 ? 80  LYS A CE  1 
ATOM   670  N NZ  . LYS A 1 80  ? -15.659 37.701 15.633 1.00 47.32 ? 80  LYS A NZ  1 
ATOM   671  N N   . TYR A 1 81  ? -10.455 38.651 13.934 1.00 17.68 ? 81  TYR A N   1 
ATOM   672  C CA  . TYR A 1 81  ? -10.054 37.619 12.978 1.00 16.85 ? 81  TYR A CA  1 
ATOM   673  C C   . TYR A 1 81  ? -10.149 36.245 13.624 1.00 17.14 ? 81  TYR A C   1 
ATOM   674  O O   . TYR A 1 81  ? -9.511  35.994 14.642 1.00 16.11 ? 81  TYR A O   1 
ATOM   675  C CB  . TYR A 1 81  ? -8.610  37.869 12.523 1.00 15.16 ? 81  TYR A CB  1 
ATOM   676  C CG  . TYR A 1 81  ? -8.083  36.892 11.491 1.00 18.41 ? 81  TYR A CG  1 
ATOM   677  C CD1 . TYR A 1 81  ? -8.588  36.877 10.190 1.00 15.38 ? 81  TYR A CD1 1 
ATOM   678  C CD2 . TYR A 1 81  ? -7.060  36.000 11.808 1.00 19.11 ? 81  TYR A CD2 1 
ATOM   679  C CE1 . TYR A 1 81  ? -8.084  36.000 9.233  1.00 19.42 ? 81  TYR A CE1 1 
ATOM   680  C CE2 . TYR A 1 81  ? -6.551  35.117 10.858 1.00 16.79 ? 81  TYR A CE2 1 
ATOM   681  C CZ  . TYR A 1 81  ? -7.066  35.123 9.580  1.00 17.93 ? 81  TYR A CZ  1 
ATOM   682  O OH  . TYR A 1 81  ? -6.560  34.258 8.642  1.00 25.94 ? 81  TYR A OH  1 
ATOM   683  N N   . ASN A 1 82  ? -10.941 35.362 13.023 1.00 16.84 ? 82  ASN A N   1 
ATOM   684  C CA  . ASN A 1 82  ? -11.113 34.007 13.536 1.00 18.56 ? 82  ASN A CA  1 
ATOM   685  C C   . ASN A 1 82  ? -10.650 32.962 12.526 1.00 13.82 ? 82  ASN A C   1 
ATOM   686  O O   . ASN A 1 82  ? -11.061 33.002 11.370 1.00 13.40 ? 82  ASN A O   1 
ATOM   687  C CB  . ASN A 1 82  ? -12.580 33.762 13.897 1.00 20.47 ? 82  ASN A CB  1 
ATOM   688  C CG  . ASN A 1 82  ? -13.035 34.591 15.083 1.00 28.33 ? 82  ASN A CG  1 
ATOM   689  O OD1 . ASN A 1 82  ? -13.039 34.116 16.219 1.00 32.36 ? 82  ASN A OD1 1 
ATOM   690  N ND2 . ASN A 1 82  ? -13.416 35.838 14.828 1.00 28.17 ? 82  ASN A ND2 1 
ATOM   691  N N   . TYR A 1 83  ? -9.794  32.042 12.969 1.00 9.25  ? 83  TYR A N   1 
ATOM   692  C CA  . TYR A 1 83  ? -9.292  30.974 12.112 1.00 9.79  ? 83  TYR A CA  1 
ATOM   693  C C   . TYR A 1 83  ? -9.065  29.712 12.944 1.00 12.49 ? 83  TYR A C   1 
ATOM   694  O O   . TYR A 1 83  ? -8.882  29.790 14.161 1.00 11.81 ? 83  TYR A O   1 
ATOM   695  C CB  . TYR A 1 83  ? -7.990  31.383 11.407 1.00 12.17 ? 83  TYR A CB  1 
ATOM   696  C CG  . TYR A 1 83  ? -6.787  31.435 12.319 1.00 12.90 ? 83  TYR A CG  1 
ATOM   697  C CD1 . TYR A 1 83  ? -6.598  32.501 13.194 1.00 16.51 ? 83  TYR A CD1 1 
ATOM   698  C CD2 . TYR A 1 83  ? -5.852  30.407 12.326 1.00 14.89 ? 83  TYR A CD2 1 
ATOM   699  C CE1 . TYR A 1 83  ? -5.511  32.536 14.058 1.00 15.67 ? 83  TYR A CE1 1 
ATOM   700  C CE2 . TYR A 1 83  ? -4.764  30.433 13.188 1.00 14.77 ? 83  TYR A CE2 1 
ATOM   701  C CZ  . TYR A 1 83  ? -4.600  31.497 14.052 1.00 14.60 ? 83  TYR A CZ  1 
ATOM   702  O OH  . TYR A 1 83  ? -3.556  31.509 14.945 1.00 17.57 ? 83  TYR A OH  1 
ATOM   703  N N   . SER A 1 84  ? -9.071  28.558 12.282 1.00 10.88 ? 84  SER A N   1 
ATOM   704  C CA  . SER A 1 84  ? -8.884  27.274 12.948 1.00 11.38 ? 84  SER A CA  1 
ATOM   705  C C   . SER A 1 84  ? -7.755  26.462 12.344 1.00 10.38 ? 84  SER A C   1 
ATOM   706  O O   . SER A 1 84  ? -7.571  26.446 11.132 1.00 12.28 ? 84  SER A O   1 
ATOM   707  C CB  . SER A 1 84  ? -10.155 26.426 12.845 1.00 10.69 ? 84  SER A CB  1 
ATOM   708  O OG  . SER A 1 84  ? -11.274 27.091 13.385 1.00 19.49 ? 84  SER A OG  1 
ATOM   709  N N   . VAL A 1 85  ? -6.998  25.797 13.205 1.00 12.09 ? 85  VAL A N   1 
ATOM   710  C CA  . VAL A 1 85  ? -5.923  24.912 12.786 1.00 10.61 ? 85  VAL A CA  1 
ATOM   711  C C   . VAL A 1 85  ? -6.662  23.579 12.689 1.00 12.03 ? 85  VAL A C   1 
ATOM   712  O O   . VAL A 1 85  ? -7.172  23.069 13.685 1.00 12.59 ? 85  VAL A O   1 
ATOM   713  C CB  . VAL A 1 85  ? -4.827  24.840 13.854 1.00 13.20 ? 85  VAL A CB  1 
ATOM   714  C CG1 . VAL A 1 85  ? -3.749  23.849 13.442 1.00 13.27 ? 85  VAL A CG1 1 
ATOM   715  C CG2 . VAL A 1 85  ? -4.235  26.231 14.086 1.00 10.38 ? 85  VAL A CG2 1 
ATOM   716  N N   . ILE A 1 86  ? -6.759  23.039 11.483 1.00 12.98 ? 86  ILE A N   1 
ATOM   717  C CA  . ILE A 1 86  ? -7.501  21.805 11.266 1.00 14.77 ? 86  ILE A CA  1 
ATOM   718  C C   . ILE A 1 86  ? -6.730  20.560 10.831 1.00 13.33 ? 86  ILE A C   1 
ATOM   719  O O   . ILE A 1 86  ? -7.292  19.466 10.817 1.00 16.99 ? 86  ILE A O   1 
ATOM   720  C CB  . ILE A 1 86  ? -8.629  22.057 10.252 1.00 15.44 ? 86  ILE A CB  1 
ATOM   721  C CG1 . ILE A 1 86  ? -8.034  22.431 8.890  1.00 11.52 ? 86  ILE A CG1 1 
ATOM   722  C CG2 . ILE A 1 86  ? -9.524  23.191 10.752 1.00 15.78 ? 86  ILE A CG2 1 
ATOM   723  C CD1 . ILE A 1 86  ? -9.044  22.458 7.765  1.00 13.72 ? 86  ILE A CD1 1 
ATOM   724  N N   . GLU A 1 87  ? -5.461  20.709 10.474 1.00 12.31 ? 87  GLU A N   1 
ATOM   725  C CA  . GLU A 1 87  ? -4.683  19.556 10.035 1.00 11.29 ? 87  GLU A CA  1 
ATOM   726  C C   . GLU A 1 87  ? -3.184  19.804 10.143 1.00 13.87 ? 87  GLU A C   1 
ATOM   727  O O   . GLU A 1 87  ? -2.721  20.935 10.024 1.00 15.37 ? 87  GLU A O   1 
ATOM   728  C CB  . GLU A 1 87  ? -5.032  19.223 8.586  1.00 10.65 ? 87  GLU A CB  1 
ATOM   729  C CG  . GLU A 1 87  ? -4.412  17.938 8.053  1.00 8.96  ? 87  GLU A CG  1 
ATOM   730  C CD  . GLU A 1 87  ? -4.543  17.829 6.549  1.00 12.66 ? 87  GLU A CD  1 
ATOM   731  O OE1 . GLU A 1 87  ? -5.683  17.758 6.035  1.00 10.88 ? 87  GLU A OE1 1 
ATOM   732  O OE2 . GLU A 1 87  ? -3.501  17.837 5.872  1.00 12.38 ? 87  GLU A OE2 1 
ATOM   733  N N   . GLY A 1 88  ? -2.429  18.730 10.345 1.00 14.60 ? 88  GLY A N   1 
ATOM   734  C CA  . GLY A 1 88  ? -0.989  18.842 10.457 1.00 12.53 ? 88  GLY A CA  1 
ATOM   735  C C   . GLY A 1 88  ? -0.591  19.455 11.777 1.00 15.61 ? 88  GLY A C   1 
ATOM   736  O O   . GLY A 1 88  ? -1.451  19.847 12.561 1.00 15.08 ? 88  GLY A O   1 
ATOM   737  N N   . GLY A 1 89  ? 0.712   19.534 12.028 1.00 18.62 ? 89  GLY A N   1 
ATOM   738  C CA  . GLY A 1 89  ? 1.185   20.111 13.275 1.00 19.55 ? 89  GLY A CA  1 
ATOM   739  C C   . GLY A 1 89  ? 0.759   19.320 14.501 1.00 18.77 ? 89  GLY A C   1 
ATOM   740  O O   . GLY A 1 89  ? 0.970   18.108 14.559 1.00 21.31 ? 89  GLY A O   1 
ATOM   741  N N   . PRO A 1 90  ? 0.146   19.979 15.499 1.00 19.55 ? 90  PRO A N   1 
ATOM   742  C CA  . PRO A 1 90  ? -0.309  19.326 16.729 1.00 15.42 ? 90  PRO A CA  1 
ATOM   743  C C   . PRO A 1 90  ? -1.647  18.610 16.564 1.00 19.45 ? 90  PRO A C   1 
ATOM   744  O O   . PRO A 1 90  ? -2.139  17.986 17.505 1.00 19.46 ? 90  PRO A O   1 
ATOM   745  C CB  . PRO A 1 90  ? -0.434  20.492 17.695 1.00 14.03 ? 90  PRO A CB  1 
ATOM   746  C CG  . PRO A 1 90  ? -0.930  21.585 16.809 1.00 17.65 ? 90  PRO A CG  1 
ATOM   747  C CD  . PRO A 1 90  ? -0.112  21.430 15.548 1.00 19.29 ? 90  PRO A CD  1 
ATOM   748  N N   . ILE A 1 91  ? -2.248  18.728 15.381 1.00 16.85 ? 91  ILE A N   1 
ATOM   749  C CA  . ILE A 1 91  ? -3.528  18.089 15.109 1.00 18.09 ? 91  ILE A CA  1 
ATOM   750  C C   . ILE A 1 91  ? -3.349  16.600 14.878 1.00 21.68 ? 91  ILE A C   1 
ATOM   751  O O   . ILE A 1 91  ? -2.659  16.173 13.946 1.00 23.45 ? 91  ILE A O   1 
ATOM   752  C CB  . ILE A 1 91  ? -4.252  18.720 13.888 1.00 14.12 ? 91  ILE A CB  1 
ATOM   753  C CG1 . ILE A 1 91  ? -4.554  20.201 14.152 1.00 14.34 ? 91  ILE A CG1 1 
ATOM   754  C CG2 . ILE A 1 91  ? -5.543  17.960 13.582 1.00 13.29 ? 91  ILE A CG2 1 
ATOM   755  C CD1 . ILE A 1 91  ? -5.294  20.470 15.458 1.00 9.75  ? 91  ILE A CD1 1 
ATOM   756  N N   . GLY A 1 92  ? -3.986  15.815 15.737 1.00 19.10 ? 92  GLY A N   1 
ATOM   757  C CA  . GLY A 1 92  ? -3.897  14.378 15.628 1.00 27.40 ? 92  GLY A CA  1 
ATOM   758  C C   . GLY A 1 92  ? -3.937  13.756 17.003 1.00 30.84 ? 92  GLY A C   1 
ATOM   759  O O   . GLY A 1 92  ? -3.857  14.465 18.012 1.00 32.99 ? 92  GLY A O   1 
ATOM   760  N N   . ASP A 1 93  ? -4.090  12.435 17.043 1.00 31.19 ? 93  ASP A N   1 
ATOM   761  C CA  . ASP A 1 93  ? -4.134  11.699 18.298 1.00 31.79 ? 93  ASP A CA  1 
ATOM   762  C C   . ASP A 1 93  ? -5.328  12.115 19.171 1.00 28.10 ? 93  ASP A C   1 
ATOM   763  O O   . ASP A 1 93  ? -6.449  11.637 18.969 1.00 25.87 ? 93  ASP A O   1 
ATOM   764  C CB  . ASP A 1 93  ? -2.800  11.888 19.046 1.00 38.45 ? 93  ASP A CB  1 
ATOM   765  C CG  . ASP A 1 93  ? -2.612  10.905 20.189 1.00 43.15 ? 93  ASP A CG  1 
ATOM   766  O OD1 . ASP A 1 93  ? -2.640  9.678  19.946 1.00 49.02 ? 93  ASP A OD1 1 
ATOM   767  O OD2 . ASP A 1 93  ? -2.406  11.366 21.331 1.00 47.03 ? 93  ASP A OD2 1 
ATOM   768  N N   . THR A 1 94  ? -5.094  13.037 20.103 1.00 23.43 ? 94  THR A N   1 
ATOM   769  C CA  . THR A 1 94  ? -6.140  13.489 21.018 1.00 20.54 ? 94  THR A CA  1 
ATOM   770  C C   . THR A 1 94  ? -6.630  14.915 20.811 1.00 14.95 ? 94  THR A C   1 
ATOM   771  O O   . THR A 1 94  ? -7.485  15.383 21.558 1.00 17.94 ? 94  THR A O   1 
ATOM   772  C CB  . THR A 1 94  ? -5.676  13.358 22.482 1.00 22.05 ? 94  THR A CB  1 
ATOM   773  O OG1 . THR A 1 94  ? -4.423  14.034 22.649 1.00 23.41 ? 94  THR A OG1 1 
ATOM   774  C CG2 . THR A 1 94  ? -5.509  11.899 22.856 1.00 23.85 ? 94  THR A CG2 1 
ATOM   775  N N   . LEU A 1 95  ? -6.080  15.605 19.818 1.00 11.08 ? 95  LEU A N   1 
ATOM   776  C CA  . LEU A 1 95  ? -6.463  16.987 19.532 1.00 13.17 ? 95  LEU A CA  1 
ATOM   777  C C   . LEU A 1 95  ? -7.120  17.043 18.153 1.00 14.04 ? 95  LEU A C   1 
ATOM   778  O O   . LEU A 1 95  ? -6.481  16.751 17.139 1.00 17.89 ? 95  LEU A O   1 
ATOM   779  C CB  . LEU A 1 95  ? -5.221  17.886 19.537 1.00 12.26 ? 95  LEU A CB  1 
ATOM   780  C CG  . LEU A 1 95  ? -5.264  19.296 20.147 1.00 21.60 ? 95  LEU A CG  1 
ATOM   781  C CD1 . LEU A 1 95  ? -4.190  20.160 19.474 1.00 19.59 ? 95  LEU A CD1 1 
ATOM   782  C CD2 . LEU A 1 95  ? -6.623  19.950 19.986 1.00 19.51 ? 95  LEU A CD2 1 
ATOM   783  N N   . GLU A 1 96  ? -8.392  17.419 18.115 1.00 13.81 ? 96  GLU A N   1 
ATOM   784  C CA  . GLU A 1 96  ? -9.122  17.500 16.852 1.00 14.98 ? 96  GLU A CA  1 
ATOM   785  C C   . GLU A 1 96  ? -8.840  18.799 16.105 1.00 16.24 ? 96  GLU A C   1 
ATOM   786  O O   . GLU A 1 96  ? -8.603  18.778 14.904 1.00 16.51 ? 96  GLU A O   1 
ATOM   787  C CB  . GLU A 1 96  ? -10.623 17.344 17.087 1.00 18.31 ? 96  GLU A CB  1 
ATOM   788  C CG  . GLU A 1 96  ? -11.447 17.218 15.814 1.00 19.69 ? 96  GLU A CG  1 
ATOM   789  C CD  . GLU A 1 96  ? -12.508 18.295 15.678 1.00 18.75 ? 96  GLU A CD  1 
ATOM   790  O OE1 . GLU A 1 96  ? -12.834 18.974 16.672 1.00 19.84 ? 96  GLU A OE1 1 
ATOM   791  O OE2 . GLU A 1 96  ? -13.024 18.458 14.561 1.00 23.87 ? 96  GLU A OE2 1 
ATOM   792  N N   . LYS A 1 97  ? -8.901  19.928 16.807 1.00 16.30 ? 97  LYS A N   1 
ATOM   793  C CA  . LYS A 1 97  ? -8.626  21.212 16.175 1.00 18.98 ? 97  LYS A CA  1 
ATOM   794  C C   . LYS A 1 97  ? -8.411  22.335 17.172 1.00 18.92 ? 97  LYS A C   1 
ATOM   795  O O   . LYS A 1 97  ? -8.643  22.169 18.371 1.00 18.39 ? 97  LYS A O   1 
ATOM   796  C CB  . LYS A 1 97  ? -9.735  21.601 15.192 1.00 21.41 ? 97  LYS A CB  1 
ATOM   797  C CG  . LYS A 1 97  ? -10.980 22.205 15.803 1.00 25.63 ? 97  LYS A CG  1 
ATOM   798  C CD  . LYS A 1 97  ? -11.814 22.858 14.706 1.00 34.89 ? 97  LYS A CD  1 
ATOM   799  C CE  . LYS A 1 97  ? -12.956 23.702 15.257 1.00 41.08 ? 97  LYS A CE  1 
ATOM   800  N NZ  . LYS A 1 97  ? -13.979 22.881 15.958 1.00 42.92 ? 97  LYS A NZ  1 
ATOM   801  N N   . ILE A 1 98  ? -7.934  23.467 16.659 1.00 18.01 ? 98  ILE A N   1 
ATOM   802  C CA  . ILE A 1 98  ? -7.682  24.654 17.467 1.00 17.47 ? 98  ILE A CA  1 
ATOM   803  C C   . ILE A 1 98  ? -8.398  25.840 16.826 1.00 17.77 ? 98  ILE A C   1 
ATOM   804  O O   . ILE A 1 98  ? -8.187  26.134 15.652 1.00 14.91 ? 98  ILE A O   1 
ATOM   805  C CB  . ILE A 1 98  ? -6.174  24.983 17.537 1.00 18.81 ? 98  ILE A CB  1 
ATOM   806  C CG1 . ILE A 1 98  ? -5.380  23.746 17.959 1.00 18.13 ? 98  ILE A CG1 1 
ATOM   807  C CG2 . ILE A 1 98  ? -5.930  26.121 18.537 1.00 20.73 ? 98  ILE A CG2 1 
ATOM   808  C CD1 . ILE A 1 98  ? -3.899  23.866 17.728 1.00 20.71 ? 98  ILE A CD1 1 
ATOM   809  N N   . SER A 1 99  ? -9.293  26.468 17.581 1.00 17.62 ? 99  SER A N   1 
ATOM   810  C CA  . SER A 1 99  ? -10.034 27.631 17.104 1.00 17.73 ? 99  SER A CA  1 
ATOM   811  C C   . SER A 1 99  ? -9.401  28.846 17.755 1.00 17.67 ? 99  SER A C   1 
ATOM   812  O O   . SER A 1 99  ? -9.273  28.908 18.978 1.00 13.67 ? 99  SER A O   1 
ATOM   813  C CB  . SER A 1 99  ? -11.507 27.539 17.500 1.00 16.86 ? 99  SER A CB  1 
ATOM   814  O OG  . SER A 1 99  ? -12.146 26.453 16.855 1.00 27.46 ? 99  SER A OG  1 
ATOM   815  N N   . ASN A 1 100 ? -8.993  29.806 16.936 1.00 18.47 ? 100 ASN A N   1 
ATOM   816  C CA  . ASN A 1 100 ? -8.347  31.006 17.447 1.00 18.35 ? 100 ASN A CA  1 
ATOM   817  C C   . ASN A 1 100 ? -9.106  32.271 17.095 1.00 17.09 ? 100 ASN A C   1 
ATOM   818  O O   . ASN A 1 100 ? -9.746  32.350 16.052 1.00 17.29 ? 100 ASN A O   1 
ATOM   819  C CB  . ASN A 1 100 ? -6.923  31.102 16.898 1.00 18.22 ? 100 ASN A CB  1 
ATOM   820  C CG  . ASN A 1 100 ? -6.148  29.808 17.054 1.00 22.51 ? 100 ASN A CG  1 
ATOM   821  O OD1 . ASN A 1 100 ? -5.745  29.190 16.072 1.00 28.12 ? 100 ASN A OD1 1 
ATOM   822  N ND2 . ASN A 1 100 ? -5.941  29.391 18.289 1.00 23.17 ? 100 ASN A ND2 1 
ATOM   823  N N   . GLU A 1 101 ? -9.067  33.241 18.003 1.00 21.94 ? 101 GLU A N   1 
ATOM   824  C CA  . GLU A 1 101 ? -9.702  34.535 17.787 1.00 23.68 ? 101 GLU A CA  1 
ATOM   825  C C   . GLU A 1 101 ? -8.729  35.620 18.210 1.00 22.85 ? 101 GLU A C   1 
ATOM   826  O O   . GLU A 1 101 ? -8.205  35.596 19.324 1.00 22.39 ? 101 GLU A O   1 
ATOM   827  C CB  . GLU A 1 101 ? -10.998 34.700 18.584 1.00 26.15 ? 101 GLU A CB  1 
ATOM   828  C CG  . GLU A 1 101 ? -11.574 36.113 18.448 1.00 32.27 ? 101 GLU A CG  1 
ATOM   829  C CD  . GLU A 1 101 ? -12.869 36.320 19.203 1.00 33.43 ? 101 GLU A CD  1 
ATOM   830  O OE1 . GLU A 1 101 ? -12.808 36.616 20.412 1.00 37.16 ? 101 GLU A OE1 1 
ATOM   831  O OE2 . GLU A 1 101 ? -13.947 36.216 18.581 1.00 33.21 ? 101 GLU A OE2 1 
ATOM   832  N N   . ILE A 1 102 ? -8.464  36.543 17.295 1.00 20.66 ? 102 ILE A N   1 
ATOM   833  C CA  . ILE A 1 102 ? -7.569  37.658 17.560 1.00 21.46 ? 102 ILE A CA  1 
ATOM   834  C C   . ILE A 1 102 ? -8.379  38.923 17.354 1.00 16.48 ? 102 ILE A C   1 
ATOM   835  O O   . ILE A 1 102 ? -9.048  39.079 16.340 1.00 22.16 ? 102 ILE A O   1 
ATOM   836  C CB  . ILE A 1 102 ? -6.363  37.665 16.598 1.00 19.04 ? 102 ILE A CB  1 
ATOM   837  C CG1 . ILE A 1 102 ? -5.580  36.355 16.724 1.00 19.12 ? 102 ILE A CG1 1 
ATOM   838  C CG2 . ILE A 1 102 ? -5.469  38.868 16.889 1.00 18.80 ? 102 ILE A CG2 1 
ATOM   839  C CD1 . ILE A 1 102 ? -4.290  36.320 15.910 1.00 23.47 ? 102 ILE A CD1 1 
ATOM   840  N N   . LYS A 1 103 ? -8.346  39.813 18.331 1.00 17.04 ? 103 LYS A N   1 
ATOM   841  C CA  . LYS A 1 103 ? -9.086  41.058 18.230 1.00 20.39 ? 103 LYS A CA  1 
ATOM   842  C C   . LYS A 1 103 ? -8.133  42.198 18.558 1.00 19.17 ? 103 LYS A C   1 
ATOM   843  O O   . LYS A 1 103 ? -7.470  42.183 19.595 1.00 19.06 ? 103 LYS A O   1 
ATOM   844  C CB  . LYS A 1 103 ? -10.264 41.023 19.198 1.00 23.89 ? 103 LYS A CB  1 
ATOM   845  C CG  . LYS A 1 103 ? -11.290 42.114 19.015 1.00 33.53 ? 103 LYS A CG  1 
ATOM   846  C CD  . LYS A 1 103 ? -12.607 41.700 19.672 1.00 43.15 ? 103 LYS A CD  1 
ATOM   847  C CE  . LYS A 1 103 ? -12.418 41.270 21.135 1.00 49.57 ? 103 LYS A CE  1 
ATOM   848  N NZ  . LYS A 1 103 ? -13.648 40.642 21.726 1.00 50.20 ? 103 LYS A NZ  1 
ATOM   849  N N   . ILE A 1 104 ? -8.020  43.152 17.642 1.00 17.66 ? 104 ILE A N   1 
ATOM   850  C CA  . ILE A 1 104 ? -7.131  44.287 17.834 1.00 17.40 ? 104 ILE A CA  1 
ATOM   851  C C   . ILE A 1 104 ? -7.888  45.483 18.402 1.00 18.55 ? 104 ILE A C   1 
ATOM   852  O O   . ILE A 1 104 ? -8.895  45.926 17.844 1.00 16.38 ? 104 ILE A O   1 
ATOM   853  C CB  . ILE A 1 104 ? -6.388  44.640 16.524 1.00 17.33 ? 104 ILE A CB  1 
ATOM   854  C CG1 . ILE A 1 104 ? -5.540  43.436 16.081 1.00 17.89 ? 104 ILE A CG1 1 
ATOM   855  C CG2 . ILE A 1 104 ? -5.476  45.844 16.739 1.00 21.63 ? 104 ILE A CG2 1 
ATOM   856  C CD1 . ILE A 1 104 ? -4.767  43.632 14.786 1.00 19.12 ? 104 ILE A CD1 1 
ATOM   857  N N   . VAL A 1 105 ? -7.423  45.962 19.552 1.00 17.84 ? 105 VAL A N   1 
ATOM   858  C CA  . VAL A 1 105 ? -8.052  47.090 20.226 1.00 19.56 ? 105 VAL A CA  1 
ATOM   859  C C   . VAL A 1 105 ? -7.086  48.264 20.312 1.00 19.77 ? 105 VAL A C   1 
ATOM   860  O O   . VAL A 1 105 ? -5.919  48.083 20.641 1.00 20.80 ? 105 VAL A O   1 
ATOM   861  C CB  . VAL A 1 105 ? -8.478  46.710 21.661 1.00 18.84 ? 105 VAL A CB  1 
ATOM   862  C CG1 . VAL A 1 105 ? -9.286  47.834 22.289 1.00 21.31 ? 105 VAL A CG1 1 
ATOM   863  C CG2 . VAL A 1 105 ? -9.278  45.418 21.652 1.00 21.15 ? 105 VAL A CG2 1 
ATOM   864  N N   . ALA A 1 106 ? -7.578  49.461 20.005 1.00 18.98 ? 106 ALA A N   1 
ATOM   865  C CA  . ALA A 1 106 ? -6.766  50.668 20.069 1.00 17.90 ? 106 ALA A CA  1 
ATOM   866  C C   . ALA A 1 106 ? -6.624  51.093 21.528 1.00 18.62 ? 106 ALA A C   1 
ATOM   867  O O   . ALA A 1 106 ? -7.558  50.938 22.317 1.00 20.50 ? 106 ALA A O   1 
ATOM   868  C CB  . ALA A 1 106 ? -7.423  51.781 19.258 1.00 20.20 ? 106 ALA A CB  1 
ATOM   869  N N   . THR A 1 107 ? -5.440  51.571 21.898 1.00 17.53 ? 107 THR A N   1 
ATOM   870  C CA  . THR A 1 107 ? -5.197  52.031 23.264 1.00 20.81 ? 107 THR A CA  1 
ATOM   871  C C   . THR A 1 107 ? -5.060  53.556 23.278 1.00 21.65 ? 107 THR A C   1 
ATOM   872  O O   . THR A 1 107 ? -4.707  54.163 22.263 1.00 18.64 ? 107 THR A O   1 
ATOM   873  C CB  . THR A 1 107 ? -3.941  51.380 23.889 1.00 20.92 ? 107 THR A CB  1 
ATOM   874  O OG1 . THR A 1 107 ? -2.820  51.554 23.018 1.00 24.84 ? 107 THR A OG1 1 
ATOM   875  C CG2 . THR A 1 107 ? -4.172  49.903 24.140 1.00 25.45 ? 107 THR A CG2 1 
ATOM   876  N N   . PRO A 1 108 ? -5.321  54.189 24.438 1.00 25.22 ? 108 PRO A N   1 
ATOM   877  C CA  . PRO A 1 108 ? -5.249  55.645 24.630 1.00 25.32 ? 108 PRO A CA  1 
ATOM   878  C C   . PRO A 1 108 ? -4.016  56.369 24.093 1.00 20.50 ? 108 PRO A C   1 
ATOM   879  O O   . PRO A 1 108 ? -4.126  57.496 23.630 1.00 25.66 ? 108 PRO A O   1 
ATOM   880  C CB  . PRO A 1 108 ? -5.375  55.795 26.150 1.00 29.46 ? 108 PRO A CB  1 
ATOM   881  C CG  . PRO A 1 108 ? -6.280  54.650 26.524 1.00 31.91 ? 108 PRO A CG  1 
ATOM   882  C CD  . PRO A 1 108 ? -5.710  53.514 25.695 1.00 27.86 ? 108 PRO A CD  1 
ATOM   883  N N   . ASP A 1 109 ? -2.853  55.727 24.146 1.00 19.80 ? 109 ASP A N   1 
ATOM   884  C CA  . ASP A 1 109 ? -1.614  56.342 23.667 1.00 19.37 ? 109 ASP A CA  1 
ATOM   885  C C   . ASP A 1 109 ? -1.426  56.274 22.145 1.00 21.45 ? 109 ASP A C   1 
ATOM   886  O O   . ASP A 1 109 ? -0.417  56.738 21.622 1.00 20.31 ? 109 ASP A O   1 
ATOM   887  C CB  . ASP A 1 109 ? -0.410  55.700 24.355 1.00 20.06 ? 109 ASP A CB  1 
ATOM   888  C CG  . ASP A 1 109 ? -0.162  54.268 23.892 1.00 27.18 ? 109 ASP A CG  1 
ATOM   889  O OD1 . ASP A 1 109 ? -1.146  53.535 23.674 1.00 26.43 ? 109 ASP A OD1 1 
ATOM   890  O OD2 . ASP A 1 109 ? 1.018   53.878 23.735 1.00 28.18 ? 109 ASP A OD2 1 
ATOM   891  N N   . GLY A 1 110 ? -2.388  55.686 21.439 1.00 24.07 ? 110 GLY A N   1 
ATOM   892  C CA  . GLY A 1 110 ? -2.276  55.563 19.996 1.00 22.48 ? 110 GLY A CA  1 
ATOM   893  C C   . GLY A 1 110 ? -1.751  54.214 19.525 1.00 19.67 ? 110 GLY A C   1 
ATOM   894  O O   . GLY A 1 110 ? -1.614  53.983 18.324 1.00 21.68 ? 110 GLY A O   1 
ATOM   895  N N   . GLY A 1 111 ? -1.444  53.328 20.468 1.00 19.14 ? 111 GLY A N   1 
ATOM   896  C CA  . GLY A 1 111 ? -0.948  52.009 20.117 1.00 15.82 ? 111 GLY A CA  1 
ATOM   897  C C   . GLY A 1 111 ? -2.077  51.002 19.991 1.00 16.36 ? 111 GLY A C   1 
ATOM   898  O O   . GLY A 1 111 ? -3.210  51.371 19.687 1.00 17.01 ? 111 GLY A O   1 
ATOM   899  N N   . SER A 1 112 ? -1.775  49.739 20.275 1.00 14.70 ? 112 SER A N   1 
ATOM   900  C CA  . SER A 1 112 ? -2.753  48.659 20.191 1.00 18.29 ? 112 SER A CA  1 
ATOM   901  C C   . SER A 1 112 ? -2.422  47.507 21.127 1.00 18.75 ? 112 SER A C   1 
ATOM   902  O O   . SER A 1 112 ? -1.315  47.407 21.649 1.00 20.49 ? 112 SER A O   1 
ATOM   903  C CB  . SER A 1 112 ? -2.795  48.085 18.771 1.00 16.36 ? 112 SER A CB  1 
ATOM   904  O OG  . SER A 1 112 ? -3.529  48.912 17.903 1.00 28.00 ? 112 SER A OG  1 
ATOM   905  N N   . ILE A 1 113 ? -3.411  46.648 21.336 1.00 21.92 ? 113 ILE A N   1 
ATOM   906  C CA  . ILE A 1 113 ? -3.254  45.446 22.138 1.00 21.21 ? 113 ILE A CA  1 
ATOM   907  C C   . ILE A 1 113 ? -4.032  44.386 21.391 1.00 22.74 ? 113 ILE A C   1 
ATOM   908  O O   . ILE A 1 113 ? -5.094  44.657 20.828 1.00 23.74 ? 113 ILE A O   1 
ATOM   909  C CB  . ILE A 1 113 ? -3.819  45.566 23.574 1.00 23.75 ? 113 ILE A CB  1 
ATOM   910  C CG1 . ILE A 1 113 ? -5.267  46.034 23.551 1.00 25.85 ? 113 ILE A CG1 1 
ATOM   911  C CG2 . ILE A 1 113 ? -2.941  46.471 24.426 1.00 23.04 ? 113 ILE A CG2 1 
ATOM   912  C CD1 . ILE A 1 113 ? -5.906  46.023 24.909 1.00 36.90 ? 113 ILE A CD1 1 
ATOM   913  N N   . LEU A 1 114 ? -3.458  43.195 21.319 1.00 24.56 ? 114 LEU A N   1 
ATOM   914  C CA  . LEU A 1 114 ? -4.098  42.088 20.637 1.00 20.77 ? 114 LEU A CA  1 
ATOM   915  C C   . LEU A 1 114 ? -4.614  41.113 21.670 1.00 22.02 ? 114 LEU A C   1 
ATOM   916  O O   . LEU A 1 114 ? -3.845  40.594 22.476 1.00 23.94 ? 114 LEU A O   1 
ATOM   917  C CB  . LEU A 1 114 ? -3.112  41.379 19.713 1.00 19.08 ? 114 LEU A CB  1 
ATOM   918  C CG  . LEU A 1 114 ? -2.600  42.135 18.486 1.00 21.11 ? 114 LEU A CG  1 
ATOM   919  C CD1 . LEU A 1 114 ? -1.672  43.276 18.896 1.00 23.07 ? 114 LEU A CD1 1 
ATOM   920  C CD2 . LEU A 1 114 ? -1.860  41.160 17.597 1.00 26.16 ? 114 LEU A CD2 1 
ATOM   921  N N   . LYS A 1 115 ? -5.929  40.932 21.692 1.00 24.03 ? 115 LYS A N   1 
ATOM   922  C CA  . LYS A 1 115 ? -6.565  39.998 22.607 1.00 22.39 ? 115 LYS A CA  1 
ATOM   923  C C   . LYS A 1 115 ? -6.669  38.686 21.842 1.00 22.70 ? 115 LYS A C   1 
ATOM   924  O O   . LYS A 1 115 ? -7.441  38.579 20.886 1.00 23.56 ? 115 LYS A O   1 
ATOM   925  C CB  . LYS A 1 115 ? -7.948  40.505 23.008 1.00 23.19 ? 115 LYS A CB  1 
ATOM   926  C CG  . LYS A 1 115 ? -7.920  41.739 23.886 1.00 29.62 ? 115 LYS A CG  1 
ATOM   927  C CD  . LYS A 1 115 ? -9.327  42.180 24.257 1.00 37.05 ? 115 LYS A CD  1 
ATOM   928  C CE  . LYS A 1 115 ? -9.334  43.191 25.405 1.00 39.57 ? 115 LYS A CE  1 
ATOM   929  N NZ  . LYS A 1 115 ? -8.657  44.469 25.067 1.00 41.12 ? 115 LYS A NZ  1 
ATOM   930  N N   . ILE A 1 116 ? -5.827  37.726 22.214 1.00 23.27 ? 116 ILE A N   1 
ATOM   931  C CA  . ILE A 1 116 ? -5.797  36.417 21.562 1.00 22.11 ? 116 ILE A CA  1 
ATOM   932  C C   . ILE A 1 116 ? -6.481  35.351 22.415 1.00 23.62 ? 116 ILE A C   1 
ATOM   933  O O   . ILE A 1 116 ? -6.295  35.296 23.630 1.00 21.14 ? 116 ILE A O   1 
ATOM   934  C CB  . ILE A 1 116 ? -4.343  35.946 21.259 1.00 22.58 ? 116 ILE A CB  1 
ATOM   935  C CG1 . ILE A 1 116 ? -3.550  37.051 20.556 1.00 22.42 ? 116 ILE A CG1 1 
ATOM   936  C CG2 . ILE A 1 116 ? -4.355  34.694 20.381 1.00 21.78 ? 116 ILE A CG2 1 
ATOM   937  C CD1 . ILE A 1 116 ? -2.684  37.873 21.502 1.00 24.33 ? 116 ILE A CD1 1 
ATOM   938  N N   . SER A 1 117 ? -7.241  34.486 21.754 1.00 22.33 ? 117 SER A N   1 
ATOM   939  C CA  . SER A 1 117 ? -7.960  33.411 22.417 1.00 24.69 ? 117 SER A CA  1 
ATOM   940  C C   . SER A 1 117 ? -7.729  32.110 21.642 1.00 22.84 ? 117 SER A C   1 
ATOM   941  O O   . SER A 1 117 ? -7.966  32.053 20.435 1.00 21.71 ? 117 SER A O   1 
ATOM   942  C CB  . SER A 1 117 ? -9.452  33.756 22.458 1.00 27.71 ? 117 SER A CB  1 
ATOM   943  O OG  . SER A 1 117 ? -10.192 32.771 23.147 1.00 36.49 ? 117 SER A OG  1 
ATOM   944  N N   . ASN A 1 118 ? -7.209  31.093 22.327 1.00 23.29 ? 118 ASN A N   1 
ATOM   945  C CA  . ASN A 1 118 ? -6.937  29.785 21.720 1.00 23.24 ? 118 ASN A CA  1 
ATOM   946  C C   . ASN A 1 118 ? -7.845  28.759 22.360 1.00 21.09 ? 118 ASN A C   1 
ATOM   947  O O   . ASN A 1 118 ? -7.763  28.508 23.553 1.00 22.11 ? 118 ASN A O   1 
ATOM   948  C CB  . ASN A 1 118 ? -5.477  29.355 21.923 1.00 27.14 ? 118 ASN A CB  1 
ATOM   949  C CG  . ASN A 1 118 ? -4.488  30.222 21.159 1.00 31.99 ? 118 ASN A CG  1 
ATOM   950  O OD1 . ASN A 1 118 ? -4.836  30.900 20.186 1.00 38.12 ? 118 ASN A OD1 1 
ATOM   951  N ND2 . ASN A 1 118 ? -3.241  30.203 21.602 1.00 36.46 ? 118 ASN A ND2 1 
ATOM   952  N N   . LYS A 1 119 ? -8.691  28.149 21.549 1.00 20.82 ? 119 LYS A N   1 
ATOM   953  C CA  . LYS A 1 119 ? -9.640  27.162 22.032 1.00 24.20 ? 119 LYS A CA  1 
ATOM   954  C C   . LYS A 1 119 ? -9.291  25.771 21.480 1.00 22.14 ? 119 LYS A C   1 
ATOM   955  O O   . LYS A 1 119 ? -9.329  25.540 20.271 1.00 21.51 ? 119 LYS A O   1 
ATOM   956  C CB  . LYS A 1 119 ? -11.050 27.597 21.622 1.00 27.55 ? 119 LYS A CB  1 
ATOM   957  C CG  . LYS A 1 119 ? -12.166 26.704 22.110 1.00 40.85 ? 119 LYS A CG  1 
ATOM   958  C CD  . LYS A 1 119 ? -13.518 27.155 21.561 1.00 49.72 ? 119 LYS A CD  1 
ATOM   959  C CE  . LYS A 1 119 ? -14.587 26.109 21.843 1.00 55.69 ? 119 LYS A CE  1 
ATOM   960  N NZ  . LYS A 1 119 ? -15.938 26.419 21.302 1.00 59.68 ? 119 LYS A NZ  1 
ATOM   961  N N   . TYR A 1 120 ? -8.921  24.856 22.371 1.00 18.76 ? 120 TYR A N   1 
ATOM   962  C CA  . TYR A 1 120 ? -8.550  23.499 21.976 1.00 15.75 ? 120 TYR A CA  1 
ATOM   963  C C   . TYR A 1 120 ? -9.683  22.503 22.132 1.00 14.26 ? 120 TYR A C   1 
ATOM   964  O O   . TYR A 1 120 ? -10.382 22.512 23.136 1.00 15.02 ? 120 TYR A O   1 
ATOM   965  C CB  . TYR A 1 120 ? -7.373  23.017 22.813 1.00 16.49 ? 120 TYR A CB  1 
ATOM   966  C CG  . TYR A 1 120 ? -6.101  23.791 22.598 1.00 14.62 ? 120 TYR A CG  1 
ATOM   967  C CD1 . TYR A 1 120 ? -5.950  25.082 23.100 1.00 15.68 ? 120 TYR A CD1 1 
ATOM   968  C CD2 . TYR A 1 120 ? -5.032  23.217 21.918 1.00 14.84 ? 120 TYR A CD2 1 
ATOM   969  C CE1 . TYR A 1 120 ? -4.759  25.781 22.923 1.00 16.73 ? 120 TYR A CE1 1 
ATOM   970  C CE2 . TYR A 1 120 ? -3.847  23.900 21.740 1.00 15.23 ? 120 TYR A CE2 1 
ATOM   971  C CZ  . TYR A 1 120 ? -3.715  25.179 22.243 1.00 17.25 ? 120 TYR A CZ  1 
ATOM   972  O OH  . TYR A 1 120 ? -2.533  25.849 22.044 1.00 20.79 ? 120 TYR A OH  1 
ATOM   973  N N   . HIS A 1 121 ? -9.830  21.620 21.149 1.00 17.08 ? 121 HIS A N   1 
ATOM   974  C CA  . HIS A 1 121 ? -10.862 20.580 21.173 1.00 20.70 ? 121 HIS A CA  1 
ATOM   975  C C   . HIS A 1 121 ? -10.171 19.220 21.317 1.00 19.71 ? 121 HIS A C   1 
ATOM   976  O O   . HIS A 1 121 ? -9.715  18.624 20.340 1.00 17.32 ? 121 HIS A O   1 
ATOM   977  C CB  . HIS A 1 121 ? -11.704 20.628 19.897 1.00 23.94 ? 121 HIS A CB  1 
ATOM   978  C CG  . HIS A 1 121 ? -12.360 21.953 19.663 1.00 34.93 ? 121 HIS A CG  1 
ATOM   979  N ND1 . HIS A 1 121 ? -11.698 23.021 19.090 1.00 39.61 ? 121 HIS A ND1 1 
ATOM   980  C CD2 . HIS A 1 121 ? -13.606 22.399 19.951 1.00 37.22 ? 121 HIS A CD2 1 
ATOM   981  C CE1 . HIS A 1 121 ? -12.505 24.064 19.038 1.00 38.64 ? 121 HIS A CE1 1 
ATOM   982  N NE2 . HIS A 1 121 ? -13.671 23.713 19.554 1.00 39.15 ? 121 HIS A NE2 1 
ATOM   983  N N   . THR A 1 122 ? -10.074 18.749 22.555 1.00 18.05 ? 122 THR A N   1 
ATOM   984  C CA  . THR A 1 122 ? -9.410  17.485 22.841 1.00 18.52 ? 122 THR A CA  1 
ATOM   985  C C   . THR A 1 122 ? -10.361 16.288 22.993 1.00 19.16 ? 122 THR A C   1 
ATOM   986  O O   . THR A 1 122 ? -11.585 16.448 23.068 1.00 14.94 ? 122 THR A O   1 
ATOM   987  C CB  . THR A 1 122 ? -8.537  17.618 24.103 1.00 16.99 ? 122 THR A CB  1 
ATOM   988  O OG1 . THR A 1 122 ? -9.377  17.862 25.236 1.00 21.40 ? 122 THR A OG1 1 
ATOM   989  C CG2 . THR A 1 122 ? -7.580  18.789 23.959 1.00 13.78 ? 122 THR A CG2 1 
ATOM   990  N N   . LYS A 1 123 ? -9.774  15.093 23.036 1.00 20.97 ? 123 LYS A N   1 
ATOM   991  C CA  . LYS A 1 123 ? -10.518 13.843 23.185 1.00 21.51 ? 123 LYS A CA  1 
ATOM   992  C C   . LYS A 1 123 ? -10.932 13.619 24.628 1.00 20.58 ? 123 LYS A C   1 
ATOM   993  O O   . LYS A 1 123 ? -10.076 13.479 25.496 1.00 20.63 ? 123 LYS A O   1 
ATOM   994  C CB  . LYS A 1 123 ? -9.658  12.651 22.756 1.00 22.93 ? 123 LYS A CB  1 
ATOM   995  C CG  . LYS A 1 123 ? -10.395 11.313 22.803 1.00 28.63 ? 123 LYS A CG  1 
ATOM   996  C CD  . LYS A 1 123 ? -9.640  10.209 22.084 1.00 31.62 ? 123 LYS A CD  1 
ATOM   997  C CE  . LYS A 1 123 ? -10.484 8.946  22.012 1.00 34.00 ? 123 LYS A CE  1 
ATOM   998  N NZ  . LYS A 1 123 ? -9.922  7.964  21.045 1.00 35.60 ? 123 LYS A NZ  1 
ATOM   999  N N   . GLY A 1 124 ? -12.239 13.551 24.867 1.00 20.94 ? 124 GLY A N   1 
ATOM   1000 C CA  . GLY A 1 124 ? -12.752 13.313 26.205 1.00 19.02 ? 124 GLY A CA  1 
ATOM   1001 C C   . GLY A 1 124 ? -12.096 14.141 27.291 1.00 21.75 ? 124 GLY A C   1 
ATOM   1002 O O   . GLY A 1 124 ? -12.174 15.371 27.275 1.00 18.62 ? 124 GLY A O   1 
ATOM   1003 N N   . ASP A 1 125 ? -11.401 13.469 28.205 1.00 19.40 ? 125 ASP A N   1 
ATOM   1004 C CA  . ASP A 1 125 ? -10.747 14.155 29.316 1.00 19.56 ? 125 ASP A CA  1 
ATOM   1005 C C   . ASP A 1 125 ? -9.257  14.424 29.166 1.00 17.97 ? 125 ASP A C   1 
ATOM   1006 O O   . ASP A 1 125 ? -8.572  14.751 30.135 1.00 17.61 ? 125 ASP A O   1 
ATOM   1007 C CB  . ASP A 1 125 ? -11.032 13.420 30.622 1.00 23.73 ? 125 ASP A CB  1 
ATOM   1008 C CG  . ASP A 1 125 ? -12.487 13.501 31.020 1.00 25.17 ? 125 ASP A CG  1 
ATOM   1009 O OD1 . ASP A 1 125 ? -13.065 14.609 30.944 1.00 27.01 ? 125 ASP A OD1 1 
ATOM   1010 O OD2 . ASP A 1 125 ? -13.053 12.458 31.402 1.00 27.30 ? 125 ASP A OD2 1 
ATOM   1011 N N   . HIS A 1 126 ? -8.759  14.301 27.944 1.00 19.42 ? 126 HIS A N   1 
ATOM   1012 C CA  . HIS A 1 126 ? -7.355  14.570 27.674 1.00 21.12 ? 126 HIS A CA  1 
ATOM   1013 C C   . HIS A 1 126 ? -7.105  16.066 27.705 1.00 20.19 ? 126 HIS A C   1 
ATOM   1014 O O   . HIS A 1 126 ? -7.966  16.857 27.323 1.00 16.98 ? 126 HIS A O   1 
ATOM   1015 C CB  . HIS A 1 126 ? -6.948  14.003 26.318 1.00 20.58 ? 126 HIS A CB  1 
ATOM   1016 C CG  . HIS A 1 126 ? -6.804  12.517 26.316 1.00 22.76 ? 126 HIS A CG  1 
ATOM   1017 N ND1 . HIS A 1 126 ? -7.838  11.668 25.993 1.00 26.42 ? 126 HIS A ND1 1 
ATOM   1018 C CD2 . HIS A 1 126 ? -5.743  11.729 26.608 1.00 25.59 ? 126 HIS A CD2 1 
ATOM   1019 C CE1 . HIS A 1 126 ? -7.424  10.418 26.084 1.00 26.94 ? 126 HIS A CE1 1 
ATOM   1020 N NE2 . HIS A 1 126 ? -6.156  10.428 26.455 1.00 27.96 ? 126 HIS A NE2 1 
ATOM   1021 N N   . GLU A 1 127 ? -5.924  16.438 28.183 1.00 20.74 ? 127 GLU A N   1 
ATOM   1022 C CA  . GLU A 1 127 ? -5.522  17.832 28.289 1.00 22.10 ? 127 GLU A CA  1 
ATOM   1023 C C   . GLU A 1 127 ? -4.359  18.135 27.358 1.00 22.94 ? 127 GLU A C   1 
ATOM   1024 O O   . GLU A 1 127 ? -3.705  17.224 26.845 1.00 24.08 ? 127 GLU A O   1 
ATOM   1025 C CB  . GLU A 1 127 ? -5.106  18.143 29.720 1.00 19.94 ? 127 GLU A CB  1 
ATOM   1026 C CG  . GLU A 1 127 ? -6.230  18.033 30.720 1.00 28.81 ? 127 GLU A CG  1 
ATOM   1027 C CD  . GLU A 1 127 ? -5.746  18.222 32.140 1.00 32.04 ? 127 GLU A CD  1 
ATOM   1028 O OE1 . GLU A 1 127 ? -5.139  19.278 32.424 1.00 31.98 ? 127 GLU A OE1 1 
ATOM   1029 O OE2 . GLU A 1 127 ? -5.961  17.308 32.967 1.00 37.83 ? 127 GLU A OE2 1 
ATOM   1030 N N   . VAL A 1 128 ? -4.119  19.422 27.129 1.00 19.73 ? 128 VAL A N   1 
ATOM   1031 C CA  . VAL A 1 128 ? -3.020  19.845 26.278 1.00 20.18 ? 128 VAL A CA  1 
ATOM   1032 C C   . VAL A 1 128 ? -1.852  20.153 27.199 1.00 19.55 ? 128 VAL A C   1 
ATOM   1033 O O   . VAL A 1 128 ? -2.049  20.480 28.371 1.00 22.98 ? 128 VAL A O   1 
ATOM   1034 C CB  . VAL A 1 128 ? -3.385  21.099 25.420 1.00 24.34 ? 128 VAL A CB  1 
ATOM   1035 C CG1 . VAL A 1 128 ? -4.819  20.998 24.931 1.00 26.31 ? 128 VAL A CG1 1 
ATOM   1036 C CG2 . VAL A 1 128 ? -3.165  22.392 26.189 1.00 22.84 ? 128 VAL A CG2 1 
ATOM   1037 N N   . LYS A 1 129 ? -0.640  20.006 26.687 1.00 16.38 ? 129 LYS A N   1 
ATOM   1038 C CA  . LYS A 1 129 ? 0.546   20.277 27.477 1.00 18.22 ? 129 LYS A CA  1 
ATOM   1039 C C   . LYS A 1 129 ? 0.910   21.755 27.391 1.00 17.53 ? 129 LYS A C   1 
ATOM   1040 O O   . LYS A 1 129 ? 0.819   22.366 26.327 1.00 17.96 ? 129 LYS A O   1 
ATOM   1041 C CB  . LYS A 1 129 ? 1.687   19.377 27.016 1.00 23.59 ? 129 LYS A CB  1 
ATOM   1042 C CG  . LYS A 1 129 ? 1.416   17.903 27.312 1.00 30.35 ? 129 LYS A CG  1 
ATOM   1043 C CD  . LYS A 1 129 ? 2.364   16.967 26.570 1.00 39.04 ? 129 LYS A CD  1 
ATOM   1044 C CE  . LYS A 1 129 ? 2.258   17.143 25.059 1.00 45.49 ? 129 LYS A CE  1 
ATOM   1045 N NZ  . LYS A 1 129 ? 3.071   16.138 24.308 1.00 49.73 ? 129 LYS A NZ  1 
ATOM   1046 N N   . ALA A 1 130 ? 1.283   22.326 28.533 1.00 17.41 ? 130 ALA A N   1 
ATOM   1047 C CA  . ALA A 1 130 ? 1.639   23.735 28.641 1.00 14.89 ? 130 ALA A CA  1 
ATOM   1048 C C   . ALA A 1 130 ? 2.653   24.226 27.616 1.00 16.02 ? 130 ALA A C   1 
ATOM   1049 O O   . ALA A 1 130 ? 2.663   25.404 27.272 1.00 14.89 ? 130 ALA A O   1 
ATOM   1050 C CB  . ALA A 1 130 ? 2.131   24.025 30.029 1.00 16.12 ? 130 ALA A CB  1 
ATOM   1051 N N   . GLU A 1 131 ? 3.522   23.330 27.156 1.00 16.30 ? 131 GLU A N   1 
ATOM   1052 C CA  . GLU A 1 131 ? 4.536   23.682 26.166 1.00 19.76 ? 131 GLU A CA  1 
ATOM   1053 C C   . GLU A 1 131 ? 3.882   23.997 24.833 1.00 21.36 ? 131 GLU A C   1 
ATOM   1054 O O   . GLU A 1 131 ? 4.346   24.856 24.089 1.00 19.21 ? 131 GLU A O   1 
ATOM   1055 C CB  . GLU A 1 131 ? 5.552   22.551 26.000 1.00 21.34 ? 131 GLU A CB  1 
ATOM   1056 C CG  . GLU A 1 131 ? 6.609   22.512 27.091 1.00 25.05 ? 131 GLU A CG  1 
ATOM   1057 C CD  . GLU A 1 131 ? 7.390   23.815 27.183 1.00 25.81 ? 131 GLU A CD  1 
ATOM   1058 O OE1 . GLU A 1 131 ? 8.250   24.055 26.315 1.00 29.93 ? 131 GLU A OE1 1 
ATOM   1059 O OE2 . GLU A 1 131 ? 7.139   24.604 28.116 1.00 24.22 ? 131 GLU A OE2 1 
ATOM   1060 N N   . GLN A 1 132 ? 2.809   23.272 24.539 1.00 21.41 ? 132 GLN A N   1 
ATOM   1061 C CA  . GLN A 1 132 ? 2.049   23.468 23.318 1.00 24.73 ? 132 GLN A CA  1 
ATOM   1062 C C   . GLN A 1 132 ? 1.437   24.871 23.355 1.00 23.30 ? 132 GLN A C   1 
ATOM   1063 O O   . GLN A 1 132 ? 1.594   25.647 22.415 1.00 23.74 ? 132 GLN A O   1 
ATOM   1064 C CB  . GLN A 1 132 ? 0.962   22.390 23.223 1.00 27.83 ? 132 GLN A CB  1 
ATOM   1065 C CG  . GLN A 1 132 ? -0.057  22.582 22.117 1.00 36.00 ? 132 GLN A CG  1 
ATOM   1066 C CD  . GLN A 1 132 ? 0.574   22.805 20.754 1.00 41.77 ? 132 GLN A CD  1 
ATOM   1067 O OE1 . GLN A 1 132 ? 1.529   22.123 20.367 1.00 42.54 ? 132 GLN A OE1 1 
ATOM   1068 N NE2 . GLN A 1 132 ? 0.037   23.768 20.015 1.00 43.10 ? 132 GLN A NE2 1 
ATOM   1069 N N   . VAL A 1 133 ? 0.789   25.203 24.470 1.00 22.38 ? 133 VAL A N   1 
ATOM   1070 C CA  . VAL A 1 133 ? 0.169   26.512 24.650 1.00 22.87 ? 133 VAL A CA  1 
ATOM   1071 C C   . VAL A 1 133 ? 1.234   27.607 24.551 1.00 25.34 ? 133 VAL A C   1 
ATOM   1072 O O   . VAL A 1 133 ? 1.080   28.573 23.801 1.00 23.20 ? 133 VAL A O   1 
ATOM   1073 C CB  . VAL A 1 133 ? -0.556  26.602 26.024 1.00 22.91 ? 133 VAL A CB  1 
ATOM   1074 C CG1 . VAL A 1 133 ? -1.033  28.024 26.294 1.00 22.89 ? 133 VAL A CG1 1 
ATOM   1075 C CG2 . VAL A 1 133 ? -1.741  25.650 26.053 1.00 23.79 ? 133 VAL A CG2 1 
ATOM   1076 N N   . LYS A 1 134 ? 2.340   27.404 25.263 1.00 24.69 ? 134 LYS A N   1 
ATOM   1077 C CA  . LYS A 1 134 ? 3.455   28.345 25.290 1.00 22.51 ? 134 LYS A CA  1 
ATOM   1078 C C   . LYS A 1 134 ? 4.046   28.614 23.904 1.00 21.58 ? 134 LYS A C   1 
ATOM   1079 O O   . LYS A 1 134 ? 4.326   29.761 23.558 1.00 18.74 ? 134 LYS A O   1 
ATOM   1080 C CB  . LYS A 1 134 ? 4.535   27.832 26.250 1.00 21.71 ? 134 LYS A CB  1 
ATOM   1081 C CG  . LYS A 1 134 ? 5.822   28.638 26.276 1.00 27.22 ? 134 LYS A CG  1 
ATOM   1082 C CD  . LYS A 1 134 ? 6.581   28.377 27.568 1.00 37.78 ? 134 LYS A CD  1 
ATOM   1083 C CE  . LYS A 1 134 ? 8.011   28.895 27.524 1.00 38.85 ? 134 LYS A CE  1 
ATOM   1084 N NZ  . LYS A 1 134 ? 8.889   27.984 26.738 1.00 46.86 ? 134 LYS A NZ  1 
ATOM   1085 N N   . ALA A 1 135 ? 4.199   27.559 23.109 1.00 20.87 ? 135 ALA A N   1 
ATOM   1086 C CA  . ALA A 1 135 ? 4.757   27.660 21.762 1.00 22.02 ? 135 ALA A CA  1 
ATOM   1087 C C   . ALA A 1 135 ? 3.887   28.496 20.822 1.00 22.72 ? 135 ALA A C   1 
ATOM   1088 O O   . ALA A 1 135 ? 4.404   29.165 19.925 1.00 22.19 ? 135 ALA A O   1 
ATOM   1089 C CB  . ALA A 1 135 ? 4.981   26.268 21.181 1.00 21.54 ? 135 ALA A CB  1 
ATOM   1090 N N   . SER A 1 136 ? 2.571   28.439 21.015 1.00 23.16 ? 136 SER A N   1 
ATOM   1091 C CA  . SER A 1 136 ? 1.649   29.212 20.194 1.00 24.47 ? 136 SER A CA  1 
ATOM   1092 C C   . SER A 1 136 ? 1.770   30.692 20.527 1.00 24.74 ? 136 SER A C   1 
ATOM   1093 O O   . SER A 1 136 ? 1.710   31.538 19.634 1.00 23.89 ? 136 SER A O   1 
ATOM   1094 C CB  . SER A 1 136 ? 0.210   28.749 20.400 1.00 24.61 ? 136 SER A CB  1 
ATOM   1095 O OG  . SER A 1 136 ? -0.017  27.535 19.716 1.00 32.95 ? 136 SER A OG  1 
ATOM   1096 N N   . LYS A 1 137 ? 1.941   31.000 21.810 1.00 23.82 ? 137 LYS A N   1 
ATOM   1097 C CA  . LYS A 1 137 ? 2.098   32.385 22.241 1.00 27.95 ? 137 LYS A CA  1 
ATOM   1098 C C   . LYS A 1 137 ? 3.421   32.943 21.700 1.00 27.78 ? 137 LYS A C   1 
ATOM   1099 O O   . LYS A 1 137 ? 3.478   34.072 21.210 1.00 25.47 ? 137 LYS A O   1 
ATOM   1100 C CB  . LYS A 1 137 ? 2.071   32.493 23.772 1.00 30.75 ? 137 LYS A CB  1 
ATOM   1101 C CG  . LYS A 1 137 ? 0.820   31.912 24.431 1.00 39.48 ? 137 LYS A CG  1 
ATOM   1102 C CD  . LYS A 1 137 ? 0.708   32.342 25.894 1.00 45.81 ? 137 LYS A CD  1 
ATOM   1103 C CE  . LYS A 1 137 ? -0.331  31.520 26.671 1.00 50.80 ? 137 LYS A CE  1 
ATOM   1104 N NZ  . LYS A 1 137 ? -1.687  31.480 26.040 1.00 52.23 ? 137 LYS A NZ  1 
ATOM   1105 N N   . GLU A 1 138 ? 4.461   32.111 21.747 1.00 28.81 ? 138 GLU A N   1 
ATOM   1106 C CA  . GLU A 1 138 ? 5.802   32.466 21.284 1.00 28.84 ? 138 GLU A CA  1 
ATOM   1107 C C   . GLU A 1 138 ? 5.795   32.789 19.794 1.00 26.65 ? 138 GLU A C   1 
ATOM   1108 O O   . GLU A 1 138 ? 6.389   33.777 19.353 1.00 23.78 ? 138 GLU A O   1 
ATOM   1109 C CB  . GLU A 1 138 ? 6.749   31.289 21.510 1.00 34.26 ? 138 GLU A CB  1 
ATOM   1110 C CG  . GLU A 1 138 ? 8.151   31.683 21.914 1.00 42.02 ? 138 GLU A CG  1 
ATOM   1111 C CD  . GLU A 1 138 ? 8.292   31.795 23.414 1.00 47.64 ? 138 GLU A CD  1 
ATOM   1112 O OE1 . GLU A 1 138 ? 8.011   32.884 23.962 1.00 51.06 ? 138 GLU A OE1 1 
ATOM   1113 O OE2 . GLU A 1 138 ? 8.666   30.782 24.046 1.00 49.84 ? 138 GLU A OE2 1 
ATOM   1114 N N   . MET A 1 139 ? 5.160   31.906 19.031 1.00 22.74 ? 139 MET A N   1 
ATOM   1115 C CA  . MET A 1 139 ? 5.039   32.043 17.588 1.00 24.49 ? 139 MET A CA  1 
ATOM   1116 C C   . MET A 1 139 ? 4.335   33.361 17.276 1.00 22.00 ? 139 MET A C   1 
ATOM   1117 O O   . MET A 1 139 ? 4.800   34.138 16.444 1.00 25.03 ? 139 MET A O   1 
ATOM   1118 C CB  . MET A 1 139 ? 4.230   30.869 17.031 1.00 27.67 ? 139 MET A CB  1 
ATOM   1119 C CG  . MET A 1 139 ? 4.175   30.783 15.519 1.00 35.82 ? 139 MET A CG  1 
ATOM   1120 S SD  . MET A 1 139 ? 5.792   30.458 14.812 1.00 48.16 ? 139 MET A SD  1 
ATOM   1121 C CE  . MET A 1 139 ? 5.867   28.675 14.921 1.00 42.60 ? 139 MET A CE  1 
ATOM   1122 N N   . GLY A 1 140 ? 3.242   33.623 17.987 1.00 20.22 ? 140 GLY A N   1 
ATOM   1123 C CA  . GLY A 1 140 ? 2.487   34.844 17.777 1.00 18.99 ? 140 GLY A CA  1 
ATOM   1124 C C   . GLY A 1 140 ? 3.311   36.089 18.027 1.00 20.59 ? 140 GLY A C   1 
ATOM   1125 O O   . GLY A 1 140 ? 3.322   37.009 17.208 1.00 19.96 ? 140 GLY A O   1 
ATOM   1126 N N   . GLU A 1 141 ? 4.030   36.108 19.144 1.00 20.94 ? 141 GLU A N   1 
ATOM   1127 C CA  . GLU A 1 141 ? 4.857   37.256 19.490 1.00 23.14 ? 141 GLU A CA  1 
ATOM   1128 C C   . GLU A 1 141 ? 5.938   37.547 18.467 1.00 22.43 ? 141 GLU A C   1 
ATOM   1129 O O   . GLU A 1 141 ? 6.080   38.685 18.027 1.00 20.65 ? 141 GLU A O   1 
ATOM   1130 C CB  . GLU A 1 141 ? 5.483   37.081 20.867 1.00 28.03 ? 141 GLU A CB  1 
ATOM   1131 C CG  . GLU A 1 141 ? 4.665   37.702 21.981 1.00 41.75 ? 141 GLU A CG  1 
ATOM   1132 C CD  . GLU A 1 141 ? 5.253   37.459 23.361 1.00 51.11 ? 141 GLU A CD  1 
ATOM   1133 O OE1 . GLU A 1 141 ? 6.402   36.968 23.460 1.00 55.52 ? 141 GLU A OE1 1 
ATOM   1134 O OE2 . GLU A 1 141 ? 4.555   37.762 24.355 1.00 55.28 ? 141 GLU A OE2 1 
ATOM   1135 N N   . THR A 1 142 ? 6.669   36.515 18.057 1.00 21.11 ? 142 THR A N   1 
ATOM   1136 C CA  . THR A 1 142 ? 7.740   36.697 17.084 1.00 23.58 ? 142 THR A CA  1 
ATOM   1137 C C   . THR A 1 142 ? 7.222   37.253 15.756 1.00 22.46 ? 142 THR A C   1 
ATOM   1138 O O   . THR A 1 142 ? 7.882   38.087 15.134 1.00 21.21 ? 142 THR A O   1 
ATOM   1139 C CB  . THR A 1 142 ? 8.525   35.392 16.835 1.00 24.23 ? 142 THR A CB  1 
ATOM   1140 O OG1 . THR A 1 142 ? 7.648   34.403 16.288 1.00 35.17 ? 142 THR A OG1 1 
ATOM   1141 C CG2 . THR A 1 142 ? 9.129   34.872 18.133 1.00 18.93 ? 142 THR A CG2 1 
ATOM   1142 N N   . LEU A 1 143 ? 6.041   36.805 15.331 1.00 16.93 ? 143 LEU A N   1 
ATOM   1143 C CA  . LEU A 1 143 ? 5.449   37.288 14.082 1.00 16.97 ? 143 LEU A CA  1 
ATOM   1144 C C   . LEU A 1 143 ? 5.033   38.755 14.190 1.00 15.66 ? 143 LEU A C   1 
ATOM   1145 O O   . LEU A 1 143 ? 5.275   39.557 13.282 1.00 14.57 ? 143 LEU A O   1 
ATOM   1146 C CB  . LEU A 1 143 ? 4.240   36.436 13.698 1.00 16.42 ? 143 LEU A CB  1 
ATOM   1147 C CG  . LEU A 1 143 ? 4.552   34.981 13.347 1.00 14.45 ? 143 LEU A CG  1 
ATOM   1148 C CD1 . LEU A 1 143 ? 3.266   34.260 13.019 1.00 14.17 ? 143 LEU A CD1 1 
ATOM   1149 C CD2 . LEU A 1 143 ? 5.518   34.911 12.175 1.00 17.05 ? 143 LEU A CD2 1 
ATOM   1150 N N   . LEU A 1 144 ? 4.415   39.098 15.315 1.00 15.95 ? 144 LEU A N   1 
ATOM   1151 C CA  . LEU A 1 144 ? 3.966   40.458 15.567 1.00 15.56 ? 144 LEU A CA  1 
ATOM   1152 C C   . LEU A 1 144 ? 5.155   41.409 15.615 1.00 16.94 ? 144 LEU A C   1 
ATOM   1153 O O   . LEU A 1 144 ? 5.121   42.480 15.008 1.00 14.95 ? 144 LEU A O   1 
ATOM   1154 C CB  . LEU A 1 144 ? 3.189   40.524 16.887 1.00 15.15 ? 144 LEU A CB  1 
ATOM   1155 C CG  . LEU A 1 144 ? 2.708   41.898 17.352 1.00 16.02 ? 144 LEU A CG  1 
ATOM   1156 C CD1 . LEU A 1 144 ? 1.706   42.469 16.368 1.00 17.10 ? 144 LEU A CD1 1 
ATOM   1157 C CD2 . LEU A 1 144 ? 2.080   41.772 18.717 1.00 21.57 ? 144 LEU A CD2 1 
ATOM   1158 N N   . ARG A 1 145 ? 6.206   41.019 16.331 1.00 17.08 ? 145 ARG A N   1 
ATOM   1159 C CA  . ARG A 1 145 ? 7.392   41.858 16.442 1.00 18.77 ? 145 ARG A CA  1 
ATOM   1160 C C   . ARG A 1 145 ? 8.060   42.029 15.091 1.00 16.51 ? 145 ARG A C   1 
ATOM   1161 O O   . ARG A 1 145 ? 8.537   43.115 14.767 1.00 18.22 ? 145 ARG A O   1 
ATOM   1162 C CB  . ARG A 1 145 ? 8.375   41.288 17.468 1.00 23.74 ? 145 ARG A CB  1 
ATOM   1163 C CG  . ARG A 1 145 ? 7.913   41.477 18.899 1.00 31.90 ? 145 ARG A CG  1 
ATOM   1164 C CD  . ARG A 1 145 ? 8.154   40.234 19.734 1.00 48.58 ? 145 ARG A CD  1 
ATOM   1165 N NE  . ARG A 1 145 ? 9.482   40.172 20.344 1.00 57.94 ? 145 ARG A NE  1 
ATOM   1166 C CZ  . ARG A 1 145 ? 10.101  39.041 20.684 1.00 62.96 ? 145 ARG A CZ  1 
ATOM   1167 N NH1 . ARG A 1 145 ? 9.525   37.863 20.464 1.00 62.58 ? 145 ARG A NH1 1 
ATOM   1168 N NH2 . ARG A 1 145 ? 11.284  39.089 21.286 1.00 67.06 ? 145 ARG A NH2 1 
ATOM   1169 N N   . ALA A 1 146 ? 8.054   40.967 14.290 1.00 14.35 ? 146 ALA A N   1 
ATOM   1170 C CA  . ALA A 1 146 ? 8.659   41.010 12.963 1.00 13.11 ? 146 ALA A CA  1 
ATOM   1171 C C   . ALA A 1 146 ? 7.911   41.987 12.070 1.00 14.07 ? 146 ALA A C   1 
ATOM   1172 O O   . ALA A 1 146 ? 8.525   42.783 11.362 1.00 17.93 ? 146 ALA A O   1 
ATOM   1173 C CB  . ALA A 1 146 ? 8.658   39.627 12.333 1.00 10.92 ? 146 ALA A CB  1 
ATOM   1174 N N   . VAL A 1 147 ? 6.582   41.904 12.090 1.00 15.91 ? 147 VAL A N   1 
ATOM   1175 C CA  . VAL A 1 147 ? 5.739   42.779 11.276 1.00 14.37 ? 147 VAL A CA  1 
ATOM   1176 C C   . VAL A 1 147 ? 5.875   44.206 11.800 1.00 16.81 ? 147 VAL A C   1 
ATOM   1177 O O   . VAL A 1 147 ? 5.919   45.167 11.031 1.00 15.88 ? 147 VAL A O   1 
ATOM   1178 C CB  . VAL A 1 147 ? 4.251   42.320 11.304 1.00 17.85 ? 147 VAL A CB  1 
ATOM   1179 C CG1 . VAL A 1 147 ? 3.335   43.401 10.751 1.00 16.21 ? 147 VAL A CG1 1 
ATOM   1180 C CG2 . VAL A 1 147 ? 4.086   41.047 10.489 1.00 13.45 ? 147 VAL A CG2 1 
ATOM   1181 N N   . GLU A 1 148 ? 6.030   44.315 13.112 1.00 15.28 ? 148 GLU A N   1 
ATOM   1182 C CA  . GLU A 1 148 ? 6.187   45.592 13.782 1.00 17.14 ? 148 GLU A CA  1 
ATOM   1183 C C   . GLU A 1 148 ? 7.478   46.294 13.328 1.00 15.97 ? 148 GLU A C   1 
ATOM   1184 O O   . GLU A 1 148 ? 7.452   47.476 12.979 1.00 14.87 ? 148 GLU A O   1 
ATOM   1185 C CB  . GLU A 1 148 ? 6.193   45.363 15.290 1.00 17.04 ? 148 GLU A CB  1 
ATOM   1186 C CG  . GLU A 1 148 ? 5.830   46.571 16.109 1.00 24.56 ? 148 GLU A CG  1 
ATOM   1187 C CD  . GLU A 1 148 ? 5.609   46.229 17.569 1.00 25.91 ? 148 GLU A CD  1 
ATOM   1188 O OE1 . GLU A 1 148 ? 6.326   45.359 18.105 1.00 27.22 ? 148 GLU A OE1 1 
ATOM   1189 O OE2 . GLU A 1 148 ? 4.714   46.835 18.183 1.00 26.41 ? 148 GLU A OE2 1 
ATOM   1190 N N   . SER A 1 149 ? 8.586   45.556 13.279 1.00 12.45 ? 149 SER A N   1 
ATOM   1191 C CA  . SER A 1 149 ? 9.865   46.120 12.853 1.00 13.29 ? 149 SER A CA  1 
ATOM   1192 C C   . SER A 1 149 ? 9.770   46.558 11.397 1.00 15.74 ? 149 SER A C   1 
ATOM   1193 O O   . SER A 1 149 ? 10.276  47.618 11.010 1.00 14.15 ? 149 SER A O   1 
ATOM   1194 C CB  . SER A 1 149 ? 10.990  45.093 12.999 1.00 15.33 ? 149 SER A CB  1 
ATOM   1195 O OG  . SER A 1 149 ? 11.121  44.665 14.338 1.00 29.74 ? 149 SER A OG  1 
ATOM   1196 N N   . TYR A 1 150 ? 9.106   45.735 10.592 1.00 15.80 ? 150 TYR A N   1 
ATOM   1197 C CA  . TYR A 1 150 ? 8.930   46.034 9.180  1.00 14.13 ? 150 TYR A CA  1 
ATOM   1198 C C   . TYR A 1 150 ? 8.233   47.380 8.977  1.00 14.55 ? 150 TYR A C   1 
ATOM   1199 O O   . TYR A 1 150 ? 8.731   48.244 8.257  1.00 12.99 ? 150 TYR A O   1 
ATOM   1200 C CB  . TYR A 1 150 ? 8.125   44.927 8.508  1.00 11.37 ? 150 TYR A CB  1 
ATOM   1201 C CG  . TYR A 1 150 ? 7.935   45.151 7.036  1.00 13.80 ? 150 TYR A CG  1 
ATOM   1202 C CD1 . TYR A 1 150 ? 8.952   44.850 6.136  1.00 16.84 ? 150 TYR A CD1 1 
ATOM   1203 C CD2 . TYR A 1 150 ? 6.748   45.686 6.540  1.00 14.85 ? 150 TYR A CD2 1 
ATOM   1204 C CE1 . TYR A 1 150 ? 8.798   45.073 4.778  1.00 17.42 ? 150 TYR A CE1 1 
ATOM   1205 C CE2 . TYR A 1 150 ? 6.585   45.916 5.181  1.00 20.14 ? 150 TYR A CE2 1 
ATOM   1206 C CZ  . TYR A 1 150 ? 7.617   45.608 4.307  1.00 16.97 ? 150 TYR A CZ  1 
ATOM   1207 O OH  . TYR A 1 150 ? 7.474   45.847 2.961  1.00 21.93 ? 150 TYR A OH  1 
ATOM   1208 N N   . LEU A 1 151 ? 7.096   47.560 9.640  1.00 14.00 ? 151 LEU A N   1 
ATOM   1209 C CA  . LEU A 1 151 ? 6.326   48.793 9.523  1.00 16.02 ? 151 LEU A CA  1 
ATOM   1210 C C   . LEU A 1 151 ? 7.099   50.026 9.993  1.00 17.77 ? 151 LEU A C   1 
ATOM   1211 O O   . LEU A 1 151 ? 6.985   51.096 9.397  1.00 18.34 ? 151 LEU A O   1 
ATOM   1212 C CB  . LEU A 1 151 ? 5.003   48.672 10.289 1.00 10.17 ? 151 LEU A CB  1 
ATOM   1213 C CG  . LEU A 1 151 ? 3.998   47.662 9.725  1.00 11.70 ? 151 LEU A CG  1 
ATOM   1214 C CD1 . LEU A 1 151 ? 2.809   47.507 10.650 1.00 9.61  ? 151 LEU A CD1 1 
ATOM   1215 C CD2 . LEU A 1 151 ? 3.554   48.092 8.330  1.00 10.83 ? 151 LEU A CD2 1 
ATOM   1216 N N   . LEU A 1 152 ? 7.903   49.867 11.043 1.00 17.74 ? 152 LEU A N   1 
ATOM   1217 C CA  . LEU A 1 152 ? 8.676   50.983 11.582 1.00 17.23 ? 152 LEU A CA  1 
ATOM   1218 C C   . LEU A 1 152 ? 9.795   51.410 10.638 1.00 17.69 ? 152 LEU A C   1 
ATOM   1219 O O   . LEU A 1 152 ? 10.144  52.589 10.581 1.00 17.50 ? 152 LEU A O   1 
ATOM   1220 C CB  . LEU A 1 152 ? 9.248   50.635 12.964 1.00 13.90 ? 152 LEU A CB  1 
ATOM   1221 C CG  . LEU A 1 152 ? 8.237   50.438 14.101 1.00 19.15 ? 152 LEU A CG  1 
ATOM   1222 C CD1 . LEU A 1 152 ? 8.940   50.019 15.375 1.00 14.09 ? 152 LEU A CD1 1 
ATOM   1223 C CD2 . LEU A 1 152 ? 7.450   51.709 14.329 1.00 16.61 ? 152 LEU A CD2 1 
ATOM   1224 N N   . ALA A 1 153 ? 10.334  50.451 9.886  1.00 17.20 ? 153 ALA A N   1 
ATOM   1225 C CA  . ALA A 1 153 ? 11.415  50.727 8.943  1.00 16.90 ? 153 ALA A CA  1 
ATOM   1226 C C   . ALA A 1 153 ? 10.891  51.141 7.573  1.00 17.92 ? 153 ALA A C   1 
ATOM   1227 O O   . ALA A 1 153 ? 11.647  51.619 6.728  1.00 17.76 ? 153 ALA A O   1 
ATOM   1228 C CB  . ALA A 1 153 ? 12.320  49.514 8.813  1.00 15.30 ? 153 ALA A CB  1 
ATOM   1229 N N   . HIS A 1 154 ? 9.598   50.932 7.353  1.00 17.95 ? 154 HIS A N   1 
ATOM   1230 C CA  . HIS A 1 154 ? 8.959   51.282 6.091  1.00 17.92 ? 154 HIS A CA  1 
ATOM   1231 C C   . HIS A 1 154 ? 7.724   52.100 6.437  1.00 17.46 ? 154 HIS A C   1 
ATOM   1232 O O   . HIS A 1 154 ? 6.606   51.598 6.371  1.00 16.85 ? 154 HIS A O   1 
ATOM   1233 C CB  . HIS A 1 154 ? 8.558   50.009 5.331  1.00 22.93 ? 154 HIS A CB  1 
ATOM   1234 C CG  . HIS A 1 154 ? 9.709   49.100 5.022  1.00 25.08 ? 154 HIS A CG  1 
ATOM   1235 N ND1 . HIS A 1 154 ? 10.115  48.090 5.871  1.00 26.44 ? 154 HIS A ND1 1 
ATOM   1236 C CD2 . HIS A 1 154 ? 10.568  49.071 3.975  1.00 25.44 ? 154 HIS A CD2 1 
ATOM   1237 C CE1 . HIS A 1 154 ? 11.173  47.486 5.365  1.00 28.07 ? 154 HIS A CE1 1 
ATOM   1238 N NE2 . HIS A 1 154 ? 11.470  48.062 4.213  1.00 26.36 ? 154 HIS A NE2 1 
ATOM   1239 N N   . SER A 1 155 ? 7.938   53.360 6.815  1.00 20.28 ? 155 SER A N   1 
ATOM   1240 C CA  . SER A 1 155 ? 6.853   54.257 7.213  1.00 19.75 ? 155 SER A CA  1 
ATOM   1241 C C   . SER A 1 155 ? 5.759   54.476 6.171  1.00 22.28 ? 155 SER A C   1 
ATOM   1242 O O   . SER A 1 155 ? 4.649   54.882 6.514  1.00 22.02 ? 155 SER A O   1 
ATOM   1243 C CB  . SER A 1 155 ? 7.407   55.604 7.700  1.00 21.21 ? 155 SER A CB  1 
ATOM   1244 O OG  . SER A 1 155 ? 8.108   56.296 6.678  1.00 21.99 ? 155 SER A OG  1 
ATOM   1245 N N   . ASP A 1 156 ? 6.061   54.192 4.906  1.00 27.80 ? 156 ASP A N   1 
ATOM   1246 C CA  . ASP A 1 156 ? 5.080   54.352 3.827  1.00 32.67 ? 156 ASP A CA  1 
ATOM   1247 C C   . ASP A 1 156 ? 4.181   53.119 3.661  1.00 31.15 ? 156 ASP A C   1 
ATOM   1248 O O   . ASP A 1 156 ? 3.105   53.204 3.072  1.00 29.78 ? 156 ASP A O   1 
ATOM   1249 C CB  . ASP A 1 156 ? 5.785   54.666 2.501  1.00 39.14 ? 156 ASP A CB  1 
ATOM   1250 C CG  . ASP A 1 156 ? 6.712   53.548 2.051  1.00 48.83 ? 156 ASP A CG  1 
ATOM   1251 O OD1 . ASP A 1 156 ? 7.758   53.329 2.705  1.00 50.85 ? 156 ASP A OD1 1 
ATOM   1252 O OD2 . ASP A 1 156 ? 6.387   52.881 1.045  1.00 57.41 ? 156 ASP A OD2 1 
ATOM   1253 N N   . ALA A 1 157 ? 4.626   51.985 4.199  1.00 29.51 ? 157 ALA A N   1 
ATOM   1254 C CA  . ALA A 1 157 ? 3.886   50.727 4.119  1.00 27.73 ? 157 ALA A CA  1 
ATOM   1255 C C   . ALA A 1 157 ? 2.581   50.747 4.907  1.00 26.09 ? 157 ALA A C   1 
ATOM   1256 O O   . ALA A 1 157 ? 2.537   51.206 6.051  1.00 22.27 ? 157 ALA A O   1 
ATOM   1257 C CB  . ALA A 1 157 ? 4.766   49.573 4.601  1.00 28.69 ? 157 ALA A CB  1 
ATOM   1258 N N   . TYR A 1 158 ? 1.528   50.216 4.289  1.00 21.94 ? 158 TYR A N   1 
ATOM   1259 C CA  . TYR A 1 158 ? 0.203   50.141 4.898  1.00 25.62 ? 158 TYR A CA  1 
ATOM   1260 C C   . TYR A 1 158 ? -0.224  51.481 5.463  1.00 32.96 ? 158 TYR A C   1 
ATOM   1261 O O   . TYR A 1 158 ? -0.916  51.560 6.480  1.00 33.67 ? 158 TYR A O   1 
ATOM   1262 C CB  . TYR A 1 158 ? 0.178   49.041 5.964  1.00 22.14 ? 158 TYR A CB  1 
ATOM   1263 C CG  . TYR A 1 158 ? 0.531   47.706 5.369  1.00 18.76 ? 158 TYR A CG  1 
ATOM   1264 C CD1 . TYR A 1 158 ? -0.439  46.937 4.724  1.00 17.29 ? 158 TYR A CD1 1 
ATOM   1265 C CD2 . TYR A 1 158 ? 1.857   47.270 5.328  1.00 17.06 ? 158 TYR A CD2 1 
ATOM   1266 C CE1 . TYR A 1 158 ? -0.097  45.774 4.037  1.00 15.32 ? 158 TYR A CE1 1 
ATOM   1267 C CE2 . TYR A 1 158 ? 2.210   46.110 4.642  1.00 17.38 ? 158 TYR A CE2 1 
ATOM   1268 C CZ  . TYR A 1 158 ? 1.226   45.373 3.996  1.00 14.66 ? 158 TYR A CZ  1 
ATOM   1269 O OH  . TYR A 1 158 ? 1.575   44.269 3.268  1.00 19.87 ? 158 TYR A OH  1 
ATOM   1270 N N   . ASN A 1 159 ? 0.159   52.534 4.749  1.00 42.32 ? 159 ASN A N   1 
ATOM   1271 C CA  . ASN A 1 159 ? -0.141  53.900 5.146  1.00 50.56 ? 159 ASN A CA  1 
ATOM   1272 C C   . ASN A 1 159 ? -0.221  54.760 3.883  1.00 54.61 ? 159 ASN A C   1 
ATOM   1273 O O   . ASN A 1 159 ? 0.842   55.190 3.378  1.00 56.89 ? 159 ASN A O   1 
ATOM   1274 C CB  . ASN A 1 159 ? 0.960   54.418 6.081  1.00 52.19 ? 159 ASN A CB  1 
ATOM   1275 C CG  . ASN A 1 159 ? 0.478   55.515 6.997  1.00 55.69 ? 159 ASN A CG  1 
ATOM   1276 O OD1 . ASN A 1 159 ? 0.434   55.343 8.215  1.00 56.23 ? 159 ASN A OD1 1 
ATOM   1277 N ND2 . ASN A 1 159 ? 0.114   56.654 6.421  1.00 62.13 ? 159 ASN A ND2 1 
ATOM   1278 O OXT . ASN A 1 159 ? -1.353  54.962 3.393  1.00 58.85 ? 159 ASN A OXT 1 
HETATM 1279 O O   . HOH B 2 .   ? -6.939  9.011  17.946 1.00 33.77 ? 200 HOH A O   1 
HETATM 1280 O O   . HOH B 2 .   ? -1.189  14.941 18.344 1.00 35.04 ? 201 HOH A O   1 
HETATM 1281 O O   . HOH B 2 .   ? -3.296  16.199 11.099 1.00 13.43 ? 202 HOH A O   1 
HETATM 1282 O O   . HOH B 2 .   ? -9.541  18.977 12.082 1.00 28.58 ? 203 HOH A O   1 
HETATM 1283 O O   . HOH B 2 .   ? -14.015 16.743 12.290 1.00 18.28 ? 204 HOH A O   1 
HETATM 1284 O O   . HOH B 2 .   ? 8.897   26.242 29.080 1.00 27.74 ? 205 HOH A O   1 
HETATM 1285 O O   . HOH B 2 .   ? -14.840 20.588 28.450 1.00 41.61 ? 206 HOH A O   1 
HETATM 1286 O O   . HOH B 2 .   ? -5.509  31.726 29.804 1.00 35.04 ? 207 HOH A O   1 
HETATM 1287 O O   . HOH B 2 .   ? -6.088  21.143 28.491 1.00 30.65 ? 208 HOH A O   1 
HETATM 1288 O O   . HOH B 2 .   ? -15.508 11.817 32.324 1.00 37.25 ? 209 HOH A O   1 
HETATM 1289 O O   . HOH B 2 .   ? -0.377  19.581 23.560 1.00 29.88 ? 210 HOH A O   1 
HETATM 1290 O O   . HOH B 2 .   ? 13.502  46.254 2.686  1.00 53.79 ? 211 HOH A O   1 
HETATM 1291 O O   . HOH B 2 .   ? -16.996 30.484 8.471  1.00 24.53 ? 212 HOH A O   1 
HETATM 1292 O O   . HOH B 2 .   ? -12.378 30.322 15.098 1.00 27.43 ? 213 HOH A O   1 
HETATM 1293 O O   . HOH B 2 .   ? 4.851   42.486 21.608 1.00 31.88 ? 214 HOH A O   1 
HETATM 1294 O O   . HOH B 2 .   ? 1.760   51.293 22.673 1.00 17.79 ? 215 HOH A O   1 
HETATM 1295 O O   . HOH B 2 .   ? -0.751  49.764 23.695 1.00 36.53 ? 216 HOH A O   1 
HETATM 1296 O O   . HOH B 2 .   ? -3.740  13.351 29.150 1.00 26.80 ? 217 HOH A O   1 
HETATM 1297 O O   . HOH B 2 .   ? -6.169  52.781 14.627 1.00 47.82 ? 218 HOH A O   1 
HETATM 1298 O O   . HOH B 2 .   ? 11.984  49.069 12.648 1.00 34.67 ? 219 HOH A O   1 
HETATM 1299 O O   . HOH B 2 .   ? 5.134   42.233 -0.768 1.00 22.64 ? 220 HOH A O   1 
HETATM 1300 O O   . HOH B 2 .   ? -1.139  32.946 0.744  1.00 44.59 ? 221 HOH A O   1 
HETATM 1301 O O   . HOH B 2 .   ? -6.663  37.535 3.943  1.00 42.87 ? 222 HOH A O   1 
HETATM 1302 O O   . HOH B 2 .   ? 10.544  38.473 15.522 1.00 18.88 ? 223 HOH A O   1 
HETATM 1303 O O   . HOH B 2 .   ? -13.437 18.071 21.582 1.00 36.42 ? 224 HOH A O   1 
HETATM 1304 O O   . HOH B 2 .   ? -9.743  16.654 10.444 1.00 25.11 ? 225 HOH A O   1 
HETATM 1305 O O   . HOH B 2 .   ? 6.704   54.751 -0.950 1.00 58.04 ? 226 HOH A O   1 
HETATM 1306 O O   . HOH B 2 .   ? -11.632 46.795 18.340 1.00 46.25 ? 227 HOH A O   1 
HETATM 1307 O O   . HOH B 2 .   ? 11.745  41.790 15.785 1.00 37.27 ? 228 HOH A O   1 
HETATM 1308 O O   . HOH B 2 .   ? 11.126  42.592 10.337 1.00 27.54 ? 229 HOH A O   1 
HETATM 1309 O O   . HOH B 2 .   ? -3.540  32.419 9.070  1.00 27.53 ? 230 HOH A O   1 
HETATM 1310 O O   . HOH B 2 .   ? -13.586 29.062 0.083  1.00 44.01 ? 231 HOH A O   1 
HETATM 1311 O O   . HOH B 2 .   ? -11.043 28.550 -4.590 1.00 28.51 ? 232 HOH A O   1 
HETATM 1312 O O   . HOH B 2 .   ? -17.422 30.661 4.763  1.00 33.47 ? 233 HOH A O   1 
HETATM 1313 O O   . HOH B 2 .   ? -17.264 35.530 16.448 1.00 59.29 ? 234 HOH A O   1 
HETATM 1314 O O   . HOH B 2 .   ? -13.039 10.059 30.127 1.00 52.95 ? 235 HOH A O   1 
HETATM 1315 O O   . HOH B 2 .   ? 1.257   27.526 29.119 1.00 29.09 ? 236 HOH A O   1 
HETATM 1316 O O   . HOH B 2 .   ? -15.908 27.132 -1.359 1.00 46.36 ? 237 HOH A O   1 
HETATM 1317 O O   . HOH B 2 .   ? -15.047 20.540 13.901 1.00 39.91 ? 238 HOH A O   1 
HETATM 1318 O O   . HOH B 2 .   ? -0.183  21.102 -0.817 1.00 52.68 ? 239 HOH A O   1 
HETATM 1319 O O   . HOH B 2 .   ? 12.258  30.020 5.870  1.00 37.08 ? 240 HOH A O   1 
HETATM 1320 O O   . HOH B 2 .   ? 3.091   18.277 9.732  1.00 40.63 ? 241 HOH A O   1 
HETATM 1321 O O   . HOH B 2 .   ? 3.061   26.297 2.361  1.00 27.88 ? 242 HOH A O   1 
HETATM 1322 O O   . HOH B 2 .   ? -11.570 26.407 29.315 1.00 38.00 ? 243 HOH A O   1 
HETATM 1323 O O   . HOH B 2 .   ? -3.914  21.063 30.142 1.00 42.15 ? 244 HOH A O   1 
HETATM 1324 O O   . HOH B 2 .   ? -10.028 37.569 21.139 1.00 41.27 ? 245 HOH A O   1 
HETATM 1325 O O   . HOH B 2 .   ? -6.100  11.795 30.056 1.00 35.92 ? 246 HOH A O   1 
HETATM 1326 O O   . HOH B 2 .   ? -4.759  52.503 17.849 1.00 24.60 ? 247 HOH A O   1 
HETATM 1327 O O   . HOH B 2 .   ? -13.830 17.790 19.124 1.00 26.90 ? 248 HOH A O   1 
HETATM 1328 O O   . HOH B 2 .   ? -3.197  53.869 5.536  1.00 61.11 ? 249 HOH A O   1 
HETATM 1329 O O   . HOH B 2 .   ? 3.860   44.915 2.098  1.00 42.99 ? 250 HOH A O   1 
HETATM 1330 O O   . HOH B 2 .   ? 0.360   58.732 19.778 1.00 59.11 ? 251 HOH A O   1 
HETATM 1331 O O   . HOH B 2 .   ? -2.047  13.729 12.238 1.00 40.42 ? 252 HOH A O   1 
HETATM 1332 O O   . HOH B 2 .   ? -3.190  16.392 22.405 1.00 47.65 ? 253 HOH A O   1 
HETATM 1333 O O   . HOH B 2 .   ? -9.611  10.735 28.519 1.00 44.67 ? 254 HOH A O   1 
HETATM 1334 O O   . HOH B 2 .   ? -10.461 9.968  31.001 1.00 77.26 ? 255 HOH A O   1 
HETATM 1335 O O   . HOH B 2 .   ? -13.340 10.443 27.474 1.00 62.51 ? 256 HOH A O   1 
HETATM 1336 O O   . HOH B 2 .   ? 10.500  52.090 2.041  1.00 56.45 ? 257 HOH A O   1 
HETATM 1337 O O   . HOH B 2 .   ? -3.467  52.212 8.095  1.00 55.23 ? 258 HOH A O   1 
HETATM 1338 O O   . HOH B 2 .   ? -2.769  52.123 3.209  1.00 39.88 ? 259 HOH A O   1 
HETATM 1339 O O   . HOH B 2 .   ? -2.635  37.622 29.252 1.00 39.59 ? 260 HOH A O   1 
HETATM 1340 O O   . HOH B 2 .   ? 2.229   29.895 28.703 1.00 54.78 ? 261 HOH A O   1 
HETATM 1341 O O   . HOH B 2 .   ? -3.844  31.976 24.174 1.00 49.96 ? 262 HOH A O   1 
HETATM 1342 O O   . HOH B 2 .   ? -1.817  29.542 15.893 1.00 46.61 ? 263 HOH A O   1 
HETATM 1343 O O   . HOH B 2 .   ? -3.349  28.460 17.938 1.00 38.98 ? 264 HOH A O   1 
HETATM 1344 O O   . HOH B 2 .   ? -2.358  28.214 23.337 1.00 46.72 ? 265 HOH A O   1 
HETATM 1345 O O   . HOH B 2 .   ? -19.754 41.186 13.002 1.00 37.39 ? 266 HOH A O   1 
HETATM 1346 O O   . HOH B 2 .   ? -20.225 38.401 12.617 1.00 56.06 ? 267 HOH A O   1 
HETATM 1347 O O   . HOH B 2 .   ? -18.038 39.001 10.337 1.00 57.34 ? 268 HOH A O   1 
HETATM 1348 O O   . HOH B 2 .   ? 14.633  28.320 11.957 1.00 36.54 ? 269 HOH A O   1 
HETATM 1349 O O   . HOH B 2 .   ? -19.794 45.746 8.907  1.00 66.12 ? 270 HOH A O   1 
HETATM 1350 O O   . HOH B 2 .   ? -16.503 43.389 7.904  1.00 31.60 ? 271 HOH A O   1 
HETATM 1351 O O   . HOH B 2 .   ? -5.261  55.617 17.991 1.00 56.40 ? 272 HOH A O   1 
HETATM 1352 O O   . HOH B 2 .   ? -6.248  55.660 20.638 1.00 55.94 ? 273 HOH A O   1 
HETATM 1353 O O   . HOH B 2 .   ? 3.400   43.308 25.937 1.00 66.06 ? 274 HOH A O   1 
HETATM 1354 O O   . HOH B 2 .   ? 11.610  38.401 18.197 1.00 51.99 ? 275 HOH A O   1 
HETATM 1355 O O   . HOH B 2 .   ? 13.422  40.760 18.192 1.00 54.12 ? 276 HOH A O   1 
HETATM 1356 O O   . HOH B 2 .   ? 8.752   35.360 21.144 1.00 57.87 ? 277 HOH A O   1 
HETATM 1357 O O   . HOH B 2 .   ? 7.530   17.037 16.387 1.00 43.23 ? 278 HOH A O   1 
HETATM 1358 O O   . HOH B 2 .   ? -2.304  38.455 2.233  1.00 59.54 ? 279 HOH A O   1 
HETATM 1359 O O   . HOH B 2 .   ? -12.955 32.922 -0.233 1.00 48.48 ? 280 HOH A O   1 
HETATM 1360 O O   . HOH B 2 .   ? 8.330   22.264 5.850  1.00 42.64 ? 281 HOH A O   1 
HETATM 1361 O O   . HOH B 2 .   ? -0.825  25.332 18.277 1.00 67.82 ? 282 HOH A O   1 
HETATM 1362 O O   . HOH B 2 .   ? 3.925   55.321 9.041  1.00 42.28 ? 283 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   ASN 4   4   4   ASN ASN A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  ASN 28  28  28  ASN ASN A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  GLN 36  36  36  GLN GLN A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  PHE 58  58  58  PHE PHE A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  HIS 76  76  76  HIS HIS A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  TYR 81  81  81  TYR TYR A . n 
A 1 82  ASN 82  82  82  ASN ASN A . n 
A 1 83  TYR 83  83  83  TYR TYR A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 TYR 120 120 120 TYR TYR A . n 
A 1 121 HIS 121 121 121 HIS HIS A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 HIS 154 154 154 HIS HIS A . n 
A 1 155 SER 155 155 155 SER SER A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 TYR 158 158 158 TYR TYR A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  200 200 HOH HOH A . 
B 2 HOH 2  201 201 HOH HOH A . 
B 2 HOH 3  202 202 HOH HOH A . 
B 2 HOH 4  203 203 HOH HOH A . 
B 2 HOH 5  204 204 HOH HOH A . 
B 2 HOH 6  205 205 HOH HOH A . 
B 2 HOH 7  206 206 HOH HOH A . 
B 2 HOH 8  207 207 HOH HOH A . 
B 2 HOH 9  208 208 HOH HOH A . 
B 2 HOH 10 209 209 HOH HOH A . 
B 2 HOH 11 210 210 HOH HOH A . 
B 2 HOH 12 211 211 HOH HOH A . 
B 2 HOH 13 212 212 HOH HOH A . 
B 2 HOH 14 213 213 HOH HOH A . 
B 2 HOH 15 214 214 HOH HOH A . 
B 2 HOH 16 215 215 HOH HOH A . 
B 2 HOH 17 216 216 HOH HOH A . 
B 2 HOH 18 217 217 HOH HOH A . 
B 2 HOH 19 218 218 HOH HOH A . 
B 2 HOH 20 219 219 HOH HOH A . 
B 2 HOH 21 220 220 HOH HOH A . 
B 2 HOH 22 221 221 HOH HOH A . 
B 2 HOH 23 222 222 HOH HOH A . 
B 2 HOH 24 223 223 HOH HOH A . 
B 2 HOH 25 224 224 HOH HOH A . 
B 2 HOH 26 225 225 HOH HOH A . 
B 2 HOH 27 226 226 HOH HOH A . 
B 2 HOH 28 227 227 HOH HOH A . 
B 2 HOH 29 228 228 HOH HOH A . 
B 2 HOH 30 229 229 HOH HOH A . 
B 2 HOH 31 230 230 HOH HOH A . 
B 2 HOH 32 231 231 HOH HOH A . 
B 2 HOH 33 232 232 HOH HOH A . 
B 2 HOH 34 233 233 HOH HOH A . 
B 2 HOH 35 234 234 HOH HOH A . 
B 2 HOH 36 235 235 HOH HOH A . 
B 2 HOH 37 236 236 HOH HOH A . 
B 2 HOH 38 237 237 HOH HOH A . 
B 2 HOH 39 238 238 HOH HOH A . 
B 2 HOH 40 239 239 HOH HOH A . 
B 2 HOH 41 240 240 HOH HOH A . 
B 2 HOH 42 241 241 HOH HOH A . 
B 2 HOH 43 242 242 HOH HOH A . 
B 2 HOH 44 243 243 HOH HOH A . 
B 2 HOH 45 244 244 HOH HOH A . 
B 2 HOH 46 245 245 HOH HOH A . 
B 2 HOH 47 246 246 HOH HOH A . 
B 2 HOH 48 247 247 HOH HOH A . 
B 2 HOH 49 248 248 HOH HOH A . 
B 2 HOH 50 249 249 HOH HOH A . 
B 2 HOH 51 250 250 HOH HOH A . 
B 2 HOH 52 251 251 HOH HOH A . 
B 2 HOH 53 252 252 HOH HOH A . 
B 2 HOH 54 253 253 HOH HOH A . 
B 2 HOH 55 254 254 HOH HOH A . 
B 2 HOH 56 255 255 HOH HOH A . 
B 2 HOH 57 256 256 HOH HOH A . 
B 2 HOH 58 257 257 HOH HOH A . 
B 2 HOH 59 258 258 HOH HOH A . 
B 2 HOH 60 259 259 HOH HOH A . 
B 2 HOH 61 260 260 HOH HOH A . 
B 2 HOH 62 261 261 HOH HOH A . 
B 2 HOH 63 262 262 HOH HOH A . 
B 2 HOH 64 263 263 HOH HOH A . 
B 2 HOH 65 264 264 HOH HOH A . 
B 2 HOH 66 265 265 HOH HOH A . 
B 2 HOH 67 266 266 HOH HOH A . 
B 2 HOH 68 267 267 HOH HOH A . 
B 2 HOH 69 268 268 HOH HOH A . 
B 2 HOH 70 269 269 HOH HOH A . 
B 2 HOH 71 270 270 HOH HOH A . 
B 2 HOH 72 271 271 HOH HOH A . 
B 2 HOH 73 272 272 HOH HOH A . 
B 2 HOH 74 273 273 HOH HOH A . 
B 2 HOH 75 274 274 HOH HOH A . 
B 2 HOH 76 275 275 HOH HOH A . 
B 2 HOH 77 276 276 HOH HOH A . 
B 2 HOH 78 277 277 HOH HOH A . 
B 2 HOH 79 278 278 HOH HOH A . 
B 2 HOH 80 279 279 HOH HOH A . 
B 2 HOH 81 280 280 HOH HOH A . 
B 2 HOH 82 281 281 HOH HOH A . 
B 2 HOH 83 282 282 HOH HOH A . 
B 2 HOH 84 283 283 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_565 x,-y+1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 74.2400000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-09-17 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' 3.851 ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
X-PLOR    phasing          3.851 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 60 ? A -12.48 -52.98 
2 1 GLU A 60 ? B -49.49 157.27 
3 1 ASP A 93 ? ? 62.49  -95.49 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#