data_1BWA
# 
_entry.id   1BWA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1BWA         pdb_00001bwa 10.2210/pdb1bwa/pdb 
RCSB  RCSB008431   ?            ?                   
WWPDB D_1000008431 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BWA 
_pdbx_database_status.recvd_initial_deposition_date   1998-09-22 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ala, P.'     1 
'Chang, C.H.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Counteracting HIV-1 protease drug resistance: structural analysis of mutant proteases complexed with XV638 and SD146, cyclic urea amides with broad specificities.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            37 
_citation.page_first                15042 
_citation.page_last                 15049 
_citation.year                      1998 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9790666 
_citation.pdbx_database_id_DOI      10.1021/bi980386e 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ala, P.J.'    1 ? 
primary 'Huston, E.E.' 2 ? 
primary 'Klabe, R.M.'  3 ? 
primary 'Jadhav, P.K.' 4 ? 
primary 'Lam, P.Y.'    5 ? 
primary 'Chang, C.H.'  6 ? 
# 
_cell.entry_id           1BWA 
_cell.length_a           62.800 
_cell.length_b           62.800 
_cell.length_c           83.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BWA 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (HIV-1 PROTEASE)' 10823.746 2  3.4.23.16 'V82F, I84V' ? ? 
2 non-polymer syn 
;[4R-(4ALPHA,5ALPHA,6BETA,7BETA)]-3,3'-[[TETRAHYDRO-5,6-DIHYDROXY-2-OXO-4,7-BIS(PHENYLMETHYL)-1H-1,3-DIAZEPINE-1,3(2H)-D IYL] BIS(METHYLENE)]BIS[N-2-THIAZOLYLBENZAMIDE]
;
758.908   1  ?         ?            ? ? 
3 water       nat water 18.015    68 ?         ?            ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PFNVIGRNLLTQIGCTLNF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PFNVIGRNLLTQIGCTLNF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  GLN n 
1 3  VAL n 
1 4  THR n 
1 5  LEU n 
1 6  TRP n 
1 7  GLN n 
1 8  ARG n 
1 9  PRO n 
1 10 LEU n 
1 11 VAL n 
1 12 THR n 
1 13 ILE n 
1 14 LYS n 
1 15 ILE n 
1 16 GLY n 
1 17 GLY n 
1 18 GLN n 
1 19 LEU n 
1 20 LYS n 
1 21 GLU n 
1 22 ALA n 
1 23 LEU n 
1 24 LEU n 
1 25 ASP n 
1 26 THR n 
1 27 GLY n 
1 28 ALA n 
1 29 ASP n 
1 30 ASP n 
1 31 THR n 
1 32 VAL n 
1 33 LEU n 
1 34 GLU n 
1 35 GLU n 
1 36 MET n 
1 37 SER n 
1 38 LEU n 
1 39 PRO n 
1 40 GLY n 
1 41 ARG n 
1 42 TRP n 
1 43 LYS n 
1 44 PRO n 
1 45 LYS n 
1 46 MET n 
1 47 ILE n 
1 48 GLY n 
1 49 GLY n 
1 50 ILE n 
1 51 GLY n 
1 52 GLY n 
1 53 PHE n 
1 54 ILE n 
1 55 LYS n 
1 56 VAL n 
1 57 ARG n 
1 58 GLN n 
1 59 TYR n 
1 60 ASP n 
1 61 GLN n 
1 62 ILE n 
1 63 LEU n 
1 64 ILE n 
1 65 GLU n 
1 66 ILE n 
1 67 CYS n 
1 68 GLY n 
1 69 HIS n 
1 70 LYS n 
1 71 ALA n 
1 72 ILE n 
1 73 GLY n 
1 74 THR n 
1 75 VAL n 
1 76 LEU n 
1 77 VAL n 
1 78 GLY n 
1 79 PRO n 
1 80 THR n 
1 81 PRO n 
1 82 PHE n 
1 83 ASN n 
1 84 VAL n 
1 85 ILE n 
1 86 GLY n 
1 87 ARG n 
1 88 ASN n 
1 89 LEU n 
1 90 LEU n 
1 91 THR n 
1 92 GLN n 
1 93 ILE n 
1 94 GLY n 
1 95 CYS n 
1 96 THR n 
1 97 LEU n 
1 98 ASN n 
1 99 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Lentivirus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    BH102 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus 1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11676 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    POL_HV1H2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04585 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BWA A 1 ? 99 ? P04585 57 ? 155 ? 1 99 
2 1 1BWA B 1 ? 99 ? P04585 57 ? 155 ? 1 99 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1BWA PHE A 82 ? UNP P04585 VAL 138 'engineered mutation' 82 1 
1 1BWA VAL A 84 ? UNP P04585 ILE 140 'engineered mutation' 84 2 
2 1BWA PHE B 82 ? UNP P04585 VAL 138 'engineered mutation' 82 3 
2 1BWA VAL B 84 ? UNP P04585 ILE 140 'engineered mutation' 84 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?     'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ?     'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ?     'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?     'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE ?     'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE ?     'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?     'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ?     'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE ?     'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ?     'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?     'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE ?     'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE ?     'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE ?     'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?     'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ?     'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE ?     'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE ?     'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?     'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ?     'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE ?     'C5 H11 N O2'      117.146 
XV6 non-polymer         . 
;[4R-(4ALPHA,5ALPHA,6BETA,7BETA)]-3,3'-[[TETRAHYDRO-5,6-DIHYDROXY-2-OXO-4,7-BIS(PHENYLMETHYL)-1H-1,3-DIAZEPINE-1,3(2H)-D IYL] BIS(METHYLENE)]BIS[N-2-THIAZOLYLBENZAMIDE]
;
XV638 'C41 H38 N6 O5 S2' 758.908 
# 
_exptl.entry_id          1BWA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.19 
_exptl_crystal.density_percent_sol   43.95 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'pH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           287 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BWA 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   14433 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              0.092 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1BWA 
_refine.ls_number_reflns_obs                     14433 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.9 
_refine.ls_percent_reflns_obs                    98 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1846 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             68 
_refine_hist.number_atoms_total               1968 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.1   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1BWA 
_struct.title                     'HIV-1 PROTEASE (V82F/I84V) DOUBLE MUTANT COMPLEXED WITH XV638 OF DUPONT PHARMACEUTICALS' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BWA 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HIV-1 PROTEASE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 86 ? THR A 91 ? GLY A 86 THR A 91 1 ? 6 
HELX_P HELX_P2 2 GLY B 86 ? THR B 91 ? GLY B 86 THR B 91 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
COA ? 8 ? 
COB ? 8 ? 
INT ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
COA 1 2 ? anti-parallel 
COA 2 3 ? anti-parallel 
COA 3 4 ? parallel      
COA 4 5 ? anti-parallel 
COA 5 6 ? parallel      
COA 6 7 ? anti-parallel 
COA 7 8 ? anti-parallel 
COB 1 2 ? anti-parallel 
COB 2 3 ? anti-parallel 
COB 3 4 ? parallel      
COB 4 5 ? anti-parallel 
COB 5 6 ? parallel      
COB 6 7 ? anti-parallel 
COB 7 8 ? anti-parallel 
INT 1 2 ? anti-parallel 
INT 2 3 ? anti-parallel 
INT 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
COA 1 LYS A 43 ? GLY A 49 ? LYS A 43 GLY A 49 
COA 2 GLY A 52 ? ILE A 66 ? GLY A 52 ILE A 66 
COA 3 HIS A 69 ? GLY A 78 ? HIS A 69 GLY A 78 
COA 4 THR A 31 ? GLU A 34 ? THR A 31 GLU A 34 
COA 5 ASN A 83 ? ILE A 85 ? ASN A 83 ILE A 85 
COA 6 GLN A 18 ? ASP A 25 ? GLN A 18 ASP A 25 
COA 7 PRO A 9  ? ILE A 15 ? PRO A 9  ILE A 15 
COA 8 GLU A 65 ? ILE A 66 ? GLU A 65 ILE A 66 
COB 1 LYS B 43 ? GLY B 49 ? LYS B 43 GLY B 49 
COB 2 GLY B 52 ? ILE B 66 ? GLY B 52 ILE B 66 
COB 3 HIS B 69 ? GLY B 78 ? HIS B 69 GLY B 78 
COB 4 THR B 31 ? GLU B 34 ? THR B 31 GLU B 34 
COB 5 ASN B 83 ? ILE B 85 ? ASN B 83 ILE B 85 
COB 6 GLN B 18 ? ASP B 25 ? GLN B 18 ASP B 25 
COB 7 PRO B 9  ? ILE B 15 ? PRO B 9  ILE B 15 
COB 8 GLU B 65 ? ILE B 66 ? GLU B 65 ILE B 66 
INT 1 PRO A 1  ? THR A 4  ? PRO A 1  THR A 4  
INT 2 THR B 96 ? PHE B 99 ? THR B 96 PHE B 99 
INT 3 THR A 96 ? PHE A 99 ? THR A 96 PHE A 99 
INT 4 PRO B 1  ? THR B 4  ? PRO B 1  THR B 4  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    B 
_struct_site.pdbx_auth_comp_id    XV6 
_struct_site.pdbx_auth_seq_id     638 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    21 
_struct_site.details              'BINDING SITE FOR RESIDUE XV6 B 638' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 ASP A 25 ? ASP A 25 . ? 1_555 ? 
2  AC1 21 GLY A 27 ? GLY A 27 . ? 1_555 ? 
3  AC1 21 ALA A 28 ? ALA A 28 . ? 1_555 ? 
4  AC1 21 ASP A 29 ? ASP A 29 . ? 1_555 ? 
5  AC1 21 ASP A 30 ? ASP A 30 . ? 1_555 ? 
6  AC1 21 ILE A 47 ? ILE A 47 . ? 1_555 ? 
7  AC1 21 GLY A 48 ? GLY A 48 . ? 1_555 ? 
8  AC1 21 GLY A 49 ? GLY A 49 . ? 1_555 ? 
9  AC1 21 ILE A 50 ? ILE A 50 . ? 1_555 ? 
10 AC1 21 VAL A 84 ? VAL A 84 . ? 1_555 ? 
11 AC1 21 ASP B 25 ? ASP B 25 . ? 1_555 ? 
12 AC1 21 GLY B 27 ? GLY B 27 . ? 1_555 ? 
13 AC1 21 ALA B 28 ? ALA B 28 . ? 1_555 ? 
14 AC1 21 ASP B 29 ? ASP B 29 . ? 1_555 ? 
15 AC1 21 ASP B 30 ? ASP B 30 . ? 1_555 ? 
16 AC1 21 VAL B 32 ? VAL B 32 . ? 1_555 ? 
17 AC1 21 ILE B 47 ? ILE B 47 . ? 1_555 ? 
18 AC1 21 GLY B 48 ? GLY B 48 . ? 1_555 ? 
19 AC1 21 GLY B 49 ? GLY B 49 . ? 1_555 ? 
20 AC1 21 ILE B 50 ? ILE B 50 . ? 1_555 ? 
21 AC1 21 VAL B 84 ? VAL B 84 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1BWA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BWA 
_atom_sites.fract_transf_matrix[1][1]   0.015923 
_atom_sites.fract_transf_matrix[1][2]   0.009193 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018387 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011976 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 1  ? -12.963 39.120 31.305 1.00 33.91 ? 1   PRO A N   1 
ATOM   2    C CA  . PRO A 1 1  ? -12.648 39.307 29.883 1.00 30.32 ? 1   PRO A CA  1 
ATOM   3    C C   . PRO A 1 1  ? -13.626 38.485 29.114 1.00 30.08 ? 1   PRO A C   1 
ATOM   4    O O   . PRO A 1 1  ? -14.279 37.617 29.666 1.00 25.43 ? 1   PRO A O   1 
ATOM   5    C CB  . PRO A 1 1  ? -11.260 38.709 29.708 1.00 30.79 ? 1   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 1  ? -10.604 39.107 31.024 1.00 33.24 ? 1   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 1  ? -11.716 38.996 32.076 1.00 33.71 ? 1   PRO A CD  1 
ATOM   8    N N   . GLN A 1 2  ? -13.704 38.761 27.833 1.00 29.55 ? 2   GLN A N   1 
ATOM   9    C CA  . GLN A 1 2  ? -14.441 37.805 27.027 1.00 31.38 ? 2   GLN A CA  1 
ATOM   10   C C   . GLN A 1 2  ? -13.439 37.221 26.071 1.00 31.06 ? 2   GLN A C   1 
ATOM   11   O O   . GLN A 1 2  ? -12.617 37.920 25.500 1.00 33.08 ? 2   GLN A O   1 
ATOM   12   C CB  . GLN A 1 2  ? -15.546 38.525 26.304 1.00 30.97 ? 2   GLN A CB  1 
ATOM   13   C CG  . GLN A 1 2  ? -16.221 37.548 25.381 1.00 35.91 ? 2   GLN A CG  1 
ATOM   14   C CD  . GLN A 1 2  ? -17.315 38.314 24.735 1.00 43.20 ? 2   GLN A CD  1 
ATOM   15   O OE1 . GLN A 1 2  ? -17.118 39.272 23.998 1.00 43.75 ? 2   GLN A OE1 1 
ATOM   16   N NE2 . GLN A 1 2  ? -18.511 37.869 25.080 1.00 47.63 ? 2   GLN A NE2 1 
ATOM   17   N N   . VAL A 1 3  ? -13.481 35.932 25.962 1.00 28.43 ? 3   VAL A N   1 
ATOM   18   C CA  . VAL A 1 3  ? -12.481 35.304 25.148 1.00 28.18 ? 3   VAL A CA  1 
ATOM   19   C C   . VAL A 1 3  ? -13.224 34.491 24.127 1.00 27.06 ? 3   VAL A C   1 
ATOM   20   O O   . VAL A 1 3  ? -14.222 33.826 24.369 1.00 27.16 ? 3   VAL A O   1 
ATOM   21   C CB  . VAL A 1 3  ? -11.495 34.521 26.052 1.00 30.03 ? 3   VAL A CB  1 
ATOM   22   C CG1 . VAL A 1 3  ? -12.047 34.183 27.439 1.00 32.92 ? 3   VAL A CG1 1 
ATOM   23   C CG2 . VAL A 1 3  ? -10.896 33.273 25.409 1.00 31.93 ? 3   VAL A CG2 1 
ATOM   24   N N   . THR A 1 4  ? -12.737 34.659 22.924 1.00 26.28 ? 4   THR A N   1 
ATOM   25   C CA  . THR A 1 4  ? -13.310 33.922 21.827 1.00 24.76 ? 4   THR A CA  1 
ATOM   26   C C   . THR A 1 4  ? -12.328 32.797 21.502 1.00 23.03 ? 4   THR A C   1 
ATOM   27   O O   . THR A 1 4  ? -11.213 32.772 22.005 1.00 20.63 ? 4   THR A O   1 
ATOM   28   C CB  . THR A 1 4  ? -13.545 34.946 20.717 1.00 25.83 ? 4   THR A CB  1 
ATOM   29   O OG1 . THR A 1 4  ? -14.508 34.431 19.804 1.00 30.35 ? 4   THR A OG1 1 
ATOM   30   C CG2 . THR A 1 4  ? -12.246 35.352 20.018 1.00 23.12 ? 4   THR A CG2 1 
ATOM   31   N N   . LEU A 1 5  ? -12.804 31.835 20.720 1.00 19.83 ? 5   LEU A N   1 
ATOM   32   C CA  . LEU A 1 5  ? -12.203 30.513 20.779 1.00 18.75 ? 5   LEU A CA  1 
ATOM   33   C C   . LEU A 1 5  ? -11.424 30.149 19.547 1.00 17.34 ? 5   LEU A C   1 
ATOM   34   O O   . LEU A 1 5  ? -11.279 28.995 19.205 1.00 17.89 ? 5   LEU A O   1 
ATOM   35   C CB  . LEU A 1 5  ? -13.317 29.492 21.006 1.00 15.57 ? 5   LEU A CB  1 
ATOM   36   C CG  . LEU A 1 5  ? -13.644 29.064 22.437 1.00 16.44 ? 5   LEU A CG  1 
ATOM   37   C CD1 . LEU A 1 5  ? -12.674 29.575 23.506 1.00 17.74 ? 5   LEU A CD1 1 
ATOM   38   C CD2 . LEU A 1 5  ? -15.103 29.315 22.735 1.00 14.13 ? 5   LEU A CD2 1 
ATOM   39   N N   . TRP A 1 6  ? -10.904 31.175 18.888 1.00 16.59 ? 6   TRP A N   1 
ATOM   40   C CA  . TRP A 1 6  ? -10.051 30.958 17.713 1.00 17.85 ? 6   TRP A CA  1 
ATOM   41   C C   . TRP A 1 6  ? -8.646  30.575 18.097 1.00 22.47 ? 6   TRP A C   1 
ATOM   42   O O   . TRP A 1 6  ? -7.853  30.161 17.271 1.00 24.51 ? 6   TRP A O   1 
ATOM   43   C CB  . TRP A 1 6  ? -9.893  32.224 16.855 1.00 15.92 ? 6   TRP A CB  1 
ATOM   44   C CG  . TRP A 1 6  ? -11.255 32.677 16.406 1.00 18.53 ? 6   TRP A CG  1 
ATOM   45   C CD1 . TRP A 1 6  ? -12.129 33.555 17.075 1.00 18.16 ? 6   TRP A CD1 1 
ATOM   46   C CD2 . TRP A 1 6  ? -11.960 32.219 15.304 1.00 19.12 ? 6   TRP A CD2 1 
ATOM   47   N NE1 . TRP A 1 6  ? -13.352 33.673 16.485 1.00 20.84 ? 6   TRP A NE1 1 
ATOM   48   C CE2 . TRP A 1 6  ? -13.314 32.862 15.380 1.00 22.32 ? 6   TRP A CE2 1 
ATOM   49   C CE3 . TRP A 1 6  ? -11.634 31.335 14.267 1.00 19.95 ? 6   TRP A CE3 1 
ATOM   50   C CZ2 . TRP A 1 6  ? -14.268 32.555 14.391 1.00 23.63 ? 6   TRP A CZ2 1 
ATOM   51   C CZ3 . TRP A 1 6  ? -12.619 31.057 13.301 1.00 24.86 ? 6   TRP A CZ3 1 
ATOM   52   C CH2 . TRP A 1 6  ? -13.908 31.650 13.361 1.00 24.38 ? 6   TRP A CH2 1 
ATOM   53   N N   . GLN A 1 7  ? -8.312  30.734 19.373 1.00 22.20 ? 7   GLN A N   1 
ATOM   54   C CA  . GLN A 1 7  ? -6.988  30.284 19.797 1.00 24.00 ? 7   GLN A CA  1 
ATOM   55   C C   . GLN A 1 7  ? -7.204  29.565 21.087 1.00 23.27 ? 7   GLN A C   1 
ATOM   56   O O   . GLN A 1 7  ? -8.240  29.786 21.690 1.00 23.80 ? 7   GLN A O   1 
ATOM   57   C CB  . GLN A 1 7  ? -6.184  31.509 20.146 1.00 28.73 ? 7   GLN A CB  1 
ATOM   58   C CG  . GLN A 1 7  ? -6.002  32.473 18.990 1.00 33.81 ? 7   GLN A CG  1 
ATOM   59   C CD  . GLN A 1 7  ? -5.420  33.726 19.557 1.00 37.10 ? 7   GLN A CD  1 
ATOM   60   O OE1 . GLN A 1 7  ? -4.272  34.054 19.328 1.00 39.60 ? 7   GLN A OE1 1 
ATOM   61   N NE2 . GLN A 1 7  ? -6.250  34.449 20.310 1.00 40.66 ? 7   GLN A NE2 1 
ATOM   62   N N   . ARG A 1 8  ? -6.237  28.755 21.541 1.00 22.87 ? 8   ARG A N   1 
ATOM   63   C CA  . ARG A 1 8  ? -6.377  28.191 22.900 1.00 21.86 ? 8   ARG A CA  1 
ATOM   64   C C   . ARG A 1 8  ? -6.705  29.276 23.913 1.00 17.98 ? 8   ARG A C   1 
ATOM   65   O O   . ARG A 1 8  ? -6.050  30.301 23.921 1.00 18.02 ? 8   ARG A O   1 
ATOM   66   C CB  . ARG A 1 8  ? -5.045  27.613 23.415 1.00 24.84 ? 8   ARG A CB  1 
ATOM   67   C CG  . ARG A 1 8  ? -4.346  26.507 22.639 1.00 31.57 ? 8   ARG A CG  1 
ATOM   68   C CD  . ARG A 1 8  ? -4.835  25.101 22.958 1.00 36.71 ? 8   ARG A CD  1 
ATOM   69   N NE  . ARG A 1 8  ? -6.285  25.029 22.767 1.00 41.95 ? 8   ARG A NE  1 
ATOM   70   C CZ  . ARG A 1 8  ? -6.973  23.949 23.103 1.00 39.26 ? 8   ARG A CZ  1 
ATOM   71   N NH1 . ARG A 1 8  ? -6.318  22.819 23.418 1.00 39.98 ? 8   ARG A NH1 1 
ATOM   72   N NH2 . ARG A 1 8  ? -8.306  24.038 23.103 1.00 29.33 ? 8   ARG A NH2 1 
ATOM   73   N N   . PRO A 1 9  ? -7.687  29.045 24.759 1.00 14.90 ? 9   PRO A N   1 
ATOM   74   C CA  . PRO A 1 9  ? -7.927  30.050 25.795 1.00 16.53 ? 9   PRO A CA  1 
ATOM   75   C C   . PRO A 1 9  ? -6.943  29.872 26.937 1.00 15.99 ? 9   PRO A C   1 
ATOM   76   O O   . PRO A 1 9  ? -7.188  29.143 27.892 1.00 21.08 ? 9   PRO A O   1 
ATOM   77   C CB  . PRO A 1 9  ? -9.376  29.723 26.157 1.00 15.29 ? 9   PRO A CB  1 
ATOM   78   C CG  . PRO A 1 9  ? -9.484  28.203 25.971 1.00 19.04 ? 9   PRO A CG  1 
ATOM   79   C CD  . PRO A 1 9  ? -8.606  27.911 24.770 1.00 14.65 ? 9   PRO A CD  1 
ATOM   80   N N   . LEU A 1 10 ? -5.799  30.529 26.812 1.00 14.31 ? 10  LEU A N   1 
ATOM   81   C CA  . LEU A 1 10 ? -4.749  30.435 27.846 1.00 13.67 ? 10  LEU A CA  1 
ATOM   82   C C   . LEU A 1 10 ? -4.709  31.616 28.766 1.00 13.92 ? 10  LEU A C   1 
ATOM   83   O O   . LEU A 1 10 ? -5.006  32.743 28.396 1.00 15.94 ? 10  LEU A O   1 
ATOM   84   C CB  . LEU A 1 10 ? -3.363  30.430 27.260 1.00 12.91 ? 10  LEU A CB  1 
ATOM   85   C CG  . LEU A 1 10 ? -2.986  29.224 26.459 1.00 12.50 ? 10  LEU A CG  1 
ATOM   86   C CD1 . LEU A 1 10 ? -1.544  29.409 26.014 1.00 14.87 ? 10  LEU A CD1 1 
ATOM   87   C CD2 . LEU A 1 10 ? -3.121  27.934 27.242 1.00 13.40 ? 10  LEU A CD2 1 
ATOM   88   N N   . VAL A 1 11 ? -4.337  31.336 29.998 1.00 14.97 ? 11  VAL A N   1 
ATOM   89   C CA  . VAL A 1 11 ? -4.394  32.390 31.002 1.00 14.49 ? 11  VAL A CA  1 
ATOM   90   C C   . VAL A 1 11 ? -3.161  32.283 31.863 1.00 12.89 ? 11  VAL A C   1 
ATOM   91   O O   . VAL A 1 11 ? -2.542  31.238 31.914 1.00 17.40 ? 11  VAL A O   1 
ATOM   92   C CB  . VAL A 1 11 ? -5.739  32.195 31.749 1.00 16.22 ? 11  VAL A CB  1 
ATOM   93   C CG1 . VAL A 1 11 ? -5.774  31.126 32.854 1.00 14.72 ? 11  VAL A CG1 1 
ATOM   94   C CG2 . VAL A 1 11 ? -6.321  33.527 32.148 1.00 19.88 ? 11  VAL A CG2 1 
ATOM   95   N N   . THR A 1 12 ? -2.793  33.346 32.534 1.00 16.23 ? 12  THR A N   1 
ATOM   96   C CA  . THR A 1 12 ? -1.723  33.206 33.524 1.00 20.05 ? 12  THR A CA  1 
ATOM   97   C C   . THR A 1 12 ? -2.260  32.875 34.911 1.00 21.27 ? 12  THR A C   1 
ATOM   98   O O   . THR A 1 12 ? -3.235  33.464 35.384 1.00 18.83 ? 12  THR A O   1 
ATOM   99   C CB  . THR A 1 12 ? -0.936  34.519 33.574 1.00 21.02 ? 12  THR A CB  1 
ATOM   100  O OG1 . THR A 1 12 ? -0.587  34.865 32.238 1.00 24.89 ? 12  THR A OG1 1 
ATOM   101  C CG2 . THR A 1 12 ? 0.363   34.416 34.378 1.00 25.80 ? 12  THR A CG2 1 
ATOM   102  N N   . ILE A 1 13 ? -1.602  31.891 35.527 1.00 19.39 ? 13  ILE A N   1 
ATOM   103  C CA  . ILE A 1 13 ? -1.889  31.606 36.929 1.00 20.04 ? 13  ILE A CA  1 
ATOM   104  C C   . ILE A 1 13 ? -0.616  31.764 37.759 1.00 18.82 ? 13  ILE A C   1 
ATOM   105  O O   . ILE A 1 13 ? 0.495   31.545 37.290 1.00 16.55 ? 13  ILE A O   1 
ATOM   106  C CB  . ILE A 1 13 ? -2.488  30.204 37.088 1.00 17.96 ? 13  ILE A CB  1 
ATOM   107  C CG1 . ILE A 1 13 ? -1.551  29.128 36.610 1.00 15.34 ? 13  ILE A CG1 1 
ATOM   108  C CG2 . ILE A 1 13 ? -3.816  30.089 36.335 1.00 18.88 ? 13  ILE A CG2 1 
ATOM   109  C CD1 . ILE A 1 13 ? -2.083  27.748 36.917 1.00 22.93 ? 13  ILE A CD1 1 
ATOM   110  N N   . LYS A 1 14 ? -0.804  32.165 39.004 1.00 18.71 ? 14  LYS A N   1 
ATOM   111  C CA  . LYS A 1 14 ? 0.298   32.106 39.967 1.00 16.67 ? 14  LYS A CA  1 
ATOM   112  C C   . LYS A 1 14 ? -0.084  31.099 40.996 1.00 17.69 ? 14  LYS A C   1 
ATOM   113  O O   . LYS A 1 14 ? -1.149  31.199 41.578 1.00 18.85 ? 14  LYS A O   1 
ATOM   114  C CB  . LYS A 1 14 ? 0.441   33.452 40.666 1.00 19.12 ? 14  LYS A CB  1 
ATOM   115  C CG  . LYS A 1 14 ? 1.617   33.511 41.649 1.00 21.61 ? 14  LYS A CG  1 
ATOM   116  C CD  . LYS A 1 14 ? 1.572   34.857 42.351 1.00 25.90 ? 14  LYS A CD  1 
ATOM   117  C CE  . LYS A 1 14 ? 2.758   35.181 43.253 1.00 30.45 ? 14  LYS A CE  1 
ATOM   118  N NZ  . LYS A 1 14 ? 2.596   36.589 43.679 1.00 32.98 ? 14  LYS A NZ  1 
ATOM   119  N N   . ILE A 1 15 ? 0.769   30.117 41.202 1.00 19.27 ? 15  ILE A N   1 
ATOM   120  C CA  . ILE A 1 15 ? 0.466   29.105 42.194 1.00 20.20 ? 15  ILE A CA  1 
ATOM   121  C C   . ILE A 1 15 ? 1.793   28.879 42.863 1.00 23.42 ? 15  ILE A C   1 
ATOM   122  O O   . ILE A 1 15 ? 2.820   28.656 42.240 1.00 22.35 ? 15  ILE A O   1 
ATOM   123  C CB  . ILE A 1 15 ? 0.146   27.756 41.584 1.00 20.86 ? 15  ILE A CB  1 
ATOM   124  C CG1 . ILE A 1 15 ? 0.101   27.757 40.084 1.00 20.85 ? 15  ILE A CG1 1 
ATOM   125  C CG2 . ILE A 1 15 ? -1.036  27.005 42.206 1.00 23.63 ? 15  ILE A CG2 1 
ATOM   126  C CD1 . ILE A 1 15 ? 1.251   26.874 39.642 1.00 23.02 ? 15  ILE A CD1 1 
ATOM   127  N N   . GLY A 1 16 ? 1.763   28.953 44.173 1.00 22.18 ? 16  GLY A N   1 
ATOM   128  C CA  . GLY A 1 16 ? 2.956   28.566 44.924 1.00 24.89 ? 16  GLY A CA  1 
ATOM   129  C C   . GLY A 1 16 ? 4.154   29.423 44.645 1.00 22.52 ? 16  GLY A C   1 
ATOM   130  O O   . GLY A 1 16 ? 5.288   29.001 44.688 1.00 25.41 ? 16  GLY A O   1 
ATOM   131  N N   . GLY A 1 17 ? 3.845   30.663 44.345 1.00 21.14 ? 17  GLY A N   1 
ATOM   132  C CA  . GLY A 1 17 ? 4.902   31.579 43.990 1.00 21.47 ? 17  GLY A CA  1 
ATOM   133  C C   . GLY A 1 17 ? 5.469   31.343 42.621 1.00 21.44 ? 17  GLY A C   1 
ATOM   134  O O   . GLY A 1 17 ? 6.451   31.941 42.257 1.00 24.35 ? 17  GLY A O   1 
ATOM   135  N N   . GLN A 1 18 ? 4.857   30.476 41.839 1.00 20.66 ? 18  GLN A N   1 
ATOM   136  C CA  . GLN A 1 18 ? 5.350   30.302 40.483 1.00 17.35 ? 18  GLN A CA  1 
ATOM   137  C C   . GLN A 1 18 ? 4.277   30.793 39.558 1.00 17.05 ? 18  GLN A C   1 
ATOM   138  O O   . GLN A 1 18 ? 3.103   30.701 39.854 1.00 15.41 ? 18  GLN A O   1 
ATOM   139  C CB  . GLN A 1 18 ? 5.606   28.811 40.239 1.00 19.77 ? 18  GLN A CB  1 
ATOM   140  C CG  . GLN A 1 18 ? 6.797   28.327 41.058 1.00 21.31 ? 18  GLN A CG  1 
ATOM   141  C CD  . GLN A 1 18 ? 6.927   26.851 40.939 1.00 22.68 ? 18  GLN A CD  1 
ATOM   142  O OE1 . GLN A 1 18 ? 7.249   26.311 39.899 1.00 24.63 ? 18  GLN A OE1 1 
ATOM   143  N NE2 . GLN A 1 18 ? 6.673   26.212 42.061 1.00 20.40 ? 18  GLN A NE2 1 
ATOM   144  N N   . LEU A 1 19 ? 4.705   31.343 38.442 1.00 17.16 ? 19  LEU A N   1 
ATOM   145  C CA  . LEU A 1 19 ? 3.740   31.740 37.439 1.00 14.39 ? 19  LEU A CA  1 
ATOM   146  C C   . LEU A 1 19 ? 3.767   30.694 36.359 1.00 13.93 ? 19  LEU A C   1 
ATOM   147  O O   . LEU A 1 19 ? 4.861   30.337 35.952 1.00 13.81 ? 19  LEU A O   1 
ATOM   148  C CB  . LEU A 1 19 ? 4.261   33.006 36.801 1.00 14.39 ? 19  LEU A CB  1 
ATOM   149  C CG  . LEU A 1 19 ? 4.666   34.048 37.813 1.00 13.59 ? 19  LEU A CG  1 
ATOM   150  C CD1 . LEU A 1 19 ? 5.463   35.121 37.092 1.00 15.77 ? 19  LEU A CD1 1 
ATOM   151  C CD2 . LEU A 1 19 ? 3.466   34.587 38.559 1.00 10.90 ? 19  LEU A CD2 1 
ATOM   152  N N   . LYS A 1 20 ? 2.605   30.215 35.913 1.00 16.17 ? 20  LYS A N   1 
ATOM   153  C CA  . LYS A 1 20 ? 2.502   29.295 34.761 1.00 18.04 ? 20  LYS A CA  1 
ATOM   154  C C   . LYS A 1 20 ? 1.482   29.851 33.803 1.00 18.42 ? 20  LYS A C   1 
ATOM   155  O O   . LYS A 1 20 ? 0.770   30.792 34.132 1.00 19.27 ? 20  LYS A O   1 
ATOM   156  C CB  . LYS A 1 20 ? 1.842   27.980 35.125 1.00 21.16 ? 20  LYS A CB  1 
ATOM   157  C CG  . LYS A 1 20 ? 2.336   27.261 36.353 1.00 26.42 ? 20  LYS A CG  1 
ATOM   158  C CD  . LYS A 1 20 ? 3.743   26.734 36.262 1.00 34.07 ? 20  LYS A CD  1 
ATOM   159  C CE  . LYS A 1 20 ? 3.995   25.826 37.471 1.00 36.50 ? 20  LYS A CE  1 
ATOM   160  N NZ  . LYS A 1 20 ? 5.317   25.192 37.339 1.00 41.34 ? 20  LYS A NZ  1 
ATOM   161  N N   . GLU A 1 21 ? 1.351   29.215 32.642 1.00 19.69 ? 21  GLU A N   1 
ATOM   162  C CA  . GLU A 1 21 ? 0.071   29.453 31.975 1.00 19.28 ? 21  GLU A CA  1 
ATOM   163  C C   . GLU A 1 21 ? -0.750  28.203 31.811 1.00 17.46 ? 21  GLU A C   1 
ATOM   164  O O   . GLU A 1 21 ? -0.238  27.105 31.933 1.00 19.80 ? 21  GLU A O   1 
ATOM   165  C CB  . GLU A 1 21 ? 0.225   30.297 30.711 1.00 21.67 ? 21  GLU A CB  1 
ATOM   166  C CG  . GLU A 1 21 ? 1.153   29.847 29.616 1.00 23.78 ? 21  GLU A CG  1 
ATOM   167  C CD  . GLU A 1 21 ? 1.327   30.997 28.637 1.00 28.30 ? 21  GLU A CD  1 
ATOM   168  O OE1 . GLU A 1 21 ? 0.681   32.035 28.770 1.00 31.50 ? 21  GLU A OE1 1 
ATOM   169  O OE2 . GLU A 1 21 ? 2.123   30.854 27.721 1.00 33.26 ? 21  GLU A OE2 1 
ATOM   170  N N   . ALA A 1 22 ? -2.038  28.382 31.626 1.00 15.77 ? 22  ALA A N   1 
ATOM   171  C CA  . ALA A 1 22 ? -2.938  27.249 31.709 1.00 13.48 ? 22  ALA A CA  1 
ATOM   172  C C   . ALA A 1 22 ? -4.102  27.492 30.790 1.00 13.85 ? 22  ALA A C   1 
ATOM   173  O O   . ALA A 1 22 ? -4.325  28.607 30.358 1.00 15.69 ? 22  ALA A O   1 
ATOM   174  C CB  . ALA A 1 22 ? -3.425  27.092 33.145 1.00 13.11 ? 22  ALA A CB  1 
ATOM   175  N N   . LEU A 1 23 ? -4.797  26.438 30.483 1.00 12.88 ? 23  LEU A N   1 
ATOM   176  C CA  . LEU A 1 23 ? -5.936  26.441 29.580 1.00 14.80 ? 23  LEU A CA  1 
ATOM   177  C C   . LEU A 1 23 ? -7.210  26.468 30.382 1.00 14.61 ? 23  LEU A C   1 
ATOM   178  O O   . LEU A 1 23 ? -7.369  25.691 31.312 1.00 14.78 ? 23  LEU A O   1 
ATOM   179  C CB  . LEU A 1 23 ? -5.829  25.075 28.920 1.00 19.19 ? 23  LEU A CB  1 
ATOM   180  C CG  . LEU A 1 23 ? -6.449  24.801 27.577 1.00 21.05 ? 23  LEU A CG  1 
ATOM   181  C CD1 . LEU A 1 23 ? -5.835  25.729 26.552 1.00 26.14 ? 23  LEU A CD1 1 
ATOM   182  C CD2 . LEU A 1 23 ? -6.090  23.369 27.189 1.00 20.25 ? 23  LEU A CD2 1 
ATOM   183  N N   . LEU A 1 24 ? -8.129  27.340 30.020 1.00 14.81 ? 24  LEU A N   1 
ATOM   184  C CA  . LEU A 1 24 ? -9.453  27.320 30.673 1.00 13.01 ? 24  LEU A CA  1 
ATOM   185  C C   . LEU A 1 24 ? -10.301 26.271 30.050 1.00 15.39 ? 24  LEU A C   1 
ATOM   186  O O   . LEU A 1 24 ? -10.620 26.387 28.872 1.00 13.21 ? 24  LEU A O   1 
ATOM   187  C CB  . LEU A 1 24 ? -10.226 28.613 30.433 1.00 12.98 ? 24  LEU A CB  1 
ATOM   188  C CG  . LEU A 1 24 ? -9.507  29.812 30.995 1.00 12.32 ? 24  LEU A CG  1 
ATOM   189  C CD1 . LEU A 1 24 ? -10.156 31.082 30.495 1.00 16.79 ? 24  LEU A CD1 1 
ATOM   190  C CD2 . LEU A 1 24 ? -9.456  29.736 32.514 1.00 15.39 ? 24  LEU A CD2 1 
ATOM   191  N N   . ASP A 1 25 ? -10.636 25.242 30.832 1.00 16.01 ? 25  ASP A N   1 
ATOM   192  C CA  . ASP A 1 25 ? -11.128 24.057 30.175 1.00 14.67 ? 25  ASP A CA  1 
ATOM   193  C C   . ASP A 1 25 ? -12.504 23.652 30.641 1.00 17.24 ? 25  ASP A C   1 
ATOM   194  O O   . ASP A 1 25 ? -12.627 22.961 31.634 1.00 17.18 ? 25  ASP A O   1 
ATOM   195  C CB  . ASP A 1 25 ? -10.125 22.958 30.466 1.00 14.68 ? 25  ASP A CB  1 
ATOM   196  C CG  . ASP A 1 25 ? -10.378 21.721 29.651 1.00 17.90 ? 25  ASP A CG  1 
ATOM   197  O OD1 . ASP A 1 25 ? -11.466 21.525 29.120 1.00 22.14 ? 25  ASP A OD1 1 
ATOM   198  O OD2 . ASP A 1 25 ? -9.467  20.928 29.544 1.00 25.26 ? 25  ASP A OD2 1 
ATOM   199  N N   . THR A 1 26 ? -13.533 24.004 29.866 1.00 13.45 ? 26  THR A N   1 
ATOM   200  C CA  . THR A 1 26 ? -14.892 23.715 30.324 1.00 14.39 ? 26  THR A CA  1 
ATOM   201  C C   . THR A 1 26 ? -15.322 22.264 30.461 1.00 17.03 ? 26  THR A C   1 
ATOM   202  O O   . THR A 1 26 ? -16.297 21.952 31.129 1.00 18.44 ? 26  THR A O   1 
ATOM   203  C CB  . THR A 1 26 ? -15.914 24.520 29.482 1.00 15.12 ? 26  THR A CB  1 
ATOM   204  O OG1 . THR A 1 26 ? -15.928 24.143 28.107 1.00 15.75 ? 26  THR A OG1 1 
ATOM   205  C CG2 . THR A 1 26 ? -15.604 26.014 29.559 1.00 14.33 ? 26  THR A CG2 1 
ATOM   206  N N   . GLY A 1 27 ? -14.583 21.370 29.805 1.00 16.50 ? 27  GLY A N   1 
ATOM   207  C CA  . GLY A 1 27 ? -14.968 19.951 29.890 1.00 16.37 ? 27  GLY A CA  1 
ATOM   208  C C   . GLY A 1 27 ? -14.237 19.168 30.973 1.00 17.11 ? 27  GLY A C   1 
ATOM   209  O O   . GLY A 1 27 ? -14.408 17.974 31.151 1.00 18.79 ? 27  GLY A O   1 
ATOM   210  N N   . ALA A 1 28 ? -13.355 19.852 31.682 1.00 17.42 ? 28  ALA A N   1 
ATOM   211  C CA  . ALA A 1 28 ? -12.542 19.158 32.664 1.00 16.06 ? 28  ALA A CA  1 
ATOM   212  C C   . ALA A 1 28 ? -13.193 19.356 33.996 1.00 16.35 ? 28  ALA A C   1 
ATOM   213  O O   . ALA A 1 28 ? -13.466 20.466 34.413 1.00 15.81 ? 28  ALA A O   1 
ATOM   214  C CB  . ALA A 1 28 ? -11.136 19.754 32.670 1.00 10.13 ? 28  ALA A CB  1 
ATOM   215  N N   . ASP A 1 29 ? -13.469 18.260 34.691 1.00 17.73 ? 29  ASP A N   1 
ATOM   216  C CA  . ASP A 1 29 ? -14.138 18.515 35.975 1.00 18.31 ? 29  ASP A CA  1 
ATOM   217  C C   . ASP A 1 29 ? -13.213 19.106 36.988 1.00 17.80 ? 29  ASP A C   1 
ATOM   218  O O   . ASP A 1 29 ? -13.605 19.931 37.783 1.00 19.61 ? 29  ASP A O   1 
ATOM   219  C CB  . ASP A 1 29 ? -14.697 17.270 36.641 1.00 17.55 ? 29  ASP A CB  1 
ATOM   220  C CG  . ASP A 1 29 ? -15.800 16.614 35.855 1.00 23.19 ? 29  ASP A CG  1 
ATOM   221  O OD1 . ASP A 1 29 ? -16.550 17.262 35.117 1.00 22.54 ? 29  ASP A OD1 1 
ATOM   222  O OD2 . ASP A 1 29 ? -15.913 15.406 36.000 1.00 30.10 ? 29  ASP A OD2 1 
ATOM   223  N N   . ASP A 1 30 ? -11.971 18.641 36.934 1.00 19.45 ? 30  ASP A N   1 
ATOM   224  C CA  . ASP A 1 30 ? -10.976 18.991 37.944 1.00 18.68 ? 30  ASP A CA  1 
ATOM   225  C C   . ASP A 1 30 ? -9.825  19.745 37.318 1.00 17.11 ? 30  ASP A C   1 
ATOM   226  O O   . ASP A 1 30 ? -9.665  19.692 36.118 1.00 18.60 ? 30  ASP A O   1 
ATOM   227  C CB  . ASP A 1 30 ? -10.439 17.685 38.518 1.00 20.53 ? 30  ASP A CB  1 
ATOM   228  C CG  . ASP A 1 30 ? -11.414 17.042 39.474 1.00 26.17 ? 30  ASP A CG  1 
ATOM   229  O OD1 . ASP A 1 30 ? -12.236 17.751 40.060 1.00 29.99 ? 30  ASP A OD1 1 
ATOM   230  O OD2 . ASP A 1 30 ? -11.341 15.822 39.646 1.00 30.25 ? 30  ASP A OD2 1 
ATOM   231  N N   . THR A 1 31 ? -9.037  20.433 38.118 1.00 14.80 ? 31  THR A N   1 
ATOM   232  C CA  . THR A 1 31 ? -7.853  21.118 37.604 1.00 11.47 ? 31  THR A CA  1 
ATOM   233  C C   . THR A 1 31 ? -6.662  20.245 37.714 1.00 10.52 ? 31  THR A C   1 
ATOM   234  O O   . THR A 1 31 ? -6.408  19.673 38.756 1.00 10.40 ? 31  THR A O   1 
ATOM   235  C CB  . THR A 1 31 ? -7.664  22.348 38.499 1.00 14.27 ? 31  THR A CB  1 
ATOM   236  O OG1 . THR A 1 31 ? -8.809  23.216 38.328 1.00 14.15 ? 31  THR A OG1 1 
ATOM   237  C CG2 . THR A 1 31 ? -6.335  23.077 38.261 1.00 9.12  ? 31  THR A CG2 1 
ATOM   238  N N   . VAL A 1 32 ? -5.921  20.136 36.645 1.00 13.18 ? 32  VAL A N   1 
ATOM   239  C CA  . VAL A 1 32 ? -4.750  19.256 36.703 1.00 14.81 ? 32  VAL A CA  1 
ATOM   240  C C   . VAL A 1 32 ? -3.565  20.063 36.214 1.00 18.06 ? 32  VAL A C   1 
ATOM   241  O O   . VAL A 1 32 ? -3.633  20.773 35.216 1.00 17.69 ? 32  VAL A O   1 
ATOM   242  C CB  . VAL A 1 32 ? -4.902  18.028 35.785 1.00 14.10 ? 32  VAL A CB  1 
ATOM   243  C CG1 . VAL A 1 32 ? -3.805  16.993 36.034 1.00 13.19 ? 32  VAL A CG1 1 
ATOM   244  C CG2 . VAL A 1 32 ? -6.270  17.378 35.953 1.00 15.01 ? 32  VAL A CG2 1 
ATOM   245  N N   . LEU A 1 33 ? -2.496  19.973 36.975 1.00 16.62 ? 33  LEU A N   1 
ATOM   246  C CA  . LEU A 1 33 ? -1.332  20.763 36.679 1.00 19.00 ? 33  LEU A CA  1 
ATOM   247  C C   . LEU A 1 33 ? -0.154  19.831 36.447 1.00 21.53 ? 33  LEU A C   1 
ATOM   248  O O   . LEU A 1 33 ? -0.112  18.722 36.962 1.00 19.82 ? 33  LEU A O   1 
ATOM   249  C CB  . LEU A 1 33 ? -1.129  21.648 37.902 1.00 20.67 ? 33  LEU A CB  1 
ATOM   250  C CG  . LEU A 1 33 ? -2.229  22.679 38.201 1.00 18.51 ? 33  LEU A CG  1 
ATOM   251  C CD1 . LEU A 1 33 ? -1.911  23.335 39.538 1.00 20.17 ? 33  LEU A CD1 1 
ATOM   252  C CD2 . LEU A 1 33 ? -2.314  23.777 37.141 1.00 18.93 ? 33  LEU A CD2 1 
ATOM   253  N N   . GLU A 1 34 ? 0.796   20.272 35.626 1.00 24.50 ? 34  GLU A N   1 
ATOM   254  C CA  . GLU A 1 34 ? 1.950   19.414 35.448 1.00 27.06 ? 34  GLU A CA  1 
ATOM   255  C C   . GLU A 1 34 ? 2.726   19.396 36.738 1.00 27.86 ? 34  GLU A C   1 
ATOM   256  O O   . GLU A 1 34 ? 2.489   20.160 37.658 1.00 26.25 ? 34  GLU A O   1 
ATOM   257  C CB  . GLU A 1 34 ? 2.837   19.930 34.316 1.00 30.45 ? 34  GLU A CB  1 
ATOM   258  C CG  . GLU A 1 34 ? 3.408   18.875 33.310 1.00 42.31 ? 34  GLU A CG  1 
ATOM   259  C CD  . GLU A 1 34 ? 4.130   17.603 33.853 1.00 45.14 ? 34  GLU A CD  1 
ATOM   260  O OE1 . GLU A 1 34 ? 5.159   17.710 34.537 1.00 47.04 ? 34  GLU A OE1 1 
ATOM   261  O OE2 . GLU A 1 34 ? 3.672   16.493 33.552 1.00 45.08 ? 34  GLU A OE2 1 
ATOM   262  N N   . GLU A 1 35 ? 3.653   18.459 36.793 1.00 30.50 ? 35  GLU A N   1 
ATOM   263  C CA  . GLU A 1 35 ? 4.488   18.308 37.965 1.00 32.01 ? 35  GLU A CA  1 
ATOM   264  C C   . GLU A 1 35 ? 5.131   19.586 38.387 1.00 33.94 ? 35  GLU A C   1 
ATOM   265  O O   . GLU A 1 35 ? 5.682   20.335 37.587 1.00 34.09 ? 35  GLU A O   1 
ATOM   266  C CB  . GLU A 1 35 ? 5.612   17.313 37.706 1.00 34.98 ? 35  GLU A CB  1 
ATOM   267  C CG  . GLU A 1 35 ? 5.218   15.855 37.943 1.00 37.43 ? 35  GLU A CG  1 
ATOM   268  C CD  . GLU A 1 35 ? 4.769   15.665 39.372 1.00 38.18 ? 35  GLU A CD  1 
ATOM   269  O OE1 . GLU A 1 35 ? 5.367   16.259 40.287 1.00 36.75 ? 35  GLU A OE1 1 
ATOM   270  O OE2 . GLU A 1 35 ? 3.809   14.917 39.553 1.00 39.89 ? 35  GLU A OE2 1 
ATOM   271  N N   . MET A 1 36 ? 5.027   19.763 39.698 1.00 34.83 ? 36  MET A N   1 
ATOM   272  C CA  . MET A 1 36 ? 5.316   21.027 40.333 1.00 35.75 ? 36  MET A CA  1 
ATOM   273  C C   . MET A 1 36 ? 5.522   20.816 41.824 1.00 37.46 ? 36  MET A C   1 
ATOM   274  O O   . MET A 1 36 ? 4.873   19.978 42.446 1.00 37.19 ? 36  MET A O   1 
ATOM   275  C CB  . MET A 1 36 ? 4.068   21.835 40.089 1.00 34.21 ? 36  MET A CB  1 
ATOM   276  C CG  . MET A 1 36 ? 4.231   23.310 40.326 1.00 34.25 ? 36  MET A CG  1 
ATOM   277  S SD  . MET A 1 36 ? 2.621   23.989 40.139 1.00 34.41 ? 36  MET A SD  1 
ATOM   278  C CE  . MET A 1 36 ? 1.687   22.670 40.905 1.00 28.90 ? 36  MET A CE  1 
ATOM   279  N N   . SER A 1 37 ? 6.462   21.587 42.384 1.00 38.88 ? 37  SER A N   1 
ATOM   280  C CA  . SER A 1 37 ? 6.677   21.525 43.826 1.00 38.98 ? 37  SER A CA  1 
ATOM   281  C C   . SER A 1 37 ? 5.564   22.247 44.515 1.00 38.18 ? 37  SER A C   1 
ATOM   282  O O   . SER A 1 37 ? 5.497   23.465 44.510 1.00 35.81 ? 37  SER A O   1 
ATOM   283  C CB  . SER A 1 37 ? 8.025   22.194 44.202 1.00 42.88 ? 37  SER A CB  1 
ATOM   284  O OG  . SER A 1 37 ? 8.421   23.236 43.273 1.00 49.08 ? 37  SER A OG  1 
ATOM   285  N N   . LEU A 1 38 ? 4.683   21.463 45.098 1.00 39.03 ? 38  LEU A N   1 
ATOM   286  C CA  . LEU A 1 38 ? 3.803   22.082 46.072 1.00 38.82 ? 38  LEU A CA  1 
ATOM   287  C C   . LEU A 1 38 ? 4.118   21.498 47.433 1.00 42.59 ? 38  LEU A C   1 
ATOM   288  O O   . LEU A 1 38 ? 4.363   20.302 47.600 1.00 43.92 ? 38  LEU A O   1 
ATOM   289  C CB  . LEU A 1 38 ? 2.342   21.842 45.738 1.00 35.96 ? 38  LEU A CB  1 
ATOM   290  C CG  . LEU A 1 38 ? 1.906   22.542 44.471 1.00 32.61 ? 38  LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 38 ? 0.456   22.190 44.213 1.00 32.64 ? 38  LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 38 ? 2.140   24.048 44.542 1.00 31.78 ? 38  LEU A CD2 1 
ATOM   293  N N   . PRO A 1 39 ? 4.148   22.403 48.400 1.00 41.64 ? 39  PRO A N   1 
ATOM   294  C CA  . PRO A 1 39 ? 4.386   21.917 49.742 1.00 43.36 ? 39  PRO A CA  1 
ATOM   295  C C   . PRO A 1 39 ? 3.107   21.256 50.248 1.00 45.16 ? 39  PRO A C   1 
ATOM   296  O O   . PRO A 1 39 ? 2.008   21.553 49.790 1.00 45.44 ? 39  PRO A O   1 
ATOM   297  C CB  . PRO A 1 39 ? 4.721   23.240 50.438 1.00 41.90 ? 39  PRO A CB  1 
ATOM   298  C CG  . PRO A 1 39 ? 3.857   24.302 49.759 1.00 42.69 ? 39  PRO A CG  1 
ATOM   299  C CD  . PRO A 1 39 ? 3.901   23.844 48.311 1.00 41.67 ? 39  PRO A CD  1 
ATOM   300  N N   . GLY A 1 40 ? 3.275   20.376 51.225 1.00 46.60 ? 40  GLY A N   1 
ATOM   301  C CA  . GLY A 1 40 ? 2.081   19.908 51.915 1.00 47.13 ? 40  GLY A CA  1 
ATOM   302  C C   . GLY A 1 40 ? 1.768   18.442 51.769 1.00 47.76 ? 40  GLY A C   1 
ATOM   303  O O   . GLY A 1 40 ? 2.540   17.611 51.307 1.00 47.77 ? 40  GLY A O   1 
ATOM   304  N N   . ARG A 1 41 ? 0.565   18.162 52.254 1.00 48.78 ? 41  ARG A N   1 
ATOM   305  C CA  . ARG A 1 41 ? 0.050   16.795 52.220 1.00 50.61 ? 41  ARG A CA  1 
ATOM   306  C C   . ARG A 1 41 ? -0.602  16.571 50.889 1.00 48.72 ? 41  ARG A C   1 
ATOM   307  O O   . ARG A 1 41 ? -1.063  17.509 50.261 1.00 49.66 ? 41  ARG A O   1 
ATOM   308  C CB  . ARG A 1 41 ? -1.007  16.614 53.334 1.00 54.67 ? 41  ARG A CB  1 
ATOM   309  C CG  . ARG A 1 41 ? -2.065  17.734 53.478 1.00 59.27 ? 41  ARG A CG  1 
ATOM   310  C CD  . ARG A 1 41 ? -3.528  17.346 53.183 1.00 62.61 ? 41  ARG A CD  1 
ATOM   311  N NE  . ARG A 1 41 ? -3.727  17.009 51.768 1.00 64.99 ? 41  ARG A NE  1 
ATOM   312  C CZ  . ARG A 1 41 ? -4.948  16.971 51.217 1.00 64.69 ? 41  ARG A CZ  1 
ATOM   313  N NH1 . ARG A 1 41 ? -6.044  17.217 51.944 1.00 63.26 ? 41  ARG A NH1 1 
ATOM   314  N NH2 . ARG A 1 41 ? -5.058  16.677 49.917 1.00 63.42 ? 41  ARG A NH2 1 
ATOM   315  N N   . TRP A 1 42 ? -0.670  15.322 50.494 1.00 46.33 ? 42  TRP A N   1 
ATOM   316  C CA  . TRP A 1 42 ? -1.427  15.046 49.296 1.00 44.78 ? 42  TRP A CA  1 
ATOM   317  C C   . TRP A 1 42 ? -1.818  13.598 49.279 1.00 45.78 ? 42  TRP A C   1 
ATOM   318  O O   . TRP A 1 42 ? -1.184  12.745 49.883 1.00 46.20 ? 42  TRP A O   1 
ATOM   319  C CB  . TRP A 1 42 ? -0.593  15.396 48.081 1.00 44.48 ? 42  TRP A CB  1 
ATOM   320  C CG  . TRP A 1 42 ? 0.746   14.713 48.136 1.00 44.73 ? 42  TRP A CG  1 
ATOM   321  C CD1 . TRP A 1 42 ? 1.963   15.269 48.574 1.00 45.27 ? 42  TRP A CD1 1 
ATOM   322  C CD2 . TRP A 1 42 ? 1.043   13.430 47.668 1.00 45.32 ? 42  TRP A CD2 1 
ATOM   323  N NE1 . TRP A 1 42 ? 3.015   14.420 48.383 1.00 45.83 ? 42  TRP A NE1 1 
ATOM   324  C CE2 . TRP A 1 42 ? 2.519   13.270 47.817 1.00 45.94 ? 42  TRP A CE2 1 
ATOM   325  C CE3 . TRP A 1 42 ? 0.274   12.387 47.124 1.00 46.17 ? 42  TRP A CE3 1 
ATOM   326  C CZ2 . TRP A 1 42 ? 3.113   12.071 47.381 1.00 48.49 ? 42  TRP A CZ2 1 
ATOM   327  C CZ3 . TRP A 1 42 ? 0.918   11.202 46.706 1.00 48.37 ? 42  TRP A CZ3 1 
ATOM   328  C CH2 . TRP A 1 42 ? 2.316   11.044 46.826 1.00 47.17 ? 42  TRP A CH2 1 
ATOM   329  N N   . LYS A 1 43 ? -2.911  13.361 48.586 1.00 45.34 ? 43  LYS A N   1 
ATOM   330  C CA  . LYS A 1 43 ? -3.487  12.026 48.484 1.00 43.30 ? 43  LYS A CA  1 
ATOM   331  C C   . LYS A 1 43 ? -3.350  11.610 47.034 1.00 42.26 ? 43  LYS A C   1 
ATOM   332  O O   . LYS A 1 43 ? -3.579  12.431 46.158 1.00 42.99 ? 43  LYS A O   1 
ATOM   333  C CB  . LYS A 1 43 ? -4.970  12.154 48.849 1.00 42.80 ? 43  LYS A CB  1 
ATOM   334  C CG  . LYS A 1 43 ? -5.207  12.680 50.269 1.00 44.95 ? 43  LYS A CG  1 
ATOM   335  C CD  . LYS A 1 43 ? -6.625  13.235 50.472 1.00 46.57 ? 43  LYS A CD  1 
ATOM   336  C CE  . LYS A 1 43 ? -6.897  13.816 51.877 1.00 47.54 ? 43  LYS A CE  1 
ATOM   337  N NZ  . LYS A 1 43 ? -8.187  14.546 51.908 1.00 46.78 ? 43  LYS A NZ  1 
ATOM   338  N N   . PRO A 1 44 ? -2.942  10.361 46.784 1.00 41.48 ? 44  PRO A N   1 
ATOM   339  C CA  . PRO A 1 44 ? -2.907  9.899  45.382 1.00 39.17 ? 44  PRO A CA  1 
ATOM   340  C C   . PRO A 1 44 ? -4.309  9.674  44.832 1.00 39.66 ? 44  PRO A C   1 
ATOM   341  O O   . PRO A 1 44 ? -5.169  9.105  45.491 1.00 39.91 ? 44  PRO A O   1 
ATOM   342  C CB  . PRO A 1 44 ? -2.144  8.582  45.532 1.00 39.66 ? 44  PRO A CB  1 
ATOM   343  C CG  . PRO A 1 44 ? -2.468  8.067  46.936 1.00 36.95 ? 44  PRO A CG  1 
ATOM   344  C CD  . PRO A 1 44 ? -2.544  9.339  47.762 1.00 37.51 ? 44  PRO A CD  1 
ATOM   345  N N   . LYS A 1 45 ? -4.534  10.114 43.606 1.00 38.33 ? 45  LYS A N   1 
ATOM   346  C CA  . LYS A 1 45 ? -5.805  9.711  43.017 1.00 37.74 ? 45  LYS A CA  1 
ATOM   347  C C   . LYS A 1 45 ? -5.627  9.481  41.542 1.00 35.31 ? 45  LYS A C   1 
ATOM   348  O O   . LYS A 1 45 ? -4.561  9.732  41.003 1.00 37.42 ? 45  LYS A O   1 
ATOM   349  C CB  . LYS A 1 45 ? -6.998  10.624 43.432 1.00 38.81 ? 45  LYS A CB  1 
ATOM   350  C CG  . LYS A 1 45 ? -7.419  11.859 42.624 1.00 41.99 ? 45  LYS A CG  1 
ATOM   351  C CD  . LYS A 1 45 ? -8.903  12.177 42.908 1.00 44.47 ? 45  LYS A CD  1 
ATOM   352  C CE  . LYS A 1 45 ? -9.565  13.074 41.847 1.00 46.89 ? 45  LYS A CE  1 
ATOM   353  N NZ  . LYS A 1 45 ? -11.040 13.090 41.989 1.00 47.67 ? 45  LYS A NZ  1 
ATOM   354  N N   . MET A 1 46 ? -6.641  8.939  40.898 1.00 33.02 ? 46  MET A N   1 
ATOM   355  C CA  . MET A 1 46 ? -6.513  8.728  39.461 1.00 32.52 ? 46  MET A CA  1 
ATOM   356  C C   . MET A 1 46 ? -7.622  9.470  38.782 1.00 29.72 ? 46  MET A C   1 
ATOM   357  O O   . MET A 1 46 ? -8.707  9.580  39.328 1.00 31.95 ? 46  MET A O   1 
ATOM   358  C CB  . MET A 1 46 ? -6.647  7.250  39.163 1.00 33.32 ? 46  MET A CB  1 
ATOM   359  C CG  . MET A 1 46 ? -5.375  6.550  39.583 1.00 39.15 ? 46  MET A CG  1 
ATOM   360  S SD  . MET A 1 46 ? -5.656  4.796  39.697 1.00 46.76 ? 46  MET A SD  1 
ATOM   361  C CE  . MET A 1 46 ? -6.011  4.691  41.465 1.00 44.46 ? 46  MET A CE  1 
ATOM   362  N N   . ILE A 1 47 ? -7.334  9.989  37.608 1.00 26.60 ? 47  ILE A N   1 
ATOM   363  C CA  . ILE A 1 47 ? -8.416  10.596 36.860 1.00 22.46 ? 47  ILE A CA  1 
ATOM   364  C C   . ILE A 1 47 ? -8.388  9.977  35.510 1.00 20.01 ? 47  ILE A C   1 
ATOM   365  O O   . ILE A 1 47 ? -7.398  9.371  35.132 1.00 19.64 ? 47  ILE A O   1 
ATOM   366  C CB  . ILE A 1 47 ? -8.219  12.120 36.744 1.00 22.51 ? 47  ILE A CB  1 
ATOM   367  C CG1 . ILE A 1 47 ? -6.851  12.541 36.268 1.00 21.15 ? 47  ILE A CG1 1 
ATOM   368  C CG2 . ILE A 1 47 ? -8.517  12.890 38.042 1.00 22.62 ? 47  ILE A CG2 1 
ATOM   369  C CD1 . ILE A 1 47 ? -7.024  13.888 35.583 1.00 16.61 ? 47  ILE A CD1 1 
ATOM   370  N N   . GLY A 1 48 ? -9.475  10.128 34.790 1.00 19.69 ? 48  GLY A N   1 
ATOM   371  C CA  . GLY A 1 48 ? -9.450  9.680  33.403 1.00 20.39 ? 48  GLY A CA  1 
ATOM   372  C C   . GLY A 1 48 ? -9.446  10.854 32.437 1.00 22.43 ? 48  GLY A C   1 
ATOM   373  O O   . GLY A 1 48 ? -9.819  11.972 32.769 1.00 23.40 ? 48  GLY A O   1 
ATOM   374  N N   . GLY A 1 49 ? -9.004  10.544 31.236 1.00 24.68 ? 49  GLY A N   1 
ATOM   375  C CA  . GLY A 1 49 ? -8.974  11.484 30.120 1.00 25.58 ? 49  GLY A CA  1 
ATOM   376  C C   . GLY A 1 49 ? -9.303  10.748 28.833 1.00 25.61 ? 49  GLY A C   1 
ATOM   377  O O   . GLY A 1 49 ? -9.712  9.599  28.768 1.00 22.79 ? 49  GLY A O   1 
ATOM   378  N N   . ILE A 1 50 ? -9.096  11.430 27.736 1.00 28.56 ? 50  ILE A N   1 
ATOM   379  C CA  . ILE A 1 50 ? -9.139  10.619 26.530 1.00 31.29 ? 50  ILE A CA  1 
ATOM   380  C C   . ILE A 1 50 ? -7.779  9.992  26.505 1.00 34.88 ? 50  ILE A C   1 
ATOM   381  O O   . ILE A 1 50 ? -6.791  10.645 26.806 1.00 38.64 ? 50  ILE A O   1 
ATOM   382  C CB  . ILE A 1 50 ? -9.361  11.579 25.364 1.00 29.14 ? 50  ILE A CB  1 
ATOM   383  C CG1 . ILE A 1 50 ? -10.843 11.552 25.022 1.00 32.42 ? 50  ILE A CG1 1 
ATOM   384  C CG2 . ILE A 1 50 ? -8.552  11.263 24.110 1.00 32.15 ? 50  ILE A CG2 1 
ATOM   385  C CD1 . ILE A 1 50 ? -11.288 12.568 23.965 1.00 30.03 ? 50  ILE A CD1 1 
ATOM   386  N N   . GLY A 1 51 ? -7.723  8.735  26.157 1.00 35.49 ? 51  GLY A N   1 
ATOM   387  C CA  . GLY A 1 51 ? -6.374  8.191  26.226 1.00 35.17 ? 51  GLY A CA  1 
ATOM   388  C C   . GLY A 1 51 ? -6.143  7.308  27.445 1.00 36.27 ? 51  GLY A C   1 
ATOM   389  O O   . GLY A 1 51 ? -5.332  6.403  27.385 1.00 39.21 ? 51  GLY A O   1 
ATOM   390  N N   . GLY A 1 52 ? -6.868  7.532  28.540 1.00 33.27 ? 52  GLY A N   1 
ATOM   391  C CA  . GLY A 1 52 ? -6.582  6.627  29.639 1.00 30.57 ? 52  GLY A CA  1 
ATOM   392  C C   . GLY A 1 52 ? -6.730  7.308  30.961 1.00 30.19 ? 52  GLY A C   1 
ATOM   393  O O   . GLY A 1 52 ? -7.440  8.300  31.053 1.00 28.93 ? 52  GLY A O   1 
ATOM   394  N N   . PHE A 1 53 ? -6.087  6.720  31.969 1.00 29.11 ? 53  PHE A N   1 
ATOM   395  C CA  . PHE A 1 53 ? -6.199  7.209  33.342 1.00 28.42 ? 53  PHE A CA  1 
ATOM   396  C C   . PHE A 1 53 ? -4.833  7.671  33.702 1.00 27.20 ? 53  PHE A C   1 
ATOM   397  O O   . PHE A 1 53 ? -3.901  7.223  33.068 1.00 32.71 ? 53  PHE A O   1 
ATOM   398  C CB  . PHE A 1 53 ? -6.598  6.072  34.279 1.00 28.71 ? 53  PHE A CB  1 
ATOM   399  C CG  . PHE A 1 53 ? -8.108  6.020  34.509 1.00 36.75 ? 53  PHE A CG  1 
ATOM   400  C CD1 . PHE A 1 53 ? -9.009  5.700  33.460 1.00 36.86 ? 53  PHE A CD1 1 
ATOM   401  C CD2 . PHE A 1 53 ? -8.635  6.314  35.794 1.00 37.81 ? 53  PHE A CD2 1 
ATOM   402  C CE1 . PHE A 1 53 ? -10.410 5.689  33.698 1.00 36.91 ? 53  PHE A CE1 1 
ATOM   403  C CE2 . PHE A 1 53 ? -10.034 6.303  36.025 1.00 37.67 ? 53  PHE A CE2 1 
ATOM   404  C CZ  . PHE A 1 53 ? -10.921 5.993  34.976 1.00 34.54 ? 53  PHE A CZ  1 
ATOM   405  N N   . ILE A 1 54 ? -4.694  8.541  34.682 1.00 26.85 ? 54  ILE A N   1 
ATOM   406  C CA  . ILE A 1 54 ? -3.355  8.901  35.146 1.00 26.34 ? 54  ILE A CA  1 
ATOM   407  C C   . ILE A 1 54 ? -3.408  9.039  36.629 1.00 27.47 ? 54  ILE A C   1 
ATOM   408  O O   . ILE A 1 54 ? -4.434  9.431  37.166 1.00 27.46 ? 54  ILE A O   1 
ATOM   409  C CB  . ILE A 1 54 ? -2.830  10.245 34.598 1.00 28.28 ? 54  ILE A CB  1 
ATOM   410  C CG1 . ILE A 1 54 ? -3.655  11.525 34.845 1.00 29.21 ? 54  ILE A CG1 1 
ATOM   411  C CG2 . ILE A 1 54 ? -2.455  10.128 33.126 1.00 30.41 ? 54  ILE A CG2 1 
ATOM   412  C CD1 . ILE A 1 54 ? -2.872  12.814 34.533 1.00 24.55 ? 54  ILE A CD1 1 
ATOM   413  N N   . LYS A 1 55 ? -2.305  8.686  37.274 1.00 28.45 ? 55  LYS A N   1 
ATOM   414  C CA  . LYS A 1 55 ? -2.272  8.776  38.739 1.00 31.30 ? 55  LYS A CA  1 
ATOM   415  C C   . LYS A 1 55 ? -1.702  10.108 39.078 1.00 29.14 ? 55  LYS A C   1 
ATOM   416  O O   . LYS A 1 55 ? -0.805  10.575 38.395 1.00 29.08 ? 55  LYS A O   1 
ATOM   417  C CB  . LYS A 1 55 ? -1.331  7.724  39.333 1.00 34.38 ? 55  LYS A CB  1 
ATOM   418  C CG  . LYS A 1 55 ? -1.864  6.316  39.097 1.00 42.51 ? 55  LYS A CG  1 
ATOM   419  C CD  . LYS A 1 55 ? -0.768  5.241  39.013 1.00 49.42 ? 55  LYS A CD  1 
ATOM   420  C CE  . LYS A 1 55 ? -0.665  4.593  37.614 1.00 52.94 ? 55  LYS A CE  1 
ATOM   421  N NZ  . LYS A 1 55 ? -0.303  5.581  36.574 1.00 55.46 ? 55  LYS A NZ  1 
ATOM   422  N N   . VAL A 1 56 ? -2.254  10.705 40.106 1.00 26.77 ? 56  VAL A N   1 
ATOM   423  C CA  . VAL A 1 56 ? -2.053  12.127 40.266 1.00 26.24 ? 56  VAL A CA  1 
ATOM   424  C C   . VAL A 1 56 ? -2.007  12.353 41.753 1.00 26.27 ? 56  VAL A C   1 
ATOM   425  O O   . VAL A 1 56 ? -2.475  11.506 42.492 1.00 26.08 ? 56  VAL A O   1 
ATOM   426  C CB  . VAL A 1 56 ? -3.293  12.693 39.547 1.00 27.97 ? 56  VAL A CB  1 
ATOM   427  C CG1 . VAL A 1 56 ? -4.472  13.107 40.435 1.00 25.19 ? 56  VAL A CG1 1 
ATOM   428  C CG2 . VAL A 1 56 ? -2.877  13.669 38.462 1.00 26.80 ? 56  VAL A CG2 1 
ATOM   429  N N   . ARG A 1 57 ? -1.457  13.472 42.201 1.00 27.53 ? 57  ARG A N   1 
ATOM   430  C CA  . ARG A 1 57 ? -1.584  13.779 43.632 1.00 27.76 ? 57  ARG A CA  1 
ATOM   431  C C   . ARG A 1 57 ? -2.519  14.944 43.817 1.00 28.76 ? 57  ARG A C   1 
ATOM   432  O O   . ARG A 1 57 ? -2.444  15.941 43.110 1.00 26.26 ? 57  ARG A O   1 
ATOM   433  C CB  . ARG A 1 57 ? -0.232  14.180 44.189 1.00 30.24 ? 57  ARG A CB  1 
ATOM   434  C CG  . ARG A 1 57 ? 0.802   13.161 43.691 1.00 38.70 ? 57  ARG A CG  1 
ATOM   435  C CD  . ARG A 1 57 ? 2.230   13.509 44.076 1.00 44.07 ? 57  ARG A CD  1 
ATOM   436  N NE  . ARG A 1 57 ? 2.460   14.893 43.703 1.00 50.08 ? 57  ARG A NE  1 
ATOM   437  C CZ  . ARG A 1 57 ? 3.479   15.573 44.202 1.00 53.59 ? 57  ARG A CZ  1 
ATOM   438  N NH1 . ARG A 1 57 ? 4.357   14.982 45.028 1.00 55.76 ? 57  ARG A NH1 1 
ATOM   439  N NH2 . ARG A 1 57 ? 3.602   16.863 43.858 1.00 55.28 ? 57  ARG A NH2 1 
ATOM   440  N N   . GLN A 1 58 ? -3.423  14.773 44.763 1.00 27.08 ? 58  GLN A N   1 
ATOM   441  C CA  . GLN A 1 58 ? -4.422  15.781 45.038 1.00 25.18 ? 58  GLN A CA  1 
ATOM   442  C C   . GLN A 1 58 ? -4.010  16.615 46.237 1.00 27.51 ? 58  GLN A C   1 
ATOM   443  O O   . GLN A 1 58 ? -3.738  16.084 47.312 1.00 25.80 ? 58  GLN A O   1 
ATOM   444  C CB  . GLN A 1 58 ? -5.692  15.017 45.356 1.00 26.62 ? 58  GLN A CB  1 
ATOM   445  C CG  . GLN A 1 58 ? -6.789  15.930 45.862 1.00 29.85 ? 58  GLN A CG  1 
ATOM   446  C CD  . GLN A 1 58 ? -7.962  15.105 46.278 1.00 33.76 ? 58  GLN A CD  1 
ATOM   447  O OE1 . GLN A 1 58 ? -8.049  13.925 46.001 1.00 39.25 ? 58  GLN A OE1 1 
ATOM   448  N NE2 . GLN A 1 58 ? -8.897  15.751 46.956 1.00 31.77 ? 58  GLN A NE2 1 
ATOM   449  N N   . TYR A 1 59 ? -3.998  17.939 46.011 1.00 27.43 ? 59  TYR A N   1 
ATOM   450  C CA  . TYR A 1 59 ? -3.703  18.915 47.061 1.00 24.29 ? 59  TYR A CA  1 
ATOM   451  C C   . TYR A 1 59 ? -4.960  19.691 47.341 1.00 23.73 ? 59  TYR A C   1 
ATOM   452  O O   . TYR A 1 59 ? -5.632  20.180 46.449 1.00 23.18 ? 59  TYR A O   1 
ATOM   453  C CB  . TYR A 1 59 ? -2.649  19.903 46.550 1.00 22.10 ? 59  TYR A CB  1 
ATOM   454  C CG  . TYR A 1 59 ? -1.238  19.349 46.514 1.00 22.85 ? 59  TYR A CG  1 
ATOM   455  C CD1 . TYR A 1 59 ? -0.764  18.576 45.423 1.00 20.81 ? 59  TYR A CD1 1 
ATOM   456  C CD2 . TYR A 1 59 ? -0.363  19.709 47.558 1.00 25.21 ? 59  TYR A CD2 1 
ATOM   457  C CE1 . TYR A 1 59 ? 0.594   18.194 45.363 1.00 25.26 ? 59  TYR A CE1 1 
ATOM   458  C CE2 . TYR A 1 59 ? 0.993   19.329 47.504 1.00 26.87 ? 59  TYR A CE2 1 
ATOM   459  C CZ  . TYR A 1 59 ? 1.467   18.587 46.400 1.00 27.60 ? 59  TYR A CZ  1 
ATOM   460  O OH  . TYR A 1 59 ? 2.817   18.309 46.311 1.00 33.29 ? 59  TYR A OH  1 
ATOM   461  N N   . ASP A 1 60 ? -5.330  19.776 48.593 1.00 24.19 ? 60  ASP A N   1 
ATOM   462  C CA  . ASP A 1 60 ? -6.541  20.545 48.834 1.00 27.50 ? 60  ASP A CA  1 
ATOM   463  C C   . ASP A 1 60 ? -6.199  21.918 49.297 1.00 30.30 ? 60  ASP A C   1 
ATOM   464  O O   . ASP A 1 60 ? -5.077  22.207 49.669 1.00 33.62 ? 60  ASP A O   1 
ATOM   465  C CB  . ASP A 1 60 ? -7.386  19.891 49.914 1.00 31.50 ? 60  ASP A CB  1 
ATOM   466  C CG  . ASP A 1 60 ? -8.032  18.625 49.391 1.00 35.44 ? 60  ASP A CG  1 
ATOM   467  O OD1 . ASP A 1 60 ? -7.411  17.907 48.602 1.00 35.00 ? 60  ASP A OD1 1 
ATOM   468  O OD2 . ASP A 1 60 ? -9.177  18.363 49.778 1.00 41.22 ? 60  ASP A OD2 1 
ATOM   469  N N   . GLN A 1 61 ? -7.216  22.750 49.278 1.00 30.50 ? 61  GLN A N   1 
ATOM   470  C CA  . GLN A 1 61 ? -7.147  24.108 49.800 1.00 31.70 ? 61  GLN A CA  1 
ATOM   471  C C   . GLN A 1 61 ? -5.940  24.925 49.329 1.00 30.99 ? 61  GLN A C   1 
ATOM   472  O O   . GLN A 1 61 ? -5.325  25.709 50.039 1.00 28.26 ? 61  GLN A O   1 
ATOM   473  C CB  . GLN A 1 61 ? -7.338  24.037 51.329 1.00 33.60 ? 61  GLN A CB  1 
ATOM   474  C CG  . GLN A 1 61 ? -7.771  25.344 52.033 1.00 42.20 ? 61  GLN A CG  1 
ATOM   475  C CD  . GLN A 1 61 ? -9.262  25.574 51.961 1.00 46.76 ? 61  GLN A CD  1 
ATOM   476  O OE1 . GLN A 1 61 ? -10.008 24.809 51.360 1.00 49.80 ? 61  GLN A OE1 1 
ATOM   477  N NE2 . GLN A 1 61 ? -9.673  26.696 52.558 1.00 45.72 ? 61  GLN A NE2 1 
ATOM   478  N N   . ILE A 1 62 ? -5.633  24.750 48.036 1.00 30.98 ? 62  ILE A N   1 
ATOM   479  C CA  . ILE A 1 62 ? -4.563  25.589 47.471 1.00 27.22 ? 62  ILE A CA  1 
ATOM   480  C C   . ILE A 1 62 ? -5.023  26.870 46.753 1.00 22.97 ? 62  ILE A C   1 
ATOM   481  O O   . ILE A 1 62 ? -6.001  26.921 46.018 1.00 21.53 ? 62  ILE A O   1 
ATOM   482  C CB  . ILE A 1 62 ? -3.534  24.738 46.686 1.00 26.20 ? 62  ILE A CB  1 
ATOM   483  C CG1 . ILE A 1 62 ? -2.958  25.335 45.415 1.00 25.33 ? 62  ILE A CG1 1 
ATOM   484  C CG2 . ILE A 1 62 ? -3.965  23.297 46.440 1.00 26.46 ? 62  ILE A CG2 1 
ATOM   485  C CD1 . ILE A 1 62 ? -1.449  25.134 45.438 1.00 32.39 ? 62  ILE A CD1 1 
ATOM   486  N N   . LEU A 1 63 ? -4.297  27.931 47.078 1.00 18.10 ? 63  LEU A N   1 
ATOM   487  C CA  . LEU A 1 63 ? -4.594  29.253 46.558 1.00 19.47 ? 63  LEU A CA  1 
ATOM   488  C C   . LEU A 1 63 ? -4.034  29.320 45.178 1.00 16.57 ? 63  LEU A C   1 
ATOM   489  O O   . LEU A 1 63 ? -2.889  28.961 44.995 1.00 17.96 ? 63  LEU A O   1 
ATOM   490  C CB  . LEU A 1 63 ? -3.795  30.250 47.385 1.00 19.94 ? 63  LEU A CB  1 
ATOM   491  C CG  . LEU A 1 63 ? -4.258  31.693 47.565 1.00 14.51 ? 63  LEU A CG  1 
ATOM   492  C CD1 . LEU A 1 63 ? -3.002  32.503 47.758 1.00 18.42 ? 63  LEU A CD1 1 
ATOM   493  C CD2 . LEU A 1 63 ? -5.086  32.304 46.469 1.00 14.80 ? 63  LEU A CD2 1 
ATOM   494  N N   . ILE A 1 64 ? -4.828  29.802 44.256 1.00 17.45 ? 64  ILE A N   1 
ATOM   495  C CA  . ILE A 1 64 ? -4.339  30.073 42.918 1.00 15.67 ? 64  ILE A CA  1 
ATOM   496  C C   . ILE A 1 64 ? -4.839  31.429 42.488 1.00 12.98 ? 64  ILE A C   1 
ATOM   497  O O   . ILE A 1 64 ? -5.910  31.867 42.864 1.00 14.86 ? 64  ILE A O   1 
ATOM   498  C CB  . ILE A 1 64 ? -4.886  28.948 42.026 1.00 19.62 ? 64  ILE A CB  1 
ATOM   499  C CG1 . ILE A 1 64 ? -4.280  28.803 40.638 1.00 17.05 ? 64  ILE A CG1 1 
ATOM   500  C CG2 . ILE A 1 64 ? -6.420  29.002 41.925 1.00 22.27 ? 64  ILE A CG2 1 
ATOM   501  C CD1 . ILE A 1 64 ? -4.497  27.367 40.119 1.00 19.44 ? 64  ILE A CD1 1 
ATOM   502  N N   . GLU A 1 65 ? -4.045  32.131 41.725 1.00 15.87 ? 65  GLU A N   1 
ATOM   503  C CA  . GLU A 1 65 ? -4.584  33.364 41.171 1.00 20.72 ? 65  GLU A CA  1 
ATOM   504  C C   . GLU A 1 65 ? -4.611  33.171 39.695 1.00 22.93 ? 65  GLU A C   1 
ATOM   505  O O   . GLU A 1 65 ? -3.571  32.951 39.093 1.00 23.41 ? 65  GLU A O   1 
ATOM   506  C CB  . GLU A 1 65 ? -3.690  34.565 41.476 1.00 23.57 ? 65  GLU A CB  1 
ATOM   507  C CG  . GLU A 1 65 ? -3.629  34.753 42.989 1.00 30.87 ? 65  GLU A CG  1 
ATOM   508  C CD  . GLU A 1 65 ? -2.630  35.791 43.430 1.00 36.19 ? 65  GLU A CD  1 
ATOM   509  O OE1 . GLU A 1 65 ? -2.570  36.840 42.775 1.00 41.71 ? 65  GLU A OE1 1 
ATOM   510  O OE2 . GLU A 1 65 ? -1.932  35.543 44.435 1.00 35.29 ? 65  GLU A OE2 1 
ATOM   511  N N   . ILE A 1 66 ? -5.814  33.215 39.141 1.00 25.67 ? 66  ILE A N   1 
ATOM   512  C CA  . ILE A 1 66 ? -6.056  32.895 37.723 1.00 26.12 ? 66  ILE A CA  1 
ATOM   513  C C   . ILE A 1 66 ? -6.462  34.185 37.107 1.00 26.49 ? 66  ILE A C   1 
ATOM   514  O O   . ILE A 1 66 ? -7.450  34.767 37.508 1.00 23.65 ? 66  ILE A O   1 
ATOM   515  C CB  . ILE A 1 66 ? -7.259  31.947 37.619 1.00 25.76 ? 66  ILE A CB  1 
ATOM   516  C CG1 . ILE A 1 66 ? -7.132  30.743 38.537 1.00 24.58 ? 66  ILE A CG1 1 
ATOM   517  C CG2 . ILE A 1 66 ? -7.584  31.509 36.175 1.00 24.45 ? 66  ILE A CG2 1 
ATOM   518  C CD1 . ILE A 1 66 ? -8.504  30.175 38.899 1.00 26.37 ? 66  ILE A CD1 1 
ATOM   519  N N   . CYS A 1 67 ? -5.658  34.681 36.194 1.00 28.62 ? 67  CYS A N   1 
ATOM   520  C CA  . CYS A 1 67 ? -5.888  36.040 35.660 1.00 35.03 ? 67  CYS A CA  1 
ATOM   521  C C   . CYS A 1 67 ? -6.110  37.091 36.757 1.00 37.14 ? 67  CYS A C   1 
ATOM   522  O O   . CYS A 1 67 ? -6.943  37.979 36.669 1.00 35.73 ? 67  CYS A O   1 
ATOM   523  C CB  . CYS A 1 67 ? -7.075  36.041 34.651 1.00 38.42 ? 67  CYS A CB  1 
ATOM   524  S SG  . CYS A 1 67 ? -7.157  37.295 33.297 1.00 41.33 ? 67  CYS A SG  1 
ATOM   525  N N   . GLY A 1 68 ? -5.354  36.942 37.847 1.00 37.10 ? 68  GLY A N   1 
ATOM   526  C CA  . GLY A 1 68 ? -5.518  37.949 38.897 1.00 39.11 ? 68  GLY A CA  1 
ATOM   527  C C   . GLY A 1 68 ? -6.650  37.685 39.881 1.00 40.68 ? 68  GLY A C   1 
ATOM   528  O O   . GLY A 1 68 ? -6.766  38.290 40.942 1.00 41.98 ? 68  GLY A O   1 
ATOM   529  N N   . HIS A 1 69 ? -7.489  36.725 39.518 1.00 37.50 ? 69  HIS A N   1 
ATOM   530  C CA  . HIS A 1 69 ? -8.598  36.444 40.424 1.00 35.26 ? 69  HIS A CA  1 
ATOM   531  C C   . HIS A 1 69 ? -8.083  35.411 41.411 1.00 32.55 ? 69  HIS A C   1 
ATOM   532  O O   . HIS A 1 69 ? -7.468  34.430 41.011 1.00 32.12 ? 69  HIS A O   1 
ATOM   533  C CB  . HIS A 1 69 ? -9.755  35.852 39.593 1.00 35.95 ? 69  HIS A CB  1 
ATOM   534  C CG  . HIS A 1 69 ? -10.265 36.778 38.499 1.00 38.56 ? 69  HIS A CG  1 
ATOM   535  N ND1 . HIS A 1 69 ? -9.526  37.317 37.511 1.00 39.86 ? 69  HIS A ND1 1 
ATOM   536  C CD2 . HIS A 1 69 ? -11.584 37.197 38.315 1.00 39.44 ? 69  HIS A CD2 1 
ATOM   537  C CE1 . HIS A 1 69 ? -10.348 38.059 36.705 1.00 40.24 ? 69  HIS A CE1 1 
ATOM   538  N NE2 . HIS A 1 69 ? -11.615 37.985 37.209 1.00 40.68 ? 69  HIS A NE2 1 
ATOM   539  N N   . LYS A 1 70 ? -8.303  35.643 42.689 1.00 29.34 ? 70  LYS A N   1 
ATOM   540  C CA  . LYS A 1 70 ? -7.884  34.579 43.594 1.00 27.64 ? 70  LYS A CA  1 
ATOM   541  C C   . LYS A 1 70 ? -8.993  33.579 43.779 1.00 27.63 ? 70  LYS A C   1 
ATOM   542  O O   . LYS A 1 70 ? -10.152 33.956 43.814 1.00 29.92 ? 70  LYS A O   1 
ATOM   543  C CB  . LYS A 1 70 ? -7.584  35.135 44.967 1.00 26.16 ? 70  LYS A CB  1 
ATOM   544  C CG  . LYS A 1 70 ? -6.500  36.181 44.920 1.00 26.77 ? 70  LYS A CG  1 
ATOM   545  C CD  . LYS A 1 70 ? -6.398  36.863 46.272 1.00 29.23 ? 70  LYS A CD  1 
ATOM   546  C CE  . LYS A 1 70 ? -5.454  38.059 46.232 1.00 32.26 ? 70  LYS A CE  1 
ATOM   547  N NZ  . LYS A 1 70 ? -4.136  37.591 45.771 1.00 38.87 ? 70  LYS A NZ  1 
ATOM   548  N N   . ALA A 1 71 ? -8.624  32.317 43.928 1.00 25.08 ? 71  ALA A N   1 
ATOM   549  C CA  . ALA A 1 71 ? -9.595  31.313 44.306 1.00 22.92 ? 71  ALA A CA  1 
ATOM   550  C C   . ALA A 1 71 ? -8.803  30.260 45.031 1.00 22.36 ? 71  ALA A C   1 
ATOM   551  O O   . ALA A 1 71 ? -7.580  30.220 44.919 1.00 21.66 ? 71  ALA A O   1 
ATOM   552  C CB  . ALA A 1 71 ? -10.289 30.792 43.043 1.00 22.25 ? 71  ALA A CB  1 
ATOM   553  N N   . ILE A 1 72 ? -9.498  29.440 45.811 1.00 21.55 ? 72  ILE A N   1 
ATOM   554  C CA  . ILE A 1 72 ? -8.817  28.365 46.556 1.00 23.67 ? 72  ILE A CA  1 
ATOM   555  C C   . ILE A 1 72 ? -9.543  27.078 46.263 1.00 23.16 ? 72  ILE A C   1 
ATOM   556  O O   . ILE A 1 72 ? -10.763 27.025 46.331 1.00 23.24 ? 72  ILE A O   1 
ATOM   557  C CB  . ILE A 1 72 ? -8.801  28.612 48.106 1.00 25.41 ? 72  ILE A CB  1 
ATOM   558  C CG1 . ILE A 1 72 ? -7.743  29.639 48.537 1.00 23.17 ? 72  ILE A CG1 1 
ATOM   559  C CG2 . ILE A 1 72 ? -8.518  27.359 48.950 1.00 24.10 ? 72  ILE A CG2 1 
ATOM   560  C CD1 . ILE A 1 72 ? -7.732  29.948 50.031 1.00 24.23 ? 72  ILE A CD1 1 
ATOM   561  N N   . GLY A 1 73 ? -8.788  26.042 45.939 1.00 22.79 ? 73  GLY A N   1 
ATOM   562  C CA  . GLY A 1 73 ? -9.483  24.769 45.843 1.00 22.16 ? 73  GLY A CA  1 
ATOM   563  C C   . GLY A 1 73 ? -8.526  23.632 45.736 1.00 22.86 ? 73  GLY A C   1 
ATOM   564  O O   . GLY A 1 73 ? -7.384  23.717 46.133 1.00 24.11 ? 73  GLY A O   1 
ATOM   565  N N   . THR A 1 74 ? -9.026  22.546 45.184 1.00 23.45 ? 74  THR A N   1 
ATOM   566  C CA  . THR A 1 74 ? -8.187  21.388 44.954 1.00 21.56 ? 74  THR A CA  1 
ATOM   567  C C   . THR A 1 74 ? -7.487  21.477 43.630 1.00 21.25 ? 74  THR A C   1 
ATOM   568  O O   . THR A 1 74 ? -8.134  21.758 42.631 1.00 20.33 ? 74  THR A O   1 
ATOM   569  C CB  . THR A 1 74 ? -9.096  20.160 44.915 1.00 20.66 ? 74  THR A CB  1 
ATOM   570  O OG1 . THR A 1 74 ? -9.843  20.071 46.131 1.00 24.13 ? 74  THR A OG1 1 
ATOM   571  C CG2 . THR A 1 74 ? -8.287  18.893 44.727 1.00 21.13 ? 74  THR A CG2 1 
ATOM   572  N N   . VAL A 1 75 ? -6.197  21.186 43.647 1.00 20.51 ? 75  VAL A N   1 
ATOM   573  C CA  . VAL A 1 75 ? -5.523  20.933 42.387 1.00 20.44 ? 75  VAL A CA  1 
ATOM   574  C C   . VAL A 1 75 ? -4.894  19.566 42.433 1.00 20.36 ? 75  VAL A C   1 
ATOM   575  O O   . VAL A 1 75 ? -4.536  19.068 43.491 1.00 20.27 ? 75  VAL A O   1 
ATOM   576  C CB  . VAL A 1 75 ? -4.479  22.024 42.048 1.00 20.08 ? 75  VAL A CB  1 
ATOM   577  C CG1 . VAL A 1 75 ? -4.997  23.439 42.343 1.00 24.02 ? 75  VAL A CG1 1 
ATOM   578  C CG2 . VAL A 1 75 ? -3.124  21.786 42.685 1.00 22.11 ? 75  VAL A CG2 1 
ATOM   579  N N   . LEU A 1 76 ? -4.822  18.978 41.251 1.00 21.23 ? 76  LEU A N   1 
ATOM   580  C CA  . LEU A 1 76 ? -4.239  17.659 41.042 1.00 21.61 ? 76  LEU A CA  1 
ATOM   581  C C   . LEU A 1 76 ? -3.006  17.953 40.256 1.00 24.05 ? 76  LEU A C   1 
ATOM   582  O O   . LEU A 1 76 ? -3.049  18.787 39.365 1.00 24.02 ? 76  LEU A O   1 
ATOM   583  C CB  . LEU A 1 76 ? -5.167  16.836 40.133 1.00 17.55 ? 76  LEU A CB  1 
ATOM   584  C CG  . LEU A 1 76 ? -6.273  16.030 40.787 1.00 15.58 ? 76  LEU A CG  1 
ATOM   585  C CD1 . LEU A 1 76 ? -6.798  16.580 42.099 1.00 15.88 ? 76  LEU A CD1 1 
ATOM   586  C CD2 . LEU A 1 76 ? -7.382  15.862 39.771 1.00 16.19 ? 76  LEU A CD2 1 
ATOM   587  N N   . VAL A 1 77 ? -1.912  17.296 40.598 1.00 23.99 ? 77  VAL A N   1 
ATOM   588  C CA  . VAL A 1 77 ? -0.666  17.566 39.883 1.00 23.61 ? 77  VAL A CA  1 
ATOM   589  C C   . VAL A 1 77 ? -0.222  16.222 39.380 1.00 25.16 ? 77  VAL A C   1 
ATOM   590  O O   . VAL A 1 77 ? -0.370  15.233 40.093 1.00 29.91 ? 77  VAL A O   1 
ATOM   591  C CB  . VAL A 1 77 ? 0.351   18.134 40.884 1.00 23.22 ? 77  VAL A CB  1 
ATOM   592  C CG1 . VAL A 1 77 ? 1.737   18.337 40.298 1.00 20.18 ? 77  VAL A CG1 1 
ATOM   593  C CG2 . VAL A 1 77 ? -0.149  19.455 41.446 1.00 25.95 ? 77  VAL A CG2 1 
ATOM   594  N N   . GLY A 1 78 ? 0.255   16.159 38.154 1.00 21.62 ? 78  GLY A N   1 
ATOM   595  C CA  . GLY A 1 78 ? 0.511   14.834 37.638 1.00 19.65 ? 78  GLY A CA  1 
ATOM   596  C C   . GLY A 1 78 ? 0.953   14.983 36.227 1.00 20.54 ? 78  GLY A C   1 
ATOM   597  O O   . GLY A 1 78 ? 1.200   16.083 35.749 1.00 20.21 ? 78  GLY A O   1 
ATOM   598  N N   . PRO A 1 79 ? 1.095   13.853 35.557 1.00 21.84 ? 79  PRO A N   1 
ATOM   599  C CA  . PRO A 1 79 ? 1.562   13.928 34.164 1.00 24.69 ? 79  PRO A CA  1 
ATOM   600  C C   . PRO A 1 79 ? 0.494   14.335 33.129 1.00 25.58 ? 79  PRO A C   1 
ATOM   601  O O   . PRO A 1 79 ? 0.082   13.599 32.246 1.00 28.13 ? 79  PRO A O   1 
ATOM   602  C CB  . PRO A 1 79 ? 2.192   12.533 33.996 1.00 20.99 ? 79  PRO A CB  1 
ATOM   603  C CG  . PRO A 1 79 ? 1.332   11.615 34.865 1.00 22.07 ? 79  PRO A CG  1 
ATOM   604  C CD  . PRO A 1 79 ? 1.004   12.497 36.076 1.00 21.28 ? 79  PRO A CD  1 
ATOM   605  N N   . THR A 1 80 ? 0.054   15.565 33.251 1.00 25.10 ? 80  THR A N   1 
ATOM   606  C CA  . THR A 1 80 ? -0.748  16.087 32.156 1.00 24.45 ? 80  THR A CA  1 
ATOM   607  C C   . THR A 1 80 ? 0.192   16.706 31.131 1.00 26.43 ? 80  THR A C   1 
ATOM   608  O O   . THR A 1 80 ? 1.263   17.161 31.493 1.00 30.56 ? 80  THR A O   1 
ATOM   609  C CB  . THR A 1 80 ? -1.695  17.139 32.743 1.00 22.45 ? 80  THR A CB  1 
ATOM   610  O OG1 . THR A 1 80 ? -2.417  17.766 31.681 1.00 16.26 ? 80  THR A OG1 1 
ATOM   611  C CG2 . THR A 1 80 ? -0.965  18.180 33.583 1.00 16.58 ? 80  THR A CG2 1 
ATOM   612  N N   . PRO A 1 81 ? -0.221  16.714 29.854 1.00 27.20 ? 81  PRO A N   1 
ATOM   613  C CA  . PRO A 1 81 ? 0.521   17.468 28.827 1.00 25.33 ? 81  PRO A CA  1 
ATOM   614  C C   . PRO A 1 81 ? 0.454   18.997 28.952 1.00 24.64 ? 81  PRO A C   1 
ATOM   615  O O   . PRO A 1 81 ? 1.268   19.748 28.414 1.00 24.84 ? 81  PRO A O   1 
ATOM   616  C CB  . PRO A 1 81 ? -0.186  17.011 27.530 1.00 23.87 ? 81  PRO A CB  1 
ATOM   617  C CG  . PRO A 1 81 ? -0.856  15.691 27.858 1.00 22.56 ? 81  PRO A CG  1 
ATOM   618  C CD  . PRO A 1 81 ? -1.310  15.926 29.285 1.00 23.76 ? 81  PRO A CD  1 
ATOM   619  N N   . PHE A 1 82 ? -0.608  19.448 29.608 1.00 22.36 ? 82  PHE A N   1 
ATOM   620  C CA  . PHE A 1 82 ? -0.860  20.884 29.651 1.00 22.77 ? 82  PHE A CA  1 
ATOM   621  C C   . PHE A 1 82 ? -1.607  21.203 30.913 1.00 18.86 ? 82  PHE A C   1 
ATOM   622  O O   . PHE A 1 82 ? -2.332  20.398 31.461 1.00 19.12 ? 82  PHE A O   1 
ATOM   623  C CB  . PHE A 1 82 ? -1.598  21.418 28.391 1.00 24.77 ? 82  PHE A CB  1 
ATOM   624  C CG  . PHE A 1 82 ? -1.204  22.884 28.289 1.00 32.17 ? 82  PHE A CG  1 
ATOM   625  C CD1 . PHE A 1 82 ? 0.146   23.241 28.029 1.00 35.77 ? 82  PHE A CD1 1 
ATOM   626  C CD2 . PHE A 1 82 ? -2.142  23.909 28.590 1.00 34.63 ? 82  PHE A CD2 1 
ATOM   627  C CE1 . PHE A 1 82 ? 0.557   24.604 28.100 1.00 37.86 ? 82  PHE A CE1 1 
ATOM   628  C CE2 . PHE A 1 82 ? -1.740  25.267 28.661 1.00 32.47 ? 82  PHE A CE2 1 
ATOM   629  C CZ  . PHE A 1 82 ? -0.389  25.612 28.422 1.00 35.72 ? 82  PHE A CZ  1 
ATOM   630  N N   . ASN A 1 83 ? -1.360  22.386 31.413 1.00 18.96 ? 83  ASN A N   1 
ATOM   631  C CA  . ASN A 1 83 ? -1.998  22.748 32.677 1.00 18.00 ? 83  ASN A CA  1 
ATOM   632  C C   . ASN A 1 83 ? -3.437  23.065 32.312 1.00 17.79 ? 83  ASN A C   1 
ATOM   633  O O   . ASN A 1 83 ? -3.691  23.848 31.399 1.00 15.86 ? 83  ASN A O   1 
ATOM   634  C CB  . ASN A 1 83 ? -1.347  24.025 33.256 1.00 17.32 ? 83  ASN A CB  1 
ATOM   635  C CG  . ASN A 1 83 ? 0.124   23.903 33.622 1.00 19.19 ? 83  ASN A CG  1 
ATOM   636  O OD1 . ASN A 1 83 ? 0.558   22.998 34.307 1.00 21.27 ? 83  ASN A OD1 1 
ATOM   637  N ND2 . ASN A 1 83 ? 0.923   24.842 33.140 1.00 17.19 ? 83  ASN A ND2 1 
ATOM   638  N N   . VAL A 1 84 ? -4.378  22.428 32.991 1.00 18.35 ? 84  VAL A N   1 
ATOM   639  C CA  . VAL A 1 84 ? -5.769  22.713 32.647 1.00 15.71 ? 84  VAL A CA  1 
ATOM   640  C C   . VAL A 1 84 ? -6.483  23.184 33.893 1.00 14.02 ? 84  VAL A C   1 
ATOM   641  O O   . VAL A 1 84 ? -6.265  22.640 34.967 1.00 13.33 ? 84  VAL A O   1 
ATOM   642  C CB  . VAL A 1 84 ? -6.523  21.498 31.973 1.00 17.97 ? 84  VAL A CB  1 
ATOM   643  C CG1 . VAL A 1 84 ? -5.663  20.642 31.032 1.00 20.65 ? 84  VAL A CG1 1 
ATOM   644  C CG2 . VAL A 1 84 ? -7.215  20.540 32.924 1.00 16.80 ? 84  VAL A CG2 1 
ATOM   645  N N   . ILE A 1 85 ? -7.321  24.215 33.725 1.00 12.72 ? 85  ILE A N   1 
ATOM   646  C CA  . ILE A 1 85 ? -8.189  24.692 34.811 1.00 12.27 ? 85  ILE A CA  1 
ATOM   647  C C   . ILE A 1 85 ? -9.592  24.249 34.546 1.00 10.77 ? 85  ILE A C   1 
ATOM   648  O O   . ILE A 1 85 ? -10.149 24.620 33.530 1.00 10.62 ? 85  ILE A O   1 
ATOM   649  C CB  . ILE A 1 85 ? -8.248  26.212 34.836 1.00 11.92 ? 85  ILE A CB  1 
ATOM   650  C CG1 . ILE A 1 85 ? -6.917  26.944 34.722 1.00 13.25 ? 85  ILE A CG1 1 
ATOM   651  C CG2 . ILE A 1 85 ? -8.991  26.678 36.085 1.00 13.47 ? 85  ILE A CG2 1 
ATOM   652  C CD1 . ILE A 1 85 ? -6.094  26.904 36.012 1.00 13.99 ? 85  ILE A CD1 1 
ATOM   653  N N   . GLY A 1 86 ? -10.115 23.447 35.453 1.00 11.08 ? 86  GLY A N   1 
ATOM   654  C CA  . GLY A 1 86 ? -11.382 22.791 35.198 1.00 9.51  ? 86  GLY A CA  1 
ATOM   655  C C   . GLY A 1 86 ? -12.512 23.415 35.961 1.00 11.82 ? 86  GLY A C   1 
ATOM   656  O O   . GLY A 1 86 ? -12.379 24.398 36.674 1.00 13.11 ? 86  GLY A O   1 
ATOM   657  N N   . ARG A 1 87 ? -13.665 22.838 35.833 1.00 12.15 ? 87  ARG A N   1 
ATOM   658  C CA  . ARG A 1 87 ? -14.822 23.520 36.399 1.00 14.88 ? 87  ARG A CA  1 
ATOM   659  C C   . ARG A 1 87 ? -14.803 23.859 37.899 1.00 16.27 ? 87  ARG A C   1 
ATOM   660  O O   . ARG A 1 87 ? -15.403 24.819 38.375 1.00 15.42 ? 87  ARG A O   1 
ATOM   661  C CB  . ARG A 1 87 ? -16.051 22.711 36.029 1.00 18.55 ? 87  ARG A CB  1 
ATOM   662  C CG  . ARG A 1 87 ? -16.404 22.618 34.535 1.00 15.86 ? 87  ARG A CG  1 
ATOM   663  C CD  . ARG A 1 87 ? -17.819 22.039 34.396 1.00 14.02 ? 87  ARG A CD  1 
ATOM   664  N NE  . ARG A 1 87 ? -17.852 20.669 34.853 1.00 11.42 ? 87  ARG A NE  1 
ATOM   665  C CZ  . ARG A 1 87 ? -18.446 20.303 35.984 1.00 17.79 ? 87  ARG A CZ  1 
ATOM   666  N NH1 . ARG A 1 87 ? -19.067 21.147 36.802 1.00 14.61 ? 87  ARG A NH1 1 
ATOM   667  N NH2 . ARG A 1 87 ? -18.395 19.034 36.329 1.00 15.28 ? 87  ARG A NH2 1 
ATOM   668  N N   . ASN A 1 88 ? -14.043 23.087 38.655 1.00 15.91 ? 88  ASN A N   1 
ATOM   669  C CA  . ASN A 1 88 ? -13.937 23.432 40.074 1.00 17.70 ? 88  ASN A CA  1 
ATOM   670  C C   . ASN A 1 88 ? -13.369 24.805 40.358 1.00 18.45 ? 88  ASN A C   1 
ATOM   671  O O   . ASN A 1 88 ? -13.764 25.454 41.309 1.00 18.58 ? 88  ASN A O   1 
ATOM   672  C CB  . ASN A 1 88 ? -13.166 22.379 40.879 1.00 17.00 ? 88  ASN A CB  1 
ATOM   673  C CG  . ASN A 1 88 ? -11.702 22.345 40.542 1.00 18.98 ? 88  ASN A CG  1 
ATOM   674  O OD1 . ASN A 1 88 ? -11.270 22.475 39.412 1.00 19.90 ? 88  ASN A OD1 1 
ATOM   675  N ND2 . ASN A 1 88 ? -10.910 22.201 41.581 1.00 20.68 ? 88  ASN A ND2 1 
ATOM   676  N N   . LEU A 1 89 ? -12.444 25.277 39.519 1.00 18.09 ? 89  LEU A N   1 
ATOM   677  C CA  . LEU A 1 89 ? -11.987 26.641 39.785 1.00 14.67 ? 89  LEU A CA  1 
ATOM   678  C C   . LEU A 1 89 ? -12.705 27.653 38.937 1.00 15.80 ? 89  LEU A C   1 
ATOM   679  O O   . LEU A 1 89 ? -12.843 28.817 39.286 1.00 14.98 ? 89  LEU A O   1 
ATOM   680  C CB  . LEU A 1 89 ? -10.472 26.750 39.620 1.00 14.62 ? 89  LEU A CB  1 
ATOM   681  C CG  . LEU A 1 89 ? -9.703  26.002 40.729 1.00 15.25 ? 89  LEU A CG  1 
ATOM   682  C CD1 . LEU A 1 89 ? -8.218  25.936 40.387 1.00 13.42 ? 89  LEU A CD1 1 
ATOM   683  C CD2 . LEU A 1 89 ? -9.939  26.595 42.134 1.00 14.58 ? 89  LEU A CD2 1 
ATOM   684  N N   . LEU A 1 90 ? -13.225 27.168 37.808 1.00 15.75 ? 90  LEU A N   1 
ATOM   685  C CA  . LEU A 1 90 ? -13.935 28.084 36.893 1.00 14.25 ? 90  LEU A CA  1 
ATOM   686  C C   . LEU A 1 90 ? -15.178 28.648 37.481 1.00 14.92 ? 90  LEU A C   1 
ATOM   687  O O   . LEU A 1 90 ? -15.609 29.731 37.143 1.00 17.13 ? 90  LEU A O   1 
ATOM   688  C CB  . LEU A 1 90 ? -14.325 27.408 35.572 1.00 13.57 ? 90  LEU A CB  1 
ATOM   689  C CG  . LEU A 1 90 ? -13.130 26.921 34.734 1.00 10.14 ? 90  LEU A CG  1 
ATOM   690  C CD1 . LEU A 1 90 ? -13.624 26.019 33.612 1.00 11.76 ? 90  LEU A CD1 1 
ATOM   691  C CD2 . LEU A 1 90 ? -12.287 28.094 34.203 1.00 7.10  ? 90  LEU A CD2 1 
ATOM   692  N N   . THR A 1 91 ? -15.773 27.913 38.393 1.00 16.94 ? 91  THR A N   1 
ATOM   693  C CA  . THR A 1 91 ? -16.977 28.475 38.987 1.00 16.87 ? 91  THR A CA  1 
ATOM   694  C C   . THR A 1 91 ? -16.659 29.592 39.931 1.00 18.86 ? 91  THR A C   1 
ATOM   695  O O   . THR A 1 91 ? -17.426 30.514 40.138 1.00 20.35 ? 91  THR A O   1 
ATOM   696  C CB  . THR A 1 91 ? -17.752 27.356 39.674 1.00 15.67 ? 91  THR A CB  1 
ATOM   697  O OG1 . THR A 1 91 ? -16.866 26.569 40.461 1.00 17.24 ? 91  THR A OG1 1 
ATOM   698  C CG2 . THR A 1 91 ? -18.327 26.419 38.626 1.00 14.39 ? 91  THR A CG2 1 
ATOM   699  N N   . GLN A 1 92 ? -15.451 29.505 40.477 1.00 20.44 ? 92  GLN A N   1 
ATOM   700  C CA  . GLN A 1 92 ? -15.038 30.486 41.472 1.00 22.61 ? 92  GLN A CA  1 
ATOM   701  C C   . GLN A 1 92 ? -14.647 31.825 40.926 1.00 23.79 ? 92  GLN A C   1 
ATOM   702  O O   . GLN A 1 92 ? -14.845 32.879 41.510 1.00 26.79 ? 92  GLN A O   1 
ATOM   703  C CB  . GLN A 1 92 ? -13.879 29.941 42.265 1.00 24.45 ? 92  GLN A CB  1 
ATOM   704  C CG  . GLN A 1 92 ? -14.340 28.836 43.182 1.00 31.47 ? 92  GLN A CG  1 
ATOM   705  C CD  . GLN A 1 92 ? -13.176 28.544 44.090 1.00 38.89 ? 92  GLN A CD  1 
ATOM   706  O OE1 . GLN A 1 92 ? -12.606 29.416 44.734 1.00 42.75 ? 92  GLN A OE1 1 
ATOM   707  N NE2 . GLN A 1 92 ? -12.823 27.270 44.138 1.00 42.14 ? 92  GLN A NE2 1 
ATOM   708  N N   . ILE A 1 93 ? -14.097 31.780 39.735 1.00 22.96 ? 93  ILE A N   1 
ATOM   709  C CA  . ILE A 1 93 ? -13.848 33.082 39.112 1.00 20.75 ? 93  ILE A CA  1 
ATOM   710  C C   . ILE A 1 93 ? -15.024 33.601 38.317 1.00 18.52 ? 93  ILE A C   1 
ATOM   711  O O   . ILE A 1 93 ? -14.970 34.614 37.669 1.00 19.53 ? 93  ILE A O   1 
ATOM   712  C CB  . ILE A 1 93 ? -12.568 32.954 38.274 1.00 20.67 ? 93  ILE A CB  1 
ATOM   713  C CG1 . ILE A 1 93 ? -12.676 31.935 37.139 1.00 22.06 ? 93  ILE A CG1 1 
ATOM   714  C CG2 . ILE A 1 93 ? -11.416 32.551 39.207 1.00 23.02 ? 93  ILE A CG2 1 
ATOM   715  C CD1 . ILE A 1 93 ? -11.377 31.811 36.357 1.00 24.10 ? 93  ILE A CD1 1 
ATOM   716  N N   . GLY A 1 94 ? -16.114 32.864 38.359 1.00 18.57 ? 94  GLY A N   1 
ATOM   717  C CA  . GLY A 1 94 ? -17.308 33.332 37.687 1.00 18.54 ? 94  GLY A CA  1 
ATOM   718  C C   . GLY A 1 94 ? -17.323 33.072 36.206 1.00 19.41 ? 94  GLY A C   1 
ATOM   719  O O   . GLY A 1 94 ? -17.881 33.799 35.408 1.00 19.93 ? 94  GLY A O   1 
ATOM   720  N N   . CYS A 1 95 ? -16.689 32.001 35.827 1.00 20.35 ? 95  CYS A N   1 
ATOM   721  C CA  . CYS A 1 95 ? -16.534 31.887 34.388 1.00 23.21 ? 95  CYS A CA  1 
ATOM   722  C C   . CYS A 1 95 ? -17.730 31.250 33.740 1.00 24.50 ? 95  CYS A C   1 
ATOM   723  O O   . CYS A 1 95 ? -18.218 30.226 34.200 1.00 27.36 ? 95  CYS A O   1 
ATOM   724  C CB  . CYS A 1 95 ? -15.292 31.061 34.149 1.00 23.34 ? 95  CYS A CB  1 
ATOM   725  S SG  . CYS A 1 95 ? -15.001 30.784 32.412 1.00 26.37 ? 95  CYS A SG  1 
ATOM   726  N N   . THR A 1 96 ? -18.189 31.870 32.662 1.00 25.11 ? 96  THR A N   1 
ATOM   727  C CA  . THR A 1 96 ? -19.389 31.368 31.998 1.00 22.82 ? 96  THR A CA  1 
ATOM   728  C C   . THR A 1 96 ? -19.206 31.115 30.517 1.00 21.48 ? 96  THR A C   1 
ATOM   729  O O   . THR A 1 96 ? -18.301 31.607 29.855 1.00 20.81 ? 96  THR A O   1 
ATOM   730  C CB  . THR A 1 96 ? -20.484 32.396 32.284 1.00 24.74 ? 96  THR A CB  1 
ATOM   731  O OG1 . THR A 1 96 ? -21.689 31.686 32.616 1.00 33.35 ? 96  THR A OG1 1 
ATOM   732  C CG2 . THR A 1 96 ? -20.691 33.467 31.211 1.00 18.17 ? 96  THR A CG2 1 
ATOM   733  N N   . LEU A 1 97 ? -20.095 30.324 29.998 1.00 17.93 ? 97  LEU A N   1 
ATOM   734  C CA  . LEU A 1 97 ? -19.979 30.030 28.584 1.00 21.27 ? 97  LEU A CA  1 
ATOM   735  C C   . LEU A 1 97 ? -21.172 30.672 27.931 1.00 21.23 ? 97  LEU A C   1 
ATOM   736  O O   . LEU A 1 97 ? -22.266 30.608 28.471 1.00 21.22 ? 97  LEU A O   1 
ATOM   737  C CB  . LEU A 1 97 ? -20.029 28.512 28.518 1.00 20.73 ? 97  LEU A CB  1 
ATOM   738  C CG  . LEU A 1 97 ? -19.390 27.829 27.342 1.00 19.99 ? 97  LEU A CG  1 
ATOM   739  C CD1 . LEU A 1 97 ? -17.963 28.337 27.122 1.00 20.32 ? 97  LEU A CD1 1 
ATOM   740  C CD2 . LEU A 1 97 ? -19.382 26.335 27.659 1.00 17.85 ? 97  LEU A CD2 1 
ATOM   741  N N   . ASN A 1 98 ? -20.956 31.339 26.815 1.00 23.12 ? 98  ASN A N   1 
ATOM   742  C CA  . ASN A 1 98 ? -22.107 31.964 26.164 1.00 25.60 ? 98  ASN A CA  1 
ATOM   743  C C   . ASN A 1 98 ? -22.059 31.654 24.704 1.00 25.32 ? 98  ASN A C   1 
ATOM   744  O O   . ASN A 1 98 ? -21.036 31.756 24.059 1.00 20.97 ? 98  ASN A O   1 
ATOM   745  C CB  . ASN A 1 98 ? -22.136 33.498 26.246 1.00 28.99 ? 98  ASN A CB  1 
ATOM   746  C CG  . ASN A 1 98 ? -21.949 33.953 27.665 1.00 36.75 ? 98  ASN A CG  1 
ATOM   747  O OD1 . ASN A 1 98 ? -22.846 34.049 28.489 1.00 43.34 ? 98  ASN A OD1 1 
ATOM   748  N ND2 . ASN A 1 98 ? -20.696 34.207 27.989 1.00 37.02 ? 98  ASN A ND2 1 
ATOM   749  N N   . PHE A 1 99 ? -23.197 31.283 24.212 1.00 28.05 ? 99  PHE A N   1 
ATOM   750  C CA  . PHE A 1 99 ? -23.483 31.151 22.795 1.00 34.89 ? 99  PHE A CA  1 
ATOM   751  C C   . PHE A 1 99 ? -24.985 31.451 22.794 1.00 39.42 ? 99  PHE A C   1 
ATOM   752  O O   . PHE A 1 99 ? -25.437 32.319 23.561 1.00 42.84 ? 99  PHE A O   1 
ATOM   753  C CB  . PHE A 1 99 ? -23.100 29.741 22.242 1.00 32.77 ? 99  PHE A CB  1 
ATOM   754  C CG  . PHE A 1 99 ? -23.866 28.606 22.884 1.00 35.83 ? 99  PHE A CG  1 
ATOM   755  C CD1 . PHE A 1 99 ? -23.771 28.344 24.267 1.00 37.93 ? 99  PHE A CD1 1 
ATOM   756  C CD2 . PHE A 1 99 ? -24.718 27.818 22.082 1.00 40.36 ? 99  PHE A CD2 1 
ATOM   757  C CE1 . PHE A 1 99 ? -24.527 27.310 24.855 1.00 39.86 ? 99  PHE A CE1 1 
ATOM   758  C CE2 . PHE A 1 99 ? -25.478 26.773 22.655 1.00 41.31 ? 99  PHE A CE2 1 
ATOM   759  C CZ  . PHE A 1 99 ? -25.379 26.525 24.047 1.00 42.73 ? 99  PHE A CZ  1 
ATOM   760  N N   . PRO B 1 1  ? -27.153 30.667 24.565 1.00 34.81 ? 1   PRO B N   1 
ATOM   761  C CA  . PRO B 1 1  ? -27.692 31.049 25.881 1.00 32.75 ? 1   PRO B CA  1 
ATOM   762  C C   . PRO B 1 1  ? -26.489 31.219 26.749 1.00 30.82 ? 1   PRO B C   1 
ATOM   763  O O   . PRO B 1 1  ? -25.392 31.066 26.257 1.00 29.03 ? 1   PRO B O   1 
ATOM   764  C CB  . PRO B 1 1  ? -28.499 29.850 26.369 1.00 33.46 ? 1   PRO B CB  1 
ATOM   765  C CG  . PRO B 1 1  ? -28.053 28.697 25.467 1.00 35.72 ? 1   PRO B CG  1 
ATOM   766  C CD  . PRO B 1 1  ? -27.786 29.409 24.147 1.00 34.93 ? 1   PRO B CD  1 
ATOM   767  N N   . GLN B 1 2  ? -26.697 31.507 28.018 1.00 31.43 ? 2   GLN B N   1 
ATOM   768  C CA  . GLN B 1 2  ? -25.540 31.538 28.910 1.00 31.27 ? 2   GLN B CA  1 
ATOM   769  C C   . GLN B 1 2  ? -25.542 30.263 29.745 1.00 30.63 ? 2   GLN B C   1 
ATOM   770  O O   . GLN B 1 2  ? -26.605 29.753 30.093 1.00 30.06 ? 2   GLN B O   1 
ATOM   771  C CB  . GLN B 1 2  ? -25.653 32.760 29.803 1.00 31.07 ? 2   GLN B CB  1 
ATOM   772  C CG  . GLN B 1 2  ? -24.512 32.783 30.796 1.00 34.26 ? 2   GLN B CG  1 
ATOM   773  C CD  . GLN B 1 2  ? -24.639 34.036 31.577 1.00 38.85 ? 2   GLN B CD  1 
ATOM   774  O OE1 . GLN B 1 2  ? -25.425 34.162 32.502 1.00 42.84 ? 2   GLN B OE1 1 
ATOM   775  N NE2 . GLN B 1 2  ? -23.849 34.992 31.139 1.00 38.90 ? 2   GLN B NE2 1 
ATOM   776  N N   . VAL B 1 3  ? -24.347 29.757 29.999 1.00 25.82 ? 3   VAL B N   1 
ATOM   777  C CA  . VAL B 1 3  ? -24.219 28.489 30.688 1.00 25.48 ? 3   VAL B CA  1 
ATOM   778  C C   . VAL B 1 3  ? -23.248 28.702 31.825 1.00 25.00 ? 3   VAL B C   1 
ATOM   779  O O   . VAL B 1 3  ? -22.135 29.176 31.620 1.00 24.29 ? 3   VAL B O   1 
ATOM   780  C CB  . VAL B 1 3  ? -23.638 27.480 29.675 1.00 25.22 ? 3   VAL B CB  1 
ATOM   781  C CG1 . VAL B 1 3  ? -23.779 26.057 30.168 1.00 25.54 ? 3   VAL B CG1 1 
ATOM   782  C CG2 . VAL B 1 3  ? -24.294 27.571 28.290 1.00 29.26 ? 3   VAL B CG2 1 
ATOM   783  N N   . THR B 1 4  ? -23.661 28.375 33.043 1.00 23.30 ? 4   THR B N   1 
ATOM   784  C CA  . THR B 1 4  ? -22.684 28.453 34.135 1.00 20.44 ? 4   THR B CA  1 
ATOM   785  C C   . THR B 1 4  ? -22.063 27.064 34.304 1.00 20.88 ? 4   THR B C   1 
ATOM   786  O O   . THR B 1 4  ? -22.617 26.090 33.827 1.00 20.09 ? 4   THR B O   1 
ATOM   787  C CB  . THR B 1 4  ? -23.389 28.943 35.419 1.00 18.59 ? 4   THR B CB  1 
ATOM   788  O OG1 . THR B 1 4  ? -24.513 28.105 35.659 1.00 22.04 ? 4   THR B OG1 1 
ATOM   789  C CG2 . THR B 1 4  ? -23.880 30.380 35.320 1.00 15.27 ? 4   THR B CG2 1 
ATOM   790  N N   . LEU B 1 5  ? -20.924 26.984 34.983 1.00 16.58 ? 5   LEU B N   1 
ATOM   791  C CA  . LEU B 1 5  ? -20.189 25.732 34.978 1.00 18.41 ? 5   LEU B CA  1 
ATOM   792  C C   . LEU B 1 5  ? -20.334 24.923 36.259 1.00 18.69 ? 5   LEU B C   1 
ATOM   793  O O   . LEU B 1 5  ? -19.478 24.146 36.640 1.00 18.85 ? 5   LEU B O   1 
ATOM   794  C CB  . LEU B 1 5  ? -18.721 26.074 34.696 1.00 19.42 ? 5   LEU B CB  1 
ATOM   795  C CG  . LEU B 1 5  ? -18.527 26.682 33.301 1.00 19.85 ? 5   LEU B CG  1 
ATOM   796  C CD1 . LEU B 1 5  ? -17.136 27.285 33.151 1.00 21.29 ? 5   LEU B CD1 1 
ATOM   797  C CD2 . LEU B 1 5  ? -18.823 25.636 32.225 1.00 17.88 ? 5   LEU B CD2 1 
ATOM   798  N N   . TRP B 1 6  ? -21.459 25.139 36.950 1.00 16.74 ? 6   TRP B N   1 
ATOM   799  C CA  . TRP B 1 6  ? -21.737 24.311 38.130 1.00 16.88 ? 6   TRP B CA  1 
ATOM   800  C C   . TRP B 1 6  ? -22.082 22.895 37.721 1.00 20.89 ? 6   TRP B C   1 
ATOM   801  O O   . TRP B 1 6  ? -21.889 21.925 38.428 1.00 21.80 ? 6   TRP B O   1 
ATOM   802  C CB  . TRP B 1 6  ? -22.932 24.887 38.902 1.00 18.29 ? 6   TRP B CB  1 
ATOM   803  C CG  . TRP B 1 6  ? -22.518 26.231 39.431 1.00 20.51 ? 6   TRP B CG  1 
ATOM   804  C CD1 . TRP B 1 6  ? -22.731 27.491 38.840 1.00 18.83 ? 6   TRP B CD1 1 
ATOM   805  C CD2 . TRP B 1 6  ? -21.755 26.463 40.578 1.00 22.41 ? 6   TRP B CD2 1 
ATOM   806  N NE1 . TRP B 1 6  ? -22.143 28.502 39.534 1.00 21.69 ? 6   TRP B NE1 1 
ATOM   807  C CE2 . TRP B 1 6  ? -21.523 27.933 40.618 1.00 21.98 ? 6   TRP B CE2 1 
ATOM   808  C CE3 . TRP B 1 6  ? -21.229 25.631 41.592 1.00 27.34 ? 6   TRP B CE3 1 
ATOM   809  C CZ2 . TRP B 1 6  ? -20.773 28.464 41.685 1.00 25.00 ? 6   TRP B CZ2 1 
ATOM   810  C CZ3 . TRP B 1 6  ? -20.487 26.204 42.643 1.00 27.45 ? 6   TRP B CZ3 1 
ATOM   811  C CH2 . TRP B 1 6  ? -20.267 27.601 42.682 1.00 26.52 ? 6   TRP B CH2 1 
ATOM   812  N N   . GLN B 1 7  ? -22.622 22.792 36.520 1.00 20.47 ? 7   GLN B N   1 
ATOM   813  C CA  . GLN B 1 7  ? -22.898 21.463 36.007 1.00 22.03 ? 7   GLN B CA  1 
ATOM   814  C C   . GLN B 1 7  ? -22.043 21.267 34.770 1.00 19.86 ? 7   GLN B C   1 
ATOM   815  O O   . GLN B 1 7  ? -21.612 22.234 34.180 1.00 15.05 ? 7   GLN B O   1 
ATOM   816  C CB  . GLN B 1 7  ? -24.394 21.393 35.670 1.00 28.06 ? 7   GLN B CB  1 
ATOM   817  C CG  . GLN B 1 7  ? -24.934 22.542 34.772 1.00 38.43 ? 7   GLN B CG  1 
ATOM   818  C CD  . GLN B 1 7  ? -25.533 23.724 35.537 1.00 44.30 ? 7   GLN B CD  1 
ATOM   819  O OE1 . GLN B 1 7  ? -26.659 23.671 36.019 1.00 47.84 ? 7   GLN B OE1 1 
ATOM   820  N NE2 . GLN B 1 7  ? -24.770 24.821 35.621 1.00 43.41 ? 7   GLN B NE2 1 
ATOM   821  N N   . ARG B 1 8  ? -21.828 20.017 34.359 1.00 19.92 ? 8   ARG B N   1 
ATOM   822  C CA  . ARG B 1 8  ? -21.203 19.814 33.051 1.00 21.83 ? 8   ARG B CA  1 
ATOM   823  C C   . ARG B 1 8  ? -22.064 20.420 31.955 1.00 17.79 ? 8   ARG B C   1 
ATOM   824  O O   . ARG B 1 8  ? -23.269 20.206 31.951 1.00 15.88 ? 8   ARG B O   1 
ATOM   825  C CB  . ARG B 1 8  ? -21.111 18.319 32.732 1.00 26.35 ? 8   ARG B CB  1 
ATOM   826  C CG  . ARG B 1 8  ? -20.108 17.546 33.569 1.00 32.45 ? 8   ARG B CG  1 
ATOM   827  C CD  . ARG B 1 8  ? -19.978 16.095 33.071 1.00 41.63 ? 8   ARG B CD  1 
ATOM   828  N NE  . ARG B 1 8  ? -19.010 15.317 33.853 1.00 45.34 ? 8   ARG B NE  1 
ATOM   829  C CZ  . ARG B 1 8  ? -17.982 14.714 33.240 1.00 50.33 ? 8   ARG B CZ  1 
ATOM   830  N NH1 . ARG B 1 8  ? -17.696 14.932 31.954 1.00 51.51 ? 8   ARG B NH1 1 
ATOM   831  N NH2 . ARG B 1 8  ? -17.223 13.862 33.927 1.00 53.61 ? 8   ARG B NH2 1 
ATOM   832  N N   . PRO B 1 9  ? -21.428 21.178 31.062 1.00 15.43 ? 9   PRO B N   1 
ATOM   833  C CA  . PRO B 1 9  ? -22.194 21.864 30.023 1.00 16.80 ? 9   PRO B CA  1 
ATOM   834  C C   . PRO B 1 9  ? -22.420 20.934 28.840 1.00 17.97 ? 9   PRO B C   1 
ATOM   835  O O   . PRO B 1 9  ? -21.619 20.839 27.914 1.00 18.52 ? 9   PRO B O   1 
ATOM   836  C CB  . PRO B 1 9  ? -21.262 23.037 29.726 1.00 12.85 ? 9   PRO B CB  1 
ATOM   837  C CG  . PRO B 1 9  ? -19.850 22.465 29.863 1.00 14.04 ? 9   PRO B CG  1 
ATOM   838  C CD  . PRO B 1 9  ? -19.999 21.472 31.014 1.00 16.30 ? 9   PRO B CD  1 
ATOM   839  N N   . LEU B 1 10 ? -23.542 20.224 28.925 1.00 17.72 ? 10  LEU B N   1 
ATOM   840  C CA  . LEU B 1 10 ? -23.950 19.324 27.848 1.00 17.03 ? 10  LEU B CA  1 
ATOM   841  C C   . LEU B 1 10 ? -24.955 19.995 26.953 1.00 17.33 ? 10  LEU B C   1 
ATOM   842  O O   . LEU B 1 10 ? -25.814 20.712 27.428 1.00 18.89 ? 10  LEU B O   1 
ATOM   843  C CB  . LEU B 1 10 ? -24.643 18.129 28.440 1.00 15.47 ? 10  LEU B CB  1 
ATOM   844  C CG  . LEU B 1 10 ? -23.761 17.372 29.385 1.00 15.43 ? 10  LEU B CG  1 
ATOM   845  C CD1 . LEU B 1 10 ? -24.628 16.429 30.211 1.00 21.71 ? 10  LEU B CD1 1 
ATOM   846  C CD2 . LEU B 1 10 ? -22.746 16.598 28.606 1.00 16.42 ? 10  LEU B CD2 1 
ATOM   847  N N   . VAL B 1 11 ? -24.841 19.733 25.663 1.00 16.80 ? 11  VAL B N   1 
ATOM   848  C CA  . VAL B 1 11 ? -25.873 20.120 24.707 1.00 15.91 ? 11  VAL B CA  1 
ATOM   849  C C   . VAL B 1 11 ? -26.348 18.881 23.940 1.00 16.31 ? 11  VAL B C   1 
ATOM   850  O O   . VAL B 1 11 ? -25.646 17.887 23.860 1.00 17.74 ? 11  VAL B O   1 
ATOM   851  C CB  . VAL B 1 11 ? -25.273 21.142 23.741 1.00 12.02 ? 11  VAL B CB  1 
ATOM   852  C CG1 . VAL B 1 11 ? -25.114 22.477 24.425 1.00 11.68 ? 11  VAL B CG1 1 
ATOM   853  C CG2 . VAL B 1 11 ? -23.950 20.636 23.164 1.00 11.65 ? 11  VAL B CG2 1 
ATOM   854  N N   . THR B 1 12 ? -27.544 18.946 23.373 1.00 17.90 ? 12  THR B N   1 
ATOM   855  C CA  . THR B 1 12 ? -27.940 17.914 22.415 1.00 19.53 ? 12  THR B CA  1 
ATOM   856  C C   . THR B 1 12 ? -27.432 18.309 21.043 1.00 18.73 ? 12  THR B C   1 
ATOM   857  O O   . THR B 1 12 ? -27.461 19.484 20.672 1.00 17.74 ? 12  THR B O   1 
ATOM   858  C CB  . THR B 1 12 ? -29.475 17.749 22.359 1.00 22.48 ? 12  THR B CB  1 
ATOM   859  O OG1 . THR B 1 12 ? -30.004 17.538 23.673 1.00 25.80 ? 12  THR B OG1 1 
ATOM   860  C CG2 . THR B 1 12 ? -29.911 16.563 21.483 1.00 24.78 ? 12  THR B CG2 1 
ATOM   861  N N   . ILE B 1 13 ? -26.922 17.294 20.346 1.00 13.96 ? 13  ILE B N   1 
ATOM   862  C CA  . ILE B 1 13 ? -26.532 17.477 18.953 1.00 14.90 ? 13  ILE B CA  1 
ATOM   863  C C   . ILE B 1 13 ? -27.266 16.462 18.066 1.00 15.71 ? 13  ILE B C   1 
ATOM   864  O O   . ILE B 1 13 ? -27.714 15.403 18.498 1.00 13.34 ? 13  ILE B O   1 
ATOM   865  C CB  . ILE B 1 13 ? -25.013 17.356 18.760 1.00 14.39 ? 13  ILE B CB  1 
ATOM   866  C CG1 . ILE B 1 13 ? -24.518 15.918 18.895 1.00 17.21 ? 13  ILE B CG1 1 
ATOM   867  C CG2 . ILE B 1 13 ? -24.290 18.315 19.714 1.00 14.65 ? 13  ILE B CG2 1 
ATOM   868  C CD1 . ILE B 1 13 ? -23.020 15.733 18.671 1.00 22.68 ? 13  ILE B CD1 1 
ATOM   869  N N   . LYS B 1 14 ? -27.403 16.816 16.810 1.00 14.86 ? 14  LYS B N   1 
ATOM   870  C CA  . LYS B 1 14 ? -27.976 15.881 15.859 1.00 15.22 ? 14  LYS B CA  1 
ATOM   871  C C   . LYS B 1 14 ? -26.914 15.710 14.831 1.00 16.45 ? 14  LYS B C   1 
ATOM   872  O O   . LYS B 1 14 ? -26.389 16.709 14.355 1.00 13.58 ? 14  LYS B O   1 
ATOM   873  C CB  . LYS B 1 14 ? -29.222 16.516 15.236 1.00 14.97 ? 14  LYS B CB  1 
ATOM   874  C CG  . LYS B 1 14 ? -29.853 15.546 14.264 1.00 18.31 ? 14  LYS B CG  1 
ATOM   875  C CD  . LYS B 1 14 ? -31.233 15.933 13.798 1.00 19.25 ? 14  LYS B CD  1 
ATOM   876  C CE  . LYS B 1 14 ? -31.671 14.833 12.822 1.00 23.80 ? 14  LYS B CE  1 
ATOM   877  N NZ  . LYS B 1 14 ? -33.084 15.022 12.458 1.00 28.13 ? 14  LYS B NZ  1 
ATOM   878  N N   . ILE B 1 15 ? -26.582 14.450 14.552 1.00 17.05 ? 15  ILE B N   1 
ATOM   879  C CA  . ILE B 1 15 ? -25.505 14.166 13.622 1.00 18.19 ? 15  ILE B CA  1 
ATOM   880  C C   . ILE B 1 15 ? -25.763 12.830 12.961 1.00 18.47 ? 15  ILE B C   1 
ATOM   881  O O   . ILE B 1 15 ? -26.118 11.860 13.596 1.00 18.32 ? 15  ILE B O   1 
ATOM   882  C CB  . ILE B 1 15 ? -24.141 14.166 14.341 1.00 20.03 ? 15  ILE B CB  1 
ATOM   883  C CG1 . ILE B 1 15 ? -23.048 13.884 13.296 1.00 19.96 ? 15  ILE B CG1 1 
ATOM   884  C CG2 . ILE B 1 15 ? -24.098 13.161 15.515 1.00 17.99 ? 15  ILE B CG2 1 
ATOM   885  C CD1 . ILE B 1 15 ? -21.602 13.972 13.754 1.00 25.20 ? 15  ILE B CD1 1 
ATOM   886  N N   . GLY B 1 16 ? -25.634 12.823 11.636 1.00 18.92 ? 16  GLY B N   1 
ATOM   887  C CA  . GLY B 1 16 ? -25.890 11.615 10.840 1.00 22.03 ? 16  GLY B CA  1 
ATOM   888  C C   . GLY B 1 16 ? -27.229 10.974 11.119 1.00 19.73 ? 16  GLY B C   1 
ATOM   889  O O   . GLY B 1 16 ? -27.384 9.782  11.271 1.00 24.06 ? 16  GLY B O   1 
ATOM   890  N N   . GLY B 1 17 ? -28.192 11.858 11.265 1.00 21.40 ? 17  GLY B N   1 
ATOM   891  C CA  . GLY B 1 17 ? -29.549 11.477 11.638 1.00 20.56 ? 17  GLY B CA  1 
ATOM   892  C C   . GLY B 1 17 ? -29.785 10.990 13.045 1.00 20.29 ? 17  GLY B C   1 
ATOM   893  O O   . GLY B 1 17 ? -30.879 10.557 13.353 1.00 20.35 ? 17  GLY B O   1 
ATOM   894  N N   . GLN B 1 18 ? -28.757 11.063 13.891 1.00 17.65 ? 18  GLN B N   1 
ATOM   895  C CA  . GLN B 1 18 ? -28.863 10.569 15.256 1.00 16.30 ? 18  GLN B CA  1 
ATOM   896  C C   . GLN B 1 18 ? -28.775 11.712 16.257 1.00 17.64 ? 18  GLN B C   1 
ATOM   897  O O   . GLN B 1 18 ? -28.056 12.677 16.039 1.00 14.17 ? 18  GLN B O   1 
ATOM   898  C CB  . GLN B 1 18 ? -27.688 9.609  15.445 1.00 21.82 ? 18  GLN B CB  1 
ATOM   899  C CG  . GLN B 1 18 ? -27.804 8.470  14.418 1.00 25.49 ? 18  GLN B CG  1 
ATOM   900  C CD  . GLN B 1 18 ? -26.585 7.605  14.364 1.00 24.98 ? 18  GLN B CD  1 
ATOM   901  O OE1 . GLN B 1 18 ? -26.272 6.851  15.277 1.00 27.69 ? 18  GLN B OE1 1 
ATOM   902  N NE2 . GLN B 1 18 ? -25.919 7.736  13.225 1.00 23.38 ? 18  GLN B NE2 1 
ATOM   903  N N   . LEU B 1 19 ? -29.504 11.546 17.353 1.00 15.41 ? 19  LEU B N   1 
ATOM   904  C CA  . LEU B 1 19 ? -29.413 12.461 18.478 1.00 15.19 ? 19  LEU B CA  1 
ATOM   905  C C   . LEU B 1 19 ? -28.457 11.978 19.571 1.00 15.94 ? 19  LEU B C   1 
ATOM   906  O O   . LEU B 1 19 ? -28.518 10.837 19.972 1.00 14.65 ? 19  LEU B O   1 
ATOM   907  C CB  . LEU B 1 19 ? -30.802 12.608 19.100 1.00 13.27 ? 19  LEU B CB  1 
ATOM   908  C CG  . LEU B 1 19 ? -31.927 12.939 18.134 1.00 13.92 ? 19  LEU B CG  1 
ATOM   909  C CD1 . LEU B 1 19 ? -33.213 13.034 18.938 1.00 11.40 ? 19  LEU B CD1 1 
ATOM   910  C CD2 . LEU B 1 19 ? -31.671 14.214 17.318 1.00 11.77 ? 19  LEU B CD2 1 
ATOM   911  N N   . LYS B 1 20 ? -27.567 12.858 20.051 1.00 16.58 ? 20  LYS B N   1 
ATOM   912  C CA  . LYS B 1 20 ? -26.644 12.524 21.150 1.00 16.78 ? 20  LYS B CA  1 
ATOM   913  C C   . LYS B 1 20 ? -26.575 13.696 22.117 1.00 15.29 ? 20  LYS B C   1 
ATOM   914  O O   . LYS B 1 20 ? -27.170 14.745 21.881 1.00 17.68 ? 20  LYS B O   1 
ATOM   915  C CB  . LYS B 1 20 ? -25.214 12.374 20.642 1.00 20.21 ? 20  LYS B CB  1 
ATOM   916  C CG  . LYS B 1 20 ? -24.999 11.504 19.419 1.00 22.00 ? 20  LYS B CG  1 
ATOM   917  C CD  . LYS B 1 20 ? -25.193 10.045 19.717 1.00 26.62 ? 20  LYS B CD  1 
ATOM   918  C CE  . LYS B 1 20 ? -24.512 9.225  18.624 1.00 32.13 ? 20  LYS B CE  1 
ATOM   919  N NZ  . LYS B 1 20 ? -24.716 7.786  18.875 1.00 39.18 ? 20  LYS B NZ  1 
ATOM   920  N N   . GLU B 1 21 ? -25.829 13.522 23.194 1.00 12.96 ? 21  GLU B N   1 
ATOM   921  C CA  . GLU B 1 21 ? -25.485 14.688 24.019 1.00 14.51 ? 21  GLU B CA  1 
ATOM   922  C C   . GLU B 1 21 ? -24.012 14.843 23.953 1.00 12.92 ? 21  GLU B C   1 
ATOM   923  O O   . GLU B 1 21 ? -23.302 13.862 23.805 1.00 13.49 ? 21  GLU B O   1 
ATOM   924  C CB  . GLU B 1 21 ? -25.878 14.503 25.480 1.00 15.15 ? 21  GLU B CB  1 
ATOM   925  C CG  . GLU B 1 21 ? -27.255 15.108 25.727 1.00 22.04 ? 21  GLU B CG  1 
ATOM   926  C CD  . GLU B 1 21 ? -27.624 14.856 27.161 1.00 25.10 ? 21  GLU B CD  1 
ATOM   927  O OE1 . GLU B 1 21 ? -27.637 13.697 27.567 1.00 30.14 ? 21  GLU B OE1 1 
ATOM   928  O OE2 . GLU B 1 21 ? -27.895 15.815 27.873 1.00 29.48 ? 21  GLU B OE2 1 
ATOM   929  N N   . ALA B 1 22 ? -23.569 16.069 24.015 1.00 13.09 ? 22  ALA B N   1 
ATOM   930  C CA  . ALA B 1 22 ? -22.143 16.271 23.929 1.00 13.91 ? 22  ALA B CA  1 
ATOM   931  C C   . ALA B 1 22 ? -21.723 17.329 24.898 1.00 13.16 ? 22  ALA B C   1 
ATOM   932  O O   . ALA B 1 22 ? -22.533 18.112 25.340 1.00 15.56 ? 22  ALA B O   1 
ATOM   933  C CB  . ALA B 1 22 ? -21.761 16.661 22.496 1.00 15.87 ? 22  ALA B CB  1 
ATOM   934  N N   . LEU B 1 23 ? -20.466 17.311 25.245 1.00 12.83 ? 23  LEU B N   1 
ATOM   935  C CA  . LEU B 1 23 ? -19.912 18.289 26.166 1.00 13.38 ? 23  LEU B CA  1 
ATOM   936  C C   . LEU B 1 23 ? -19.293 19.405 25.358 1.00 12.57 ? 23  LEU B C   1 
ATOM   937  O O   . LEU B 1 23 ? -18.619 19.188 24.358 1.00 11.98 ? 23  LEU B O   1 
ATOM   938  C CB  . LEU B 1 23 ? -18.818 17.538 26.942 1.00 17.29 ? 23  LEU B CB  1 
ATOM   939  C CG  . LEU B 1 23 ? -18.374 18.004 28.322 1.00 19.01 ? 23  LEU B CG  1 
ATOM   940  C CD1 . LEU B 1 23 ? -19.539 18.097 29.306 1.00 13.79 ? 23  LEU B CD1 1 
ATOM   941  C CD2 . LEU B 1 23 ? -17.324 17.014 28.838 1.00 19.17 ? 23  LEU B CD2 1 
ATOM   942  N N   . LEU B 1 24 ? -19.533 20.610 25.803 1.00 10.77 ? 24  LEU B N   1 
ATOM   943  C CA  . LEU B 1 24 ? -18.829 21.724 25.185 1.00 14.17 ? 24  LEU B CA  1 
ATOM   944  C C   . LEU B 1 24 ? -17.490 21.924 25.860 1.00 16.31 ? 24  LEU B C   1 
ATOM   945  O O   . LEU B 1 24 ? -17.405 22.114 27.070 1.00 17.14 ? 24  LEU B O   1 
ATOM   946  C CB  . LEU B 1 24 ? -19.622 23.021 25.362 1.00 11.82 ? 24  LEU B CB  1 
ATOM   947  C CG  . LEU B 1 24 ? -21.048 23.013 24.825 1.00 8.05  ? 24  LEU B CG  1 
ATOM   948  C CD1 . LEU B 1 24 ? -21.724 24.295 25.285 1.00 9.99  ? 24  LEU B CD1 1 
ATOM   949  C CD2 . LEU B 1 24 ? -21.123 22.836 23.316 1.00 7.31  ? 24  LEU B CD2 1 
ATOM   950  N N   . ASP B 1 25 ? -16.444 21.873 25.050 1.00 15.42 ? 25  ASP B N   1 
ATOM   951  C CA  . ASP B 1 25 ? -15.160 21.710 25.661 1.00 13.20 ? 25  ASP B CA  1 
ATOM   952  C C   . ASP B 1 25 ? -14.144 22.673 25.101 1.00 14.78 ? 25  ASP B C   1 
ATOM   953  O O   . ASP B 1 25 ? -13.509 22.411 24.095 1.00 14.66 ? 25  ASP B O   1 
ATOM   954  C CB  . ASP B 1 25 ? -14.796 20.254 25.404 1.00 14.16 ? 25  ASP B CB  1 
ATOM   955  C CG  . ASP B 1 25 ? -13.540 19.831 26.133 1.00 19.15 ? 25  ASP B CG  1 
ATOM   956  O OD1 . ASP B 1 25 ? -12.775 20.661 26.641 1.00 18.01 ? 25  ASP B OD1 1 
ATOM   957  O OD2 . ASP B 1 25 ? -13.326 18.637 26.182 1.00 22.60 ? 25  ASP B OD2 1 
ATOM   958  N N   . THR B 1 26 ? -13.917 23.775 25.829 1.00 14.27 ? 26  THR B N   1 
ATOM   959  C CA  . THR B 1 26 ? -12.942 24.760 25.343 1.00 12.79 ? 26  THR B CA  1 
ATOM   960  C C   . THR B 1 26 ? -11.483 24.344 25.388 1.00 14.20 ? 26  THR B C   1 
ATOM   961  O O   . THR B 1 26 ? -10.590 24.937 24.802 1.00 15.40 ? 26  THR B O   1 
ATOM   962  C CB  . THR B 1 26 ? -13.151 26.089 26.078 1.00 14.53 ? 26  THR B CB  1 
ATOM   963  O OG1 . THR B 1 26 ? -12.971 25.906 27.496 1.00 16.39 ? 26  THR B OG1 1 
ATOM   964  C CG2 . THR B 1 26 ? -14.557 26.642 25.857 1.00 9.99  ? 26  THR B CG2 1 
ATOM   965  N N   . GLY B 1 27 ? -11.232 23.276 26.111 1.00 15.21 ? 27  GLY B N   1 
ATOM   966  C CA  . GLY B 1 27 ? -9.823  22.892 26.085 1.00 13.92 ? 27  GLY B CA  1 
ATOM   967  C C   . GLY B 1 27 ? -9.466  21.954 24.951 1.00 17.10 ? 27  GLY B C   1 
ATOM   968  O O   . GLY B 1 27 ? -8.347  21.465 24.875 1.00 19.35 ? 27  GLY B O   1 
ATOM   969  N N   . ALA B 1 28 ? -10.453 21.649 24.092 1.00 15.33 ? 28  ALA B N   1 
ATOM   970  C CA  . ALA B 1 28 ? -10.244 20.616 23.083 1.00 14.62 ? 28  ALA B CA  1 
ATOM   971  C C   . ALA B 1 28 ? -10.159 21.212 21.706 1.00 14.72 ? 28  ALA B C   1 
ATOM   972  O O   . ALA B 1 28 ? -11.020 21.953 21.259 1.00 14.46 ? 28  ALA B O   1 
ATOM   973  C CB  . ALA B 1 28 ? -11.405 19.619 23.076 1.00 11.35 ? 28  ALA B CB  1 
ATOM   974  N N   . ASP B 1 29 ? -9.089  20.871 21.007 1.00 14.51 ? 29  ASP B N   1 
ATOM   975  C CA  . ASP B 1 29 ? -8.914  21.550 19.718 1.00 12.68 ? 29  ASP B CA  1 
ATOM   976  C C   . ASP B 1 29 ? -9.915  21.066 18.720 1.00 14.01 ? 29  ASP B C   1 
ATOM   977  O O   . ASP B 1 29 ? -10.477 21.828 17.964 1.00 14.91 ? 29  ASP B O   1 
ATOM   978  C CB  . ASP B 1 29 ? -7.529  21.332 19.088 1.00 14.41 ? 29  ASP B CB  1 
ATOM   979  C CG  . ASP B 1 29 ? -6.399  21.849 19.940 1.00 17.84 ? 29  ASP B CG  1 
ATOM   980  O OD1 . ASP B 1 29 ? -6.564  22.823 20.661 1.00 17.45 ? 29  ASP B OD1 1 
ATOM   981  O OD2 . ASP B 1 29 ? -5.326  21.271 19.873 1.00 23.31 ? 29  ASP B OD2 1 
ATOM   982  N N   . ASP B 1 30 ? -10.104 19.757 18.768 1.00 16.29 ? 30  ASP B N   1 
ATOM   983  C CA  . ASP B 1 30 ? -10.943 19.031 17.819 1.00 17.97 ? 30  ASP B CA  1 
ATOM   984  C C   . ASP B 1 30 ? -12.139 18.466 18.539 1.00 17.34 ? 30  ASP B C   1 
ATOM   985  O O   . ASP B 1 30 ? -12.096 18.276 19.740 1.00 17.25 ? 30  ASP B O   1 
ATOM   986  C CB  . ASP B 1 30 ? -10.175 17.819 17.314 1.00 21.05 ? 30  ASP B CB  1 
ATOM   987  C CG  . ASP B 1 30 ? -9.180  18.144 16.225 1.00 29.10 ? 30  ASP B CG  1 
ATOM   988  O OD1 . ASP B 1 30 ? -9.310  19.193 15.575 1.00 32.17 ? 30  ASP B OD1 1 
ATOM   989  O OD2 . ASP B 1 30 ? -8.275  17.323 16.020 1.00 31.99 ? 30  ASP B OD2 1 
ATOM   990  N N   . THR B 1 31 ? -13.173 18.175 17.766 1.00 17.08 ? 31  THR B N   1 
ATOM   991  C CA  . THR B 1 31 ? -14.373 17.476 18.226 1.00 17.59 ? 31  THR B CA  1 
ATOM   992  C C   . THR B 1 31 ? -14.204 15.995 18.042 1.00 18.48 ? 31  THR B C   1 
ATOM   993  O O   . THR B 1 31 ? -13.774 15.542 16.994 1.00 21.25 ? 31  THR B O   1 
ATOM   994  C CB  . THR B 1 31 ? -15.515 17.971 17.335 1.00 14.55 ? 31  THR B CB  1 
ATOM   995  O OG1 . THR B 1 31 ? -15.726 19.362 17.575 1.00 15.87 ? 31  THR B OG1 1 
ATOM   996  C CG2 . THR B 1 31 ? -16.812 17.197 17.517 1.00 17.47 ? 31  THR B CG2 1 
ATOM   997  N N   . VAL B 1 32 ? -14.552 15.255 19.061 1.00 21.57 ? 32  VAL B N   1 
ATOM   998  C CA  . VAL B 1 32 ? -14.408 13.801 18.978 1.00 22.79 ? 32  VAL B CA  1 
ATOM   999  C C   . VAL B 1 32 ? -15.600 13.112 19.656 1.00 23.40 ? 32  VAL B C   1 
ATOM   1000 O O   . VAL B 1 32 ? -16.073 13.484 20.730 1.00 22.21 ? 32  VAL B O   1 
ATOM   1001 C CB  . VAL B 1 32 ? -13.020 13.372 19.543 1.00 26.16 ? 32  VAL B CB  1 
ATOM   1002 C CG1 . VAL B 1 32 ? -12.693 14.060 20.859 1.00 27.23 ? 32  VAL B CG1 1 
ATOM   1003 C CG2 . VAL B 1 32 ? -12.820 11.848 19.639 1.00 23.63 ? 32  VAL B CG2 1 
ATOM   1004 N N   . LEU B 1 33 ? -16.124 12.135 18.925 1.00 19.80 ? 33  LEU B N   1 
ATOM   1005 C CA  . LEU B 1 33 ? -17.356 11.507 19.311 1.00 17.63 ? 33  LEU B CA  1 
ATOM   1006 C C   . LEU B 1 33 ? -17.132 10.035 19.473 1.00 19.03 ? 33  LEU B C   1 
ATOM   1007 O O   . LEU B 1 33 ? -16.204 9.426  18.949 1.00 16.01 ? 33  LEU B O   1 
ATOM   1008 C CB  . LEU B 1 33 ? -18.369 11.758 18.214 1.00 17.87 ? 33  LEU B CB  1 
ATOM   1009 C CG  . LEU B 1 33 ? -18.584 13.208 17.798 1.00 17.31 ? 33  LEU B CG  1 
ATOM   1010 C CD1 . LEU B 1 33 ? -19.350 13.180 16.511 1.00 20.32 ? 33  LEU B CD1 1 
ATOM   1011 C CD2 . LEU B 1 33 ? -19.372 14.041 18.787 1.00 17.15 ? 33  LEU B CD2 1 
ATOM   1012 N N   . GLU B 1 34 ? -18.026 9.469  20.262 1.00 22.35 ? 34  GLU B N   1 
ATOM   1013 C CA  . GLU B 1 34 ? -17.993 8.025  20.466 1.00 27.42 ? 34  GLU B CA  1 
ATOM   1014 C C   . GLU B 1 34 ? -18.187 7.339  19.127 1.00 29.05 ? 34  GLU B C   1 
ATOM   1015 O O   . GLU B 1 34 ? -18.645 7.921  18.154 1.00 28.49 ? 34  GLU B O   1 
ATOM   1016 C CB  . GLU B 1 34 ? -19.128 7.650  21.445 1.00 30.89 ? 34  GLU B CB  1 
ATOM   1017 C CG  . GLU B 1 34 ? -18.993 8.337  22.823 1.00 37.90 ? 34  GLU B CG  1 
ATOM   1018 C CD  . GLU B 1 34 ? -20.298 8.413  23.627 1.00 44.20 ? 34  GLU B CD  1 
ATOM   1019 O OE1 . GLU B 1 34 ? -21.373 8.064  23.099 1.00 46.10 ? 34  GLU B OE1 1 
ATOM   1020 O OE2 . GLU B 1 34 ? -20.231 8.847  24.789 1.00 45.79 ? 34  GLU B OE2 1 
ATOM   1021 N N   . GLU B 1 35 ? -17.828 6.074  19.062 1.00 30.48 ? 35  GLU B N   1 
ATOM   1022 C CA  . GLU B 1 35 ? -18.072 5.437  17.780 1.00 32.86 ? 35  GLU B CA  1 
ATOM   1023 C C   . GLU B 1 35 ? -19.562 5.393  17.497 1.00 32.29 ? 35  GLU B C   1 
ATOM   1024 O O   . GLU B 1 35 ? -20.396 5.212  18.376 1.00 33.65 ? 35  GLU B O   1 
ATOM   1025 C CB  . GLU B 1 35 ? -17.434 4.032  17.722 1.00 37.51 ? 35  GLU B CB  1 
ATOM   1026 C CG  . GLU B 1 35 ? -15.930 3.960  18.079 1.00 45.97 ? 35  GLU B CG  1 
ATOM   1027 C CD  . GLU B 1 35 ? -15.689 3.524  19.536 1.00 52.45 ? 35  GLU B CD  1 
ATOM   1028 O OE1 . GLU B 1 35 ? -16.426 3.947  20.440 1.00 54.07 ? 35  GLU B OE1 1 
ATOM   1029 O OE2 . GLU B 1 35 ? -14.751 2.749  19.769 1.00 55.58 ? 35  GLU B OE2 1 
ATOM   1030 N N   . MET B 1 36 ? -19.871 5.596  16.244 1.00 30.29 ? 36  MET B N   1 
ATOM   1031 C CA  . MET B 1 36 ? -21.253 5.582  15.801 1.00 31.94 ? 36  MET B CA  1 
ATOM   1032 C C   . MET B 1 36 ? -21.096 5.359  14.335 1.00 33.25 ? 36  MET B C   1 
ATOM   1033 O O   . MET B 1 36 ? -19.981 5.327  13.834 1.00 31.55 ? 36  MET B O   1 
ATOM   1034 C CB  . MET B 1 36 ? -21.860 6.960  16.018 1.00 32.57 ? 36  MET B CB  1 
ATOM   1035 C CG  . MET B 1 36 ? -20.924 7.997  15.411 1.00 34.05 ? 36  MET B CG  1 
ATOM   1036 S SD  . MET B 1 36 ? -21.676 9.598  15.433 1.00 40.48 ? 36  MET B SD  1 
ATOM   1037 C CE  . MET B 1 36 ? -23.320 9.171  14.818 1.00 37.08 ? 36  MET B CE  1 
ATOM   1038 N N   . SER B 1 37 ? -22.202 5.233  13.642 1.00 36.02 ? 37  SER B N   1 
ATOM   1039 C CA  . SER B 1 37 ? -22.035 5.073  12.202 1.00 38.68 ? 37  SER B CA  1 
ATOM   1040 C C   . SER B 1 37 ? -22.349 6.350  11.472 1.00 37.65 ? 37  SER B C   1 
ATOM   1041 O O   . SER B 1 37 ? -23.421 6.907  11.646 1.00 37.60 ? 37  SER B O   1 
ATOM   1042 C CB  . SER B 1 37 ? -22.936 3.930  11.750 1.00 42.22 ? 37  SER B CB  1 
ATOM   1043 O OG  . SER B 1 37 ? -22.518 2.731  12.437 1.00 49.21 ? 37  SER B OG  1 
ATOM   1044 N N   . LEU B 1 38 ? -21.368 6.788  10.696 1.00 35.34 ? 38  LEU B N   1 
ATOM   1045 C CA  . LEU B 1 38 ? -21.457 7.959  9.847  1.00 34.46 ? 38  LEU B CA  1 
ATOM   1046 C C   . LEU B 1 38 ? -21.193 7.464  8.429  1.00 37.85 ? 38  LEU B C   1 
ATOM   1047 O O   . LEU B 1 38 ? -20.444 6.511  8.249  1.00 40.79 ? 38  LEU B O   1 
ATOM   1048 C CB  . LEU B 1 38 ? -20.354 8.934  10.286 1.00 32.55 ? 38  LEU B CB  1 
ATOM   1049 C CG  . LEU B 1 38 ? -20.741 9.807  11.481 1.00 32.24 ? 38  LEU B CG  1 
ATOM   1050 C CD1 . LEU B 1 38 ? -19.530 10.450 12.124 1.00 33.84 ? 38  LEU B CD1 1 
ATOM   1051 C CD2 . LEU B 1 38 ? -21.706 10.902 11.053 1.00 29.88 ? 38  LEU B CD2 1 
ATOM   1052 N N   . PRO B 1 39 ? -21.843 8.095  7.446  1.00 36.72 ? 39  PRO B N   1 
ATOM   1053 C CA  . PRO B 1 39 ? -21.595 7.699  6.069  1.00 36.75 ? 39  PRO B CA  1 
ATOM   1054 C C   . PRO B 1 39 ? -20.340 8.329  5.490  1.00 37.72 ? 39  PRO B C   1 
ATOM   1055 O O   . PRO B 1 39 ? -19.957 9.464  5.734  1.00 37.26 ? 39  PRO B O   1 
ATOM   1056 C CB  . PRO B 1 39 ? -22.831 8.264  5.383  1.00 36.61 ? 39  PRO B CB  1 
ATOM   1057 C CG  . PRO B 1 39 ? -23.094 9.581  6.115  1.00 35.96 ? 39  PRO B CG  1 
ATOM   1058 C CD  . PRO B 1 39 ? -22.806 9.194  7.551  1.00 35.88 ? 39  PRO B CD  1 
ATOM   1059 N N   . GLY B 1 40 ? -19.746 7.559  4.617  1.00 40.00 ? 40  GLY B N   1 
ATOM   1060 C CA  . GLY B 1 40 ? -18.767 8.220  3.785  1.00 42.50 ? 40  GLY B CA  1 
ATOM   1061 C C   . GLY B 1 40 ? -17.371 7.732  4.034  1.00 43.78 ? 40  GLY B C   1 
ATOM   1062 O O   . GLY B 1 40 ? -17.105 6.630  4.495  1.00 43.91 ? 40  GLY B O   1 
ATOM   1063 N N   . ARG B 1 41 ? -16.473 8.613  3.644  1.00 44.00 ? 41  ARG B N   1 
ATOM   1064 C CA  . ARG B 1 41 ? -15.068 8.250  3.623  1.00 46.09 ? 41  ARG B CA  1 
ATOM   1065 C C   . ARG B 1 41 ? -14.446 8.919  4.819  1.00 44.11 ? 41  ARG B C   1 
ATOM   1066 O O   . ARG B 1 41 ? -14.922 9.950  5.275  1.00 44.25 ? 41  ARG B O   1 
ATOM   1067 C CB  . ARG B 1 41 ? -14.414 8.739  2.306  1.00 50.29 ? 41  ARG B CB  1 
ATOM   1068 C CG  . ARG B 1 41 ? -15.272 9.618  1.355  1.00 56.96 ? 41  ARG B CG  1 
ATOM   1069 C CD  . ARG B 1 41 ? -16.288 8.885  0.435  1.00 59.77 ? 41  ARG B CD  1 
ATOM   1070 N NE  . ARG B 1 41 ? -17.531 9.661  0.305  1.00 60.63 ? 41  ARG B NE  1 
ATOM   1071 C CZ  . ARG B 1 41 ? -18.733 9.071  0.165  1.00 60.82 ? 41  ARG B CZ  1 
ATOM   1072 N NH1 . ARG B 1 41 ? -18.874 7.767  -0.097 1.00 59.03 ? 41  ARG B NH1 1 
ATOM   1073 N NH2 . ARG B 1 41 ? -19.821 9.823  0.318  1.00 60.84 ? 41  ARG B NH2 1 
ATOM   1074 N N   . TRP B 1 42 ? -13.399 8.305  5.328  1.00 42.32 ? 42  TRP B N   1 
ATOM   1075 C CA  . TRP B 1 42 ? -12.769 8.844  6.522  1.00 41.47 ? 42  TRP B CA  1 
ATOM   1076 C C   . TRP B 1 42 ? -11.299 8.609  6.394  1.00 41.09 ? 42  TRP B C   1 
ATOM   1077 O O   . TRP B 1 42 ? -10.913 7.834  5.538  1.00 42.89 ? 42  TRP B O   1 
ATOM   1078 C CB  . TRP B 1 42 ? -13.314 8.122  7.763  1.00 40.51 ? 42  TRP B CB  1 
ATOM   1079 C CG  . TRP B 1 42 ? -13.153 6.614  7.748  1.00 41.42 ? 42  TRP B CG  1 
ATOM   1080 C CD1 . TRP B 1 42 ? -14.127 5.699  7.313  1.00 41.88 ? 42  TRP B CD1 1 
ATOM   1081 C CD2 . TRP B 1 42 ? -12.101 5.827  8.255  1.00 42.86 ? 42  TRP B CD2 1 
ATOM   1082 N NE1 . TRP B 1 42 ? -13.776 4.405  7.529  1.00 41.81 ? 42  TRP B NE1 1 
ATOM   1083 C CE2 . TRP B 1 42 ? -12.538 4.409  8.117  1.00 43.79 ? 42  TRP B CE2 1 
ATOM   1084 C CE3 . TRP B 1 42 ? -10.844 6.092  8.829  1.00 45.37 ? 42  TRP B CE3 1 
ATOM   1085 C CZ2 . TRP B 1 42 ? -11.691 3.381  8.579  1.00 44.80 ? 42  TRP B CZ2 1 
ATOM   1086 C CZ3 . TRP B 1 42 ? -10.026 5.030  9.281  1.00 45.88 ? 42  TRP B CZ3 1 
ATOM   1087 C CH2 . TRP B 1 42 ? -10.443 3.688  9.162  1.00 44.89 ? 42  TRP B CH2 1 
ATOM   1088 N N   . LYS B 1 43 ? -10.495 9.208  7.254  1.00 39.87 ? 43  LYS B N   1 
ATOM   1089 C CA  . LYS B 1 43 ? -9.105  8.744  7.284  1.00 40.27 ? 43  LYS B CA  1 
ATOM   1090 C C   . LYS B 1 43 ? -8.560  8.635  8.719  1.00 39.67 ? 43  LYS B C   1 
ATOM   1091 O O   . LYS B 1 43 ? -9.106  9.290  9.596  1.00 39.05 ? 43  LYS B O   1 
ATOM   1092 C CB  . LYS B 1 43 ? -8.293  9.649  6.356  1.00 39.38 ? 43  LYS B CB  1 
ATOM   1093 C CG  . LYS B 1 43 ? -8.325  11.116 6.716  1.00 42.34 ? 43  LYS B CG  1 
ATOM   1094 C CD  . LYS B 1 43 ? -7.445  11.851 5.725  1.00 47.48 ? 43  LYS B CD  1 
ATOM   1095 C CE  . LYS B 1 43 ? -8.087  11.977 4.347  1.00 49.03 ? 43  LYS B CE  1 
ATOM   1096 N NZ  . LYS B 1 43 ? -8.656  13.332 4.232  1.00 51.38 ? 43  LYS B NZ  1 
ATOM   1097 N N   . PRO B 1 44 ? -7.547  7.763  8.978  1.00 38.61 ? 44  PRO B N   1 
ATOM   1098 C CA  . PRO B 1 44 ? -7.093  7.631  10.370 1.00 36.61 ? 44  PRO B CA  1 
ATOM   1099 C C   . PRO B 1 44 ? -6.308  8.848  10.786 1.00 37.18 ? 44  PRO B C   1 
ATOM   1100 O O   . PRO B 1 44 ? -5.709  9.549  9.977  1.00 37.27 ? 44  PRO B O   1 
ATOM   1101 C CB  . PRO B 1 44 ? -6.236  6.361  10.342 1.00 34.78 ? 44  PRO B CB  1 
ATOM   1102 C CG  . PRO B 1 44 ? -5.697  6.302  8.927  1.00 33.67 ? 44  PRO B CG  1 
ATOM   1103 C CD  . PRO B 1 44 ? -6.816  6.872  8.072  1.00 34.83 ? 44  PRO B CD  1 
ATOM   1104 N N   . LYS B 1 45 ? -6.377  9.076  12.088 1.00 34.84 ? 45  LYS B N   1 
ATOM   1105 C CA  . LYS B 1 45 ? -5.686  10.166 12.729 1.00 32.14 ? 45  LYS B CA  1 
ATOM   1106 C C   . LYS B 1 45 ? -5.479  9.586  14.088 1.00 32.22 ? 45  LYS B C   1 
ATOM   1107 O O   . LYS B 1 45 ? -5.983  8.516  14.389 1.00 28.54 ? 45  LYS B O   1 
ATOM   1108 C CB  . LYS B 1 45 ? -6.594  11.383 12.839 1.00 32.40 ? 45  LYS B CB  1 
ATOM   1109 C CG  . LYS B 1 45 ? -5.837  12.717 12.792 1.00 36.16 ? 45  LYS B CG  1 
ATOM   1110 C CD  . LYS B 1 45 ? -6.572  13.903 13.453 1.00 37.79 ? 45  LYS B CD  1 
ATOM   1111 C CE  . LYS B 1 45 ? -5.851  15.246 13.200 1.00 44.51 ? 45  LYS B CE  1 
ATOM   1112 N NZ  . LYS B 1 45 ? -6.205  16.286 14.189 1.00 45.41 ? 45  LYS B NZ  1 
ATOM   1113 N N   . MET B 1 46 ? -4.731  10.308 14.900 1.00 35.19 ? 46  MET B N   1 
ATOM   1114 C CA  . MET B 1 46 ? -4.352  9.880  16.241 1.00 32.89 ? 46  MET B CA  1 
ATOM   1115 C C   . MET B 1 46 ? -4.357  11.140 17.037 1.00 30.64 ? 46  MET B C   1 
ATOM   1116 O O   . MET B 1 46 ? -3.865  12.155 16.579 1.00 33.23 ? 46  MET B O   1 
ATOM   1117 C CB  . MET B 1 46 ? -2.945  9.335  16.112 1.00 37.09 ? 46  MET B CB  1 
ATOM   1118 C CG  . MET B 1 46 ? -2.224  8.937  17.378 1.00 41.31 ? 46  MET B CG  1 
ATOM   1119 S SD  . MET B 1 46 ? -1.208  7.529  16.916 1.00 49.60 ? 46  MET B SD  1 
ATOM   1120 C CE  . MET B 1 46 ? -2.456  6.257  17.178 1.00 45.59 ? 46  MET B CE  1 
ATOM   1121 N N   . ILE B 1 47 ? -4.973  11.078 18.183 1.00 28.29 ? 47  ILE B N   1 
ATOM   1122 C CA  . ILE B 1 47 ? -5.260  12.279 18.945 1.00 27.29 ? 47  ILE B CA  1 
ATOM   1123 C C   . ILE B 1 47 ? -4.681  12.057 20.310 1.00 24.41 ? 47  ILE B C   1 
ATOM   1124 O O   . ILE B 1 47 ? -4.743  10.964 20.840 1.00 22.35 ? 47  ILE B O   1 
ATOM   1125 C CB  . ILE B 1 47 ? -6.805  12.362 18.947 1.00 29.50 ? 47  ILE B CB  1 
ATOM   1126 C CG1 . ILE B 1 47 ? -7.294  13.122 17.727 1.00 30.70 ? 47  ILE B CG1 1 
ATOM   1127 C CG2 . ILE B 1 47 ? -7.520  12.939 20.177 1.00 29.99 ? 47  ILE B CG2 1 
ATOM   1128 C CD1 . ILE B 1 47 ? -6.766  14.557 17.652 1.00 30.33 ? 47  ILE B CD1 1 
ATOM   1129 N N   . GLY B 1 48 ? -4.123  13.100 20.866 1.00 23.01 ? 48  GLY B N   1 
ATOM   1130 C CA  . GLY B 1 48 ? -3.696  12.972 22.247 1.00 25.67 ? 48  GLY B CA  1 
ATOM   1131 C C   . GLY B 1 48 ? -4.635  13.669 23.214 1.00 27.72 ? 48  GLY B C   1 
ATOM   1132 O O   . GLY B 1 48 ? -5.225  14.701 22.919 1.00 24.87 ? 48  GLY B O   1 
ATOM   1133 N N   . GLY B 1 49 ? -4.727  13.052 24.382 1.00 29.30 ? 49  GLY B N   1 
ATOM   1134 C CA  . GLY B 1 49 ? -5.491  13.589 25.488 1.00 29.96 ? 49  GLY B CA  1 
ATOM   1135 C C   . GLY B 1 49 ? -4.713  13.337 26.747 1.00 31.69 ? 49  GLY B C   1 
ATOM   1136 O O   . GLY B 1 49 ? -3.598  12.833 26.743 1.00 30.33 ? 49  GLY B O   1 
ATOM   1137 N N   . ILE B 1 50 ? -5.321  13.711 27.868 1.00 33.62 ? 50  ILE B N   1 
ATOM   1138 C CA  . ILE B 1 50 ? -4.705  13.328 29.140 1.00 34.18 ? 50  ILE B CA  1 
ATOM   1139 C C   . ILE B 1 50 ? -4.867  11.851 29.274 1.00 33.87 ? 50  ILE B C   1 
ATOM   1140 O O   . ILE B 1 50 ? -5.952  11.329 29.098 1.00 36.48 ? 50  ILE B O   1 
ATOM   1141 C CB  . ILE B 1 50 ? -5.411  14.074 30.286 1.00 33.84 ? 50  ILE B CB  1 
ATOM   1142 C CG1 . ILE B 1 50 ? -4.661  15.378 30.544 1.00 37.36 ? 50  ILE B CG1 1 
ATOM   1143 C CG2 . ILE B 1 50 ? -5.467  13.338 31.620 1.00 32.67 ? 50  ILE B CG2 1 
ATOM   1144 C CD1 . ILE B 1 50 ? -5.284  16.255 31.633 1.00 38.21 ? 50  ILE B CD1 1 
ATOM   1145 N N   . GLY B 1 51 ? -3.774  11.191 29.580 1.00 33.87 ? 51  GLY B N   1 
ATOM   1146 C CA  . GLY B 1 51 ? -3.910  9.739  29.640 1.00 31.63 ? 51  GLY B CA  1 
ATOM   1147 C C   . GLY B 1 51 ? -3.267  9.045  28.465 1.00 30.82 ? 51  GLY B C   1 
ATOM   1148 O O   . GLY B 1 51 ? -2.808  7.926  28.573 1.00 31.28 ? 51  GLY B O   1 
ATOM   1149 N N   . GLY B 1 52 ? -3.210  9.723  27.332 1.00 29.88 ? 52  GLY B N   1 
ATOM   1150 C CA  . GLY B 1 52 ? -2.543  9.055  26.232 1.00 30.64 ? 52  GLY B CA  1 
ATOM   1151 C C   . GLY B 1 52 ? -3.089  9.489  24.910 1.00 30.41 ? 52  GLY B C   1 
ATOM   1152 O O   . GLY B 1 52 ? -3.652  10.559 24.766 1.00 31.59 ? 52  GLY B O   1 
ATOM   1153 N N   . PHE B 1 53 ? -2.885  8.634  23.938 1.00 29.67 ? 53  PHE B N   1 
ATOM   1154 C CA  . PHE B 1 53 ? -3.277  8.984  22.593 1.00 30.42 ? 53  PHE B CA  1 
ATOM   1155 C C   . PHE B 1 53 ? -4.218  7.945  22.126 1.00 27.47 ? 53  PHE B C   1 
ATOM   1156 O O   . PHE B 1 53 ? -4.122  6.825  22.571 1.00 31.26 ? 53  PHE B O   1 
ATOM   1157 C CB  . PHE B 1 53 ? -2.047  9.044  21.686 1.00 35.76 ? 53  PHE B CB  1 
ATOM   1158 C CG  . PHE B 1 53 ? -1.144  7.838  21.820 1.00 46.75 ? 53  PHE B CG  1 
ATOM   1159 C CD1 . PHE B 1 53 ? -0.140  7.802  22.825 1.00 51.76 ? 53  PHE B CD1 1 
ATOM   1160 C CD2 . PHE B 1 53 ? -1.274  6.761  20.910 1.00 50.55 ? 53  PHE B CD2 1 
ATOM   1161 C CE1 . PHE B 1 53 ? 0.739   6.695  22.911 1.00 53.40 ? 53  PHE B CE1 1 
ATOM   1162 C CE2 . PHE B 1 53 ? -0.394  5.653  21.002 1.00 53.50 ? 53  PHE B CE2 1 
ATOM   1163 C CZ  . PHE B 1 53 ? 0.611   5.623  22.000 1.00 54.40 ? 53  PHE B CZ  1 
ATOM   1164 N N   . ILE B 1 54 ? -5.119  8.295  21.253 1.00 26.11 ? 54  ILE B N   1 
ATOM   1165 C CA  . ILE B 1 54 ? -6.000  7.276  20.707 1.00 26.03 ? 54  ILE B CA  1 
ATOM   1166 C C   . ILE B 1 54 ? -5.946  7.434  19.214 1.00 27.14 ? 54  ILE B C   1 
ATOM   1167 O O   . ILE B 1 54 ? -5.618  8.519  18.765 1.00 24.29 ? 54  ILE B O   1 
ATOM   1168 C CB  . ILE B 1 54 ? -7.454  7.471  21.230 1.00 26.95 ? 54  ILE B CB  1 
ATOM   1169 C CG1 . ILE B 1 54 ? -8.103  8.842  21.002 1.00 25.21 ? 54  ILE B CG1 1 
ATOM   1170 C CG2 . ILE B 1 54 ? -7.595  7.103  22.713 1.00 28.64 ? 54  ILE B CG2 1 
ATOM   1171 C CD1 . ILE B 1 54 ? -9.551  8.832  21.490 1.00 21.09 ? 54  ILE B CD1 1 
ATOM   1172 N N   . LYS B 1 55 ? -6.257  6.376  18.458 1.00 28.07 ? 55  LYS B N   1 
ATOM   1173 C CA  . LYS B 1 55 ? -6.432  6.575  17.012 1.00 32.54 ? 55  LYS B CA  1 
ATOM   1174 C C   . LYS B 1 55 ? -7.904  6.798  16.707 1.00 32.15 ? 55  LYS B C   1 
ATOM   1175 O O   . LYS B 1 55 ? -8.734  6.158  17.330 1.00 35.34 ? 55  LYS B O   1 
ATOM   1176 C CB  . LYS B 1 55 ? -5.882  5.337  16.260 1.00 37.35 ? 55  LYS B CB  1 
ATOM   1177 C CG  . LYS B 1 55 ? -6.030  5.396  14.718 1.00 42.21 ? 55  LYS B CG  1 
ATOM   1178 C CD  . LYS B 1 55 ? -4.996  4.599  13.912 1.00 48.90 ? 55  LYS B CD  1 
ATOM   1179 C CE  . LYS B 1 55 ? -3.562  5.206  13.868 1.00 54.19 ? 55  LYS B CE  1 
ATOM   1180 N NZ  . LYS B 1 55 ? -3.436  6.391  12.980 1.00 54.43 ? 55  LYS B NZ  1 
ATOM   1181 N N   . VAL B 1 56 ? -8.223  7.718  15.799 1.00 30.98 ? 56  VAL B N   1 
ATOM   1182 C CA  . VAL B 1 56 ? -9.628  8.026  15.529 1.00 28.20 ? 56  VAL B CA  1 
ATOM   1183 C C   . VAL B 1 56 ? -9.822  8.059  14.024 1.00 29.63 ? 56  VAL B C   1 
ATOM   1184 O O   . VAL B 1 56 ? -8.852  8.032  13.275 1.00 31.10 ? 56  VAL B O   1 
ATOM   1185 C CB  . VAL B 1 56 ? -9.974  9.387  16.134 1.00 26.19 ? 56  VAL B CB  1 
ATOM   1186 C CG1 . VAL B 1 56 ? -9.914  9.372  17.661 1.00 24.81 ? 56  VAL B CG1 1 
ATOM   1187 C CG2 . VAL B 1 56 ? -9.090  10.486 15.564 1.00 23.90 ? 56  VAL B CG2 1 
ATOM   1188 N N   . ARG B 1 57 ? -11.059 8.144  13.569 1.00 29.13 ? 57  ARG B N   1 
ATOM   1189 C CA  . ARG B 1 57 ? -11.207 8.370  12.134 1.00 30.20 ? 57  ARG B CA  1 
ATOM   1190 C C   . ARG B 1 57 ? -11.780 9.721  11.843 1.00 30.59 ? 57  ARG B C   1 
ATOM   1191 O O   . ARG B 1 57 ? -12.672 10.240 12.500 1.00 29.70 ? 57  ARG B O   1 
ATOM   1192 C CB  . ARG B 1 57 ? -11.993 7.245  11.460 1.00 31.46 ? 57  ARG B CB  1 
ATOM   1193 C CG  . ARG B 1 57 ? -13.396 6.919  11.938 1.00 41.06 ? 57  ARG B CG  1 
ATOM   1194 C CD  . ARG B 1 57 ? -13.688 5.409  12.052 1.00 44.40 ? 57  ARG B CD  1 
ATOM   1195 N NE  . ARG B 1 57 ? -12.762 4.805  13.017 1.00 49.66 ? 57  ARG B NE  1 
ATOM   1196 C CZ  . ARG B 1 57 ? -13.014 4.745  14.342 1.00 49.66 ? 57  ARG B CZ  1 
ATOM   1197 N NH1 . ARG B 1 57 ? -14.236 4.990  14.836 1.00 49.56 ? 57  ARG B NH1 1 
ATOM   1198 N NH2 . ARG B 1 57 ? -12.007 4.438  15.176 1.00 47.03 ? 57  ARG B NH2 1 
ATOM   1199 N N   . GLN B 1 58 ? -11.157 10.324 10.865 1.00 29.34 ? 58  GLN B N   1 
ATOM   1200 C CA  . GLN B 1 58 ? -11.459 11.709 10.596 1.00 29.45 ? 58  GLN B CA  1 
ATOM   1201 C C   . GLN B 1 58 ? -12.461 11.761 9.501  1.00 29.93 ? 58  GLN B C   1 
ATOM   1202 O O   . GLN B 1 58 ? -12.186 11.256 8.422  1.00 31.71 ? 58  GLN B O   1 
ATOM   1203 C CB  . GLN B 1 58 ? -10.169 12.385 10.158 1.00 28.04 ? 58  GLN B CB  1 
ATOM   1204 C CG  . GLN B 1 58 ? -10.414 13.756 9.527  1.00 31.19 ? 58  GLN B CG  1 
ATOM   1205 C CD  . GLN B 1 58 ? -9.224  14.679 9.609  1.00 30.84 ? 58  GLN B CD  1 
ATOM   1206 O OE1 . GLN B 1 58 ? -9.328  15.862 9.343  1.00 31.81 ? 58  GLN B OE1 1 
ATOM   1207 N NE2 . GLN B 1 58 ? -8.091  14.151 10.041 1.00 31.17 ? 58  GLN B NE2 1 
ATOM   1208 N N   . TYR B 1 59 ? -13.590 12.377 9.800  1.00 30.12 ? 59  TYR B N   1 
ATOM   1209 C CA  . TYR B 1 59 ? -14.598 12.631 8.775  1.00 29.35 ? 59  TYR B CA  1 
ATOM   1210 C C   . TYR B 1 59 ? -14.613 14.107 8.528  1.00 29.03 ? 59  TYR B C   1 
ATOM   1211 O O   . TYR B 1 59 ? -14.673 14.903 9.452  1.00 29.33 ? 59  TYR B O   1 
ATOM   1212 C CB  . TYR B 1 59 ? -15.981 12.214 9.290  1.00 27.00 ? 59  TYR B CB  1 
ATOM   1213 C CG  . TYR B 1 59 ? -16.147 10.715 9.382  1.00 28.98 ? 59  TYR B CG  1 
ATOM   1214 C CD1 . TYR B 1 59 ? -15.716 10.008 10.530 1.00 27.04 ? 59  TYR B CD1 1 
ATOM   1215 C CD2 . TYR B 1 59 ? -16.828 10.032 8.345  1.00 31.52 ? 59  TYR B CD2 1 
ATOM   1216 C CE1 . TYR B 1 59 ? -15.992 8.625  10.643 1.00 27.55 ? 59  TYR B CE1 1 
ATOM   1217 C CE2 . TYR B 1 59 ? -17.101 8.648  8.457  1.00 28.97 ? 59  TYR B CE2 1 
ATOM   1218 C CZ  . TYR B 1 59 ? -16.690 7.951  9.613  1.00 29.43 ? 59  TYR B CZ  1 
ATOM   1219 O OH  . TYR B 1 59 ? -17.013 6.612  9.763  1.00 30.26 ? 59  TYR B OH  1 
ATOM   1220 N N   . ASP B 1 60 ? -14.514 14.487 7.274  1.00 30.88 ? 60  ASP B N   1 
ATOM   1221 C CA  . ASP B 1 60 ? -14.519 15.925 7.025  1.00 32.90 ? 60  ASP B CA  1 
ATOM   1222 C C   . ASP B 1 60 ? -15.873 16.313 6.509  1.00 34.37 ? 60  ASP B C   1 
ATOM   1223 O O   . ASP B 1 60 ? -16.596 15.485 5.975  1.00 34.12 ? 60  ASP B O   1 
ATOM   1224 C CB  . ASP B 1 60 ? -13.508 16.324 5.948  1.00 34.96 ? 60  ASP B CB  1 
ATOM   1225 C CG  . ASP B 1 60 ? -12.057 16.164 6.355  1.00 37.14 ? 60  ASP B CG  1 
ATOM   1226 O OD1 . ASP B 1 60 ? -11.752 16.049 7.548  1.00 35.54 ? 60  ASP B OD1 1 
ATOM   1227 O OD2 . ASP B 1 60 ? -11.218 16.166 5.447  1.00 40.89 ? 60  ASP B OD2 1 
ATOM   1228 N N   . GLN B 1 61 ? -16.184 17.599 6.682  1.00 34.86 ? 61  GLN B N   1 
ATOM   1229 C CA  . GLN B 1 61 ? -17.418 18.160 6.117  1.00 36.22 ? 61  GLN B CA  1 
ATOM   1230 C C   . GLN B 1 61 ? -18.752 17.560 6.591  1.00 35.48 ? 61  GLN B C   1 
ATOM   1231 O O   . GLN B 1 61 ? -19.720 17.478 5.845  1.00 36.04 ? 61  GLN B O   1 
ATOM   1232 C CB  . GLN B 1 61 ? -17.334 18.146 4.584  1.00 39.45 ? 61  GLN B CB  1 
ATOM   1233 C CG  . GLN B 1 61 ? -16.140 18.929 4.049  1.00 46.12 ? 61  GLN B CG  1 
ATOM   1234 C CD  . GLN B 1 61 ? -15.743 18.402 2.688  1.00 52.86 ? 61  GLN B CD  1 
ATOM   1235 O OE1 . GLN B 1 61 ? -15.021 17.418 2.545  1.00 53.90 ? 61  GLN B OE1 1 
ATOM   1236 N NE2 . GLN B 1 61 ? -16.203 19.133 1.673  1.00 55.26 ? 61  GLN B NE2 1 
ATOM   1237 N N   . ILE B 1 62 ? -18.795 17.185 7.880  1.00 31.33 ? 62  ILE B N   1 
ATOM   1238 C CA  . ILE B 1 62 ? -20.035 16.633 8.457  1.00 24.97 ? 62  ILE B CA  1 
ATOM   1239 C C   . ILE B 1 62 ? -20.979 17.725 8.955  1.00 21.34 ? 62  ILE B C   1 
ATOM   1240 O O   . ILE B 1 62 ? -20.542 18.735 9.467  1.00 22.40 ? 62  ILE B O   1 
ATOM   1241 C CB  . ILE B 1 62 ? -19.618 15.716 9.599  1.00 22.02 ? 62  ILE B CB  1 
ATOM   1242 C CG1 . ILE B 1 62 ? -18.750 14.584 9.108  1.00 23.94 ? 62  ILE B CG1 1 
ATOM   1243 C CG2 . ILE B 1 62 ? -20.805 15.095 10.306 1.00 24.19 ? 62  ILE B CG2 1 
ATOM   1244 C CD1 . ILE B 1 62 ? -19.609 13.595 8.316  1.00 26.61 ? 62  ILE B CD1 1 
ATOM   1245 N N   . LEU B 1 63 ? -22.267 17.517 8.792  1.00 18.63 ? 63  LEU B N   1 
ATOM   1246 C CA  . LEU B 1 63 ? -23.214 18.480 9.323  1.00 19.27 ? 63  LEU B CA  1 
ATOM   1247 C C   . LEU B 1 63 ? -23.614 18.051 10.707 1.00 18.04 ? 63  LEU B C   1 
ATOM   1248 O O   . LEU B 1 63 ? -24.053 16.931 10.907 1.00 19.96 ? 63  LEU B O   1 
ATOM   1249 C CB  . LEU B 1 63 ? -24.418 18.496 8.361  1.00 20.93 ? 63  LEU B CB  1 
ATOM   1250 C CG  . LEU B 1 63 ? -25.520 19.556 8.508  1.00 22.57 ? 63  LEU B CG  1 
ATOM   1251 C CD1 . LEU B 1 63 ? -26.513 19.215 9.588  1.00 26.63 ? 63  LEU B CD1 1 
ATOM   1252 C CD2 . LEU B 1 63 ? -24.990 20.966 8.755  1.00 19.71 ? 63  LEU B CD2 1 
ATOM   1253 N N   . ILE B 1 64 ? -23.457 18.967 11.639 1.00 19.44 ? 64  ILE B N   1 
ATOM   1254 C CA  . ILE B 1 64 ? -23.906 18.777 13.009 1.00 18.26 ? 64  ILE B CA  1 
ATOM   1255 C C   . ILE B 1 64 ? -24.888 19.865 13.326 1.00 18.17 ? 64  ILE B C   1 
ATOM   1256 O O   . ILE B 1 64 ? -24.726 20.998 12.892 1.00 14.63 ? 64  ILE B O   1 
ATOM   1257 C CB  . ILE B 1 64 ? -22.762 18.978 14.005 1.00 21.66 ? 64  ILE B CB  1 
ATOM   1258 C CG1 . ILE B 1 64 ? -21.416 19.336 13.392 1.00 23.32 ? 64  ILE B CG1 1 
ATOM   1259 C CG2 . ILE B 1 64 ? -22.614 17.792 14.977 1.00 19.17 ? 64  ILE B CG2 1 
ATOM   1260 C CD1 . ILE B 1 64 ? -20.625 18.107 12.939 1.00 28.55 ? 64  ILE B CD1 1 
ATOM   1261 N N   . GLU B 1 65 ? -25.890 19.519 14.115 1.00 18.07 ? 65  GLU B N   1 
ATOM   1262 C CA  . GLU B 1 65 ? -26.659 20.585 14.761 1.00 24.24 ? 65  GLU B CA  1 
ATOM   1263 C C   . GLU B 1 65 ? -26.456 20.525 16.230 1.00 26.14 ? 65  GLU B C   1 
ATOM   1264 O O   . GLU B 1 65 ? -26.592 19.466 16.811 1.00 25.84 ? 65  GLU B O   1 
ATOM   1265 C CB  . GLU B 1 65 ? -28.136 20.424 14.526 1.00 24.83 ? 65  GLU B CB  1 
ATOM   1266 C CG  . GLU B 1 65 ? -28.338 20.827 13.085 1.00 34.31 ? 65  GLU B CG  1 
ATOM   1267 C CD  . GLU B 1 65 ? -29.705 20.410 12.634 1.00 40.84 ? 65  GLU B CD  1 
ATOM   1268 O OE1 . GLU B 1 65 ? -30.652 20.632 13.400 1.00 45.05 ? 65  GLU B OE1 1 
ATOM   1269 O OE2 . GLU B 1 65 ? -29.806 19.857 11.525 1.00 42.06 ? 65  GLU B OE2 1 
ATOM   1270 N N   . ILE B 1 66 ? -26.071 21.646 16.797 1.00 27.79 ? 66  ILE B N   1 
ATOM   1271 C CA  . ILE B 1 66 ? -25.675 21.690 18.206 1.00 31.40 ? 66  ILE B CA  1 
ATOM   1272 C C   . ILE B 1 66 ? -26.576 22.725 18.791 1.00 33.33 ? 66  ILE B C   1 
ATOM   1273 O O   . ILE B 1 66 ? -26.596 23.850 18.314 1.00 32.30 ? 66  ILE B O   1 
ATOM   1274 C CB  . ILE B 1 66 ? -24.214 22.181 18.273 1.00 32.45 ? 66  ILE B CB  1 
ATOM   1275 C CG1 . ILE B 1 66 ? -23.228 21.210 17.597 1.00 30.18 ? 66  ILE B CG1 1 
ATOM   1276 C CG2 . ILE B 1 66 ? -23.773 22.512 19.710 1.00 30.82 ? 66  ILE B CG2 1 
ATOM   1277 C CD1 . ILE B 1 66 ? -21.834 21.810 17.433 1.00 29.25 ? 66  ILE B CD1 1 
ATOM   1278 N N   . CYS B 1 67 ? -27.396 22.329 19.758 1.00 37.41 ? 67  CYS B N   1 
ATOM   1279 C CA  . CYS B 1 67 ? -28.622 23.131 19.954 1.00 42.33 ? 67  CYS B CA  1 
ATOM   1280 C C   . CYS B 1 67 ? -29.349 23.354 18.605 1.00 42.94 ? 67  CYS B C   1 
ATOM   1281 O O   . CYS B 1 67 ? -29.445 22.451 17.792 1.00 42.97 ? 67  CYS B O   1 
ATOM   1282 C CB  . CYS B 1 67 ? -28.340 24.452 20.724 1.00 45.06 ? 67  CYS B CB  1 
ATOM   1283 S SG  . CYS B 1 67 ? -28.285 24.349 22.542 1.00 48.02 ? 67  CYS B SG  1 
ATOM   1284 N N   . GLY B 1 68 ? -29.851 24.549 18.340 1.00 43.05 ? 68  GLY B N   1 
ATOM   1285 C CA  . GLY B 1 68 ? -30.501 24.654 17.033 1.00 44.34 ? 68  GLY B CA  1 
ATOM   1286 C C   . GLY B 1 68 ? -29.599 25.230 15.956 1.00 45.35 ? 68  GLY B C   1 
ATOM   1287 O O   . GLY B 1 68 ? -30.056 25.803 14.972 1.00 47.90 ? 68  GLY B O   1 
ATOM   1288 N N   . HIS B 1 69 ? -28.289 25.125 16.180 1.00 42.14 ? 69  HIS B N   1 
ATOM   1289 C CA  . HIS B 1 69 ? -27.458 25.810 15.205 1.00 37.87 ? 69  HIS B CA  1 
ATOM   1290 C C   . HIS B 1 69 ? -26.675 24.768 14.462 1.00 32.39 ? 69  HIS B C   1 
ATOM   1291 O O   . HIS B 1 69 ? -26.220 23.800 15.048 1.00 31.59 ? 69  HIS B O   1 
ATOM   1292 C CB  . HIS B 1 69 ? -26.583 26.878 15.911 1.00 44.07 ? 69  HIS B CB  1 
ATOM   1293 C CG  . HIS B 1 69 ? -25.851 27.707 14.859 1.00 53.26 ? 69  HIS B CG  1 
ATOM   1294 N ND1 . HIS B 1 69 ? -24.517 27.663 14.630 1.00 56.12 ? 69  HIS B ND1 1 
ATOM   1295 C CD2 . HIS B 1 69 ? -26.433 28.553 13.905 1.00 54.69 ? 69  HIS B CD2 1 
ATOM   1296 C CE1 . HIS B 1 69 ? -24.237 28.449 13.546 1.00 55.34 ? 69  HIS B CE1 1 
ATOM   1297 N NE2 . HIS B 1 69 ? -25.424 28.991 13.107 1.00 57.54 ? 69  HIS B NE2 1 
ATOM   1298 N N   . LYS B 1 70 ? -26.577 24.976 13.158 1.00 28.72 ? 70  LYS B N   1 
ATOM   1299 C CA  . LYS B 1 70 ? -25.851 24.058 12.282 1.00 26.76 ? 70  LYS B CA  1 
ATOM   1300 C C   . LYS B 1 70 ? -24.415 24.504 12.098 1.00 24.23 ? 70  LYS B C   1 
ATOM   1301 O O   . LYS B 1 70 ? -24.100 25.679 12.184 1.00 26.28 ? 70  LYS B O   1 
ATOM   1302 C CB  . LYS B 1 70 ? -26.521 24.042 10.911 1.00 28.67 ? 70  LYS B CB  1 
ATOM   1303 C CG  . LYS B 1 70 ? -28.000 23.652 10.920 1.00 29.83 ? 70  LYS B CG  1 
ATOM   1304 C CD  . LYS B 1 70 ? -28.672 24.044 9.601  1.00 29.45 ? 70  LYS B CD  1 
ATOM   1305 C CE  . LYS B 1 70 ? -30.188 23.817 9.545  1.00 33.46 ? 70  LYS B CE  1 
ATOM   1306 N NZ  . LYS B 1 70 ? -30.506 22.380 9.638  1.00 31.22 ? 70  LYS B NZ  1 
ATOM   1307 N N   . ALA B 1 71 ? -23.536 23.554 11.859 1.00 21.83 ? 71  ALA B N   1 
ATOM   1308 C CA  . ALA B 1 71 ? -22.151 23.889 11.555 1.00 22.02 ? 71  ALA B CA  1 
ATOM   1309 C C   . ALA B 1 71 ? -21.718 22.761 10.652 1.00 21.35 ? 71  ALA B C   1 
ATOM   1310 O O   . ALA B 1 71 ? -22.402 21.748 10.662 1.00 25.73 ? 71  ALA B O   1 
ATOM   1311 C CB  . ALA B 1 71 ? -21.338 23.961 12.855 1.00 20.69 ? 71  ALA B CB  1 
ATOM   1312 N N   . ILE B 1 72 ? -20.647 22.899 9.876  1.00 18.66 ? 72  ILE B N   1 
ATOM   1313 C CA  . ILE B 1 72 ? -20.137 21.763 9.093  1.00 19.90 ? 72  ILE B CA  1 
ATOM   1314 C C   . ILE B 1 72 ? -18.671 21.743 9.428  1.00 20.62 ? 72  ILE B C   1 
ATOM   1315 O O   . ILE B 1 72 ? -18.038 22.793 9.449  1.00 20.17 ? 72  ILE B O   1 
ATOM   1316 C CB  . ILE B 1 72 ? -20.293 22.004 7.562  1.00 21.77 ? 72  ILE B CB  1 
ATOM   1317 C CG1 . ILE B 1 72 ? -21.707 21.899 6.989  1.00 20.44 ? 72  ILE B CG1 1 
ATOM   1318 C CG2 . ILE B 1 72 ? -19.419 21.093 6.686  1.00 20.19 ? 72  ILE B CG2 1 
ATOM   1319 C CD1 . ILE B 1 72 ? -22.037 20.524 6.389  1.00 25.32 ? 72  ILE B CD1 1 
ATOM   1320 N N   . GLY B 1 73 ? -18.123 20.577 9.711  1.00 21.42 ? 73  GLY B N   1 
ATOM   1321 C CA  . GLY B 1 73 ? -16.720 20.620 10.085 1.00 17.91 ? 73  GLY B CA  1 
ATOM   1322 C C   . GLY B 1 73 ? -16.153 19.243 10.057 1.00 19.30 ? 73  GLY B C   1 
ATOM   1323 O O   . GLY B 1 73 ? -16.810 18.325 9.592  1.00 17.55 ? 73  GLY B O   1 
ATOM   1324 N N   . THR B 1 74 ? -14.918 19.141 10.560 1.00 20.05 ? 74  THR B N   1 
ATOM   1325 C CA  . THR B 1 74 ? -14.324 17.832 10.773 1.00 18.58 ? 74  THR B CA  1 
ATOM   1326 C C   . THR B 1 74 ? -14.774 17.268 12.107 1.00 18.25 ? 74  THR B C   1 
ATOM   1327 O O   . THR B 1 74 ? -14.825 17.980 13.096 1.00 16.85 ? 74  THR B O   1 
ATOM   1328 C CB  . THR B 1 74 ? -12.794 17.976 10.727 1.00 20.18 ? 74  THR B CB  1 
ATOM   1329 O OG1 . THR B 1 74 ? -12.428 18.560 9.474  1.00 22.10 ? 74  THR B OG1 1 
ATOM   1330 C CG2 . THR B 1 74 ? -12.045 16.644 10.917 1.00 24.06 ? 74  THR B CG2 1 
ATOM   1331 N N   . VAL B 1 75 ? -15.118 15.999 12.092 1.00 18.10 ? 75  VAL B N   1 
ATOM   1332 C CA  . VAL B 1 75 ? -15.529 15.270 13.278 1.00 19.64 ? 75  VAL B CA  1 
ATOM   1333 C C   . VAL B 1 75 ? -14.639 14.050 13.371 1.00 22.10 ? 75  VAL B C   1 
ATOM   1334 O O   . VAL B 1 75 ? -14.369 13.408 12.362 1.00 24.39 ? 75  VAL B O   1 
ATOM   1335 C CB  . VAL B 1 75 ? -16.982 14.867 13.021 1.00 19.50 ? 75  VAL B CB  1 
ATOM   1336 C CG1 . VAL B 1 75 ? -17.441 13.646 13.795 1.00 18.78 ? 75  VAL B CG1 1 
ATOM   1337 C CG2 . VAL B 1 75 ? -17.870 16.063 13.320 1.00 20.16 ? 75  VAL B CG2 1 
ATOM   1338 N N   . LEU B 1 76 ? -14.163 13.757 14.575 1.00 22.93 ? 76  LEU B N   1 
ATOM   1339 C CA  . LEU B 1 76 ? -13.350 12.560 14.756 1.00 21.26 ? 76  LEU B CA  1 
ATOM   1340 C C   . LEU B 1 76 ? -14.174 11.556 15.508 1.00 24.19 ? 76  LEU B C   1 
ATOM   1341 O O   . LEU B 1 76 ? -14.858 11.877 16.471 1.00 26.19 ? 76  LEU B O   1 
ATOM   1342 C CB  . LEU B 1 76 ? -12.096 12.883 15.578 1.00 21.13 ? 76  LEU B CB  1 
ATOM   1343 C CG  . LEU B 1 76 ? -11.244 13.996 14.980 1.00 19.27 ? 76  LEU B CG  1 
ATOM   1344 C CD1 . LEU B 1 76 ? -10.102 14.339 15.923 1.00 21.48 ? 76  LEU B CD1 1 
ATOM   1345 C CD2 . LEU B 1 76 ? -10.721 13.569 13.625 1.00 21.79 ? 76  LEU B CD2 1 
ATOM   1346 N N   . VAL B 1 77 ? -14.130 10.332 15.035 1.00 22.81 ? 77  VAL B N   1 
ATOM   1347 C CA  . VAL B 1 77 ? -14.931 9.312  15.680 1.00 22.93 ? 77  VAL B CA  1 
ATOM   1348 C C   . VAL B 1 77 ? -13.967 8.302  16.239 1.00 25.52 ? 77  VAL B C   1 
ATOM   1349 O O   . VAL B 1 77 ? -12.981 7.947  15.597 1.00 25.67 ? 77  VAL B O   1 
ATOM   1350 C CB  . VAL B 1 77 ? -15.816 8.698  14.601 1.00 20.95 ? 77  VAL B CB  1 
ATOM   1351 C CG1 . VAL B 1 77 ? -16.536 7.463  15.081 1.00 21.16 ? 77  VAL B CG1 1 
ATOM   1352 C CG2 . VAL B 1 77 ? -16.812 9.732  14.123 1.00 22.16 ? 77  VAL B CG2 1 
ATOM   1353 N N   . GLY B 1 78 ? -14.242 7.889  17.460 1.00 24.16 ? 78  GLY B N   1 
ATOM   1354 C CA  . GLY B 1 78 ? -13.264 7.043  18.077 1.00 22.01 ? 78  GLY B CA  1 
ATOM   1355 C C   . GLY B 1 78 ? -13.603 6.816  19.523 1.00 24.19 ? 78  GLY B C   1 
ATOM   1356 O O   . GLY B 1 78 ? -14.639 7.193  20.057 1.00 23.27 ? 78  GLY B O   1 
ATOM   1357 N N   . PRO B 1 79 ? -12.674 6.127  20.139 1.00 24.04 ? 79  PRO B N   1 
ATOM   1358 C CA  . PRO B 1 79 ? -12.903 5.618  21.491 1.00 26.98 ? 79  PRO B CA  1 
ATOM   1359 C C   . PRO B 1 79 ? -12.760 6.606  22.639 1.00 28.00 ? 79  PRO B C   1 
ATOM   1360 O O   . PRO B 1 79 ? -12.022 6.400  23.590 1.00 29.56 ? 79  PRO B O   1 
ATOM   1361 C CB  . PRO B 1 79 ? -11.878 4.497  21.534 1.00 24.55 ? 79  PRO B CB  1 
ATOM   1362 C CG  . PRO B 1 79 ? -10.729 5.025  20.703 1.00 24.78 ? 79  PRO B CG  1 
ATOM   1363 C CD  . PRO B 1 79 ? -11.440 5.663  19.541 1.00 22.11 ? 79  PRO B CD  1 
ATOM   1364 N N   . THR B 1 80 ? -13.523 7.679  22.547 1.00 28.79 ? 80  THR B N   1 
ATOM   1365 C CA  . THR B 1 80 ? -13.619 8.554  23.712 1.00 25.21 ? 80  THR B CA  1 
ATOM   1366 C C   . THR B 1 80 ? -14.667 7.987  24.645 1.00 25.14 ? 80  THR B C   1 
ATOM   1367 O O   . THR B 1 80 ? -15.558 7.294  24.187 1.00 27.29 ? 80  THR B O   1 
ATOM   1368 C CB  . THR B 1 80 ? -14.024 9.924  23.171 1.00 20.92 ? 80  THR B CB  1 
ATOM   1369 O OG1 . THR B 1 80 ? -14.155 10.861 24.224 1.00 21.20 ? 80  THR B OG1 1 
ATOM   1370 C CG2 . THR B 1 80 ? -15.301 9.868  22.365 1.00 21.25 ? 80  THR B CG2 1 
ATOM   1371 N N   . PRO B 1 81 ? -14.547 8.295  25.944 1.00 26.62 ? 81  PRO B N   1 
ATOM   1372 C CA  . PRO B 1 81 ? -15.669 8.124  26.888 1.00 26.00 ? 81  PRO B CA  1 
ATOM   1373 C C   . PRO B 1 81 ? -16.814 9.106  26.723 1.00 24.90 ? 81  PRO B C   1 
ATOM   1374 O O   . PRO B 1 81 ? -17.914 8.901  27.223 1.00 24.95 ? 81  PRO B O   1 
ATOM   1375 C CB  . PRO B 1 81 ? -15.040 8.408  28.270 1.00 28.72 ? 81  PRO B CB  1 
ATOM   1376 C CG  . PRO B 1 81 ? -13.529 8.417  28.080 1.00 26.67 ? 81  PRO B CG  1 
ATOM   1377 C CD  . PRO B 1 81 ? -13.340 8.784  26.614 1.00 27.19 ? 81  PRO B CD  1 
ATOM   1378 N N   . PHE B 1 82 ? -16.543 10.226 26.071 1.00 22.44 ? 82  PHE B N   1 
ATOM   1379 C CA  . PHE B 1 82 ? -17.606 11.213 26.093 1.00 23.21 ? 82  PHE B CA  1 
ATOM   1380 C C   . PHE B 1 82 ? -17.502 11.973 24.825 1.00 18.86 ? 82  PHE B C   1 
ATOM   1381 O O   . PHE B 1 82 ? -16.424 12.250 24.353 1.00 18.79 ? 82  PHE B O   1 
ATOM   1382 C CB  . PHE B 1 82 ? -17.449 12.149 27.323 1.00 25.78 ? 82  PHE B CB  1 
ATOM   1383 C CG  . PHE B 1 82 ? -18.814 12.558 27.823 1.00 32.61 ? 82  PHE B CG  1 
ATOM   1384 C CD1 . PHE B 1 82 ? -19.546 13.586 27.182 1.00 36.01 ? 82  PHE B CD1 1 
ATOM   1385 C CD2 . PHE B 1 82 ? -19.386 11.887 28.928 1.00 38.29 ? 82  PHE B CD2 1 
ATOM   1386 C CE1 . PHE B 1 82 ? -20.845 13.945 27.631 1.00 37.40 ? 82  PHE B CE1 1 
ATOM   1387 C CE2 . PHE B 1 82 ? -20.684 12.247 29.387 1.00 41.34 ? 82  PHE B CE2 1 
ATOM   1388 C CZ  . PHE B 1 82 ? -21.417 13.274 28.736 1.00 39.35 ? 82  PHE B CZ  1 
ATOM   1389 N N   . ASN B 1 83 ? -18.643 12.298 24.268 1.00 16.90 ? 83  ASN B N   1 
ATOM   1390 C CA  . ASN B 1 83 ? -18.575 13.133 23.082 1.00 14.85 ? 83  ASN B CA  1 
ATOM   1391 C C   . ASN B 1 83 ? -18.187 14.518 23.484 1.00 11.90 ? 83  ASN B C   1 
ATOM   1392 O O   . ASN B 1 83 ? -18.767 15.089 24.401 1.00 8.08  ? 83  ASN B O   1 
ATOM   1393 C CB  . ASN B 1 83 ? -19.934 13.300 22.432 1.00 18.20 ? 83  ASN B CB  1 
ATOM   1394 C CG  . ASN B 1 83 ? -20.506 12.008 21.992 1.00 16.90 ? 83  ASN B CG  1 
ATOM   1395 O OD1 . ASN B 1 83 ? -19.891 11.219 21.297 1.00 15.74 ? 83  ASN B OD1 1 
ATOM   1396 N ND2 . ASN B 1 83 ? -21.725 11.804 22.453 1.00 15.31 ? 83  ASN B ND2 1 
ATOM   1397 N N   . VAL B 1 84 ? -17.209 15.027 22.775 1.00 12.97 ? 84  VAL B N   1 
ATOM   1398 C CA  . VAL B 1 84 ? -16.606 16.339 23.062 1.00 14.98 ? 84  VAL B CA  1 
ATOM   1399 C C   . VAL B 1 84 ? -16.777 17.217 21.825 1.00 13.38 ? 84  VAL B C   1 
ATOM   1400 O O   . VAL B 1 84 ? -16.386 16.823 20.740 1.00 14.98 ? 84  VAL B O   1 
ATOM   1401 C CB  . VAL B 1 84 ? -15.089 16.052 23.362 1.00 14.32 ? 84  VAL B CB  1 
ATOM   1402 C CG1 . VAL B 1 84 ? -14.181 17.255 23.248 1.00 16.42 ? 84  VAL B CG1 1 
ATOM   1403 C CG2 . VAL B 1 84 ? -14.886 15.468 24.761 1.00 15.84 ? 84  VAL B CG2 1 
ATOM   1404 N N   . ILE B 1 85 ? -17.332 18.411 21.985 1.00 11.75 ? 85  ILE B N   1 
ATOM   1405 C CA  . ILE B 1 85 ? -17.262 19.398 20.892 1.00 12.77 ? 85  ILE B CA  1 
ATOM   1406 C C   . ILE B 1 85 ? -16.158 20.376 21.179 1.00 13.06 ? 85  ILE B C   1 
ATOM   1407 O O   . ILE B 1 85 ? -16.195 21.052 22.197 1.00 14.48 ? 85  ILE B O   1 
ATOM   1408 C CB  . ILE B 1 85 ? -18.549 20.223 20.855 1.00 11.26 ? 85  ILE B CB  1 
ATOM   1409 C CG1 . ILE B 1 85 ? -19.831 19.367 20.847 1.00 12.82 ? 85  ILE B CG1 1 
ATOM   1410 C CG2 . ILE B 1 85 ? -18.547 21.180 19.682 1.00 12.25 ? 85  ILE B CG2 1 
ATOM   1411 C CD1 . ILE B 1 85 ? -19.990 18.434 19.640 1.00 16.94 ? 85  ILE B CD1 1 
ATOM   1412 N N   . GLY B 1 86 ? -15.196 20.436 20.272 1.00 15.65 ? 86  GLY B N   1 
ATOM   1413 C CA  . GLY B 1 86 ? -13.984 21.219 20.509 1.00 9.45  ? 86  GLY B CA  1 
ATOM   1414 C C   . GLY B 1 86 ? -14.017 22.554 19.796 1.00 13.52 ? 86  GLY B C   1 
ATOM   1415 O O   . GLY B 1 86 ? -15.017 22.977 19.212 1.00 17.15 ? 86  GLY B O   1 
ATOM   1416 N N   . ARG B 1 87 ? -12.900 23.250 19.839 1.00 11.59 ? 87  ARG B N   1 
ATOM   1417 C CA  . ARG B 1 87 ? -12.979 24.625 19.372 1.00 13.86 ? 87  ARG B CA  1 
ATOM   1418 C C   . ARG B 1 87 ? -13.235 24.762 17.919 1.00 15.59 ? 87  ARG B C   1 
ATOM   1419 O O   . ARG B 1 87 ? -13.849 25.729 17.489 1.00 19.15 ? 87  ARG B O   1 
ATOM   1420 C CB  . ARG B 1 87 ? -11.741 25.437 19.699 1.00 16.94 ? 87  ARG B CB  1 
ATOM   1421 C CG  . ARG B 1 87 ? -11.379 25.552 21.186 1.00 13.78 ? 87  ARG B CG  1 
ATOM   1422 C CD  . ARG B 1 87 ? -10.142 26.452 21.391 1.00 13.09 ? 87  ARG B CD  1 
ATOM   1423 N NE  . ARG B 1 87 ? -8.928  25.827 20.881 1.00 13.07 ? 87  ARG B NE  1 
ATOM   1424 C CZ  . ARG B 1 87 ? -8.338  26.284 19.791 1.00 14.42 ? 87  ARG B CZ  1 
ATOM   1425 N NH1 . ARG B 1 87 ? -8.803  27.311 19.116 1.00 17.30 ? 87  ARG B NH1 1 
ATOM   1426 N NH2 . ARG B 1 87 ? -7.255  25.685 19.360 1.00 19.17 ? 87  ARG B NH2 1 
ATOM   1427 N N   . ASN B 1 88 ? -12.830 23.750 17.164 1.00 17.08 ? 88  ASN B N   1 
ATOM   1428 C CA  . ASN B 1 88 ? -13.188 23.786 15.734 1.00 18.12 ? 88  ASN B CA  1 
ATOM   1429 C C   . ASN B 1 88 ? -14.670 23.906 15.407 1.00 18.11 ? 88  ASN B C   1 
ATOM   1430 O O   . ASN B 1 88 ? -15.046 24.462 14.397 1.00 21.03 ? 88  ASN B O   1 
ATOM   1431 C CB  . ASN B 1 88 ? -12.643 22.583 14.950 1.00 19.83 ? 88  ASN B CB  1 
ATOM   1432 C CG  . ASN B 1 88 ? -13.405 21.288 15.189 1.00 18.44 ? 88  ASN B CG  1 
ATOM   1433 O OD1 . ASN B 1 88 ? -13.790 20.910 16.282 1.00 18.26 ? 88  ASN B OD1 1 
ATOM   1434 N ND2 . ASN B 1 88 ? -13.629 20.584 14.099 1.00 20.69 ? 88  ASN B ND2 1 
ATOM   1435 N N   . LEU B 1 89 ? -15.523 23.400 16.266 1.00 16.93 ? 89  LEU B N   1 
ATOM   1436 C CA  . LEU B 1 89 ? -16.916 23.660 15.983 1.00 16.14 ? 89  LEU B CA  1 
ATOM   1437 C C   . LEU B 1 89 ? -17.454 24.806 16.806 1.00 17.64 ? 89  LEU B C   1 
ATOM   1438 O O   . LEU B 1 89 ? -18.307 25.573 16.379 1.00 19.06 ? 89  LEU B O   1 
ATOM   1439 C CB  . LEU B 1 89 ? -17.693 22.365 16.153 1.00 14.50 ? 89  LEU B CB  1 
ATOM   1440 C CG  . LEU B 1 89 ? -17.310 21.379 15.060 1.00 14.22 ? 89  LEU B CG  1 
ATOM   1441 C CD1 . LEU B 1 89 ? -17.988 20.049 15.272 1.00 17.13 ? 89  LEU B CD1 1 
ATOM   1442 C CD2 . LEU B 1 89 ? -17.706 21.906 13.694 1.00 14.23 ? 89  LEU B CD2 1 
ATOM   1443 N N   . LEU B 1 90 ? -16.885 24.953 17.999 1.00 16.92 ? 90  LEU B N   1 
ATOM   1444 C CA  . LEU B 1 90 ? -17.304 26.011 18.941 1.00 17.31 ? 90  LEU B CA  1 
ATOM   1445 C C   . LEU B 1 90 ? -17.216 27.436 18.400 1.00 16.42 ? 90  LEU B C   1 
ATOM   1446 O O   . LEU B 1 90 ? -18.052 28.307 18.591 1.00 13.84 ? 90  LEU B O   1 
ATOM   1447 C CB  . LEU B 1 90 ? -16.432 25.869 20.184 1.00 17.37 ? 90  LEU B CB  1 
ATOM   1448 C CG  . LEU B 1 90 ? -17.068 25.344 21.478 1.00 19.60 ? 90  LEU B CG  1 
ATOM   1449 C CD1 . LEU B 1 90 ? -18.226 24.368 21.294 1.00 14.23 ? 90  LEU B CD1 1 
ATOM   1450 C CD2 . LEU B 1 90 ? -15.936 24.818 22.371 1.00 18.05 ? 90  LEU B CD2 1 
ATOM   1451 N N   . THR B 1 91 ? -16.171 27.632 17.663 1.00 15.62 ? 91  THR B N   1 
ATOM   1452 C CA  . THR B 1 91 ? -16.017 28.839 16.878 1.00 19.01 ? 91  THR B CA  1 
ATOM   1453 C C   . THR B 1 91 ? -17.146 29.141 15.891 1.00 20.97 ? 91  THR B C   1 
ATOM   1454 O O   . THR B 1 91 ? -17.499 30.285 15.653 1.00 19.51 ? 91  THR B O   1 
ATOM   1455 C CB  . THR B 1 91 ? -14.645 28.539 16.287 1.00 20.29 ? 91  THR B CB  1 
ATOM   1456 O OG1 . THR B 1 91 ? -13.655 29.188 17.099 1.00 23.69 ? 91  THR B OG1 1 
ATOM   1457 C CG2 . THR B 1 91 ? -14.428 28.647 14.795 1.00 20.24 ? 91  THR B CG2 1 
ATOM   1458 N N   . GLN B 1 92 ? -17.767 28.077 15.343 1.00 24.82 ? 92  GLN B N   1 
ATOM   1459 C CA  . GLN B 1 92 ? -18.845 28.238 14.359 1.00 23.37 ? 92  GLN B CA  1 
ATOM   1460 C C   . GLN B 1 92 ? -20.219 28.571 14.918 1.00 25.10 ? 92  GLN B C   1 
ATOM   1461 O O   . GLN B 1 92 ? -21.057 29.201 14.293 1.00 28.09 ? 92  GLN B O   1 
ATOM   1462 C CB  . GLN B 1 92 ? -18.970 26.972 13.511 1.00 26.67 ? 92  GLN B CB  1 
ATOM   1463 C CG  . GLN B 1 92 ? -18.043 26.959 12.287 1.00 30.97 ? 92  GLN B CG  1 
ATOM   1464 C CD  . GLN B 1 92 ? -18.513 25.913 11.268 1.00 35.33 ? 92  GLN B CD  1 
ATOM   1465 O OE1 . GLN B 1 92 ? -19.550 25.994 10.600 1.00 31.89 ? 92  GLN B OE1 1 
ATOM   1466 N NE2 . GLN B 1 92 ? -17.663 24.901 11.171 1.00 35.36 ? 92  GLN B NE2 1 
ATOM   1467 N N   . ILE B 1 93 ? -20.445 28.159 16.150 1.00 21.32 ? 93  ILE B N   1 
ATOM   1468 C CA  . ILE B 1 93 ? -21.705 28.559 16.740 1.00 18.81 ? 93  ILE B CA  1 
ATOM   1469 C C   . ILE B 1 93 ? -21.579 29.861 17.509 1.00 18.38 ? 93  ILE B C   1 
ATOM   1470 O O   . ILE B 1 93 ? -22.462 30.246 18.264 1.00 20.51 ? 93  ILE B O   1 
ATOM   1471 C CB  . ILE B 1 93 ? -22.226 27.424 17.642 1.00 19.90 ? 93  ILE B CB  1 
ATOM   1472 C CG1 . ILE B 1 93 ? -21.306 27.058 18.811 1.00 19.80 ? 93  ILE B CG1 1 
ATOM   1473 C CG2 . ILE B 1 93 ? -22.508 26.171 16.813 1.00 18.05 ? 93  ILE B CG2 1 
ATOM   1474 C CD1 . ILE B 1 93 ? -21.999 26.095 19.766 1.00 19.17 ? 93  ILE B CD1 1 
ATOM   1475 N N   . GLY B 1 94 ? -20.417 30.494 17.338 1.00 16.86 ? 94  GLY B N   1 
ATOM   1476 C CA  . GLY B 1 94 ? -20.087 31.731 18.036 1.00 15.72 ? 94  GLY B CA  1 
ATOM   1477 C C   . GLY B 1 94 ? -19.956 31.665 19.545 1.00 20.53 ? 94  GLY B C   1 
ATOM   1478 O O   . GLY B 1 94 ? -20.316 32.565 20.279 1.00 22.04 ? 94  GLY B O   1 
ATOM   1479 N N   . CYS B 1 95 ? -19.410 30.581 20.019 1.00 23.09 ? 95  CYS B N   1 
ATOM   1480 C CA  . CYS B 1 95 ? -19.336 30.437 21.472 1.00 24.61 ? 95  CYS B CA  1 
ATOM   1481 C C   . CYS B 1 95 ? -18.225 31.276 22.121 1.00 24.84 ? 95  CYS B C   1 
ATOM   1482 O O   . CYS B 1 95 ? -17.088 31.259 21.663 1.00 27.34 ? 95  CYS B O   1 
ATOM   1483 C CB  . CYS B 1 95 ? -19.103 28.941 21.635 1.00 27.02 ? 95  CYS B CB  1 
ATOM   1484 S SG  . CYS B 1 95 ? -19.318 28.318 23.297 1.00 31.16 ? 95  CYS B SG  1 
ATOM   1485 N N   . THR B 1 96 ? -18.541 32.013 23.184 1.00 22.52 ? 96  THR B N   1 
ATOM   1486 C CA  . THR B 1 96 ? -17.496 32.725 23.941 1.00 21.84 ? 96  THR B CA  1 
ATOM   1487 C C   . THR B 1 96 ? -17.367 32.269 25.380 1.00 19.97 ? 96  THR B C   1 
ATOM   1488 O O   . THR B 1 96 ? -18.282 31.739 26.010 1.00 19.60 ? 96  THR B O   1 
ATOM   1489 C CB  . THR B 1 96 ? -17.760 34.235 23.973 1.00 20.29 ? 96  THR B CB  1 
ATOM   1490 O OG1 . THR B 1 96 ? -19.093 34.494 24.409 1.00 22.35 ? 96  THR B OG1 1 
ATOM   1491 C CG2 . THR B 1 96 ? -17.518 34.881 22.614 1.00 25.44 ? 96  THR B CG2 1 
ATOM   1492 N N   . LEU B 1 97 ? -16.198 32.545 25.901 1.00 18.48 ? 97  LEU B N   1 
ATOM   1493 C CA  . LEU B 1 97 ? -15.991 32.318 27.332 1.00 22.80 ? 97  LEU B CA  1 
ATOM   1494 C C   . LEU B 1 97 ? -15.904 33.692 28.021 1.00 23.12 ? 97  LEU B C   1 
ATOM   1495 O O   . LEU B 1 97 ? -15.280 34.605 27.503 1.00 24.53 ? 97  LEU B O   1 
ATOM   1496 C CB  . LEU B 1 97 ? -14.714 31.490 27.314 1.00 22.92 ? 97  LEU B CB  1 
ATOM   1497 C CG  . LEU B 1 97 ? -14.263 30.704 28.517 1.00 24.74 ? 97  LEU B CG  1 
ATOM   1498 C CD1 . LEU B 1 97 ? -15.370 29.823 29.096 1.00 25.13 ? 97  LEU B CD1 1 
ATOM   1499 C CD2 . LEU B 1 97 ? -13.043 29.900 28.062 1.00 23.71 ? 97  LEU B CD2 1 
ATOM   1500 N N   . ASN B 1 98 ? -16.587 33.867 29.142 1.00 23.50 ? 98  ASN B N   1 
ATOM   1501 C CA  . ASN B 1 98 ? -16.641 35.188 29.783 1.00 21.83 ? 98  ASN B CA  1 
ATOM   1502 C C   . ASN B 1 98 ? -16.408 35.031 31.256 1.00 21.02 ? 98  ASN B C   1 
ATOM   1503 O O   . ASN B 1 98 ? -17.049 34.233 31.919 1.00 18.13 ? 98  ASN B O   1 
ATOM   1504 C CB  . ASN B 1 98 ? -18.030 35.807 29.874 1.00 28.85 ? 98  ASN B CB  1 
ATOM   1505 C CG  . ASN B 1 98 ? -18.746 36.235 28.616 1.00 37.10 ? 98  ASN B CG  1 
ATOM   1506 O OD1 . ASN B 1 98 ? -18.574 35.797 27.486 1.00 40.29 ? 98  ASN B OD1 1 
ATOM   1507 N ND2 . ASN B 1 98 ? -19.754 37.055 28.881 1.00 44.69 ? 98  ASN B ND2 1 
ATOM   1508 N N   . PHE B 1 99 ? -15.518 35.835 31.757 1.00 24.32 ? 99  PHE B N   1 
ATOM   1509 C CA  . PHE B 1 99 ? -15.306 36.059 33.185 1.00 25.43 ? 99  PHE B CA  1 
ATOM   1510 C C   . PHE B 1 99 ? -14.840 37.506 33.204 1.00 28.85 ? 99  PHE B C   1 
ATOM   1511 O O   . PHE B 1 99 ? -15.036 38.195 32.193 1.00 35.50 ? 99  PHE B O   1 
ATOM   1512 C CB  . PHE B 1 99 ? -14.279 35.054 33.802 1.00 23.86 ? 99  PHE B CB  1 
ATOM   1513 C CG  . PHE B 1 99 ? -12.859 35.142 33.262 1.00 26.70 ? 99  PHE B CG  1 
ATOM   1514 C CD1 . PHE B 1 99 ? -12.534 34.607 31.987 1.00 21.42 ? 99  PHE B CD1 1 
ATOM   1515 C CD2 . PHE B 1 99 ? -11.848 35.750 34.056 1.00 25.66 ? 99  PHE B CD2 1 
ATOM   1516 C CE1 . PHE B 1 99 ? -11.211 34.683 31.507 1.00 23.01 ? 99  PHE B CE1 1 
ATOM   1517 C CE2 . PHE B 1 99 ? -10.517 35.821 33.574 1.00 23.65 ? 99  PHE B CE2 1 
ATOM   1518 C CZ  . PHE B 1 99 ? -10.205 35.284 32.300 1.00 23.24 ? 99  PHE B CZ  1 
HETATM 1519 O O1  . XV6 C 2 .  ? -8.358  14.369 27.859 1.00 20.07 ? 638 XV6 B O1  1 
HETATM 1520 O O4  . XV6 C 2 .  ? -11.891 18.762 28.890 1.00 16.50 ? 638 XV6 B O4  1 
HETATM 1521 O O5  . XV6 C 2 .  ? -10.137 19.728 26.943 1.00 21.46 ? 638 XV6 B O5  1 
HETATM 1522 N N2  . XV6 C 2 .  ? -9.793  15.728 28.920 1.00 18.20 ? 638 XV6 B N2  1 
HETATM 1523 N N7  . XV6 C 2 .  ? -8.784  16.290 26.840 1.00 20.64 ? 638 XV6 B N7  1 
HETATM 1524 C C1  . XV6 C 2 .  ? -8.973  15.437 27.873 1.00 22.39 ? 638 XV6 B C1  1 
HETATM 1525 C C2  . XV6 C 2 .  ? -9.653  14.909 30.120 1.00 20.37 ? 638 XV6 B C2  1 
HETATM 1526 C C3  . XV6 C 2 .  ? -10.950 16.637 28.886 1.00 18.12 ? 638 XV6 B C3  1 
HETATM 1527 C C4  . XV6 C 2 .  ? -10.687 18.103 28.625 1.00 17.65 ? 638 XV6 B C4  1 
HETATM 1528 C C5  . XV6 C 2 .  ? -10.274 18.352 27.195 1.00 17.45 ? 638 XV6 B C5  1 
HETATM 1529 C C6  . XV6 C 2 .  ? -8.912  17.763 26.920 1.00 22.25 ? 638 XV6 B C6  1 
HETATM 1530 C C7  . XV6 C 2 .  ? -8.148  15.778 25.623 1.00 20.37 ? 638 XV6 B C7  1 
HETATM 1531 C C31 . XV6 C 2 .  ? -12.078 16.009 28.029 1.00 21.60 ? 638 XV6 B C31 1 
HETATM 1532 C C32 . XV6 C 2 .  ? -12.589 14.725 28.635 1.00 29.42 ? 638 XV6 B C32 1 
HETATM 1533 C C33 . XV6 C 2 .  ? -12.159 13.476 28.118 1.00 30.54 ? 638 XV6 B C33 1 
HETATM 1534 C C34 . XV6 C 2 .  ? -12.537 12.283 28.772 1.00 32.39 ? 638 XV6 B C34 1 
HETATM 1535 C C35 . XV6 C 2 .  ? -13.344 12.332 29.934 1.00 33.23 ? 638 XV6 B C35 1 
HETATM 1536 C C36 . XV6 C 2 .  ? -13.783 13.579 30.438 1.00 32.63 ? 638 XV6 B C36 1 
HETATM 1537 C C37 . XV6 C 2 .  ? -13.412 14.779 29.786 1.00 29.90 ? 638 XV6 B C37 1 
HETATM 1538 C C61 . XV6 C 2 .  ? -7.763  18.339 27.790 1.00 24.03 ? 638 XV6 B C61 1 
HETATM 1539 C C62 . XV6 C 2 .  ? -6.393  18.243 27.151 1.00 28.82 ? 638 XV6 B C62 1 
HETATM 1540 C C63 . XV6 C 2 .  ? -6.114  18.991 25.978 1.00 29.26 ? 638 XV6 B C63 1 
HETATM 1541 C C64 . XV6 C 2 .  ? -4.830  18.931 25.404 1.00 31.07 ? 638 XV6 B C64 1 
HETATM 1542 C C65 . XV6 C 2 .  ? -3.836  18.118 26.004 1.00 32.38 ? 638 XV6 B C65 1 
HETATM 1543 C C66 . XV6 C 2 .  ? -4.114  17.368 27.168 1.00 30.03 ? 638 XV6 B C66 1 
HETATM 1544 C C67 . XV6 C 2 .  ? -5.402  17.433 27.745 1.00 28.22 ? 638 XV6 B C67 1 
HETATM 1545 C C20 . XV6 C 2 .  ? -9.615  15.624 31.439 1.00 20.82 ? 638 XV6 B C20 1 
HETATM 1546 C C21 . XV6 C 2 .  ? -10.383 15.108 32.486 1.00 18.21 ? 638 XV6 B C21 1 
HETATM 1547 C C22 . XV6 C 2 .  ? -10.315 15.718 33.746 1.00 18.84 ? 638 XV6 B C22 1 
HETATM 1548 C C23 . XV6 C 2 .  ? -9.498  16.844 33.961 1.00 20.62 ? 638 XV6 B C23 1 
HETATM 1549 C C24 . XV6 C 2 .  ? -8.728  17.367 32.904 1.00 19.29 ? 638 XV6 B C24 1 
HETATM 1550 C C25 . XV6 C 2 .  ? -8.788  16.753 31.639 1.00 21.37 ? 638 XV6 B C25 1 
HETATM 1551 C C26 . XV6 C 2 .  ? -11.040 15.127 34.908 1.00 22.80 ? 638 XV6 B C26 1 
HETATM 1552 O O26 . XV6 C 2 .  ? -11.438 15.773 35.864 1.00 19.40 ? 638 XV6 B O26 1 
HETATM 1553 N N26 . XV6 C 2 .  ? -11.163 13.797 34.842 1.00 22.22 ? 638 XV6 B N26 1 
HETATM 1554 N N27 . XV6 C 2 .  ? -11.821 11.735 36.072 1.00 26.52 ? 638 XV6 B N27 1 
HETATM 1555 C C27 . XV6 C 2 .  ? -11.764 13.073 35.950 1.00 24.37 ? 638 XV6 B C27 1 
HETATM 1556 C C28 . XV6 C 2 .  ? -12.449 11.339 37.227 1.00 23.88 ? 638 XV6 B C28 1 
HETATM 1557 S S29 . XV6 C 2 .  ? -12.496 13.825 37.269 1.00 27.63 ? 638 XV6 B S29 1 
HETATM 1558 C C29 . XV6 C 2 .  ? -12.908 12.387 38.052 1.00 29.26 ? 638 XV6 B C29 1 
HETATM 1559 C C70 . XV6 C 2 .  ? -8.852  16.060 24.321 1.00 18.75 ? 638 XV6 B C70 1 
HETATM 1560 C C71 . XV6 C 2 .  ? -8.061  16.437 23.234 1.00 17.85 ? 638 XV6 B C71 1 
HETATM 1561 C C72 . XV6 C 2 .  ? -8.674  16.687 21.991 1.00 17.06 ? 638 XV6 B C72 1 
HETATM 1562 C C73 . XV6 C 2 .  ? -10.062 16.550 21.831 1.00 17.58 ? 638 XV6 B C73 1 
HETATM 1563 C C74 . XV6 C 2 .  ? -10.851 16.159 22.930 1.00 17.14 ? 638 XV6 B C74 1 
HETATM 1564 C C75 . XV6 C 2 .  ? -10.250 15.920 24.178 1.00 18.07 ? 638 XV6 B C75 1 
HETATM 1565 C C76 . XV6 C 2 .  ? -7.834  17.114 20.842 1.00 20.36 ? 638 XV6 B C76 1 
HETATM 1566 O O76 . XV6 C 2 .  ? -8.243  17.792 19.912 1.00 15.21 ? 638 XV6 B O76 1 
HETATM 1567 N N76 . XV6 C 2 .  ? -6.572  16.656 20.940 1.00 21.38 ? 638 XV6 B N76 1 
HETATM 1568 N N77 . XV6 C 2 .  ? -4.400  16.096 19.912 1.00 24.53 ? 638 XV6 B N77 1 
HETATM 1569 C C77 . XV6 C 2 .  ? -5.541  16.808 19.911 1.00 25.32 ? 638 XV6 B C77 1 
HETATM 1570 C C78 . XV6 C 2 .  ? -3.646  16.333 18.785 1.00 28.59 ? 638 XV6 B C78 1 
HETATM 1571 S S79 . XV6 C 2 .  ? -5.664  17.769 18.503 1.00 28.90 ? 638 XV6 B S79 1 
HETATM 1572 C C79 . XV6 C 2 .  ? -4.191  17.253 17.861 1.00 30.52 ? 638 XV6 B C79 1 
HETATM 1573 O O   . HOH D 3 .  ? -1.167  32.759 44.652 1.00 18.28 ? 402 HOH A O   1 
HETATM 1574 O O   . HOH D 3 .  ? -12.074 22.507 44.628 1.00 23.51 ? 403 HOH A O   1 
HETATM 1575 O O   . HOH D 3 .  ? -18.090 23.642 41.180 1.00 36.10 ? 407 HOH A O   1 
HETATM 1576 O O   . HOH D 3 .  ? -5.261  33.830 25.013 1.00 49.51 ? 410 HOH A O   1 
HETATM 1577 O O   . HOH D 3 .  ? -13.931 15.570 33.367 1.00 29.03 ? 411 HOH A O   1 
HETATM 1578 O O   . HOH D 3 .  ? -9.289  19.725 41.077 1.00 21.05 ? 412 HOH A O   1 
HETATM 1579 O O   . HOH D 3 .  ? -15.768 13.883 38.211 1.00 37.41 ? 415 HOH A O   1 
HETATM 1580 O O   . HOH D 3 .  ? -17.358 34.050 18.315 1.00 41.55 ? 419 HOH A O   1 
HETATM 1581 O O   . HOH D 3 .  ? -8.403  32.740 22.992 1.00 35.83 ? 421 HOH A O   1 
HETATM 1582 O O   . HOH D 3 .  ? -16.174 20.363 39.046 1.00 23.55 ? 422 HOH A O   1 
HETATM 1583 O O   . HOH D 3 .  ? -9.907  21.949 48.465 1.00 28.51 ? 423 HOH A O   1 
HETATM 1584 O O   . HOH D 3 .  ? -13.340 32.863 44.816 1.00 43.14 ? 425 HOH A O   1 
HETATM 1585 O O   . HOH D 3 .  ? -17.163 18.986 32.614 1.00 29.07 ? 427 HOH A O   1 
HETATM 1586 O O   . HOH D 3 .  ? 0.133   26.075 48.191 1.00 52.16 ? 428 HOH A O   1 
HETATM 1587 O O   . HOH D 3 .  ? -6.206  10.359 32.419 1.00 63.91 ? 429 HOH A O   1 
HETATM 1588 O O   . HOH D 3 .  ? -10.667 15.501 49.276 1.00 34.41 ? 434 HOH A O   1 
HETATM 1589 O O   . HOH D 3 .  ? 7.815   31.449 38.230 1.00 27.64 ? 439 HOH A O   1 
HETATM 1590 O O   . HOH D 3 .  ? 1.526   32.295 45.570 1.00 56.87 ? 442 HOH A O   1 
HETATM 1591 O O   . HOH D 3 .  ? -0.490  29.408 45.997 1.00 21.89 ? 443 HOH A O   1 
HETATM 1592 O O   . HOH D 3 .  ? -15.197 25.106 44.008 1.00 44.55 ? 444 HOH A O   1 
HETATM 1593 O O   . HOH D 3 .  ? -9.154  34.211 19.776 1.00 32.30 ? 445 HOH A O   1 
HETATM 1594 O O   . HOH D 3 .  ? 2.323   22.135 54.790 1.00 48.25 ? 446 HOH A O   1 
HETATM 1595 O O   . HOH D 3 .  ? -19.971 29.619 36.411 1.00 31.17 ? 448 HOH A O   1 
HETATM 1596 O O   . HOH D 3 .  ? -1.477  35.585 38.203 1.00 39.00 ? 450 HOH A O   1 
HETATM 1597 O O   . HOH D 3 .  ? -2.940  19.672 50.383 1.00 47.27 ? 451 HOH A O   1 
HETATM 1598 O O   . HOH D 3 .  ? 3.569   22.946 33.056 1.00 41.29 ? 454 HOH A O   1 
HETATM 1599 O O   . HOH D 3 .  ? -12.401 34.715 42.154 1.00 36.03 ? 455 HOH A O   1 
HETATM 1600 O O   . HOH D 3 .  ? -9.523  36.125 22.466 1.00 31.47 ? 458 HOH A O   1 
HETATM 1601 O O   . HOH D 3 .  ? 5.370   26.262 45.135 1.00 50.95 ? 460 HOH A O   1 
HETATM 1602 O O   . HOH D 3 .  ? -1.686  23.820 24.430 1.00 60.67 ? 463 HOH A O   1 
HETATM 1603 O O   . HOH D 3 .  ? 2.617   26.547 30.647 1.00 47.47 ? 466 HOH A O   1 
HETATM 1604 O O   . HOH D 3 .  ? -16.558 37.381 36.121 1.00 65.47 ? 468 HOH A O   1 
HETATM 1605 O O   . HOH D 3 .  ? -11.490 16.795 51.670 1.00 48.38 ? 469 HOH A O   1 
HETATM 1606 O O   . HOH D 3 .  ? -3.753  31.601 23.025 1.00 52.11 ? 471 HOH A O   1 
HETATM 1607 O O   . HOH E 3 .  ? -15.583 31.808 19.360 1.00 25.26 ? 401 HOH B O   1 
HETATM 1608 O O   . HOH E 3 .  ? -9.981  25.252 16.123 1.00 32.87 ? 404 HOH B O   1 
HETATM 1609 O O   . HOH E 3 .  ? -25.280 8.180  10.189 1.00 30.63 ? 405 HOH B O   1 
HETATM 1610 O O   . HOH E 3 .  ? -17.176 12.164 4.977  1.00 37.79 ? 408 HOH B O   1 
HETATM 1611 O O   . HOH E 3 .  ? -12.594 17.575 14.867 1.00 28.74 ? 409 HOH B O   1 
HETATM 1612 O O   . HOH E 3 .  ? -21.401 11.340 25.491 1.00 23.60 ? 413 HOH B O   1 
HETATM 1613 O O   . HOH E 3 .  ? -17.089 39.038 30.427 1.00 44.88 ? 414 HOH B O   1 
HETATM 1614 O O   . HOH E 3 .  ? -27.233 16.895 11.719 1.00 24.96 ? 418 HOH B O   1 
HETATM 1615 O O   . HOH E 3 .  ? -6.708  19.866 22.650 1.00 32.93 ? 420 HOH B O   1 
HETATM 1616 O O   . HOH E 3 .  ? -2.296  12.458 13.147 1.00 37.99 ? 424 HOH B O   1 
HETATM 1617 O O   . HOH E 3 .  ? -13.546 22.231 11.040 1.00 31.07 ? 426 HOH B O   1 
HETATM 1618 O O   . HOH E 3 .  ? -23.238 23.914 32.453 1.00 22.87 ? 430 HOH B O   1 
HETATM 1619 O O   . HOH E 3 .  ? -3.447  5.390  30.363 1.00 39.20 ? 431 HOH B O   1 
HETATM 1620 O O   . HOH E 3 .  ? -14.205 11.429 33.970 1.00 47.84 ? 432 HOH B O   1 
HETATM 1621 O O   . HOH E 3 .  ? -11.254 12.753 6.120  1.00 36.25 ? 435 HOH B O   1 
HETATM 1622 O O   . HOH E 3 .  ? -9.113  6.648  3.791  1.00 47.53 ? 436 HOH B O   1 
HETATM 1623 O O   . HOH E 3 .  ? -28.724 14.663 10.487 1.00 27.89 ? 437 HOH B O   1 
HETATM 1624 O O   . HOH E 3 .  ? -26.163 9.853  5.146  1.00 24.73 ? 438 HOH B O   1 
HETATM 1625 O O   . HOH E 3 .  ? -22.786 15.253 6.833  1.00 38.68 ? 440 HOH B O   1 
HETATM 1626 O O   . HOH E 3 .  ? -31.007 23.455 13.273 1.00 59.33 ? 441 HOH B O   1 
HETATM 1627 O O   . HOH E 3 .  ? -22.995 31.714 14.636 1.00 41.27 ? 447 HOH B O   1 
HETATM 1628 O O   . HOH E 3 .  ? -24.607 4.596  15.316 1.00 33.38 ? 449 HOH B O   1 
HETATM 1629 O O   . HOH E 3 .  ? -21.158 9.339  19.004 1.00 29.33 ? 452 HOH B O   1 
HETATM 1630 O O   . HOH E 3 .  ? -9.788  17.875 12.865 1.00 50.17 ? 453 HOH B O   1 
HETATM 1631 O O   . HOH E 3 .  ? -24.942 19.179 38.067 1.00 49.60 ? 456 HOH B O   1 
HETATM 1632 O O   . HOH E 3 .  ? -30.870 8.766  17.681 1.00 31.68 ? 457 HOH B O   1 
HETATM 1633 O O   . HOH E 3 .  ? -5.597  13.070 8.860  1.00 36.88 ? 459 HOH B O   1 
HETATM 1634 O O   . HOH E 3 .  ? -2.292  5.500  24.887 1.00 44.19 ? 461 HOH B O   1 
HETATM 1635 O O   . HOH E 3 .  ? -19.648 35.935 32.934 1.00 50.34 ? 462 HOH B O   1 
HETATM 1636 O O   . HOH E 3 .  ? -29.092 18.960 26.931 1.00 42.01 ? 464 HOH B O   1 
HETATM 1637 O O   . HOH E 3 .  ? -15.101 20.867 6.402  1.00 46.09 ? 465 HOH B O   1 
HETATM 1638 O O   . HOH E 3 .  ? -3.110  23.340 20.853 1.00 49.63 ? 467 HOH B O   1 
HETATM 1639 O O   . HOH E 3 .  ? -30.882 19.903 8.129  1.00 37.26 ? 470 HOH B O   1 
HETATM 1640 O O   . HOH E 3 .  ? -21.469 34.557 22.668 1.00 27.63 ? 472 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  1  1   PRO PRO A . n 
A 1 2  GLN 2  2  2   GLN GLN A . n 
A 1 3  VAL 3  3  3   VAL VAL A . n 
A 1 4  THR 4  4  4   THR THR A . n 
A 1 5  LEU 5  5  5   LEU LEU A . n 
A 1 6  TRP 6  6  6   TRP TRP A . n 
A 1 7  GLN 7  7  7   GLN GLN A . n 
A 1 8  ARG 8  8  8   ARG ARG A . n 
A 1 9  PRO 9  9  9   PRO PRO A . n 
A 1 10 LEU 10 10 10  LEU LEU A . n 
A 1 11 VAL 11 11 11  VAL VAL A . n 
A 1 12 THR 12 12 12  THR THR A . n 
A 1 13 ILE 13 13 13  ILE ILE A . n 
A 1 14 LYS 14 14 14  LYS LYS A . n 
A 1 15 ILE 15 15 15  ILE ILE A . n 
A 1 16 GLY 16 16 16  GLY GLY A . n 
A 1 17 GLY 17 17 17  GLY GLY A . n 
A 1 18 GLN 18 18 18  GLN GLN A . n 
A 1 19 LEU 19 19 19  LEU LEU A . n 
A 1 20 LYS 20 20 20  LYS LYS A . n 
A 1 21 GLU 21 21 21  GLU GLU A . n 
A 1 22 ALA 22 22 22  ALA ALA A . n 
A 1 23 LEU 23 23 23  LEU LEU A . n 
A 1 24 LEU 24 24 24  LEU LEU A . n 
A 1 25 ASP 25 25 25  ASP ASP A . n 
A 1 26 THR 26 26 26  THR THR A . n 
A 1 27 GLY 27 27 27  GLY GLY A . n 
A 1 28 ALA 28 28 28  ALA ALA A . n 
A 1 29 ASP 29 29 29  ASP ASP A . n 
A 1 30 ASP 30 30 30  ASP ASP A . n 
A 1 31 THR 31 31 31  THR THR A . n 
A 1 32 VAL 32 32 32  VAL VAL A . n 
A 1 33 LEU 33 33 33  LEU LEU A . n 
A 1 34 GLU 34 34 34  GLU GLU A . n 
A 1 35 GLU 35 35 35  GLU GLU A . n 
A 1 36 MET 36 36 36  MET MET A . n 
A 1 37 SER 37 37 37  SER SER A . n 
A 1 38 LEU 38 38 38  LEU LEU A . n 
A 1 39 PRO 39 39 39  PRO PRO A . n 
A 1 40 GLY 40 40 40  GLY GLY A . n 
A 1 41 ARG 41 41 41  ARG ARG A . n 
A 1 42 TRP 42 42 42  TRP TRP A . n 
A 1 43 LYS 43 43 43  LYS LYS A . n 
A 1 44 PRO 44 44 44  PRO PRO A . n 
A 1 45 LYS 45 45 45  LYS LYS A . n 
A 1 46 MET 46 46 46  MET MET A . n 
A 1 47 ILE 47 47 47  ILE ILE A . n 
A 1 48 GLY 48 48 48  GLY GLY A . n 
A 1 49 GLY 49 49 49  GLY GLY A . n 
A 1 50 ILE 50 50 50  ILE ILE A . n 
A 1 51 GLY 51 51 51  GLY GLY A . n 
A 1 52 GLY 52 52 52  GLY GLY A . n 
A 1 53 PHE 53 53 53  PHE PHE A . n 
A 1 54 ILE 54 54 54  ILE ILE A . n 
A 1 55 LYS 55 55 55  LYS LYS A . n 
A 1 56 VAL 56 56 56  VAL VAL A . n 
A 1 57 ARG 57 57 57  ARG ARG A . n 
A 1 58 GLN 58 58 58  GLN GLN A . n 
A 1 59 TYR 59 59 59  TYR TYR A . n 
A 1 60 ASP 60 60 60  ASP ASP A . n 
A 1 61 GLN 61 61 61  GLN GLN A . n 
A 1 62 ILE 62 62 62  ILE ILE A . n 
A 1 63 LEU 63 63 63  LEU LEU A . n 
A 1 64 ILE 64 64 64  ILE ILE A . n 
A 1 65 GLU 65 65 65  GLU GLU A . n 
A 1 66 ILE 66 66 66  ILE ILE A . n 
A 1 67 CYS 67 67 67  CYS CYS A . n 
A 1 68 GLY 68 68 68  GLY GLY A . n 
A 1 69 HIS 69 69 69  HIS HIS A . n 
A 1 70 LYS 70 70 70  LYS LYS A . n 
A 1 71 ALA 71 71 71  ALA ALA A . n 
A 1 72 ILE 72 72 72  ILE ILE A . n 
A 1 73 GLY 73 73 73  GLY GLY A . n 
A 1 74 THR 74 74 74  THR THR A . n 
A 1 75 VAL 75 75 75  VAL VAL A . n 
A 1 76 LEU 76 76 76  LEU LEU A . n 
A 1 77 VAL 77 77 77  VAL VAL A . n 
A 1 78 GLY 78 78 78  GLY GLY A . n 
A 1 79 PRO 79 79 79  PRO PRO A . n 
A 1 80 THR 80 80 80  THR THR A . n 
A 1 81 PRO 81 81 81  PRO PRO A . n 
A 1 82 PHE 82 82 82  PHE PHE A . n 
A 1 83 ASN 83 83 83  ASN ASN A . n 
A 1 84 VAL 84 84 84  VAL VAL A . n 
A 1 85 ILE 85 85 85  ILE ILE A . n 
A 1 86 GLY 86 86 86  GLY GLY A . n 
A 1 87 ARG 87 87 87  ARG ARG A . n 
A 1 88 ASN 88 88 88  ASN ASN A . n 
A 1 89 LEU 89 89 89  LEU LEU A . n 
A 1 90 LEU 90 90 90  LEU LEU A . n 
A 1 91 THR 91 91 91  THR THR A . n 
A 1 92 GLN 92 92 92  GLN GLN A . n 
A 1 93 ILE 93 93 93  ILE ILE A . n 
A 1 94 GLY 94 94 94  GLY GLY A . n 
A 1 95 CYS 95 95 95  CYS CYS A . n 
A 1 96 THR 96 96 96  THR THR A . n 
A 1 97 LEU 97 97 97  LEU LEU A . n 
A 1 98 ASN 98 98 98  ASN ASN A . n 
A 1 99 PHE 99 99 99  PHE PHE A . n 
B 1 1  PRO 1  1  101 PRO PRO B . n 
B 1 2  GLN 2  2  102 GLN GLN B . n 
B 1 3  VAL 3  3  103 VAL VAL B . n 
B 1 4  THR 4  4  104 THR THR B . n 
B 1 5  LEU 5  5  105 LEU LEU B . n 
B 1 6  TRP 6  6  106 TRP TRP B . n 
B 1 7  GLN 7  7  107 GLN GLN B . n 
B 1 8  ARG 8  8  108 ARG ARG B . n 
B 1 9  PRO 9  9  109 PRO PRO B . n 
B 1 10 LEU 10 10 110 LEU LEU B . n 
B 1 11 VAL 11 11 111 VAL VAL B . n 
B 1 12 THR 12 12 112 THR THR B . n 
B 1 13 ILE 13 13 113 ILE ILE B . n 
B 1 14 LYS 14 14 114 LYS LYS B . n 
B 1 15 ILE 15 15 115 ILE ILE B . n 
B 1 16 GLY 16 16 116 GLY GLY B . n 
B 1 17 GLY 17 17 117 GLY GLY B . n 
B 1 18 GLN 18 18 118 GLN GLN B . n 
B 1 19 LEU 19 19 119 LEU LEU B . n 
B 1 20 LYS 20 20 120 LYS LYS B . n 
B 1 21 GLU 21 21 121 GLU GLU B . n 
B 1 22 ALA 22 22 122 ALA ALA B . n 
B 1 23 LEU 23 23 123 LEU LEU B . n 
B 1 24 LEU 24 24 124 LEU LEU B . n 
B 1 25 ASP 25 25 125 ASP ASP B . n 
B 1 26 THR 26 26 126 THR THR B . n 
B 1 27 GLY 27 27 127 GLY GLY B . n 
B 1 28 ALA 28 28 128 ALA ALA B . n 
B 1 29 ASP 29 29 129 ASP ASP B . n 
B 1 30 ASP 30 30 130 ASP ASP B . n 
B 1 31 THR 31 31 131 THR THR B . n 
B 1 32 VAL 32 32 132 VAL VAL B . n 
B 1 33 LEU 33 33 133 LEU LEU B . n 
B 1 34 GLU 34 34 134 GLU GLU B . n 
B 1 35 GLU 35 35 135 GLU GLU B . n 
B 1 36 MET 36 36 136 MET MET B . n 
B 1 37 SER 37 37 137 SER SER B . n 
B 1 38 LEU 38 38 138 LEU LEU B . n 
B 1 39 PRO 39 39 139 PRO PRO B . n 
B 1 40 GLY 40 40 140 GLY GLY B . n 
B 1 41 ARG 41 41 141 ARG ARG B . n 
B 1 42 TRP 42 42 142 TRP TRP B . n 
B 1 43 LYS 43 43 143 LYS LYS B . n 
B 1 44 PRO 44 44 144 PRO PRO B . n 
B 1 45 LYS 45 45 145 LYS LYS B . n 
B 1 46 MET 46 46 146 MET MET B . n 
B 1 47 ILE 47 47 147 ILE ILE B . n 
B 1 48 GLY 48 48 148 GLY GLY B . n 
B 1 49 GLY 49 49 149 GLY GLY B . n 
B 1 50 ILE 50 50 150 ILE ILE B . n 
B 1 51 GLY 51 51 151 GLY GLY B . n 
B 1 52 GLY 52 52 152 GLY GLY B . n 
B 1 53 PHE 53 53 153 PHE PHE B . n 
B 1 54 ILE 54 54 154 ILE ILE B . n 
B 1 55 LYS 55 55 155 LYS LYS B . n 
B 1 56 VAL 56 56 156 VAL VAL B . n 
B 1 57 ARG 57 57 157 ARG ARG B . n 
B 1 58 GLN 58 58 158 GLN GLN B . n 
B 1 59 TYR 59 59 159 TYR TYR B . n 
B 1 60 ASP 60 60 160 ASP ASP B . n 
B 1 61 GLN 61 61 161 GLN GLN B . n 
B 1 62 ILE 62 62 162 ILE ILE B . n 
B 1 63 LEU 63 63 163 LEU LEU B . n 
B 1 64 ILE 64 64 164 ILE ILE B . n 
B 1 65 GLU 65 65 165 GLU GLU B . n 
B 1 66 ILE 66 66 166 ILE ILE B . n 
B 1 67 CYS 67 67 167 CYS CYS B . n 
B 1 68 GLY 68 68 168 GLY GLY B . n 
B 1 69 HIS 69 69 169 HIS HIS B . n 
B 1 70 LYS 70 70 170 LYS LYS B . n 
B 1 71 ALA 71 71 171 ALA ALA B . n 
B 1 72 ILE 72 72 172 ILE ILE B . n 
B 1 73 GLY 73 73 173 GLY GLY B . n 
B 1 74 THR 74 74 174 THR THR B . n 
B 1 75 VAL 75 75 175 VAL VAL B . n 
B 1 76 LEU 76 76 176 LEU LEU B . n 
B 1 77 VAL 77 77 177 VAL VAL B . n 
B 1 78 GLY 78 78 178 GLY GLY B . n 
B 1 79 PRO 79 79 179 PRO PRO B . n 
B 1 80 THR 80 80 180 THR THR B . n 
B 1 81 PRO 81 81 181 PRO PRO B . n 
B 1 82 PHE 82 82 182 PHE PHE B . n 
B 1 83 ASN 83 83 183 ASN ASN B . n 
B 1 84 VAL 84 84 184 VAL VAL B . n 
B 1 85 ILE 85 85 185 ILE ILE B . n 
B 1 86 GLY 86 86 186 GLY GLY B . n 
B 1 87 ARG 87 87 187 ARG ARG B . n 
B 1 88 ASN 88 88 188 ASN ASN B . n 
B 1 89 LEU 89 89 189 LEU LEU B . n 
B 1 90 LEU 90 90 190 LEU LEU B . n 
B 1 91 THR 91 91 191 THR THR B . n 
B 1 92 GLN 92 92 192 GLN GLN B . n 
B 1 93 ILE 93 93 193 ILE ILE B . n 
B 1 94 GLY 94 94 194 GLY GLY B . n 
B 1 95 CYS 95 95 195 CYS CYS B . n 
B 1 96 THR 96 96 196 THR THR B . n 
B 1 97 LEU 97 97 197 LEU LEU B . n 
B 1 98 ASN 98 98 198 ASN ASN B . n 
B 1 99 PHE 99 99 199 PHE PHE B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 XV6 1  638 638 XV6 XV6 B . 
D 3 HOH 1  402 402 HOH HOH A . 
D 3 HOH 2  403 403 HOH HOH A . 
D 3 HOH 3  407 407 HOH HOH A . 
D 3 HOH 4  410 410 HOH HOH A . 
D 3 HOH 5  411 411 HOH HOH A . 
D 3 HOH 6  412 412 HOH HOH A . 
D 3 HOH 7  415 415 HOH HOH A . 
D 3 HOH 8  419 419 HOH HOH A . 
D 3 HOH 9  421 421 HOH HOH A . 
D 3 HOH 10 422 422 HOH HOH A . 
D 3 HOH 11 423 423 HOH HOH A . 
D 3 HOH 12 425 425 HOH HOH A . 
D 3 HOH 13 427 427 HOH HOH A . 
D 3 HOH 14 428 428 HOH HOH A . 
D 3 HOH 15 429 429 HOH HOH A . 
D 3 HOH 16 434 434 HOH HOH A . 
D 3 HOH 17 439 439 HOH HOH A . 
D 3 HOH 18 442 442 HOH HOH A . 
D 3 HOH 19 443 443 HOH HOH A . 
D 3 HOH 20 444 444 HOH HOH A . 
D 3 HOH 21 445 445 HOH HOH A . 
D 3 HOH 22 446 446 HOH HOH A . 
D 3 HOH 23 448 448 HOH HOH A . 
D 3 HOH 24 450 450 HOH HOH A . 
D 3 HOH 25 451 451 HOH HOH A . 
D 3 HOH 26 454 454 HOH HOH A . 
D 3 HOH 27 455 455 HOH HOH A . 
D 3 HOH 28 458 458 HOH HOH A . 
D 3 HOH 29 460 460 HOH HOH A . 
D 3 HOH 30 463 463 HOH HOH A . 
D 3 HOH 31 466 466 HOH HOH A . 
D 3 HOH 32 468 468 HOH HOH A . 
D 3 HOH 33 469 469 HOH HOH A . 
D 3 HOH 34 471 471 HOH HOH A . 
E 3 HOH 1  401 401 HOH HOH B . 
E 3 HOH 2  404 404 HOH HOH B . 
E 3 HOH 3  405 405 HOH HOH B . 
E 3 HOH 4  408 408 HOH HOH B . 
E 3 HOH 5  409 409 HOH HOH B . 
E 3 HOH 6  413 413 HOH HOH B . 
E 3 HOH 7  414 414 HOH HOH B . 
E 3 HOH 8  418 418 HOH HOH B . 
E 3 HOH 9  420 420 HOH HOH B . 
E 3 HOH 10 424 424 HOH HOH B . 
E 3 HOH 11 426 426 HOH HOH B . 
E 3 HOH 12 430 430 HOH HOH B . 
E 3 HOH 13 431 431 HOH HOH B . 
E 3 HOH 14 432 432 HOH HOH B . 
E 3 HOH 15 435 435 HOH HOH B . 
E 3 HOH 16 436 436 HOH HOH B . 
E 3 HOH 17 437 437 HOH HOH B . 
E 3 HOH 18 438 438 HOH HOH B . 
E 3 HOH 19 440 440 HOH HOH B . 
E 3 HOH 20 441 441 HOH HOH B . 
E 3 HOH 21 447 447 HOH HOH B . 
E 3 HOH 22 449 449 HOH HOH B . 
E 3 HOH 23 452 452 HOH HOH B . 
E 3 HOH 24 453 453 HOH HOH B . 
E 3 HOH 25 456 456 HOH HOH B . 
E 3 HOH 26 457 457 HOH HOH B . 
E 3 HOH 27 459 459 HOH HOH B . 
E 3 HOH 28 461 461 HOH HOH B . 
E 3 HOH 29 462 462 HOH HOH B . 
E 3 HOH 30 464 464 HOH HOH B . 
E 3 HOH 31 465 465 HOH HOH B . 
E 3 HOH 32 467 467 HOH HOH B . 
E 3 HOH 33 470 470 HOH HOH B . 
E 3 HOH 34 472 472 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5160 ? 
1 MORE         -32  ? 
1 'SSA (A^2)'  8930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-10-30 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
5 'Structure model' 1 4 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 5 'Structure model' 'Database references'       
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' struct_conf         
2 4 'Structure model' struct_conf_type    
3 5 'Structure model' chem_comp           
4 5 'Structure model' database_2          
5 5 'Structure model' entity              
6 5 'Structure model' pdbx_entity_nonpoly 
7 5 'Structure model' struct_ref_seq_dif  
8 5 'Structure model' struct_site         
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_chem_comp.name'                     
2 5 'Structure model' '_database_2.pdbx_DOI'                
3 5 'Structure model' '_database_2.pdbx_database_accession' 
4 5 'Structure model' '_entity.pdbx_description'            
5 5 'Structure model' '_pdbx_entity_nonpoly.name'           
6 5 'Structure model' '_struct_ref_seq_dif.details'         
7 5 'Structure model' '_struct_site.pdbx_auth_asym_id'      
8 5 'Structure model' '_struct_site.pdbx_auth_comp_id'      
9 5 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_software.name             X-PLOR 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CE2 A TRP 6  ? ? CD2 A TRP 6  ? ? 1.501 1.409 0.092 0.012 N 
2 1 CE2 A TRP 42 ? ? CD2 A TRP 42 ? ? 1.492 1.409 0.083 0.012 N 
3 1 CE2 B TRP 6  ? ? CD2 B TRP 6  ? ? 1.489 1.409 0.080 0.012 N 
4 1 CE2 B TRP 42 ? ? CD2 B TRP 42 ? ? 1.490 1.409 0.081 0.012 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 87 ? ? CZ A ARG 87 ? ? NH1 A ARG 87 ? ? 123.89 120.30 3.59   0.50 N 
2 1 N  B THR 91 ? ? CA B THR 91 ? ? CB  B THR 91 ? ? 98.16  110.30 -12.14 1.90 N 
3 1 CB B ASN 98 ? ? CA B ASN 98 ? ? C   B ASN 98 ? ? 97.21  110.40 -13.19 2.00 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    CYS 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     67 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             49.43 
_pdbx_validate_torsion.psi             -137.92 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;[4R-(4ALPHA,5ALPHA,6BETA,7BETA)]-3,3'-[[TETRAHYDRO-5,6-DIHYDROXY-2-OXO-4,7-BIS(PHENYLMETHYL)-1H-1,3-DIAZEPINE-1,3(2H)-D IYL] BIS(METHYLENE)]BIS[N-2-THIAZOLYLBENZAMIDE]
;
XV6 
3 water HOH 
#