data_1BWC
# 
_entry.id   1BWC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BWC         
RCSB  RCSB001222   
WWPDB D_1000001222 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BWC 
_pdbx_database_status.recvd_initial_deposition_date   1998-09-23 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gallwitz, H.'        1 
'Bonse, S.'           2 
'Martinez-Cruz, A.'   3 
'Schlichting, I.'     4 
'Schumacher, K.'      5 
'Krauth-Siegel, R.L.' 6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Ajoene is an inhibitor and subversive substrate of human glutathione reductase and Trypanosoma cruzi trypanothione reductase: crystallographic, kinetic, and spectroscopic studies.
;
J.Med.Chem.    42  364 372 1999 JMCMAR US 0022-2623 0151 ? 9986706 10.1021/jm980471k 
1       
;Inhibition of Human Glutathione Reductase by the Nitrosourea Drugs 1,3-Bis(2- Chloroethyl)-1-Nitrosourea and 1-(2-Chloroethyl)-3-(2-Hydroxyethyl)-1- Nitrosourea. A Crystallographic Analysis
;
Eur.J.Biochem. 171 193 ?   1988 EJBCAI IX 0014-2956 0262 ? ?       ?                 
2       'Refined Structure of Glutathione Reductase at 1.54 A Resolution' J.Mol.Biol.    195 701 ?   1987 JMOBAK UK 0022-2836 0070 
? ?       ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gallwitz, H.'        1  
primary 'Bonse, S.'           2  
primary 'Martinez-Cruz, A.'   3  
primary 'Schlichting, I.'     4  
primary 'Schumacher, K.'      5  
primary 'Krauth-Siegel, R.L.' 6  
1       'Karplus, P.A.'       7  
1       'Krauth-Siegel, R.L.' 8  
1       'Schirmer, R.H.'      9  
1       'Schulz, G.E.'        10 
2       'Karplus, P.A.'       11 
2       'Schulz, G.E.'        12 
# 
_cell.entry_id           1BWC 
_cell.length_a           64.300 
_cell.length_b           146.900 
_cell.length_c           128.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BWC 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (GLUTATHIONE REDUCTASE)'           51636.242 1   1.6.4.2 ? ? ? 
2 non-polymer syn 'CHLORIDE ION'                              35.453    1   ?       ? ? ? 
3 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE'               785.550   1   ?       ? ? ? 
4 non-polymer syn '3-(PROP-2-ENE-1-SULFINYL)-PROPENE-1-THIOL' 162.273   1   ?       ? ? ? 
5 water       nat water                                       18.015    142 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        GR 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ACRQEPQPQGPPPAAGAVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMH
DHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMP
STPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELEN
AGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQN
TNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYS
TSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ACRQEPQPQGPPPAAGAVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMH
DHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMP
STPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELEN
AGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQN
TNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYS
TSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   CYS n 
1 3   ARG n 
1 4   GLN n 
1 5   GLU n 
1 6   PRO n 
1 7   GLN n 
1 8   PRO n 
1 9   GLN n 
1 10  GLY n 
1 11  PRO n 
1 12  PRO n 
1 13  PRO n 
1 14  ALA n 
1 15  ALA n 
1 16  GLY n 
1 17  ALA n 
1 18  VAL n 
1 19  ALA n 
1 20  SER n 
1 21  TYR n 
1 22  ASP n 
1 23  TYR n 
1 24  LEU n 
1 25  VAL n 
1 26  ILE n 
1 27  GLY n 
1 28  GLY n 
1 29  GLY n 
1 30  SER n 
1 31  GLY n 
1 32  GLY n 
1 33  LEU n 
1 34  ALA n 
1 35  SER n 
1 36  ALA n 
1 37  ARG n 
1 38  ARG n 
1 39  ALA n 
1 40  ALA n 
1 41  GLU n 
1 42  LEU n 
1 43  GLY n 
1 44  ALA n 
1 45  ARG n 
1 46  ALA n 
1 47  ALA n 
1 48  VAL n 
1 49  VAL n 
1 50  GLU n 
1 51  SER n 
1 52  HIS n 
1 53  LYS n 
1 54  LEU n 
1 55  GLY n 
1 56  GLY n 
1 57  THR n 
1 58  CYS n 
1 59  VAL n 
1 60  ASN n 
1 61  VAL n 
1 62  GLY n 
1 63  CYS n 
1 64  VAL n 
1 65  PRO n 
1 66  LYS n 
1 67  LYS n 
1 68  VAL n 
1 69  MET n 
1 70  TRP n 
1 71  ASN n 
1 72  THR n 
1 73  ALA n 
1 74  VAL n 
1 75  HIS n 
1 76  SER n 
1 77  GLU n 
1 78  PHE n 
1 79  MET n 
1 80  HIS n 
1 81  ASP n 
1 82  HIS n 
1 83  ALA n 
1 84  ASP n 
1 85  TYR n 
1 86  GLY n 
1 87  PHE n 
1 88  PRO n 
1 89  SER n 
1 90  CYS n 
1 91  GLU n 
1 92  GLY n 
1 93  LYS n 
1 94  PHE n 
1 95  ASN n 
1 96  TRP n 
1 97  ARG n 
1 98  VAL n 
1 99  ILE n 
1 100 LYS n 
1 101 GLU n 
1 102 LYS n 
1 103 ARG n 
1 104 ASP n 
1 105 ALA n 
1 106 TYR n 
1 107 VAL n 
1 108 SER n 
1 109 ARG n 
1 110 LEU n 
1 111 ASN n 
1 112 ALA n 
1 113 ILE n 
1 114 TYR n 
1 115 GLN n 
1 116 ASN n 
1 117 ASN n 
1 118 LEU n 
1 119 THR n 
1 120 LYS n 
1 121 SER n 
1 122 HIS n 
1 123 ILE n 
1 124 GLU n 
1 125 ILE n 
1 126 ILE n 
1 127 ARG n 
1 128 GLY n 
1 129 HIS n 
1 130 ALA n 
1 131 ALA n 
1 132 PHE n 
1 133 THR n 
1 134 SER n 
1 135 ASP n 
1 136 PRO n 
1 137 LYS n 
1 138 PRO n 
1 139 THR n 
1 140 ILE n 
1 141 GLU n 
1 142 VAL n 
1 143 SER n 
1 144 GLY n 
1 145 LYS n 
1 146 LYS n 
1 147 TYR n 
1 148 THR n 
1 149 ALA n 
1 150 PRO n 
1 151 HIS n 
1 152 ILE n 
1 153 LEU n 
1 154 ILE n 
1 155 ALA n 
1 156 THR n 
1 157 GLY n 
1 158 GLY n 
1 159 MET n 
1 160 PRO n 
1 161 SER n 
1 162 THR n 
1 163 PRO n 
1 164 HIS n 
1 165 GLU n 
1 166 SER n 
1 167 GLN n 
1 168 ILE n 
1 169 PRO n 
1 170 GLY n 
1 171 ALA n 
1 172 SER n 
1 173 LEU n 
1 174 GLY n 
1 175 ILE n 
1 176 THR n 
1 177 SER n 
1 178 ASP n 
1 179 GLY n 
1 180 PHE n 
1 181 PHE n 
1 182 GLN n 
1 183 LEU n 
1 184 GLU n 
1 185 GLU n 
1 186 LEU n 
1 187 PRO n 
1 188 GLY n 
1 189 ARG n 
1 190 SER n 
1 191 VAL n 
1 192 ILE n 
1 193 VAL n 
1 194 GLY n 
1 195 ALA n 
1 196 GLY n 
1 197 TYR n 
1 198 ILE n 
1 199 ALA n 
1 200 VAL n 
1 201 GLU n 
1 202 MET n 
1 203 ALA n 
1 204 GLY n 
1 205 ILE n 
1 206 LEU n 
1 207 SER n 
1 208 ALA n 
1 209 LEU n 
1 210 GLY n 
1 211 SER n 
1 212 LYS n 
1 213 THR n 
1 214 SER n 
1 215 LEU n 
1 216 MET n 
1 217 ILE n 
1 218 ARG n 
1 219 HIS n 
1 220 ASP n 
1 221 LYS n 
1 222 VAL n 
1 223 LEU n 
1 224 ARG n 
1 225 SER n 
1 226 PHE n 
1 227 ASP n 
1 228 SER n 
1 229 MET n 
1 230 ILE n 
1 231 SER n 
1 232 THR n 
1 233 ASN n 
1 234 CYS n 
1 235 THR n 
1 236 GLU n 
1 237 GLU n 
1 238 LEU n 
1 239 GLU n 
1 240 ASN n 
1 241 ALA n 
1 242 GLY n 
1 243 VAL n 
1 244 GLU n 
1 245 VAL n 
1 246 LEU n 
1 247 LYS n 
1 248 PHE n 
1 249 SER n 
1 250 GLN n 
1 251 VAL n 
1 252 LYS n 
1 253 GLU n 
1 254 VAL n 
1 255 LYS n 
1 256 LYS n 
1 257 THR n 
1 258 LEU n 
1 259 SER n 
1 260 GLY n 
1 261 LEU n 
1 262 GLU n 
1 263 VAL n 
1 264 SER n 
1 265 MET n 
1 266 VAL n 
1 267 THR n 
1 268 ALA n 
1 269 VAL n 
1 270 PRO n 
1 271 GLY n 
1 272 ARG n 
1 273 LEU n 
1 274 PRO n 
1 275 VAL n 
1 276 MET n 
1 277 THR n 
1 278 MET n 
1 279 ILE n 
1 280 PRO n 
1 281 ASP n 
1 282 VAL n 
1 283 ASP n 
1 284 CYS n 
1 285 LEU n 
1 286 LEU n 
1 287 TRP n 
1 288 ALA n 
1 289 ILE n 
1 290 GLY n 
1 291 ARG n 
1 292 VAL n 
1 293 PRO n 
1 294 ASN n 
1 295 THR n 
1 296 LYS n 
1 297 ASP n 
1 298 LEU n 
1 299 SER n 
1 300 LEU n 
1 301 ASN n 
1 302 LYS n 
1 303 LEU n 
1 304 GLY n 
1 305 ILE n 
1 306 GLN n 
1 307 THR n 
1 308 ASP n 
1 309 ASP n 
1 310 LYS n 
1 311 GLY n 
1 312 HIS n 
1 313 ILE n 
1 314 ILE n 
1 315 VAL n 
1 316 ASP n 
1 317 GLU n 
1 318 PHE n 
1 319 GLN n 
1 320 ASN n 
1 321 THR n 
1 322 ASN n 
1 323 VAL n 
1 324 LYS n 
1 325 GLY n 
1 326 ILE n 
1 327 TYR n 
1 328 ALA n 
1 329 VAL n 
1 330 GLY n 
1 331 ASP n 
1 332 VAL n 
1 333 CYS n 
1 334 GLY n 
1 335 LYS n 
1 336 ALA n 
1 337 LEU n 
1 338 LEU n 
1 339 THR n 
1 340 PRO n 
1 341 VAL n 
1 342 ALA n 
1 343 ILE n 
1 344 ALA n 
1 345 ALA n 
1 346 GLY n 
1 347 ARG n 
1 348 LYS n 
1 349 LEU n 
1 350 ALA n 
1 351 HIS n 
1 352 ARG n 
1 353 LEU n 
1 354 PHE n 
1 355 GLU n 
1 356 TYR n 
1 357 LYS n 
1 358 GLU n 
1 359 ASP n 
1 360 SER n 
1 361 LYS n 
1 362 LEU n 
1 363 ASP n 
1 364 TYR n 
1 365 ASN n 
1 366 ASN n 
1 367 ILE n 
1 368 PRO n 
1 369 THR n 
1 370 VAL n 
1 371 VAL n 
1 372 PHE n 
1 373 SER n 
1 374 HIS n 
1 375 PRO n 
1 376 PRO n 
1 377 ILE n 
1 378 GLY n 
1 379 THR n 
1 380 VAL n 
1 381 GLY n 
1 382 LEU n 
1 383 THR n 
1 384 GLU n 
1 385 ASP n 
1 386 GLU n 
1 387 ALA n 
1 388 ILE n 
1 389 HIS n 
1 390 LYS n 
1 391 TYR n 
1 392 GLY n 
1 393 ILE n 
1 394 GLU n 
1 395 ASN n 
1 396 VAL n 
1 397 LYS n 
1 398 THR n 
1 399 TYR n 
1 400 SER n 
1 401 THR n 
1 402 SER n 
1 403 PHE n 
1 404 THR n 
1 405 PRO n 
1 406 MET n 
1 407 TYR n 
1 408 HIS n 
1 409 ALA n 
1 410 VAL n 
1 411 THR n 
1 412 LYS n 
1 413 ARG n 
1 414 LYS n 
1 415 THR n 
1 416 LYS n 
1 417 CYS n 
1 418 VAL n 
1 419 MET n 
1 420 LYS n 
1 421 MET n 
1 422 VAL n 
1 423 CYS n 
1 424 ALA n 
1 425 ASN n 
1 426 LYS n 
1 427 GLU n 
1 428 GLU n 
1 429 LYS n 
1 430 VAL n 
1 431 VAL n 
1 432 GLY n 
1 433 ILE n 
1 434 HIS n 
1 435 MET n 
1 436 GLN n 
1 437 GLY n 
1 438 LEU n 
1 439 GLY n 
1 440 CYS n 
1 441 ASP n 
1 442 GLU n 
1 443 MET n 
1 444 LEU n 
1 445 GLN n 
1 446 GLY n 
1 447 PHE n 
1 448 ALA n 
1 449 VAL n 
1 450 ALA n 
1 451 VAL n 
1 452 LYS n 
1 453 MET n 
1 454 GLY n 
1 455 ALA n 
1 456 THR n 
1 457 LYS n 
1 458 ALA n 
1 459 ASP n 
1 460 PHE n 
1 461 ASP n 
1 462 ASN n 
1 463 THR n 
1 464 VAL n 
1 465 ALA n 
1 466 ILE n 
1 467 HIS n 
1 468 PRO n 
1 469 THR n 
1 470 SER n 
1 471 SER n 
1 472 GLU n 
1 473 GLU n 
1 474 LEU n 
1 475 VAL n 
1 476 THR n 
1 477 LEU n 
1 478 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GOR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ERYTHROCYTES 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 GOR 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               SG5 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PUB302-2 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GSHR_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00390 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1BWC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 478 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00390 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  478 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       478 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AJ3 non-polymer         . '3-(PROP-2-ENE-1-SULFINYL)-PROPENE-1-THIOL' ? 'C6 H10 O S2'       162.273 
ALA 'L-peptide linking' y ALANINE                                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ? 'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'                              ? 'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                                    ? 'C3 H7 N O2 S'      121.158 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE'               ? 'C27 H33 N9 O15 P2' 785.550 
GLN 'L-peptide linking' y GLUTAMINE                                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                       ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                  ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1BWC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.94 
_exptl_crystal.density_percent_sol   58.22 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.9 
_exptl_crystal_grow.pdbx_details    'pH 6.9' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           277 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'SIEMENS X1000' 
_diffrn_detector.pdbx_collection_date   1997-06 
_diffrn_detector.details                MONOCHROMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BWC 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   34707 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.4 
_reflns.pdbx_Rmerge_I_obs            0.117 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        23.4 
_reflns.pdbx_redundancy              4.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.2 
_reflns_shell.percent_possible_all   74.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1BWC 
_refine.ls_number_reflns_obs                     33205 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               100000.00 
_refine.pdbx_data_cutoff_low_absF                0.00000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    92.3 
_refine.ls_R_factor_obs                          0.18 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18 
_refine.ls_R_factor_R_free                       0.23 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.1 
_refine.ls_number_reflns_R_free                  2372 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               22.5 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1GRE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1BWC 
_refine_analyze.Luzzati_coordinate_error_obs    0.23 
_refine_analyze.Luzzati_sigma_a_obs             0.28 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.28 
_refine_analyze.Luzzati_sigma_a_free            0.31 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3499 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         63 
_refine_hist.number_atoms_solvent             142 
_refine_hist.number_atoms_total               3704 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             0.925 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      27.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.083 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.17  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            1.91  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.20  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            3.34  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.20 
_refine_ls_shell.number_reflns_R_work             3082 
_refine_ls_shell.R_factor_R_work                  0.285 
_refine_ls_shell.percent_reflns_obs               74.6 
_refine_ls_shell.R_factor_R_free                  0.338 
_refine_ls_shell.R_factor_R_free_error            0.021 
_refine_ls_shell.percent_reflns_R_free            6.7 
_refine_ls_shell.number_reflns_R_free             220 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.SOL  TOPH19.SOL   'X-RAY DIFFRACTION' 
3 FAD.PAR      FAD.TOP      'X-RAY DIFFRACTION' 
4 AJO3.PARM    AJO3.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1BWC 
_struct.title                     
'STRUCTURE OF HUMAN GLUTATHIONE REDUCTASE COMPLEXED with AJOENE INHIBITOR AND SUBVERSIVE SUBSTRATE' 
_struct.pdbx_descriptor           'PROTEIN (GLUTATHIONE REDUCTASE) (1.6.4.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BWC 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'OXIDOREDUCTASE, FLAVOENZYME, REDOX-ACTIVE CENTER' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 30  ? GLU A 41  ? SER A 30  GLU A 41  1 ? 12 
HELX_P HELX_P2  2  GLY A 56  ? ASN A 60  ? GLY A 56  ASN A 60  1 ? 5  
HELX_P HELX_P3  3  CYS A 63  ? HIS A 80  ? CYS A 63  HIS A 80  1 ? 18 
HELX_P HELX_P4  4  ALA A 83  ? TYR A 85  ? ALA A 83  TYR A 85  5 ? 3  
HELX_P HELX_P5  5  TRP A 96  ? LYS A 120 ? TRP A 96  LYS A 120 1 ? 25 
HELX_P HELX_P6  6  ALA A 171 ? LEU A 173 ? ALA A 171 LEU A 173 5 ? 3  
HELX_P HELX_P7  7  SER A 177 ? GLN A 182 ? SER A 177 GLN A 182 1 ? 6  
HELX_P HELX_P8  8  TYR A 197 ? LEU A 209 ? TYR A 197 LEU A 209 1 ? 13 
HELX_P HELX_P9  9  SER A 228 ? ASN A 240 ? SER A 228 ASN A 240 1 ? 13 
HELX_P HELX_P10 10 LEU A 300 ? LYS A 302 ? LEU A 300 LYS A 302 5 ? 3  
HELX_P HELX_P11 11 GLY A 330 ? CYS A 333 ? GLY A 330 CYS A 333 5 ? 4  
HELX_P HELX_P12 12 THR A 339 ? PHE A 354 ? THR A 339 PHE A 354 1 ? 16 
HELX_P HELX_P13 13 GLU A 384 ? TYR A 391 ? GLU A 384 TYR A 391 1 ? 8  
HELX_P HELX_P14 14 ILE A 393 ? ASN A 395 ? ILE A 393 ASN A 395 5 ? 3  
HELX_P HELX_P15 15 MET A 406 ? VAL A 410 ? MET A 406 VAL A 410 5 ? 5  
HELX_P HELX_P16 16 CYS A 440 ? LYS A 452 ? CYS A 440 LYS A 452 1 ? 13 
HELX_P HELX_P17 17 LYS A 457 ? ASP A 461 ? LYS A 457 ASP A 461 1 ? 5  
HELX_P HELX_P18 18 SER A 471 ? VAL A 475 ? SER A 471 VAL A 475 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 58 SG A ? ? 1_555 A CYS 63 SG A ? A CYS 58   A CYS 63 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2 disulf ? ? A CYS 90 SG ? ? ? 1_555 A CYS 90 SG ? ? A CYS 90   A CYS 90 4_565 ? ? ? ? ? ? ? 2.559 ? 
covale1 covale ? ? D AJ3 .  S5 ? ? ? 1_555 A CYS 58 SG B ? A AJ3 4058 A CYS 58 1_555 ? ? ? ? ? ? ? 2.047 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 374 A . ? HIS 374 A PRO 375 A ? PRO 375 A 1 -14.17 
2 HIS 467 A . ? HIS 467 A PRO 468 A ? PRO 468 A 1 -20.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 2 ? 
D ? 4 ? 
E ? 3 ? 
F ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 19  ? TYR A 21  ? ALA A 19  TYR A 21  
A 2 LYS A 145 ? ALA A 149 ? LYS A 145 ALA A 149 
A 3 THR A 139 ? VAL A 142 ? THR A 139 VAL A 142 
B 1 ILE A 326 ? ALA A 328 ? ILE A 326 ALA A 328 
B 2 ILE A 152 ? ILE A 154 ? ILE A 152 ILE A 154 
B 3 TYR A 23  ? ILE A 26  ? TYR A 23  ILE A 26  
B 4 ALA A 46  ? GLU A 50  ? ALA A 46  GLU A 50  
B 5 GLU A 124 ? ARG A 127 ? GLU A 124 ARG A 127 
C 1 GLY A 158 ? PRO A 160 ? GLY A 158 PRO A 160 
C 2 ARG A 291 ? PRO A 293 ? ARG A 291 PRO A 293 
D 1 CYS A 284 ? TRP A 287 ? CYS A 284 TRP A 287 
D 2 ARG A 189 ? VAL A 193 ? ARG A 189 VAL A 193 
D 3 LYS A 212 ? MET A 216 ? LYS A 212 MET A 216 
D 4 GLU A 244 ? LEU A 246 ? GLU A 244 LEU A 246 
E 1 VAL A 275 ? ILE A 279 ? VAL A 275 ILE A 279 
E 2 GLY A 260 ? THR A 267 ? GLY A 260 THR A 267 
E 3 SER A 249 ? THR A 257 ? SER A 249 THR A 257 
F 1 THR A 369 ? VAL A 371 ? THR A 369 VAL A 371 
F 2 ILE A 377 ? GLY A 381 ? ILE A 377 GLY A 381 
F 3 LYS A 429 ? GLN A 436 ? LYS A 429 GLN A 436 
F 4 CYS A 417 ? ALA A 424 ? CYS A 417 ALA A 424 
F 5 VAL A 396 ? PHE A 403 ? VAL A 396 PHE A 403 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 19  ? O ALA A 19  N THR A 148 ? N THR A 148 
A 2 3 O LYS A 145 ? O LYS A 145 N VAL A 142 ? N VAL A 142 
B 1 2 O TYR A 327 ? O TYR A 327 N ILE A 152 ? N ILE A 152 
B 2 3 O LEU A 153 ? O LEU A 153 N LEU A 24  ? N LEU A 24  
B 3 4 O TYR A 23  ? O TYR A 23  N ALA A 47  ? N ALA A 47  
B 4 5 O VAL A 48  ? O VAL A 48  N GLU A 124 ? N GLU A 124 
C 1 2 O MET A 159 ? O MET A 159 N VAL A 292 ? N VAL A 292 
D 1 2 O CYS A 284 ? O CYS A 284 N VAL A 191 ? N VAL A 191 
D 2 3 O SER A 190 ? O SER A 190 N LYS A 212 ? N LYS A 212 
D 3 4 O LEU A 215 ? O LEU A 215 N GLU A 244 ? N GLU A 244 
E 1 2 O VAL A 275 ? O VAL A 275 N THR A 267 ? N THR A 267 
E 2 3 O GLY A 260 ? O GLY A 260 N THR A 257 ? N THR A 257 
F 1 2 O THR A 369 ? O THR A 369 N THR A 379 ? N THR A 379 
F 2 3 O GLY A 378 ? O GLY A 378 N MET A 435 ? N MET A 435 
F 3 4 O LYS A 429 ? O LYS A 429 N ALA A 424 ? N ALA A 424 
F 4 5 O CYS A 417 ? O CYS A 417 N PHE A 403 ? N PHE A 403 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL A 3000'  
AC2 Software ? ? ? ? 36 'BINDING SITE FOR RESIDUE FAD A 479'  
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE AJ3 A 4058' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  LEU A 54  ? LEU A 54   . ? 1_555 ? 
2  AC1 4  GLN A 115 ? GLN A 115  . ? 3_655 ? 
3  AC1 4  ARG A 127 ? ARG A 127  . ? 1_555 ? 
4  AC1 4  HOH E .   ? HOH A 4179 . ? 3_655 ? 
5  AC2 36 GLY A 27  ? GLY A 27   . ? 1_555 ? 
6  AC2 36 GLY A 29  ? GLY A 29   . ? 1_555 ? 
7  AC2 36 SER A 30  ? SER A 30   . ? 1_555 ? 
8  AC2 36 GLY A 31  ? GLY A 31   . ? 1_555 ? 
9  AC2 36 VAL A 49  ? VAL A 49   . ? 1_555 ? 
10 AC2 36 GLU A 50  ? GLU A 50   . ? 1_555 ? 
11 AC2 36 SER A 51  ? SER A 51   . ? 1_555 ? 
12 AC2 36 HIS A 52  ? HIS A 52   . ? 1_555 ? 
13 AC2 36 GLY A 56  ? GLY A 56   . ? 1_555 ? 
14 AC2 36 THR A 57  ? THR A 57   . ? 1_555 ? 
15 AC2 36 CYS A 58  ? CYS A 58   . ? 1_555 ? 
16 AC2 36 CYS A 63  ? CYS A 63   . ? 1_555 ? 
17 AC2 36 LYS A 66  ? LYS A 66   . ? 1_555 ? 
18 AC2 36 GLY A 128 ? GLY A 128  . ? 1_555 ? 
19 AC2 36 HIS A 129 ? HIS A 129  . ? 1_555 ? 
20 AC2 36 ALA A 130 ? ALA A 130  . ? 1_555 ? 
21 AC2 36 ALA A 155 ? ALA A 155  . ? 1_555 ? 
22 AC2 36 THR A 156 ? THR A 156  . ? 1_555 ? 
23 AC2 36 GLY A 157 ? GLY A 157  . ? 1_555 ? 
24 AC2 36 TYR A 197 ? TYR A 197  . ? 1_555 ? 
25 AC2 36 ARG A 291 ? ARG A 291  . ? 1_555 ? 
26 AC2 36 ASN A 294 ? ASN A 294  . ? 1_555 ? 
27 AC2 36 GLY A 330 ? GLY A 330  . ? 1_555 ? 
28 AC2 36 ASP A 331 ? ASP A 331  . ? 1_555 ? 
29 AC2 36 LEU A 337 ? LEU A 337  . ? 1_555 ? 
30 AC2 36 LEU A 338 ? LEU A 338  . ? 1_555 ? 
31 AC2 36 THR A 339 ? THR A 339  . ? 1_555 ? 
32 AC2 36 PRO A 340 ? PRO A 340  . ? 1_555 ? 
33 AC2 36 HIS A 467 ? HIS A 467  . ? 4_565 ? 
34 AC2 36 PRO A 468 ? PRO A 468  . ? 4_565 ? 
35 AC2 36 HOH E .   ? HOH A 4060 . ? 1_555 ? 
36 AC2 36 HOH E .   ? HOH A 4068 . ? 1_555 ? 
37 AC2 36 HOH E .   ? HOH A 4069 . ? 1_555 ? 
38 AC2 36 HOH E .   ? HOH A 4072 . ? 1_555 ? 
39 AC2 36 HOH E .   ? HOH A 4126 . ? 1_555 ? 
40 AC2 36 HOH E .   ? HOH A 4138 . ? 1_555 ? 
41 AC3 8  SER A 30  ? SER A 30   . ? 1_555 ? 
42 AC3 8  ALA A 34  ? ALA A 34   . ? 1_555 ? 
43 AC3 8  ARG A 37  ? ARG A 37   . ? 1_555 ? 
44 AC3 8  GLY A 55  ? GLY A 55   . ? 1_555 ? 
45 AC3 8  CYS A 58  ? CYS A 58   . ? 1_555 ? 
46 AC3 8  VAL A 59  ? VAL A 59   . ? 1_555 ? 
47 AC3 8  TYR A 114 ? TYR A 114  . ? 1_555 ? 
48 AC3 8  ARG A 347 ? ARG A 347  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1BWC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BWC 
_atom_sites.fract_transf_matrix[1][1]   0.015552 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006807 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007764 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . VAL A 1 18  ? 16.531 47.625 44.848  1.00 36.58 ? 18   VAL A N     1 
ATOM   2    C  CA    . VAL A 1 18  ? 16.090 47.934 43.446  1.00 37.88 ? 18   VAL A CA    1 
ATOM   3    C  C     . VAL A 1 18  ? 15.701 49.404 43.266  1.00 37.36 ? 18   VAL A C     1 
ATOM   4    O  O     . VAL A 1 18  ? 14.665 49.830 43.776  1.00 39.21 ? 18   VAL A O     1 
ATOM   5    C  CB    . VAL A 1 18  ? 14.861 47.079 43.044  1.00 38.13 ? 18   VAL A CB    1 
ATOM   6    C  CG1   . VAL A 1 18  ? 14.515 47.303 41.562  1.00 37.64 ? 18   VAL A CG1   1 
ATOM   7    C  CG2   . VAL A 1 18  ? 15.136 45.600 43.324  1.00 38.37 ? 18   VAL A CG2   1 
ATOM   8    N  N     . ALA A 1 19  ? 16.506 50.169 42.525  1.00 35.73 ? 19   ALA A N     1 
ATOM   9    C  CA    . ALA A 1 19  ? 16.268 51.608 42.381  1.00 34.39 ? 19   ALA A CA    1 
ATOM   10   C  C     . ALA A 1 19  ? 15.275 51.908 41.253  1.00 33.12 ? 19   ALA A C     1 
ATOM   11   O  O     . ALA A 1 19  ? 15.262 51.206 40.238  1.00 33.26 ? 19   ALA A O     1 
ATOM   12   C  CB    . ALA A 1 19  ? 17.587 52.342 42.134  1.00 33.94 ? 19   ALA A CB    1 
ATOM   13   N  N     . SER A 1 20  ? 14.452 52.944 41.435  1.00 30.87 ? 20   SER A N     1 
ATOM   14   C  CA    . SER A 1 20  ? 13.315 53.206 40.546  1.00 28.87 ? 20   SER A CA    1 
ATOM   15   C  C     . SER A 1 20  ? 13.393 54.569 39.870  1.00 26.62 ? 20   SER A C     1 
ATOM   16   O  O     . SER A 1 20  ? 13.760 55.558 40.503  1.00 25.89 ? 20   SER A O     1 
ATOM   17   C  CB    . SER A 1 20  ? 11.998 53.113 41.313  1.00 28.78 ? 20   SER A CB    1 
ATOM   18   O  OG    . SER A 1 20  ? 11.213 52.046 40.806  1.00 31.95 ? 20   SER A OG    1 
ATOM   19   N  N     . TYR A 1 21  ? 13.034 54.610 38.589  1.00 24.52 ? 21   TYR A N     1 
ATOM   20   C  CA    . TYR A 1 21  ? 13.006 55.850 37.809  1.00 23.16 ? 21   TYR A CA    1 
ATOM   21   C  C     . TYR A 1 21  ? 11.682 55.939 37.054  1.00 22.33 ? 21   TYR A C     1 
ATOM   22   O  O     . TYR A 1 21  ? 10.958 54.946 36.977  1.00 23.84 ? 21   TYR A O     1 
ATOM   23   C  CB    . TYR A 1 21  ? 14.173 55.870 36.818  1.00 21.99 ? 21   TYR A CB    1 
ATOM   24   C  CG    . TYR A 1 21  ? 15.521 55.947 37.487  1.00 21.54 ? 21   TYR A CG    1 
ATOM   25   C  CD1   . TYR A 1 21  ? 16.039 57.170 37.915  1.00 22.22 ? 21   TYR A CD1   1 
ATOM   26   C  CD2   . TYR A 1 21  ? 16.260 54.797 37.737  1.00 21.87 ? 21   TYR A CD2   1 
ATOM   27   C  CE1   . TYR A 1 21  ? 17.260 57.239 38.584  1.00 22.95 ? 21   TYR A CE1   1 
ATOM   28   C  CE2   . TYR A 1 21  ? 17.483 54.857 38.405  1.00 23.23 ? 21   TYR A CE2   1 
ATOM   29   C  CZ    . TYR A 1 21  ? 17.973 56.080 38.827  1.00 23.01 ? 21   TYR A CZ    1 
ATOM   30   O  OH    . TYR A 1 21  ? 19.169 56.143 39.513  1.00 25.85 ? 21   TYR A OH    1 
ATOM   31   N  N     . ASP A 1 22  ? 11.369 57.113 36.500  1.00 21.11 ? 22   ASP A N     1 
ATOM   32   C  CA    . ASP A 1 22  ? 10.315 57.244 35.476  1.00 22.06 ? 22   ASP A CA    1 
ATOM   33   C  C     . ASP A 1 22  ? 10.718 56.637 34.131  1.00 21.66 ? 22   ASP A C     1 
ATOM   34   O  O     . ASP A 1 22  ? 9.868  56.173 33.365  1.00 22.83 ? 22   ASP A O     1 
ATOM   35   C  CB    . ASP A 1 22  ? 9.963  58.717 35.235  1.00 23.80 ? 22   ASP A CB    1 
ATOM   36   C  CG    . ASP A 1 22  ? 9.460  59.427 36.485  1.00 26.72 ? 22   ASP A CG    1 
ATOM   37   O  OD1   . ASP A 1 22  ? 9.080  58.754 37.463  1.00 28.19 ? 22   ASP A OD1   1 
ATOM   38   O  OD2   . ASP A 1 22  ? 9.444  60.673 36.488  1.00 26.64 ? 22   ASP A OD2   1 
ATOM   39   N  N     . TYR A 1 23  ? 12.006 56.720 33.815  1.00 19.67 ? 23   TYR A N     1 
ATOM   40   C  CA    . TYR A 1 23  ? 12.497 56.410 32.478  1.00 17.17 ? 23   TYR A CA    1 
ATOM   41   C  C     . TYR A 1 23  ? 13.905 55.865 32.608  1.00 17.83 ? 23   TYR A C     1 
ATOM   42   O  O     . TYR A 1 23  ? 14.812 56.548 33.076  1.00 16.88 ? 23   TYR A O     1 
ATOM   43   C  CB    . TYR A 1 23  ? 12.513 57.665 31.607  1.00 15.46 ? 23   TYR A CB    1 
ATOM   44   C  CG    . TYR A 1 23  ? 12.536 57.404 30.110  1.00 15.66 ? 23   TYR A CG    1 
ATOM   45   C  CD1   . TYR A 1 23  ? 11.929 56.273 29.562  1.00 14.69 ? 23   TYR A CD1   1 
ATOM   46   C  CD2   . TYR A 1 23  ? 13.102 58.332 29.231  1.00 14.85 ? 23   TYR A CD2   1 
ATOM   47   C  CE1   . TYR A 1 23  ? 11.873 56.077 28.180  1.00 13.90 ? 23   TYR A CE1   1 
ATOM   48   C  CE2   . TYR A 1 23  ? 13.050 58.144 27.849  1.00 13.61 ? 23   TYR A CE2   1 
ATOM   49   C  CZ    . TYR A 1 23  ? 12.431 57.018 27.332  1.00 13.37 ? 23   TYR A CZ    1 
ATOM   50   O  OH    . TYR A 1 23  ? 12.342 56.858 25.969  1.00 13.32 ? 23   TYR A OH    1 
ATOM   51   N  N     . LEU A 1 24  ? 14.064 54.610 32.228  1.00 17.91 ? 24   LEU A N     1 
ATOM   52   C  CA    . LEU A 1 24  ? 15.365 53.977 32.168  1.00 18.70 ? 24   LEU A CA    1 
ATOM   53   C  C     . LEU A 1 24  ? 15.741 53.809 30.692  1.00 18.77 ? 24   LEU A C     1 
ATOM   54   O  O     . LEU A 1 24  ? 14.947 53.312 29.892  1.00 19.83 ? 24   LEU A O     1 
ATOM   55   C  CB    . LEU A 1 24  ? 15.275 52.625 32.865  1.00 18.22 ? 24   LEU A CB    1 
ATOM   56   C  CG    . LEU A 1 24  ? 16.536 51.919 33.332  1.00 20.58 ? 24   LEU A CG    1 
ATOM   57   C  CD1   . LEU A 1 24  ? 17.108 52.635 34.549  1.00 22.97 ? 24   LEU A CD1   1 
ATOM   58   C  CD2   . LEU A 1 24  ? 16.184 50.477 33.669  1.00 20.53 ? 24   LEU A CD2   1 
ATOM   59   N  N     . VAL A 1 25  ? 16.916 54.298 30.323  1.00 17.43 ? 25   VAL A N     1 
ATOM   60   C  CA    . VAL A 1 25  ? 17.377 54.232 28.941  1.00 16.54 ? 25   VAL A CA    1 
ATOM   61   C  C     . VAL A 1 25  ? 18.633 53.371 28.883  1.00 16.39 ? 25   VAL A C     1 
ATOM   62   O  O     . VAL A 1 25  ? 19.621 53.653 29.558  1.00 15.33 ? 25   VAL A O     1 
ATOM   63   C  CB    . VAL A 1 25  ? 17.713 55.642 28.370  1.00 17.68 ? 25   VAL A CB    1 
ATOM   64   C  CG1   . VAL A 1 25  ? 18.358 55.516 26.990  1.00 17.03 ? 25   VAL A CG1   1 
ATOM   65   C  CG2   . VAL A 1 25  ? 16.453 56.518 28.301  1.00 17.04 ? 25   VAL A CG2   1 
ATOM   66   N  N     . ILE A 1 26  ? 18.583 52.313 28.083  1.00 15.73 ? 26   ILE A N     1 
ATOM   67   C  CA    . ILE A 1 26  ? 19.753 51.477 27.865  1.00 16.34 ? 26   ILE A CA    1 
ATOM   68   C  C     . ILE A 1 26  ? 20.517 51.881 26.609  1.00 16.70 ? 26   ILE A C     1 
ATOM   69   O  O     . ILE A 1 26  ? 20.051 51.663 25.486  1.00 17.19 ? 26   ILE A O     1 
ATOM   70   C  CB    . ILE A 1 26  ? 19.385 49.989 27.797  1.00 16.52 ? 26   ILE A CB    1 
ATOM   71   C  CG1   . ILE A 1 26  ? 18.430 49.636 28.941  1.00 16.92 ? 26   ILE A CG1   1 
ATOM   72   C  CG2   . ILE A 1 26  ? 20.655 49.141 27.866  1.00 14.49 ? 26   ILE A CG2   1 
ATOM   73   C  CD1   . ILE A 1 26  ? 18.019 48.173 28.967  1.00 18.84 ? 26   ILE A CD1   1 
ATOM   74   N  N     . GLY A 1 27  ? 21.690 52.473 26.821  1.00 15.55 ? 27   GLY A N     1 
ATOM   75   C  CA    . GLY A 1 27  ? 22.500 52.967 25.731  1.00 14.75 ? 27   GLY A CA    1 
ATOM   76   C  C     . GLY A 1 27  ? 22.525 54.475 25.690  1.00 15.27 ? 27   GLY A C     1 
ATOM   77   O  O     . GLY A 1 27  ? 21.500 55.119 25.492  1.00 16.32 ? 27   GLY A O     1 
ATOM   78   N  N     . GLY A 1 28  ? 23.710 55.044 25.862  1.00 15.15 ? 28   GLY A N     1 
ATOM   79   C  CA    . GLY A 1 28  ? 23.856 56.482 25.794  1.00 14.60 ? 28   GLY A CA    1 
ATOM   80   C  C     . GLY A 1 28  ? 24.455 56.964 24.491  1.00 14.81 ? 28   GLY A C     1 
ATOM   81   O  O     . GLY A 1 28  ? 25.329 57.824 24.503  1.00 13.97 ? 28   GLY A O     1 
ATOM   82   N  N     . GLY A 1 29  ? 23.975 56.427 23.371  1.00 15.38 ? 29   GLY A N     1 
ATOM   83   C  CA    . GLY A 1 29  ? 24.304 56.980 22.066  1.00 13.24 ? 29   GLY A CA    1 
ATOM   84   C  C     . GLY A 1 29  ? 23.251 57.948 21.555  1.00 14.41 ? 29   GLY A C     1 
ATOM   85   O  O     . GLY A 1 29  ? 22.569 58.598 22.346  1.00 14.00 ? 29   GLY A O     1 
ATOM   86   N  N     . SER A 1 30  ? 23.115 58.043 20.235  1.00 13.47 ? 30   SER A N     1 
ATOM   87   C  CA    . SER A 1 30  ? 22.317 59.096 19.607  1.00 13.28 ? 30   SER A CA    1 
ATOM   88   C  C     . SER A 1 30  ? 20.864 59.071 20.057  1.00 12.50 ? 30   SER A C     1 
ATOM   89   O  O     . SER A 1 30  ? 20.338 60.078 20.524  1.00 13.47 ? 30   SER A O     1 
ATOM   90   C  CB    . SER A 1 30  ? 22.375 58.962 18.092  1.00 12.30 ? 30   SER A CB    1 
ATOM   91   O  OG    . SER A 1 30  ? 23.680 59.239 17.622  1.00 16.08 ? 30   SER A OG    1 
ATOM   92   N  N     . GLY A 1 31  ? 20.227 57.911 19.917  1.00 12.52 ? 31   GLY A N     1 
ATOM   93   C  CA    . GLY A 1 31  ? 18.828 57.762 20.276  1.00 12.82 ? 31   GLY A CA    1 
ATOM   94   C  C     . GLY A 1 31  ? 18.590 57.845 21.774  1.00 13.39 ? 31   GLY A C     1 
ATOM   95   O  O     . GLY A 1 31  ? 17.646 58.479 22.220  1.00 11.25 ? 31   GLY A O     1 
ATOM   96   N  N     . GLY A 1 32  ? 19.479 57.230 22.545  1.00 11.88 ? 32   GLY A N     1 
ATOM   97   C  CA    . GLY A 1 32  ? 19.302 57.165 23.982  1.00 13.35 ? 32   GLY A CA    1 
ATOM   98   C  C     . GLY A 1 32  ? 19.404 58.530 24.631  1.00 14.74 ? 32   GLY A C     1 
ATOM   99   O  O     . GLY A 1 32  ? 18.520 58.928 25.387  1.00 14.04 ? 32   GLY A O     1 
ATOM   100  N  N     . LEU A 1 33  ? 20.471 59.258 24.315  1.00 13.80 ? 33   LEU A N     1 
ATOM   101  C  CA    . LEU A 1 33  ? 20.671 60.594 24.861  1.00 14.11 ? 33   LEU A CA    1 
ATOM   102  C  C     . LEU A 1 33  ? 19.584 61.563 24.423  1.00 14.63 ? 33   LEU A C     1 
ATOM   103  O  O     . LEU A 1 33  ? 19.115 62.364 25.220  1.00 16.24 ? 33   LEU A O     1 
ATOM   104  C  CB    . LEU A 1 33  ? 22.046 61.139 24.479  1.00 14.20 ? 33   LEU A CB    1 
ATOM   105  C  CG    . LEU A 1 33  ? 23.223 60.313 24.998  1.00 14.02 ? 33   LEU A CG    1 
ATOM   106  C  CD1   . LEU A 1 33  ? 24.529 60.920 24.517  1.00 15.53 ? 33   LEU A CD1   1 
ATOM   107  C  CD2   . LEU A 1 33  ? 23.198 60.247 26.515  1.00 11.00 ? 33   LEU A CD2   1 
ATOM   108  N  N     . ALA A 1 34  ? 19.166 61.472 23.167  1.00 15.61 ? 34   ALA A N     1 
ATOM   109  C  CA    . ALA A 1 34  ? 18.104 62.329 22.658  1.00 15.51 ? 34   ALA A CA    1 
ATOM   110  C  C     . ALA A 1 34  ? 16.828 62.161 23.480  1.00 16.09 ? 34   ALA A C     1 
ATOM   111  O  O     . ALA A 1 34  ? 16.137 63.137 23.778  1.00 17.53 ? 34   ALA A O     1 
ATOM   112  C  CB    . ALA A 1 34  ? 17.840 62.032 21.194  1.00 13.20 ? 34   ALA A CB    1 
ATOM   113  N  N     . SER A 1 35  ? 16.538 60.923 23.869  1.00 16.34 ? 35   SER A N     1 
ATOM   114  C  CA    . SER A 1 35  ? 15.248 60.587 24.452  1.00 15.07 ? 35   SER A CA    1 
ATOM   115  C  C     . SER A 1 35  ? 15.252 60.839 25.954  1.00 15.46 ? 35   SER A C     1 
ATOM   116  O  O     . SER A 1 35  ? 14.297 61.385 26.501  1.00 15.76 ? 35   SER A O     1 
ATOM   117  C  CB    . SER A 1 35  ? 14.911 59.128 24.169  1.00 14.40 ? 35   SER A CB    1 
ATOM   118  O  OG    . SER A 1 35  ? 13.515 58.947 24.078  1.00 15.90 ? 35   SER A OG    1 
ATOM   119  N  N     . ALA A 1 36  ? 16.339 60.450 26.609  1.00 14.85 ? 36   ALA A N     1 
ATOM   120  C  CA    . ALA A 1 36  ? 16.619 60.849 27.987  1.00 15.82 ? 36   ALA A CA    1 
ATOM   121  C  C     . ALA A 1 36  ? 16.472 62.351 28.230  1.00 16.54 ? 36   ALA A C     1 
ATOM   122  O  O     . ALA A 1 36  ? 15.815 62.757 29.189  1.00 16.61 ? 36   ALA A O     1 
ATOM   123  C  CB    . ALA A 1 36  ? 18.018 60.380 28.407  1.00 17.39 ? 36   ALA A CB    1 
ATOM   124  N  N     . ARG A 1 37  ? 17.066 63.161 27.352  1.00 17.49 ? 37   ARG A N     1 
ATOM   125  C  CA    . ARG A 1 37  ? 17.071 64.621 27.498  1.00 19.15 ? 37   ARG A CA    1 
ATOM   126  C  C     . ARG A 1 37  ? 15.678 65.231 27.392  1.00 18.94 ? 37   ARG A C     1 
ATOM   127  O  O     . ARG A 1 37  ? 15.275 66.022 28.244  1.00 18.63 ? 37   ARG A O     1 
ATOM   128  C  CB    . ARG A 1 37  ? 17.977 65.268 26.450  1.00 21.67 ? 37   ARG A CB    1 
ATOM   129  C  CG    . ARG A 1 37  ? 19.437 64.971 26.640  1.00 27.81 ? 37   ARG A CG    1 
ATOM   130  C  CD    . ARG A 1 37  ? 20.287 66.102 26.136  1.00 33.20 ? 37   ARG A CD    1 
ATOM   131  N  NE    . ARG A 1 37  ? 20.899 66.821 27.255  1.00 37.61 ? 37   ARG A NE    1 
ATOM   132  C  CZ    . ARG A 1 37  ? 20.713 68.116 27.497  1.00 39.29 ? 37   ARG A CZ    1 
ATOM   133  N  NH1   . ARG A 1 37  ? 20.062 68.498 28.595  1.00 39.64 ? 37   ARG A NH1   1 
ATOM   134  N  NH2   . ARG A 1 37  ? 21.166 69.026 26.636  1.00 38.99 ? 37   ARG A NH2   1 
ATOM   135  N  N     . ARG A 1 38  ? 14.953 64.855 26.339  1.00 18.78 ? 38   ARG A N     1 
ATOM   136  C  CA    . ARG A 1 38  ? 13.613 65.361 26.098  1.00 18.95 ? 38   ARG A CA    1 
ATOM   137  C  C     . ARG A 1 38  ? 12.688 64.975 27.250  1.00 18.91 ? 38   ARG A C     1 
ATOM   138  O  O     . ARG A 1 38  ? 11.936 65.802 27.749  1.00 19.01 ? 38   ARG A O     1 
ATOM   139  C  CB    . ARG A 1 38  ? 13.082 64.829 24.765  1.00 18.29 ? 38   ARG A CB    1 
ATOM   140  C  CG    . ARG A 1 38  ? 11.790 65.480 24.282  1.00 19.24 ? 38   ARG A CG    1 
ATOM   141  C  CD    . ARG A 1 38  ? 11.853 67.023 24.273  1.00 22.64 ? 38   ARG A CD    1 
ATOM   142  N  NE    . ARG A 1 38  ? 13.002 67.576 23.544  1.00 25.50 ? 38   ARG A NE    1 
ATOM   143  C  CZ    . ARG A 1 38  ? 13.000 67.895 22.248  1.00 26.82 ? 38   ARG A CZ    1 
ATOM   144  N  NH1   . ARG A 1 38  ? 11.928 67.678 21.492  1.00 26.89 ? 38   ARG A NH1   1 
ATOM   145  N  NH2   . ARG A 1 38  ? 14.082 68.429 21.697  1.00 27.94 ? 38   ARG A NH2   1 
ATOM   146  N  N     . ALA A 1 39  ? 12.787 63.731 27.703  1.00 19.82 ? 39   ALA A N     1 
ATOM   147  C  CA    . ALA A 1 39  ? 11.981 63.256 28.823  1.00 20.58 ? 39   ALA A CA    1 
ATOM   148  C  C     . ALA A 1 39  ? 12.257 64.047 30.104  1.00 22.28 ? 39   ALA A C     1 
ATOM   149  O  O     . ALA A 1 39  ? 11.332 64.351 30.865  1.00 21.82 ? 39   ALA A O     1 
ATOM   150  C  CB    . ALA A 1 39  ? 12.234 61.770 29.061  1.00 18.29 ? 39   ALA A CB    1 
ATOM   151  N  N     . ALA A 1 40  ? 13.529 64.367 30.346  1.00 23.08 ? 40   ALA A N     1 
ATOM   152  C  CA    . ALA A 1 40  ? 13.899 65.206 31.484  1.00 24.54 ? 40   ALA A CA    1 
ATOM   153  C  C     . ALA A 1 40  ? 13.274 66.602 31.380  1.00 25.25 ? 40   ALA A C     1 
ATOM   154  O  O     . ALA A 1 40  ? 12.640 67.078 32.326  1.00 26.30 ? 40   ALA A O     1 
ATOM   155  C  CB    . ALA A 1 40  ? 15.418 65.304 31.605  1.00 23.22 ? 40   ALA A CB    1 
ATOM   156  N  N     . GLU A 1 41  ? 13.425 67.232 30.217  1.00 25.91 ? 41   GLU A N     1 
ATOM   157  C  CA    . GLU A 1 41  ? 12.704 68.464 29.890  1.00 27.33 ? 41   GLU A CA    1 
ATOM   158  C  C     . GLU A 1 41  ? 11.220 68.407 30.230  1.00 27.20 ? 41   GLU A C     1 
ATOM   159  O  O     . GLU A 1 41  ? 10.667 69.372 30.748  1.00 27.63 ? 41   GLU A O     1 
ATOM   160  C  CB    . GLU A 1 41  ? 12.836 68.792 28.407  1.00 29.72 ? 41   GLU A CB    1 
ATOM   161  C  CG    . GLU A 1 41  ? 14.152 69.417 28.003  1.00 34.53 ? 41   GLU A CG    1 
ATOM   162  C  CD    . GLU A 1 41  ? 14.128 69.915 26.562  1.00 39.18 ? 41   GLU A CD    1 
ATOM   163  O  OE1   . GLU A 1 41  ? 13.020 70.247 26.051  1.00 41.85 ? 41   GLU A OE1   1 
ATOM   164  O  OE2   . GLU A 1 41  ? 15.217 69.983 25.936  1.00 40.33 ? 41   GLU A OE2   1 
ATOM   165  N  N     . LEU A 1 42  ? 10.581 67.285 29.904  1.00 26.28 ? 42   LEU A N     1 
ATOM   166  C  CA    . LEU A 1 42  ? 9.150  67.102 30.133  1.00 25.91 ? 42   LEU A CA    1 
ATOM   167  C  C     . LEU A 1 42  ? 8.863  66.669 31.565  1.00 25.39 ? 42   LEU A C     1 
ATOM   168  O  O     . LEU A 1 42  ? 7.716  66.499 31.941  1.00 25.85 ? 42   LEU A O     1 
ATOM   169  C  CB    . LEU A 1 42  ? 8.583  66.071 29.155  1.00 24.58 ? 42   LEU A CB    1 
ATOM   170  C  CG    . LEU A 1 42  ? 8.679  66.460 27.678  1.00 25.53 ? 42   LEU A CG    1 
ATOM   171  C  CD1   . LEU A 1 42  ? 8.328  65.262 26.815  1.00 26.26 ? 42   LEU A CD1   1 
ATOM   172  C  CD2   . LEU A 1 42  ? 7.750  67.638 27.379  1.00 25.57 ? 42   LEU A CD2   1 
ATOM   173  N  N     . GLY A 1 43  ? 9.908  66.497 32.363  1.00 25.78 ? 43   GLY A N     1 
ATOM   174  C  CA    . GLY A 1 43  ? 9.731  66.448 33.802  1.00 25.67 ? 43   GLY A CA    1 
ATOM   175  C  C     . GLY A 1 43  ? 9.821  65.041 34.361  1.00 25.80 ? 43   GLY A C     1 
ATOM   176  O  O     . GLY A 1 43  ? 9.451  64.807 35.515  1.00 26.31 ? 43   GLY A O     1 
ATOM   177  N  N     . ALA A 1 44  ? 10.323 64.104 33.556  1.00 25.60 ? 44   ALA A N     1 
ATOM   178  C  CA    . ALA A 1 44  ? 10.572 62.737 34.026  1.00 23.96 ? 44   ALA A CA    1 
ATOM   179  C  C     . ALA A 1 44  ? 11.896 62.610 34.763  1.00 23.21 ? 44   ALA A C     1 
ATOM   180  O  O     . ALA A 1 44  ? 12.817 63.395 34.555  1.00 22.26 ? 44   ALA A O     1 
ATOM   181  C  CB    . ALA A 1 44  ? 10.534 61.763 32.874  1.00 23.17 ? 44   ALA A CB    1 
ATOM   182  N  N     . ARG A 1 45  ? 11.980 61.595 35.608  1.00 22.62 ? 45   ARG A N     1 
ATOM   183  C  CA    . ARG A 1 45  ? 13.204 61.254 36.313  1.00 23.35 ? 45   ARG A CA    1 
ATOM   184  C  C     . ARG A 1 45  ? 13.874 60.132 35.543  1.00 22.27 ? 45   ARG A C     1 
ATOM   185  O  O     . ARG A 1 45  ? 13.361 59.014 35.497  1.00 21.78 ? 45   ARG A O     1 
ATOM   186  C  CB    . ARG A 1 45  ? 12.863 60.767 37.720  1.00 26.09 ? 45   ARG A CB    1 
ATOM   187  C  CG    . ARG A 1 45  ? 13.802 61.244 38.801  1.00 30.56 ? 45   ARG A CG    1 
ATOM   188  C  CD    . ARG A 1 45  ? 13.437 60.584 40.134  1.00 34.74 ? 45   ARG A CD    1 
ATOM   189  N  NE    . ARG A 1 45  ? 14.623 60.288 40.946  1.00 38.31 ? 45   ARG A NE    1 
ATOM   190  C  CZ    . ARG A 1 45  ? 15.142 59.068 41.111  1.00 40.70 ? 45   ARG A CZ    1 
ATOM   191  N  NH1   . ARG A 1 45  ? 14.348 57.992 41.113  1.00 39.93 ? 45   ARG A NH1   1 
ATOM   192  N  NH2   . ARG A 1 45  ? 16.461 58.922 41.284  1.00 39.79 ? 45   ARG A NH2   1 
ATOM   193  N  N     . ALA A 1 46  ? 14.980 60.449 34.882  1.00 21.02 ? 46   ALA A N     1 
ATOM   194  C  CA    . ALA A 1 46  ? 15.522 59.572 33.850  1.00 20.83 ? 46   ALA A CA    1 
ATOM   195  C  C     . ALA A 1 46  ? 16.913 59.105 34.254  1.00 20.51 ? 46   ALA A C     1 
ATOM   196  O  O     . ALA A 1 46  ? 17.641 59.825 34.946  1.00 20.36 ? 46   ALA A O     1 
ATOM   197  C  CB    . ALA A 1 46  ? 15.569 60.295 32.500  1.00 20.55 ? 46   ALA A CB    1 
ATOM   198  N  N     . ALA A 1 47  ? 17.259 57.884 33.849  1.00 19.65 ? 47   ALA A N     1 
ATOM   199  C  CA    . ALA A 1 47  ? 18.622 57.380 33.951  1.00 18.23 ? 47   ALA A CA    1 
ATOM   200  C  C     . ALA A 1 47  ? 19.066 56.789 32.622  1.00 17.66 ? 47   ALA A C     1 
ATOM   201  O  O     . ALA A 1 47  ? 18.258 56.206 31.893  1.00 17.18 ? 47   ALA A O     1 
ATOM   202  C  CB    . ALA A 1 47  ? 18.726 56.339 35.054  1.00 16.88 ? 47   ALA A CB    1 
ATOM   203  N  N     . VAL A 1 48  ? 20.343 56.982 32.303  1.00 16.32 ? 48   VAL A N     1 
ATOM   204  C  CA    . VAL A 1 48  ? 20.962 56.391 31.126  1.00 15.21 ? 48   VAL A CA    1 
ATOM   205  C  C     . VAL A 1 48  ? 22.022 55.396 31.563  1.00 13.82 ? 48   VAL A C     1 
ATOM   206  O  O     . VAL A 1 48  ? 22.915 55.729 32.338  1.00 14.02 ? 48   VAL A O     1 
ATOM   207  C  CB    . VAL A 1 48  ? 21.624 57.473 30.245  1.00 15.63 ? 48   VAL A CB    1 
ATOM   208  C  CG1   . VAL A 1 48  ? 22.261 56.853 29.019  1.00 16.87 ? 48   VAL A CG1   1 
ATOM   209  C  CG2   . VAL A 1 48  ? 20.609 58.507 29.834  1.00 15.22 ? 48   VAL A CG2   1 
ATOM   210  N  N     . VAL A 1 49  ? 21.926 54.179 31.047  1.00 12.38 ? 49   VAL A N     1 
ATOM   211  C  CA    . VAL A 1 49  ? 22.948 53.163 31.255  1.00 11.25 ? 49   VAL A CA    1 
ATOM   212  C  C     . VAL A 1 49  ? 23.907 53.149 30.071  1.00 12.49 ? 49   VAL A C     1 
ATOM   213  O  O     . VAL A 1 49  ? 23.472 53.032 28.937  1.00 13.69 ? 49   VAL A O     1 
ATOM   214  C  CB    . VAL A 1 49  ? 22.316 51.761 31.387  1.00 11.33 ? 49   VAL A CB    1 
ATOM   215  C  CG1   . VAL A 1 49  ? 23.338 50.782 31.927  1.00 9.43  ? 49   VAL A CG1   1 
ATOM   216  C  CG2   . VAL A 1 49  ? 21.078 51.805 32.282  1.00 7.84  ? 49   VAL A CG2   1 
ATOM   217  N  N     . GLU A 1 50  ? 25.204 53.264 30.331  1.00 11.56 ? 50   GLU A N     1 
ATOM   218  C  CA    . GLU A 1 50  ? 26.192 53.241 29.264  1.00 11.91 ? 50   GLU A CA    1 
ATOM   219  C  C     . GLU A 1 50  ? 27.422 52.418 29.652  1.00 13.89 ? 50   GLU A C     1 
ATOM   220  O  O     . GLU A 1 50  ? 28.020 52.645 30.695  1.00 12.64 ? 50   GLU A O     1 
ATOM   221  C  CB    . GLU A 1 50  ? 26.594 54.672 28.904  1.00 11.11 ? 50   GLU A CB    1 
ATOM   222  C  CG    . GLU A 1 50  ? 27.723 54.793 27.896  1.00 11.49 ? 50   GLU A CG    1 
ATOM   223  C  CD    . GLU A 1 50  ? 27.430 54.094 26.586  1.00 12.05 ? 50   GLU A CD    1 
ATOM   224  O  OE1   . GLU A 1 50  ? 26.464 54.473 25.907  1.00 11.85 ? 50   GLU A OE1   1 
ATOM   225  O  OE2   . GLU A 1 50  ? 28.174 53.166 26.224  1.00 14.50 ? 50   GLU A OE2   1 
ATOM   226  N  N     . SER A 1 51  ? 27.791 51.463 28.798  1.00 15.82 ? 51   SER A N     1 
ATOM   227  C  CA    . SER A 1 51  ? 28.875 50.523 29.097  1.00 16.36 ? 51   SER A CA    1 
ATOM   228  C  C     . SER A 1 51  ? 30.237 51.008 28.601  1.00 16.94 ? 51   SER A C     1 
ATOM   229  O  O     . SER A 1 51  ? 31.270 50.486 29.008  1.00 17.17 ? 51   SER A O     1 
ATOM   230  C  CB    . SER A 1 51  ? 28.574 49.156 28.489  1.00 16.06 ? 51   SER A CB    1 
ATOM   231  O  OG    . SER A 1 51  ? 28.410 49.247 27.088  1.00 17.03 ? 51   SER A OG    1 
ATOM   232  N  N     . HIS A 1 52  ? 30.237 51.985 27.701  1.00 18.05 ? 52   HIS A N     1 
ATOM   233  C  CA    . HIS A 1 52  ? 31.478 52.483 27.117  1.00 18.90 ? 52   HIS A CA    1 
ATOM   234  C  C     . HIS A 1 52  ? 31.528 53.989 27.257  1.00 18.25 ? 52   HIS A C     1 
ATOM   235  O  O     . HIS A 1 52  ? 31.602 54.481 28.380  1.00 19.29 ? 52   HIS A O     1 
ATOM   236  C  CB    . HIS A 1 52  ? 31.610 52.032 25.660  1.00 23.39 ? 52   HIS A CB    1 
ATOM   237  C  CG    . HIS A 1 52  ? 31.611 50.541 25.503  1.00 28.53 ? 52   HIS A CG    1 
ATOM   238  N  ND1   . HIS A 1 52  ? 32.766 49.789 25.525  1.00 31.28 ? 52   HIS A ND1   1 
ATOM   239  C  CD2   . HIS A 1 52  ? 30.588 49.653 25.457  1.00 30.57 ? 52   HIS A CD2   1 
ATOM   240  C  CE1   . HIS A 1 52  ? 32.458 48.504 25.512  1.00 32.32 ? 52   HIS A CE1   1 
ATOM   241  N  NE2   . HIS A 1 52  ? 31.140 48.393 25.474  1.00 32.03 ? 52   HIS A NE2   1 
ATOM   242  N  N     . LYS A 1 53  ? 31.463 54.728 26.151  1.00 16.91 ? 53   LYS A N     1 
ATOM   243  C  CA    . LYS A 1 53  ? 31.481 56.186 26.233  1.00 15.08 ? 53   LYS A CA    1 
ATOM   244  C  C     . LYS A 1 53  ? 30.193 56.818 25.750  1.00 15.23 ? 53   LYS A C     1 
ATOM   245  O  O     . LYS A 1 53  ? 29.573 56.335 24.797  1.00 16.72 ? 53   LYS A O     1 
ATOM   246  C  CB    . LYS A 1 53  ? 32.655 56.755 25.447  1.00 14.79 ? 53   LYS A CB    1 
ATOM   247  C  CG    . LYS A 1 53  ? 33.924 56.828 26.254  1.00 13.92 ? 53   LYS A CG    1 
ATOM   248  C  CD    . LYS A 1 53  ? 35.128 56.587 25.394  1.00 14.33 ? 53   LYS A CD    1 
ATOM   249  C  CE    . LYS A 1 53  ? 36.371 56.514 26.248  1.00 15.13 ? 53   LYS A CE    1 
ATOM   250  N  NZ    . LYS A 1 53  ? 37.420 57.452 25.787  1.00 15.39 ? 53   LYS A NZ    1 
ATOM   251  N  N     . LEU A 1 54  ? 29.814 57.923 26.387  1.00 13.80 ? 54   LEU A N     1 
ATOM   252  C  CA    . LEU A 1 54  ? 28.646 58.693 25.983  1.00 13.72 ? 54   LEU A CA    1 
ATOM   253  C  C     . LEU A 1 54  ? 28.786 59.302 24.589  1.00 14.74 ? 54   LEU A C     1 
ATOM   254  O  O     . LEU A 1 54  ? 29.875 59.730 24.180  1.00 13.61 ? 54   LEU A O     1 
ATOM   255  C  CB    . LEU A 1 54  ? 28.347 59.795 26.999  1.00 13.70 ? 54   LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 54  ? 28.120 59.352 28.447  1.00 14.80 ? 54   LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 54  ? 28.223 60.553 29.357  1.00 11.79 ? 54   LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 54  ? 26.774 58.664 28.598  1.00 13.18 ? 54   LEU A CD2   1 
ATOM   259  N  N     . GLY A 1 55  ? 27.664 59.344 23.876  1.00 13.55 ? 55   GLY A N     1 
ATOM   260  C  CA    . GLY A 1 55  ? 27.678 59.749 22.484  1.00 13.69 ? 55   GLY A CA    1 
ATOM   261  C  C     . GLY A 1 55  ? 27.660 58.593 21.503  1.00 14.04 ? 55   GLY A C     1 
ATOM   262  O  O     . GLY A 1 55  ? 27.337 58.782 20.334  1.00 12.25 ? 55   GLY A O     1 
ATOM   263  N  N     . GLY A 1 56  ? 28.019 57.401 21.977  1.00 14.15 ? 56   GLY A N     1 
ATOM   264  C  CA    . GLY A 1 56  ? 27.799 56.191 21.206  1.00 14.54 ? 56   GLY A CA    1 
ATOM   265  C  C     . GLY A 1 56  ? 28.587 56.138 19.909  1.00 15.70 ? 56   GLY A C     1 
ATOM   266  O  O     . GLY A 1 56  ? 29.755 56.518 19.865  1.00 15.22 ? 56   GLY A O     1 
ATOM   267  N  N     . THR A 1 57  ? 27.939 55.664 18.851  1.00 16.92 ? 57   THR A N     1 
ATOM   268  C  CA    . THR A 1 57  ? 28.618 55.398 17.593  1.00 19.35 ? 57   THR A CA    1 
ATOM   269  C  C     . THR A 1 57  ? 28.916 56.681 16.813  1.00 19.54 ? 57   THR A C     1 
ATOM   270  O  O     . THR A 1 57  ? 30.033 56.850 16.310  1.00 20.30 ? 57   THR A O     1 
ATOM   271  C  CB    . THR A 1 57  ? 27.816 54.397 16.721  1.00 19.71 ? 57   THR A CB    1 
ATOM   272  O  OG1   . THR A 1 57  ? 27.828 53.115 17.360  1.00 21.79 ? 57   THR A OG1   1 
ATOM   273  C  CG2   . THR A 1 57  ? 28.441 54.246 15.344  1.00 18.56 ? 57   THR A CG2   1 
ATOM   274  N  N     . CYS A 1 58  ? 27.952 57.600 16.760  1.00 18.83 ? 58   CYS A N     1 
ATOM   275  C  CA    . CYS A 1 58  ? 28.165 58.854 16.052  1.00 20.45 ? 58   CYS A CA    1 
ATOM   276  C  C     . CYS A 1 58  ? 29.371 59.619 16.593  1.00 19.76 ? 58   CYS A C     1 
ATOM   277  O  O     . CYS A 1 58  ? 30.247 59.978 15.814  1.00 20.89 ? 58   CYS A O     1 
ATOM   278  C  CB    A CYS A 1 58  ? 26.917 59.726 16.058  0.22 16.77 ? 58   CYS A CB    1 
ATOM   279  C  CB    B CYS A 1 58  ? 26.872 59.710 16.082  0.80 28.33 ? 58   CYS A CB    1 
ATOM   280  S  SG    A CYS A 1 58  ? 26.810 60.829 14.607  0.22 13.30 ? 58   CYS A SG    1 
ATOM   281  S  SG    B CYS A 1 58  ? 26.955 61.525 16.475  0.80 33.65 ? 58   CYS A SG    1 
ATOM   282  N  N     . VAL A 1 59  ? 29.481 59.747 17.915  1.00 17.14 ? 59   VAL A N     1 
ATOM   283  C  CA    . VAL A 1 59  ? 30.597 60.472 18.533  1.00 15.41 ? 59   VAL A CA    1 
ATOM   284  C  C     . VAL A 1 59  ? 31.931 59.744 18.475  1.00 15.47 ? 59   VAL A C     1 
ATOM   285  O  O     . VAL A 1 59  ? 32.957 60.356 18.196  1.00 15.76 ? 59   VAL A O     1 
ATOM   286  C  CB    . VAL A 1 59  ? 30.302 60.840 19.998  1.00 15.86 ? 59   VAL A CB    1 
ATOM   287  C  CG1   . VAL A 1 59  ? 31.519 61.481 20.637  1.00 14.73 ? 59   VAL A CG1   1 
ATOM   288  C  CG2   . VAL A 1 59  ? 29.115 61.800 20.064  1.00 18.95 ? 59   VAL A CG2   1 
ATOM   289  N  N     . ASN A 1 60  ? 31.928 58.444 18.747  1.00 14.76 ? 60   ASN A N     1 
ATOM   290  C  CA    . ASN A 1 60  ? 33.161 57.751 19.073  1.00 14.49 ? 60   ASN A CA    1 
ATOM   291  C  C     . ASN A 1 60  ? 33.817 57.035 17.900  1.00 15.87 ? 60   ASN A C     1 
ATOM   292  O  O     . ASN A 1 60  ? 35.032 57.110 17.738  1.00 17.03 ? 60   ASN A O     1 
ATOM   293  C  CB    . ASN A 1 60  ? 32.926 56.795 20.223  1.00 13.32 ? 60   ASN A CB    1 
ATOM   294  C  CG    . ASN A 1 60  ? 32.647 57.519 21.513  1.00 14.63 ? 60   ASN A CG    1 
ATOM   295  O  OD1   . ASN A 1 60  ? 33.543 58.144 22.092  1.00 13.99 ? 60   ASN A OD1   1 
ATOM   296  N  ND2   . ASN A 1 60  ? 31.396 57.479 21.955  1.00 11.63 ? 60   ASN A ND2   1 
ATOM   297  N  N     . VAL A 1 61  ? 33.030 56.337 17.087  1.00 16.81 ? 61   VAL A N     1 
ATOM   298  C  CA    . VAL A 1 61  ? 33.583 55.463 16.049  1.00 17.58 ? 61   VAL A CA    1 
ATOM   299  C  C     . VAL A 1 61  ? 32.830 55.638 14.741  1.00 18.39 ? 61   VAL A C     1 
ATOM   300  O  O     . VAL A 1 61  ? 32.677 54.696 13.961  1.00 19.80 ? 61   VAL A O     1 
ATOM   301  C  CB    . VAL A 1 61  ? 33.519 53.968 16.445  1.00 17.15 ? 61   VAL A CB    1 
ATOM   302  C  CG1   . VAL A 1 61  ? 34.654 53.620 17.401  1.00 16.22 ? 61   VAL A CG1   1 
ATOM   303  C  CG2   . VAL A 1 61  ? 32.163 53.641 17.055  1.00 17.64 ? 61   VAL A CG2   1 
ATOM   304  N  N     . GLY A 1 62  ? 32.335 56.844 14.511  1.00 18.85 ? 62   GLY A N     1 
ATOM   305  C  CA    . GLY A 1 62  ? 31.297 57.016 13.521  1.00 15.97 ? 62   GLY A CA    1 
ATOM   306  C  C     . GLY A 1 62  ? 31.377 58.411 12.972  1.00 16.28 ? 62   GLY A C     1 
ATOM   307  O  O     . GLY A 1 62  ? 32.448 58.878 12.561  1.00 14.65 ? 62   GLY A O     1 
ATOM   308  N  N     . CYS A 1 63  ? 30.242 59.094 13.007  1.00 14.75 ? 63   CYS A N     1 
ATOM   309  C  CA    . CYS A 1 63  ? 30.009 60.170 12.078  1.00 16.12 ? 63   CYS A CA    1 
ATOM   310  C  C     . CYS A 1 63  ? 30.978 61.329 12.357  1.00 15.81 ? 63   CYS A C     1 
ATOM   311  O  O     . CYS A 1 63  ? 31.475 61.958 11.428  1.00 16.90 ? 63   CYS A O     1 
ATOM   312  C  CB    A CYS A 1 63  ? 28.565 60.688 12.153  0.48 13.04 ? 63   CYS A CB    1 
ATOM   313  C  CB    B CYS A 1 63  ? 28.547 60.598 12.164  0.63 18.81 ? 63   CYS A CB    1 
ATOM   314  S  SG    A CYS A 1 63  ? 27.338 59.664 13.030  0.48 6.39  ? 63   CYS A SG    1 
ATOM   315  S  SG    B CYS A 1 63  ? 28.324 62.119 13.020  0.63 31.67 ? 63   CYS A SG    1 
ATOM   316  N  N     . VAL A 1 64  ? 31.300 61.557 13.628  1.00 15.02 ? 64   VAL A N     1 
ATOM   317  C  CA    . VAL A 1 64  ? 32.171 62.665 14.012  1.00 14.86 ? 64   VAL A CA    1 
ATOM   318  C  C     . VAL A 1 64  ? 33.649 62.461 13.651  1.00 14.02 ? 64   VAL A C     1 
ATOM   319  O  O     . VAL A 1 64  ? 34.222 63.309 12.980  1.00 14.63 ? 64   VAL A O     1 
ATOM   320  C  CB    . VAL A 1 64  ? 32.018 63.037 15.517  1.00 16.07 ? 64   VAL A CB    1 
ATOM   321  C  CG1   . VAL A 1 64  ? 33.128 63.987 15.953  1.00 17.51 ? 64   VAL A CG1   1 
ATOM   322  C  CG2   . VAL A 1 64  ? 30.660 63.676 15.769  1.00 14.93 ? 64   VAL A CG2   1 
ATOM   323  N  N     . PRO A 1 65  ? 34.282 61.337 14.077  1.00 14.51 ? 65   PRO A N     1 
ATOM   324  C  CA    . PRO A 1 65  ? 35.645 61.061 13.588  1.00 13.70 ? 65   PRO A CA    1 
ATOM   325  C  C     . PRO A 1 65  ? 35.734 60.877 12.067  1.00 13.33 ? 65   PRO A C     1 
ATOM   326  O  O     . PRO A 1 65  ? 36.694 61.319 11.439  1.00 11.50 ? 65   PRO A O     1 
ATOM   327  C  CB    . PRO A 1 65  ? 36.057 59.784 14.338  1.00 13.42 ? 65   PRO A CB    1 
ATOM   328  C  CG    . PRO A 1 65  ? 34.798 59.194 14.833  1.00 12.97 ? 65   PRO A CG    1 
ATOM   329  C  CD    . PRO A 1 65  ? 33.864 60.338 15.079  1.00 13.75 ? 65   PRO A CD    1 
ATOM   330  N  N     . LYS A 1 66  ? 34.704 60.264 11.490  1.00 13.03 ? 66   LYS A N     1 
ATOM   331  C  CA    . LYS A 1 66  ? 34.597 60.115 10.045  1.00 13.22 ? 66   LYS A CA    1 
ATOM   332  C  C     . LYS A 1 66  ? 34.676 61.460 9.331   1.00 14.55 ? 66   LYS A C     1 
ATOM   333  O  O     . LYS A 1 66  ? 35.444 61.620 8.384   1.00 13.93 ? 66   LYS A O     1 
ATOM   334  C  CB    . LYS A 1 66  ? 33.294 59.399 9.677   1.00 15.18 ? 66   LYS A CB    1 
ATOM   335  C  CG    . LYS A 1 66  ? 33.188 58.962 8.215   1.00 15.03 ? 66   LYS A CG    1 
ATOM   336  C  CD    . LYS A 1 66  ? 32.472 60.008 7.355   1.00 15.20 ? 66   LYS A CD    1 
ATOM   337  C  CE    . LYS A 1 66  ? 31.030 60.271 7.813   1.00 12.69 ? 66   LYS A CE    1 
ATOM   338  N  NZ    . LYS A 1 66  ? 30.095 59.155 7.482   1.00 9.38  ? 66   LYS A NZ    1 
ATOM   339  N  N     . LYS A 1 67  ? 33.896 62.426 9.798   1.00 12.57 ? 67   LYS A N     1 
ATOM   340  C  CA    . LYS A 1 67  ? 33.830 63.732 9.152   1.00 12.83 ? 67   LYS A CA    1 
ATOM   341  C  C     . LYS A 1 67  ? 35.164 64.460 9.236   1.00 13.05 ? 67   LYS A C     1 
ATOM   342  O  O     . LYS A 1 67  ? 35.588 65.103 8.281   1.00 14.42 ? 67   LYS A O     1 
ATOM   343  C  CB    . LYS A 1 67  ? 32.726 64.591 9.781   1.00 12.66 ? 67   LYS A CB    1 
ATOM   344  C  CG    . LYS A 1 67  ? 32.357 65.827 8.991   1.00 11.41 ? 67   LYS A CG    1 
ATOM   345  C  CD    . LYS A 1 67  ? 31.698 65.461 7.691   1.00 12.11 ? 67   LYS A CD    1 
ATOM   346  C  CE    . LYS A 1 67  ? 31.707 66.620 6.735   1.00 11.41 ? 67   LYS A CE    1 
ATOM   347  N  NZ    . LYS A 1 67  ? 30.658 67.616 7.090   1.00 10.03 ? 67   LYS A NZ    1 
ATOM   348  N  N     . VAL A 1 68  ? 35.830 64.352 10.379  1.00 13.58 ? 68   VAL A N     1 
ATOM   349  C  CA    . VAL A 1 68  ? 37.137 64.977 10.544  1.00 13.05 ? 68   VAL A CA    1 
ATOM   350  C  C     . VAL A 1 68  ? 38.139 64.401 9.541   1.00 12.91 ? 68   VAL A C     1 
ATOM   351  O  O     . VAL A 1 68  ? 38.904 65.148 8.940   1.00 14.28 ? 68   VAL A O     1 
ATOM   352  C  CB    . VAL A 1 68  ? 37.675 64.821 11.995  1.00 13.45 ? 68   VAL A CB    1 
ATOM   353  C  CG1   . VAL A 1 68  ? 39.050 65.463 12.119  1.00 14.47 ? 68   VAL A CG1   1 
ATOM   354  C  CG2   . VAL A 1 68  ? 36.713 65.464 12.993  1.00 13.79 ? 68   VAL A CG2   1 
ATOM   355  N  N     . MET A 1 69  ? 38.081 63.090 9.314   1.00 11.02 ? 69   MET A N     1 
ATOM   356  C  CA    . MET A 1 69  ? 38.961 62.430 8.347   1.00 12.62 ? 69   MET A CA    1 
ATOM   357  C  C     . MET A 1 69  ? 38.588 62.738 6.893   1.00 12.90 ? 69   MET A C     1 
ATOM   358  O  O     . MET A 1 69  ? 39.461 62.792 6.019   1.00 11.74 ? 69   MET A O     1 
ATOM   359  C  CB    . MET A 1 69  ? 38.961 60.910 8.559   1.00 13.60 ? 69   MET A CB    1 
ATOM   360  C  CG    . MET A 1 69  ? 39.494 60.445 9.910   1.00 16.03 ? 69   MET A CG    1 
ATOM   361  S  SD    . MET A 1 69  ? 41.099 61.156 10.287  1.00 19.70 ? 69   MET A SD    1 
ATOM   362  C  CE    . MET A 1 69  ? 42.134 60.060 9.336   1.00 18.67 ? 69   MET A CE    1 
ATOM   363  N  N     . TRP A 1 70  ? 37.293 62.929 6.639   1.00 12.85 ? 70   TRP A N     1 
ATOM   364  C  CA    . TRP A 1 70  ? 36.833 63.363 5.327   1.00 13.28 ? 70   TRP A CA    1 
ATOM   365  C  C     . TRP A 1 70  ? 37.286 64.788 5.001   1.00 13.11 ? 70   TRP A C     1 
ATOM   366  O  O     . TRP A 1 70  ? 37.826 65.028 3.925   1.00 13.73 ? 70   TRP A O     1 
ATOM   367  C  CB    . TRP A 1 70  ? 35.310 63.237 5.209   1.00 13.11 ? 70   TRP A CB    1 
ATOM   368  C  CG    . TRP A 1 70  ? 34.784 63.556 3.818   1.00 15.30 ? 70   TRP A CG    1 
ATOM   369  C  CD1   . TRP A 1 70  ? 34.738 62.713 2.739   1.00 15.45 ? 70   TRP A CD1   1 
ATOM   370  C  CD2   . TRP A 1 70  ? 34.239 64.807 3.370   1.00 14.48 ? 70   TRP A CD2   1 
ATOM   371  N  NE1   . TRP A 1 70  ? 34.197 63.360 1.654   1.00 14.49 ? 70   TRP A NE1   1 
ATOM   372  C  CE2   . TRP A 1 70  ? 33.881 64.642 2.010   1.00 14.80 ? 70   TRP A CE2   1 
ATOM   373  C  CE3   . TRP A 1 70  ? 33.944 66.023 4.006   1.00 14.67 ? 70   TRP A CE3   1 
ATOM   374  C  CZ2   . TRP A 1 70  ? 33.245 65.654 1.277   1.00 15.05 ? 70   TRP A CZ2   1 
ATOM   375  C  CZ3   . TRP A 1 70  ? 33.313 67.024 3.277   1.00 13.30 ? 70   TRP A CZ3   1 
ATOM   376  C  CH2   . TRP A 1 70  ? 32.968 66.830 1.924   1.00 14.18 ? 70   TRP A CH2   1 
ATOM   377  N  N     . ASN A 1 71  ? 37.103 65.713 5.943   1.00 13.70 ? 71   ASN A N     1 
ATOM   378  C  CA    . ASN A 1 71  ? 37.707 67.052 5.868   1.00 14.13 ? 71   ASN A CA    1 
ATOM   379  C  C     . ASN A 1 71  ? 39.212 67.023 5.572   1.00 14.79 ? 71   ASN A C     1 
ATOM   380  O  O     . ASN A 1 71  ? 39.714 67.821 4.781   1.00 14.48 ? 71   ASN A O     1 
ATOM   381  C  CB    . ASN A 1 71  ? 37.465 67.816 7.170   1.00 14.36 ? 71   ASN A CB    1 
ATOM   382  C  CG    . ASN A 1 71  ? 36.055 68.344 7.283   1.00 14.70 ? 71   ASN A CG    1 
ATOM   383  O  OD1   . ASN A 1 71  ? 35.358 68.474 6.286   1.00 17.75 ? 71   ASN A OD1   1 
ATOM   384  N  ND2   . ASN A 1 71  ? 35.624 68.646 8.503   1.00 14.74 ? 71   ASN A ND2   1 
ATOM   385  N  N     . THR A 1 72  ? 39.925 66.108 6.222   1.00 14.51 ? 72   THR A N     1 
ATOM   386  C  CA    . THR A 1 72  ? 41.352 65.930 5.981   1.00 13.95 ? 72   THR A CA    1 
ATOM   387  C  C     . THR A 1 72  ? 41.595 65.472 4.550   1.00 14.90 ? 72   THR A C     1 
ATOM   388  O  O     . THR A 1 72  ? 42.441 66.027 3.852   1.00 13.94 ? 72   THR A O     1 
ATOM   389  C  CB    . THR A 1 72  ? 41.959 64.895 6.942   1.00 13.60 ? 72   THR A CB    1 
ATOM   390  O  OG1   . THR A 1 72  ? 41.611 65.224 8.290   1.00 14.19 ? 72   THR A OG1   1 
ATOM   391  C  CG2   . THR A 1 72  ? 43.456 64.870 6.807   1.00 13.52 ? 72   THR A CG2   1 
ATOM   392  N  N     . ALA A 1 73  ? 40.824 64.483 4.111   1.00 14.84 ? 73   ALA A N     1 
ATOM   393  C  CA    . ALA A 1 73  ? 40.950 63.943 2.767   1.00 16.08 ? 73   ALA A CA    1 
ATOM   394  C  C     . ALA A 1 73  ? 40.705 64.984 1.670   1.00 18.13 ? 73   ALA A C     1 
ATOM   395  O  O     . ALA A 1 73  ? 41.402 64.987 0.661   1.00 18.68 ? 73   ALA A O     1 
ATOM   396  C  CB    . ALA A 1 73  ? 40.020 62.765 2.594   1.00 15.90 ? 73   ALA A CB    1 
ATOM   397  N  N     . VAL A 1 74  ? 39.742 65.883 1.866   1.00 19.42 ? 74   VAL A N     1 
ATOM   398  C  CA    . VAL A 1 74  ? 39.518 66.945 0.885   1.00 21.25 ? 74   VAL A CA    1 
ATOM   399  C  C     . VAL A 1 74  ? 40.608 68.019 0.906   1.00 21.34 ? 74   VAL A C     1 
ATOM   400  O  O     . VAL A 1 74  ? 40.894 68.624 -0.126  1.00 21.06 ? 74   VAL A O     1 
ATOM   401  C  CB    . VAL A 1 74  ? 38.108 67.615 0.997   1.00 21.46 ? 74   VAL A CB    1 
ATOM   402  C  CG1   . VAL A 1 74  ? 37.019 66.572 1.011   1.00 20.83 ? 74   VAL A CG1   1 
ATOM   403  C  CG2   . VAL A 1 74  ? 38.023 68.497 2.222   1.00 24.87 ? 74   VAL A CG2   1 
ATOM   404  N  N     . HIS A 1 75  ? 41.259 68.214 2.051   1.00 22.34 ? 75   HIS A N     1 
ATOM   405  C  CA    . HIS A 1 75  ? 42.536 68.927 2.073   1.00 23.63 ? 75   HIS A CA    1 
ATOM   406  C  C     . HIS A 1 75  ? 43.575 68.295 1.170   1.00 25.18 ? 75   HIS A C     1 
ATOM   407  O  O     . HIS A 1 75  ? 44.378 69.000 0.556   1.00 26.76 ? 75   HIS A O     1 
ATOM   408  C  CB    . HIS A 1 75  ? 43.099 69.024 3.485   1.00 24.12 ? 75   HIS A CB    1 
ATOM   409  C  CG    . HIS A 1 75  ? 43.073 70.412 4.034   1.00 26.49 ? 75   HIS A CG    1 
ATOM   410  N  ND1   . HIS A 1 75  ? 44.017 71.360 3.701   1.00 26.68 ? 75   HIS A ND1   1 
ATOM   411  C  CD2   . HIS A 1 75  ? 42.195 71.026 4.864   1.00 26.92 ? 75   HIS A CD2   1 
ATOM   412  C  CE1   . HIS A 1 75  ? 43.723 72.501 4.303   1.00 27.53 ? 75   HIS A CE1   1 
ATOM   413  N  NE2   . HIS A 1 75  ? 42.622 72.324 5.016   1.00 28.89 ? 75   HIS A NE2   1 
ATOM   414  N  N     . SER A 1 76  ? 43.565 66.970 1.081   1.00 25.91 ? 76   SER A N     1 
ATOM   415  C  CA    . SER A 1 76  ? 44.517 66.276 0.228   1.00 26.15 ? 76   SER A CA    1 
ATOM   416  C  C     . SER A 1 76  ? 44.251 66.587 -1.237  1.00 26.96 ? 76   SER A C     1 
ATOM   417  O  O     . SER A 1 76  ? 45.184 66.849 -2.002  1.00 25.77 ? 76   SER A O     1 
ATOM   418  C  CB    . SER A 1 76  ? 44.451 64.771 0.455   1.00 26.49 ? 76   SER A CB    1 
ATOM   419  O  OG    . SER A 1 76  ? 45.732 64.201 0.268   1.00 28.04 ? 76   SER A OG    1 
ATOM   420  N  N     . GLU A 1 77  ? 42.972 66.583 -1.612  1.00 28.28 ? 77   GLU A N     1 
ATOM   421  C  CA    . GLU A 1 77  ? 42.560 66.841 -2.997  1.00 30.11 ? 77   GLU A CA    1 
ATOM   422  C  C     . GLU A 1 77  ? 42.817 68.273 -3.415  1.00 29.80 ? 77   GLU A C     1 
ATOM   423  O  O     . GLU A 1 77  ? 43.122 68.540 -4.571  1.00 31.41 ? 77   GLU A O     1 
ATOM   424  C  CB    . GLU A 1 77  ? 41.083 66.501 -3.190  1.00 30.20 ? 77   GLU A CB    1 
ATOM   425  C  CG    . GLU A 1 77  ? 40.699 65.240 -2.454  1.00 33.48 ? 77   GLU A CG    1 
ATOM   426  C  CD    . GLU A 1 77  ? 39.317 64.742 -2.791  1.00 37.12 ? 77   GLU A CD    1 
ATOM   427  O  OE1   . GLU A 1 77  ? 38.344 65.547 -2.802  1.00 37.92 ? 77   GLU A OE1   1 
ATOM   428  O  OE2   . GLU A 1 77  ? 39.211 63.519 -3.044  1.00 41.21 ? 77   GLU A OE2   1 
ATOM   429  N  N     . PHE A 1 78  ? 42.729 69.195 -2.471  1.00 31.18 ? 78   PHE A N     1 
ATOM   430  C  CA    . PHE A 1 78  ? 42.983 70.590 -2.781  1.00 33.42 ? 78   PHE A CA    1 
ATOM   431  C  C     . PHE A 1 78  ? 44.481 70.921 -2.820  1.00 33.29 ? 78   PHE A C     1 
ATOM   432  O  O     . PHE A 1 78  ? 44.903 71.753 -3.623  1.00 33.59 ? 78   PHE A O     1 
ATOM   433  C  CB    . PHE A 1 78  ? 42.222 71.504 -1.805  1.00 36.56 ? 78   PHE A CB    1 
ATOM   434  C  CG    . PHE A 1 78  ? 40.708 71.426 -1.953  1.00 40.46 ? 78   PHE A CG    1 
ATOM   435  C  CD1   . PHE A 1 78  ? 40.126 70.885 -3.109  1.00 41.58 ? 78   PHE A CD1   1 
ATOM   436  C  CD2   . PHE A 1 78  ? 39.867 71.897 -0.940  1.00 41.78 ? 78   PHE A CD2   1 
ATOM   437  C  CE1   . PHE A 1 78  ? 38.719 70.807 -3.256  1.00 43.59 ? 78   PHE A CE1   1 
ATOM   438  C  CE2   . PHE A 1 78  ? 38.453 71.826 -1.069  1.00 44.10 ? 78   PHE A CE2   1 
ATOM   439  C  CZ    . PHE A 1 78  ? 37.879 71.283 -2.230  1.00 43.64 ? 78   PHE A CZ    1 
ATOM   440  N  N     . MET A 1 79  ? 45.291 70.223 -2.021  1.00 32.91 ? 79   MET A N     1 
ATOM   441  C  CA    . MET A 1 79  ? 46.739 70.176 -2.268  1.00 33.19 ? 79   MET A CA    1 
ATOM   442  C  C     . MET A 1 79  ? 47.089 69.882 -3.735  1.00 31.49 ? 79   MET A C     1 
ATOM   443  O  O     . MET A 1 79  ? 47.920 70.581 -4.323  1.00 32.03 ? 79   MET A O     1 
ATOM   444  C  CB    . MET A 1 79  ? 47.433 69.167 -1.342  1.00 35.96 ? 79   MET A CB    1 
ATOM   445  C  CG    . MET A 1 79  ? 48.935 69.433 -1.129  1.00 40.15 ? 79   MET A CG    1 
ATOM   446  S  SD    . MET A 1 79  ? 49.889 68.061 -0.285  1.00 43.70 ? 79   MET A SD    1 
ATOM   447  C  CE    . MET A 1 79  ? 49.408 66.524 -1.339  1.00 44.13 ? 79   MET A CE    1 
ATOM   448  N  N     . HIS A 1 80  ? 46.420 68.902 -4.342  1.00 29.56 ? 80   HIS A N     1 
ATOM   449  C  CA    . HIS A 1 80  ? 46.685 68.549 -5.741  1.00 28.75 ? 80   HIS A CA    1 
ATOM   450  C  C     . HIS A 1 80  ? 46.429 69.713 -6.687  1.00 26.68 ? 80   HIS A C     1 
ATOM   451  O  O     . HIS A 1 80  ? 47.219 69.954 -7.601  1.00 26.26 ? 80   HIS A O     1 
ATOM   452  C  CB    . HIS A 1 80  ? 45.847 67.344 -6.174  1.00 30.32 ? 80   HIS A CB    1 
ATOM   453  C  CG    . HIS A 1 80  ? 46.152 66.096 -5.410  1.00 35.04 ? 80   HIS A CG    1 
ATOM   454  N  ND1   . HIS A 1 80  ? 47.238 65.989 -4.565  1.00 36.42 ? 80   HIS A ND1   1 
ATOM   455  C  CD2   . HIS A 1 80  ? 45.506 64.907 -5.346  1.00 37.72 ? 80   HIS A CD2   1 
ATOM   456  C  CE1   . HIS A 1 80  ? 47.246 64.789 -4.009  1.00 37.92 ? 80   HIS A CE1   1 
ATOM   457  N  NE2   . HIS A 1 80  ? 46.206 64.112 -4.466  1.00 38.47 ? 80   HIS A NE2   1 
ATOM   458  N  N     . ASP A 1 81  ? 45.330 70.433 -6.463  1.00 24.80 ? 81   ASP A N     1 
ATOM   459  C  CA    . ASP A 1 81  ? 44.887 71.468 -7.398  1.00 23.21 ? 81   ASP A CA    1 
ATOM   460  C  C     . ASP A 1 81  ? 45.673 72.759 -7.235  1.00 22.65 ? 81   ASP A C     1 
ATOM   461  O  O     . ASP A 1 81  ? 45.469 73.719 -7.977  1.00 20.85 ? 81   ASP A O     1 
ATOM   462  C  CB    . ASP A 1 81  ? 43.396 71.750 -7.223  1.00 22.61 ? 81   ASP A CB    1 
ATOM   463  C  CG    . ASP A 1 81  ? 42.532 70.552 -7.561  1.00 23.21 ? 81   ASP A CG    1 
ATOM   464  O  OD1   . ASP A 1 81  ? 43.033 69.593 -8.199  1.00 21.73 ? 81   ASP A OD1   1 
ATOM   465  O  OD2   . ASP A 1 81  ? 41.342 70.575 -7.186  1.00 23.16 ? 81   ASP A OD2   1 
ATOM   466  N  N     . HIS A 1 82  ? 46.592 72.760 -6.275  1.00 22.13 ? 82   HIS A N     1 
ATOM   467  C  CA    . HIS A 1 82  ? 47.239 73.985 -5.826  1.00 24.07 ? 82   HIS A CA    1 
ATOM   468  C  C     . HIS A 1 82  ? 47.967 74.731 -6.952  1.00 23.12 ? 82   HIS A C     1 
ATOM   469  O  O     . HIS A 1 82  ? 47.637 75.873 -7.264  1.00 21.59 ? 82   HIS A O     1 
ATOM   470  C  CB    . HIS A 1 82  ? 48.207 73.667 -4.688  1.00 26.36 ? 82   HIS A CB    1 
ATOM   471  C  CG    . HIS A 1 82  ? 48.423 74.810 -3.748  1.00 31.85 ? 82   HIS A CG    1 
ATOM   472  N  ND1   . HIS A 1 82  ? 47.379 75.572 -3.255  1.00 32.70 ? 82   HIS A ND1   1 
ATOM   473  C  CD2   . HIS A 1 82  ? 49.561 75.359 -3.253  1.00 32.66 ? 82   HIS A CD2   1 
ATOM   474  C  CE1   . HIS A 1 82  ? 47.870 76.546 -2.503  1.00 33.97 ? 82   HIS A CE1   1 
ATOM   475  N  NE2   . HIS A 1 82  ? 49.190 76.439 -2.487  1.00 33.52 ? 82   HIS A NE2   1 
ATOM   476  N  N     . ALA A 1 83  ? 48.944 74.068 -7.563  1.00 23.18 ? 83   ALA A N     1 
ATOM   477  C  CA    . ALA A 1 83  ? 49.692 74.638 -8.678  1.00 21.93 ? 83   ALA A CA    1 
ATOM   478  C  C     . ALA A 1 83  ? 48.799 75.139 -9.824  1.00 21.64 ? 83   ALA A C     1 
ATOM   479  O  O     . ALA A 1 83  ? 49.113 76.142 -10.462 1.00 20.94 ? 83   ALA A O     1 
ATOM   480  C  CB    . ALA A 1 83  ? 50.722 73.623 -9.198  1.00 20.85 ? 83   ALA A CB    1 
ATOM   481  N  N     . ASP A 1 84  ? 47.677 74.465 -10.062 1.00 20.52 ? 84   ASP A N     1 
ATOM   482  C  CA    . ASP A 1 84  ? 46.716 74.920 -11.064 1.00 20.85 ? 84   ASP A CA    1 
ATOM   483  C  C     . ASP A 1 84  ? 46.137 76.285 -10.741 1.00 20.13 ? 84   ASP A C     1 
ATOM   484  O  O     . ASP A 1 84  ? 45.831 77.068 -11.643 1.00 19.14 ? 84   ASP A O     1 
ATOM   485  C  CB    . ASP A 1 84  ? 45.582 73.914 -11.233 1.00 23.41 ? 84   ASP A CB    1 
ATOM   486  C  CG    . ASP A 1 84  ? 45.975 72.733 -12.099 1.00 25.60 ? 84   ASP A CG    1 
ATOM   487  O  OD1   . ASP A 1 84  ? 46.981 72.826 -12.841 1.00 30.21 ? 84   ASP A OD1   1 
ATOM   488  O  OD2   . ASP A 1 84  ? 45.287 71.699 -12.036 1.00 25.96 ? 84   ASP A OD2   1 
ATOM   489  N  N     . TYR A 1 85  ? 46.041 76.592 -9.452  1.00 19.44 ? 85   TYR A N     1 
ATOM   490  C  CA    . TYR A 1 85  ? 45.425 77.841 -9.027  1.00 19.28 ? 85   TYR A CA    1 
ATOM   491  C  C     . TYR A 1 85  ? 46.446 78.953 -8.828  1.00 19.44 ? 85   TYR A C     1 
ATOM   492  O  O     . TYR A 1 85  ? 46.135 80.008 -8.279  1.00 19.47 ? 85   TYR A O     1 
ATOM   493  C  CB    . TYR A 1 85  ? 44.571 77.618 -7.776  1.00 16.42 ? 85   TYR A CB    1 
ATOM   494  C  CG    . TYR A 1 85  ? 43.118 77.383 -8.118  1.00 16.77 ? 85   TYR A CG    1 
ATOM   495  C  CD1   . TYR A 1 85  ? 42.271 78.458 -8.396  1.00 15.53 ? 85   TYR A CD1   1 
ATOM   496  C  CD2   . TYR A 1 85  ? 42.593 76.088 -8.201  1.00 14.83 ? 85   TYR A CD2   1 
ATOM   497  C  CE1   . TYR A 1 85  ? 40.948 78.256 -8.748  1.00 15.35 ? 85   TYR A CE1   1 
ATOM   498  C  CE2   . TYR A 1 85  ? 41.266 75.877 -8.549  1.00 15.82 ? 85   TYR A CE2   1 
ATOM   499  C  CZ    . TYR A 1 85  ? 40.452 76.970 -8.819  1.00 15.33 ? 85   TYR A CZ    1 
ATOM   500  O  OH    . TYR A 1 85  ? 39.132 76.795 -9.142  1.00 16.06 ? 85   TYR A OH    1 
ATOM   501  N  N     . GLY A 1 86  ? 47.657 78.725 -9.327  1.00 21.25 ? 86   GLY A N     1 
ATOM   502  C  CA    . GLY A 1 86  ? 48.648 79.785 -9.388  1.00 23.47 ? 86   GLY A CA    1 
ATOM   503  C  C     . GLY A 1 86  ? 49.580 79.789 -8.187  1.00 24.37 ? 86   GLY A C     1 
ATOM   504  O  O     . GLY A 1 86  ? 50.261 80.781 -7.909  1.00 23.21 ? 86   GLY A O     1 
ATOM   505  N  N     . PHE A 1 87  ? 49.625 78.665 -7.487  1.00 24.83 ? 87   PHE A N     1 
ATOM   506  C  CA    . PHE A 1 87  ? 50.302 78.585 -6.212  1.00 28.94 ? 87   PHE A CA    1 
ATOM   507  C  C     . PHE A 1 87  ? 51.477 77.633 -6.332  1.00 32.41 ? 87   PHE A C     1 
ATOM   508  O  O     . PHE A 1 87  ? 51.515 76.789 -7.229  1.00 31.37 ? 87   PHE A O     1 
ATOM   509  C  CB    . PHE A 1 87  ? 49.339 78.076 -5.151  1.00 28.43 ? 87   PHE A CB    1 
ATOM   510  C  CG    . PHE A 1 87  ? 48.426 79.137 -4.603  1.00 29.18 ? 87   PHE A CG    1 
ATOM   511  C  CD1   . PHE A 1 87  ? 48.884 80.046 -3.649  1.00 29.54 ? 87   PHE A CD1   1 
ATOM   512  C  CD2   . PHE A 1 87  ? 47.106 79.225 -5.039  1.00 28.99 ? 87   PHE A CD2   1 
ATOM   513  C  CE1   . PHE A 1 87  ? 48.033 81.032 -3.134  1.00 29.85 ? 87   PHE A CE1   1 
ATOM   514  C  CE2   . PHE A 1 87  ? 46.254 80.201 -4.533  1.00 29.54 ? 87   PHE A CE2   1 
ATOM   515  C  CZ    . PHE A 1 87  ? 46.719 81.107 -3.578  1.00 29.37 ? 87   PHE A CZ    1 
ATOM   516  N  N     . PRO A 1 88  ? 52.468 77.770 -5.435  1.00 37.26 ? 88   PRO A N     1 
ATOM   517  C  CA    . PRO A 1 88  ? 53.629 76.867 -5.421  1.00 40.01 ? 88   PRO A CA    1 
ATOM   518  C  C     . PRO A 1 88  ? 53.253 75.389 -5.424  1.00 42.68 ? 88   PRO A C     1 
ATOM   519  O  O     . PRO A 1 88  ? 52.478 74.924 -4.568  1.00 42.61 ? 88   PRO A O     1 
ATOM   520  C  CB    . PRO A 1 88  ? 54.375 77.267 -4.150  1.00 39.83 ? 88   PRO A CB    1 
ATOM   521  C  CG    . PRO A 1 88  ? 54.093 78.735 -4.023  1.00 39.46 ? 88   PRO A CG    1 
ATOM   522  C  CD    . PRO A 1 88  ? 52.641 78.892 -4.491  1.00 38.18 ? 88   PRO A CD    1 
ATOM   523  N  N     . SER A 1 89  ? 53.763 74.686 -6.439  1.00 45.91 ? 89   SER A N     1 
ATOM   524  C  CA    . SER A 1 89  ? 53.662 73.224 -6.547  1.00 49.14 ? 89   SER A CA    1 
ATOM   525  C  C     . SER A 1 89  ? 54.055 72.523 -5.239  1.00 50.52 ? 89   SER A C     1 
ATOM   526  O  O     . SER A 1 89  ? 55.240 72.491 -4.861  1.00 50.53 ? 89   SER A O     1 
ATOM   527  C  CB    . SER A 1 89  ? 54.541 72.717 -7.710  1.00 49.85 ? 89   SER A CB    1 
ATOM   528  O  OG    . SER A 1 89  ? 53.924 71.647 -8.430  1.00 50.35 ? 89   SER A OG    1 
ATOM   529  N  N     . CYS A 1 90  ? 53.048 71.991 -4.545  1.00 51.81 ? 90   CYS A N     1 
ATOM   530  C  CA    . CYS A 1 90  ? 53.176 71.653 -3.126  1.00 53.73 ? 90   CYS A CA    1 
ATOM   531  C  C     . CYS A 1 90  ? 52.530 70.273 -2.871  1.00 55.09 ? 90   CYS A C     1 
ATOM   532  O  O     . CYS A 1 90  ? 51.544 69.888 -3.542  1.00 55.46 ? 90   CYS A O     1 
ATOM   533  C  CB    . CYS A 1 90  ? 52.528 72.748 -2.259  1.00 53.38 ? 90   CYS A CB    1 
ATOM   534  S  SG    . CYS A 1 90  ? 52.062 72.292 -0.544  1.00 52.21 ? 90   CYS A SG    1 
ATOM   535  N  N     . GLU A 1 91  ? 53.099 69.525 -1.924  1.00 55.72 ? 91   GLU A N     1 
ATOM   536  C  CA    . GLU A 1 91  ? 54.361 68.800 -2.143  1.00 56.15 ? 91   GLU A CA    1 
ATOM   537  C  C     . GLU A 1 91  ? 54.254 67.284 -1.832  1.00 55.22 ? 91   GLU A C     1 
ATOM   538  O  O     . GLU A 1 91  ? 54.746 66.440 -2.610  1.00 55.06 ? 91   GLU A O     1 
ATOM   539  C  CB    . GLU A 1 91  ? 55.488 69.433 -1.297  1.00 56.91 ? 91   GLU A CB    1 
ATOM   540  C  CG    . GLU A 1 91  ? 55.172 69.587 0.206   1.00 57.54 ? 91   GLU A CG    1 
ATOM   541  C  CD    . GLU A 1 91  ? 56.126 68.782 1.112   1.00 58.16 ? 91   GLU A CD    1 
ATOM   542  O  OE1   . GLU A 1 91  ? 55.929 67.536 1.229   1.00 58.94 ? 91   GLU A OE1   1 
ATOM   543  O  OE2   . GLU A 1 91  ? 57.052 69.392 1.724   1.00 57.55 ? 91   GLU A OE2   1 
ATOM   544  N  N     . GLY A 1 92  ? 53.631 66.951 -0.692  1.00 53.68 ? 92   GLY A N     1 
ATOM   545  C  CA    . GLY A 1 92  ? 53.794 65.625 -0.099  1.00 50.77 ? 92   GLY A CA    1 
ATOM   546  C  C     . GLY A 1 92  ? 53.174 65.468 1.288   1.00 47.67 ? 92   GLY A C     1 
ATOM   547  O  O     . GLY A 1 92  ? 51.941 65.575 1.424   1.00 47.10 ? 92   GLY A O     1 
ATOM   548  N  N     . LYS A 1 93  ? 54.015 65.225 2.307   1.00 43.99 ? 93   LYS A N     1 
ATOM   549  C  CA    . LYS A 1 93  ? 53.884 64.039 3.170   1.00 40.91 ? 93   LYS A CA    1 
ATOM   550  C  C     . LYS A 1 93  ? 52.880 64.226 4.323   1.00 37.40 ? 93   LYS A C     1 
ATOM   551  O  O     . LYS A 1 93  ? 53.084 65.060 5.216   1.00 36.56 ? 93   LYS A O     1 
ATOM   552  C  CB    . LYS A 1 93  ? 55.242 63.628 3.763   1.00 43.62 ? 93   LYS A CB    1 
ATOM   553  C  CG    . LYS A 1 93  ? 56.412 63.597 2.770   1.00 46.78 ? 93   LYS A CG    1 
ATOM   554  C  CD    . LYS A 1 93  ? 57.684 64.205 3.387   1.00 48.85 ? 93   LYS A CD    1 
ATOM   555  C  CE    . LYS A 1 93  ? 57.390 65.547 4.099   1.00 49.80 ? 93   LYS A CE    1 
ATOM   556  N  NZ    . LYS A 1 93  ? 58.206 66.699 3.557   1.00 50.52 ? 93   LYS A NZ    1 
ATOM   557  N  N     . PHE A 1 94  ? 51.829 63.404 4.319   1.00 33.18 ? 94   PHE A N     1 
ATOM   558  C  CA    . PHE A 1 94  ? 50.788 63.443 5.344   1.00 28.27 ? 94   PHE A CA    1 
ATOM   559  C  C     . PHE A 1 94  ? 51.262 62.819 6.651   1.00 26.85 ? 94   PHE A C     1 
ATOM   560  O  O     . PHE A 1 94  ? 51.760 61.703 6.669   1.00 26.76 ? 94   PHE A O     1 
ATOM   561  C  CB    . PHE A 1 94  ? 49.536 62.702 4.864   1.00 25.01 ? 94   PHE A CB    1 
ATOM   562  C  CG    . PHE A 1 94  ? 48.416 62.690 5.874   1.00 23.27 ? 94   PHE A CG    1 
ATOM   563  C  CD1   . PHE A 1 94  ? 47.929 63.885 6.412   1.00 20.85 ? 94   PHE A CD1   1 
ATOM   564  C  CD2   . PHE A 1 94  ? 47.861 61.489 6.307   1.00 20.62 ? 94   PHE A CD2   1 
ATOM   565  C  CE1   . PHE A 1 94  ? 46.912 63.877 7.363   1.00 19.72 ? 94   PHE A CE1   1 
ATOM   566  C  CE2   . PHE A 1 94  ? 46.839 61.474 7.262   1.00 20.09 ? 94   PHE A CE2   1 
ATOM   567  C  CZ    . PHE A 1 94  ? 46.366 62.666 7.789   1.00 20.04 ? 94   PHE A CZ    1 
ATOM   568  N  N     . ASN A 1 95  ? 51.042 63.524 7.752   1.00 25.52 ? 95   ASN A N     1 
ATOM   569  C  CA    . ASN A 1 95  ? 51.324 62.988 9.077   1.00 23.91 ? 95   ASN A CA    1 
ATOM   570  C  C     . ASN A 1 95  ? 50.029 62.583 9.764   1.00 22.59 ? 95   ASN A C     1 
ATOM   571  O  O     . ASN A 1 95  ? 49.305 63.424 10.300  1.00 22.00 ? 95   ASN A O     1 
ATOM   572  C  CB    . ASN A 1 95  ? 52.071 64.021 9.922   1.00 24.95 ? 95   ASN A CB    1 
ATOM   573  C  CG    . ASN A 1 95  ? 52.699 63.414 11.174  1.00 27.72 ? 95   ASN A CG    1 
ATOM   574  O  OD1   . ASN A 1 95  ? 52.490 62.235 11.498  1.00 28.49 ? 95   ASN A OD1   1 
ATOM   575  N  ND2   . ASN A 1 95  ? 53.473 64.224 11.888  1.00 28.43 ? 95   ASN A ND2   1 
ATOM   576  N  N     . TRP A 1 96  ? 49.755 61.283 9.735   1.00 21.84 ? 96   TRP A N     1 
ATOM   577  C  CA    . TRP A 1 96  ? 48.550 60.708 10.322  1.00 22.22 ? 96   TRP A CA    1 
ATOM   578  C  C     . TRP A 1 96  ? 48.483 60.939 11.835  1.00 23.94 ? 96   TRP A C     1 
ATOM   579  O  O     . TRP A 1 96  ? 47.433 61.301 12.361  1.00 24.60 ? 96   TRP A O     1 
ATOM   580  C  CB    . TRP A 1 96  ? 48.499 59.210 10.001  1.00 20.89 ? 96   TRP A CB    1 
ATOM   581  C  CG    . TRP A 1 96  ? 47.282 58.495 10.485  1.00 20.82 ? 96   TRP A CG    1 
ATOM   582  C  CD1   . TRP A 1 96  ? 46.990 58.155 11.775  1.00 21.70 ? 96   TRP A CD1   1 
ATOM   583  C  CD2   . TRP A 1 96  ? 46.199 58.005 9.684   1.00 19.98 ? 96   TRP A CD2   1 
ATOM   584  N  NE1   . TRP A 1 96  ? 45.793 57.480 11.826  1.00 21.25 ? 96   TRP A NE1   1 
ATOM   585  C  CE2   . TRP A 1 96  ? 45.284 57.374 10.560  1.00 19.87 ? 96   TRP A CE2   1 
ATOM   586  C  CE3   . TRP A 1 96  ? 45.917 58.024 8.309   1.00 19.87 ? 96   TRP A CE3   1 
ATOM   587  C  CZ2   . TRP A 1 96  ? 44.098 56.775 10.109  1.00 18.85 ? 96   TRP A CZ2   1 
ATOM   588  C  CZ3   . TRP A 1 96  ? 44.735 57.425 7.858   1.00 19.10 ? 96   TRP A CZ3   1 
ATOM   589  C  CH2   . TRP A 1 96  ? 43.845 56.809 8.762   1.00 19.28 ? 96   TRP A CH2   1 
ATOM   590  N  N     . ARG A 1 97  ? 49.606 60.743 12.519  1.00 24.15 ? 97   ARG A N     1 
ATOM   591  C  CA    . ARG A 1 97  ? 49.694 60.946 13.962  1.00 25.44 ? 97   ARG A CA    1 
ATOM   592  C  C     . ARG A 1 97  ? 49.057 62.265 14.431  1.00 23.71 ? 97   ARG A C     1 
ATOM   593  O  O     . ARG A 1 97  ? 48.357 62.303 15.431  1.00 23.36 ? 97   ARG A O     1 
ATOM   594  C  CB    . ARG A 1 97  ? 51.168 60.864 14.392  1.00 30.87 ? 97   ARG A CB    1 
ATOM   595  C  CG    . ARG A 1 97  ? 51.485 61.431 15.782  1.00 37.49 ? 97   ARG A CG    1 
ATOM   596  C  CD    . ARG A 1 97  ? 52.004 60.350 16.733  1.00 41.81 ? 97   ARG A CD    1 
ATOM   597  N  NE    . ARG A 1 97  ? 51.220 59.115 16.620  1.00 47.75 ? 97   ARG A NE    1 
ATOM   598  C  CZ    . ARG A 1 97  ? 50.690 58.465 17.658  1.00 50.18 ? 97   ARG A CZ    1 
ATOM   599  N  NH1   . ARG A 1 97  ? 49.479 58.812 18.121  1.00 50.86 ? 97   ARG A NH1   1 
ATOM   600  N  NH2   . ARG A 1 97  ? 51.382 57.481 18.243  1.00 50.30 ? 97   ARG A NH2   1 
ATOM   601  N  N     . VAL A 1 98  ? 49.285 63.334 13.684  1.00 22.03 ? 98   VAL A N     1 
ATOM   602  C  CA    . VAL A 1 98  ? 48.964 64.678 14.135  1.00 21.60 ? 98   VAL A CA    1 
ATOM   603  C  C     . VAL A 1 98  ? 47.449 64.907 14.147  1.00 22.30 ? 98   VAL A C     1 
ATOM   604  O  O     . VAL A 1 98  ? 46.897 65.454 15.106  1.00 20.61 ? 98   VAL A O     1 
ATOM   605  C  CB    . VAL A 1 98  ? 49.640 65.731 13.224  1.00 21.63 ? 98   VAL A CB    1 
ATOM   606  C  CG1   . VAL A 1 98  ? 48.999 67.103 13.410  1.00 22.19 ? 98   VAL A CG1   1 
ATOM   607  C  CG2   . VAL A 1 98  ? 51.130 65.804 13.530  1.00 24.61 ? 98   VAL A CG2   1 
ATOM   608  N  N     . ILE A 1 99  ? 46.783 64.510 13.066  1.00 21.81 ? 99   ILE A N     1 
ATOM   609  C  CA    . ILE A 1 99  ? 45.338 64.669 12.981  1.00 21.97 ? 99   ILE A CA    1 
ATOM   610  C  C     . ILE A 1 99  ? 44.640 63.631 13.868  1.00 20.77 ? 99   ILE A C     1 
ATOM   611  O  O     . ILE A 1 99  ? 43.615 63.920 14.473  1.00 19.90 ? 99   ILE A O     1 
ATOM   612  C  CB    . ILE A 1 99  ? 44.832 64.603 11.507  1.00 22.02 ? 99   ILE A CB    1 
ATOM   613  C  CG1   . ILE A 1 99  ? 43.357 64.999 11.430  1.00 22.43 ? 99   ILE A CG1   1 
ATOM   614  C  CG2   . ILE A 1 99  ? 45.037 63.209 10.922  1.00 24.07 ? 99   ILE A CG2   1 
ATOM   615  C  CD1   . ILE A 1 99  ? 43.095 66.467 11.747  1.00 23.98 ? 99   ILE A CD1   1 
ATOM   616  N  N     . LYS A 1 100 ? 45.248 62.460 14.011  1.00 21.31 ? 100  LYS A N     1 
ATOM   617  C  CA    . LYS A 1 100 ? 44.723 61.437 14.900  1.00 22.00 ? 100  LYS A CA    1 
ATOM   618  C  C     . LYS A 1 100 ? 44.637 61.938 16.344  1.00 22.77 ? 100  LYS A C     1 
ATOM   619  O  O     . LYS A 1 100 ? 43.633 61.721 17.018  1.00 21.93 ? 100  LYS A O     1 
ATOM   620  C  CB    . LYS A 1 100 ? 45.581 60.173 14.822  1.00 21.80 ? 100  LYS A CB    1 
ATOM   621  C  CG    . LYS A 1 100 ? 45.411 59.230 16.008  1.00 24.48 ? 100  LYS A CG    1 
ATOM   622  C  CD    . LYS A 1 100 ? 44.570 58.019 15.665  1.00 23.33 ? 100  LYS A CD    1 
ATOM   623  C  CE    . LYS A 1 100 ? 44.762 56.927 16.691  1.00 23.40 ? 100  LYS A CE    1 
ATOM   624  N  NZ    . LYS A 1 100 ? 44.032 57.217 17.947  1.00 23.54 ? 100  LYS A NZ    1 
ATOM   625  N  N     . GLU A 1 101 ? 45.674 62.635 16.798  1.00 22.87 ? 101  GLU A N     1 
ATOM   626  C  CA    . GLU A 1 101 ? 45.679 63.213 18.135  1.00 23.50 ? 101  GLU A CA    1 
ATOM   627  C  C     . GLU A 1 101 ? 44.591 64.266 18.322  1.00 21.24 ? 101  GLU A C     1 
ATOM   628  O  O     . GLU A 1 101 ? 43.934 64.315 19.356  1.00 18.41 ? 101  GLU A O     1 
ATOM   629  C  CB    . GLU A 1 101 ? 47.033 63.847 18.426  1.00 28.64 ? 101  GLU A CB    1 
ATOM   630  C  CG    . GLU A 1 101 ? 47.679 63.335 19.702  1.00 37.04 ? 101  GLU A CG    1 
ATOM   631  C  CD    . GLU A 1 101 ? 48.980 62.584 19.424  1.00 42.46 ? 101  GLU A CD    1 
ATOM   632  O  OE1   . GLU A 1 101 ? 49.892 63.189 18.795  1.00 43.78 ? 101  GLU A OE1   1 
ATOM   633  O  OE2   . GLU A 1 101 ? 49.089 61.389 19.829  1.00 45.63 ? 101  GLU A OE2   1 
ATOM   634  N  N     . LYS A 1 102 ? 44.438 65.129 17.322  1.00 20.56 ? 102  LYS A N     1 
ATOM   635  C  CA    . LYS A 1 102 ? 43.475 66.222 17.384  1.00 19.12 ? 102  LYS A CA    1 
ATOM   636  C  C     . LYS A 1 102 ? 42.070 65.645 17.390  1.00 17.71 ? 102  LYS A C     1 
ATOM   637  O  O     . LYS A 1 102 ? 41.201 66.115 18.118  1.00 18.43 ? 102  LYS A O     1 
ATOM   638  C  CB    . LYS A 1 102 ? 43.643 67.150 16.180  1.00 19.46 ? 102  LYS A CB    1 
ATOM   639  C  CG    . LYS A 1 102 ? 45.033 67.771 16.048  1.00 21.36 ? 102  LYS A CG    1 
ATOM   640  C  CD    . LYS A 1 102 ? 44.922 69.250 15.684  1.00 22.49 ? 102  LYS A CD    1 
ATOM   641  C  CE    . LYS A 1 102 ? 46.146 69.760 14.930  1.00 21.97 ? 102  LYS A CE    1 
ATOM   642  N  NZ    . LYS A 1 102 ? 46.075 71.243 14.797  1.00 24.48 ? 102  LYS A NZ    1 
ATOM   643  N  N     . ARG A 1 103 ? 41.877 64.600 16.594  1.00 15.74 ? 103  ARG A N     1 
ATOM   644  C  CA    . ARG A 1 103 ? 40.583 63.951 16.437  1.00 16.40 ? 103  ARG A CA    1 
ATOM   645  C  C     . ARG A 1 103 ? 40.145 63.253 17.729  1.00 16.62 ? 103  ARG A C     1 
ATOM   646  O  O     . ARG A 1 103 ? 39.006 63.404 18.172  1.00 17.31 ? 103  ARG A O     1 
ATOM   647  C  CB    . ARG A 1 103 ? 40.661 62.952 15.292  1.00 15.17 ? 103  ARG A CB    1 
ATOM   648  C  CG    . ARG A 1 103 ? 39.335 62.555 14.717  1.00 16.19 ? 103  ARG A CG    1 
ATOM   649  C  CD    . ARG A 1 103 ? 39.500 61.312 13.872  1.00 17.47 ? 103  ARG A CD    1 
ATOM   650  N  NE    . ARG A 1 103 ? 39.865 60.152 14.676  1.00 21.07 ? 103  ARG A NE    1 
ATOM   651  C  CZ    . ARG A 1 103 ? 40.822 59.280 14.366  1.00 20.46 ? 103  ARG A CZ    1 
ATOM   652  N  NH1   . ARG A 1 103 ? 41.503 59.389 13.229  1.00 20.06 ? 103  ARG A NH1   1 
ATOM   653  N  NH2   . ARG A 1 103 ? 41.093 58.287 15.198  1.00 21.46 ? 103  ARG A NH2   1 
ATOM   654  N  N     . ASP A 1 104 ? 41.070 62.520 18.342  1.00 16.82 ? 104  ASP A N     1 
ATOM   655  C  CA    . ASP A 1 104 ? 40.868 61.933 19.668  1.00 16.78 ? 104  ASP A CA    1 
ATOM   656  C  C     . ASP A 1 104 ? 40.455 62.959 20.711  1.00 16.66 ? 104  ASP A C     1 
ATOM   657  O  O     . ASP A 1 104 ? 39.594 62.688 21.542  1.00 15.59 ? 104  ASP A O     1 
ATOM   658  C  CB    . ASP A 1 104 ? 42.142 61.233 20.146  1.00 17.53 ? 104  ASP A CB    1 
ATOM   659  C  CG    . ASP A 1 104 ? 42.413 59.928 19.413  1.00 18.85 ? 104  ASP A CG    1 
ATOM   660  O  OD1   . ASP A 1 104 ? 41.500 59.371 18.782  1.00 18.42 ? 104  ASP A OD1   1 
ATOM   661  O  OD2   . ASP A 1 104 ? 43.561 59.452 19.474  1.00 21.77 ? 104  ASP A OD2   1 
ATOM   662  N  N     . ALA A 1 105 ? 41.100 64.120 20.683  1.00 16.29 ? 105  ALA A N     1 
ATOM   663  C  CA    . ALA A 1 105 ? 40.938 65.103 21.740  1.00 17.02 ? 105  ALA A CA    1 
ATOM   664  C  C     . ALA A 1 105 ? 39.595 65.800 21.587  1.00 16.40 ? 105  ALA A C     1 
ATOM   665  O  O     . ALA A 1 105 ? 38.969 66.188 22.569  1.00 15.94 ? 105  ALA A O     1 
ATOM   666  C  CB    . ALA A 1 105 ? 42.059 66.118 21.693  1.00 18.04 ? 105  ALA A CB    1 
ATOM   667  N  N     . TYR A 1 106 ? 39.159 65.941 20.342  1.00 15.12 ? 106  TYR A N     1 
ATOM   668  C  CA    . TYR A 1 106 ? 37.849 66.487 20.037  1.00 15.10 ? 106  TYR A CA    1 
ATOM   669  C  C     . TYR A 1 106 ? 36.727 65.515 20.430  1.00 14.28 ? 106  TYR A C     1 
ATOM   670  O  O     . TYR A 1 106 ? 35.690 65.926 20.931  1.00 14.07 ? 106  TYR A O     1 
ATOM   671  C  CB    . TYR A 1 106 ? 37.778 66.845 18.550  1.00 15.87 ? 106  TYR A CB    1 
ATOM   672  C  CG    . TYR A 1 106 ? 36.457 67.413 18.113  1.00 18.08 ? 106  TYR A CG    1 
ATOM   673  C  CD1   . TYR A 1 106 ? 35.988 68.627 18.620  1.00 20.08 ? 106  TYR A CD1   1 
ATOM   674  C  CD2   . TYR A 1 106 ? 35.663 66.733 17.196  1.00 20.67 ? 106  TYR A CD2   1 
ATOM   675  C  CE1   . TYR A 1 106 ? 34.747 69.150 18.221  1.00 21.08 ? 106  TYR A CE1   1 
ATOM   676  C  CE2   . TYR A 1 106 ? 34.424 67.246 16.792  1.00 22.56 ? 106  TYR A CE2   1 
ATOM   677  C  CZ    . TYR A 1 106 ? 33.977 68.447 17.307  1.00 19.77 ? 106  TYR A CZ    1 
ATOM   678  O  OH    . TYR A 1 106 ? 32.760 68.930 16.906  1.00 22.19 ? 106  TYR A OH    1 
ATOM   679  N  N     . VAL A 1 107 ? 36.951 64.222 20.230  1.00 14.78 ? 107  VAL A N     1 
ATOM   680  C  CA    . VAL A 1 107 ? 35.984 63.214 20.659  1.00 15.05 ? 107  VAL A CA    1 
ATOM   681  C  C     . VAL A 1 107 ? 35.841 63.204 22.194  1.00 16.15 ? 107  VAL A C     1 
ATOM   682  O  O     . VAL A 1 107 ? 34.733 63.317 22.721  1.00 14.35 ? 107  VAL A O     1 
ATOM   683  C  CB    . VAL A 1 107 ? 36.366 61.808 20.123  1.00 14.24 ? 107  VAL A CB    1 
ATOM   684  C  CG1   . VAL A 1 107 ? 35.615 60.733 20.863  1.00 13.92 ? 107  VAL A CG1   1 
ATOM   685  C  CG2   . VAL A 1 107 ? 36.069 61.719 18.622  1.00 13.49 ? 107  VAL A CG2   1 
ATOM   686  N  N     . SER A 1 108 ? 36.971 63.145 22.895  1.00 16.14 ? 108  SER A N     1 
ATOM   687  C  CA    . SER A 1 108 ? 36.995 63.216 24.355  1.00 16.25 ? 108  SER A CA    1 
ATOM   688  C  C     . SER A 1 108 ? 36.290 64.460 24.888  1.00 17.18 ? 108  SER A C     1 
ATOM   689  O  O     . SER A 1 108 ? 35.560 64.392 25.874  1.00 15.82 ? 108  SER A O     1 
ATOM   690  C  CB    . SER A 1 108 ? 38.438 63.195 24.859  1.00 15.51 ? 108  SER A CB    1 
ATOM   691  O  OG    . SER A 1 108 ? 39.072 61.981 24.492  1.00 19.79 ? 108  SER A OG    1 
ATOM   692  N  N     . ARG A 1 109 ? 36.519 65.589 24.225  1.00 16.28 ? 109  ARG A N     1 
ATOM   693  C  CA    . ARG A 1 109 ? 35.805 66.827 24.504  1.00 16.55 ? 109  ARG A CA    1 
ATOM   694  C  C     . ARG A 1 109 ? 34.290 66.639 24.480  1.00 16.45 ? 109  ARG A C     1 
ATOM   695  O  O     . ARG A 1 109 ? 33.599 67.042 25.407  1.00 16.42 ? 109  ARG A O     1 
ATOM   696  C  CB    . ARG A 1 109 ? 36.206 67.877 23.480  1.00 20.45 ? 109  ARG A CB    1 
ATOM   697  C  CG    . ARG A 1 109 ? 36.120 69.292 23.971  1.00 27.74 ? 109  ARG A CG    1 
ATOM   698  C  CD    . ARG A 1 109 ? 37.320 70.109 23.467  1.00 32.92 ? 109  ARG A CD    1 
ATOM   699  N  NE    . ARG A 1 109 ? 37.365 70.218 22.006  1.00 35.90 ? 109  ARG A NE    1 
ATOM   700  C  CZ    . ARG A 1 109 ? 38.449 69.960 21.279  1.00 38.35 ? 109  ARG A CZ    1 
ATOM   701  N  NH1   . ARG A 1 109 ? 39.580 69.578 21.889  1.00 38.92 ? 109  ARG A NH1   1 
ATOM   702  N  NH2   . ARG A 1 109 ? 38.413 70.088 19.947  1.00 38.37 ? 109  ARG A NH2   1 
ATOM   703  N  N     . LEU A 1 110 ? 33.787 66.013 23.423  1.00 14.91 ? 110  LEU A N     1 
ATOM   704  C  CA    . LEU A 1 110 ? 32.365 65.719 23.301  1.00 14.52 ? 110  LEU A CA    1 
ATOM   705  C  C     . LEU A 1 110 ? 31.838 64.751 24.357  1.00 12.68 ? 110  LEU A C     1 
ATOM   706  O  O     . LEU A 1 110 ? 30.705 64.894 24.804  1.00 11.94 ? 110  LEU A O     1 
ATOM   707  C  CB    . LEU A 1 110 ? 32.047 65.190 21.895  1.00 15.34 ? 110  LEU A CB    1 
ATOM   708  C  CG    . LEU A 1 110 ? 32.234 66.153 20.714  1.00 15.18 ? 110  LEU A CG    1 
ATOM   709  C  CD1   . LEU A 1 110 ? 31.975 65.444 19.401  1.00 14.89 ? 110  LEU A CD1   1 
ATOM   710  C  CD2   . LEU A 1 110 ? 31.317 67.351 20.858  1.00 16.62 ? 110  LEU A CD2   1 
ATOM   711  N  N     . ASN A 1 111 ? 32.654 63.772 24.752  1.00 12.25 ? 111  ASN A N     1 
ATOM   712  C  CA    . ASN A 1 111 ? 32.282 62.838 25.827  1.00 12.92 ? 111  ASN A CA    1 
ATOM   713  C  C     . ASN A 1 111 ? 31.919 63.624 27.096  1.00 13.11 ? 111  ASN A C     1 
ATOM   714  O  O     . ASN A 1 111 ? 30.891 63.375 27.731  1.00 12.28 ? 111  ASN A O     1 
ATOM   715  C  CB    . ASN A 1 111 ? 33.439 61.880 26.170  1.00 14.21 ? 111  ASN A CB    1 
ATOM   716  C  CG    . ASN A 1 111 ? 33.739 60.866 25.071  1.00 15.72 ? 111  ASN A CG    1 
ATOM   717  O  OD1   . ASN A 1 111 ? 34.850 60.343 25.002  1.00 13.75 ? 111  ASN A OD1   1 
ATOM   718  N  ND2   . ASN A 1 111 ? 32.756 60.574 24.225  1.00 14.24 ? 111  ASN A ND2   1 
ATOM   719  N  N     . ALA A 1 112 ? 32.782 64.582 27.432  1.00 12.82 ? 112  ALA A N     1 
ATOM   720  C  CA    . ALA A 1 112 ? 32.656 65.389 28.637  1.00 13.39 ? 112  ALA A CA    1 
ATOM   721  C  C     . ALA A 1 112 ? 31.476 66.349 28.534  1.00 13.75 ? 112  ALA A C     1 
ATOM   722  O  O     . ALA A 1 112 ? 30.737 66.525 29.495  1.00 14.57 ? 112  ALA A O     1 
ATOM   723  C  CB    . ALA A 1 112 ? 33.940 66.161 28.881  1.00 10.57 ? 112  ALA A CB    1 
ATOM   724  N  N     . ILE A 1 113 ? 31.289 66.947 27.362  1.00 14.28 ? 113  ILE A N     1 
ATOM   725  C  CA    . ILE A 1 113 ? 30.114 67.771 27.090  1.00 16.01 ? 113  ILE A CA    1 
ATOM   726  C  C     . ILE A 1 113 ? 28.817 67.016 27.365  1.00 16.52 ? 113  ILE A C     1 
ATOM   727  O  O     . ILE A 1 113 ? 27.881 67.574 27.946  1.00 18.61 ? 113  ILE A O     1 
ATOM   728  C  CB    . ILE A 1 113 ? 30.109 68.291 25.626  1.00 16.03 ? 113  ILE A CB    1 
ATOM   729  C  CG1   . ILE A 1 113 ? 31.032 69.503 25.503  1.00 15.32 ? 113  ILE A CG1   1 
ATOM   730  C  CG2   . ILE A 1 113 ? 28.689 68.696 25.190  1.00 15.25 ? 113  ILE A CG2   1 
ATOM   731  C  CD1   . ILE A 1 113 ? 31.634 69.676 24.119  1.00 17.53 ? 113  ILE A CD1   1 
ATOM   732  N  N     . TYR A 1 114 ? 28.770 65.748 26.970  1.00 15.45 ? 114  TYR A N     1 
ATOM   733  C  CA    . TYR A 1 114 ? 27.576 64.944 27.170  1.00 18.11 ? 114  TYR A CA    1 
ATOM   734  C  C     . TYR A 1 114 ? 27.342 64.559 28.624  1.00 18.54 ? 114  TYR A C     1 
ATOM   735  O  O     . TYR A 1 114 ? 26.243 64.738 29.133  1.00 18.59 ? 114  TYR A O     1 
ATOM   736  C  CB    . TYR A 1 114 ? 27.615 63.694 26.295  1.00 20.39 ? 114  TYR A CB    1 
ATOM   737  C  CG    . TYR A 1 114 ? 27.325 63.999 24.859  1.00 24.03 ? 114  TYR A CG    1 
ATOM   738  C  CD1   . TYR A 1 114 ? 26.237 64.794 24.504  1.00 26.34 ? 114  TYR A CD1   1 
ATOM   739  C  CD2   . TYR A 1 114 ? 28.166 63.552 23.852  1.00 25.69 ? 114  TYR A CD2   1 
ATOM   740  C  CE1   . TYR A 1 114 ? 26.003 65.142 23.180  1.00 29.16 ? 114  TYR A CE1   1 
ATOM   741  C  CE2   . TYR A 1 114 ? 27.942 63.894 22.528  1.00 27.76 ? 114  TYR A CE2   1 
ATOM   742  C  CZ    . TYR A 1 114 ? 26.864 64.690 22.199  1.00 28.18 ? 114  TYR A CZ    1 
ATOM   743  O  OH    . TYR A 1 114 ? 26.670 65.070 20.888  1.00 32.37 ? 114  TYR A OH    1 
ATOM   744  N  N     . GLN A 1 115 ? 28.372 64.036 29.290  1.00 19.39 ? 115  GLN A N     1 
ATOM   745  C  CA    . GLN A 1 115 ? 28.290 63.733 30.722  1.00 19.98 ? 115  GLN A CA    1 
ATOM   746  C  C     . GLN A 1 115 ? 27.813 64.950 31.503  1.00 20.52 ? 115  GLN A C     1 
ATOM   747  O  O     . GLN A 1 115 ? 26.994 64.830 32.417  1.00 19.80 ? 115  GLN A O     1 
ATOM   748  C  CB    . GLN A 1 115 ? 29.649 63.277 31.260  1.00 19.62 ? 115  GLN A CB    1 
ATOM   749  C  CG    . GLN A 1 115 ? 29.738 63.234 32.789  1.00 21.92 ? 115  GLN A CG    1 
ATOM   750  C  CD    . GLN A 1 115 ? 30.478 62.011 33.311  1.00 24.48 ? 115  GLN A CD    1 
ATOM   751  O  OE1   . GLN A 1 115 ? 30.853 61.127 32.546  1.00 27.44 ? 115  GLN A OE1   1 
ATOM   752  N  NE2   . GLN A 1 115 ? 30.679 61.951 34.620  1.00 25.46 ? 115  GLN A NE2   1 
ATOM   753  N  N     . ASN A 1 116 ? 28.320 66.120 31.122  1.00 20.27 ? 116  ASN A N     1 
ATOM   754  C  CA    . ASN A 1 116 ? 28.034 67.354 31.834  1.00 22.44 ? 116  ASN A CA    1 
ATOM   755  C  C     . ASN A 1 116 ? 26.619 67.885 31.581  1.00 21.82 ? 116  ASN A C     1 
ATOM   756  O  O     . ASN A 1 116 ? 25.978 68.405 32.487  1.00 21.15 ? 116  ASN A O     1 
ATOM   757  C  CB    . ASN A 1 116 ? 29.063 68.422 31.483  1.00 25.64 ? 116  ASN A CB    1 
ATOM   758  C  CG    . ASN A 1 116 ? 28.941 69.637 32.366  1.00 30.78 ? 116  ASN A CG    1 
ATOM   759  O  OD1   . ASN A 1 116 ? 28.269 70.611 32.009  1.00 34.47 ? 116  ASN A OD1   1 
ATOM   760  N  ND2   . ASN A 1 116 ? 29.556 69.582 33.550  1.00 31.37 ? 116  ASN A ND2   1 
ATOM   761  N  N     . ASN A 1 117 ? 26.120 67.715 30.361  1.00 22.13 ? 117  ASN A N     1 
ATOM   762  C  CA    . ASN A 1 117 ? 24.748 68.099 30.049  1.00 22.04 ? 117  ASN A CA    1 
ATOM   763  C  C     . ASN A 1 117 ? 23.704 67.175 30.671  1.00 20.41 ? 117  ASN A C     1 
ATOM   764  O  O     . ASN A 1 117 ? 22.678 67.636 31.168  1.00 18.91 ? 117  ASN A O     1 
ATOM   765  C  CB    . ASN A 1 117 ? 24.547 68.193 28.535  1.00 26.03 ? 117  ASN A CB    1 
ATOM   766  C  CG    . ASN A 1 117 ? 25.043 69.519 27.965  1.00 30.12 ? 117  ASN A CG    1 
ATOM   767  O  OD1   . ASN A 1 117 ? 25.876 69.542 27.062  1.00 33.72 ? 117  ASN A OD1   1 
ATOM   768  N  ND2   . ASN A 1 117 ? 24.524 70.630 28.487  1.00 32.76 ? 117  ASN A ND2   1 
ATOM   769  N  N     . LEU A 1 118 ? 23.973 65.875 30.649  1.00 18.15 ? 118  LEU A N     1 
ATOM   770  C  CA    . LEU A 1 118 ? 23.178 64.913 31.404  1.00 17.76 ? 118  LEU A CA    1 
ATOM   771  C  C     . LEU A 1 118 ? 23.092 65.275 32.886  1.00 19.30 ? 118  LEU A C     1 
ATOM   772  O  O     . LEU A 1 118 ? 22.008 65.251 33.471  1.00 18.20 ? 118  LEU A O     1 
ATOM   773  C  CB    . LEU A 1 118 ? 23.759 63.503 31.251  1.00 17.58 ? 118  LEU A CB    1 
ATOM   774  C  CG    . LEU A 1 118 ? 23.625 62.750 29.918  1.00 15.66 ? 118  LEU A CG    1 
ATOM   775  C  CD1   . LEU A 1 118 ? 23.955 61.297 30.146  1.00 15.78 ? 118  LEU A CD1   1 
ATOM   776  C  CD2   . LEU A 1 118 ? 22.236 62.882 29.338  1.00 16.81 ? 118  LEU A CD2   1 
ATOM   777  N  N     . THR A 1 119 ? 24.234 65.619 33.483  1.00 19.46 ? 119  THR A N     1 
ATOM   778  C  CA    . THR A 1 119 ? 24.294 65.905 34.914  1.00 19.69 ? 119  THR A CA    1 
ATOM   779  C  C     . THR A 1 119 ? 23.563 67.193 35.255  1.00 19.91 ? 119  THR A C     1 
ATOM   780  O  O     . THR A 1 119 ? 22.830 67.240 36.241  1.00 20.67 ? 119  THR A O     1 
ATOM   781  C  CB    . THR A 1 119 ? 25.750 66.000 35.432  1.00 19.21 ? 119  THR A CB    1 
ATOM   782  O  OG1   . THR A 1 119 ? 26.377 64.723 35.306  1.00 17.97 ? 119  THR A OG1   1 
ATOM   783  C  CG2   . THR A 1 119 ? 25.777 66.398 36.905  1.00 18.69 ? 119  THR A CG2   1 
ATOM   784  N  N     . LYS A 1 120 ? 23.761 68.226 34.437  1.00 20.85 ? 120  LYS A N     1 
ATOM   785  C  CA    . LYS A 1 120 ? 23.045 69.494 34.594  1.00 22.26 ? 120  LYS A CA    1 
ATOM   786  C  C     . LYS A 1 120 ? 21.527 69.291 34.571  1.00 22.61 ? 120  LYS A C     1 
ATOM   787  O  O     . LYS A 1 120 ? 20.785 69.990 35.263  1.00 22.56 ? 120  LYS A O     1 
ATOM   788  C  CB    . LYS A 1 120 ? 23.449 70.477 33.489  1.00 24.74 ? 120  LYS A CB    1 
ATOM   789  C  CG    . LYS A 1 120 ? 24.686 71.326 33.798  1.00 30.35 ? 120  LYS A CG    1 
ATOM   790  C  CD    . LYS A 1 120 ? 24.987 72.324 32.653  1.00 34.28 ? 120  LYS A CD    1 
ATOM   791  C  CE    . LYS A 1 120 ? 26.208 73.202 32.967  1.00 35.83 ? 120  LYS A CE    1 
ATOM   792  N  NZ    . LYS A 1 120 ? 26.622 74.062 31.808  1.00 35.78 ? 120  LYS A NZ    1 
ATOM   793  N  N     . SER A 1 121 ? 21.075 68.326 33.776  1.00 22.35 ? 121  SER A N     1 
ATOM   794  C  CA    . SER A 1 121 ? 19.651 68.032 33.651  1.00 22.68 ? 121  SER A CA    1 
ATOM   795  C  C     . SER A 1 121 ? 19.201 67.016 34.691  1.00 22.69 ? 121  SER A C     1 
ATOM   796  O  O     . SER A 1 121 ? 18.059 66.560 34.658  1.00 22.55 ? 121  SER A O     1 
ATOM   797  C  CB    . SER A 1 121 ? 19.331 67.524 32.242  1.00 20.77 ? 121  SER A CB    1 
ATOM   798  O  OG    . SER A 1 121 ? 19.670 68.501 31.267  1.00 23.50 ? 121  SER A OG    1 
ATOM   799  N  N     . HIS A 1 122 ? 20.091 66.686 35.626  1.00 23.77 ? 122  HIS A N     1 
ATOM   800  C  CA    . HIS A 1 122 ? 19.802 65.690 36.664  1.00 24.45 ? 122  HIS A CA    1 
ATOM   801  C  C     . HIS A 1 122 ? 19.284 64.376 36.088  1.00 23.05 ? 122  HIS A C     1 
ATOM   802  O  O     . HIS A 1 122 ? 18.417 63.733 36.671  1.00 22.08 ? 122  HIS A O     1 
ATOM   803  C  CB    . HIS A 1 122 ? 18.784 66.239 37.666  1.00 27.14 ? 122  HIS A CB    1 
ATOM   804  C  CG    . HIS A 1 122 ? 19.259 67.455 38.391  1.00 31.42 ? 122  HIS A CG    1 
ATOM   805  N  ND1   . HIS A 1 122 ? 18.865 68.731 38.040  1.00 33.48 ? 122  HIS A ND1   1 
ATOM   806  C  CD2   . HIS A 1 122 ? 20.105 67.599 39.441  1.00 33.45 ? 122  HIS A CD2   1 
ATOM   807  C  CE1   . HIS A 1 122 ? 19.447 69.608 38.841  1.00 35.45 ? 122  HIS A CE1   1 
ATOM   808  N  NE2   . HIS A 1 122 ? 20.206 68.947 39.700  1.00 36.44 ? 122  HIS A NE2   1 
ATOM   809  N  N     . ILE A 1 123 ? 19.822 63.989 34.937  1.00 21.78 ? 123  ILE A N     1 
ATOM   810  C  CA    . ILE A 1 123 ? 19.695 62.626 34.440  1.00 21.26 ? 123  ILE A CA    1 
ATOM   811  C  C     . ILE A 1 123 ? 20.839 61.797 35.005  1.00 21.91 ? 123  ILE A C     1 
ATOM   812  O  O     . ILE A 1 123 ? 22.012 62.131 34.820  1.00 22.43 ? 123  ILE A O     1 
ATOM   813  C  CB    . ILE A 1 123 ? 19.752 62.606 32.903  1.00 20.28 ? 123  ILE A CB    1 
ATOM   814  C  CG1   . ILE A 1 123 ? 18.590 63.414 32.336  1.00 19.60 ? 123  ILE A CG1   1 
ATOM   815  C  CG2   . ILE A 1 123 ? 19.734 61.171 32.380  1.00 19.65 ? 123  ILE A CG2   1 
ATOM   816  C  CD1   . ILE A 1 123 ? 18.803 63.840 30.918  1.00 21.71 ? 123  ILE A CD1   1 
ATOM   817  N  N     . GLU A 1 124 ? 20.490 60.741 35.728  1.00 21.34 ? 124  GLU A N     1 
ATOM   818  C  CA    . GLU A 1 124 ? 21.477 59.881 36.354  1.00 22.32 ? 124  GLU A CA    1 
ATOM   819  C  C     . GLU A 1 124 ? 22.182 59.054 35.276  1.00 21.21 ? 124  GLU A C     1 
ATOM   820  O  O     . GLU A 1 124 ? 21.549 58.578 34.340  1.00 20.72 ? 124  GLU A O     1 
ATOM   821  C  CB    . GLU A 1 124 ? 20.783 58.983 37.384  1.00 25.06 ? 124  GLU A CB    1 
ATOM   822  C  CG    . GLU A 1 124 ? 21.664 57.916 38.028  1.00 30.48 ? 124  GLU A CG    1 
ATOM   823  C  CD    . GLU A 1 124 ? 22.572 58.431 39.151  1.00 34.20 ? 124  GLU A CD    1 
ATOM   824  O  OE1   . GLU A 1 124 ? 22.378 59.578 39.649  1.00 35.61 ? 124  GLU A OE1   1 
ATOM   825  O  OE2   . GLU A 1 124 ? 23.502 57.665 39.526  1.00 37.65 ? 124  GLU A OE2   1 
ATOM   826  N  N     . ILE A 1 125 ? 23.506 58.962 35.373  1.00 19.41 ? 125  ILE A N     1 
ATOM   827  C  CA    . ILE A 1 125 ? 24.286 58.045 34.555  1.00 16.86 ? 125  ILE A CA    1 
ATOM   828  C  C     . ILE A 1 125 ? 24.626 56.803 35.351  1.00 16.66 ? 125  ILE A C     1 
ATOM   829  O  O     . ILE A 1 125 ? 25.169 56.885 36.443  1.00 17.53 ? 125  ILE A O     1 
ATOM   830  C  CB    . ILE A 1 125 ? 25.587 58.707 34.051  1.00 16.74 ? 125  ILE A CB    1 
ATOM   831  C  CG1   . ILE A 1 125 ? 25.241 59.928 33.197  1.00 17.11 ? 125  ILE A CG1   1 
ATOM   832  C  CG2   . ILE A 1 125 ? 26.404 57.722 33.224  1.00 14.70 ? 125  ILE A CG2   1 
ATOM   833  C  CD1   . ILE A 1 125 ? 25.999 61.164 33.566  1.00 17.70 ? 125  ILE A CD1   1 
ATOM   834  N  N     . ILE A 1 126 ? 24.264 55.652 34.805  1.00 15.59 ? 126  ILE A N     1 
ATOM   835  C  CA    . ILE A 1 126 ? 24.632 54.359 35.359  1.00 15.27 ? 126  ILE A CA    1 
ATOM   836  C  C     . ILE A 1 126 ? 25.687 53.719 34.451  1.00 15.93 ? 126  ILE A C     1 
ATOM   837  O  O     . ILE A 1 126 ? 25.464 53.555 33.246  1.00 15.80 ? 126  ILE A O     1 
ATOM   838  C  CB    . ILE A 1 126 ? 23.389 53.445 35.437  1.00 15.32 ? 126  ILE A CB    1 
ATOM   839  C  CG1   . ILE A 1 126 ? 22.297 54.124 36.274  1.00 14.79 ? 126  ILE A CG1   1 
ATOM   840  C  CG2   . ILE A 1 126 ? 23.755 52.088 36.001  1.00 14.42 ? 126  ILE A CG2   1 
ATOM   841  C  CD1   . ILE A 1 126 ? 20.908 53.603 36.007  1.00 15.90 ? 126  ILE A CD1   1 
ATOM   842  N  N     . ARG A 1 127 ? 26.845 53.397 35.021  1.00 15.51 ? 127  ARG A N     1 
ATOM   843  C  CA    . ARG A 1 127 ? 27.982 52.944 34.224  1.00 15.35 ? 127  ARG A CA    1 
ATOM   844  C  C     . ARG A 1 127 ? 28.110 51.420 34.241  1.00 15.43 ? 127  ARG A C     1 
ATOM   845  O  O     . ARG A 1 127 ? 28.241 50.813 35.304  1.00 15.88 ? 127  ARG A O     1 
ATOM   846  C  CB    . ARG A 1 127 ? 29.281 53.590 34.721  1.00 14.68 ? 127  ARG A CB    1 
ATOM   847  C  CG    . ARG A 1 127 ? 29.333 55.096 34.569  1.00 15.01 ? 127  ARG A CG    1 
ATOM   848  C  CD    . ARG A 1 127 ? 30.203 55.494 33.410  1.00 14.07 ? 127  ARG A CD    1 
ATOM   849  N  NE    . ARG A 1 127 ? 29.961 56.868 32.988  1.00 14.78 ? 127  ARG A NE    1 
ATOM   850  C  CZ    . ARG A 1 127 ? 30.421 57.395 31.859  1.00 14.60 ? 127  ARG A CZ    1 
ATOM   851  N  NH1   . ARG A 1 127 ? 30.544 56.639 30.783  1.00 12.82 ? 127  ARG A NH1   1 
ATOM   852  N  NH2   . ARG A 1 127 ? 30.755 58.675 31.804  1.00 12.02 ? 127  ARG A NH2   1 
ATOM   853  N  N     . GLY A 1 128 ? 28.051 50.810 33.059  1.00 16.29 ? 128  GLY A N     1 
ATOM   854  C  CA    . GLY A 1 128 ? 28.158 49.366 32.955  1.00 17.08 ? 128  GLY A CA    1 
ATOM   855  C  C     . GLY A 1 128 ? 27.209 48.733 31.945  1.00 18.03 ? 128  GLY A C     1 
ATOM   856  O  O     . GLY A 1 128 ? 26.487 49.434 31.233  1.00 18.33 ? 128  GLY A O     1 
ATOM   857  N  N     . HIS A 1 129 ? 27.216 47.400 31.891  1.00 18.94 ? 129  HIS A N     1 
ATOM   858  C  CA    . HIS A 1 129 ? 26.428 46.629 30.927  1.00 19.93 ? 129  HIS A CA    1 
ATOM   859  C  C     . HIS A 1 129 ? 25.087 46.179 31.526  1.00 19.81 ? 129  HIS A C     1 
ATOM   860  O  O     . HIS A 1 129 ? 25.047 45.343 32.432  1.00 19.60 ? 129  HIS A O     1 
ATOM   861  C  CB    . HIS A 1 129 ? 27.235 45.412 30.456  1.00 20.62 ? 129  HIS A CB    1 
ATOM   862  C  CG    . HIS A 1 129 ? 26.560 44.612 29.384  1.00 23.37 ? 129  HIS A CG    1 
ATOM   863  N  ND1   . HIS A 1 129 ? 26.750 44.858 28.038  1.00 24.89 ? 129  HIS A ND1   1 
ATOM   864  C  CD2   . HIS A 1 129 ? 25.700 43.567 29.457  1.00 23.15 ? 129  HIS A CD2   1 
ATOM   865  C  CE1   . HIS A 1 129 ? 26.035 44.001 27.329  1.00 23.71 ? 129  HIS A CE1   1 
ATOM   866  N  NE2   . HIS A 1 129 ? 25.389 43.207 28.167  1.00 23.49 ? 129  HIS A NE2   1 
ATOM   867  N  N     . ALA A 1 130 ? 23.993 46.749 31.027  1.00 19.60 ? 130  ALA A N     1 
ATOM   868  C  CA    . ALA A 1 130 ? 22.657 46.276 31.373  1.00 19.42 ? 130  ALA A CA    1 
ATOM   869  C  C     . ALA A 1 130 ? 22.385 44.910 30.755  1.00 20.51 ? 130  ALA A C     1 
ATOM   870  O  O     . ALA A 1 130 ? 22.687 44.678 29.585  1.00 20.73 ? 130  ALA A O     1 
ATOM   871  C  CB    . ALA A 1 130 ? 21.620 47.271 30.915  1.00 18.23 ? 130  ALA A CB    1 
ATOM   872  N  N     . ALA A 1 131 ? 21.809 44.008 31.541  1.00 20.96 ? 131  ALA A N     1 
ATOM   873  C  CA    . ALA A 1 131 ? 20.922 42.988 30.997  1.00 20.98 ? 131  ALA A CA    1 
ATOM   874  C  C     . ALA A 1 131 ? 19.607 42.954 31.763  1.00 22.14 ? 131  ALA A C     1 
ATOM   875  O  O     . ALA A 1 131 ? 19.551 43.328 32.936  1.00 21.65 ? 131  ALA A O     1 
ATOM   876  C  CB    . ALA A 1 131 ? 21.590 41.642 31.047  1.00 20.38 ? 131  ALA A CB    1 
ATOM   877  N  N     . PHE A 1 132 ? 18.552 42.502 31.094  1.00 23.23 ? 132  PHE A N     1 
ATOM   878  C  CA    . PHE A 1 132 ? 17.286 42.214 31.753  1.00 25.15 ? 132  PHE A CA    1 
ATOM   879  C  C     . PHE A 1 132 ? 17.365 40.984 32.660  1.00 27.38 ? 132  PHE A C     1 
ATOM   880  O  O     . PHE A 1 132 ? 18.094 40.024 32.376  1.00 28.17 ? 132  PHE A O     1 
ATOM   881  C  CB    . PHE A 1 132 ? 16.195 42.008 30.712  1.00 24.22 ? 132  PHE A CB    1 
ATOM   882  C  CG    . PHE A 1 132 ? 15.779 43.266 30.008  1.00 23.05 ? 132  PHE A CG    1 
ATOM   883  C  CD1   . PHE A 1 132 ? 14.868 44.138 30.592  1.00 22.63 ? 132  PHE A CD1   1 
ATOM   884  C  CD2   . PHE A 1 132 ? 16.271 43.564 28.741  1.00 23.32 ? 132  PHE A CD2   1 
ATOM   885  C  CE1   . PHE A 1 132 ? 14.448 45.288 29.926  1.00 21.47 ? 132  PHE A CE1   1 
ATOM   886  C  CE2   . PHE A 1 132 ? 15.855 44.713 28.067  1.00 22.37 ? 132  PHE A CE2   1 
ATOM   887  C  CZ    . PHE A 1 132 ? 14.943 45.572 28.662  1.00 20.52 ? 132  PHE A CZ    1 
ATOM   888  N  N     . THR A 1 133 ? 16.610 41.026 33.755  1.00 29.38 ? 133  THR A N     1 
ATOM   889  C  CA    . THR A 1 133 ? 16.516 39.907 34.690  1.00 31.11 ? 133  THR A CA    1 
ATOM   890  C  C     . THR A 1 133 ? 15.243 39.087 34.452  1.00 33.93 ? 133  THR A C     1 
ATOM   891  O  O     . THR A 1 133 ? 14.445 39.378 33.547  1.00 32.10 ? 133  THR A O     1 
ATOM   892  C  CB    . THR A 1 133 ? 16.486 40.397 36.145  1.00 29.68 ? 133  THR A CB    1 
ATOM   893  O  OG1   . THR A 1 133 ? 15.237 41.059 36.387  1.00 29.50 ? 133  THR A OG1   1 
ATOM   894  C  CG2   . THR A 1 133 ? 17.641 41.351 36.416  1.00 27.89 ? 133  THR A CG2   1 
ATOM   895  N  N     . SER A 1 134 ? 15.068 38.056 35.278  1.00 37.72 ? 134  SER A N     1 
ATOM   896  C  CA    . SER A 1 134 ? 13.922 37.162 35.147  1.00 41.03 ? 134  SER A CA    1 
ATOM   897  C  C     . SER A 1 134 ? 12.828 37.564 36.133  1.00 42.70 ? 134  SER A C     1 
ATOM   898  O  O     . SER A 1 134 ? 11.818 36.873 36.249  1.00 43.95 ? 134  SER A O     1 
ATOM   899  C  CB    . SER A 1 134 ? 14.340 35.699 35.379  1.00 40.95 ? 134  SER A CB    1 
ATOM   900  O  OG    . SER A 1 134 ? 15.042 35.555 36.609  1.00 41.47 ? 134  SER A OG    1 
ATOM   901  N  N     . ASP A 1 135 ? 13.012 38.698 36.808  1.00 43.39 ? 135  ASP A N     1 
ATOM   902  C  CA    . ASP A 1 135 ? 11.928 39.336 37.548  1.00 43.83 ? 135  ASP A CA    1 
ATOM   903  C  C     . ASP A 1 135 ? 10.697 39.570 36.671  1.00 43.76 ? 135  ASP A C     1 
ATOM   904  O  O     . ASP A 1 135 ? 10.803 39.665 35.441  1.00 43.84 ? 135  ASP A O     1 
ATOM   905  C  CB    . ASP A 1 135 ? 12.408 40.662 38.153  1.00 44.06 ? 135  ASP A CB    1 
ATOM   906  C  CG    . ASP A 1 135 ? 13.402 40.456 39.295  1.00 45.77 ? 135  ASP A CG    1 
ATOM   907  O  OD1   . ASP A 1 135 ? 13.193 39.520 40.109  1.00 46.43 ? 135  ASP A OD1   1 
ATOM   908  O  OD2   . ASP A 1 135 ? 14.400 41.221 39.376  1.00 45.67 ? 135  ASP A OD2   1 
ATOM   909  N  N     . PRO A 1 136 ? 9.505  39.635 37.294  1.00 44.13 ? 136  PRO A N     1 
ATOM   910  C  CA    . PRO A 1 136 ? 8.241  39.662 36.542  1.00 43.44 ? 136  PRO A CA    1 
ATOM   911  C  C     . PRO A 1 136 ? 7.846  41.073 36.068  1.00 41.93 ? 136  PRO A C     1 
ATOM   912  O  O     . PRO A 1 136 ? 7.436  41.262 34.907  1.00 41.31 ? 136  PRO A O     1 
ATOM   913  C  CB    . PRO A 1 136 ? 7.220  39.094 37.542  1.00 44.14 ? 136  PRO A CB    1 
ATOM   914  C  CG    . PRO A 1 136 ? 7.771  39.460 38.904  1.00 44.74 ? 136  PRO A CG    1 
ATOM   915  C  CD    . PRO A 1 136 ? 9.283  39.642 38.758  1.00 44.66 ? 136  PRO A CD    1 
ATOM   916  N  N     . LYS A 1 137 ? 7.943  42.044 36.978  1.00 40.14 ? 137  LYS A N     1 
ATOM   917  C  CA    . LYS A 1 137 ? 8.218  43.437 36.626  1.00 38.94 ? 137  LYS A CA    1 
ATOM   918  C  C     . LYS A 1 137 ? 9.451  43.510 35.718  1.00 37.32 ? 137  LYS A C     1 
ATOM   919  O  O     . LYS A 1 137 ? 10.434 42.780 35.935  1.00 38.26 ? 137  LYS A O     1 
ATOM   920  C  CB    . LYS A 1 137 ? 8.445  44.254 37.903  1.00 40.10 ? 137  LYS A CB    1 
ATOM   921  C  CG    . LYS A 1 137 ? 7.656  45.566 37.961  1.00 42.15 ? 137  LYS A CG    1 
ATOM   922  C  CD    . LYS A 1 137 ? 8.379  46.601 38.842  1.00 44.01 ? 137  LYS A CD    1 
ATOM   923  C  CE    . LYS A 1 137 ? 7.707  47.987 38.775  1.00 45.00 ? 137  LYS A CE    1 
ATOM   924  N  NZ    . LYS A 1 137 ? 8.547  49.035 38.079  1.00 43.69 ? 137  LYS A NZ    1 
ATOM   925  N  N     . PRO A 1 138 ? 9.381  44.316 34.636  1.00 35.02 ? 138  PRO A N     1 
ATOM   926  C  CA    . PRO A 1 138 ? 10.566 44.620 33.821  1.00 31.25 ? 138  PRO A CA    1 
ATOM   927  C  C     . PRO A 1 138 ? 11.623 45.433 34.560  1.00 28.72 ? 138  PRO A C     1 
ATOM   928  O  O     . PRO A 1 138 ? 11.370 46.543 35.039  1.00 26.69 ? 138  PRO A O     1 
ATOM   929  C  CB    . PRO A 1 138 ? 9.995  45.379 32.619  1.00 31.99 ? 138  PRO A CB    1 
ATOM   930  C  CG    . PRO A 1 138 ? 8.562  44.925 32.547  1.00 31.84 ? 138  PRO A CG    1 
ATOM   931  C  CD    . PRO A 1 138 ? 8.144  44.783 33.981  1.00 33.75 ? 138  PRO A CD    1 
ATOM   932  N  N     . THR A 1 139 ? 12.815 44.848 34.629  1.00 26.07 ? 139  THR A N     1 
ATOM   933  C  CA    . THR A 1 139 ? 13.839 45.209 35.591  1.00 24.81 ? 139  THR A CA    1 
ATOM   934  C  C     . THR A 1 139 ? 15.149 44.821 34.918  1.00 25.30 ? 139  THR A C     1 
ATOM   935  O  O     . THR A 1 139 ? 15.241 43.738 34.329  1.00 25.85 ? 139  THR A O     1 
ATOM   936  C  CB    . THR A 1 139 ? 13.695 44.384 36.884  1.00 24.16 ? 139  THR A CB    1 
ATOM   937  O  OG1   . THR A 1 139 ? 12.422 44.654 37.477  1.00 24.51 ? 139  THR A OG1   1 
ATOM   938  C  CG2   . THR A 1 139 ? 14.798 44.725 37.881  1.00 22.77 ? 139  THR A CG2   1 
ATOM   939  N  N     . ILE A 1 140 ? 16.141 45.707 34.963  1.00 24.39 ? 140  ILE A N     1 
ATOM   940  C  CA    . ILE A 1 140 ? 17.487 45.363 34.510  1.00 23.99 ? 140  ILE A CA    1 
ATOM   941  C  C     . ILE A 1 140 ? 18.441 45.290 35.691  1.00 24.49 ? 140  ILE A C     1 
ATOM   942  O  O     . ILE A 1 140 ? 18.123 45.744 36.783  1.00 25.70 ? 140  ILE A O     1 
ATOM   943  C  CB    . ILE A 1 140 ? 18.051 46.403 33.504  1.00 24.41 ? 140  ILE A CB    1 
ATOM   944  C  CG1   . ILE A 1 140 ? 18.152 47.774 34.172  1.00 23.76 ? 140  ILE A CG1   1 
ATOM   945  C  CG2   . ILE A 1 140 ? 17.196 46.455 32.229  1.00 24.62 ? 140  ILE A CG2   1 
ATOM   946  C  CD1   . ILE A 1 140 ? 19.296 48.600 33.698  1.00 23.37 ? 140  ILE A CD1   1 
ATOM   947  N  N     . GLU A 1 141 ? 19.636 44.764 35.450  1.00 25.13 ? 141  GLU A N     1 
ATOM   948  C  CA    . GLU A 1 141 ? 20.696 44.844 36.427  1.00 25.05 ? 141  GLU A CA    1 
ATOM   949  C  C     . GLU A 1 141 ? 22.040 45.177 35.793  1.00 24.00 ? 141  GLU A C     1 
ATOM   950  O  O     . GLU A 1 141 ? 22.343 44.729 34.690  1.00 22.99 ? 141  GLU A O     1 
ATOM   951  C  CB    . GLU A 1 141 ? 20.741 43.544 37.224  1.00 28.41 ? 141  GLU A CB    1 
ATOM   952  C  CG    . GLU A 1 141 ? 21.877 42.599 36.908  1.00 33.02 ? 141  GLU A CG    1 
ATOM   953  C  CD    . GLU A 1 141 ? 21.983 41.473 37.927  1.00 37.80 ? 141  GLU A CD    1 
ATOM   954  O  OE1   . GLU A 1 141 ? 22.000 41.763 39.155  1.00 39.71 ? 141  GLU A OE1   1 
ATOM   955  O  OE2   . GLU A 1 141 ? 22.036 40.295 37.496  1.00 38.97 ? 141  GLU A OE2   1 
ATOM   956  N  N     . VAL A 1 142 ? 22.810 46.011 36.486  1.00 23.65 ? 142  VAL A N     1 
ATOM   957  C  CA    . VAL A 1 142 ? 24.122 46.471 36.041  1.00 23.99 ? 142  VAL A CA    1 
ATOM   958  C  C     . VAL A 1 142 ? 25.089 46.302 37.222  1.00 26.77 ? 142  VAL A C     1 
ATOM   959  O  O     . VAL A 1 142 ? 24.829 46.823 38.309  1.00 27.83 ? 142  VAL A O     1 
ATOM   960  C  CB    . VAL A 1 142 ? 24.082 47.982 35.658  1.00 22.59 ? 142  VAL A CB    1 
ATOM   961  C  CG1   . VAL A 1 142 ? 25.381 48.403 34.985  1.00 21.40 ? 142  VAL A CG1   1 
ATOM   962  C  CG2   . VAL A 1 142 ? 22.905 48.278 34.753  1.00 20.68 ? 142  VAL A CG2   1 
ATOM   963  N  N     . SER A 1 143 ? 26.204 45.597 36.994  1.00 29.08 ? 143  SER A N     1 
ATOM   964  C  CA    . SER A 1 143 ? 27.175 45.222 38.040  1.00 30.20 ? 143  SER A CA    1 
ATOM   965  C  C     . SER A 1 143 ? 26.535 44.786 39.364  1.00 31.31 ? 143  SER A C     1 
ATOM   966  O  O     . SER A 1 143 ? 26.604 45.516 40.357  1.00 32.15 ? 143  SER A O     1 
ATOM   967  C  CB    . SER A 1 143 ? 28.174 46.362 38.308  1.00 30.33 ? 143  SER A CB    1 
ATOM   968  O  OG    . SER A 1 143 ? 28.430 47.110 37.134  1.00 32.97 ? 143  SER A OG    1 
ATOM   969  N  N     . GLY A 1 144 ? 25.950 43.587 39.383  1.00 31.94 ? 144  GLY A N     1 
ATOM   970  C  CA    . GLY A 1 144 ? 24.520 43.436 39.593  1.00 31.62 ? 144  GLY A CA    1 
ATOM   971  C  C     . GLY A 1 144 ? 23.935 44.186 40.778  1.00 31.68 ? 144  GLY A C     1 
ATOM   972  O  O     . GLY A 1 144 ? 23.636 43.581 41.809  1.00 32.44 ? 144  GLY A O     1 
ATOM   973  N  N     . LYS A 1 145 ? 23.732 45.496 40.620  1.00 30.47 ? 145  LYS A N     1 
ATOM   974  C  CA    . LYS A 1 145 ? 22.551 46.175 41.158  1.00 28.79 ? 145  LYS A CA    1 
ATOM   975  C  C     . LYS A 1 145 ? 21.349 46.099 40.209  1.00 26.99 ? 145  LYS A C     1 
ATOM   976  O  O     . LYS A 1 145 ? 21.509 46.167 38.992  1.00 26.11 ? 145  LYS A O     1 
ATOM   977  C  CB    . LYS A 1 145 ? 22.894 47.639 41.450  1.00 30.85 ? 145  LYS A CB    1 
ATOM   978  C  CG    . LYS A 1 145 ? 22.165 48.216 42.657  1.00 36.53 ? 145  LYS A CG    1 
ATOM   979  C  CD    . LYS A 1 145 ? 21.144 49.293 42.250  1.00 38.47 ? 145  LYS A CD    1 
ATOM   980  C  CE    . LYS A 1 145 ? 20.060 49.513 43.318  1.00 40.20 ? 145  LYS A CE    1 
ATOM   981  N  NZ    . LYS A 1 145 ? 20.273 50.780 44.101  1.00 40.36 ? 145  LYS A NZ    1 
ATOM   982  N  N     . LYS A 1 146 ? 20.145 46.001 40.767  1.00 26.05 ? 146  LYS A N     1 
ATOM   983  C  CA    . LYS A 1 146 ? 18.918 46.049 39.970  1.00 24.78 ? 146  LYS A CA    1 
ATOM   984  C  C     . LYS A 1 146 ? 18.331 47.455 39.814  1.00 23.33 ? 146  LYS A C     1 
ATOM   985  O  O     . LYS A 1 146 ? 18.483 48.310 40.688  1.00 23.36 ? 146  LYS A O     1 
ATOM   986  C  CB    . LYS A 1 146 ? 17.867 45.112 40.564  1.00 27.30 ? 146  LYS A CB    1 
ATOM   987  C  CG    . LYS A 1 146 ? 17.859 43.733 39.937  1.00 30.47 ? 146  LYS A CG    1 
ATOM   988  C  CD    . LYS A 1 146 ? 17.068 42.722 40.775  1.00 33.11 ? 146  LYS A CD    1 
ATOM   989  C  CE    . LYS A 1 146 ? 17.719 41.326 40.737  1.00 34.58 ? 146  LYS A CE    1 
ATOM   990  N  NZ    . LYS A 1 146 ? 16.813 40.267 40.155  1.00 35.49 ? 146  LYS A NZ    1 
ATOM   991  N  N     . TYR A 1 147 ? 17.636 47.675 38.702  1.00 21.98 ? 147  TYR A N     1 
ATOM   992  C  CA    . TYR A 1 147 ? 17.033 48.971 38.377  1.00 21.44 ? 147  TYR A CA    1 
ATOM   993  C  C     . TYR A 1 147 ? 15.718 48.706 37.658  1.00 20.93 ? 147  TYR A C     1 
ATOM   994  O  O     . TYR A 1 147 ? 15.613 47.742 36.912  1.00 22.72 ? 147  TYR A O     1 
ATOM   995  C  CB    . TYR A 1 147 ? 17.950 49.770 37.438  1.00 22.25 ? 147  TYR A CB    1 
ATOM   996  C  CG    . TYR A 1 147 ? 19.288 50.194 38.031  1.00 22.24 ? 147  TYR A CG    1 
ATOM   997  C  CD1   . TYR A 1 147 ? 19.399 51.358 38.785  1.00 21.30 ? 147  TYR A CD1   1 
ATOM   998  C  CD2   . TYR A 1 147 ? 20.442 49.429 37.828  1.00 22.47 ? 147  TYR A CD2   1 
ATOM   999  C  CE1   . TYR A 1 147 ? 20.621 51.754 39.325  1.00 22.78 ? 147  TYR A CE1   1 
ATOM   1000 C  CE2   . TYR A 1 147 ? 21.668 49.818 38.368  1.00 22.88 ? 147  TYR A CE2   1 
ATOM   1001 C  CZ    . TYR A 1 147 ? 21.748 50.979 39.114  1.00 22.08 ? 147  TYR A CZ    1 
ATOM   1002 O  OH    . TYR A 1 147 ? 22.946 51.365 39.662  1.00 24.10 ? 147  TYR A OH    1 
ATOM   1003 N  N     . THR A 1 148 ? 14.730 49.567 37.837  1.00 20.86 ? 148  THR A N     1 
ATOM   1004 C  CA    . THR A 1 148 ? 13.499 49.439 37.071  1.00 22.84 ? 148  THR A CA    1 
ATOM   1005 C  C     . THR A 1 148 ? 12.878 50.796 36.779  1.00 22.71 ? 148  THR A C     1 
ATOM   1006 O  O     . THR A 1 148 ? 13.178 51.780 37.458  1.00 24.58 ? 148  THR A O     1 
ATOM   1007 C  CB    . THR A 1 148 ? 12.454 48.527 37.789  1.00 25.86 ? 148  THR A CB    1 
ATOM   1008 O  OG1   . THR A 1 148 ? 11.228 48.511 37.036  1.00 28.03 ? 148  THR A OG1   1 
ATOM   1009 C  CG2   . THR A 1 148 ? 12.164 49.027 39.205  1.00 26.38 ? 148  THR A CG2   1 
ATOM   1010 N  N     . ALA A 1 149 ? 12.041 50.846 35.747  1.00 22.28 ? 149  ALA A N     1 
ATOM   1011 C  CA    . ALA A 1 149 ? 11.127 51.962 35.527  1.00 21.20 ? 149  ALA A CA    1 
ATOM   1012 C  C     . ALA A 1 149 ? 9.849  51.421 34.914  1.00 20.39 ? 149  ALA A C     1 
ATOM   1013 O  O     . ALA A 1 149 ? 9.832  50.317 34.378  1.00 20.51 ? 149  ALA A O     1 
ATOM   1014 C  CB    . ALA A 1 149 ? 11.765 53.002 34.591  1.00 21.49 ? 149  ALA A CB    1 
ATOM   1015 N  N     . PRO A 1 150 ? 8.759  52.198 34.973  1.00 20.66 ? 150  PRO A N     1 
ATOM   1016 C  CA    . PRO A 1 150 ? 7.578  51.975 34.127  1.00 21.08 ? 150  PRO A CA    1 
ATOM   1017 C  C     . PRO A 1 150 ? 7.883  51.961 32.623  1.00 22.00 ? 150  PRO A C     1 
ATOM   1018 O  O     . PRO A 1 150 ? 7.164  51.335 31.845  1.00 22.81 ? 150  PRO A O     1 
ATOM   1019 C  CB    . PRO A 1 150 ? 6.646  53.135 34.492  1.00 20.07 ? 150  PRO A CB    1 
ATOM   1020 C  CG    . PRO A 1 150 ? 7.520  54.134 35.184  1.00 20.88 ? 150  PRO A CG    1 
ATOM   1021 C  CD    . PRO A 1 150 ? 8.566  53.336 35.886  1.00 19.65 ? 150  PRO A CD    1 
ATOM   1022 N  N     . HIS A 1 151 ? 8.936  52.672 32.221  1.00 21.40 ? 151  HIS A N     1 
ATOM   1023 C  CA    . HIS A 1 151 ? 9.239  52.882 30.811  1.00 20.51 ? 151  HIS A CA    1 
ATOM   1024 C  C     . HIS A 1 151 ? 10.715 52.627 30.576  1.00 21.01 ? 151  HIS A C     1 
ATOM   1025 O  O     . HIS A 1 151 ? 11.564 53.337 31.121  1.00 21.65 ? 151  HIS A O     1 
ATOM   1026 C  CB    . HIS A 1 151 ? 8.927  54.314 30.414  1.00 21.79 ? 151  HIS A CB    1 
ATOM   1027 C  CG    . HIS A 1 151 ? 7.493  54.688 30.599  1.00 23.71 ? 151  HIS A CG    1 
ATOM   1028 N  ND1   . HIS A 1 151 ? 6.489  54.190 29.795  1.00 22.53 ? 151  HIS A ND1   1 
ATOM   1029 C  CD2   . HIS A 1 151 ? 6.894  55.529 31.477  1.00 22.81 ? 151  HIS A CD2   1 
ATOM   1030 C  CE1   . HIS A 1 151 ? 5.334  54.712 30.166  1.00 23.71 ? 151  HIS A CE1   1 
ATOM   1031 N  NE2   . HIS A 1 151 ? 5.552  55.527 31.185  1.00 23.51 ? 151  HIS A NE2   1 
ATOM   1032 N  N     . ILE A 1 152 ? 11.020 51.610 29.778  1.00 18.44 ? 152  ILE A N     1 
ATOM   1033 C  CA    . ILE A 1 152 ? 12.402 51.281 29.467  1.00 17.75 ? 152  ILE A CA    1 
ATOM   1034 C  C     . ILE A 1 152 ? 12.646 51.391 27.958  1.00 17.71 ? 152  ILE A C     1 
ATOM   1035 O  O     . ILE A 1 152 ? 11.949 50.755 27.150  1.00 16.41 ? 152  ILE A O     1 
ATOM   1036 C  CB    . ILE A 1 152 ? 12.758 49.871 29.977  1.00 17.49 ? 152  ILE A CB    1 
ATOM   1037 C  CG1   . ILE A 1 152 ? 12.549 49.807 31.492  1.00 16.73 ? 152  ILE A CG1   1 
ATOM   1038 C  CG2   . ILE A 1 152 ? 14.190 49.518 29.614  1.00 16.31 ? 152  ILE A CG2   1 
ATOM   1039 C  CD1   . ILE A 1 152 ? 12.684 48.427 32.086  1.00 17.43 ? 152  ILE A CD1   1 
ATOM   1040 N  N     . LEU A 1 153 ? 13.604 52.241 27.591  1.00 15.14 ? 153  LEU A N     1 
ATOM   1041 C  CA    . LEU A 1 153 ? 14.026 52.373 26.205  1.00 14.93 ? 153  LEU A CA    1 
ATOM   1042 C  C     . LEU A 1 153 ? 15.281 51.554 25.937  1.00 14.93 ? 153  LEU A C     1 
ATOM   1043 O  O     . LEU A 1 153 ? 16.306 51.755 26.577  1.00 16.20 ? 153  LEU A O     1 
ATOM   1044 C  CB    . LEU A 1 153 ? 14.276 53.838 25.858  1.00 13.47 ? 153  LEU A CB    1 
ATOM   1045 C  CG    . LEU A 1 153 ? 14.907 54.102 24.492  1.00 11.32 ? 153  LEU A CG    1 
ATOM   1046 C  CD1   . LEU A 1 153 ? 14.017 53.557 23.385  1.00 11.48 ? 153  LEU A CD1   1 
ATOM   1047 C  CD2   . LEU A 1 153 ? 15.126 55.572 24.333  1.00 8.83  ? 153  LEU A CD2   1 
ATOM   1048 N  N     . ILE A 1 154 ? 15.185 50.615 25.005  1.00 13.77 ? 154  ILE A N     1 
ATOM   1049 C  CA    . ILE A 1 154 ? 16.351 49.907 24.511  1.00 13.98 ? 154  ILE A CA    1 
ATOM   1050 C  C     . ILE A 1 154 ? 16.946 50.654 23.318  1.00 14.45 ? 154  ILE A C     1 
ATOM   1051 O  O     . ILE A 1 154 ? 16.299 50.805 22.288  1.00 15.43 ? 154  ILE A O     1 
ATOM   1052 C  CB    . ILE A 1 154 ? 15.990 48.471 24.082  1.00 15.11 ? 154  ILE A CB    1 
ATOM   1053 C  CG1   . ILE A 1 154 ? 15.375 47.702 25.260  1.00 14.43 ? 154  ILE A CG1   1 
ATOM   1054 C  CG2   . ILE A 1 154 ? 17.229 47.757 23.552  1.00 13.61 ? 154  ILE A CG2   1 
ATOM   1055 C  CD1   . ILE A 1 154 ? 14.621 46.453 24.847  1.00 11.87 ? 154  ILE A CD1   1 
ATOM   1056 N  N     . ALA A 1 155 ? 18.168 51.145 23.481  1.00 12.49 ? 155  ALA A N     1 
ATOM   1057 C  CA    . ALA A 1 155 ? 18.816 51.960 22.459  1.00 11.76 ? 155  ALA A CA    1 
ATOM   1058 C  C     . ALA A 1 155 ? 20.289 51.595 22.340  1.00 11.82 ? 155  ALA A C     1 
ATOM   1059 O  O     . ALA A 1 155 ? 21.168 52.456 22.426  1.00 11.44 ? 155  ALA A O     1 
ATOM   1060 C  CB    . ALA A 1 155 ? 18.648 53.449 22.778  1.00 11.20 ? 155  ALA A CB    1 
ATOM   1061 N  N     . THR A 1 156 ? 20.545 50.306 22.135  1.00 11.52 ? 156  THR A N     1 
ATOM   1062 C  CA    . THR A 1 156 ? 21.878 49.732 22.310  1.00 12.43 ? 156  THR A CA    1 
ATOM   1063 C  C     . THR A 1 156 ? 22.699 49.719 21.011  1.00 12.03 ? 156  THR A C     1 
ATOM   1064 O  O     . THR A 1 156 ? 23.850 49.302 21.015  1.00 11.06 ? 156  THR A O     1 
ATOM   1065 C  CB    . THR A 1 156 ? 21.809 48.286 22.894  1.00 12.90 ? 156  THR A CB    1 
ATOM   1066 O  OG1   . THR A 1 156 ? 20.875 47.500 22.142  1.00 15.78 ? 156  THR A OG1   1 
ATOM   1067 C  CG2   . THR A 1 156 ? 21.378 48.315 24.362  1.00 13.87 ? 156  THR A CG2   1 
ATOM   1068 N  N     . GLY A 1 157 ? 22.103 50.189 19.916  1.00 10.82 ? 157  GLY A N     1 
ATOM   1069 C  CA    . GLY A 1 157 ? 22.844 50.373 18.681  1.00 12.78 ? 157  GLY A CA    1 
ATOM   1070 C  C     . GLY A 1 157 ? 23.269 49.076 18.000  1.00 13.66 ? 157  GLY A C     1 
ATOM   1071 O  O     . GLY A 1 157 ? 22.673 48.021 18.210  1.00 13.71 ? 157  GLY A O     1 
ATOM   1072 N  N     . GLY A 1 158 ? 24.297 49.165 17.166  1.00 13.76 ? 158  GLY A N     1 
ATOM   1073 C  CA    . GLY A 1 158 ? 24.810 47.997 16.484  1.00 13.93 ? 158  GLY A CA    1 
ATOM   1074 C  C     . GLY A 1 158 ? 26.319 47.932 16.585  1.00 14.85 ? 158  GLY A C     1 
ATOM   1075 O  O     . GLY A 1 158 ? 26.936 48.752 17.253  1.00 13.29 ? 158  GLY A O     1 
ATOM   1076 N  N     . MET A 1 159 ? 26.918 46.961 15.905  1.00 15.66 ? 159  MET A N     1 
ATOM   1077 C  CA    . MET A 1 159 ? 28.361 46.869 15.796  1.00 16.50 ? 159  MET A CA    1 
ATOM   1078 C  C     . MET A 1 159 ? 28.690 46.295 14.419  1.00 17.02 ? 159  MET A C     1 
ATOM   1079 O  O     . MET A 1 159 ? 27.801 45.804 13.722  1.00 16.08 ? 159  MET A O     1 
ATOM   1080 C  CB    . MET A 1 159 ? 28.901 45.970 16.900  1.00 20.48 ? 159  MET A CB    1 
ATOM   1081 C  CG    . MET A 1 159 ? 28.539 44.512 16.726  1.00 26.76 ? 159  MET A CG    1 
ATOM   1082 S  SD    . MET A 1 159 ? 28.666 43.581 18.269  1.00 36.34 ? 159  MET A SD    1 
ATOM   1083 C  CE    . MET A 1 159 ? 26.897 43.003 18.464  1.00 32.34 ? 159  MET A CE    1 
ATOM   1084 N  N     . PRO A 1 160 ? 29.961 46.385 13.987  1.00 16.79 ? 160  PRO A N     1 
ATOM   1085 C  CA    . PRO A 1 160 ? 30.289 45.840 12.666  1.00 17.51 ? 160  PRO A CA    1 
ATOM   1086 C  C     . PRO A 1 160 ? 30.226 44.312 12.705  1.00 19.01 ? 160  PRO A C     1 
ATOM   1087 O  O     . PRO A 1 160 ? 30.595 43.701 13.712  1.00 19.88 ? 160  PRO A O     1 
ATOM   1088 C  CB    . PRO A 1 160 ? 31.722 46.338 12.418  1.00 16.92 ? 160  PRO A CB    1 
ATOM   1089 C  CG    . PRO A 1 160 ? 31.989 47.353 13.458  1.00 15.57 ? 160  PRO A CG    1 
ATOM   1090 C  CD    . PRO A 1 160 ? 31.142 46.978 14.630  1.00 15.60 ? 160  PRO A CD    1 
ATOM   1091 N  N     . SER A 1 161 ? 29.747 43.691 11.630  1.00 20.47 ? 161  SER A N     1 
ATOM   1092 C  CA    . SER A 1 161 ? 29.921 42.247 11.475  1.00 23.36 ? 161  SER A CA    1 
ATOM   1093 C  C     . SER A 1 161 ? 31.262 41.908 10.837  1.00 23.23 ? 161  SER A C     1 
ATOM   1094 O  O     . SER A 1 161 ? 31.758 42.646 9.983   1.00 22.80 ? 161  SER A O     1 
ATOM   1095 C  CB    . SER A 1 161 ? 28.784 41.642 10.654  1.00 23.86 ? 161  SER A CB    1 
ATOM   1096 O  OG    . SER A 1 161 ? 28.643 42.311 9.421   1.00 27.13 ? 161  SER A OG    1 
ATOM   1097 N  N     . THR A 1 162 ? 31.853 40.804 11.283  1.00 25.40 ? 162  THR A N     1 
ATOM   1098 C  CA    . THR A 1 162 ? 33.015 40.216 10.622  1.00 26.33 ? 162  THR A CA    1 
ATOM   1099 C  C     . THR A 1 162 ? 32.746 38.749 10.331  1.00 26.88 ? 162  THR A C     1 
ATOM   1100 O  O     . THR A 1 162 ? 32.067 38.075 11.105  1.00 28.60 ? 162  THR A O     1 
ATOM   1101 C  CB    . THR A 1 162 ? 34.258 40.293 11.511  1.00 27.12 ? 162  THR A CB    1 
ATOM   1102 O  OG1   . THR A 1 162 ? 33.966 39.686 12.776  1.00 30.41 ? 162  THR A OG1   1 
ATOM   1103 C  CG2   . THR A 1 162 ? 34.664 41.727 11.735  1.00 26.13 ? 162  THR A CG2   1 
ATOM   1104 N  N     . PRO A 1 163 ? 33.310 38.224 9.233   1.00 26.89 ? 163  PRO A N     1 
ATOM   1105 C  CA    . PRO A 1 163 ? 33.232 36.795 8.899   1.00 27.54 ? 163  PRO A CA    1 
ATOM   1106 C  C     . PRO A 1 163 ? 33.743 35.911 10.031  1.00 28.23 ? 163  PRO A C     1 
ATOM   1107 O  O     . PRO A 1 163 ? 34.632 36.312 10.786  1.00 27.43 ? 163  PRO A O     1 
ATOM   1108 C  CB    . PRO A 1 163 ? 34.133 36.668 7.675   1.00 26.76 ? 163  PRO A CB    1 
ATOM   1109 C  CG    . PRO A 1 163 ? 34.255 38.052 7.141   1.00 25.47 ? 163  PRO A CG    1 
ATOM   1110 C  CD    . PRO A 1 163 ? 34.194 38.951 8.310   1.00 25.52 ? 163  PRO A CD    1 
ATOM   1111 N  N     . HIS A 1 164 ? 33.185 34.705 10.137  1.00 31.59 ? 164  HIS A N     1 
ATOM   1112 C  CA    . HIS A 1 164 ? 33.741 33.674 11.023  1.00 33.99 ? 164  HIS A CA    1 
ATOM   1113 C  C     . HIS A 1 164 ? 34.977 33.039 10.384  1.00 33.29 ? 164  HIS A C     1 
ATOM   1114 O  O     . HIS A 1 164 ? 35.082 32.972 9.159   1.00 32.71 ? 164  HIS A O     1 
ATOM   1115 C  CB    . HIS A 1 164 ? 32.688 32.594 11.333  1.00 37.84 ? 164  HIS A CB    1 
ATOM   1116 C  CG    . HIS A 1 164 ? 31.543 33.083 12.175  1.00 42.72 ? 164  HIS A CG    1 
ATOM   1117 N  ND1   . HIS A 1 164 ? 31.388 32.734 13.504  1.00 44.98 ? 164  HIS A ND1   1 
ATOM   1118 C  CD2   . HIS A 1 164 ? 30.504 33.909 11.882  1.00 43.53 ? 164  HIS A CD2   1 
ATOM   1119 C  CE1   . HIS A 1 164 ? 30.308 33.323 13.992  1.00 45.15 ? 164  HIS A CE1   1 
ATOM   1120 N  NE2   . HIS A 1 164 ? 29.754 34.042 13.029  1.00 44.96 ? 164  HIS A NE2   1 
ATOM   1121 N  N     . GLU A 1 165 ? 35.913 32.593 11.212  1.00 32.95 ? 165  GLU A N     1 
ATOM   1122 C  CA    . GLU A 1 165 ? 37.048 31.816 10.734  1.00 34.06 ? 165  GLU A CA    1 
ATOM   1123 C  C     . GLU A 1 165 ? 36.610 30.553 9.993   1.00 34.34 ? 165  GLU A C     1 
ATOM   1124 O  O     . GLU A 1 165 ? 37.313 30.082 9.096   1.00 35.42 ? 165  GLU A O     1 
ATOM   1125 C  CB    . GLU A 1 165 ? 37.977 31.451 11.898  1.00 35.83 ? 165  GLU A CB    1 
ATOM   1126 C  CG    . GLU A 1 165 ? 39.486 31.695 11.630  1.00 37.05 ? 165  GLU A CG    1 
ATOM   1127 C  CD    . GLU A 1 165 ? 39.906 33.149 11.824  1.00 37.47 ? 165  GLU A CD    1 
ATOM   1128 O  OE1   . GLU A 1 165 ? 39.051 33.986 12.191  1.00 39.17 ? 165  GLU A OE1   1 
ATOM   1129 O  OE2   . GLU A 1 165 ? 41.098 33.466 11.612  1.00 38.85 ? 165  GLU A OE2   1 
ATOM   1130 N  N     . SER A 1 166 ? 35.434 30.025 10.327  1.00 34.05 ? 166  SER A N     1 
ATOM   1131 C  CA    . SER A 1 166 ? 34.945 28.825 9.654   1.00 34.37 ? 166  SER A CA    1 
ATOM   1132 C  C     . SER A 1 166 ? 34.558 29.050 8.184   1.00 34.29 ? 166  SER A C     1 
ATOM   1133 O  O     . SER A 1 166 ? 34.713 28.147 7.362   1.00 34.94 ? 166  SER A O     1 
ATOM   1134 C  CB    . SER A 1 166 ? 33.795 28.175 10.447  1.00 34.29 ? 166  SER A CB    1 
ATOM   1135 O  OG    . SER A 1 166 ? 32.544 28.794 10.188  1.00 37.15 ? 166  SER A OG    1 
ATOM   1136 N  N     . GLN A 1 167 ? 34.127 30.259 7.832   1.00 33.91 ? 167  GLN A N     1 
ATOM   1137 C  CA    . GLN A 1 167 ? 33.881 30.586 6.420   1.00 33.66 ? 167  GLN A CA    1 
ATOM   1138 C  C     . GLN A 1 167 ? 35.134 31.061 5.671   1.00 31.76 ? 167  GLN A C     1 
ATOM   1139 O  O     . GLN A 1 167 ? 35.344 30.697 4.510   1.00 31.84 ? 167  GLN A O     1 
ATOM   1140 C  CB    . GLN A 1 167 ? 32.783 31.646 6.285   1.00 36.73 ? 167  GLN A CB    1 
ATOM   1141 C  CG    . GLN A 1 167 ? 31.708 31.617 7.393   1.00 42.40 ? 167  GLN A CG    1 
ATOM   1142 C  CD    . GLN A 1 167 ? 31.281 33.030 7.864   1.00 45.99 ? 167  GLN A CD    1 
ATOM   1143 O  OE1   . GLN A 1 167 ? 30.822 33.208 9.007   1.00 47.20 ? 167  GLN A OE1   1 
ATOM   1144 N  NE2   . GLN A 1 167 ? 31.434 34.033 6.986   1.00 45.86 ? 167  GLN A NE2   1 
ATOM   1145 N  N     . ILE A 1 168 ? 35.930 31.912 6.319   1.00 29.57 ? 168  ILE A N     1 
ATOM   1146 C  CA    . ILE A 1 168 ? 37.121 32.504 5.708   1.00 26.91 ? 168  ILE A CA    1 
ATOM   1147 C  C     . ILE A 1 168 ? 38.260 32.427 6.724   1.00 27.52 ? 168  ILE A C     1 
ATOM   1148 O  O     . ILE A 1 168 ? 38.310 33.217 7.677   1.00 28.14 ? 168  ILE A O     1 
ATOM   1149 C  CB    . ILE A 1 168 ? 36.891 33.996 5.305   1.00 25.54 ? 168  ILE A CB    1 
ATOM   1150 C  CG1   . ILE A 1 168 ? 35.779 34.097 4.257   1.00 24.22 ? 168  ILE A CG1   1 
ATOM   1151 C  CG2   . ILE A 1 168 ? 38.177 34.609 4.753   1.00 23.66 ? 168  ILE A CG2   1 
ATOM   1152 C  CD1   . ILE A 1 168 ? 35.434 35.505 3.852   1.00 22.03 ? 168  ILE A CD1   1 
ATOM   1153 N  N     . PRO A 1 169 ? 39.170 31.447 6.557   1.00 27.17 ? 169  PRO A N     1 
ATOM   1154 C  CA    . PRO A 1 169 ? 40.346 31.342 7.438   1.00 25.82 ? 169  PRO A CA    1 
ATOM   1155 C  C     . PRO A 1 169 ? 41.175 32.625 7.431   1.00 24.56 ? 169  PRO A C     1 
ATOM   1156 O  O     . PRO A 1 169 ? 41.487 33.165 6.370   1.00 25.66 ? 169  PRO A O     1 
ATOM   1157 C  CB    . PRO A 1 169 ? 41.135 30.162 6.856   1.00 25.61 ? 169  PRO A CB    1 
ATOM   1158 C  CG    . PRO A 1 169 ? 40.139 29.386 6.034   1.00 26.60 ? 169  PRO A CG    1 
ATOM   1159 C  CD    . PRO A 1 169 ? 39.127 30.377 5.540   1.00 26.76 ? 169  PRO A CD    1 
ATOM   1160 N  N     . GLY A 1 170 ? 41.487 33.134 8.619   1.00 23.85 ? 170  GLY A N     1 
ATOM   1161 C  CA    . GLY A 1 170 ? 42.244 34.370 8.722   1.00 22.57 ? 170  GLY A CA    1 
ATOM   1162 C  C     . GLY A 1 170 ? 41.405 35.637 8.814   1.00 22.25 ? 170  GLY A C     1 
ATOM   1163 O  O     . GLY A 1 170 ? 41.955 36.733 8.915   1.00 22.60 ? 170  GLY A O     1 
ATOM   1164 N  N     . ALA A 1 171 ? 40.082 35.506 8.787   1.00 21.52 ? 171  ALA A N     1 
ATOM   1165 C  CA    . ALA A 1 171 ? 39.210 36.680 8.782   1.00 22.06 ? 171  ALA A CA    1 
ATOM   1166 C  C     . ALA A 1 171 ? 39.511 37.646 9.936   1.00 21.75 ? 171  ALA A C     1 
ATOM   1167 O  O     . ALA A 1 171 ? 39.469 38.860 9.760   1.00 21.96 ? 171  ALA A O     1 
ATOM   1168 C  CB    . ALA A 1 171 ? 37.745 36.252 8.806   1.00 21.14 ? 171  ALA A CB    1 
ATOM   1169 N  N     . SER A 1 172 ? 39.875 37.105 11.095  1.00 21.80 ? 172  SER A N     1 
ATOM   1170 C  CA    . SER A 1 172 ? 40.122 37.933 12.269  1.00 22.59 ? 172  SER A CA    1 
ATOM   1171 C  C     . SER A 1 172 ? 41.443 38.693 12.209  1.00 21.98 ? 172  SER A C     1 
ATOM   1172 O  O     . SER A 1 172 ? 41.749 39.473 13.101  1.00 22.58 ? 172  SER A O     1 
ATOM   1173 C  CB    . SER A 1 172 ? 40.059 37.092 13.550  1.00 23.37 ? 172  SER A CB    1 
ATOM   1174 O  OG    . SER A 1 172 ? 40.922 35.974 13.470  1.00 26.38 ? 172  SER A OG    1 
ATOM   1175 N  N     . LEU A 1 173 ? 42.210 38.499 11.145  1.00 21.59 ? 173  LEU A N     1 
ATOM   1176 C  CA    . LEU A 1 173 ? 43.333 39.388 10.866  1.00 21.27 ? 173  LEU A CA    1 
ATOM   1177 C  C     . LEU A 1 173 ? 42.895 40.754 10.320  1.00 21.83 ? 173  LEU A C     1 
ATOM   1178 O  O     . LEU A 1 173 ? 43.585 41.753 10.528  1.00 22.75 ? 173  LEU A O     1 
ATOM   1179 C  CB    . LEU A 1 173 ? 44.310 38.726 9.896   1.00 21.58 ? 173  LEU A CB    1 
ATOM   1180 C  CG    . LEU A 1 173 ? 44.977 37.453 10.415  1.00 21.53 ? 173  LEU A CG    1 
ATOM   1181 C  CD1   . LEU A 1 173 ? 45.702 36.747 9.282   1.00 21.31 ? 173  LEU A CD1   1 
ATOM   1182 C  CD2   . LEU A 1 173 ? 45.935 37.804 11.538  1.00 22.81 ? 173  LEU A CD2   1 
ATOM   1183 N  N     . GLY A 1 174 ? 41.746 40.798 9.644   1.00 20.60 ? 174  GLY A N     1 
ATOM   1184 C  CA    . GLY A 1 174 ? 41.159 42.068 9.255   1.00 19.85 ? 174  GLY A CA    1 
ATOM   1185 C  C     . GLY A 1 174 ? 40.666 42.910 10.423  1.00 18.92 ? 174  GLY A C     1 
ATOM   1186 O  O     . GLY A 1 174 ? 40.379 42.384 11.504  1.00 19.23 ? 174  GLY A O     1 
ATOM   1187 N  N     . ILE A 1 175 ? 40.583 44.221 10.203  1.00 17.33 ? 175  ILE A N     1 
ATOM   1188 C  CA    . ILE A 1 175 ? 39.916 45.133 11.128  1.00 17.90 ? 175  ILE A CA    1 
ATOM   1189 C  C     . ILE A 1 175 ? 38.521 45.562 10.645  1.00 18.56 ? 175  ILE A C     1 
ATOM   1190 O  O     . ILE A 1 175 ? 38.107 45.235 9.537   1.00 19.40 ? 175  ILE A O     1 
ATOM   1191 C  CB    . ILE A 1 175 ? 40.776 46.401 11.403  1.00 17.37 ? 175  ILE A CB    1 
ATOM   1192 C  CG1   . ILE A 1 175 ? 40.992 47.193 10.115  1.00 15.35 ? 175  ILE A CG1   1 
ATOM   1193 C  CG2   . ILE A 1 175 ? 42.108 46.020 12.038  1.00 16.95 ? 175  ILE A CG2   1 
ATOM   1194 C  CD1   . ILE A 1 175 ? 41.417 48.614 10.363  1.00 17.02 ? 175  ILE A CD1   1 
ATOM   1195 N  N     . THR A 1 176 ? 37.794 46.279 11.492  1.00 17.74 ? 176  THR A N     1 
ATOM   1196 C  CA    . THR A 1 176 ? 36.549 46.893 11.071  1.00 17.28 ? 176  THR A CA    1 
ATOM   1197 C  C     . THR A 1 176 ? 36.667 48.411 11.125  1.00 17.39 ? 176  THR A C     1 
ATOM   1198 O  O     . THR A 1 176 ? 37.739 48.947 11.432  1.00 17.16 ? 176  THR A O     1 
ATOM   1199 C  CB    . THR A 1 176 ? 35.384 46.427 11.952  1.00 16.87 ? 176  THR A CB    1 
ATOM   1200 O  OG1   . THR A 1 176 ? 35.604 46.846 13.301  1.00 20.00 ? 176  THR A OG1   1 
ATOM   1201 C  CG2   . THR A 1 176 ? 35.284 44.922 11.927  1.00 16.72 ? 176  THR A CG2   1 
ATOM   1202 N  N     . SER A 1 177 ? 35.569 49.102 10.821  1.00 17.32 ? 177  SER A N     1 
ATOM   1203 C  CA    . SER A 1 177 ? 35.542 50.555 10.895  1.00 17.07 ? 177  SER A CA    1 
ATOM   1204 C  C     . SER A 1 177 ? 35.930 51.045 12.283  1.00 17.10 ? 177  SER A C     1 
ATOM   1205 O  O     . SER A 1 177 ? 36.595 52.064 12.407  1.00 17.36 ? 177  SER A O     1 
ATOM   1206 C  CB    . SER A 1 177 ? 34.155 51.086 10.520  1.00 17.83 ? 177  SER A CB    1 
ATOM   1207 O  OG    . SER A 1 177 ? 33.162 50.573 11.385  1.00 14.72 ? 177  SER A OG    1 
ATOM   1208 N  N     . ASP A 1 178 ? 35.511 50.307 13.312  1.00 17.60 ? 178  ASP A N     1 
ATOM   1209 C  CA    . ASP A 1 178 ? 35.977 50.503 14.691  1.00 18.97 ? 178  ASP A CA    1 
ATOM   1210 C  C     . ASP A 1 178 ? 37.505 50.563 14.809  1.00 18.46 ? 178  ASP A C     1 
ATOM   1211 O  O     . ASP A 1 178 ? 38.059 51.518 15.353  1.00 19.27 ? 178  ASP A O     1 
ATOM   1212 C  CB    . ASP A 1 178 ? 35.459 49.367 15.585  1.00 19.69 ? 178  ASP A CB    1 
ATOM   1213 C  CG    . ASP A 1 178 ? 34.022 49.575 16.048  1.00 23.21 ? 178  ASP A CG    1 
ATOM   1214 O  OD1   . ASP A 1 178 ? 33.325 50.508 15.585  1.00 22.31 ? 178  ASP A OD1   1 
ATOM   1215 O  OD2   . ASP A 1 178 ? 33.574 48.772 16.891  1.00 26.35 ? 178  ASP A OD2   1 
ATOM   1216 N  N     . GLY A 1 179 ? 38.175 49.537 14.289  1.00 18.37 ? 179  GLY A N     1 
ATOM   1217 C  CA    . GLY A 1 179 ? 39.627 49.527 14.264  1.00 18.30 ? 179  GLY A CA    1 
ATOM   1218 C  C     . GLY A 1 179 ? 40.232 50.627 13.409  1.00 18.21 ? 179  GLY A C     1 
ATOM   1219 O  O     . GLY A 1 179 ? 41.346 51.077 13.662  1.00 19.08 ? 179  GLY A O     1 
ATOM   1220 N  N     . PHE A 1 180 ? 39.508 51.054 12.382  1.00 17.67 ? 180  PHE A N     1 
ATOM   1221 C  CA    . PHE A 1 180 ? 39.960 52.161 11.561  1.00 17.97 ? 180  PHE A CA    1 
ATOM   1222 C  C     . PHE A 1 180 ? 40.323 53.378 12.419  1.00 19.21 ? 180  PHE A C     1 
ATOM   1223 O  O     . PHE A 1 180 ? 41.297 54.077 12.127  1.00 18.29 ? 180  PHE A O     1 
ATOM   1224 C  CB    . PHE A 1 180 ? 38.894 52.524 10.520  1.00 17.47 ? 180  PHE A CB    1 
ATOM   1225 C  CG    . PHE A 1 180 ? 39.261 53.695 9.677   1.00 18.97 ? 180  PHE A CG    1 
ATOM   1226 C  CD1   . PHE A 1 180 ? 40.146 53.546 8.609   1.00 18.88 ? 180  PHE A CD1   1 
ATOM   1227 C  CD2   . PHE A 1 180 ? 38.775 54.960 9.980   1.00 18.10 ? 180  PHE A CD2   1 
ATOM   1228 C  CE1   . PHE A 1 180 ? 40.546 54.643 7.858   1.00 20.48 ? 180  PHE A CE1   1 
ATOM   1229 C  CE2   . PHE A 1 180 ? 39.165 56.064 9.239   1.00 19.50 ? 180  PHE A CE2   1 
ATOM   1230 C  CZ    . PHE A 1 180 ? 40.054 55.909 8.177   1.00 20.14 ? 180  PHE A CZ    1 
ATOM   1231 N  N     . PHE A 1 181 ? 39.578 53.593 13.506  1.00 19.54 ? 181  PHE A N     1 
ATOM   1232 C  CA    . PHE A 1 181 ? 39.760 54.783 14.348  1.00 20.40 ? 181  PHE A CA    1 
ATOM   1233 C  C     . PHE A 1 181 ? 40.780 54.599 15.469  1.00 20.42 ? 181  PHE A C     1 
ATOM   1234 O  O     . PHE A 1 181 ? 41.063 55.526 16.211  1.00 21.25 ? 181  PHE A O     1 
ATOM   1235 C  CB    . PHE A 1 181 ? 38.419 55.231 14.927  1.00 20.09 ? 181  PHE A CB    1 
ATOM   1236 C  CG    . PHE A 1 181 ? 37.456 55.693 13.884  1.00 22.07 ? 181  PHE A CG    1 
ATOM   1237 C  CD1   . PHE A 1 181 ? 37.796 56.745 13.030  1.00 22.55 ? 181  PHE A CD1   1 
ATOM   1238 C  CD2   . PHE A 1 181 ? 36.239 55.045 13.703  1.00 20.77 ? 181  PHE A CD2   1 
ATOM   1239 C  CE1   . PHE A 1 181 ? 36.940 57.145 12.007  1.00 22.40 ? 181  PHE A CE1   1 
ATOM   1240 C  CE2   . PHE A 1 181 ? 35.376 55.435 12.684  1.00 21.17 ? 181  PHE A CE2   1 
ATOM   1241 C  CZ    . PHE A 1 181 ? 35.723 56.482 11.835  1.00 22.58 ? 181  PHE A CZ    1 
ATOM   1242 N  N     . GLN A 1 182 ? 41.336 53.400 15.572  1.00 21.86 ? 182  GLN A N     1 
ATOM   1243 C  CA    . GLN A 1 182 ? 42.526 53.163 16.373  1.00 22.93 ? 182  GLN A CA    1 
ATOM   1244 C  C     . GLN A 1 182 ? 43.805 53.161 15.549  1.00 22.79 ? 182  GLN A C     1 
ATOM   1245 O  O     . GLN A 1 182 ? 44.894 53.008 16.100  1.00 24.11 ? 182  GLN A O     1 
ATOM   1246 C  CB    . GLN A 1 182 ? 42.417 51.819 17.081  1.00 24.53 ? 182  GLN A CB    1 
ATOM   1247 C  CG    . GLN A 1 182 ? 41.177 51.637 17.923  1.00 27.87 ? 182  GLN A CG    1 
ATOM   1248 C  CD    . GLN A 1 182 ? 40.851 50.170 18.143  1.00 31.26 ? 182  GLN A CD    1 
ATOM   1249 O  OE1   . GLN A 1 182 ? 39.678 49.801 18.292  1.00 34.55 ? 182  GLN A OE1   1 
ATOM   1250 N  NE2   . GLN A 1 182 ? 41.885 49.318 18.158  1.00 30.77 ? 182  GLN A NE2   1 
ATOM   1251 N  N     . LEU A 1 183 ? 43.682 53.262 14.230  1.00 22.65 ? 183  LEU A N     1 
ATOM   1252 C  CA    . LEU A 1 183 ? 44.870 53.275 13.389  1.00 23.18 ? 183  LEU A CA    1 
ATOM   1253 C  C     . LEU A 1 183 ? 45.767 54.453 13.778  1.00 24.65 ? 183  LEU A C     1 
ATOM   1254 O  O     . LEU A 1 183 ? 45.314 55.600 13.850  1.00 23.04 ? 183  LEU A O     1 
ATOM   1255 C  CB    . LEU A 1 183 ? 44.489 53.364 11.912  1.00 21.50 ? 183  LEU A CB    1 
ATOM   1256 C  CG    . LEU A 1 183 ? 44.221 52.020 11.250  1.00 20.85 ? 183  LEU A CG    1 
ATOM   1257 C  CD1   . LEU A 1 183 ? 43.691 52.253 9.851   1.00 21.40 ? 183  LEU A CD1   1 
ATOM   1258 C  CD2   . LEU A 1 183 ? 45.493 51.202 11.219  1.00 20.23 ? 183  LEU A CD2   1 
ATOM   1259 N  N     . GLU A 1 184 ? 47.023 54.145 14.083  1.00 25.24 ? 184  GLU A N     1 
ATOM   1260 C  CA    . GLU A 1 184 ? 47.976 55.144 14.552  1.00 26.23 ? 184  GLU A CA    1 
ATOM   1261 C  C     . GLU A 1 184 ? 48.869 55.641 13.418  1.00 24.95 ? 184  GLU A C     1 
ATOM   1262 O  O     . GLU A 1 184 ? 49.456 56.716 13.521  1.00 23.73 ? 184  GLU A O     1 
ATOM   1263 C  CB    . GLU A 1 184 ? 48.835 54.551 15.671  1.00 28.66 ? 184  GLU A CB    1 
ATOM   1264 C  CG    . GLU A 1 184 ? 48.753 55.311 16.980  1.00 34.03 ? 184  GLU A CG    1 
ATOM   1265 C  CD    . GLU A 1 184 ? 48.105 54.509 18.097  1.00 36.57 ? 184  GLU A CD    1 
ATOM   1266 O  OE1   . GLU A 1 184 ? 48.428 53.304 18.239  1.00 39.96 ? 184  GLU A OE1   1 
ATOM   1267 O  OE2   . GLU A 1 184 ? 47.279 55.094 18.842  1.00 38.35 ? 184  GLU A OE2   1 
ATOM   1268 N  N     . GLU A 1 185 ? 48.965 54.854 12.343  1.00 24.59 ? 185  GLU A N     1 
ATOM   1269 C  CA    . GLU A 1 185 ? 49.678 55.267 11.136  1.00 25.10 ? 185  GLU A CA    1 
ATOM   1270 C  C     . GLU A 1 185 ? 48.877 54.980 9.876   1.00 23.23 ? 185  GLU A C     1 
ATOM   1271 O  O     . GLU A 1 185 ? 47.956 54.166 9.883   1.00 22.92 ? 185  GLU A O     1 
ATOM   1272 C  CB    . GLU A 1 185 ? 51.040 54.568 11.042  1.00 28.88 ? 185  GLU A CB    1 
ATOM   1273 C  CG    . GLU A 1 185 ? 52.243 55.419 11.541  1.00 36.03 ? 185  GLU A CG    1 
ATOM   1274 C  CD    . GLU A 1 185 ? 52.289 56.849 10.952  1.00 40.52 ? 185  GLU A CD    1 
ATOM   1275 O  OE1   . GLU A 1 185 ? 52.169 57.002 9.701   1.00 41.29 ? 185  GLU A OE1   1 
ATOM   1276 O  OE2   . GLU A 1 185 ? 52.439 57.821 11.750  1.00 42.59 ? 185  GLU A OE2   1 
ATOM   1277 N  N     . LEU A 1 186 ? 49.245 55.651 8.792   1.00 21.84 ? 186  LEU A N     1 
ATOM   1278 C  CA    . LEU A 1 186 ? 48.611 55.438 7.495   1.00 21.33 ? 186  LEU A CA    1 
ATOM   1279 C  C     . LEU A 1 186 ? 49.047 54.096 6.917   1.00 20.64 ? 186  LEU A C     1 
ATOM   1280 O  O     . LEU A 1 186 ? 50.222 53.890 6.624   1.00 19.15 ? 186  LEU A O     1 
ATOM   1281 C  CB    . LEU A 1 186 ? 48.983 56.573 6.530   1.00 21.32 ? 186  LEU A CB    1 
ATOM   1282 C  CG    . LEU A 1 186 ? 48.481 56.430 5.091   1.00 22.54 ? 186  LEU A CG    1 
ATOM   1283 C  CD1   . LEU A 1 186 ? 47.057 56.962 4.984   1.00 20.37 ? 186  LEU A CD1   1 
ATOM   1284 C  CD2   . LEU A 1 186 ? 49.413 57.154 4.128   1.00 22.12 ? 186  LEU A CD2   1 
ATOM   1285 N  N     . PRO A 1 187 ? 48.105 53.160 6.756   1.00 19.60 ? 187  PRO A N     1 
ATOM   1286 C  CA    . PRO A 1 187 ? 48.443 51.890 6.105   1.00 20.06 ? 187  PRO A CA    1 
ATOM   1287 C  C     . PRO A 1 187 ? 49.031 52.138 4.716   1.00 20.41 ? 187  PRO A C     1 
ATOM   1288 O  O     . PRO A 1 187 ? 48.498 52.926 3.939   1.00 19.53 ? 187  PRO A O     1 
ATOM   1289 C  CB    . PRO A 1 187 ? 47.108 51.159 6.012   1.00 19.24 ? 187  PRO A CB    1 
ATOM   1290 C  CG    . PRO A 1 187 ? 46.227 51.835 7.000   1.00 20.65 ? 187  PRO A CG    1 
ATOM   1291 C  CD    . PRO A 1 187 ? 46.677 53.249 7.095   1.00 19.72 ? 187  PRO A CD    1 
ATOM   1292 N  N     . GLY A 1 188 ? 50.149 51.491 4.420   1.00 20.23 ? 188  GLY A N     1 
ATOM   1293 C  CA    . GLY A 1 188 ? 50.768 51.670 3.120   1.00 18.78 ? 188  GLY A CA    1 
ATOM   1294 C  C     . GLY A 1 188 ? 49.880 51.128 2.024   1.00 19.79 ? 188  GLY A C     1 
ATOM   1295 O  O     . GLY A 1 188 ? 49.778 51.725 0.957   1.00 20.36 ? 188  GLY A O     1 
ATOM   1296 N  N     . ARG A 1 189 ? 49.218 50.008 2.301   1.00 18.65 ? 189  ARG A N     1 
ATOM   1297 C  CA    . ARG A 1 189 ? 48.414 49.314 1.308   1.00 19.14 ? 189  ARG A CA    1 
ATOM   1298 C  C     . ARG A 1 189 ? 47.147 48.742 1.961   1.00 18.94 ? 189  ARG A C     1 
ATOM   1299 O  O     . ARG A 1 189 ? 47.235 47.902 2.851   1.00 18.82 ? 189  ARG A O     1 
ATOM   1300 C  CB    . ARG A 1 189 ? 49.247 48.200 0.672   1.00 19.42 ? 189  ARG A CB    1 
ATOM   1301 C  CG    . ARG A 1 189 ? 48.470 47.229 -0.184  1.00 20.63 ? 189  ARG A CG    1 
ATOM   1302 C  CD    . ARG A 1 189 ? 48.516 47.605 -1.655  1.00 20.90 ? 189  ARG A CD    1 
ATOM   1303 N  NE    . ARG A 1 189 ? 47.865 46.587 -2.477  1.00 20.85 ? 189  ARG A NE    1 
ATOM   1304 C  CZ    . ARG A 1 189 ? 46.632 46.692 -2.968  1.00 21.14 ? 189  ARG A CZ    1 
ATOM   1305 N  NH1   . ARG A 1 189 ? 45.798 47.616 -2.505  1.00 21.30 ? 189  ARG A NH1   1 
ATOM   1306 N  NH2   . ARG A 1 189 ? 46.234 45.869 -3.926  1.00 21.69 ? 189  ARG A NH2   1 
ATOM   1307 N  N     . SER A 1 190 ? 45.979 49.226 1.534   1.00 17.13 ? 190  SER A N     1 
ATOM   1308 C  CA    . SER A 1 190 ? 44.700 48.823 2.128   1.00 17.10 ? 190  SER A CA    1 
ATOM   1309 C  C     . SER A 1 190 ? 43.822 48.045 1.153   1.00 16.07 ? 190  SER A C     1 
ATOM   1310 O  O     . SER A 1 190 ? 43.725 48.385 -0.028  1.00 16.13 ? 190  SER A O     1 
ATOM   1311 C  CB    . SER A 1 190 ? 43.909 50.037 2.626   1.00 14.50 ? 190  SER A CB    1 
ATOM   1312 O  OG    . SER A 1 190 ? 44.754 51.021 3.180   1.00 17.09 ? 190  SER A OG    1 
ATOM   1313 N  N     . VAL A 1 191 ? 43.142 47.033 1.678   1.00 14.82 ? 191  VAL A N     1 
ATOM   1314 C  CA    . VAL A 1 191 ? 42.070 46.357 0.967   1.00 15.58 ? 191  VAL A CA    1 
ATOM   1315 C  C     . VAL A 1 191 ? 40.801 46.476 1.803   1.00 14.66 ? 191  VAL A C     1 
ATOM   1316 O  O     . VAL A 1 191 ? 40.763 46.028 2.943   1.00 15.01 ? 191  VAL A O     1 
ATOM   1317 C  CB    . VAL A 1 191 ? 42.432 44.864 0.714   1.00 15.98 ? 191  VAL A CB    1 
ATOM   1318 C  CG1   . VAL A 1 191 ? 41.237 44.092 0.166   1.00 16.07 ? 191  VAL A CG1   1 
ATOM   1319 C  CG2   . VAL A 1 191 ? 43.590 44.774 -0.250  1.00 15.50 ? 191  VAL A CG2   1 
ATOM   1320 N  N     . ILE A 1 192 ? 39.808 47.171 1.260   1.00 14.25 ? 192  ILE A N     1 
ATOM   1321 C  CA    . ILE A 1 192 ? 38.509 47.313 1.904   1.00 14.74 ? 192  ILE A CA    1 
ATOM   1322 C  C     . ILE A 1 192 ? 37.558 46.314 1.263   1.00 15.01 ? 192  ILE A C     1 
ATOM   1323 O  O     . ILE A 1 192 ? 37.434 46.280 0.049   1.00 16.49 ? 192  ILE A O     1 
ATOM   1324 C  CB    . ILE A 1 192 ? 37.926 48.731 1.691   1.00 14.67 ? 192  ILE A CB    1 
ATOM   1325 C  CG1   . ILE A 1 192 ? 38.985 49.794 1.964   1.00 15.64 ? 192  ILE A CG1   1 
ATOM   1326 C  CG2   . ILE A 1 192 ? 36.694 48.935 2.553   1.00 15.90 ? 192  ILE A CG2   1 
ATOM   1327 C  CD1   . ILE A 1 192 ? 39.653 49.654 3.309   1.00 19.67 ? 192  ILE A CD1   1 
ATOM   1328 N  N     . VAL A 1 193 ? 36.870 45.525 2.073   1.00 14.12 ? 193  VAL A N     1 
ATOM   1329 C  CA    . VAL A 1 193 ? 35.830 44.645 1.555   1.00 13.75 ? 193  VAL A CA    1 
ATOM   1330 C  C     . VAL A 1 193 ? 34.427 45.175 1.858   1.00 14.24 ? 193  VAL A C     1 
ATOM   1331 O  O     . VAL A 1 193 ? 34.059 45.364 3.018   1.00 14.98 ? 193  VAL A O     1 
ATOM   1332 C  CB    . VAL A 1 193 ? 35.976 43.231 2.124   1.00 13.90 ? 193  VAL A CB    1 
ATOM   1333 C  CG1   . VAL A 1 193 ? 34.944 42.310 1.513   1.00 10.37 ? 193  VAL A CG1   1 
ATOM   1334 C  CG2   . VAL A 1 193 ? 37.382 42.719 1.872   1.00 12.00 ? 193  VAL A CG2   1 
ATOM   1335 N  N     . GLY A 1 194 ? 33.662 45.417 0.798   1.00 14.82 ? 194  GLY A N     1 
ATOM   1336 C  CA    . GLY A 1 194 ? 32.243 45.708 0.923   1.00 13.31 ? 194  GLY A CA    1 
ATOM   1337 C  C     . GLY A 1 194 ? 31.852 46.802 -0.051  1.00 14.36 ? 194  GLY A C     1 
ATOM   1338 O  O     . GLY A 1 194 ? 32.713 47.431 -0.673  1.00 15.02 ? 194  GLY A O     1 
ATOM   1339 N  N     . ALA A 1 195 ? 30.558 47.043 -0.202  1.00 12.74 ? 195  ALA A N     1 
ATOM   1340 C  CA    . ALA A 1 195 ? 30.090 47.861 -1.310  1.00 13.76 ? 195  ALA A CA    1 
ATOM   1341 C  C     . ALA A 1 195 ? 29.074 48.902 -0.856  1.00 13.21 ? 195  ALA A C     1 
ATOM   1342 O  O     . ALA A 1 195 ? 28.470 49.574 -1.681  1.00 14.48 ? 195  ALA A O     1 
ATOM   1343 C  CB    . ALA A 1 195 ? 29.500 46.980 -2.408  1.00 13.92 ? 195  ALA A CB    1 
ATOM   1344 N  N     . GLY A 1 196 ? 28.892 49.021 0.458   1.00 12.99 ? 196  GLY A N     1 
ATOM   1345 C  CA    . GLY A 1 196 ? 27.946 49.976 1.009   1.00 13.07 ? 196  GLY A CA    1 
ATOM   1346 C  C     . GLY A 1 196 ? 28.610 51.292 1.322   1.00 12.89 ? 196  GLY A C     1 
ATOM   1347 O  O     . GLY A 1 196 ? 29.786 51.483 1.030   1.00 13.34 ? 196  GLY A O     1 
ATOM   1348 N  N     . TYR A 1 197 ? 27.867 52.207 1.925   1.00 12.93 ? 197  TYR A N     1 
ATOM   1349 C  CA    . TYR A 1 197 ? 28.356 53.567 2.070   1.00 13.15 ? 197  TYR A CA    1 
ATOM   1350 C  C     . TYR A 1 197 ? 29.598 53.646 2.963   1.00 13.26 ? 197  TYR A C     1 
ATOM   1351 O  O     . TYR A 1 197 ? 30.495 54.437 2.717   1.00 13.02 ? 197  TYR A O     1 
ATOM   1352 C  CB    . TYR A 1 197 ? 27.235 54.497 2.561   1.00 13.44 ? 197  TYR A CB    1 
ATOM   1353 C  CG    . TYR A 1 197 ? 27.062 54.581 4.056   1.00 12.37 ? 197  TYR A CG    1 
ATOM   1354 C  CD1   . TYR A 1 197 ? 26.217 53.698 4.733   1.00 15.11 ? 197  TYR A CD1   1 
ATOM   1355 C  CD2   . TYR A 1 197 ? 27.724 55.561 4.794   1.00 13.86 ? 197  TYR A CD2   1 
ATOM   1356 C  CE1   . TYR A 1 197 ? 26.036 53.791 6.113   1.00 16.26 ? 197  TYR A CE1   1 
ATOM   1357 C  CE2   . TYR A 1 197 ? 27.555 55.666 6.166   1.00 16.04 ? 197  TYR A CE2   1 
ATOM   1358 C  CZ    . TYR A 1 197 ? 26.713 54.782 6.823   1.00 16.09 ? 197  TYR A CZ    1 
ATOM   1359 O  OH    . TYR A 1 197 ? 26.562 54.892 8.184   1.00 17.25 ? 197  TYR A OH    1 
ATOM   1360 N  N     . ILE A 1 198 ? 29.665 52.791 3.975   1.00 14.13 ? 198  ILE A N     1 
ATOM   1361 C  CA    . ILE A 1 198 ? 30.815 52.787 4.877   1.00 15.58 ? 198  ILE A CA    1 
ATOM   1362 C  C     . ILE A 1 198 ? 32.092 52.369 4.129   1.00 15.13 ? 198  ILE A C     1 
ATOM   1363 O  O     . ILE A 1 198 ? 33.126 53.015 4.267   1.00 16.61 ? 198  ILE A O     1 
ATOM   1364 C  CB    . ILE A 1 198 ? 30.540 51.890 6.137   1.00 15.62 ? 198  ILE A CB    1 
ATOM   1365 C  CG1   . ILE A 1 198 ? 29.560 52.614 7.076   1.00 16.53 ? 198  ILE A CG1   1 
ATOM   1366 C  CG2   . ILE A 1 198 ? 31.836 51.572 6.890   1.00 14.06 ? 198  ILE A CG2   1 
ATOM   1367 C  CD1   . ILE A 1 198 ? 29.116 51.815 8.293   1.00 14.76 ? 198  ILE A CD1   1 
ATOM   1368 N  N     . ALA A 1 199 ? 31.998 51.332 3.301   1.00 15.01 ? 199  ALA A N     1 
ATOM   1369 C  CA    . ALA A 1 199 ? 33.136 50.853 2.511   1.00 15.18 ? 199  ALA A CA    1 
ATOM   1370 C  C     . ALA A 1 199 ? 33.661 51.923 1.563   1.00 15.54 ? 199  ALA A C     1 
ATOM   1371 O  O     . ALA A 1 199 ? 34.861 52.181 1.510   1.00 16.12 ? 199  ALA A O     1 
ATOM   1372 C  CB    . ALA A 1 199 ? 32.746 49.623 1.724   1.00 13.90 ? 199  ALA A CB    1 
ATOM   1373 N  N     . VAL A 1 200 ? 32.741 52.538 0.827   1.00 15.00 ? 200  VAL A N     1 
ATOM   1374 C  CA    . VAL A 1 200 ? 33.039 53.625 -0.099  1.00 14.22 ? 200  VAL A CA    1 
ATOM   1375 C  C     . VAL A 1 200 ? 33.744 54.799 0.605   1.00 14.38 ? 200  VAL A C     1 
ATOM   1376 O  O     . VAL A 1 200 ? 34.763 55.296 0.123   1.00 14.40 ? 200  VAL A O     1 
ATOM   1377 C  CB    . VAL A 1 200 ? 31.725 54.123 -0.799  1.00 12.65 ? 200  VAL A CB    1 
ATOM   1378 C  CG1   . VAL A 1 200 ? 31.968 55.426 -1.553  1.00 11.56 ? 200  VAL A CG1   1 
ATOM   1379 C  CG2   . VAL A 1 200 ? 31.184 53.046 -1.744  1.00 11.30 ? 200  VAL A CG2   1 
ATOM   1380 N  N     . GLU A 1 201 ? 33.198 55.227 1.744   1.00 14.20 ? 201  GLU A N     1 
ATOM   1381 C  CA    . GLU A 1 201 ? 33.764 56.332 2.519   1.00 14.63 ? 201  GLU A CA    1 
ATOM   1382 C  C     . GLU A 1 201 ? 35.178 56.029 2.999   1.00 14.01 ? 201  GLU A C     1 
ATOM   1383 O  O     . GLU A 1 201 ? 36.070 56.860 2.864   1.00 15.69 ? 201  GLU A O     1 
ATOM   1384 C  CB    . GLU A 1 201 ? 32.861 56.677 3.715   1.00 13.19 ? 201  GLU A CB    1 
ATOM   1385 C  CG    . GLU A 1 201 ? 31.594 57.453 3.339   1.00 13.69 ? 201  GLU A CG    1 
ATOM   1386 C  CD    . GLU A 1 201 ? 30.759 57.892 4.536   1.00 13.79 ? 201  GLU A CD    1 
ATOM   1387 O  OE1   . GLU A 1 201 ? 31.100 57.530 5.677   1.00 12.21 ? 201  GLU A OE1   1 
ATOM   1388 O  OE2   . GLU A 1 201 ? 29.757 58.609 4.338   1.00 12.06 ? 201  GLU A OE2   1 
ATOM   1389 N  N     . MET A 1 202 ? 35.389 54.825 3.519   1.00 15.04 ? 202  MET A N     1 
ATOM   1390 C  CA    . MET A 1 202 ? 36.702 54.413 4.011   1.00 16.74 ? 202  MET A CA    1 
ATOM   1391 C  C     . MET A 1 202 ? 37.724 54.348 2.885   1.00 17.15 ? 202  MET A C     1 
ATOM   1392 O  O     . MET A 1 202 ? 38.842 54.824 3.040   1.00 17.93 ? 202  MET A O     1 
ATOM   1393 C  CB    . MET A 1 202 ? 36.623 53.050 4.693   1.00 19.50 ? 202  MET A CB    1 
ATOM   1394 C  CG    . MET A 1 202 ? 35.678 52.985 5.875   1.00 22.09 ? 202  MET A CG    1 
ATOM   1395 S  SD    . MET A 1 202 ? 36.386 53.683 7.363   1.00 27.57 ? 202  MET A SD    1 
ATOM   1396 C  CE    . MET A 1 202 ? 35.671 55.299 7.346   1.00 24.71 ? 202  MET A CE    1 
ATOM   1397 N  N     . ALA A 1 203 ? 37.334 53.776 1.749   1.00 15.94 ? 203  ALA A N     1 
ATOM   1398 C  CA    . ALA A 1 203 ? 38.216 53.700 0.587   1.00 15.97 ? 203  ALA A CA    1 
ATOM   1399 C  C     . ALA A 1 203 ? 38.613 55.095 0.116   1.00 16.25 ? 203  ALA A C     1 
ATOM   1400 O  O     . ALA A 1 203 ? 39.764 55.325 -0.257  1.00 19.00 ? 203  ALA A O     1 
ATOM   1401 C  CB    . ALA A 1 203 ? 37.544 52.930 -0.552  1.00 15.30 ? 203  ALA A CB    1 
ATOM   1402 N  N     . GLY A 1 204 ? 37.669 56.030 0.159   1.00 14.42 ? 204  GLY A N     1 
ATOM   1403 C  CA    . GLY A 1 204 ? 37.932 57.364 -0.347  1.00 13.42 ? 204  GLY A CA    1 
ATOM   1404 C  C     . GLY A 1 204 ? 38.859 58.170 0.541   1.00 13.85 ? 204  GLY A C     1 
ATOM   1405 O  O     . GLY A 1 204 ? 39.726 58.882 0.044   1.00 15.46 ? 204  GLY A O     1 
ATOM   1406 N  N     . ILE A 1 205 ? 38.671 58.056 1.853   1.00 12.97 ? 205  ILE A N     1 
ATOM   1407 C  CA    . ILE A 1 205 ? 39.555 58.688 2.830   1.00 13.13 ? 205  ILE A CA    1 
ATOM   1408 C  C     . ILE A 1 205 ? 40.970 58.139 2.710   1.00 13.75 ? 205  ILE A C     1 
ATOM   1409 O  O     . ILE A 1 205 ? 41.924 58.904 2.568   1.00 11.96 ? 205  ILE A O     1 
ATOM   1410 C  CB    . ILE A 1 205 ? 39.027 58.503 4.286   1.00 13.25 ? 205  ILE A CB    1 
ATOM   1411 C  CG1   . ILE A 1 205 ? 37.850 59.451 4.541   1.00 11.70 ? 205  ILE A CG1   1 
ATOM   1412 C  CG2   . ILE A 1 205 ? 40.124 58.795 5.301   1.00 12.35 ? 205  ILE A CG2   1 
ATOM   1413 C  CD1   . ILE A 1 205 ? 36.969 59.035 5.676   1.00 10.76 ? 205  ILE A CD1   1 
ATOM   1414 N  N     . LEU A 1 206 ? 41.089 56.813 2.735   1.00 13.31 ? 206  LEU A N     1 
ATOM   1415 C  CA    . LEU A 1 206 ? 42.389 56.146 2.708   1.00 16.88 ? 206  LEU A CA    1 
ATOM   1416 C  C     . LEU A 1 206 ? 43.192 56.403 1.433   1.00 17.68 ? 206  LEU A C     1 
ATOM   1417 O  O     . LEU A 1 206 ? 44.385 56.677 1.494   1.00 20.21 ? 206  LEU A O     1 
ATOM   1418 C  CB    . LEU A 1 206 ? 42.222 54.641 2.928   1.00 17.08 ? 206  LEU A CB    1 
ATOM   1419 C  CG    . LEU A 1 206 ? 42.144 54.218 4.403   1.00 17.92 ? 206  LEU A CG    1 
ATOM   1420 C  CD1   . LEU A 1 206 ? 41.679 52.770 4.510   1.00 19.08 ? 206  LEU A CD1   1 
ATOM   1421 C  CD2   . LEU A 1 206 ? 43.489 54.402 5.086   1.00 16.56 ? 206  LEU A CD2   1 
ATOM   1422 N  N     . SER A 1 207 ? 42.539 56.329 0.283   1.00 17.76 ? 207  SER A N     1 
ATOM   1423 C  CA    . SER A 1 207 ? 43.190 56.636 -0.979  1.00 17.48 ? 207  SER A CA    1 
ATOM   1424 C  C     . SER A 1 207 ? 43.603 58.104 -1.111  1.00 18.09 ? 207  SER A C     1 
ATOM   1425 O  O     . SER A 1 207 ? 44.705 58.401 -1.571  1.00 17.32 ? 207  SER A O     1 
ATOM   1426 C  CB    . SER A 1 207 ? 42.285 56.248 -2.140  1.00 18.49 ? 207  SER A CB    1 
ATOM   1427 O  OG    . SER A 1 207 ? 43.033 56.165 -3.330  1.00 21.63 ? 207  SER A OG    1 
ATOM   1428 N  N     . ALA A 1 208 ? 42.727 59.021 -0.702  1.00 19.11 ? 208  ALA A N     1 
ATOM   1429 C  CA    . ALA A 1 208 ? 43.035 60.445 -0.781  1.00 19.81 ? 208  ALA A CA    1 
ATOM   1430 C  C     . ALA A 1 208 ? 44.315 60.754 -0.010  1.00 20.04 ? 208  ALA A C     1 
ATOM   1431 O  O     . ALA A 1 208 ? 45.153 61.532 -0.478  1.00 21.86 ? 208  ALA A O     1 
ATOM   1432 C  CB    . ALA A 1 208 ? 41.884 61.280 -0.247  1.00 18.41 ? 208  ALA A CB    1 
ATOM   1433 N  N     . LEU A 1 209 ? 44.479 60.122 1.151   1.00 19.71 ? 209  LEU A N     1 
ATOM   1434 C  CA    . LEU A 1 209 ? 45.615 60.411 2.026   1.00 19.95 ? 209  LEU A CA    1 
ATOM   1435 C  C     . LEU A 1 209 ? 46.883 59.642 1.642   1.00 20.87 ? 209  LEU A C     1 
ATOM   1436 O  O     . LEU A 1 209 ? 47.954 59.885 2.207   1.00 23.27 ? 209  LEU A O     1 
ATOM   1437 C  CB    . LEU A 1 209 ? 45.260 60.080 3.472   1.00 18.59 ? 209  LEU A CB    1 
ATOM   1438 C  CG    . LEU A 1 209 ? 44.071 60.832 4.048   1.00 18.09 ? 209  LEU A CG    1 
ATOM   1439 C  CD1   . LEU A 1 209 ? 43.892 60.447 5.494   1.00 17.65 ? 209  LEU A CD1   1 
ATOM   1440 C  CD2   . LEU A 1 209 ? 44.268 62.324 3.886   1.00 16.48 ? 209  LEU A CD2   1 
ATOM   1441 N  N     . GLY A 1 210 ? 46.748 58.674 0.741   1.00 20.47 ? 210  GLY A N     1 
ATOM   1442 C  CA    . GLY A 1 210 ? 47.904 58.155 0.039   1.00 20.61 ? 210  GLY A CA    1 
ATOM   1443 C  C     . GLY A 1 210 ? 48.158 56.670 0.225   1.00 20.06 ? 210  GLY A C     1 
ATOM   1444 O  O     . GLY A 1 210 ? 49.200 56.170 -0.176  1.00 19.93 ? 210  GLY A O     1 
ATOM   1445 N  N     . SER A 1 211 ? 47.209 55.959 0.822   1.00 19.13 ? 211  SER A N     1 
ATOM   1446 C  CA    . SER A 1 211 ? 47.267 54.504 0.864   1.00 18.14 ? 211  SER A CA    1 
ATOM   1447 C  C     . SER A 1 211 ? 46.972 53.934 -0.515  1.00 18.99 ? 211  SER A C     1 
ATOM   1448 O  O     . SER A 1 211 ? 46.050 54.378 -1.197  1.00 18.45 ? 211  SER A O     1 
ATOM   1449 C  CB    . SER A 1 211 ? 46.251 53.964 1.870   1.00 18.29 ? 211  SER A CB    1 
ATOM   1450 O  OG    . SER A 1 211 ? 46.522 52.610 2.190   1.00 16.90 ? 211  SER A OG    1 
ATOM   1451 N  N     . LYS A 1 212 ? 47.747 52.942 -0.927  1.00 18.53 ? 212  LYS A N     1 
ATOM   1452 C  CA    . LYS A 1 212 ? 47.381 52.184 -2.105  1.00 19.89 ? 212  LYS A CA    1 
ATOM   1453 C  C     . LYS A 1 212 ? 46.164 51.307 -1.813  1.00 18.10 ? 212  LYS A C     1 
ATOM   1454 O  O     . LYS A 1 212 ? 46.265 50.279 -1.141  1.00 18.03 ? 212  LYS A O     1 
ATOM   1455 C  CB    . LYS A 1 212 ? 48.561 51.344 -2.595  1.00 22.28 ? 212  LYS A CB    1 
ATOM   1456 C  CG    . LYS A 1 212 ? 49.054 51.746 -3.983  1.00 27.95 ? 212  LYS A CG    1 
ATOM   1457 C  CD    . LYS A 1 212 ? 48.456 50.859 -5.080  1.00 30.65 ? 212  LYS A CD    1 
ATOM   1458 C  CE    . LYS A 1 212 ? 49.502 49.904 -5.670  1.00 33.54 ? 212  LYS A CE    1 
ATOM   1459 N  NZ    . LYS A 1 212 ? 50.124 50.431 -6.937  1.00 34.93 ? 212  LYS A NZ    1 
ATOM   1460 N  N     . THR A 1 213 ? 45.014 51.733 -2.324  1.00 16.84 ? 213  THR A N     1 
ATOM   1461 C  CA    . THR A 1 213 ? 43.730 51.177 -1.915  1.00 16.14 ? 213  THR A CA    1 
ATOM   1462 C  C     . THR A 1 213 ? 43.069 50.321 -3.008  1.00 15.19 ? 213  THR A C     1 
ATOM   1463 O  O     . THR A 1 213 ? 43.007 50.719 -4.171  1.00 16.74 ? 213  THR A O     1 
ATOM   1464 C  CB    . THR A 1 213 ? 42.771 52.297 -1.461  1.00 15.51 ? 213  THR A CB    1 
ATOM   1465 O  OG1   . THR A 1 213 ? 43.489 53.220 -0.643  1.00 13.79 ? 213  THR A OG1   1 
ATOM   1466 C  CG2   . THR A 1 213 ? 41.631 51.723 -0.638  1.00 14.28 ? 213  THR A CG2   1 
ATOM   1467 N  N     . SER A 1 214 ? 42.588 49.140 -2.622  1.00 14.85 ? 214  SER A N     1 
ATOM   1468 C  CA    . SER A 1 214 ? 41.605 48.407 -3.420  1.00 14.91 ? 214  SER A CA    1 
ATOM   1469 C  C     . SER A 1 214 ? 40.299 48.289 -2.652  1.00 15.27 ? 214  SER A C     1 
ATOM   1470 O  O     . SER A 1 214 ? 40.294 48.188 -1.427  1.00 15.98 ? 214  SER A O     1 
ATOM   1471 C  CB    . SER A 1 214 ? 42.100 46.997 -3.773  1.00 15.68 ? 214  SER A CB    1 
ATOM   1472 O  OG    . SER A 1 214 ? 43.455 46.987 -4.180  1.00 15.21 ? 214  SER A OG    1 
ATOM   1473 N  N     . LEU A 1 215 ? 39.193 48.296 -3.384  1.00 14.50 ? 215  LEU A N     1 
ATOM   1474 C  CA    . LEU A 1 215 ? 37.884 48.048 -2.813  1.00 13.14 ? 215  LEU A CA    1 
ATOM   1475 C  C     . LEU A 1 215 ? 37.325 46.791 -3.473  1.00 13.53 ? 215  LEU A C     1 
ATOM   1476 O  O     . LEU A 1 215 ? 37.259 46.705 -4.698  1.00 13.36 ? 215  LEU A O     1 
ATOM   1477 C  CB    . LEU A 1 215 ? 36.988 49.262 -3.077  1.00 12.69 ? 215  LEU A CB    1 
ATOM   1478 C  CG    . LEU A 1 215 ? 35.516 49.235 -2.670  1.00 13.18 ? 215  LEU A CG    1 
ATOM   1479 C  CD1   . LEU A 1 215 ? 35.366 49.354 -1.172  1.00 11.24 ? 215  LEU A CD1   1 
ATOM   1480 C  CD2   . LEU A 1 215 ? 34.809 50.370 -3.361  1.00 13.54 ? 215  LEU A CD2   1 
ATOM   1481 N  N     . MET A 1 216 ? 36.965 45.803 -2.664  1.00 12.61 ? 216  MET A N     1 
ATOM   1482 C  CA    . MET A 1 216 ? 36.575 44.505 -3.175  1.00 12.67 ? 216  MET A CA    1 
ATOM   1483 C  C     . MET A 1 216 ? 35.069 44.353 -3.057  1.00 13.95 ? 216  MET A C     1 
ATOM   1484 O  O     . MET A 1 216 ? 34.510 44.393 -1.964  1.00 13.41 ? 216  MET A O     1 
ATOM   1485 C  CB    . MET A 1 216 ? 37.277 43.390 -2.405  1.00 13.45 ? 216  MET A CB    1 
ATOM   1486 C  CG    . MET A 1 216 ? 37.066 42.001 -3.003  1.00 17.00 ? 216  MET A CG    1 
ATOM   1487 S  SD    . MET A 1 216 ? 37.993 40.659 -2.186  1.00 21.74 ? 216  MET A SD    1 
ATOM   1488 C  CE    . MET A 1 216 ? 39.603 41.429 -1.930  1.00 13.68 ? 216  MET A CE    1 
ATOM   1489 N  N     . ILE A 1 217 ? 34.410 44.214 -4.194  1.00 14.35 ? 217  ILE A N     1 
ATOM   1490 C  CA    . ILE A 1 217 ? 32.957 44.167 -4.218  1.00 17.63 ? 217  ILE A CA    1 
ATOM   1491 C  C     . ILE A 1 217 ? 32.468 42.919 -4.951  1.00 18.28 ? 217  ILE A C     1 
ATOM   1492 O  O     . ILE A 1 217 ? 33.146 42.404 -5.839  1.00 17.39 ? 217  ILE A O     1 
ATOM   1493 C  CB    . ILE A 1 217 ? 32.365 45.443 -4.865  1.00 16.74 ? 217  ILE A CB    1 
ATOM   1494 C  CG1   . ILE A 1 217 ? 32.884 45.614 -6.294  1.00 14.99 ? 217  ILE A CG1   1 
ATOM   1495 C  CG2   . ILE A 1 217 ? 32.738 46.668 -4.037  1.00 15.06 ? 217  ILE A CG2   1 
ATOM   1496 C  CD1   . ILE A 1 217 ? 32.089 46.605 -7.118  1.00 14.94 ? 217  ILE A CD1   1 
ATOM   1497 N  N     . ARG A 1 218 ? 31.299 42.426 -4.557  1.00 19.25 ? 218  ARG A N     1 
ATOM   1498 C  CA    . ARG A 1 218 ? 30.814 41.136 -5.016  1.00 20.31 ? 218  ARG A CA    1 
ATOM   1499 C  C     . ARG A 1 218 ? 30.224 41.215 -6.415  1.00 20.83 ? 218  ARG A C     1 
ATOM   1500 O  O     . ARG A 1 218 ? 30.117 40.200 -7.103  1.00 21.24 ? 218  ARG A O     1 
ATOM   1501 C  CB    . ARG A 1 218 ? 29.757 40.604 -4.060  1.00 24.14 ? 218  ARG A CB    1 
ATOM   1502 C  CG    . ARG A 1 218 ? 30.296 40.241 -2.701  1.00 30.42 ? 218  ARG A CG    1 
ATOM   1503 C  CD    . ARG A 1 218 ? 29.162 40.061 -1.700  1.00 35.87 ? 218  ARG A CD    1 
ATOM   1504 N  NE    . ARG A 1 218 ? 28.695 38.673 -1.644  1.00 40.58 ? 218  ARG A NE    1 
ATOM   1505 C  CZ    . ARG A 1 218 ? 27.942 38.103 -2.583  1.00 43.72 ? 218  ARG A CZ    1 
ATOM   1506 N  NH1   . ARG A 1 218 ? 28.395 37.027 -3.224  1.00 45.70 ? 218  ARG A NH1   1 
ATOM   1507 N  NH2   . ARG A 1 218 ? 26.746 38.615 -2.895  1.00 43.89 ? 218  ARG A NH2   1 
ATOM   1508 N  N     . HIS A 1 219 ? 29.816 42.414 -6.828  1.00 19.87 ? 219  HIS A N     1 
ATOM   1509 C  CA    . HIS A 1 219 ? 29.238 42.620 -8.157  1.00 19.48 ? 219  HIS A CA    1 
ATOM   1510 C  C     . HIS A 1 219 ? 30.046 43.673 -8.905  1.00 18.34 ? 219  HIS A C     1 
ATOM   1511 O  O     . HIS A 1 219 ? 31.262 43.771 -8.721  1.00 18.76 ? 219  HIS A O     1 
ATOM   1512 C  CB    . HIS A 1 219 ? 27.767 43.041 -8.045  1.00 20.25 ? 219  HIS A CB    1 
ATOM   1513 C  CG    . HIS A 1 219 ? 26.958 42.168 -7.137  1.00 21.89 ? 219  HIS A CG    1 
ATOM   1514 N  ND1   . HIS A 1 219 ? 26.110 41.186 -7.608  1.00 21.69 ? 219  HIS A ND1   1 
ATOM   1515 C  CD2   . HIS A 1 219 ? 26.877 42.118 -5.784  1.00 23.52 ? 219  HIS A CD2   1 
ATOM   1516 C  CE1   . HIS A 1 219 ? 25.543 40.569 -6.585  1.00 22.08 ? 219  HIS A CE1   1 
ATOM   1517 N  NE2   . HIS A 1 219 ? 25.992 41.116 -5.467  1.00 24.22 ? 219  HIS A NE2   1 
ATOM   1518 N  N     . ASP A 1 220 ? 29.389 44.454 -9.753  1.00 17.64 ? 220  ASP A N     1 
ATOM   1519 C  CA    . ASP A 1 220 ? 30.113 45.294 -10.691 1.00 18.66 ? 220  ASP A CA    1 
ATOM   1520 C  C     . ASP A 1 220 ? 30.129 46.763 -10.285 1.00 18.99 ? 220  ASP A C     1 
ATOM   1521 O  O     . ASP A 1 220 ? 30.963 47.524 -10.771 1.00 21.32 ? 220  ASP A O     1 
ATOM   1522 C  CB    . ASP A 1 220 ? 29.573 45.122 -12.121 1.00 21.75 ? 220  ASP A CB    1 
ATOM   1523 C  CG    . ASP A 1 220 ? 28.098 45.519 -12.268 1.00 23.92 ? 220  ASP A CG    1 
ATOM   1524 O  OD1   . ASP A 1 220 ? 27.271 45.226 -11.369 1.00 24.84 ? 220  ASP A OD1   1 
ATOM   1525 O  OD2   . ASP A 1 220 ? 27.764 46.116 -13.322 1.00 27.62 ? 220  ASP A OD2   1 
ATOM   1526 N  N     . LYS A 1 221 ? 29.223 47.147 -9.384  1.00 17.61 ? 221  LYS A N     1 
ATOM   1527 C  CA    . LYS A 1 221 ? 29.057 48.544 -8.954  1.00 17.13 ? 221  LYS A CA    1 
ATOM   1528 C  C     . LYS A 1 221 ? 28.911 48.634 -7.426  1.00 15.68 ? 221  LYS A C     1 
ATOM   1529 O  O     . LYS A 1 221 ? 28.483 47.674 -6.790  1.00 13.62 ? 221  LYS A O     1 
ATOM   1530 C  CB    . LYS A 1 221 ? 27.818 49.154 -9.620  1.00 18.73 ? 221  LYS A CB    1 
ATOM   1531 C  CG    . LYS A 1 221 ? 28.017 49.602 -11.068 1.00 21.77 ? 221  LYS A CG    1 
ATOM   1532 C  CD    . LYS A 1 221 ? 26.709 50.161 -11.631 1.00 24.74 ? 221  LYS A CD    1 
ATOM   1533 C  CE    . LYS A 1 221 ? 26.335 49.519 -12.952 1.00 25.32 ? 221  LYS A CE    1 
ATOM   1534 N  NZ    . LYS A 1 221 ? 26.576 50.464 -14.078 1.00 27.01 ? 221  LYS A NZ    1 
ATOM   1535 N  N     . VAL A 1 222 ? 29.274 49.782 -6.849  1.00 15.10 ? 222  VAL A N     1 
ATOM   1536 C  CA    . VAL A 1 222 ? 29.018 50.066 -5.428  1.00 15.31 ? 222  VAL A CA    1 
ATOM   1537 C  C     . VAL A 1 222 ? 27.647 50.701 -5.217  1.00 14.93 ? 222  VAL A C     1 
ATOM   1538 O  O     . VAL A 1 222 ? 27.044 51.207 -6.156  1.00 12.11 ? 222  VAL A O     1 
ATOM   1539 C  CB    . VAL A 1 222 ? 30.086 51.019 -4.804  1.00 15.49 ? 222  VAL A CB    1 
ATOM   1540 C  CG1   . VAL A 1 222 ? 31.443 50.352 -4.791  1.00 16.00 ? 222  VAL A CG1   1 
ATOM   1541 C  CG2   . VAL A 1 222 ? 30.133 52.359 -5.552  1.00 13.93 ? 222  VAL A CG2   1 
ATOM   1542 N  N     . LEU A 1 223 ? 27.186 50.694 -3.966  1.00 14.94 ? 223  LEU A N     1 
ATOM   1543 C  CA    . LEU A 1 223 ? 25.963 51.400 -3.564  1.00 16.49 ? 223  LEU A CA    1 
ATOM   1544 C  C     . LEU A 1 223 ? 24.761 50.987 -4.410  1.00 17.35 ? 223  LEU A C     1 
ATOM   1545 O  O     . LEU A 1 223 ? 24.112 51.815 -5.061  1.00 18.71 ? 223  LEU A O     1 
ATOM   1546 C  CB    . LEU A 1 223 ? 26.158 52.918 -3.641  1.00 12.82 ? 223  LEU A CB    1 
ATOM   1547 C  CG    . LEU A 1 223 ? 27.204 53.490 -2.693  1.00 13.20 ? 223  LEU A CG    1 
ATOM   1548 C  CD1   . LEU A 1 223 ? 27.322 54.971 -2.933  1.00 10.20 ? 223  LEU A CD1   1 
ATOM   1549 C  CD2   . LEU A 1 223 ? 26.836 53.191 -1.264  1.00 10.36 ? 223  LEU A CD2   1 
ATOM   1550 N  N     . ARG A 1 224 ? 24.493 49.690 -4.413  1.00 19.03 ? 224  ARG A N     1 
ATOM   1551 C  CA    . ARG A 1 224 ? 23.629 49.097 -5.418  1.00 20.55 ? 224  ARG A CA    1 
ATOM   1552 C  C     . ARG A 1 224 ? 22.178 49.279 -5.006  1.00 20.95 ? 224  ARG A C     1 
ATOM   1553 O  O     . ARG A 1 224 ? 21.278 49.041 -5.796  1.00 20.69 ? 224  ARG A O     1 
ATOM   1554 C  CB    . ARG A 1 224 ? 23.949 47.607 -5.573  1.00 22.64 ? 224  ARG A CB    1 
ATOM   1555 C  CG    . ARG A 1 224 ? 25.185 47.334 -6.418  1.00 25.03 ? 224  ARG A CG    1 
ATOM   1556 C  CD    . ARG A 1 224 ? 25.134 45.942 -7.020  1.00 27.03 ? 224  ARG A CD    1 
ATOM   1557 N  NE    . ARG A 1 224 ? 25.185 44.915 -5.982  1.00 30.93 ? 224  ARG A NE    1 
ATOM   1558 C  CZ    . ARG A 1 224 ? 24.222 44.024 -5.755  1.00 30.84 ? 224  ARG A CZ    1 
ATOM   1559 N  NH1   . ARG A 1 224 ? 23.495 43.551 -6.765  1.00 30.73 ? 224  ARG A NH1   1 
ATOM   1560 N  NH2   . ARG A 1 224 ? 24.008 43.582 -4.516  1.00 30.93 ? 224  ARG A NH2   1 
ATOM   1561 N  N     . SER A 1 225 ? 21.961 49.709 -3.766  1.00 20.45 ? 225  SER A N     1 
ATOM   1562 C  CA    . SER A 1 225 ? 20.627 50.061 -3.298  1.00 22.13 ? 225  SER A CA    1 
ATOM   1563 C  C     . SER A 1 225 ? 20.221 51.506 -3.628  1.00 21.39 ? 225  SER A C     1 
ATOM   1564 O  O     . SER A 1 225 ? 19.073 51.907 -3.389  1.00 21.98 ? 225  SER A O     1 
ATOM   1565 C  CB    . SER A 1 225 ? 20.534 49.832 -1.787  1.00 23.21 ? 225  SER A CB    1 
ATOM   1566 O  OG    . SER A 1 225 ? 21.132 50.909 -1.086  1.00 27.87 ? 225  SER A OG    1 
ATOM   1567 N  N     . PHE A 1 226 ? 21.180 52.282 -4.135  1.00 19.14 ? 226  PHE A N     1 
ATOM   1568 C  CA    . PHE A 1 226 ? 20.965 53.668 -4.531  1.00 18.19 ? 226  PHE A CA    1 
ATOM   1569 C  C     . PHE A 1 226 ? 20.507 53.742 -5.979  1.00 19.12 ? 226  PHE A C     1 
ATOM   1570 O  O     . PHE A 1 226 ? 20.595 52.757 -6.718  1.00 21.10 ? 226  PHE A O     1 
ATOM   1571 C  CB    . PHE A 1 226 ? 22.255 54.469 -4.381  1.00 17.18 ? 226  PHE A CB    1 
ATOM   1572 C  CG    . PHE A 1 226 ? 22.643 54.729 -2.961  1.00 17.44 ? 226  PHE A CG    1 
ATOM   1573 C  CD1   . PHE A 1 226 ? 22.814 53.675 -2.068  1.00 17.58 ? 226  PHE A CD1   1 
ATOM   1574 C  CD2   . PHE A 1 226 ? 22.857 56.025 -2.516  1.00 16.20 ? 226  PHE A CD2   1 
ATOM   1575 C  CE1   . PHE A 1 226 ? 23.193 53.905 -0.751  1.00 18.56 ? 226  PHE A CE1   1 
ATOM   1576 C  CE2   . PHE A 1 226 ? 23.240 56.273 -1.196  1.00 17.26 ? 226  PHE A CE2   1 
ATOM   1577 C  CZ    . PHE A 1 226 ? 23.407 55.207 -0.311  1.00 18.61 ? 226  PHE A CZ    1 
ATOM   1578 N  N     . ASP A 1 227 ? 20.036 54.917 -6.387  1.00 17.69 ? 227  ASP A N     1 
ATOM   1579 C  CA    . ASP A 1 227 ? 19.603 55.107 -7.760  1.00 18.51 ? 227  ASP A CA    1 
ATOM   1580 C  C     . ASP A 1 227 ? 20.755 54.764 -8.678  1.00 19.24 ? 227  ASP A C     1 
ATOM   1581 O  O     . ASP A 1 227 ? 21.908 55.049 -8.365  1.00 19.37 ? 227  ASP A O     1 
ATOM   1582 C  CB    . ASP A 1 227 ? 19.159 56.548 -7.999  1.00 18.44 ? 227  ASP A CB    1 
ATOM   1583 C  CG    . ASP A 1 227 ? 18.568 56.747 -9.379  1.00 20.21 ? 227  ASP A CG    1 
ATOM   1584 O  OD1   . ASP A 1 227 ? 19.345 56.914 -10.337 1.00 20.86 ? 227  ASP A OD1   1 
ATOM   1585 O  OD2   . ASP A 1 227 ? 17.332 56.709 -9.517  1.00 19.57 ? 227  ASP A OD2   1 
ATOM   1586 N  N     . SER A 1 228 ? 20.443 54.140 -9.804  1.00 20.33 ? 228  SER A N     1 
ATOM   1587 C  CA    . SER A 1 228 ? 21.466 53.501 -10.619 1.00 20.66 ? 228  SER A CA    1 
ATOM   1588 C  C     . SER A 1 228 ? 22.429 54.510 -11.251 1.00 20.10 ? 228  SER A C     1 
ATOM   1589 O  O     . SER A 1 228 ? 23.571 54.175 -11.550 1.00 20.30 ? 228  SER A O     1 
ATOM   1590 C  CB    . SER A 1 228 ? 20.820 52.628 -11.698 1.00 21.43 ? 228  SER A CB    1 
ATOM   1591 O  OG    . SER A 1 228 ? 20.302 53.428 -12.743 1.00 25.42 ? 228  SER A OG    1 
ATOM   1592 N  N     . MET A 1 229 ? 21.977 55.747 -11.427 1.00 18.85 ? 229  MET A N     1 
ATOM   1593 C  CA    . MET A 1 229 ? 22.863 56.846 -11.808 1.00 20.08 ? 229  MET A CA    1 
ATOM   1594 C  C     . MET A 1 229 ? 23.986 57.060 -10.803 1.00 19.37 ? 229  MET A C     1 
ATOM   1595 O  O     . MET A 1 229 ? 25.142 57.235 -11.185 1.00 19.73 ? 229  MET A O     1 
ATOM   1596 C  CB    . MET A 1 229 ? 22.076 58.150 -11.960 1.00 21.90 ? 229  MET A CB    1 
ATOM   1597 C  CG    . MET A 1 229 ? 22.832 59.204 -12.755 1.00 26.08 ? 229  MET A CG    1 
ATOM   1598 S  SD    . MET A 1 229 ? 22.151 60.890 -12.607 1.00 31.25 ? 229  MET A SD    1 
ATOM   1599 C  CE    . MET A 1 229 ? 22.302 61.163 -10.781 1.00 28.23 ? 229  MET A CE    1 
ATOM   1600 N  N     . ILE A 1 230 ? 23.622 57.077 -9.522  1.00 18.52 ? 230  ILE A N     1 
ATOM   1601 C  CA    . ILE A 1 230 ? 24.573 57.257 -8.426  1.00 18.79 ? 230  ILE A CA    1 
ATOM   1602 C  C     . ILE A 1 230 ? 25.486 56.042 -8.323  1.00 19.55 ? 230  ILE A C     1 
ATOM   1603 O  O     . ILE A 1 230 ? 26.703 56.177 -8.294  1.00 19.25 ? 230  ILE A O     1 
ATOM   1604 C  CB    . ILE A 1 230 ? 23.837 57.471 -7.065  1.00 18.50 ? 230  ILE A CB    1 
ATOM   1605 C  CG1   . ILE A 1 230 ? 22.993 58.744 -7.116  1.00 17.45 ? 230  ILE A CG1   1 
ATOM   1606 C  CG2   . ILE A 1 230 ? 24.833 57.549 -5.903  1.00 18.22 ? 230  ILE A CG2   1 
ATOM   1607 C  CD1   . ILE A 1 230 ? 23.760 59.953 -7.577  1.00 19.67 ? 230  ILE A CD1   1 
ATOM   1608 N  N     . SER A 1 231 ? 24.896 54.854 -8.288  1.00 18.76 ? 231  SER A N     1 
ATOM   1609 C  CA    . SER A 1 231 ? 25.673 53.622 -8.276  1.00 20.06 ? 231  SER A CA    1 
ATOM   1610 C  C     . SER A 1 231 ? 26.763 53.641 -9.350  1.00 20.08 ? 231  SER A C     1 
ATOM   1611 O  O     . SER A 1 231 ? 27.940 53.422 -9.062  1.00 22.05 ? 231  SER A O     1 
ATOM   1612 C  CB    . SER A 1 231 ? 24.750 52.421 -8.477  1.00 20.37 ? 231  SER A CB    1 
ATOM   1613 O  OG    . SER A 1 231 ? 25.441 51.212 -8.238  1.00 23.82 ? 231  SER A OG    1 
ATOM   1614 N  N     . THR A 1 232 ? 26.374 53.976 -10.573 1.00 18.01 ? 232  THR A N     1 
ATOM   1615 C  CA    . THR A 1 232 ? 27.275 53.945 -11.711 1.00 17.07 ? 232  THR A CA    1 
ATOM   1616 C  C     . THR A 1 232 ? 28.315 55.053 -11.609 1.00 18.27 ? 232  THR A C     1 
ATOM   1617 O  O     . THR A 1 232 ? 29.511 54.794 -11.710 1.00 18.47 ? 232  THR A O     1 
ATOM   1618 C  CB    . THR A 1 232 ? 26.483 54.070 -13.031 1.00 17.87 ? 232  THR A CB    1 
ATOM   1619 O  OG1   . THR A 1 232 ? 25.655 52.913 -13.183 1.00 16.04 ? 232  THR A OG1   1 
ATOM   1620 C  CG2   . THR A 1 232 ? 27.418 54.191 -14.242 1.00 15.48 ? 232  THR A CG2   1 
ATOM   1621 N  N     . ASN A 1 233 ? 27.865 56.281 -11.374 1.00 17.33 ? 233  ASN A N     1 
ATOM   1622 C  CA    . ASN A 1 233 ? 28.774 57.423 -11.348 1.00 17.37 ? 233  ASN A CA    1 
ATOM   1623 C  C     . ASN A 1 233 ? 29.792 57.325 -10.205 1.00 16.30 ? 233  ASN A C     1 
ATOM   1624 O  O     . ASN A 1 233 ? 30.932 57.765 -10.343 1.00 16.93 ? 233  ASN A O     1 
ATOM   1625 C  CB    . ASN A 1 233 ? 27.990 58.745 -11.249 1.00 16.61 ? 233  ASN A CB    1 
ATOM   1626 C  CG    . ASN A 1 233 ? 28.892 59.969 -11.359 1.00 16.97 ? 233  ASN A CG    1 
ATOM   1627 O  OD1   . ASN A 1 233 ? 29.401 60.287 -12.436 1.00 17.85 ? 233  ASN A OD1   1 
ATOM   1628 N  ND2   . ASN A 1 233 ? 29.106 60.645 -10.240 1.00 15.66 ? 233  ASN A ND2   1 
ATOM   1629 N  N     . CYS A 1 234 ? 29.368 56.766 -9.079  1.00 15.69 ? 234  CYS A N     1 
ATOM   1630 C  CA    . CYS A 1 234 ? 30.239 56.654 -7.921  1.00 17.26 ? 234  CYS A CA    1 
ATOM   1631 C  C     . CYS A 1 234 ? 31.321 55.598 -8.156  1.00 16.07 ? 234  CYS A C     1 
ATOM   1632 O  O     . CYS A 1 234 ? 32.463 55.787 -7.756  1.00 16.01 ? 234  CYS A O     1 
ATOM   1633 C  CB    . CYS A 1 234 ? 29.432 56.322 -6.659  1.00 17.33 ? 234  CYS A CB    1 
ATOM   1634 S  SG    . CYS A 1 234 ? 30.402 56.314 -5.119  1.00 17.94 ? 234  CYS A SG    1 
ATOM   1635 N  N     . THR A 1 235 ? 30.959 54.504 -8.820  1.00 16.14 ? 235  THR A N     1 
ATOM   1636 C  CA    . THR A 1 235 ? 31.915 53.464 -9.173  1.00 17.16 ? 235  THR A CA    1 
ATOM   1637 C  C     . THR A 1 235 ? 32.985 54.018 -10.111 1.00 18.75 ? 235  THR A C     1 
ATOM   1638 O  O     . THR A 1 235 ? 34.172 53.730 -9.946  1.00 19.63 ? 235  THR A O     1 
ATOM   1639 C  CB    . THR A 1 235 ? 31.218 52.266 -9.846  1.00 16.47 ? 235  THR A CB    1 
ATOM   1640 O  OG1   . THR A 1 235 ? 30.133 51.815 -9.025  1.00 13.96 ? 235  THR A OG1   1 
ATOM   1641 C  CG2   . THR A 1 235 ? 32.201 51.120 -10.051 1.00 16.12 ? 235  THR A CG2   1 
ATOM   1642 N  N     . GLU A 1 236 ? 32.560 54.863 -11.049 1.00 19.88 ? 236  GLU A N     1 
ATOM   1643 C  CA    . GLU A 1 236 ? 33.474 55.571 -11.941 1.00 20.27 ? 236  GLU A CA    1 
ATOM   1644 C  C     . GLU A 1 236 ? 34.388 56.565 -11.247 1.00 19.47 ? 236  GLU A C     1 
ATOM   1645 O  O     . GLU A 1 236 ? 35.580 56.607 -11.534 1.00 18.82 ? 236  GLU A O     1 
ATOM   1646 C  CB    . GLU A 1 236 ? 32.694 56.272 -13.041 1.00 23.23 ? 236  GLU A CB    1 
ATOM   1647 C  CG    . GLU A 1 236 ? 32.361 55.354 -14.201 1.00 30.46 ? 236  GLU A CG    1 
ATOM   1648 C  CD    . GLU A 1 236 ? 31.430 55.987 -15.220 1.00 34.48 ? 236  GLU A CD    1 
ATOM   1649 O  OE1   . GLU A 1 236 ? 31.509 57.226 -15.441 1.00 36.75 ? 236  GLU A OE1   1 
ATOM   1650 O  OE2   . GLU A 1 236 ? 30.622 55.227 -15.810 1.00 35.43 ? 236  GLU A OE2   1 
ATOM   1651 N  N     . GLU A 1 237 ? 33.837 57.360 -10.335 1.00 18.42 ? 237  GLU A N     1 
ATOM   1652 C  CA    . GLU A 1 237 ? 34.622 58.386 -9.663  1.00 18.67 ? 237  GLU A CA    1 
ATOM   1653 C  C     . GLU A 1 237 ? 35.634 57.801 -8.669  1.00 17.84 ? 237  GLU A C     1 
ATOM   1654 O  O     . GLU A 1 237 ? 36.682 58.394 -8.431  1.00 17.19 ? 237  GLU A O     1 
ATOM   1655 C  CB    . GLU A 1 237 ? 33.713 59.414 -8.975  1.00 19.69 ? 237  GLU A CB    1 
ATOM   1656 C  CG    . GLU A 1 237 ? 33.041 60.393 -9.953  1.00 25.98 ? 237  GLU A CG    1 
ATOM   1657 C  CD    . GLU A 1 237 ? 33.941 61.565 -10.376 1.00 27.27 ? 237  GLU A CD    1 
ATOM   1658 O  OE1   . GLU A 1 237 ? 35.090 61.333 -10.814 1.00 29.04 ? 237  GLU A OE1   1 
ATOM   1659 O  OE2   . GLU A 1 237 ? 33.488 62.727 -10.278 1.00 29.01 ? 237  GLU A OE2   1 
ATOM   1660 N  N     . LEU A 1 238 ? 35.336 56.618 -8.139  1.00 16.34 ? 238  LEU A N     1 
ATOM   1661 C  CA    . LEU A 1 238 ? 36.288 55.881 -7.318  1.00 17.41 ? 238  LEU A CA    1 
ATOM   1662 C  C     . LEU A 1 238 ? 37.492 55.412 -8.132  1.00 18.61 ? 238  LEU A C     1 
ATOM   1663 O  O     . LEU A 1 238 ? 38.641 55.586 -7.727  1.00 18.02 ? 238  LEU A O     1 
ATOM   1664 C  CB    . LEU A 1 238 ? 35.603 54.676 -6.681  1.00 14.98 ? 238  LEU A CB    1 
ATOM   1665 C  CG    . LEU A 1 238 ? 34.800 54.912 -5.405  1.00 15.32 ? 238  LEU A CG    1 
ATOM   1666 C  CD1   . LEU A 1 238 ? 33.975 53.672 -5.130  1.00 13.07 ? 238  LEU A CD1   1 
ATOM   1667 C  CD2   . LEU A 1 238 ? 35.721 55.229 -4.235  1.00 13.19 ? 238  LEU A CD2   1 
ATOM   1668 N  N     . GLU A 1 239 ? 37.213 54.809 -9.282  1.00 19.83 ? 239  GLU A N     1 
ATOM   1669 C  CA    . GLU A 1 239 ? 38.242 54.477 -10.259 1.00 22.15 ? 239  GLU A CA    1 
ATOM   1670 C  C     . GLU A 1 239 ? 39.079 55.686 -10.678 1.00 23.28 ? 239  GLU A C     1 
ATOM   1671 O  O     . GLU A 1 239 ? 40.312 55.619 -10.706 1.00 24.26 ? 239  GLU A O     1 
ATOM   1672 C  CB    . GLU A 1 239 ? 37.598 53.830 -11.476 1.00 24.56 ? 239  GLU A CB    1 
ATOM   1673 C  CG    . GLU A 1 239 ? 36.685 52.666 -11.113 1.00 28.66 ? 239  GLU A CG    1 
ATOM   1674 C  CD    . GLU A 1 239 ? 36.544 51.641 -12.222 1.00 31.10 ? 239  GLU A CD    1 
ATOM   1675 O  OE1   . GLU A 1 239 ? 37.558 50.978 -12.538 1.00 31.99 ? 239  GLU A OE1   1 
ATOM   1676 O  OE2   . GLU A 1 239 ? 35.415 51.485 -12.764 1.00 32.71 ? 239  GLU A OE2   1 
ATOM   1677 N  N     . ASN A 1 240 ? 38.410 56.802 -10.947 1.00 24.01 ? 240  ASN A N     1 
ATOM   1678 C  CA    . ASN A 1 240 ? 39.088 58.018 -11.384 1.00 25.83 ? 240  ASN A CA    1 
ATOM   1679 C  C     . ASN A 1 240 ? 39.986 58.619 -10.305 1.00 25.00 ? 240  ASN A C     1 
ATOM   1680 O  O     . ASN A 1 240 ? 41.039 59.177 -10.612 1.00 25.66 ? 240  ASN A O     1 
ATOM   1681 C  CB    . ASN A 1 240 ? 38.068 59.054 -11.880 1.00 28.64 ? 240  ASN A CB    1 
ATOM   1682 C  CG    . ASN A 1 240 ? 37.588 58.754 -13.286 1.00 32.20 ? 240  ASN A CG    1 
ATOM   1683 O  OD1   . ASN A 1 240 ? 38.209 57.954 -14.006 1.00 34.02 ? 240  ASN A OD1   1 
ATOM   1684 N  ND2   . ASN A 1 240 ? 36.476 59.370 -13.687 1.00 33.52 ? 240  ASN A ND2   1 
ATOM   1685 N  N     . ALA A 1 241 ? 39.590 58.470 -9.045  1.00 24.14 ? 241  ALA A N     1 
ATOM   1686 C  CA    . ALA A 1 241 ? 40.369 59.001 -7.931  1.00 22.79 ? 241  ALA A CA    1 
ATOM   1687 C  C     . ALA A 1 241 ? 41.499 58.049 -7.565  1.00 22.22 ? 241  ALA A C     1 
ATOM   1688 O  O     . ALA A 1 241 ? 42.281 58.327 -6.653  1.00 23.28 ? 241  ALA A O     1 
ATOM   1689 C  CB    . ALA A 1 241 ? 39.468 59.243 -6.720  1.00 22.04 ? 241  ALA A CB    1 
ATOM   1690 N  N     . GLY A 1 242 ? 41.557 56.912 -8.258  1.00 21.81 ? 242  GLY A N     1 
ATOM   1691 C  CA    . GLY A 1 242 ? 42.686 56.005 -8.127  1.00 21.01 ? 242  GLY A CA    1 
ATOM   1692 C  C     . GLY A 1 242 ? 42.458 54.884 -7.129  1.00 21.06 ? 242  GLY A C     1 
ATOM   1693 O  O     . GLY A 1 242 ? 43.406 54.212 -6.725  1.00 21.71 ? 242  GLY A O     1 
ATOM   1694 N  N     . VAL A 1 243 ? 41.206 54.679 -6.727  1.00 19.06 ? 243  VAL A N     1 
ATOM   1695 C  CA    . VAL A 1 243 ? 40.819 53.459 -6.024  1.00 17.33 ? 243  VAL A CA    1 
ATOM   1696 C  C     . VAL A 1 243 ? 40.682 52.291 -7.001  1.00 17.64 ? 243  VAL A C     1 
ATOM   1697 O  O     . VAL A 1 243 ? 39.989 52.384 -8.013  1.00 17.96 ? 243  VAL A O     1 
ATOM   1698 C  CB    . VAL A 1 243 ? 39.501 53.660 -5.220  1.00 16.28 ? 243  VAL A CB    1 
ATOM   1699 C  CG1   . VAL A 1 243 ? 39.033 52.347 -4.595  1.00 14.18 ? 243  VAL A CG1   1 
ATOM   1700 C  CG2   . VAL A 1 243 ? 39.705 54.718 -4.151  1.00 11.80 ? 243  VAL A CG2   1 
ATOM   1701 N  N     . GLU A 1 244 ? 41.386 51.206 -6.714  1.00 18.51 ? 244  GLU A N     1 
ATOM   1702 C  CA    . GLU A 1 244 ? 41.272 50.008 -7.526  1.00 19.06 ? 244  GLU A CA    1 
ATOM   1703 C  C     . GLU A 1 244 ? 40.007 49.254 -7.119  1.00 18.54 ? 244  GLU A C     1 
ATOM   1704 O  O     . GLU A 1 244 ? 39.926 48.709 -6.018  1.00 18.44 ? 244  GLU A O     1 
ATOM   1705 C  CB    . GLU A 1 244 ? 42.512 49.128 -7.336  1.00 20.69 ? 244  GLU A CB    1 
ATOM   1706 C  CG    . GLU A 1 244 ? 42.504 47.847 -8.172  1.00 23.97 ? 244  GLU A CG    1 
ATOM   1707 C  CD    . GLU A 1 244 ? 43.722 46.968 -7.930  1.00 26.90 ? 244  GLU A CD    1 
ATOM   1708 O  OE1   . GLU A 1 244 ? 44.245 46.940 -6.791  1.00 28.57 ? 244  GLU A OE1   1 
ATOM   1709 O  OE2   . GLU A 1 244 ? 44.163 46.299 -8.887  1.00 27.56 ? 244  GLU A OE2   1 
ATOM   1710 N  N     . VAL A 1 245 ? 38.998 49.270 -7.987  1.00 18.31 ? 245  VAL A N     1 
ATOM   1711 C  CA    . VAL A 1 245 ? 37.778 48.519 -7.721  1.00 17.99 ? 245  VAL A CA    1 
ATOM   1712 C  C     . VAL A 1 245 ? 37.872 47.109 -8.287  1.00 17.97 ? 245  VAL A C     1 
ATOM   1713 O  O     . VAL A 1 245 ? 37.950 46.918 -9.494  1.00 20.22 ? 245  VAL A O     1 
ATOM   1714 C  CB    . VAL A 1 245 ? 36.525 49.239 -8.277  1.00 19.54 ? 245  VAL A CB    1 
ATOM   1715 C  CG1   . VAL A 1 245 ? 35.295 48.346 -8.143  1.00 17.64 ? 245  VAL A CG1   1 
ATOM   1716 C  CG2   . VAL A 1 245 ? 36.309 50.551 -7.530  1.00 18.33 ? 245  VAL A CG2   1 
ATOM   1717 N  N     . LEU A 1 246 ? 37.901 46.131 -7.390  1.00 17.16 ? 246  LEU A N     1 
ATOM   1718 C  CA    . LEU A 1 246 ? 38.007 44.728 -7.747  1.00 15.46 ? 246  LEU A CA    1 
ATOM   1719 C  C     . LEU A 1 246 ? 36.605 44.178 -7.838  1.00 16.09 ? 246  LEU A C     1 
ATOM   1720 O  O     . LEU A 1 246 ? 36.010 43.829 -6.821  1.00 15.25 ? 246  LEU A O     1 
ATOM   1721 C  CB    . LEU A 1 246 ? 38.774 43.960 -6.666  1.00 15.24 ? 246  LEU A CB    1 
ATOM   1722 C  CG    . LEU A 1 246 ? 40.192 44.429 -6.338  1.00 16.16 ? 246  LEU A CG    1 
ATOM   1723 C  CD1   . LEU A 1 246 ? 40.658 43.834 -5.020  1.00 16.79 ? 246  LEU A CD1   1 
ATOM   1724 C  CD2   . LEU A 1 246 ? 41.120 44.035 -7.462  1.00 16.08 ? 246  LEU A CD2   1 
ATOM   1725 N  N     . LYS A 1 247 ? 36.091 44.090 -9.059  1.00 16.09 ? 247  LYS A N     1 
ATOM   1726 C  CA    . LYS A 1 247 ? 34.713 43.675 -9.305  1.00 18.14 ? 247  LYS A CA    1 
ATOM   1727 C  C     . LYS A 1 247 ? 34.522 42.151 -9.293  1.00 18.94 ? 247  LYS A C     1 
ATOM   1728 O  O     . LYS A 1 247 ? 35.416 41.396 -9.685  1.00 19.44 ? 247  LYS A O     1 
ATOM   1729 C  CB    . LYS A 1 247 ? 34.232 44.267 -10.629 1.00 18.56 ? 247  LYS A CB    1 
ATOM   1730 C  CG    . LYS A 1 247 ? 34.158 45.775 -10.603 1.00 19.23 ? 247  LYS A CG    1 
ATOM   1731 C  CD    . LYS A 1 247 ? 33.880 46.338 -11.980 1.00 22.72 ? 247  LYS A CD    1 
ATOM   1732 C  CE    . LYS A 1 247 ? 34.829 47.485 -12.304 1.00 25.84 ? 247  LYS A CE    1 
ATOM   1733 N  NZ    . LYS A 1 247 ? 34.096 48.710 -12.744 1.00 23.56 ? 247  LYS A NZ    1 
ATOM   1734 N  N     . PHE A 1 248 ? 33.364 41.707 -8.812  1.00 18.82 ? 248  PHE A N     1 
ATOM   1735 C  CA    . PHE A 1 248 ? 33.018 40.280 -8.780  1.00 17.41 ? 248  PHE A CA    1 
ATOM   1736 C  C     . PHE A 1 248 ? 33.965 39.391 -7.970  1.00 17.66 ? 248  PHE A C     1 
ATOM   1737 O  O     . PHE A 1 248 ? 34.221 38.251 -8.341  1.00 16.45 ? 248  PHE A O     1 
ATOM   1738 C  CB    . PHE A 1 248 ? 32.878 39.733 -10.199 1.00 17.99 ? 248  PHE A CB    1 
ATOM   1739 C  CG    . PHE A 1 248 ? 31.720 40.313 -10.954 1.00 18.87 ? 248  PHE A CG    1 
ATOM   1740 C  CD1   . PHE A 1 248 ? 30.413 39.972 -10.610 1.00 18.91 ? 248  PHE A CD1   1 
ATOM   1741 C  CD2   . PHE A 1 248 ? 31.934 41.207 -11.997 1.00 19.19 ? 248  PHE A CD2   1 
ATOM   1742 C  CE1   . PHE A 1 248 ? 29.334 40.514 -11.292 1.00 20.10 ? 248  PHE A CE1   1 
ATOM   1743 C  CE2   . PHE A 1 248 ? 30.866 41.755 -12.689 1.00 21.76 ? 248  PHE A CE2   1 
ATOM   1744 C  CZ    . PHE A 1 248 ? 29.556 41.407 -12.331 1.00 21.07 ? 248  PHE A CZ    1 
ATOM   1745 N  N     . SER A 1 249 ? 34.420 39.905 -6.830  1.00 17.10 ? 249  SER A N     1 
ATOM   1746 C  CA    . SER A 1 249 ? 35.527 39.321 -6.084  1.00 16.77 ? 249  SER A CA    1 
ATOM   1747 C  C     . SER A 1 249 ? 35.182 39.104 -4.616  1.00 19.02 ? 249  SER A C     1 
ATOM   1748 O  O     . SER A 1 249 ? 34.352 39.813 -4.040  1.00 19.92 ? 249  SER A O     1 
ATOM   1749 C  CB    . SER A 1 249 ? 36.759 40.215 -6.196  1.00 15.99 ? 249  SER A CB    1 
ATOM   1750 O  OG    . SER A 1 249 ? 37.089 40.428 -7.556  1.00 14.70 ? 249  SER A OG    1 
ATOM   1751 N  N     . GLN A 1 250 ? 35.819 38.107 -4.017  1.00 20.78 ? 250  GLN A N     1 
ATOM   1752 C  CA    . GLN A 1 250 ? 35.477 37.650 -2.676  1.00 22.87 ? 250  GLN A CA    1 
ATOM   1753 C  C     . GLN A 1 250 ? 36.730 37.083 -2.027  1.00 22.04 ? 250  GLN A C     1 
ATOM   1754 O  O     . GLN A 1 250 ? 37.508 36.377 -2.677  1.00 21.84 ? 250  GLN A O     1 
ATOM   1755 C  CB    . GLN A 1 250 ? 34.404 36.562 -2.736  1.00 25.86 ? 250  GLN A CB    1 
ATOM   1756 C  CG    . GLN A 1 250 ? 33.015 37.081 -3.054  1.00 31.39 ? 250  GLN A CG    1 
ATOM   1757 C  CD    . GLN A 1 250 ? 31.935 36.062 -2.744  1.00 34.95 ? 250  GLN A CD    1 
ATOM   1758 O  OE1   . GLN A 1 250 ? 30.936 36.372 -2.063  1.00 38.79 ? 250  GLN A OE1   1 
ATOM   1759 N  NE2   . GLN A 1 250 ? 32.128 34.834 -3.229  1.00 34.16 ? 250  GLN A NE2   1 
ATOM   1760 N  N     . VAL A 1 251 ? 36.915 37.383 -0.748  1.00 20.26 ? 251  VAL A N     1 
ATOM   1761 C  CA    . VAL A 1 251 ? 38.055 36.870 -0.011  1.00 21.08 ? 251  VAL A CA    1 
ATOM   1762 C  C     . VAL A 1 251 ? 37.831 35.398 0.310   1.00 21.73 ? 251  VAL A C     1 
ATOM   1763 O  O     . VAL A 1 251 ? 36.729 34.991 0.702   1.00 21.44 ? 251  VAL A O     1 
ATOM   1764 C  CB    . VAL A 1 251 ? 38.293 37.664 1.282   1.00 20.15 ? 251  VAL A CB    1 
ATOM   1765 C  CG1   . VAL A 1 251 ? 39.475 37.101 2.024   1.00 21.24 ? 251  VAL A CG1   1 
ATOM   1766 C  CG2   . VAL A 1 251 ? 38.550 39.112 0.958   1.00 21.00 ? 251  VAL A CG2   1 
ATOM   1767 N  N     . LYS A 1 252 ? 38.862 34.591 0.089   1.00 22.29 ? 252  LYS A N     1 
ATOM   1768 C  CA    . LYS A 1 252 ? 38.773 33.172 0.375   1.00 23.18 ? 252  LYS A CA    1 
ATOM   1769 C  C     . LYS A 1 252 ? 39.613 32.824 1.581   1.00 21.83 ? 252  LYS A C     1 
ATOM   1770 O  O     . LYS A 1 252 ? 39.233 31.967 2.369   1.00 21.55 ? 252  LYS A O     1 
ATOM   1771 C  CB    . LYS A 1 252 ? 39.178 32.337 -0.848  1.00 26.00 ? 252  LYS A CB    1 
ATOM   1772 C  CG    . LYS A 1 252 ? 38.092 32.298 -1.947  1.00 30.39 ? 252  LYS A CG    1 
ATOM   1773 C  CD    . LYS A 1 252 ? 36.947 31.301 -1.630  1.00 33.31 ? 252  LYS A CD    1 
ATOM   1774 C  CE    . LYS A 1 252 ? 35.806 31.938 -0.804  1.00 35.33 ? 252  LYS A CE    1 
ATOM   1775 N  NZ    . LYS A 1 252 ? 34.518 32.138 -1.581  1.00 35.15 ? 252  LYS A NZ    1 
ATOM   1776 N  N     . GLU A 1 253 ? 40.723 33.532 1.758   1.00 21.89 ? 253  GLU A N     1 
ATOM   1777 C  CA    . GLU A 1 253 ? 41.391 33.555 3.048   1.00 23.28 ? 253  GLU A CA    1 
ATOM   1778 C  C     . GLU A 1 253 ? 42.510 34.571 3.177   1.00 22.05 ? 253  GLU A C     1 
ATOM   1779 O  O     . GLU A 1 253 ? 42.952 35.168 2.193   1.00 20.28 ? 253  GLU A O     1 
ATOM   1780 C  CB    . GLU A 1 253 ? 41.922 32.167 3.392   1.00 26.88 ? 253  GLU A CB    1 
ATOM   1781 C  CG    . GLU A 1 253 ? 42.955 31.631 2.441   1.00 32.34 ? 253  GLU A CG    1 
ATOM   1782 C  CD    . GLU A 1 253 ? 43.575 30.351 2.967   1.00 35.32 ? 253  GLU A CD    1 
ATOM   1783 O  OE1   . GLU A 1 253 ? 42.920 29.283 2.849   1.00 36.22 ? 253  GLU A OE1   1 
ATOM   1784 O  OE2   . GLU A 1 253 ? 44.701 30.426 3.525   1.00 36.96 ? 253  GLU A OE2   1 
ATOM   1785 N  N     . VAL A 1 254 ? 42.954 34.761 4.416   1.00 21.08 ? 254  VAL A N     1 
ATOM   1786 C  CA    . VAL A 1 254 ? 43.933 35.779 4.740   1.00 22.67 ? 254  VAL A CA    1 
ATOM   1787 C  C     . VAL A 1 254 ? 45.025 35.112 5.560   1.00 24.36 ? 254  VAL A C     1 
ATOM   1788 O  O     . VAL A 1 254 ? 44.730 34.359 6.488   1.00 23.84 ? 254  VAL A O     1 
ATOM   1789 C  CB    . VAL A 1 254 ? 43.306 36.933 5.566   1.00 21.99 ? 254  VAL A CB    1 
ATOM   1790 C  CG1   . VAL A 1 254 ? 44.285 38.100 5.676   1.00 21.68 ? 254  VAL A CG1   1 
ATOM   1791 C  CG2   . VAL A 1 254 ? 41.995 37.402 4.929   1.00 22.27 ? 254  VAL A CG2   1 
ATOM   1792 N  N     . LYS A 1 255 ? 46.280 35.380 5.200   1.00 26.95 ? 255  LYS A N     1 
ATOM   1793 C  CA    . LYS A 1 255 ? 47.437 34.820 5.906   1.00 30.00 ? 255  LYS A CA    1 
ATOM   1794 C  C     . LYS A 1 255 ? 48.360 35.943 6.381   1.00 30.28 ? 255  LYS A C     1 
ATOM   1795 O  O     . LYS A 1 255 ? 48.508 36.964 5.710   1.00 30.00 ? 255  LYS A O     1 
ATOM   1796 C  CB    . LYS A 1 255 ? 48.229 33.869 4.995   1.00 32.46 ? 255  LYS A CB    1 
ATOM   1797 C  CG    . LYS A 1 255 ? 47.382 32.834 4.239   1.00 36.72 ? 255  LYS A CG    1 
ATOM   1798 C  CD    . LYS A 1 255 ? 47.925 31.390 4.432   1.00 41.56 ? 255  LYS A CD    1 
ATOM   1799 C  CE    . LYS A 1 255 ? 49.000 30.996 3.375   1.00 42.80 ? 255  LYS A CE    1 
ATOM   1800 N  NZ    . LYS A 1 255 ? 49.562 32.184 2.629   1.00 44.24 ? 255  LYS A NZ    1 
ATOM   1801 N  N     . LYS A 1 256 ? 48.962 35.754 7.549   1.00 31.50 ? 256  LYS A N     1 
ATOM   1802 C  CA    . LYS A 1 256 ? 50.064 36.604 7.997   1.00 33.29 ? 256  LYS A CA    1 
ATOM   1803 C  C     . LYS A 1 256 ? 51.303 36.192 7.217   1.00 33.60 ? 256  LYS A C     1 
ATOM   1804 O  O     . LYS A 1 256 ? 51.560 34.998 7.038   1.00 34.32 ? 256  LYS A O     1 
ATOM   1805 C  CB    . LYS A 1 256 ? 50.304 36.411 9.500   1.00 35.24 ? 256  LYS A CB    1 
ATOM   1806 C  CG    . LYS A 1 256 ? 50.853 37.640 10.224  1.00 38.73 ? 256  LYS A CG    1 
ATOM   1807 C  CD    . LYS A 1 256 ? 50.300 37.739 11.658  1.00 41.29 ? 256  LYS A CD    1 
ATOM   1808 C  CE    . LYS A 1 256 ? 49.886 39.195 12.006  1.00 42.80 ? 256  LYS A CE    1 
ATOM   1809 N  NZ    . LYS A 1 256 ? 49.407 39.348 13.438  1.00 42.73 ? 256  LYS A NZ    1 
ATOM   1810 N  N     . THR A 1 257 ? 52.037 37.175 6.712   1.00 33.67 ? 257  THR A N     1 
ATOM   1811 C  CA    . THR A 1 257 ? 53.363 36.925 6.177   1.00 34.25 ? 257  THR A CA    1 
ATOM   1812 C  C     . THR A 1 257 ? 54.385 37.825 6.871   1.00 35.68 ? 257  THR A C     1 
ATOM   1813 O  O     . THR A 1 257 ? 54.078 38.469 7.885   1.00 35.43 ? 257  THR A O     1 
ATOM   1814 C  CB    . THR A 1 257 ? 53.424 37.123 4.635   1.00 33.53 ? 257  THR A CB    1 
ATOM   1815 O  OG1   . THR A 1 257 ? 53.536 38.516 4.326   1.00 32.95 ? 257  THR A OG1   1 
ATOM   1816 C  CG2   . THR A 1 257 ? 52.184 36.535 3.953   1.00 34.56 ? 257  THR A CG2   1 
ATOM   1817 N  N     . LEU A 1 258 ? 55.606 37.843 6.339   1.00 37.37 ? 258  LEU A N     1 
ATOM   1818 C  CA    . LEU A 1 258 ? 56.675 38.672 6.892   1.00 38.89 ? 258  LEU A CA    1 
ATOM   1819 C  C     . LEU A 1 258 ? 56.453 40.138 6.550   1.00 38.82 ? 258  LEU A C     1 
ATOM   1820 O  O     . LEU A 1 258 ? 56.857 41.019 7.303   1.00 39.29 ? 258  LEU A O     1 
ATOM   1821 C  CB    . LEU A 1 258 ? 58.044 38.208 6.364   1.00 38.84 ? 258  LEU A CB    1 
ATOM   1822 C  CG    . LEU A 1 258 ? 58.449 36.798 6.830   1.00 39.41 ? 258  LEU A CG    1 
ATOM   1823 C  CD1   . LEU A 1 258 ? 59.655 36.330 6.039   1.00 40.17 ? 258  LEU A CD1   1 
ATOM   1824 C  CD2   . LEU A 1 258 ? 58.749 36.770 8.336   1.00 37.53 ? 258  LEU A CD2   1 
ATOM   1825 N  N     . SER A 1 259 ? 55.811 40.394 5.413   1.00 38.98 ? 259  SER A N     1 
ATOM   1826 C  CA    . SER A 1 259 ? 55.691 41.755 4.891   1.00 38.32 ? 259  SER A CA    1 
ATOM   1827 C  C     . SER A 1 259 ? 54.239 42.239 4.950   1.00 37.12 ? 259  SER A C     1 
ATOM   1828 O  O     . SER A 1 259 ? 53.854 43.168 4.221   1.00 38.34 ? 259  SER A O     1 
ATOM   1829 C  CB    . SER A 1 259 ? 56.191 41.813 3.446   1.00 39.35 ? 259  SER A CB    1 
ATOM   1830 O  OG    . SER A 1 259 ? 55.500 40.867 2.643   1.00 41.48 ? 259  SER A OG    1 
ATOM   1831 N  N     . GLY A 1 260 ? 53.443 41.617 5.820   1.00 34.17 ? 260  GLY A N     1 
ATOM   1832 C  CA    . GLY A 1 260 ? 52.074 42.061 6.018   1.00 31.71 ? 260  GLY A CA    1 
ATOM   1833 C  C     . GLY A 1 260 ? 51.085 40.923 5.882   1.00 30.18 ? 260  GLY A C     1 
ATOM   1834 O  O     . GLY A 1 260 ? 51.404 39.779 6.174   1.00 30.63 ? 260  GLY A O     1 
ATOM   1835 N  N     . LEU A 1 261 ? 49.877 41.231 5.434   1.00 28.68 ? 261  LEU A N     1 
ATOM   1836 C  CA    . LEU A 1 261 ? 48.892 40.196 5.148   1.00 26.19 ? 261  LEU A CA    1 
ATOM   1837 C  C     . LEU A 1 261 ? 48.996 39.805 3.688   1.00 25.80 ? 261  LEU A C     1 
ATOM   1838 O  O     . LEU A 1 261 ? 49.420 40.609 2.851   1.00 25.91 ? 261  LEU A O     1 
ATOM   1839 C  CB    . LEU A 1 261 ? 47.479 40.699 5.465   1.00 25.00 ? 261  LEU A CB    1 
ATOM   1840 C  CG    . LEU A 1 261 ? 47.278 41.236 6.882   1.00 24.16 ? 261  LEU A CG    1 
ATOM   1841 C  CD1   . LEU A 1 261 ? 45.857 41.736 7.043   1.00 23.80 ? 261  LEU A CD1   1 
ATOM   1842 C  CD2   . LEU A 1 261 ? 47.593 40.138 7.898   1.00 24.90 ? 261  LEU A CD2   1 
ATOM   1843 N  N     . GLU A 1 262 ? 48.599 38.574 3.380   1.00 25.61 ? 262  GLU A N     1 
ATOM   1844 C  CA    . GLU A 1 262 ? 48.316 38.193 2.003   1.00 25.43 ? 262  GLU A CA    1 
ATOM   1845 C  C     . GLU A 1 262 ? 46.887 37.688 1.819   1.00 24.47 ? 262  GLU A C     1 
ATOM   1846 O  O     . GLU A 1 262 ? 46.431 36.793 2.531   1.00 25.10 ? 262  GLU A O     1 
ATOM   1847 C  CB    . GLU A 1 262 ? 49.329 37.143 1.556   1.00 28.65 ? 262  GLU A CB    1 
ATOM   1848 C  CG    . GLU A 1 262 ? 48.785 36.056 0.643   1.00 33.79 ? 262  GLU A CG    1 
ATOM   1849 C  CD    . GLU A 1 262 ? 49.894 35.169 0.107   1.00 36.82 ? 262  GLU A CD    1 
ATOM   1850 O  OE1   . GLU A 1 262 ? 50.689 35.675 -0.728  1.00 37.51 ? 262  GLU A OE1   1 
ATOM   1851 O  OE2   . GLU A 1 262 ? 49.977 33.988 0.543   1.00 37.08 ? 262  GLU A OE2   1 
ATOM   1852 N  N     . VAL A 1 263 ? 46.184 38.271 0.857   1.00 23.54 ? 263  VAL A N     1 
ATOM   1853 C  CA    . VAL A 1 263 ? 44.749 38.057 0.699   1.00 23.54 ? 263  VAL A CA    1 
ATOM   1854 C  C     . VAL A 1 263 ? 44.513 37.201 -0.545  1.00 23.28 ? 263  VAL A C     1 
ATOM   1855 O  O     . VAL A 1 263 ? 44.940 37.562 -1.643  1.00 23.89 ? 263  VAL A O     1 
ATOM   1856 C  CB    . VAL A 1 263 ? 43.995 39.420 0.567   1.00 24.44 ? 263  VAL A CB    1 
ATOM   1857 C  CG1   . VAL A 1 263 ? 42.583 39.227 -0.005  1.00 24.48 ? 263  VAL A CG1   1 
ATOM   1858 C  CG2   . VAL A 1 263 ? 43.907 40.089 1.919   1.00 23.85 ? 263  VAL A CG2   1 
ATOM   1859 N  N     . SER A 1 264 ? 43.860 36.055 -0.359  1.00 23.06 ? 264  SER A N     1 
ATOM   1860 C  CA    . SER A 1 264 ? 43.387 35.241 -1.476  1.00 23.25 ? 264  SER A CA    1 
ATOM   1861 C  C     . SER A 1 264 ? 41.998 35.689 -1.869  1.00 23.61 ? 264  SER A C     1 
ATOM   1862 O  O     . SER A 1 264 ? 41.099 35.669 -1.036  1.00 23.30 ? 264  SER A O     1 
ATOM   1863 C  CB    . SER A 1 264 ? 43.331 33.776 -1.074  1.00 22.89 ? 264  SER A CB    1 
ATOM   1864 O  OG    . SER A 1 264 ? 44.627 33.295 -0.795  1.00 26.76 ? 264  SER A OG    1 
ATOM   1865 N  N     . MET A 1 265 ? 41.819 36.088 -3.126  1.00 23.74 ? 265  MET A N     1 
ATOM   1866 C  CA    . MET A 1 265 ? 40.474 36.254 -3.674  1.00 24.42 ? 265  MET A CA    1 
ATOM   1867 C  C     . MET A 1 265 ? 40.166 35.368 -4.877  1.00 23.58 ? 265  MET A C     1 
ATOM   1868 O  O     . MET A 1 265 ? 41.042 35.102 -5.690  1.00 23.67 ? 265  MET A O     1 
ATOM   1869 C  CB    . MET A 1 265 ? 40.221 37.718 -4.032  1.00 25.27 ? 265  MET A CB    1 
ATOM   1870 C  CG    . MET A 1 265 ? 41.183 38.300 -5.031  1.00 25.44 ? 265  MET A CG    1 
ATOM   1871 S  SD    . MET A 1 265 ? 40.674 39.969 -5.477  1.00 28.82 ? 265  MET A SD    1 
ATOM   1872 C  CE    . MET A 1 265 ? 41.929 40.354 -6.743  1.00 25.88 ? 265  MET A CE    1 
ATOM   1873 N  N     . VAL A 1 266 ? 38.915 34.923 -4.982  1.00 23.23 ? 266  VAL A N     1 
ATOM   1874 C  CA    . VAL A 1 266 ? 38.312 34.574 -6.271  1.00 23.03 ? 266  VAL A CA    1 
ATOM   1875 C  C     . VAL A 1 266 ? 37.720 35.803 -6.960  1.00 22.81 ? 266  VAL A C     1 
ATOM   1876 O  O     . VAL A 1 266 ? 36.975 36.564 -6.346  1.00 22.14 ? 266  VAL A O     1 
ATOM   1877 C  CB    . VAL A 1 266 ? 37.191 33.536 -6.093  1.00 24.04 ? 266  VAL A CB    1 
ATOM   1878 C  CG1   . VAL A 1 266 ? 36.599 33.157 -7.441  1.00 22.75 ? 266  VAL A CG1   1 
ATOM   1879 C  CG2   . VAL A 1 266 ? 37.737 32.310 -5.402  1.00 26.24 ? 266  VAL A CG2   1 
ATOM   1880 N  N     . THR A 1 267 ? 38.052 35.989 -8.232  1.00 21.00 ? 267  THR A N     1 
ATOM   1881 C  CA    . THR A 1 267 ? 37.241 36.794 -9.136  1.00 20.18 ? 267  THR A CA    1 
ATOM   1882 C  C     . THR A 1 267 ? 36.436 35.930 -10.109 1.00 20.71 ? 267  THR A C     1 
ATOM   1883 O  O     . THR A 1 267 ? 36.991 35.119 -10.848 1.00 20.81 ? 267  THR A O     1 
ATOM   1884 C  CB    . THR A 1 267 ? 38.115 37.767 -9.939  1.00 20.03 ? 267  THR A CB    1 
ATOM   1885 O  OG1   . THR A 1 267 ? 38.902 38.554 -9.036  1.00 21.35 ? 267  THR A OG1   1 
ATOM   1886 C  CG2   . THR A 1 267 ? 37.252 38.686 -10.809 1.00 21.29 ? 267  THR A CG2   1 
ATOM   1887 N  N     . ALA A 1 268 ? 35.124 36.129 -10.113 1.00 20.61 ? 268  ALA A N     1 
ATOM   1888 C  CA    . ALA A 1 268 ? 34.221 35.332 -10.930 1.00 21.26 ? 268  ALA A CA    1 
ATOM   1889 C  C     . ALA A 1 268 ? 33.372 36.249 -11.815 1.00 22.04 ? 268  ALA A C     1 
ATOM   1890 O  O     . ALA A 1 268 ? 32.173 36.425 -11.582 1.00 21.28 ? 268  ALA A O     1 
ATOM   1891 C  CB    . ALA A 1 268 ? 33.332 34.469 -10.032 1.00 20.10 ? 268  ALA A CB    1 
ATOM   1892 N  N     . VAL A 1 269 ? 34.006 36.861 -12.808 1.00 22.68 ? 269  VAL A N     1 
ATOM   1893 C  CA    . VAL A 1 269 ? 33.265 37.640 -13.794 1.00 25.42 ? 269  VAL A CA    1 
ATOM   1894 C  C     . VAL A 1 269 ? 32.395 36.741 -14.679 1.00 28.41 ? 269  VAL A C     1 
ATOM   1895 O  O     . VAL A 1 269 ? 32.908 35.860 -15.383 1.00 28.72 ? 269  VAL A O     1 
ATOM   1896 C  CB    . VAL A 1 269 ? 34.196 38.466 -14.684 1.00 24.30 ? 269  VAL A CB    1 
ATOM   1897 C  CG1   . VAL A 1 269 ? 33.387 39.316 -15.628 1.00 24.58 ? 269  VAL A CG1   1 
ATOM   1898 C  CG2   . VAL A 1 269 ? 35.070 39.337 -13.838 1.00 24.89 ? 269  VAL A CG2   1 
ATOM   1899 N  N     . PRO A 1 270 ? 31.060 36.961 -14.648 1.00 30.97 ? 270  PRO A N     1 
ATOM   1900 C  CA    . PRO A 1 270 ? 30.089 36.690 -15.714 1.00 31.81 ? 270  PRO A CA    1 
ATOM   1901 C  C     . PRO A 1 270 ? 30.656 36.247 -17.064 1.00 31.96 ? 270  PRO A C     1 
ATOM   1902 O  O     . PRO A 1 270 ? 31.269 37.039 -17.797 1.00 30.90 ? 270  PRO A O     1 
ATOM   1903 C  CB    . PRO A 1 270 ? 29.331 38.016 -15.815 1.00 33.41 ? 270  PRO A CB    1 
ATOM   1904 C  CG    . PRO A 1 270 ? 29.387 38.581 -14.359 1.00 32.55 ? 270  PRO A CG    1 
ATOM   1905 C  CD    . PRO A 1 270 ? 30.418 37.756 -13.585 1.00 32.27 ? 270  PRO A CD    1 
ATOM   1906 N  N     . GLY A 1 271 ? 30.450 34.965 -17.372 1.00 32.51 ? 271  GLY A N     1 
ATOM   1907 C  CA    . GLY A 1 271 ? 30.766 34.449 -18.695 1.00 33.04 ? 271  GLY A CA    1 
ATOM   1908 C  C     . GLY A 1 271 ? 32.262 34.363 -18.946 1.00 32.88 ? 271  GLY A C     1 
ATOM   1909 O  O     . GLY A 1 271 ? 32.718 34.387 -20.096 1.00 32.93 ? 271  GLY A O     1 
ATOM   1910 N  N     . ARG A 1 272 ? 33.023 34.289 -17.858 1.00 31.70 ? 272  ARG A N     1 
ATOM   1911 C  CA    . ARG A 1 272 ? 34.450 33.995 -17.918 1.00 31.33 ? 272  ARG A CA    1 
ATOM   1912 C  C     . ARG A 1 272 ? 34.764 32.957 -16.861 1.00 28.91 ? 272  ARG A C     1 
ATOM   1913 O  O     . ARG A 1 272 ? 33.900 32.588 -16.059 1.00 28.94 ? 272  ARG A O     1 
ATOM   1914 C  CB    . ARG A 1 272 ? 35.271 35.265 -17.675 1.00 33.21 ? 272  ARG A CB    1 
ATOM   1915 C  CG    . ARG A 1 272 ? 35.468 36.093 -18.925 1.00 38.27 ? 272  ARG A CG    1 
ATOM   1916 C  CD    . ARG A 1 272 ? 36.863 36.706 -18.966 1.00 43.20 ? 272  ARG A CD    1 
ATOM   1917 N  NE    . ARG A 1 272 ? 37.085 37.638 -17.853 1.00 46.39 ? 272  ARG A NE    1 
ATOM   1918 C  CZ    . ARG A 1 272 ? 37.585 38.870 -17.990 1.00 48.34 ? 272  ARG A CZ    1 
ATOM   1919 N  NH1   . ARG A 1 272 ? 36.766 39.916 -18.151 1.00 48.16 ? 272  ARG A NH1   1 
ATOM   1920 N  NH2   . ARG A 1 272 ? 38.909 39.056 -17.954 1.00 48.42 ? 272  ARG A NH2   1 
ATOM   1921 N  N     . LEU A 1 273 ? 35.990 32.458 -16.878 1.00 26.27 ? 273  LEU A N     1 
ATOM   1922 C  CA    . LEU A 1 273 ? 36.376 31.428 -15.941 1.00 24.31 ? 273  LEU A CA    1 
ATOM   1923 C  C     . LEU A 1 273 ? 36.776 32.099 -14.641 1.00 22.71 ? 273  LEU A C     1 
ATOM   1924 O  O     . LEU A 1 273 ? 37.417 33.149 -14.656 1.00 23.04 ? 273  LEU A O     1 
ATOM   1925 C  CB    . LEU A 1 273 ? 37.522 30.590 -16.519 1.00 23.73 ? 273  LEU A CB    1 
ATOM   1926 C  CG    . LEU A 1 273 ? 37.082 29.566 -17.569 1.00 23.35 ? 273  LEU A CG    1 
ATOM   1927 C  CD1   . LEU A 1 273 ? 38.299 28.987 -18.265 1.00 23.73 ? 273  LEU A CD1   1 
ATOM   1928 C  CD2   . LEU A 1 273 ? 36.260 28.466 -16.916 1.00 23.54 ? 273  LEU A CD2   1 
ATOM   1929 N  N     . PRO A 1 274 ? 36.364 31.521 -13.502 1.00 21.34 ? 274  PRO A N     1 
ATOM   1930 C  CA    . PRO A 1 274 ? 36.776 31.968 -12.165 1.00 21.46 ? 274  PRO A CA    1 
ATOM   1931 C  C     . PRO A 1 274 ? 38.291 31.950 -12.027 1.00 22.92 ? 274  PRO A C     1 
ATOM   1932 O  O     . PRO A 1 274 ? 38.937 30.975 -12.402 1.00 23.22 ? 274  PRO A O     1 
ATOM   1933 C  CB    . PRO A 1 274 ? 36.139 30.942 -11.229 1.00 19.48 ? 274  PRO A CB    1 
ATOM   1934 C  CG    . PRO A 1 274 ? 35.022 30.347 -12.003 1.00 21.69 ? 274  PRO A CG    1 
ATOM   1935 C  CD    . PRO A 1 274 ? 35.452 30.365 -13.441 1.00 20.70 ? 274  PRO A CD    1 
ATOM   1936 N  N     . VAL A 1 275 ? 38.862 33.030 -11.509 1.00 22.92 ? 275  VAL A N     1 
ATOM   1937 C  CA    . VAL A 1 275 ? 40.302 33.085 -11.326 1.00 24.19 ? 275  VAL A CA    1 
ATOM   1938 C  C     . VAL A 1 275 ? 40.673 33.474 -9.892  1.00 24.82 ? 275  VAL A C     1 
ATOM   1939 O  O     . VAL A 1 275 ? 40.062 34.360 -9.295  1.00 24.34 ? 275  VAL A O     1 
ATOM   1940 C  CB    . VAL A 1 275 ? 40.987 33.991 -12.397 1.00 23.33 ? 275  VAL A CB    1 
ATOM   1941 C  CG1   . VAL A 1 275 ? 40.049 35.068 -12.886 1.00 25.55 ? 275  VAL A CG1   1 
ATOM   1942 C  CG2   . VAL A 1 275 ? 42.277 34.587 -11.873 1.00 25.16 ? 275  VAL A CG2   1 
ATOM   1943 N  N     . MET A 1 276 ? 41.615 32.725 -9.326  1.00 25.58 ? 276  MET A N     1 
ATOM   1944 C  CA    . MET A 1 276 ? 42.105 32.945 -7.977  1.00 27.77 ? 276  MET A CA    1 
ATOM   1945 C  C     . MET A 1 276 ? 43.368 33.768 -8.111  1.00 28.70 ? 276  MET A C     1 
ATOM   1946 O  O     . MET A 1 276 ? 44.259 33.414 -8.889  1.00 28.94 ? 276  MET A O     1 
ATOM   1947 C  CB    . MET A 1 276 ? 42.440 31.607 -7.329  1.00 31.69 ? 276  MET A CB    1 
ATOM   1948 C  CG    . MET A 1 276 ? 41.597 31.247 -6.125  1.00 38.43 ? 276  MET A CG    1 
ATOM   1949 S  SD    . MET A 1 276 ? 42.544 31.559 -4.579  1.00 47.49 ? 276  MET A SD    1 
ATOM   1950 C  CE    . MET A 1 276 ? 42.741 29.790 -3.881  1.00 44.16 ? 276  MET A CE    1 
ATOM   1951 N  N     . THR A 1 277 ? 43.434 34.891 -7.401  1.00 28.05 ? 277  THR A N     1 
ATOM   1952 C  CA    . THR A 1 277 ? 44.687 35.618 -7.281  1.00 29.30 ? 277  THR A CA    1 
ATOM   1953 C  C     . THR A 1 277 ? 44.998 35.972 -5.843  1.00 29.55 ? 277  THR A C     1 
ATOM   1954 O  O     . THR A 1 277 ? 44.165 35.785 -4.955  1.00 31.33 ? 277  THR A O     1 
ATOM   1955 C  CB    . THR A 1 277 ? 44.700 36.893 -8.152  1.00 30.16 ? 277  THR A CB    1 
ATOM   1956 O  OG1   . THR A 1 277 ? 43.429 37.545 -8.067  1.00 30.37 ? 277  THR A OG1   1 
ATOM   1957 C  CG2   . THR A 1 277 ? 44.978 36.530 -9.632  1.00 31.99 ? 277  THR A CG2   1 
ATOM   1958 N  N     . MET A 1 278 ? 46.229 36.413 -5.613  1.00 30.06 ? 278  MET A N     1 
ATOM   1959 C  CA    . MET A 1 278 ? 46.709 36.743 -4.280  1.00 30.06 ? 278  MET A CA    1 
ATOM   1960 C  C     . MET A 1 278 ? 47.159 38.190 -4.241  1.00 29.32 ? 278  MET A C     1 
ATOM   1961 O  O     . MET A 1 278 ? 47.957 38.627 -5.080  1.00 29.87 ? 278  MET A O     1 
ATOM   1962 C  CB    . MET A 1 278 ? 47.888 35.865 -3.909  1.00 32.52 ? 278  MET A CB    1 
ATOM   1963 C  CG    . MET A 1 278 ? 47.642 35.082 -2.653  1.00 38.47 ? 278  MET A CG    1 
ATOM   1964 S  SD    . MET A 1 278 ? 47.585 33.328 -3.021  1.00 45.09 ? 278  MET A SD    1 
ATOM   1965 C  CE    . MET A 1 278 ? 47.420 33.340 -4.931  1.00 42.44 ? 278  MET A CE    1 
ATOM   1966 N  N     . ILE A 1 279 ? 46.643 38.928 -3.266  1.00 27.18 ? 279  ILE A N     1 
ATOM   1967 C  CA    . ILE A 1 279 ? 47.133 40.260 -2.972  1.00 25.77 ? 279  ILE A CA    1 
ATOM   1968 C  C     . ILE A 1 279 ? 48.114 40.213 -1.801  1.00 25.42 ? 279  ILE A C     1 
ATOM   1969 O  O     . ILE A 1 279 ? 47.729 39.948 -0.668  1.00 23.42 ? 279  ILE A O     1 
ATOM   1970 C  CB    . ILE A 1 279 ? 45.964 41.215 -2.667  1.00 26.27 ? 279  ILE A CB    1 
ATOM   1971 C  CG1   . ILE A 1 279 ? 44.813 40.940 -3.647  1.00 26.57 ? 279  ILE A CG1   1 
ATOM   1972 C  CG2   . ILE A 1 279 ? 46.424 42.657 -2.787  1.00 24.73 ? 279  ILE A CG2   1 
ATOM   1973 C  CD1   . ILE A 1 279 ? 43.705 41.991 -3.634  1.00 29.18 ? 279  ILE A CD1   1 
ATOM   1974 N  N     . PRO A 1 280 ? 49.411 40.412 -2.085  1.00 25.73 ? 280  PRO A N     1 
ATOM   1975 C  CA    . PRO A 1 280 ? 50.493 40.411 -1.092  1.00 26.52 ? 280  PRO A CA    1 
ATOM   1976 C  C     . PRO A 1 280 ? 50.664 41.780 -0.442  1.00 26.71 ? 280  PRO A C     1 
ATOM   1977 O  O     . PRO A 1 280 ? 50.190 42.788 -0.980  1.00 28.49 ? 280  PRO A O     1 
ATOM   1978 C  CB    . PRO A 1 280 ? 51.714 40.062 -1.923  1.00 26.45 ? 280  PRO A CB    1 
ATOM   1979 C  CG    . PRO A 1 280 ? 51.430 40.709 -3.248  1.00 27.08 ? 280  PRO A CG    1 
ATOM   1980 C  CD    . PRO A 1 280 ? 49.930 40.605 -3.456  1.00 26.45 ? 280  PRO A CD    1 
ATOM   1981 N  N     . ASP A 1 281 ? 51.355 41.821 0.698   1.00 27.40 ? 281  ASP A N     1 
ATOM   1982 C  CA    . ASP A 1 281 ? 51.972 43.058 1.188   1.00 27.93 ? 281  ASP A CA    1 
ATOM   1983 C  C     . ASP A 1 281 ? 50.913 44.030 1.723   1.00 27.52 ? 281  ASP A C     1 
ATOM   1984 O  O     . ASP A 1 281 ? 51.040 45.251 1.540   1.00 27.56 ? 281  ASP A O     1 
ATOM   1985 C  CB    . ASP A 1 281 ? 52.748 43.765 0.063   1.00 29.57 ? 281  ASP A CB    1 
ATOM   1986 C  CG    . ASP A 1 281 ? 54.032 43.039 -0.333  1.00 32.44 ? 281  ASP A CG    1 
ATOM   1987 O  OD1   . ASP A 1 281 ? 54.467 42.104 0.389   1.00 32.52 ? 281  ASP A OD1   1 
ATOM   1988 O  OD2   . ASP A 1 281 ? 54.605 43.419 -1.384  1.00 32.46 ? 281  ASP A OD2   1 
ATOM   1989 N  N     . VAL A 1 282 ? 49.850 43.498 2.326   1.00 25.28 ? 282  VAL A N     1 
ATOM   1990 C  CA    . VAL A 1 282 ? 48.689 44.317 2.668   1.00 23.31 ? 282  VAL A CA    1 
ATOM   1991 C  C     . VAL A 1 282 ? 48.760 44.691 4.145   1.00 22.88 ? 282  VAL A C     1 
ATOM   1992 O  O     . VAL A 1 282 ? 48.744 43.821 5.019   1.00 23.05 ? 282  VAL A O     1 
ATOM   1993 C  CB    . VAL A 1 282 ? 47.346 43.572 2.355   1.00 23.28 ? 282  VAL A CB    1 
ATOM   1994 C  CG1   . VAL A 1 282 ? 46.159 44.293 2.986   1.00 20.43 ? 282  VAL A CG1   1 
ATOM   1995 C  CG2   . VAL A 1 282 ? 47.140 43.477 0.861   1.00 21.60 ? 282  VAL A CG2   1 
ATOM   1996 N  N     . ASP A 1 283 ? 48.841 45.988 4.424   1.00 22.08 ? 283  ASP A N     1 
ATOM   1997 C  CA    . ASP A 1 283 ? 48.969 46.455 5.799   1.00 22.59 ? 283  ASP A CA    1 
ATOM   1998 C  C     . ASP A 1 283 ? 47.633 46.534 6.505   1.00 22.14 ? 283  ASP A C     1 
ATOM   1999 O  O     . ASP A 1 283 ? 47.567 46.392 7.721   1.00 23.83 ? 283  ASP A O     1 
ATOM   2000 C  CB    . ASP A 1 283 ? 49.642 47.820 5.850   1.00 23.33 ? 283  ASP A CB    1 
ATOM   2001 C  CG    . ASP A 1 283 ? 50.947 47.839 5.115   1.00 25.87 ? 283  ASP A CG    1 
ATOM   2002 O  OD1   . ASP A 1 283 ? 51.878 47.109 5.513   1.00 27.57 ? 283  ASP A OD1   1 
ATOM   2003 O  OD2   . ASP A 1 283 ? 51.036 48.576 4.115   1.00 27.80 ? 283  ASP A OD2   1 
ATOM   2004 N  N     . CYS A 1 284 ? 46.568 46.776 5.752   1.00 20.70 ? 284  CYS A N     1 
ATOM   2005 C  CA    . CYS A 1 284 ? 45.262 46.953 6.357   1.00 19.18 ? 284  CYS A CA    1 
ATOM   2006 C  C     . CYS A 1 284 ? 44.181 46.267 5.524   1.00 19.40 ? 284  CYS A C     1 
ATOM   2007 O  O     . CYS A 1 284 ? 43.891 46.676 4.400   1.00 17.82 ? 284  CYS A O     1 
ATOM   2008 C  CB    . CYS A 1 284 ? 44.967 48.445 6.519   1.00 20.38 ? 284  CYS A CB    1 
ATOM   2009 S  SG    . CYS A 1 284 ? 43.334 48.845 7.191   1.00 22.31 ? 284  CYS A SG    1 
ATOM   2010 N  N     . LEU A 1 285 ? 43.610 45.199 6.072   1.00 18.17 ? 285  LEU A N     1 
ATOM   2011 C  CA    . LEU A 1 285 ? 42.398 44.630 5.513   1.00 16.51 ? 285  LEU A CA    1 
ATOM   2012 C  C     . LEU A 1 285 ? 41.195 45.002 6.363   1.00 17.26 ? 285  LEU A C     1 
ATOM   2013 O  O     . LEU A 1 285 ? 41.144 44.698 7.555   1.00 17.40 ? 285  LEU A O     1 
ATOM   2014 C  CB    . LEU A 1 285 ? 42.520 43.109 5.400   1.00 17.45 ? 285  LEU A CB    1 
ATOM   2015 C  CG    . LEU A 1 285 ? 41.271 42.344 4.944   1.00 16.94 ? 285  LEU A CG    1 
ATOM   2016 C  CD1   . LEU A 1 285 ? 41.128 42.427 3.432   1.00 19.82 ? 285  LEU A CD1   1 
ATOM   2017 C  CD2   . LEU A 1 285 ? 41.337 40.895 5.408   1.00 18.81 ? 285  LEU A CD2   1 
ATOM   2018 N  N     . LEU A 1 286 ? 40.228 45.662 5.737   1.00 15.99 ? 286  LEU A N     1 
ATOM   2019 C  CA    . LEU A 1 286 ? 39.126 46.298 6.452   1.00 16.76 ? 286  LEU A CA    1 
ATOM   2020 C  C     . LEU A 1 286 ? 37.807 45.686 5.996   1.00 15.17 ? 286  LEU A C     1 
ATOM   2021 O  O     . LEU A 1 286 ? 37.435 45.821 4.840   1.00 17.78 ? 286  LEU A O     1 
ATOM   2022 C  CB    . LEU A 1 286 ? 39.124 47.797 6.176   1.00 17.25 ? 286  LEU A CB    1 
ATOM   2023 C  CG    . LEU A 1 286 ? 38.140 48.598 7.022   1.00 20.55 ? 286  LEU A CG    1 
ATOM   2024 C  CD1   . LEU A 1 286 ? 38.927 49.549 7.898   1.00 23.52 ? 286  LEU A CD1   1 
ATOM   2025 C  CD2   . LEU A 1 286 ? 37.154 49.384 6.143   1.00 24.58 ? 286  LEU A CD2   1 
ATOM   2026 N  N     . TRP A 1 287 ? 37.124 44.992 6.897   1.00 13.78 ? 287  TRP A N     1 
ATOM   2027 C  CA    . TRP A 1 287 ? 35.789 44.466 6.624   1.00 14.05 ? 287  TRP A CA    1 
ATOM   2028 C  C     . TRP A 1 287 ? 34.702 45.527 6.795   1.00 14.01 ? 287  TRP A C     1 
ATOM   2029 O  O     . TRP A 1 287 ? 34.471 46.007 7.901   1.00 14.08 ? 287  TRP A O     1 
ATOM   2030 C  CB    . TRP A 1 287 ? 35.477 43.298 7.558   1.00 14.81 ? 287  TRP A CB    1 
ATOM   2031 C  CG    . TRP A 1 287 ? 36.432 42.152 7.470   1.00 17.74 ? 287  TRP A CG    1 
ATOM   2032 C  CD1   . TRP A 1 287 ? 37.282 41.732 8.441   1.00 16.82 ? 287  TRP A CD1   1 
ATOM   2033 C  CD2   . TRP A 1 287 ? 36.609 41.257 6.362   1.00 18.36 ? 287  TRP A CD2   1 
ATOM   2034 N  NE1   . TRP A 1 287 ? 37.976 40.634 8.018   1.00 19.50 ? 287  TRP A NE1   1 
ATOM   2035 C  CE2   . TRP A 1 287 ? 37.586 40.314 6.746   1.00 18.09 ? 287  TRP A CE2   1 
ATOM   2036 C  CE3   . TRP A 1 287 ? 35.947 41.077 5.139   1.00 18.06 ? 287  TRP A CE3   1 
ATOM   2037 C  CZ2   . TRP A 1 287 ? 37.918 39.210 5.955   1.00 18.69 ? 287  TRP A CZ2   1 
ATOM   2038 C  CZ3   . TRP A 1 287 ? 36.278 39.978 4.353   1.00 19.55 ? 287  TRP A CZ3   1 
ATOM   2039 C  CH2   . TRP A 1 287 ? 37.255 39.059 4.766   1.00 18.13 ? 287  TRP A CH2   1 
ATOM   2040 N  N     . ALA A 1 288 ? 34.013 45.858 5.708   1.00 14.24 ? 288  ALA A N     1 
ATOM   2041 C  CA    . ALA A 1 288 ? 32.843 46.712 5.779   1.00 14.07 ? 288  ALA A CA    1 
ATOM   2042 C  C     . ALA A 1 288 ? 31.659 46.083 5.051   1.00 16.23 ? 288  ALA A C     1 
ATOM   2043 O  O     . ALA A 1 288 ? 31.212 46.555 4.002   1.00 15.12 ? 288  ALA A O     1 
ATOM   2044 C  CB    . ALA A 1 288 ? 33.157 48.082 5.226   1.00 11.64 ? 288  ALA A CB    1 
ATOM   2045 N  N     . ILE A 1 289 ? 31.134 45.024 5.654   1.00 18.52 ? 289  ILE A N     1 
ATOM   2046 C  CA    . ILE A 1 289 ? 30.180 44.140 5.003   1.00 20.69 ? 289  ILE A CA    1 
ATOM   2047 C  C     . ILE A 1 289 ? 28.797 44.180 5.672   1.00 21.95 ? 289  ILE A C     1 
ATOM   2048 O  O     . ILE A 1 289 ? 27.863 43.520 5.222   1.00 23.68 ? 289  ILE A O     1 
ATOM   2049 C  CB    . ILE A 1 289 ? 30.702 42.687 5.002   1.00 20.59 ? 289  ILE A CB    1 
ATOM   2050 C  CG1   . ILE A 1 289 ? 30.829 42.161 6.433   1.00 20.64 ? 289  ILE A CG1   1 
ATOM   2051 C  CG2   . ILE A 1 289 ? 32.048 42.618 4.293   1.00 20.82 ? 289  ILE A CG2   1 
ATOM   2052 C  CD1   . ILE A 1 289 ? 30.993 40.656 6.518   1.00 22.37 ? 289  ILE A CD1   1 
ATOM   2053 N  N     . GLY A 1 290 ? 28.672 44.953 6.744   1.00 22.21 ? 290  GLY A N     1 
ATOM   2054 C  CA    . GLY A 1 290 ? 27.368 45.224 7.317   1.00 21.23 ? 290  GLY A CA    1 
ATOM   2055 C  C     . GLY A 1 290 ? 27.483 45.400 8.816   1.00 21.43 ? 290  GLY A C     1 
ATOM   2056 O  O     . GLY A 1 290 ? 28.550 45.192 9.382   1.00 21.91 ? 290  GLY A O     1 
ATOM   2057 N  N     . ARG A 1 291 ? 26.397 45.822 9.453   1.00 22.22 ? 291  ARG A N     1 
ATOM   2058 C  CA    . ARG A 1 291 ? 26.343 45.941 10.907  1.00 20.62 ? 291  ARG A CA    1 
ATOM   2059 C  C     . ARG A 1 291 ? 25.306 44.994 11.509  1.00 20.93 ? 291  ARG A C     1 
ATOM   2060 O  O     . ARG A 1 291 ? 24.272 44.711 10.901  1.00 21.45 ? 291  ARG A O     1 
ATOM   2061 C  CB    . ARG A 1 291 ? 26.020 47.381 11.321  1.00 21.66 ? 291  ARG A CB    1 
ATOM   2062 C  CG    . ARG A 1 291 ? 26.551 48.455 10.383  1.00 20.57 ? 291  ARG A CG    1 
ATOM   2063 C  CD    . ARG A 1 291 ? 27.617 49.285 11.051  1.00 18.95 ? 291  ARG A CD    1 
ATOM   2064 N  NE    . ARG A 1 291 ? 27.210 49.754 12.374  1.00 19.44 ? 291  ARG A NE    1 
ATOM   2065 C  CZ    . ARG A 1 291 ? 28.039 49.889 13.412  1.00 20.64 ? 291  ARG A CZ    1 
ATOM   2066 N  NH1   . ARG A 1 291 ? 29.333 49.604 13.283  1.00 17.42 ? 291  ARG A NH1   1 
ATOM   2067 N  NH2   . ARG A 1 291 ? 27.578 50.320 14.581  1.00 19.92 ? 291  ARG A NH2   1 
ATOM   2068 N  N     . VAL A 1 292 ? 25.597 44.502 12.706  1.00 19.32 ? 292  VAL A N     1 
ATOM   2069 C  CA    . VAL A 1 292 ? 24.658 43.673 13.444  1.00 19.27 ? 292  VAL A CA    1 
ATOM   2070 C  C     . VAL A 1 292 ? 24.209 44.390 14.718  1.00 18.05 ? 292  VAL A C     1 
ATOM   2071 O  O     . VAL A 1 292 ? 24.959 45.165 15.301  1.00 17.06 ? 292  VAL A O     1 
ATOM   2072 C  CB    . VAL A 1 292 ? 25.285 42.297 13.802  1.00 19.44 ? 292  VAL A CB    1 
ATOM   2073 C  CG1   . VAL A 1 292 ? 25.371 41.427 12.554  1.00 19.56 ? 292  VAL A CG1   1 
ATOM   2074 C  CG2   . VAL A 1 292 ? 26.663 42.480 14.396  1.00 20.54 ? 292  VAL A CG2   1 
ATOM   2075 N  N     . PRO A 1 293 ? 22.969 44.151 15.152  1.00 16.82 ? 293  PRO A N     1 
ATOM   2076 C  CA    . PRO A 1 293 ? 22.463 44.866 16.329  1.00 17.36 ? 293  PRO A CA    1 
ATOM   2077 C  C     . PRO A 1 293 ? 23.063 44.349 17.642  1.00 18.12 ? 293  PRO A C     1 
ATOM   2078 O  O     . PRO A 1 293 ? 23.519 43.214 17.717  1.00 19.52 ? 293  PRO A O     1 
ATOM   2079 C  CB    . PRO A 1 293 ? 20.953 44.648 16.256  1.00 16.33 ? 293  PRO A CB    1 
ATOM   2080 C  CG    . PRO A 1 293 ? 20.788 43.386 15.469  1.00 16.09 ? 293  PRO A CG    1 
ATOM   2081 C  CD    . PRO A 1 293 ? 21.965 43.252 14.554  1.00 16.38 ? 293  PRO A CD    1 
ATOM   2082 N  N     . ASN A 1 294 ? 23.087 45.201 18.660  1.00 18.48 ? 294  ASN A N     1 
ATOM   2083 C  CA    . ASN A 1 294 ? 23.627 44.841 19.962  1.00 20.45 ? 294  ASN A CA    1 
ATOM   2084 C  C     . ASN A 1 294 ? 22.510 44.312 20.855  1.00 21.83 ? 294  ASN A C     1 
ATOM   2085 O  O     . ASN A 1 294 ? 21.971 45.046 21.685  1.00 21.13 ? 294  ASN A O     1 
ATOM   2086 C  CB    . ASN A 1 294 ? 24.236 46.071 20.630  1.00 23.71 ? 294  ASN A CB    1 
ATOM   2087 C  CG    . ASN A 1 294 ? 25.741 46.066 20.600  1.00 26.28 ? 294  ASN A CG    1 
ATOM   2088 O  OD1   . ASN A 1 294 ? 26.341 45.704 19.598  1.00 32.35 ? 294  ASN A OD1   1 
ATOM   2089 N  ND2   . ASN A 1 294 ? 26.365 46.478 21.698  1.00 28.94 ? 294  ASN A ND2   1 
ATOM   2090 N  N     . THR A 1 295 ? 22.164 43.039 20.695  1.00 23.35 ? 295  THR A N     1 
ATOM   2091 C  CA    . THR A 1 295 ? 21.082 42.447 21.473  1.00 24.19 ? 295  THR A CA    1 
ATOM   2092 C  C     . THR A 1 295 ? 21.446 41.106 22.119  1.00 26.60 ? 295  THR A C     1 
ATOM   2093 O  O     . THR A 1 295 ? 20.676 40.573 22.922  1.00 26.15 ? 295  THR A O     1 
ATOM   2094 C  CB    . THR A 1 295 ? 19.850 42.236 20.607  1.00 24.15 ? 295  THR A CB    1 
ATOM   2095 O  OG1   . THR A 1 295 ? 20.226 41.534 19.415  1.00 26.64 ? 295  THR A OG1   1 
ATOM   2096 C  CG2   . THR A 1 295 ? 19.214 43.572 20.249  1.00 22.74 ? 295  THR A CG2   1 
ATOM   2097 N  N     . LYS A 1 296 ? 22.611 40.566 21.764  1.00 28.04 ? 296  LYS A N     1 
ATOM   2098 C  CA    . LYS A 1 296 ? 22.982 39.190 22.114  1.00 30.68 ? 296  LYS A CA    1 
ATOM   2099 C  C     . LYS A 1 296 ? 23.125 39.063 23.631  1.00 30.88 ? 296  LYS A C     1 
ATOM   2100 O  O     . LYS A 1 296 ? 22.964 37.978 24.190  1.00 31.35 ? 296  LYS A O     1 
ATOM   2101 C  CB    . LYS A 1 296 ? 24.313 38.815 21.440  1.00 32.62 ? 296  LYS A CB    1 
ATOM   2102 C  CG    . LYS A 1 296 ? 24.391 37.397 20.889  1.00 37.10 ? 296  LYS A CG    1 
ATOM   2103 C  CD    . LYS A 1 296 ? 24.562 36.339 22.000  1.00 40.60 ? 296  LYS A CD    1 
ATOM   2104 C  CE    . LYS A 1 296 ? 25.774 36.617 22.908  1.00 42.77 ? 296  LYS A CE    1 
ATOM   2105 N  NZ    . LYS A 1 296 ? 25.498 36.310 24.361  1.00 42.44 ? 296  LYS A NZ    1 
ATOM   2106 N  N     . ASP A 1 297 ? 23.430 40.181 24.289  1.00 31.15 ? 297  ASP A N     1 
ATOM   2107 C  CA    . ASP A 1 297 ? 23.866 40.157 25.682  1.00 30.55 ? 297  ASP A CA    1 
ATOM   2108 C  C     . ASP A 1 297 ? 22.841 40.793 26.610  1.00 29.41 ? 297  ASP A C     1 
ATOM   2109 O  O     . ASP A 1 297 ? 23.122 41.026 27.787  1.00 28.17 ? 297  ASP A O     1 
ATOM   2110 C  CB    . ASP A 1 297 ? 25.197 40.894 25.838  1.00 33.84 ? 297  ASP A CB    1 
ATOM   2111 C  CG    . ASP A 1 297 ? 26.354 40.164 25.188  1.00 36.73 ? 297  ASP A CG    1 
ATOM   2112 O  OD1   . ASP A 1 297 ? 26.459 38.914 25.348  1.00 37.24 ? 297  ASP A OD1   1 
ATOM   2113 O  OD2   . ASP A 1 297 ? 27.158 40.857 24.513  1.00 38.43 ? 297  ASP A OD2   1 
ATOM   2114 N  N     . LEU A 1 298 ? 21.662 41.088 26.074  1.00 28.42 ? 298  LEU A N     1 
ATOM   2115 C  CA    . LEU A 1 298 ? 20.647 41.847 26.801  1.00 27.55 ? 298  LEU A CA    1 
ATOM   2116 C  C     . LEU A 1 298 ? 19.669 40.946 27.573  1.00 27.40 ? 298  LEU A C     1 
ATOM   2117 O  O     . LEU A 1 298 ? 18.784 41.445 28.267  1.00 26.98 ? 298  LEU A O     1 
ATOM   2118 C  CB    . LEU A 1 298 ? 19.866 42.721 25.821  1.00 27.28 ? 298  LEU A CB    1 
ATOM   2119 C  CG    . LEU A 1 298 ? 20.316 44.158 25.593  1.00 26.71 ? 298  LEU A CG    1 
ATOM   2120 C  CD1   . LEU A 1 298 ? 19.286 44.841 24.694  1.00 26.34 ? 298  LEU A CD1   1 
ATOM   2121 C  CD2   . LEU A 1 298 ? 20.438 44.886 26.932  1.00 25.60 ? 298  LEU A CD2   1 
ATOM   2122 N  N     . SER A 1 299 ? 19.827 39.628 27.437  1.00 26.98 ? 299  SER A N     1 
ATOM   2123 C  CA    . SER A 1 299 ? 18.871 38.652 27.967  1.00 27.50 ? 299  SER A CA    1 
ATOM   2124 C  C     . SER A 1 299 ? 17.432 38.981 27.581  1.00 27.93 ? 299  SER A C     1 
ATOM   2125 O  O     . SER A 1 299 ? 16.544 39.044 28.432  1.00 27.36 ? 299  SER A O     1 
ATOM   2126 C  CB    . SER A 1 299 ? 18.988 38.549 29.489  1.00 27.33 ? 299  SER A CB    1 
ATOM   2127 O  OG    . SER A 1 299 ? 20.288 38.150 29.875  1.00 27.75 ? 299  SER A OG    1 
ATOM   2128 N  N     . LEU A 1 300 ? 17.203 39.174 26.288  1.00 28.38 ? 300  LEU A N     1 
ATOM   2129 C  CA    . LEU A 1 300 ? 15.882 39.562 25.808  1.00 28.09 ? 300  LEU A CA    1 
ATOM   2130 C  C     . LEU A 1 300 ? 14.907 38.407 26.004  1.00 28.20 ? 300  LEU A C     1 
ATOM   2131 O  O     . LEU A 1 300 ? 13.708 38.622 26.177  1.00 27.31 ? 300  LEU A O     1 
ATOM   2132 C  CB    . LEU A 1 300 ? 15.926 39.952 24.324  1.00 27.09 ? 300  LEU A CB    1 
ATOM   2133 C  CG    . LEU A 1 300 ? 16.555 41.288 23.913  1.00 27.03 ? 300  LEU A CG    1 
ATOM   2134 C  CD1   . LEU A 1 300 ? 16.263 41.513 22.432  1.00 26.91 ? 300  LEU A CD1   1 
ATOM   2135 C  CD2   . LEU A 1 300 ? 16.030 42.450 24.753  1.00 23.81 ? 300  LEU A CD2   1 
ATOM   2136 N  N     . ASN A 1 301 ? 15.428 37.185 25.965  1.00 29.36 ? 301  ASN A N     1 
ATOM   2137 C  CA    . ASN A 1 301 ? 14.575 36.008 25.927  1.00 31.74 ? 301  ASN A CA    1 
ATOM   2138 C  C     . ASN A 1 301 ? 13.963 35.779 27.309  1.00 32.60 ? 301  ASN A C     1 
ATOM   2139 O  O     . ASN A 1 301 ? 12.897 35.162 27.440  1.00 32.64 ? 301  ASN A O     1 
ATOM   2140 C  CB    . ASN A 1 301 ? 15.360 34.772 25.447  1.00 33.54 ? 301  ASN A CB    1 
ATOM   2141 C  CG    . ASN A 1 301 ? 16.451 34.322 26.433  1.00 35.76 ? 301  ASN A CG    1 
ATOM   2142 O  OD1   . ASN A 1 301 ? 17.065 35.138 27.140  1.00 35.29 ? 301  ASN A OD1   1 
ATOM   2143 N  ND2   . ASN A 1 301 ? 16.720 33.010 26.449  1.00 36.58 ? 301  ASN A ND2   1 
ATOM   2144 N  N     . LYS A 1 302 ? 14.598 36.362 28.324  1.00 31.62 ? 302  LYS A N     1 
ATOM   2145 C  CA    . LYS A 1 302 ? 14.035 36.417 29.661  1.00 30.45 ? 302  LYS A CA    1 
ATOM   2146 C  C     . LYS A 1 302 ? 12.663 37.088 29.726  1.00 30.76 ? 302  LYS A C     1 
ATOM   2147 O  O     . LYS A 1 302 ? 11.865 36.774 30.605  1.00 32.43 ? 302  LYS A O     1 
ATOM   2148 C  CB    . LYS A 1 302 ? 15.011 37.119 30.601  1.00 30.99 ? 302  LYS A CB    1 
ATOM   2149 C  CG    . LYS A 1 302 ? 16.212 36.258 30.983  1.00 31.19 ? 302  LYS A CG    1 
ATOM   2150 C  CD    . LYS A 1 302 ? 16.441 36.309 32.475  1.00 32.19 ? 302  LYS A CD    1 
ATOM   2151 C  CE    . LYS A 1 302 ? 17.789 35.737 32.865  1.00 32.78 ? 302  LYS A CE    1 
ATOM   2152 N  NZ    . LYS A 1 302 ? 18.838 36.801 32.839  1.00 36.23 ? 302  LYS A NZ    1 
ATOM   2153 N  N     . LEU A 1 303 ? 12.372 37.995 28.792  1.00 30.02 ? 303  LEU A N     1 
ATOM   2154 C  CA    . LEU A 1 303 ? 11.077 38.686 28.778  1.00 28.20 ? 303  LEU A CA    1 
ATOM   2155 C  C     . LEU A 1 303 ? 10.240 38.398 27.527  1.00 26.81 ? 303  LEU A C     1 
ATOM   2156 O  O     . LEU A 1 303 ? 9.129  38.916 27.376  1.00 25.96 ? 303  LEU A O     1 
ATOM   2157 C  CB    . LEU A 1 303 ? 11.274 40.196 28.951  1.00 29.18 ? 303  LEU A CB    1 
ATOM   2158 C  CG    . LEU A 1 303 ? 11.618 40.644 30.378  1.00 30.42 ? 303  LEU A CG    1 
ATOM   2159 C  CD1   . LEU A 1 303 ? 12.449 41.909 30.339  1.00 29.70 ? 303  LEU A CD1   1 
ATOM   2160 C  CD2   . LEU A 1 303 ? 10.342 40.878 31.193  1.00 31.99 ? 303  LEU A CD2   1 
ATOM   2161 N  N     . GLY A 1 304 ? 10.778 37.570 26.639  1.00 25.42 ? 304  GLY A N     1 
ATOM   2162 C  CA    . GLY A 1 304 ? 10.098 37.275 25.394  1.00 25.75 ? 304  GLY A CA    1 
ATOM   2163 C  C     . GLY A 1 304 ? 9.953  38.488 24.492  1.00 26.28 ? 304  GLY A C     1 
ATOM   2164 O  O     . GLY A 1 304 ? 8.888  38.712 23.913  1.00 26.46 ? 304  GLY A O     1 
ATOM   2165 N  N     . ILE A 1 305 ? 11.014 39.284 24.377  1.00 24.90 ? 305  ILE A N     1 
ATOM   2166 C  CA    . ILE A 1 305 ? 10.989 40.418 23.466  1.00 23.08 ? 305  ILE A CA    1 
ATOM   2167 C  C     . ILE A 1 305 ? 11.316 39.909 22.077  1.00 22.07 ? 305  ILE A C     1 
ATOM   2168 O  O     . ILE A 1 305 ? 12.227 39.102 21.907  1.00 22.34 ? 305  ILE A O     1 
ATOM   2169 C  CB    . ILE A 1 305 ? 11.989 41.534 23.904  1.00 23.56 ? 305  ILE A CB    1 
ATOM   2170 C  CG1   . ILE A 1 305 ? 11.407 42.317 25.080  1.00 22.27 ? 305  ILE A CG1   1 
ATOM   2171 C  CG2   . ILE A 1 305 ? 12.231 42.527 22.778  1.00 22.80 ? 305  ILE A CG2   1 
ATOM   2172 C  CD1   . ILE A 1 305 ? 12.454 42.836 26.051  1.00 23.25 ? 305  ILE A CD1   1 
ATOM   2173 N  N     . GLN A 1 306 ? 10.542 40.361 21.098  1.00 21.31 ? 306  GLN A N     1 
ATOM   2174 C  CA    . GLN A 1 306 ? 10.565 39.811 19.748  1.00 21.50 ? 306  GLN A CA    1 
ATOM   2175 C  C     . GLN A 1 306 ? 11.763 40.359 18.978  1.00 21.70 ? 306  GLN A C     1 
ATOM   2176 O  O     . GLN A 1 306 ? 11.954 41.580 18.908  1.00 22.08 ? 306  GLN A O     1 
ATOM   2177 C  CB    . GLN A 1 306 ? 9.292  40.217 19.006  1.00 21.91 ? 306  GLN A CB    1 
ATOM   2178 C  CG    . GLN A 1 306 ? 8.218  39.161 18.885  1.00 22.14 ? 306  GLN A CG    1 
ATOM   2179 C  CD    . GLN A 1 306 ? 7.168  39.553 17.850  1.00 21.94 ? 306  GLN A CD    1 
ATOM   2180 O  OE1   . GLN A 1 306 ? 6.140  40.141 18.186  1.00 21.03 ? 306  GLN A OE1   1 
ATOM   2181 N  NE2   . GLN A 1 306 ? 7.445  39.263 16.581  1.00 21.11 ? 306  GLN A NE2   1 
ATOM   2182 N  N     . THR A 1 307 ? 12.535 39.461 18.368  1.00 20.61 ? 307  THR A N     1 
ATOM   2183 C  CA    . THR A 1 307 ? 13.546 39.836 17.381  1.00 20.54 ? 307  THR A CA    1 
ATOM   2184 C  C     . THR A 1 307 ? 13.241 39.200 16.024  1.00 21.38 ? 307  THR A C     1 
ATOM   2185 O  O     . THR A 1 307 ? 12.365 38.339 15.924  1.00 21.16 ? 307  THR A O     1 
ATOM   2186 C  CB    . THR A 1 307 ? 14.958 39.402 17.839  1.00 20.36 ? 307  THR A CB    1 
ATOM   2187 O  OG1   . THR A 1 307 ? 14.967 37.991 18.116  1.00 21.79 ? 307  THR A OG1   1 
ATOM   2188 C  CG2   . THR A 1 307 ? 15.353 40.153 19.101  1.00 19.29 ? 307  THR A CG2   1 
ATOM   2189 N  N     . ASP A 1 308 ? 13.954 39.625 14.985  1.00 21.20 ? 308  ASP A N     1 
ATOM   2190 C  CA    . ASP A 1 308 ? 14.043 38.840 13.762  1.00 22.51 ? 308  ASP A CA    1 
ATOM   2191 C  C     . ASP A 1 308 ? 15.245 37.902 13.781  1.00 23.83 ? 308  ASP A C     1 
ATOM   2192 O  O     . ASP A 1 308 ? 15.895 37.728 14.815  1.00 24.77 ? 308  ASP A O     1 
ATOM   2193 C  CB    . ASP A 1 308 ? 14.058 39.745 12.514  1.00 21.51 ? 308  ASP A CB    1 
ATOM   2194 C  CG    . ASP A 1 308 ? 15.265 40.676 12.448  1.00 21.84 ? 308  ASP A CG    1 
ATOM   2195 O  OD1   . ASP A 1 308 ? 16.220 40.529 13.240  1.00 21.68 ? 308  ASP A OD1   1 
ATOM   2196 O  OD2   . ASP A 1 308 ? 15.260 41.567 11.581  1.00 20.19 ? 308  ASP A OD2   1 
ATOM   2197 N  N     . ASP A 1 309 ? 15.539 37.290 12.642  1.00 25.95 ? 309  ASP A N     1 
ATOM   2198 C  CA    . ASP A 1 309 ? 16.553 36.243 12.606  1.00 28.34 ? 309  ASP A CA    1 
ATOM   2199 C  C     . ASP A 1 309 ? 17.956 36.810 12.784  1.00 27.46 ? 309  ASP A C     1 
ATOM   2200 O  O     . ASP A 1 309 ? 18.892 36.068 13.086  1.00 28.54 ? 309  ASP A O     1 
ATOM   2201 C  CB    . ASP A 1 309 ? 16.461 35.424 11.307  1.00 31.85 ? 309  ASP A CB    1 
ATOM   2202 C  CG    . ASP A 1 309 ? 16.622 36.272 10.057  1.00 35.13 ? 309  ASP A CG    1 
ATOM   2203 O  OD1   . ASP A 1 309 ? 16.163 37.445 10.042  1.00 38.79 ? 309  ASP A OD1   1 
ATOM   2204 O  OD2   . ASP A 1 309 ? 17.195 35.759 9.065   1.00 39.49 ? 309  ASP A OD2   1 
ATOM   2205 N  N     . LYS A 1 310 ? 18.097 38.124 12.623  1.00 25.80 ? 310  LYS A N     1 
ATOM   2206 C  CA    . LYS A 1 310 ? 19.392 38.777 12.802  1.00 24.65 ? 310  LYS A CA    1 
ATOM   2207 C  C     . LYS A 1 310 ? 19.478 39.556 14.112  1.00 22.93 ? 310  LYS A C     1 
ATOM   2208 O  O     . LYS A 1 310 ? 20.510 40.159 14.408  1.00 21.99 ? 310  LYS A O     1 
ATOM   2209 C  CB    . LYS A 1 310 ? 19.690 39.705 11.628  1.00 25.79 ? 310  LYS A CB    1 
ATOM   2210 C  CG    . LYS A 1 310 ? 19.784 38.998 10.284  1.00 28.94 ? 310  LYS A CG    1 
ATOM   2211 C  CD    . LYS A 1 310 ? 19.070 39.796 9.197   1.00 33.89 ? 310  LYS A CD    1 
ATOM   2212 C  CE    . LYS A 1 310 ? 19.212 39.122 7.824   1.00 36.31 ? 310  LYS A CE    1 
ATOM   2213 N  NZ    . LYS A 1 310 ? 19.060 37.628 7.943   1.00 38.86 ? 310  LYS A NZ    1 
ATOM   2214 N  N     . GLY A 1 311 ? 18.392 39.539 14.888  1.00 21.21 ? 311  GLY A N     1 
ATOM   2215 C  CA    . GLY A 1 311 ? 18.424 40.046 16.252  1.00 19.81 ? 311  GLY A CA    1 
ATOM   2216 C  C     . GLY A 1 311 ? 18.068 41.516 16.411  1.00 18.74 ? 311  GLY A C     1 
ATOM   2217 O  O     . GLY A 1 311 ? 18.226 42.089 17.486  1.00 18.41 ? 311  GLY A O     1 
ATOM   2218 N  N     . HIS A 1 312 ? 17.607 42.138 15.332  1.00 18.02 ? 312  HIS A N     1 
ATOM   2219 C  CA    . HIS A 1 312 ? 16.903 43.411 15.415  1.00 17.20 ? 312  HIS A CA    1 
ATOM   2220 C  C     . HIS A 1 312 ? 15.696 43.274 16.318  1.00 18.22 ? 312  HIS A C     1 
ATOM   2221 O  O     . HIS A 1 312 ? 15.016 42.255 16.284  1.00 19.32 ? 312  HIS A O     1 
ATOM   2222 C  CB    . HIS A 1 312 ? 16.449 43.844 14.026  1.00 17.17 ? 312  HIS A CB    1 
ATOM   2223 C  CG    . HIS A 1 312 ? 17.565 43.959 13.041  1.00 18.31 ? 312  HIS A CG    1 
ATOM   2224 N  ND1   . HIS A 1 312 ? 17.606 43.236 11.873  1.00 19.19 ? 312  HIS A ND1   1 
ATOM   2225 C  CD2   . HIS A 1 312 ? 18.693 44.714 13.057  1.00 19.10 ? 312  HIS A CD2   1 
ATOM   2226 C  CE1   . HIS A 1 312 ? 18.707 43.537 11.207  1.00 21.62 ? 312  HIS A CE1   1 
ATOM   2227 N  NE2   . HIS A 1 312 ? 19.384 44.432 11.906  1.00 20.54 ? 312  HIS A NE2   1 
ATOM   2228 N  N     . ILE A 1 313 ? 15.424 44.302 17.112  1.00 17.63 ? 313  ILE A N     1 
ATOM   2229 C  CA    . ILE A 1 313 ? 14.203 44.332 17.906  1.00 16.95 ? 313  ILE A CA    1 
ATOM   2230 C  C     . ILE A 1 313 ? 13.010 44.819 17.077  1.00 17.82 ? 313  ILE A C     1 
ATOM   2231 O  O     . ILE A 1 313 ? 13.110 45.787 16.322  1.00 16.98 ? 313  ILE A O     1 
ATOM   2232 C  CB    . ILE A 1 313 ? 14.384 45.176 19.195  1.00 16.16 ? 313  ILE A CB    1 
ATOM   2233 C  CG1   . ILE A 1 313 ? 15.439 44.516 20.093  1.00 17.85 ? 313  ILE A CG1   1 
ATOM   2234 C  CG2   . ILE A 1 313 ? 13.072 45.281 19.961  1.00 16.43 ? 313  ILE A CG2   1 
ATOM   2235 C  CD1   . ILE A 1 313 ? 15.907 45.368 21.229  1.00 17.08 ? 313  ILE A CD1   1 
ATOM   2236 N  N     . ILE A 1 314 ? 11.901 44.087 17.173  1.00 17.97 ? 314  ILE A N     1 
ATOM   2237 C  CA    . ILE A 1 314 ? 10.712 44.377 16.376  1.00 18.08 ? 314  ILE A CA    1 
ATOM   2238 C  C     . ILE A 1 314 ? 9.894  45.439 17.097  1.00 17.93 ? 314  ILE A C     1 
ATOM   2239 O  O     . ILE A 1 314 ? 9.587  45.300 18.281  1.00 17.70 ? 314  ILE A O     1 
ATOM   2240 C  CB    . ILE A 1 314 ? 9.825  43.108 16.155  1.00 18.33 ? 314  ILE A CB    1 
ATOM   2241 C  CG1   . ILE A 1 314 ? 10.678 41.918 15.693  1.00 18.10 ? 314  ILE A CG1   1 
ATOM   2242 C  CG2   . ILE A 1 314 ? 8.723  43.400 15.149  1.00 17.00 ? 314  ILE A CG2   1 
ATOM   2243 C  CD1   . ILE A 1 314 ? 11.517 42.191 14.476  1.00 17.35 ? 314  ILE A CD1   1 
ATOM   2244 N  N     . VAL A 1 315 ? 9.575  46.513 16.386  1.00 17.10 ? 315  VAL A N     1 
ATOM   2245 C  CA    . VAL A 1 315 ? 8.743  47.569 16.944  1.00 17.75 ? 315  VAL A CA    1 
ATOM   2246 C  C     . VAL A 1 315 ? 7.607  47.908 15.998  1.00 18.55 ? 315  VAL A C     1 
ATOM   2247 O  O     . VAL A 1 315 ? 7.667  47.582 14.815  1.00 19.36 ? 315  VAL A O     1 
ATOM   2248 C  CB    . VAL A 1 315 ? 9.567  48.852 17.240  1.00 16.42 ? 315  VAL A CB    1 
ATOM   2249 C  CG1   . VAL A 1 315 ? 10.582 48.579 18.342  1.00 15.89 ? 315  VAL A CG1   1 
ATOM   2250 C  CG2   . VAL A 1 315 ? 10.260 49.348 15.982  1.00 15.04 ? 315  VAL A CG2   1 
ATOM   2251 N  N     . ASP A 1 316 ? 6.571  48.559 16.517  1.00 19.34 ? 316  ASP A N     1 
ATOM   2252 C  CA    . ASP A 1 316 ? 5.572  49.178 15.654  1.00 20.95 ? 316  ASP A CA    1 
ATOM   2253 C  C     . ASP A 1 316 ? 5.952  50.602 15.304  1.00 21.15 ? 316  ASP A C     1 
ATOM   2254 O  O     . ASP A 1 316 ? 7.074  51.037 15.585  1.00 21.50 ? 316  ASP A O     1 
ATOM   2255 C  CB    . ASP A 1 316 ? 4.173  49.131 16.288  1.00 22.66 ? 316  ASP A CB    1 
ATOM   2256 C  CG    . ASP A 1 316 ? 4.115  49.774 17.666  1.00 24.68 ? 316  ASP A CG    1 
ATOM   2257 O  OD1   . ASP A 1 316 ? 4.843  50.749 17.952  1.00 25.96 ? 316  ASP A OD1   1 
ATOM   2258 O  OD2   . ASP A 1 316 ? 3.296  49.306 18.476  1.00 26.45 ? 316  ASP A OD2   1 
ATOM   2259 N  N     . GLU A 1 317 ? 5.012  51.337 14.717  1.00 21.06 ? 317  GLU A N     1 
ATOM   2260 C  CA    . GLU A 1 317 ? 5.341  52.645 14.174  1.00 22.92 ? 317  GLU A CA    1 
ATOM   2261 C  C     . GLU A 1 317 ? 5.528  53.637 15.302  1.00 21.27 ? 317  GLU A C     1 
ATOM   2262 O  O     . GLU A 1 317 ? 5.908  54.778 15.063  1.00 20.91 ? 317  GLU A O     1 
ATOM   2263 C  CB    . GLU A 1 317 ? 4.268  53.157 13.210  1.00 25.94 ? 317  GLU A CB    1 
ATOM   2264 C  CG    . GLU A 1 317 ? 3.192  52.165 12.857  1.00 33.90 ? 317  GLU A CG    1 
ATOM   2265 C  CD    . GLU A 1 317 ? 1.843  52.564 13.427  1.00 38.56 ? 317  GLU A CD    1 
ATOM   2266 O  OE1   . GLU A 1 317 ? 1.295  53.615 12.981  1.00 40.58 ? 317  GLU A OE1   1 
ATOM   2267 O  OE2   . GLU A 1 317 ? 1.336  51.834 14.322  1.00 40.25 ? 317  GLU A OE2   1 
ATOM   2268 N  N     . PHE A 1 318 ? 5.273  53.186 16.530  1.00 19.73 ? 318  PHE A N     1 
ATOM   2269 C  CA    . PHE A 1 318 ? 5.391  54.025 17.719  1.00 18.93 ? 318  PHE A CA    1 
ATOM   2270 C  C     . PHE A 1 318 ? 6.593  53.641 18.571  1.00 18.27 ? 318  PHE A C     1 
ATOM   2271 O  O     . PHE A 1 318 ? 6.778  54.172 19.667  1.00 17.92 ? 318  PHE A O     1 
ATOM   2272 C  CB    . PHE A 1 318 ? 4.108  53.930 18.552  1.00 21.31 ? 318  PHE A CB    1 
ATOM   2273 C  CG    . PHE A 1 318 ? 2.942  54.657 17.944  1.00 22.77 ? 318  PHE A CG    1 
ATOM   2274 C  CD1   . PHE A 1 318 ? 2.875  56.048 17.987  1.00 24.73 ? 318  PHE A CD1   1 
ATOM   2275 C  CD2   . PHE A 1 318 ? 1.933  53.956 17.294  1.00 24.49 ? 318  PHE A CD2   1 
ATOM   2276 C  CE1   . PHE A 1 318 ? 1.817  56.736 17.382  1.00 24.66 ? 318  PHE A CE1   1 
ATOM   2277 C  CE2   . PHE A 1 318 ? 0.870  54.630 16.685  1.00 24.88 ? 318  PHE A CE2   1 
ATOM   2278 C  CZ    . PHE A 1 318 ? 0.814  56.023 16.729  1.00 25.17 ? 318  PHE A CZ    1 
ATOM   2279 N  N     . GLN A 1 319 ? 7.406  52.719 18.055  1.00 17.21 ? 319  GLN A N     1 
ATOM   2280 C  CA    . GLN A 1 319 ? 8.586  52.197 18.756  1.00 16.73 ? 319  GLN A CA    1 
ATOM   2281 C  C     . GLN A 1 319 ? 8.262  51.296 19.961  1.00 17.55 ? 319  GLN A C     1 
ATOM   2282 O  O     . GLN A 1 319 ? 9.097  51.121 20.851  1.00 17.29 ? 319  GLN A O     1 
ATOM   2283 C  CB    . GLN A 1 319 ? 9.530  53.336 19.201  1.00 16.60 ? 319  GLN A CB    1 
ATOM   2284 C  CG    . GLN A 1 319 ? 9.736  54.487 18.205  1.00 13.46 ? 319  GLN A CG    1 
ATOM   2285 C  CD    . GLN A 1 319 ? 10.402 54.065 16.906  1.00 13.73 ? 319  GLN A CD    1 
ATOM   2286 O  OE1   . GLN A 1 319 ? 10.075 54.585 15.844  1.00 12.49 ? 319  GLN A OE1   1 
ATOM   2287 N  NE2   . GLN A 1 319 ? 11.343 53.129 16.986  1.00 12.05 ? 319  GLN A NE2   1 
ATOM   2288 N  N     . ASN A 1 320 ? 7.058  50.722 19.988  1.00 19.00 ? 320  ASN A N     1 
ATOM   2289 C  CA    . ASN A 1 320 ? 6.716  49.704 20.989  1.00 17.75 ? 320  ASN A CA    1 
ATOM   2290 C  C     . ASN A 1 320 ? 7.308  48.367 20.573  1.00 17.33 ? 320  ASN A C     1 
ATOM   2291 O  O     . ASN A 1 320 ? 7.150  47.949 19.426  1.00 18.03 ? 320  ASN A O     1 
ATOM   2292 C  CB    . ASN A 1 320 ? 5.201  49.542 21.127  1.00 18.10 ? 320  ASN A CB    1 
ATOM   2293 C  CG    . ASN A 1 320 ? 4.531  50.776 21.669  1.00 17.43 ? 320  ASN A CG    1 
ATOM   2294 O  OD1   . ASN A 1 320 ? 4.861  51.253 22.757  1.00 18.85 ? 320  ASN A OD1   1 
ATOM   2295 N  ND2   . ASN A 1 320 ? 3.578  51.307 20.909  1.00 17.54 ? 320  ASN A ND2   1 
ATOM   2296 N  N     . THR A 1 321 ? 7.956  47.686 21.512  1.00 15.63 ? 321  THR A N     1 
ATOM   2297 C  CA    . THR A 1 321 ? 8.113  46.241 21.425  1.00 16.75 ? 321  THR A CA    1 
ATOM   2298 C  C     . THR A 1 321 ? 6.772  45.510 21.630  1.00 18.38 ? 321  THR A C     1 
ATOM   2299 O  O     . THR A 1 321 ? 5.726  46.142 21.788  1.00 18.24 ? 321  THR A O     1 
ATOM   2300 C  CB    . THR A 1 321 ? 9.169  45.740 22.432  1.00 15.32 ? 321  THR A CB    1 
ATOM   2301 O  OG1   . THR A 1 321 ? 8.641  45.782 23.764  1.00 13.26 ? 321  THR A OG1   1 
ATOM   2302 C  CG2   . THR A 1 321 ? 10.408 46.613 22.364  1.00 14.48 ? 321  THR A CG2   1 
ATOM   2303 N  N     . ASN A 1 322 ? 6.812  44.182 21.609  1.00 18.75 ? 322  ASN A N     1 
ATOM   2304 C  CA    . ASN A 1 322 ? 5.654  43.364 21.963  1.00 20.36 ? 322  ASN A CA    1 
ATOM   2305 C  C     . ASN A 1 322 ? 5.367  43.357 23.475  1.00 21.23 ? 322  ASN A C     1 
ATOM   2306 O  O     . ASN A 1 322 ? 4.319  42.879 23.909  1.00 20.46 ? 322  ASN A O     1 
ATOM   2307 C  CB    . ASN A 1 322 ? 5.866  41.930 21.474  1.00 20.44 ? 322  ASN A CB    1 
ATOM   2308 C  CG    . ASN A 1 322 ? 7.071  41.261 22.128  1.00 21.30 ? 322  ASN A CG    1 
ATOM   2309 O  OD1   . ASN A 1 322 ? 8.170  41.818 22.163  1.00 22.20 ? 322  ASN A OD1   1 
ATOM   2310 N  ND2   . ASN A 1 322 ? 6.862  40.070 22.660  1.00 21.55 ? 322  ASN A ND2   1 
ATOM   2311 N  N     . VAL A 1 323 ? 6.299  43.881 24.267  1.00 22.09 ? 323  VAL A N     1 
ATOM   2312 C  CA    . VAL A 1 323 ? 6.153  43.921 25.715  1.00 23.19 ? 323  VAL A CA    1 
ATOM   2313 C  C     . VAL A 1 323 ? 5.827  45.329 26.180  1.00 24.70 ? 323  VAL A C     1 
ATOM   2314 O  O     . VAL A 1 323 ? 6.557  46.274 25.870  1.00 25.08 ? 323  VAL A O     1 
ATOM   2315 C  CB    . VAL A 1 323 ? 7.443  43.485 26.409  1.00 23.62 ? 323  VAL A CB    1 
ATOM   2316 C  CG1   . VAL A 1 323 ? 7.249  43.474 27.911  1.00 23.98 ? 323  VAL A CG1   1 
ATOM   2317 C  CG2   . VAL A 1 323 ? 7.876  42.122 25.895  1.00 24.83 ? 323  VAL A CG2   1 
ATOM   2318 N  N     . LYS A 1 324 ? 4.740  45.468 26.934  1.00 26.55 ? 324  LYS A N     1 
ATOM   2319 C  CA    . LYS A 1 324 ? 4.223  46.785 27.301  1.00 27.10 ? 324  LYS A CA    1 
ATOM   2320 C  C     . LYS A 1 324 ? 5.189  47.503 28.243  1.00 26.53 ? 324  LYS A C     1 
ATOM   2321 O  O     . LYS A 1 324 ? 5.696  46.900 29.196  1.00 26.10 ? 324  LYS A O     1 
ATOM   2322 C  CB    . LYS A 1 324 ? 2.849  46.666 27.970  1.00 29.73 ? 324  LYS A CB    1 
ATOM   2323 C  CG    . LYS A 1 324 ? 1.824  47.703 27.470  1.00 33.93 ? 324  LYS A CG    1 
ATOM   2324 C  CD    . LYS A 1 324 ? 1.912  49.029 28.246  1.00 36.19 ? 324  LYS A CD    1 
ATOM   2325 C  CE    . LYS A 1 324 ? 1.975  50.236 27.295  1.00 37.86 ? 324  LYS A CE    1 
ATOM   2326 N  NZ    . LYS A 1 324 ? 3.301  50.966 27.306  1.00 38.57 ? 324  LYS A NZ    1 
ATOM   2327 N  N     . GLY A 1 325 ? 5.453  48.779 27.954  1.00 24.90 ? 325  GLY A N     1 
ATOM   2328 C  CA    . GLY A 1 325 ? 6.388  49.556 28.756  1.00 23.55 ? 325  GLY A CA    1 
ATOM   2329 C  C     . GLY A 1 325 ? 7.848  49.414 28.355  1.00 21.68 ? 325  GLY A C     1 
ATOM   2330 O  O     . GLY A 1 325 ? 8.732  50.005 28.982  1.00 19.73 ? 325  GLY A O     1 
ATOM   2331 N  N     . ILE A 1 326 ? 8.098  48.639 27.305  1.00 20.60 ? 326  ILE A N     1 
ATOM   2332 C  CA    . ILE A 1 326 ? 9.437  48.524 26.731  1.00 19.58 ? 326  ILE A CA    1 
ATOM   2333 C  C     . ILE A 1 326 ? 9.450  48.946 25.258  1.00 19.16 ? 326  ILE A C     1 
ATOM   2334 O  O     . ILE A 1 326 ? 8.560  48.561 24.482  1.00 17.40 ? 326  ILE A O     1 
ATOM   2335 C  CB    . ILE A 1 326 ? 9.984  47.080 26.861  1.00 19.74 ? 326  ILE A CB    1 
ATOM   2336 C  CG1   . ILE A 1 326 ? 10.219 46.740 28.341  1.00 19.99 ? 326  ILE A CG1   1 
ATOM   2337 C  CG2   . ILE A 1 326 ? 11.283 46.939 26.096  1.00 17.25 ? 326  ILE A CG2   1 
ATOM   2338 C  CD1   . ILE A 1 326 ? 10.334 45.266 28.633  1.00 20.87 ? 326  ILE A CD1   1 
ATOM   2339 N  N     . TYR A 1 327 ? 10.450 49.756 24.899  1.00 17.19 ? 327  TYR A N     1 
ATOM   2340 C  CA    . TYR A 1 327 ? 10.518 50.431 23.605  1.00 16.14 ? 327  TYR A CA    1 
ATOM   2341 C  C     . TYR A 1 327 ? 11.891 50.221 22.992  1.00 16.05 ? 327  TYR A C     1 
ATOM   2342 O  O     . TYR A 1 327 ? 12.819 49.792 23.672  1.00 15.23 ? 327  TYR A O     1 
ATOM   2343 C  CB    . TYR A 1 327 ? 10.251 51.932 23.764  1.00 16.98 ? 327  TYR A CB    1 
ATOM   2344 C  CG    . TYR A 1 327 ? 9.122  52.238 24.718  1.00 16.08 ? 327  TYR A CG    1 
ATOM   2345 C  CD1   . TYR A 1 327 ? 7.800  52.294 24.268  1.00 16.70 ? 327  TYR A CD1   1 
ATOM   2346 C  CD2   . TYR A 1 327 ? 9.363  52.384 26.084  1.00 15.28 ? 327  TYR A CD2   1 
ATOM   2347 C  CE1   . TYR A 1 327 ? 6.751  52.477 25.154  1.00 16.59 ? 327  TYR A CE1   1 
ATOM   2348 C  CE2   . TYR A 1 327 ? 8.318  52.570 26.982  1.00 16.56 ? 327  TYR A CE2   1 
ATOM   2349 C  CZ    . TYR A 1 327 ? 7.018  52.607 26.509  1.00 17.17 ? 327  TYR A CZ    1 
ATOM   2350 O  OH    . TYR A 1 327 ? 5.984  52.752 27.394  1.00 20.06 ? 327  TYR A OH    1 
ATOM   2351 N  N     . ALA A 1 328 ? 12.017 50.528 21.707  1.00 15.76 ? 328  ALA A N     1 
ATOM   2352 C  CA    . ALA A 1 328 ? 13.313 50.516 21.037  1.00 15.82 ? 328  ALA A CA    1 
ATOM   2353 C  C     . ALA A 1 328 ? 13.367 51.572 19.941  1.00 14.50 ? 328  ALA A C     1 
ATOM   2354 O  O     . ALA A 1 328 ? 12.400 51.756 19.202  1.00 14.62 ? 328  ALA A O     1 
ATOM   2355 C  CB    . ALA A 1 328 ? 13.607 49.125 20.459  1.00 16.26 ? 328  ALA A CB    1 
ATOM   2356 N  N     . VAL A 1 329 ? 14.483 52.295 19.879  1.00 13.82 ? 329  VAL A N     1 
ATOM   2357 C  CA    . VAL A 1 329 ? 14.758 53.216 18.778  1.00 13.74 ? 329  VAL A CA    1 
ATOM   2358 C  C     . VAL A 1 329 ? 16.143 52.961 18.219  1.00 13.07 ? 329  VAL A C     1 
ATOM   2359 O  O     . VAL A 1 329 ? 17.006 52.411 18.900  1.00 13.43 ? 329  VAL A O     1 
ATOM   2360 C  CB    . VAL A 1 329 ? 14.654 54.712 19.211  1.00 13.86 ? 329  VAL A CB    1 
ATOM   2361 C  CG1   . VAL A 1 329 ? 13.314 54.987 19.869  1.00 14.70 ? 329  VAL A CG1   1 
ATOM   2362 C  CG2   . VAL A 1 329 ? 15.793 55.096 20.135  1.00 13.04 ? 329  VAL A CG2   1 
ATOM   2363 N  N     . GLY A 1 330 ? 16.340 53.361 16.971  1.00 12.34 ? 330  GLY A N     1 
ATOM   2364 C  CA    . GLY A 1 330 ? 17.678 53.505 16.437  1.00 12.41 ? 330  GLY A CA    1 
ATOM   2365 C  C     . GLY A 1 330 ? 18.186 52.247 15.760  1.00 12.74 ? 330  GLY A C     1 
ATOM   2366 O  O     . GLY A 1 330 ? 17.406 51.424 15.267  1.00 11.93 ? 330  GLY A O     1 
ATOM   2367 N  N     . ASP A 1 331 ? 19.505 52.098 15.741  1.00 13.17 ? 331  ASP A N     1 
ATOM   2368 C  CA    . ASP A 1 331 ? 20.150 51.070 14.930  1.00 13.71 ? 331  ASP A CA    1 
ATOM   2369 C  C     . ASP A 1 331 ? 19.690 49.670 15.313  1.00 13.86 ? 331  ASP A C     1 
ATOM   2370 O  O     . ASP A 1 331 ? 19.670 48.778 14.470  1.00 14.17 ? 331  ASP A O     1 
ATOM   2371 C  CB    . ASP A 1 331 ? 21.670 51.150 15.068  1.00 13.65 ? 331  ASP A CB    1 
ATOM   2372 C  CG    . ASP A 1 331 ? 22.301 52.119 14.093  1.00 14.04 ? 331  ASP A CG    1 
ATOM   2373 O  OD1   . ASP A 1 331 ? 21.591 52.988 13.553  1.00 11.92 ? 331  ASP A OD1   1 
ATOM   2374 O  OD2   . ASP A 1 331 ? 23.517 52.014 13.879  1.00 13.96 ? 331  ASP A OD2   1 
ATOM   2375 N  N     . VAL A 1 332 ? 19.354 49.483 16.589  1.00 12.43 ? 332  VAL A N     1 
ATOM   2376 C  CA    . VAL A 1 332 ? 19.004 48.169 17.119  1.00 12.78 ? 332  VAL A CA    1 
ATOM   2377 C  C     . VAL A 1 332 ? 17.732 47.605 16.468  1.00 13.34 ? 332  VAL A C     1 
ATOM   2378 O  O     . VAL A 1 332 ? 17.519 46.396 16.454  1.00 12.61 ? 332  VAL A O     1 
ATOM   2379 C  CB    . VAL A 1 332 ? 18.859 48.215 18.663  1.00 12.80 ? 332  VAL A CB    1 
ATOM   2380 C  CG1   . VAL A 1 332 ? 17.532 48.823 19.065  1.00 12.67 ? 332  VAL A CG1   1 
ATOM   2381 C  CG2   . VAL A 1 332 ? 19.017 46.835 19.251  1.00 11.66 ? 332  VAL A CG2   1 
ATOM   2382 N  N     . CYS A 1 333 ? 16.940 48.485 15.861  1.00 14.68 ? 333  CYS A N     1 
ATOM   2383 C  CA    . CYS A 1 333 ? 15.747 48.081 15.120  1.00 17.55 ? 333  CYS A CA    1 
ATOM   2384 C  C     . CYS A 1 333 ? 15.970 47.880 13.615  1.00 18.57 ? 333  CYS A C     1 
ATOM   2385 O  O     . CYS A 1 333 ? 15.118 47.311 12.922  1.00 18.11 ? 333  CYS A O     1 
ATOM   2386 C  CB    . CYS A 1 333 ? 14.634 49.103 15.339  1.00 15.87 ? 333  CYS A CB    1 
ATOM   2387 S  SG    . CYS A 1 333 ? 14.213 49.322 17.061  1.00 15.75 ? 333  CYS A SG    1 
ATOM   2388 N  N     . GLY A 1 334 ? 17.090 48.385 13.110  1.00 18.43 ? 334  GLY A N     1 
ATOM   2389 C  CA    . GLY A 1 334 ? 17.597 47.922 11.834  1.00 19.72 ? 334  GLY A CA    1 
ATOM   2390 C  C     . GLY A 1 334 ? 16.969 48.636 10.651  1.00 21.73 ? 334  GLY A C     1 
ATOM   2391 O  O     . GLY A 1 334 ? 17.081 48.176 9.510   1.00 23.63 ? 334  GLY A O     1 
ATOM   2392 N  N     . LYS A 1 335 ? 16.314 49.764 10.919  1.00 22.98 ? 335  LYS A N     1 
ATOM   2393 C  CA    . LYS A 1 335 ? 15.639 50.544 9.879   1.00 23.16 ? 335  LYS A CA    1 
ATOM   2394 C  C     . LYS A 1 335 ? 16.222 51.959 9.845   1.00 22.11 ? 335  LYS A C     1 
ATOM   2395 O  O     . LYS A 1 335 ? 16.240 52.652 10.867  1.00 22.07 ? 335  LYS A O     1 
ATOM   2396 C  CB    . LYS A 1 335 ? 14.125 50.611 10.168  1.00 24.80 ? 335  LYS A CB    1 
ATOM   2397 C  CG    . LYS A 1 335 ? 13.344 51.586 9.280   1.00 29.00 ? 335  LYS A CG    1 
ATOM   2398 C  CD    . LYS A 1 335 ? 11.821 51.551 9.559   1.00 31.32 ? 335  LYS A CD    1 
ATOM   2399 C  CE    . LYS A 1 335 ? 10.987 51.252 8.290   1.00 33.34 ? 335  LYS A CE    1 
ATOM   2400 N  NZ    . LYS A 1 335 ? 11.623 51.717 7.000   1.00 32.92 ? 335  LYS A NZ    1 
ATOM   2401 N  N     . ALA A 1 336 ? 16.692 52.385 8.676   1.00 19.82 ? 336  ALA A N     1 
ATOM   2402 C  CA    . ALA A 1 336 ? 17.234 53.733 8.512   1.00 18.38 ? 336  ALA A CA    1 
ATOM   2403 C  C     . ALA A 1 336 ? 18.325 54.011 9.555   1.00 17.37 ? 336  ALA A C     1 
ATOM   2404 O  O     . ALA A 1 336 ? 18.073 54.618 10.594  1.00 16.22 ? 336  ALA A O     1 
ATOM   2405 C  CB    . ALA A 1 336 ? 16.114 54.768 8.616   1.00 16.27 ? 336  ALA A CB    1 
ATOM   2406 N  N     . LEU A 1 337 ? 19.526 53.519 9.279   1.00 16.16 ? 337  LEU A N     1 
ATOM   2407 C  CA    . LEU A 1 337 ? 20.580 53.432 10.278  1.00 16.85 ? 337  LEU A CA    1 
ATOM   2408 C  C     . LEU A 1 337 ? 21.360 54.747 10.233  1.00 16.58 ? 337  LEU A C     1 
ATOM   2409 O  O     . LEU A 1 337 ? 22.442 54.809 9.663   1.00 16.26 ? 337  LEU A O     1 
ATOM   2410 C  CB    . LEU A 1 337 ? 21.510 52.254 9.958   1.00 18.40 ? 337  LEU A CB    1 
ATOM   2411 C  CG    . LEU A 1 337 ? 21.321 50.938 10.723  1.00 21.75 ? 337  LEU A CG    1 
ATOM   2412 C  CD1   . LEU A 1 337 ? 19.878 50.490 10.679  1.00 22.49 ? 337  LEU A CD1   1 
ATOM   2413 C  CD2   . LEU A 1 337 ? 22.219 49.856 10.139  1.00 22.67 ? 337  LEU A CD2   1 
ATOM   2414 N  N     . LEU A 1 338 ? 20.765 55.804 10.780  1.00 14.83 ? 338  LEU A N     1 
ATOM   2415 C  CA    . LEU A 1 338 ? 21.330 57.150 10.715  1.00 13.97 ? 338  LEU A CA    1 
ATOM   2416 C  C     . LEU A 1 338 ? 21.130 57.836 12.057  1.00 13.50 ? 338  LEU A C     1 
ATOM   2417 O  O     . LEU A 1 338 ? 20.160 57.562 12.752  1.00 13.12 ? 338  LEU A O     1 
ATOM   2418 C  CB    . LEU A 1 338 ? 20.639 57.968 9.626   1.00 13.63 ? 338  LEU A CB    1 
ATOM   2419 C  CG    . LEU A 1 338 ? 20.793 57.460 8.198   1.00 15.20 ? 338  LEU A CG    1 
ATOM   2420 C  CD1   . LEU A 1 338 ? 19.771 58.131 7.305   1.00 15.71 ? 338  LEU A CD1   1 
ATOM   2421 C  CD2   . LEU A 1 338 ? 22.202 57.725 7.707   1.00 15.43 ? 338  LEU A CD2   1 
ATOM   2422 N  N     . THR A 1 339 ? 22.045 58.732 12.407  1.00 11.68 ? 339  THR A N     1 
ATOM   2423 C  CA    . THR A 1 339 ? 22.004 59.436 13.686  1.00 12.66 ? 339  THR A CA    1 
ATOM   2424 C  C     . THR A 1 339 ? 20.744 60.280 13.855  1.00 12.02 ? 339  THR A C     1 
ATOM   2425 O  O     . THR A 1 339 ? 20.097 60.220 14.887  1.00 13.07 ? 339  THR A O     1 
ATOM   2426 C  CB    . THR A 1 339 ? 23.276 60.309 13.884  1.00 12.40 ? 339  THR A CB    1 
ATOM   2427 O  OG1   . THR A 1 339 ? 24.334 59.487 14.392  1.00 14.78 ? 339  THR A OG1   1 
ATOM   2428 C  CG2   . THR A 1 339 ? 23.026 61.479 14.842  1.00 11.27 ? 339  THR A CG2   1 
ATOM   2429 N  N     . PRO A 1 340 ? 20.386 61.079 12.841  1.00 12.75 ? 340  PRO A N     1 
ATOM   2430 C  CA    . PRO A 1 340 ? 19.241 61.969 13.028  1.00 14.91 ? 340  PRO A CA    1 
ATOM   2431 C  C     . PRO A 1 340 ? 17.914 61.223 13.108  1.00 15.03 ? 340  PRO A C     1 
ATOM   2432 O  O     . PRO A 1 340 ? 16.965 61.702 13.729  1.00 17.60 ? 340  PRO A O     1 
ATOM   2433 C  CB    . PRO A 1 340 ? 19.304 62.898 11.809  1.00 15.03 ? 340  PRO A CB    1 
ATOM   2434 C  CG    . PRO A 1 340 ? 20.700 62.790 11.316  1.00 13.12 ? 340  PRO A CG    1 
ATOM   2435 C  CD    . PRO A 1 340 ? 21.096 61.381 11.588  1.00 13.08 ? 340  PRO A CD    1 
ATOM   2436 N  N     . VAL A 1 341 ? 17.865 60.030 12.527  1.00 14.58 ? 341  VAL A N     1 
ATOM   2437 C  CA    . VAL A 1 341 ? 16.695 59.169 12.662  1.00 13.94 ? 341  VAL A CA    1 
ATOM   2438 C  C     . VAL A 1 341 ? 16.556 58.649 14.086  1.00 13.88 ? 341  VAL A C     1 
ATOM   2439 O  O     . VAL A 1 341 ? 15.495 58.777 14.681  1.00 14.58 ? 341  VAL A O     1 
ATOM   2440 C  CB    . VAL A 1 341 ? 16.742 57.989 11.677  1.00 13.94 ? 341  VAL A CB    1 
ATOM   2441 C  CG1   . VAL A 1 341 ? 15.528 57.089 11.868  1.00 16.04 ? 341  VAL A CG1   1 
ATOM   2442 C  CG2   . VAL A 1 341 ? 16.795 58.511 10.252  1.00 12.87 ? 341  VAL A CG2   1 
ATOM   2443 N  N     . ALA A 1 342 ? 17.642 58.103 14.634  1.00 13.35 ? 342  ALA A N     1 
ATOM   2444 C  CA    . ALA A 1 342 ? 17.718 57.714 16.042  1.00 12.49 ? 342  ALA A CA    1 
ATOM   2445 C  C     . ALA A 1 342 ? 17.280 58.834 16.995  1.00 13.21 ? 342  ALA A C     1 
ATOM   2446 O  O     . ALA A 1 342 ? 16.524 58.594 17.942  1.00 12.47 ? 342  ALA A O     1 
ATOM   2447 C  CB    . ALA A 1 342 ? 19.129 57.260 16.379  1.00 13.22 ? 342  ALA A CB    1 
ATOM   2448 N  N     . ILE A 1 343 ? 17.764 60.049 16.735  1.00 11.78 ? 343  ILE A N     1 
ATOM   2449 C  CA    . ILE A 1 343 ? 17.427 61.216 17.546  1.00 12.31 ? 343  ILE A CA    1 
ATOM   2450 C  C     . ILE A 1 343 ? 15.938 61.575 17.465  1.00 12.89 ? 343  ILE A C     1 
ATOM   2451 O  O     . ILE A 1 343 ? 15.260 61.624 18.487  1.00 13.15 ? 343  ILE A O     1 
ATOM   2452 C  CB    . ILE A 1 343 ? 18.314 62.441 17.170  1.00 10.99 ? 343  ILE A CB    1 
ATOM   2453 C  CG1   . ILE A 1 343 ? 19.749 62.201 17.646  1.00 11.09 ? 343  ILE A CG1   1 
ATOM   2454 C  CG2   . ILE A 1 343 ? 17.769 63.725 17.801  1.00 10.28 ? 343  ILE A CG2   1 
ATOM   2455 C  CD1   . ILE A 1 343 ? 20.757 63.235 17.180  1.00 10.18 ? 343  ILE A CD1   1 
ATOM   2456 N  N     . ALA A 1 344 ? 15.434 61.794 16.254  1.00 12.39 ? 344  ALA A N     1 
ATOM   2457 C  CA    . ALA A 1 344 ? 14.032 62.165 16.060  1.00 13.36 ? 344  ALA A CA    1 
ATOM   2458 C  C     . ALA A 1 344 ? 13.042 61.139 16.628  1.00 12.85 ? 344  ALA A C     1 
ATOM   2459 O  O     . ALA A 1 344 ? 12.045 61.515 17.240  1.00 13.77 ? 344  ALA A O     1 
ATOM   2460 C  CB    . ALA A 1 344 ? 13.751 62.417 14.579  1.00 12.63 ? 344  ALA A CB    1 
ATOM   2461 N  N     . ALA A 1 345 ? 13.321 59.850 16.429  1.00 12.69 ? 345  ALA A N     1 
ATOM   2462 C  CA    . ALA A 1 345 ? 12.486 58.784 16.993  1.00 13.00 ? 345  ALA A CA    1 
ATOM   2463 C  C     . ALA A 1 345 ? 12.533 58.774 18.528  1.00 15.13 ? 345  ALA A C     1 
ATOM   2464 O  O     . ALA A 1 345 ? 11.508 58.567 19.190  1.00 16.14 ? 345  ALA A O     1 
ATOM   2465 C  CB    . ALA A 1 345 ? 12.905 57.436 16.447  1.00 10.52 ? 345  ALA A CB    1 
ATOM   2466 N  N     . GLY A 1 346 ? 13.717 59.021 19.086  1.00 15.38 ? 346  GLY A N     1 
ATOM   2467 C  CA    . GLY A 1 346 ? 13.859 59.084 20.529  1.00 15.31 ? 346  GLY A CA    1 
ATOM   2468 C  C     . GLY A 1 346 ? 13.111 60.256 21.135  1.00 15.74 ? 346  GLY A C     1 
ATOM   2469 O  O     . GLY A 1 346 ? 12.492 60.127 22.196  1.00 15.71 ? 346  GLY A O     1 
ATOM   2470 N  N     . ARG A 1 347 ? 13.165 61.395 20.454  1.00 14.69 ? 347  ARG A N     1 
ATOM   2471 C  CA    . ARG A 1 347 ? 12.476 62.598 20.900  1.00 16.38 ? 347  ARG A CA    1 
ATOM   2472 C  C     . ARG A 1 347 ? 10.961 62.496 20.754  1.00 16.95 ? 347  ARG A C     1 
ATOM   2473 O  O     . ARG A 1 347 ? 10.219 62.885 21.655  1.00 17.17 ? 347  ARG A O     1 
ATOM   2474 C  CB    . ARG A 1 347 ? 12.982 63.816 20.131  1.00 16.28 ? 347  ARG A CB    1 
ATOM   2475 C  CG    . ARG A 1 347 ? 14.389 64.221 20.485  1.00 16.34 ? 347  ARG A CG    1 
ATOM   2476 C  CD    . ARG A 1 347 ? 14.843 65.309 19.544  1.00 19.11 ? 347  ARG A CD    1 
ATOM   2477 N  NE    . ARG A 1 347 ? 15.824 66.201 20.151  1.00 20.37 ? 347  ARG A NE    1 
ATOM   2478 C  CZ    . ARG A 1 347 ? 16.915 66.638 19.537  1.00 21.05 ? 347  ARG A CZ    1 
ATOM   2479 N  NH1   . ARG A 1 347 ? 16.872 66.939 18.250  1.00 20.59 ? 347  ARG A NH1   1 
ATOM   2480 N  NH2   . ARG A 1 347 ? 18.045 66.774 20.213  1.00 20.53 ? 347  ARG A NH2   1 
ATOM   2481 N  N     . LYS A 1 348 ? 10.505 61.980 19.617  1.00 16.66 ? 348  LYS A N     1 
ATOM   2482 C  CA    . LYS A 1 348 ? 9.077  61.776 19.390  1.00 17.57 ? 348  LYS A CA    1 
ATOM   2483 C  C     . LYS A 1 348 ? 8.468  60.898 20.482  1.00 16.78 ? 348  LYS A C     1 
ATOM   2484 O  O     . LYS A 1 348 ? 7.433  61.233 21.050  1.00 16.84 ? 348  LYS A O     1 
ATOM   2485 C  CB    . LYS A 1 348 ? 8.852  61.137 18.020  1.00 17.69 ? 348  LYS A CB    1 
ATOM   2486 C  CG    . LYS A 1 348 ? 8.305  62.089 16.982  1.00 20.60 ? 348  LYS A CG    1 
ATOM   2487 C  CD    . LYS A 1 348 ? 9.327  63.132 16.587  1.00 23.48 ? 348  LYS A CD    1 
ATOM   2488 C  CE    . LYS A 1 348 ? 8.690  64.283 15.810  1.00 26.40 ? 348  LYS A CE    1 
ATOM   2489 N  NZ    . LYS A 1 348 ? 7.205  64.143 15.644  1.00 29.85 ? 348  LYS A NZ    1 
ATOM   2490 N  N     . LEU A 1 349 ? 9.141  59.784 20.774  1.00 16.34 ? 349  LEU A N     1 
ATOM   2491 C  CA    . LEU A 1 349 ? 8.730  58.852 21.817  1.00 17.01 ? 349  LEU A CA    1 
ATOM   2492 C  C     . LEU A 1 349 ? 8.654  59.484 23.213  1.00 16.89 ? 349  LEU A C     1 
ATOM   2493 O  O     . LEU A 1 349 ? 7.721  59.217 23.966  1.00 17.34 ? 349  LEU A O     1 
ATOM   2494 C  CB    . LEU A 1 349 ? 9.666  57.638 21.831  1.00 16.70 ? 349  LEU A CB    1 
ATOM   2495 C  CG    . LEU A 1 349 ? 9.463  56.583 22.925  1.00 17.19 ? 349  LEU A CG    1 
ATOM   2496 C  CD1   . LEU A 1 349 ? 8.189  55.785 22.645  1.00 16.06 ? 349  LEU A CD1   1 
ATOM   2497 C  CD2   . LEU A 1 349 ? 10.677 55.659 23.001  1.00 16.72 ? 349  LEU A CD2   1 
ATOM   2498 N  N     . ALA A 1 350 ? 9.623  60.322 23.559  1.00 18.15 ? 350  ALA A N     1 
ATOM   2499 C  CA    . ALA A 1 350 ? 9.594  60.994 24.851  1.00 19.79 ? 350  ALA A CA    1 
ATOM   2500 C  C     . ALA A 1 350 ? 8.407  61.961 24.940  1.00 21.78 ? 350  ALA A C     1 
ATOM   2501 O  O     . ALA A 1 350 ? 7.805  62.123 26.005  1.00 22.71 ? 350  ALA A O     1 
ATOM   2502 C  CB    . ALA A 1 350 ? 10.897 61.723 25.094  1.00 21.08 ? 350  ALA A CB    1 
ATOM   2503 N  N     . HIS A 1 351 ? 8.037  62.560 23.811  1.00 20.82 ? 351  HIS A N     1 
ATOM   2504 C  CA    . HIS A 1 351 ? 6.816  63.348 23.747  1.00 21.44 ? 351  HIS A CA    1 
ATOM   2505 C  C     . HIS A 1 351 ? 5.562  62.504 23.947  1.00 20.78 ? 351  HIS A C     1 
ATOM   2506 O  O     . HIS A 1 351 ? 4.684  62.894 24.714  1.00 22.31 ? 351  HIS A O     1 
ATOM   2507 C  CB    . HIS A 1 351 ? 6.753  64.145 22.449  1.00 20.63 ? 351  HIS A CB    1 
ATOM   2508 C  CG    . HIS A 1 351 ? 7.615  65.366 22.468  1.00 22.73 ? 351  HIS A CG    1 
ATOM   2509 N  ND1   . HIS A 1 351 ? 7.360  66.441 23.294  1.00 22.70 ? 351  HIS A ND1   1 
ATOM   2510 C  CD2   . HIS A 1 351 ? 8.760  65.664 21.808  1.00 23.20 ? 351  HIS A CD2   1 
ATOM   2511 C  CE1   . HIS A 1 351 ? 8.311  67.345 23.145  1.00 22.78 ? 351  HIS A CE1   1 
ATOM   2512 N  NE2   . HIS A 1 351 ? 9.173  66.897 22.249  1.00 23.05 ? 351  HIS A NE2   1 
ATOM   2513 N  N     . ARG A 1 352 ? 5.523  61.312 23.354  1.00 20.99 ? 352  ARG A N     1 
ATOM   2514 C  CA    . ARG A 1 352 ? 4.400  60.398 23.553  1.00 20.58 ? 352  ARG A CA    1 
ATOM   2515 C  C     . ARG A 1 352 ? 4.229  59.975 25.009  1.00 20.37 ? 352  ARG A C     1 
ATOM   2516 O  O     . ARG A 1 352 ? 3.126  60.037 25.544  1.00 21.93 ? 352  ARG A O     1 
ATOM   2517 C  CB    . ARG A 1 352 ? 4.525  59.165 22.658  1.00 19.59 ? 352  ARG A CB    1 
ATOM   2518 C  CG    . ARG A 1 352 ? 3.247  58.311 22.584  1.00 22.69 ? 352  ARG A CG    1 
ATOM   2519 C  CD    . ARG A 1 352 ? 3.282  57.275 21.444  1.00 21.14 ? 352  ARG A CD    1 
ATOM   2520 N  NE    . ARG A 1 352 ? 4.321  56.252 21.616  1.00 18.34 ? 352  ARG A NE    1 
ATOM   2521 C  CZ    . ARG A 1 352 ? 4.195  55.158 22.365  1.00 19.87 ? 352  ARG A CZ    1 
ATOM   2522 N  NH1   . ARG A 1 352 ? 3.154  55.015 23.177  1.00 19.76 ? 352  ARG A NH1   1 
ATOM   2523 N  NH2   . ARG A 1 352 ? 5.126  54.209 22.314  1.00 19.02 ? 352  ARG A NH2   1 
ATOM   2524 N  N     . LEU A 1 353 ? 5.316  59.575 25.660  1.00 19.82 ? 353  LEU A N     1 
ATOM   2525 C  CA    . LEU A 1 353 ? 5.225  58.991 27.001  1.00 19.85 ? 353  LEU A CA    1 
ATOM   2526 C  C     . LEU A 1 353 ? 4.996  60.012 28.128  1.00 20.67 ? 353  LEU A C     1 
ATOM   2527 O  O     . LEU A 1 353 ? 4.298  59.717 29.105  1.00 20.56 ? 353  LEU A O     1 
ATOM   2528 C  CB    . LEU A 1 353 ? 6.462  58.143 27.314  1.00 18.90 ? 353  LEU A CB    1 
ATOM   2529 C  CG    . LEU A 1 353 ? 6.749  56.952 26.398  1.00 19.26 ? 353  LEU A CG    1 
ATOM   2530 C  CD1   . LEU A 1 353 ? 8.131  56.400 26.680  1.00 17.88 ? 353  LEU A CD1   1 
ATOM   2531 C  CD2   . LEU A 1 353 ? 5.702  55.875 26.601  1.00 20.02 ? 353  LEU A CD2   1 
ATOM   2532 N  N     . PHE A 1 354 ? 5.584  61.201 28.004  1.00 21.01 ? 354  PHE A N     1 
ATOM   2533 C  CA    . PHE A 1 354 ? 5.639  62.131 29.134  1.00 23.06 ? 354  PHE A CA    1 
ATOM   2534 C  C     . PHE A 1 354 ? 4.938  63.453 28.860  1.00 24.86 ? 354  PHE A C     1 
ATOM   2535 O  O     . PHE A 1 354 ? 4.685  64.226 29.781  1.00 27.00 ? 354  PHE A O     1 
ATOM   2536 C  CB    . PHE A 1 354 ? 7.089  62.372 29.566  1.00 21.86 ? 354  PHE A CB    1 
ATOM   2537 C  CG    . PHE A 1 354 ? 7.827  61.112 29.886  1.00 20.15 ? 354  PHE A CG    1 
ATOM   2538 C  CD1   . PHE A 1 354 ? 7.518  60.388 31.034  1.00 20.18 ? 354  PHE A CD1   1 
ATOM   2539 C  CD2   . PHE A 1 354 ? 8.767  60.599 28.999  1.00 20.06 ? 354  PHE A CD2   1 
ATOM   2540 C  CE1   . PHE A 1 354 ? 8.124  59.163 31.298  1.00 20.75 ? 354  PHE A CE1   1 
ATOM   2541 C  CE2   . PHE A 1 354 ? 9.384  59.376 29.245  1.00 20.15 ? 354  PHE A CE2   1 
ATOM   2542 C  CZ    . PHE A 1 354 ? 9.061  58.650 30.398  1.00 21.91 ? 354  PHE A CZ    1 
ATOM   2543 N  N     . GLU A 1 355 ? 4.601  63.692 27.597  1.00 26.54 ? 355  GLU A N     1 
ATOM   2544 C  CA    . GLU A 1 355 ? 3.663  64.743 27.229  1.00 27.34 ? 355  GLU A CA    1 
ATOM   2545 C  C     . GLU A 1 355 ? 2.314  64.175 26.796  1.00 29.24 ? 355  GLU A C     1 
ATOM   2546 O  O     . GLU A 1 355 ? 1.429  64.921 26.375  1.00 29.84 ? 355  GLU A O     1 
ATOM   2547 C  CB    . GLU A 1 355 ? 4.242  65.563 26.082  1.00 27.87 ? 355  GLU A CB    1 
ATOM   2548 C  CG    . GLU A 1 355 ? 3.849  67.012 26.118  1.00 30.19 ? 355  GLU A CG    1 
ATOM   2549 C  CD    . GLU A 1 355 ? 4.556  67.826 25.068  1.00 31.22 ? 355  GLU A CD    1 
ATOM   2550 O  OE1   . GLU A 1 355 ? 4.764  67.309 23.944  1.00 33.95 ? 355  GLU A OE1   1 
ATOM   2551 O  OE2   . GLU A 1 355 ? 4.891  68.989 25.361  1.00 30.65 ? 355  GLU A OE2   1 
ATOM   2552 N  N     . TYR A 1 356 ? 2.191  62.848 26.833  1.00 29.91 ? 356  TYR A N     1 
ATOM   2553 C  CA    . TYR A 1 356 ? 0.955  62.155 26.470  1.00 31.07 ? 356  TYR A CA    1 
ATOM   2554 C  C     . TYR A 1 356 ? 0.413  62.558 25.098  1.00 32.29 ? 356  TYR A C     1 
ATOM   2555 O  O     . TYR A 1 356 ? -0.773 62.360 24.811  1.00 33.11 ? 356  TYR A O     1 
ATOM   2556 C  CB    . TYR A 1 356 ? -0.109 62.359 27.562  1.00 31.45 ? 356  TYR A CB    1 
ATOM   2557 C  CG    . TYR A 1 356 ? 0.465  62.283 28.964  1.00 31.92 ? 356  TYR A CG    1 
ATOM   2558 C  CD1   . TYR A 1 356 ? 0.648  61.046 29.599  1.00 31.82 ? 356  TYR A CD1   1 
ATOM   2559 C  CD2   . TYR A 1 356 ? 0.873  63.444 29.642  1.00 30.62 ? 356  TYR A CD2   1 
ATOM   2560 C  CE1   . TYR A 1 356 ? 1.231  60.968 30.879  1.00 31.67 ? 356  TYR A CE1   1 
ATOM   2561 C  CE2   . TYR A 1 356 ? 1.456  63.380 30.918  1.00 30.13 ? 356  TYR A CE2   1 
ATOM   2562 C  CZ    . TYR A 1 356 ? 1.629  62.140 31.528  1.00 31.68 ? 356  TYR A CZ    1 
ATOM   2563 O  OH    . TYR A 1 356 ? 2.186  62.062 32.790  1.00 33.49 ? 356  TYR A OH    1 
ATOM   2564 N  N     . LYS A 1 357 ? 1.286  63.099 24.246  1.00 32.68 ? 357  LYS A N     1 
ATOM   2565 C  CA    . LYS A 1 357 ? 0.993  63.264 22.826  1.00 33.58 ? 357  LYS A CA    1 
ATOM   2566 C  C     . LYS A 1 357 ? 0.921  61.907 22.132  1.00 34.36 ? 357  LYS A C     1 
ATOM   2567 O  O     . LYS A 1 357 ? 1.944  61.387 21.683  1.00 35.46 ? 357  LYS A O     1 
ATOM   2568 C  CB    . LYS A 1 357 ? 2.078  64.111 22.157  1.00 34.29 ? 357  LYS A CB    1 
ATOM   2569 C  CG    . LYS A 1 357 ? 2.082  65.584 22.556  1.00 36.94 ? 357  LYS A CG    1 
ATOM   2570 C  CD    . LYS A 1 357 ? 1.786  66.486 21.351  1.00 40.66 ? 357  LYS A CD    1 
ATOM   2571 C  CE    . LYS A 1 357 ? 2.773  66.278 20.175  1.00 43.06 ? 357  LYS A CE    1 
ATOM   2572 N  NZ    . LYS A 1 357 ? 2.115  65.897 18.853  1.00 43.62 ? 357  LYS A NZ    1 
ATOM   2573 N  N     . GLU A 1 358 ? -0.286 61.353 22.016  1.00 34.92 ? 358  GLU A N     1 
ATOM   2574 C  CA    . GLU A 1 358 ? -0.471 59.942 21.640  1.00 35.74 ? 358  GLU A CA    1 
ATOM   2575 C  C     . GLU A 1 358 ? -0.202 59.651 20.150  1.00 34.36 ? 358  GLU A C     1 
ATOM   2576 O  O     . GLU A 1 358 ? 0.089  58.506 19.769  1.00 33.16 ? 358  GLU A O     1 
ATOM   2577 C  CB    . GLU A 1 358 ? -1.877 59.452 22.039  1.00 39.22 ? 358  GLU A CB    1 
ATOM   2578 C  CG    . GLU A 1 358 ? -2.949 60.562 22.205  1.00 45.56 ? 358  GLU A CG    1 
ATOM   2579 C  CD    . GLU A 1 358 ? -3.717 60.870 20.896  1.00 49.18 ? 358  GLU A CD    1 
ATOM   2580 O  OE1   . GLU A 1 358 ? -3.131 61.552 20.009  1.00 50.27 ? 358  GLU A OE1   1 
ATOM   2581 O  OE2   . GLU A 1 358 ? -4.904 60.436 20.761  1.00 48.20 ? 358  GLU A OE2   1 
ATOM   2582 N  N     . ASP A 1 359 ? -0.229 60.705 19.337  1.00 33.15 ? 359  ASP A N     1 
ATOM   2583 C  CA    . ASP A 1 359 ? 0.041  60.612 17.899  1.00 33.06 ? 359  ASP A CA    1 
ATOM   2584 C  C     . ASP A 1 359 ? 1.464  61.082 17.549  1.00 31.46 ? 359  ASP A C     1 
ATOM   2585 O  O     . ASP A 1 359 ? 1.744  61.465 16.404  1.00 30.30 ? 359  ASP A O     1 
ATOM   2586 C  CB    . ASP A 1 359 ? -0.977 61.472 17.131  1.00 35.69 ? 359  ASP A CB    1 
ATOM   2587 C  CG    . ASP A 1 359 ? -0.836 62.977 17.441  1.00 38.69 ? 359  ASP A CG    1 
ATOM   2588 O  OD1   . ASP A 1 359 ? -0.366 63.340 18.552  1.00 39.39 ? 359  ASP A OD1   1 
ATOM   2589 O  OD2   . ASP A 1 359 ? -1.202 63.804 16.572  1.00 40.16 ? 359  ASP A OD2   1 
ATOM   2590 N  N     . SER A 1 360 ? 2.340  61.090 18.552  1.00 30.02 ? 360  SER A N     1 
ATOM   2591 C  CA    . SER A 1 360 ? 3.748  61.447 18.370  1.00 27.09 ? 360  SER A CA    1 
ATOM   2592 C  C     . SER A 1 360 ? 4.535  60.252 17.854  1.00 25.58 ? 360  SER A C     1 
ATOM   2593 O  O     . SER A 1 360 ? 4.747  59.278 18.585  1.00 24.53 ? 360  SER A O     1 
ATOM   2594 C  CB    . SER A 1 360 ? 4.356  61.912 19.696  1.00 26.93 ? 360  SER A CB    1 
ATOM   2595 O  OG    . SER A 1 360 ? 5.611  62.543 19.481  1.00 27.65 ? 360  SER A OG    1 
ATOM   2596 N  N     . LYS A 1 361 ? 4.989  60.352 16.605  1.00 23.61 ? 361  LYS A N     1 
ATOM   2597 C  CA    . LYS A 1 361 ? 5.755  59.289 15.949  1.00 22.90 ? 361  LYS A CA    1 
ATOM   2598 C  C     . LYS A 1 361 ? 6.628  59.867 14.814  1.00 21.83 ? 361  LYS A C     1 
ATOM   2599 O  O     . LYS A 1 361 ? 6.342  60.949 14.294  1.00 22.22 ? 361  LYS A O     1 
ATOM   2600 C  CB    . LYS A 1 361 ? 4.794  58.226 15.401  1.00 21.97 ? 361  LYS A CB    1 
ATOM   2601 C  CG    . LYS A 1 361 ? 3.997  58.699 14.209  1.00 21.93 ? 361  LYS A CG    1 
ATOM   2602 C  CD    . LYS A 1 361 ? 3.174  57.578 13.639  1.00 25.07 ? 361  LYS A CD    1 
ATOM   2603 C  CE    . LYS A 1 361 ? 1.973  58.112 12.859  1.00 27.06 ? 361  LYS A CE    1 
ATOM   2604 N  NZ    . LYS A 1 361 ? 0.950  57.018 12.685  1.00 30.69 ? 361  LYS A NZ    1 
ATOM   2605 N  N     . LEU A 1 362 ? 7.697  59.162 14.456  1.00 19.51 ? 362  LEU A N     1 
ATOM   2606 C  CA    . LEU A 1 362 ? 8.519  59.546 13.311  1.00 19.50 ? 362  LEU A CA    1 
ATOM   2607 C  C     . LEU A 1 362 ? 7.969  58.960 12.004  1.00 19.20 ? 362  LEU A C     1 
ATOM   2608 O  O     . LEU A 1 362 ? 7.740  57.763 11.888  1.00 19.01 ? 362  LEU A O     1 
ATOM   2609 C  CB    . LEU A 1 362 ? 9.987  59.128 13.513  1.00 18.16 ? 362  LEU A CB    1 
ATOM   2610 C  CG    . LEU A 1 362 ? 11.028 59.514 12.439  1.00 18.04 ? 362  LEU A CG    1 
ATOM   2611 C  CD1   . LEU A 1 362 ? 10.939 61.001 12.110  1.00 16.56 ? 362  LEU A CD1   1 
ATOM   2612 C  CD2   . LEU A 1 362 ? 12.435 59.156 12.893  1.00 13.90 ? 362  LEU A CD2   1 
ATOM   2613 N  N     . ASP A 1 363 ? 7.727  59.842 11.044  1.00 20.29 ? 363  ASP A N     1 
ATOM   2614 C  CA    . ASP A 1 363 ? 7.605  59.501 9.629   1.00 22.24 ? 363  ASP A CA    1 
ATOM   2615 C  C     . ASP A 1 363 ? 8.945  59.095 9.010   1.00 21.56 ? 363  ASP A C     1 
ATOM   2616 O  O     . ASP A 1 363 ? 9.869  59.899 8.943   1.00 22.83 ? 363  ASP A O     1 
ATOM   2617 C  CB    . ASP A 1 363 ? 7.040  60.715 8.882   1.00 23.19 ? 363  ASP A CB    1 
ATOM   2618 C  CG    . ASP A 1 363 ? 6.626  60.405 7.451   1.00 25.17 ? 363  ASP A CG    1 
ATOM   2619 O  OD1   . ASP A 1 363 ? 6.885  59.289 6.932   1.00 24.40 ? 363  ASP A OD1   1 
ATOM   2620 O  OD2   . ASP A 1 363 ? 6.029  61.318 6.841   1.00 28.46 ? 363  ASP A OD2   1 
ATOM   2621 N  N     . TYR A 1 364 ? 9.020  57.858 8.525   1.00 20.79 ? 364  TYR A N     1 
ATOM   2622 C  CA    . TYR A 1 364 ? 10.256 57.300 8.000   1.00 20.29 ? 364  TYR A CA    1 
ATOM   2623 C  C     . TYR A 1 364 ? 10.346 57.493 6.486   1.00 21.79 ? 364  TYR A C     1 
ATOM   2624 O  O     . TYR A 1 364 ? 11.152 56.845 5.809   1.00 22.81 ? 364  TYR A O     1 
ATOM   2625 C  CB    . TYR A 1 364 ? 10.353 55.808 8.348   1.00 20.61 ? 364  TYR A CB    1 
ATOM   2626 C  CG    . TYR A 1 364 ? 10.793 55.532 9.772   1.00 20.99 ? 364  TYR A CG    1 
ATOM   2627 C  CD1   . TYR A 1 364 ? 9.861  55.459 10.812  1.00 21.19 ? 364  TYR A CD1   1 
ATOM   2628 C  CD2   . TYR A 1 364 ? 12.143 55.364 10.084  1.00 20.71 ? 364  TYR A CD2   1 
ATOM   2629 C  CE1   . TYR A 1 364 ? 10.265 55.234 12.136  1.00 20.90 ? 364  TYR A CE1   1 
ATOM   2630 C  CE2   . TYR A 1 364 ? 12.561 55.134 11.400  1.00 21.24 ? 364  TYR A CE2   1 
ATOM   2631 C  CZ    . TYR A 1 364 ? 11.616 55.070 12.423  1.00 21.72 ? 364  TYR A CZ    1 
ATOM   2632 O  OH    . TYR A 1 364 ? 12.026 54.840 13.723  1.00 19.87 ? 364  TYR A OH    1 
ATOM   2633 N  N     . ASN A 1 365 ? 9.519  58.385 5.951   1.00 23.25 ? 365  ASN A N     1 
ATOM   2634 C  CA    . ASN A 1 365 ? 9.529  58.657 4.519   1.00 23.81 ? 365  ASN A CA    1 
ATOM   2635 C  C     . ASN A 1 365 ? 10.328 59.908 4.204   1.00 23.06 ? 365  ASN A C     1 
ATOM   2636 O  O     . ASN A 1 365 ? 10.332 60.859 4.984   1.00 22.78 ? 365  ASN A O     1 
ATOM   2637 C  CB    . ASN A 1 365 ? 8.099  58.798 3.989   1.00 26.50 ? 365  ASN A CB    1 
ATOM   2638 C  CG    . ASN A 1 365 ? 7.371  57.464 3.923   1.00 29.85 ? 365  ASN A CG    1 
ATOM   2639 O  OD1   . ASN A 1 365 ? 6.223  57.349 4.351   1.00 32.85 ? 365  ASN A OD1   1 
ATOM   2640 N  ND2   . ASN A 1 365 ? 8.055  56.438 3.424   1.00 30.60 ? 365  ASN A ND2   1 
ATOM   2641 N  N     . ASN A 1 366 ? 10.994 59.894 3.050   1.00 22.94 ? 366  ASN A N     1 
ATOM   2642 C  CA    . ASN A 1 366 ? 11.741 61.042 2.547   1.00 21.60 ? 366  ASN A CA    1 
ATOM   2643 C  C     . ASN A 1 366 ? 12.794 61.476 3.552   1.00 19.55 ? 366  ASN A C     1 
ATOM   2644 O  O     . ASN A 1 366 ? 12.982 62.666 3.796   1.00 21.27 ? 366  ASN A O     1 
ATOM   2645 C  CB    . ASN A 1 366 ? 10.802 62.218 2.251   1.00 23.27 ? 366  ASN A CB    1 
ATOM   2646 C  CG    . ASN A 1 366 ? 9.743  61.882 1.207   1.00 25.63 ? 366  ASN A CG    1 
ATOM   2647 O  OD1   . ASN A 1 366 ? 8.534  62.007 1.469   1.00 26.28 ? 366  ASN A OD1   1 
ATOM   2648 N  ND2   . ASN A 1 366 ? 10.187 61.456 0.019   1.00 26.38 ? 366  ASN A ND2   1 
ATOM   2649 N  N     . ILE A 1 367 ? 13.447 60.501 4.165   1.00 18.73 ? 367  ILE A N     1 
ATOM   2650 C  CA    . ILE A 1 367 ? 14.605 60.758 5.014   1.00 17.29 ? 367  ILE A CA    1 
ATOM   2651 C  C     . ILE A 1 367 ? 15.830 60.930 4.130   1.00 15.87 ? 367  ILE A C     1 
ATOM   2652 O  O     . ILE A 1 367 ? 16.160 60.042 3.355   1.00 15.85 ? 367  ILE A O     1 
ATOM   2653 C  CB    . ILE A 1 367 ? 14.841 59.579 5.986   1.00 18.87 ? 367  ILE A CB    1 
ATOM   2654 C  CG1   . ILE A 1 367 ? 13.720 59.534 7.026   1.00 19.05 ? 367  ILE A CG1   1 
ATOM   2655 C  CG2   . ILE A 1 367 ? 16.179 59.714 6.673   1.00 19.02 ? 367  ILE A CG2   1 
ATOM   2656 C  CD1   . ILE A 1 367 ? 13.867 58.422 8.023   1.00 20.30 ? 367  ILE A CD1   1 
ATOM   2657 N  N     . PRO A 1 368 ? 16.506 62.085 4.215   1.00 14.93 ? 368  PRO A N     1 
ATOM   2658 C  CA    . PRO A 1 368 ? 17.642 62.349 3.330   1.00 13.87 ? 368  PRO A CA    1 
ATOM   2659 C  C     . PRO A 1 368 ? 18.937 61.721 3.833   1.00 15.68 ? 368  PRO A C     1 
ATOM   2660 O  O     . PRO A 1 368 ? 19.143 61.589 5.034   1.00 17.40 ? 368  PRO A O     1 
ATOM   2661 C  CB    . PRO A 1 368 ? 17.722 63.868 3.308   1.00 13.52 ? 368  PRO A CB    1 
ATOM   2662 C  CG    . PRO A 1 368 ? 17.110 64.319 4.604   1.00 12.69 ? 368  PRO A CG    1 
ATOM   2663 C  CD    . PRO A 1 368 ? 16.239 63.209 5.133   1.00 14.13 ? 368  PRO A CD    1 
ATOM   2664 N  N     . THR A 1 369 ? 19.808 61.338 2.910   1.00 16.41 ? 369  THR A N     1 
ATOM   2665 C  CA    . THR A 1 369 ? 21.137 60.831 3.257   1.00 17.80 ? 369  THR A CA    1 
ATOM   2666 C  C     . THR A 1 369 ? 22.250 61.534 2.482   1.00 16.64 ? 369  THR A C     1 
ATOM   2667 O  O     . THR A 1 369 ? 22.133 61.759 1.283   1.00 16.36 ? 369  THR A O     1 
ATOM   2668 C  CB    . THR A 1 369 ? 21.240 59.333 2.967   1.00 19.37 ? 369  THR A CB    1 
ATOM   2669 O  OG1   . THR A 1 369 ? 20.072 58.680 3.466   1.00 24.41 ? 369  THR A OG1   1 
ATOM   2670 C  CG2   . THR A 1 369 ? 22.453 58.742 3.641   1.00 21.42 ? 369  THR A CG2   1 
ATOM   2671 N  N     . VAL A 1 370 ? 23.343 61.852 3.162   1.00 15.23 ? 370  VAL A N     1 
ATOM   2672 C  CA    . VAL A 1 370 ? 24.583 62.189 2.475   1.00 13.18 ? 370  VAL A CA    1 
ATOM   2673 C  C     . VAL A 1 370 ? 25.626 61.099 2.683   1.00 12.64 ? 370  VAL A C     1 
ATOM   2674 O  O     . VAL A 1 370 ? 25.864 60.663 3.806   1.00 12.68 ? 370  VAL A O     1 
ATOM   2675 C  CB    . VAL A 1 370 ? 25.129 63.557 2.931   1.00 12.63 ? 370  VAL A CB    1 
ATOM   2676 C  CG1   . VAL A 1 370 ? 26.575 63.726 2.508   1.00 12.67 ? 370  VAL A CG1   1 
ATOM   2677 C  CG2   . VAL A 1 370 ? 24.291 64.671 2.337   1.00 10.84 ? 370  VAL A CG2   1 
ATOM   2678 N  N     . VAL A 1 371 ? 26.206 60.633 1.584   1.00 12.90 ? 371  VAL A N     1 
ATOM   2679 C  CA    . VAL A 1 371 ? 27.390 59.789 1.638   1.00 14.42 ? 371  VAL A CA    1 
ATOM   2680 C  C     . VAL A 1 371 ? 28.618 60.621 1.325   1.00 14.19 ? 371  VAL A C     1 
ATOM   2681 O  O     . VAL A 1 371 ? 28.676 61.302 0.309   1.00 16.63 ? 371  VAL A O     1 
ATOM   2682 C  CB    . VAL A 1 371 ? 27.298 58.596 0.640   1.00 15.13 ? 371  VAL A CB    1 
ATOM   2683 C  CG1   . VAL A 1 371 ? 28.605 57.784 0.641   1.00 15.65 ? 371  VAL A CG1   1 
ATOM   2684 C  CG2   . VAL A 1 371 ? 26.111 57.697 0.995   1.00 14.53 ? 371  VAL A CG2   1 
ATOM   2685 N  N     . PHE A 1 372 ? 29.596 60.565 2.214   1.00 15.33 ? 372  PHE A N     1 
ATOM   2686 C  CA    . PHE A 1 372 ? 30.764 61.423 2.129   1.00 14.56 ? 372  PHE A CA    1 
ATOM   2687 C  C     . PHE A 1 372 ? 31.850 60.714 1.341   1.00 15.39 ? 372  PHE A C     1 
ATOM   2688 O  O     . PHE A 1 372 ? 32.908 60.368 1.873   1.00 15.60 ? 372  PHE A O     1 
ATOM   2689 C  CB    . PHE A 1 372 ? 31.235 61.802 3.535   1.00 13.91 ? 372  PHE A CB    1 
ATOM   2690 C  CG    . PHE A 1 372 ? 30.324 62.776 4.225   1.00 12.72 ? 372  PHE A CG    1 
ATOM   2691 C  CD1   . PHE A 1 372 ? 30.390 64.136 3.935   1.00 12.18 ? 372  PHE A CD1   1 
ATOM   2692 C  CD2   . PHE A 1 372 ? 29.364 62.332 5.131   1.00 13.37 ? 372  PHE A CD2   1 
ATOM   2693 C  CE1   . PHE A 1 372 ? 29.511 65.041 4.533   1.00 13.69 ? 372  PHE A CE1   1 
ATOM   2694 C  CE2   . PHE A 1 372 ? 28.484 63.233 5.733   1.00 12.62 ? 372  PHE A CE2   1 
ATOM   2695 C  CZ    . PHE A 1 372 ? 28.559 64.587 5.432   1.00 10.75 ? 372  PHE A CZ    1 
ATOM   2696 N  N     . SER A 1 373 ? 31.554 60.471 0.069   1.00 16.39 ? 373  SER A N     1 
ATOM   2697 C  CA    . SER A 1 373 ? 32.567 60.125 -0.923  1.00 17.01 ? 373  SER A CA    1 
ATOM   2698 C  C     . SER A 1 373 ? 33.230 61.370 -1.506  1.00 17.48 ? 373  SER A C     1 
ATOM   2699 O  O     . SER A 1 373 ? 33.042 62.485 -1.012  1.00 17.21 ? 373  SER A O     1 
ATOM   2700 C  CB    . SER A 1 373 ? 31.941 59.296 -2.045  1.00 17.60 ? 373  SER A CB    1 
ATOM   2701 O  OG    . SER A 1 373 ? 30.645 59.782 -2.366  1.00 20.55 ? 373  SER A OG    1 
ATOM   2702 N  N     . HIS A 1 374 ? 34.026 61.164 -2.550  1.00 18.56 ? 374  HIS A N     1 
ATOM   2703 C  CA    . HIS A 1 374 ? 34.626 62.269 -3.272  1.00 18.98 ? 374  HIS A CA    1 
ATOM   2704 C  C     . HIS A 1 374 ? 34.224 62.148 -4.722  1.00 18.09 ? 374  HIS A C     1 
ATOM   2705 O  O     . HIS A 1 374 ? 34.572 61.169 -5.377  1.00 19.88 ? 374  HIS A O     1 
ATOM   2706 C  CB    . HIS A 1 374 ? 36.144 62.218 -3.126  1.00 20.46 ? 374  HIS A CB    1 
ATOM   2707 C  CG    . HIS A 1 374 ? 36.600 62.071 -1.709  1.00 23.24 ? 374  HIS A CG    1 
ATOM   2708 N  ND1   . HIS A 1 374 ? 36.859 63.155 -0.894  1.00 24.36 ? 374  HIS A ND1   1 
ATOM   2709 C  CD2   . HIS A 1 374 ? 36.791 60.971 -0.941  1.00 24.30 ? 374  HIS A CD2   1 
ATOM   2710 C  CE1   . HIS A 1 374 ? 37.183 62.730 0.316   1.00 25.13 ? 374  HIS A CE1   1 
ATOM   2711 N  NE2   . HIS A 1 374 ? 37.150 61.409 0.314   1.00 25.78 ? 374  HIS A NE2   1 
ATOM   2712 N  N     . PRO A 1 375 ? 33.418 63.103 -5.224  1.00 16.30 ? 375  PRO A N     1 
ATOM   2713 C  CA    . PRO A 1 375 ? 32.674 64.068 -4.407  1.00 14.62 ? 375  PRO A CA    1 
ATOM   2714 C  C     . PRO A 1 375 ? 31.469 63.441 -3.690  1.00 13.82 ? 375  PRO A C     1 
ATOM   2715 O  O     . PRO A 1 375 ? 31.121 62.284 -3.936  1.00 12.94 ? 375  PRO A O     1 
ATOM   2716 C  CB    . PRO A 1 375 ? 32.254 65.148 -5.413  1.00 13.82 ? 375  PRO A CB    1 
ATOM   2717 C  CG    . PRO A 1 375 ? 32.400 64.555 -6.758  1.00 12.57 ? 375  PRO A CG    1 
ATOM   2718 C  CD    . PRO A 1 375 ? 33.103 63.232 -6.659  1.00 15.49 ? 375  PRO A CD    1 
ATOM   2719 N  N     . PRO A 1 376 ? 30.856 64.177 -2.752  1.00 12.91 ? 376  PRO A N     1 
ATOM   2720 C  CA    . PRO A 1 376 ? 29.788 63.597 -1.932  1.00 11.66 ? 376  PRO A CA    1 
ATOM   2721 C  C     . PRO A 1 376 ? 28.474 63.379 -2.681  1.00 13.06 ? 376  PRO A C     1 
ATOM   2722 O  O     . PRO A 1 376 ? 28.190 64.029 -3.693  1.00 13.48 ? 376  PRO A O     1 
ATOM   2723 C  CB    . PRO A 1 376 ? 29.613 64.605 -0.804  1.00 12.24 ? 376  PRO A CB    1 
ATOM   2724 C  CG    . PRO A 1 376 ? 30.063 65.893 -1.400  1.00 12.75 ? 376  PRO A CG    1 
ATOM   2725 C  CD    . PRO A 1 376 ? 31.177 65.554 -2.341  1.00 11.65 ? 376  PRO A CD    1 
ATOM   2726 N  N     . ILE A 1 377 ? 27.684 62.457 -2.142  1.00 12.34 ? 377  ILE A N     1 
ATOM   2727 C  CA    . ILE A 1 377 ? 26.413 62.044 -2.705  1.00 13.30 ? 377  ILE A CA    1 
ATOM   2728 C  C     . ILE A 1 377 ? 25.307 62.602 -1.817  1.00 13.26 ? 377  ILE A C     1 
ATOM   2729 O  O     . ILE A 1 377 ? 25.375 62.495 -0.593  1.00 14.43 ? 377  ILE A O     1 
ATOM   2730 C  CB    . ILE A 1 377 ? 26.332 60.503 -2.741  1.00 12.96 ? 377  ILE A CB    1 
ATOM   2731 C  CG1   . ILE A 1 377 ? 27.386 59.963 -3.705  1.00 12.86 ? 377  ILE A CG1   1 
ATOM   2732 C  CG2   . ILE A 1 377 ? 24.938 60.040 -3.132  1.00 11.78 ? 377  ILE A CG2   1 
ATOM   2733 C  CD1   . ILE A 1 377 ? 27.617 58.496 -3.591  1.00 13.00 ? 377  ILE A CD1   1 
ATOM   2734 N  N     . GLY A 1 378 ? 24.315 63.231 -2.437  1.00 13.69 ? 378  GLY A N     1 
ATOM   2735 C  CA    . GLY A 1 378 ? 23.088 63.541 -1.737  1.00 13.66 ? 378  GLY A CA    1 
ATOM   2736 C  C     . GLY A 1 378 ? 21.925 62.809 -2.364  1.00 14.86 ? 378  GLY A C     1 
ATOM   2737 O  O     . GLY A 1 378 ? 21.777 62.790 -3.583  1.00 14.37 ? 378  GLY A O     1 
ATOM   2738 N  N     . THR A 1 379 ? 21.096 62.201 -1.528  1.00 14.67 ? 379  THR A N     1 
ATOM   2739 C  CA    . THR A 1 379 ? 19.925 61.494 -2.012  1.00 15.26 ? 379  THR A CA    1 
ATOM   2740 C  C     . THR A 1 379 ? 18.750 61.660 -1.063  1.00 15.90 ? 379  THR A C     1 
ATOM   2741 O  O     . THR A 1 379 ? 18.911 61.593 0.150   1.00 15.87 ? 379  THR A O     1 
ATOM   2742 C  CB    . THR A 1 379 ? 20.214 59.992 -2.234  1.00 14.71 ? 379  THR A CB    1 
ATOM   2743 O  OG1   . THR A 1 379 ? 19.063 59.387 -2.816  1.00 17.37 ? 379  THR A OG1   1 
ATOM   2744 C  CG2   . THR A 1 379 ? 20.544 59.274 -0.921  1.00 13.25 ? 379  THR A CG2   1 
ATOM   2745 N  N     . VAL A 1 380 ? 17.563 61.865 -1.622  1.00 15.40 ? 380  VAL A N     1 
ATOM   2746 C  CA    . VAL A 1 380 ? 16.341 61.815 -0.833  1.00 15.90 ? 380  VAL A CA    1 
ATOM   2747 C  C     . VAL A 1 380 ? 15.178 61.303 -1.677  1.00 16.85 ? 380  VAL A C     1 
ATOM   2748 O  O     . VAL A 1 380 ? 15.076 61.618 -2.860  1.00 17.87 ? 380  VAL A O     1 
ATOM   2749 C  CB    . VAL A 1 380 ? 16.007 63.203 -0.244  1.00 15.54 ? 380  VAL A CB    1 
ATOM   2750 C  CG1   . VAL A 1 380 ? 15.712 64.191 -1.355  1.00 14.60 ? 380  VAL A CG1   1 
ATOM   2751 C  CG2   . VAL A 1 380 ? 14.851 63.104 0.736   1.00 13.64 ? 380  VAL A CG2   1 
ATOM   2752 N  N     . GLY A 1 381 ? 14.315 60.496 -1.069  1.00 17.24 ? 381  GLY A N     1 
ATOM   2753 C  CA    . GLY A 1 381 ? 13.141 60.003 -1.769  1.00 17.25 ? 381  GLY A CA    1 
ATOM   2754 C  C     . GLY A 1 381 ? 13.417 58.741 -2.568  1.00 18.33 ? 381  GLY A C     1 
ATOM   2755 O  O     . GLY A 1 381 ? 14.255 57.924 -2.192  1.00 18.30 ? 381  GLY A O     1 
ATOM   2756 N  N     . LEU A 1 382 ? 12.693 58.576 -3.668  1.00 19.08 ? 382  LEU A N     1 
ATOM   2757 C  CA    . LEU A 1 382 ? 12.644 57.301 -4.371  1.00 19.82 ? 382  LEU A CA    1 
ATOM   2758 C  C     . LEU A 1 382 ? 13.628 57.302 -5.535  1.00 19.32 ? 382  LEU A C     1 
ATOM   2759 O  O     . LEU A 1 382 ? 13.798 58.315 -6.220  1.00 18.21 ? 382  LEU A O     1 
ATOM   2760 C  CB    . LEU A 1 382 ? 11.220 57.009 -4.871  1.00 20.66 ? 382  LEU A CB    1 
ATOM   2761 C  CG    . LEU A 1 382 ? 10.131 57.022 -3.788  1.00 20.63 ? 382  LEU A CG    1 
ATOM   2762 C  CD1   . LEU A 1 382 ? 8.768  57.223 -4.428  1.00 23.15 ? 382  LEU A CD1   1 
ATOM   2763 C  CD2   . LEU A 1 382 ? 10.157 55.738 -2.996  1.00 19.77 ? 382  LEU A CD2   1 
ATOM   2764 N  N     . THR A 1 383 ? 14.289 56.166 -5.734  1.00 18.79 ? 383  THR A N     1 
ATOM   2765 C  CA    . THR A 1 383 ? 15.015 55.889 -6.965  1.00 19.14 ? 383  THR A CA    1 
ATOM   2766 C  C     . THR A 1 383 ? 14.060 55.802 -8.143  1.00 21.27 ? 383  THR A C     1 
ATOM   2767 O  O     . THR A 1 383 ? 12.848 55.613 -7.973  1.00 21.53 ? 383  THR A O     1 
ATOM   2768 C  CB    . THR A 1 383 ? 15.807 54.568 -6.875  1.00 17.81 ? 383  THR A CB    1 
ATOM   2769 O  OG1   . THR A 1 383 ? 14.891 53.472 -6.807  1.00 18.90 ? 383  THR A OG1   1 
ATOM   2770 C  CG2   . THR A 1 383 ? 16.678 54.551 -5.641  1.00 14.91 ? 383  THR A CG2   1 
ATOM   2771 N  N     . GLU A 1 384 ? 14.614 55.938 -9.340  1.00 21.74 ? 384  GLU A N     1 
ATOM   2772 C  CA    . GLU A 1 384 ? 13.817 55.884 -10.555 1.00 23.69 ? 384  GLU A CA    1 
ATOM   2773 C  C     . GLU A 1 384 ? 13.146 54.511 -10.638 1.00 24.47 ? 384  GLU A C     1 
ATOM   2774 O  O     . GLU A 1 384 ? 11.964 54.407 -10.970 1.00 23.24 ? 384  GLU A O     1 
ATOM   2775 C  CB    . GLU A 1 384 ? 14.704 56.150 -11.772 1.00 23.01 ? 384  GLU A CB    1 
ATOM   2776 C  CG    . GLU A 1 384 ? 14.252 55.474 -13.041 1.00 25.17 ? 384  GLU A CG    1 
ATOM   2777 C  CD    . GLU A 1 384 ? 14.841 56.093 -14.287 1.00 25.63 ? 384  GLU A CD    1 
ATOM   2778 O  OE1   . GLU A 1 384 ? 15.905 56.745 -14.214 1.00 24.67 ? 384  GLU A OE1   1 
ATOM   2779 O  OE2   . GLU A 1 384 ? 14.226 55.928 -15.358 1.00 29.77 ? 384  GLU A OE2   1 
ATOM   2780 N  N     . ASP A 1 385 ? 13.882 53.478 -10.240 1.00 26.61 ? 385  ASP A N     1 
ATOM   2781 C  CA    . ASP A 1 385 ? 13.306 52.155 -10.010 1.00 28.56 ? 385  ASP A CA    1 
ATOM   2782 C  C     . ASP A 1 385 ? 12.126 52.097 -9.046  1.00 28.22 ? 385  ASP A C     1 
ATOM   2783 O  O     . ASP A 1 385 ? 11.050 51.639 -9.417  1.00 28.70 ? 385  ASP A O     1 
ATOM   2784 C  CB    . ASP A 1 385 ? 14.387 51.181 -9.562  1.00 32.12 ? 385  ASP A CB    1 
ATOM   2785 C  CG    . ASP A 1 385 ? 14.988 50.421 -10.719 1.00 35.92 ? 385  ASP A CG    1 
ATOM   2786 O  OD1   . ASP A 1 385 ? 15.014 50.971 -11.847 1.00 37.48 ? 385  ASP A OD1   1 
ATOM   2787 O  OD2   . ASP A 1 385 ? 15.435 49.271 -10.503 1.00 39.43 ? 385  ASP A OD2   1 
ATOM   2788 N  N     . GLU A 1 386 ? 12.319 52.536 -7.807  1.00 27.37 ? 386  GLU A N     1 
ATOM   2789 C  CA    . GLU A 1 386 ? 11.233 52.483 -6.828  1.00 26.72 ? 386  GLU A CA    1 
ATOM   2790 C  C     . GLU A 1 386 ? 10.013 53.259 -7.326  1.00 27.24 ? 386  GLU A C     1 
ATOM   2791 O  O     . GLU A 1 386 ? 8.877  52.815 -7.164  1.00 27.06 ? 386  GLU A O     1 
ATOM   2792 C  CB    . GLU A 1 386 ? 11.699 53.036 -5.483  1.00 26.35 ? 386  GLU A CB    1 
ATOM   2793 C  CG    . GLU A 1 386 ? 12.737 52.167 -4.805  1.00 26.30 ? 386  GLU A CG    1 
ATOM   2794 C  CD    . GLU A 1 386 ? 13.474 52.884 -3.694  1.00 27.57 ? 386  GLU A CD    1 
ATOM   2795 O  OE1   . GLU A 1 386 ? 13.670 54.116 -3.784  1.00 26.21 ? 386  GLU A OE1   1 
ATOM   2796 O  OE2   . GLU A 1 386 ? 13.852 52.210 -2.717  1.00 29.19 ? 386  GLU A OE2   1 
ATOM   2797 N  N     . ALA A 1 387 ? 10.257 54.388 -7.984  1.00 26.57 ? 387  ALA A N     1 
ATOM   2798 C  CA    . ALA A 1 387 ? 9.173  55.229 -8.468  1.00 26.81 ? 387  ALA A CA    1 
ATOM   2799 C  C     . ALA A 1 387 ? 8.376  54.501 -9.542  1.00 26.43 ? 387  ALA A C     1 
ATOM   2800 O  O     . ALA A 1 387 ? 7.149  54.542 -9.535  1.00 25.21 ? 387  ALA A O     1 
ATOM   2801 C  CB    . ALA A 1 387 ? 9.717  56.545 -9.008  1.00 25.19 ? 387  ALA A CB    1 
ATOM   2802 N  N     . ILE A 1 388 ? 9.075  53.824 -10.451 1.00 27.61 ? 388  ILE A N     1 
ATOM   2803 C  CA    . ILE A 1 388 ? 8.416  53.066 -11.512 1.00 27.95 ? 388  ILE A CA    1 
ATOM   2804 C  C     . ILE A 1 388 ? 7.579  51.941 -10.921 1.00 30.05 ? 388  ILE A C     1 
ATOM   2805 O  O     . ILE A 1 388 ? 6.450  51.744 -11.349 1.00 30.32 ? 388  ILE A O     1 
ATOM   2806 C  CB    . ILE A 1 388 ? 9.415  52.491 -12.557 1.00 27.40 ? 388  ILE A CB    1 
ATOM   2807 C  CG1   . ILE A 1 388 ? 9.891  53.600 -13.507 1.00 26.79 ? 388  ILE A CG1   1 
ATOM   2808 C  CG2   . ILE A 1 388 ? 8.744  51.391 -13.393 1.00 26.64 ? 388  ILE A CG2   1 
ATOM   2809 C  CD1   . ILE A 1 388 ? 11.237 53.330 -14.146 1.00 26.42 ? 388  ILE A CD1   1 
ATOM   2810 N  N     . HIS A 1 389 ? 8.092  51.253 -9.900  1.00 32.29 ? 389  HIS A N     1 
ATOM   2811 C  CA    . HIS A 1 389 ? 7.340  50.148 -9.306  1.00 35.09 ? 389  HIS A CA    1 
ATOM   2812 C  C     . HIS A 1 389 ? 6.058  50.636 -8.630  1.00 34.80 ? 389  HIS A C     1 
ATOM   2813 O  O     . HIS A 1 389 ? 5.102  49.871 -8.446  1.00 36.19 ? 389  HIS A O     1 
ATOM   2814 C  CB    . HIS A 1 389 ? 8.195  49.342 -8.308  1.00 38.08 ? 389  HIS A CB    1 
ATOM   2815 C  CG    . HIS A 1 389 ? 7.437  48.238 -7.623  1.00 43.00 ? 389  HIS A CG    1 
ATOM   2816 N  ND1   . HIS A 1 389 ? 7.189  48.231 -6.262  1.00 44.55 ? 389  HIS A ND1   1 
ATOM   2817 C  CD2   . HIS A 1 389 ? 6.817  47.136 -8.121  1.00 44.18 ? 389  HIS A CD2   1 
ATOM   2818 C  CE1   . HIS A 1 389 ? 6.446  47.179 -5.953  1.00 44.94 ? 389  HIS A CE1   1 
ATOM   2819 N  NE2   . HIS A 1 389 ? 6.206  46.499 -7.062  1.00 45.04 ? 389  HIS A NE2   1 
ATOM   2820 N  N     . LYS A 1 390 ? 6.039  51.913 -8.274  1.00 34.19 ? 390  LYS A N     1 
ATOM   2821 C  CA    . LYS A 1 390 ? 5.041  52.445 -7.354  1.00 33.88 ? 390  LYS A CA    1 
ATOM   2822 C  C     . LYS A 1 390 ? 3.991  53.218 -8.141  1.00 33.61 ? 390  LYS A C     1 
ATOM   2823 O  O     . LYS A 1 390 ? 2.837  53.317 -7.733  1.00 34.62 ? 390  LYS A O     1 
ATOM   2824 C  CB    . LYS A 1 390 ? 5.714  53.376 -6.347  1.00 33.96 ? 390  LYS A CB    1 
ATOM   2825 C  CG    . LYS A 1 390 ? 5.064  53.411 -4.991  1.00 35.76 ? 390  LYS A CG    1 
ATOM   2826 C  CD    . LYS A 1 390 ? 4.491  54.780 -4.718  1.00 37.29 ? 390  LYS A CD    1 
ATOM   2827 C  CE    . LYS A 1 390 ? 4.587  55.104 -3.239  1.00 40.31 ? 390  LYS A CE    1 
ATOM   2828 N  NZ    . LYS A 1 390 ? 4.137  56.505 -2.958  1.00 42.06 ? 390  LYS A NZ    1 
ATOM   2829 N  N     . TYR A 1 391 ? 4.405  53.787 -9.263  1.00 32.51 ? 391  TYR A N     1 
ATOM   2830 C  CA    . TYR A 1 391 ? 3.554  54.699 -10.008 1.00 32.20 ? 391  TYR A CA    1 
ATOM   2831 C  C     . TYR A 1 391 ? 3.271  54.147 -11.404 1.00 32.75 ? 391  TYR A C     1 
ATOM   2832 O  O     . TYR A 1 391 ? 2.414  54.671 -12.118 1.00 33.96 ? 391  TYR A O     1 
ATOM   2833 C  CB    . TYR A 1 391 ? 4.211  56.086 -10.105 1.00 30.91 ? 391  TYR A CB    1 
ATOM   2834 C  CG    . TYR A 1 391 ? 4.259  56.829 -8.786  1.00 29.89 ? 391  TYR A CG    1 
ATOM   2835 C  CD1   . TYR A 1 391 ? 3.109  57.387 -8.234  1.00 30.17 ? 391  TYR A CD1   1 
ATOM   2836 C  CD2   . TYR A 1 391 ? 5.450  56.956 -8.080  1.00 30.02 ? 391  TYR A CD2   1 
ATOM   2837 C  CE1   . TYR A 1 391 ? 3.143  58.056 -6.996  1.00 29.72 ? 391  TYR A CE1   1 
ATOM   2838 C  CE2   . TYR A 1 391 ? 5.498  57.623 -6.841  1.00 29.95 ? 391  TYR A CE2   1 
ATOM   2839 C  CZ    . TYR A 1 391 ? 4.340  58.169 -6.306  1.00 29.50 ? 391  TYR A CZ    1 
ATOM   2840 O  OH    . TYR A 1 391 ? 4.381  58.805 -5.075  1.00 29.28 ? 391  TYR A OH    1 
ATOM   2841 N  N     . GLY A 1 392 ? 4.005  53.104 -11.795 1.00 32.26 ? 392  GLY A N     1 
ATOM   2842 C  CA    . GLY A 1 392 ? 3.951  52.622 -13.164 1.00 32.73 ? 392  GLY A CA    1 
ATOM   2843 C  C     . GLY A 1 392 ? 4.696  53.488 -14.165 1.00 33.73 ? 392  GLY A C     1 
ATOM   2844 O  O     . GLY A 1 392 ? 4.805  54.704 -13.991 1.00 33.44 ? 392  GLY A O     1 
ATOM   2845 N  N     . ILE A 1 393 ? 5.191  52.865 -15.233 1.00 35.21 ? 393  ILE A N     1 
ATOM   2846 C  CA    . ILE A 1 393 ? 6.295  53.431 -16.001 1.00 37.60 ? 393  ILE A CA    1 
ATOM   2847 C  C     . ILE A 1 393 ? 5.853  54.720 -16.672 1.00 39.06 ? 393  ILE A C     1 
ATOM   2848 O  O     . ILE A 1 393 ? 6.682  55.603 -16.952 1.00 38.92 ? 393  ILE A O     1 
ATOM   2849 C  CB    . ILE A 1 393 ? 6.803  52.476 -17.118 1.00 38.79 ? 393  ILE A CB    1 
ATOM   2850 C  CG1   . ILE A 1 393 ? 6.813  51.021 -16.620 1.00 40.39 ? 393  ILE A CG1   1 
ATOM   2851 C  CG2   . ILE A 1 393 ? 8.201  52.935 -17.602 1.00 37.39 ? 393  ILE A CG2   1 
ATOM   2852 C  CD1   . ILE A 1 393 ? 7.578  50.047 -17.532 1.00 41.20 ? 393  ILE A CD1   1 
ATOM   2853 N  N     . GLU A 1 394 ? 4.554  54.820 -16.959 1.00 39.32 ? 394  GLU A N     1 
ATOM   2854 C  CA    . GLU A 1 394 ? 4.049  55.922 -17.777 1.00 39.38 ? 394  GLU A CA    1 
ATOM   2855 C  C     . GLU A 1 394 ? 3.830  57.146 -16.912 1.00 37.64 ? 394  GLU A C     1 
ATOM   2856 O  O     . GLU A 1 394 ? 3.732  58.270 -17.425 1.00 37.93 ? 394  GLU A O     1 
ATOM   2857 C  CB    . GLU A 1 394 ? 2.741  55.540 -18.482 1.00 41.91 ? 394  GLU A CB    1 
ATOM   2858 C  CG    . GLU A 1 394 ? 1.587  55.230 -17.521 1.00 44.77 ? 394  GLU A CG    1 
ATOM   2859 C  CD    . GLU A 1 394 ? 1.467  53.742 -17.238 1.00 46.83 ? 394  GLU A CD    1 
ATOM   2860 O  OE1   . GLU A 1 394 ? 1.367  52.979 -18.239 1.00 48.31 ? 394  GLU A OE1   1 
ATOM   2861 O  OE2   . GLU A 1 394 ? 1.481  53.343 -16.031 1.00 45.85 ? 394  GLU A OE2   1 
ATOM   2862 N  N     . ASN A 1 395 ? 3.774  56.935 -15.598 1.00 35.69 ? 395  ASN A N     1 
ATOM   2863 C  CA    . ASN A 1 395 ? 3.550  58.047 -14.677 1.00 34.69 ? 395  ASN A CA    1 
ATOM   2864 C  C     . ASN A 1 395 ? 4.828  58.543 -14.021 1.00 32.55 ? 395  ASN A C     1 
ATOM   2865 O  O     . ASN A 1 395 ? 4.767  59.337 -13.081 1.00 32.08 ? 395  ASN A O     1 
ATOM   2866 C  CB    . ASN A 1 395 ? 2.522  57.667 -13.615 1.00 35.20 ? 395  ASN A CB    1 
ATOM   2867 C  CG    . ASN A 1 395 ? 1.193  57.282 -14.221 1.00 37.76 ? 395  ASN A CG    1 
ATOM   2868 O  OD1   . ASN A 1 395 ? 0.737  57.899 -15.197 1.00 36.84 ? 395  ASN A OD1   1 
ATOM   2869 N  ND2   . ASN A 1 395 ? 0.577  56.231 -13.677 1.00 36.28 ? 395  ASN A ND2   1 
ATOM   2870 N  N     . VAL A 1 396 ? 5.973  58.089 -14.535 1.00 30.23 ? 396  VAL A N     1 
ATOM   2871 C  CA    . VAL A 1 396 ? 7.277  58.497 -14.020 1.00 28.29 ? 396  VAL A CA    1 
ATOM   2872 C  C     . VAL A 1 396 ? 8.078  59.254 -15.085 1.00 28.76 ? 396  VAL A C     1 
ATOM   2873 O  O     . VAL A 1 396 ? 8.223  58.798 -16.217 1.00 28.90 ? 396  VAL A O     1 
ATOM   2874 C  CB    . VAL A 1 396 ? 8.083  57.274 -13.495 1.00 27.06 ? 396  VAL A CB    1 
ATOM   2875 C  CG1   . VAL A 1 396 ? 9.513  57.674 -13.130 1.00 25.78 ? 396  VAL A CG1   1 
ATOM   2876 C  CG2   . VAL A 1 396 ? 7.386  56.680 -12.283 1.00 23.43 ? 396  VAL A CG2   1 
ATOM   2877 N  N     . LYS A 1 397 ? 8.549  60.441 -14.730 1.00 28.52 ? 397  LYS A N     1 
ATOM   2878 C  CA    . LYS A 1 397 ? 9.366  61.240 -15.630 1.00 28.51 ? 397  LYS A CA    1 
ATOM   2879 C  C     . LYS A 1 397 ? 10.639 61.585 -14.876 1.00 28.34 ? 397  LYS A C     1 
ATOM   2880 O  O     . LYS A 1 397 ? 10.574 62.080 -13.752 1.00 28.40 ? 397  LYS A O     1 
ATOM   2881 C  CB    . LYS A 1 397 ? 8.619  62.526 -16.017 1.00 29.20 ? 397  LYS A CB    1 
ATOM   2882 C  CG    . LYS A 1 397 ? 8.644  62.851 -17.502 1.00 32.30 ? 397  LYS A CG    1 
ATOM   2883 C  CD    . LYS A 1 397 ? 9.871  63.694 -17.869 1.00 35.48 ? 397  LYS A CD    1 
ATOM   2884 C  CE    . LYS A 1 397 ? 9.763  64.267 -19.296 1.00 37.64 ? 397  LYS A CE    1 
ATOM   2885 N  NZ    . LYS A 1 397 ? 9.208  65.675 -19.333 1.00 38.42 ? 397  LYS A NZ    1 
ATOM   2886 N  N     . THR A 1 398 ? 11.795 61.321 -15.478 1.00 26.58 ? 398  THR A N     1 
ATOM   2887 C  CA    . THR A 1 398 ? 13.032 61.824 -14.912 1.00 24.96 ? 398  THR A CA    1 
ATOM   2888 C  C     . THR A 1 398 ? 13.662 62.948 -15.725 1.00 24.26 ? 398  THR A C     1 
ATOM   2889 O  O     . THR A 1 398 ? 13.502 63.033 -16.941 1.00 24.12 ? 398  THR A O     1 
ATOM   2890 C  CB    . THR A 1 398 ? 14.041 60.691 -14.663 1.00 25.13 ? 398  THR A CB    1 
ATOM   2891 O  OG1   . THR A 1 398 ? 14.583 60.238 -15.909 1.00 26.10 ? 398  THR A OG1   1 
ATOM   2892 C  CG2   . THR A 1 398 ? 13.360 59.536 -13.947 1.00 23.55 ? 398  THR A CG2   1 
ATOM   2893 N  N     . TYR A 1 399 ? 14.309 63.855 -15.007 1.00 23.42 ? 399  TYR A N     1 
ATOM   2894 C  CA    . TYR A 1 399 ? 15.130 64.903 -15.589 1.00 22.77 ? 399  TYR A CA    1 
ATOM   2895 C  C     . TYR A 1 399 ? 16.502 64.743 -14.984 1.00 23.45 ? 399  TYR A C     1 
ATOM   2896 O  O     . TYR A 1 399 ? 16.617 64.472 -13.789 1.00 24.29 ? 399  TYR A O     1 
ATOM   2897 C  CB    . TYR A 1 399 ? 14.609 66.267 -15.171 1.00 22.04 ? 399  TYR A CB    1 
ATOM   2898 C  CG    . TYR A 1 399 ? 13.229 66.565 -15.654 1.00 23.45 ? 399  TYR A CG    1 
ATOM   2899 C  CD1   . TYR A 1 399 ? 12.118 66.169 -14.922 1.00 23.41 ? 399  TYR A CD1   1 
ATOM   2900 C  CD2   . TYR A 1 399 ? 13.031 67.276 -16.832 1.00 24.04 ? 399  TYR A CD2   1 
ATOM   2901 C  CE1   . TYR A 1 399 ? 10.840 66.477 -15.353 1.00 25.29 ? 399  TYR A CE1   1 
ATOM   2902 C  CE2   . TYR A 1 399 ? 11.763 67.591 -17.271 1.00 25.00 ? 399  TYR A CE2   1 
ATOM   2903 C  CZ    . TYR A 1 399 ? 10.671 67.194 -16.528 1.00 25.34 ? 399  TYR A CZ    1 
ATOM   2904 O  OH    . TYR A 1 399 ? 9.412  67.544 -16.951 1.00 25.63 ? 399  TYR A OH    1 
ATOM   2905 N  N     . SER A 1 400 ? 17.542 64.927 -15.785 1.00 22.25 ? 400  SER A N     1 
ATOM   2906 C  CA    . SER A 1 400 ? 18.888 64.732 -15.277 1.00 22.48 ? 400  SER A CA    1 
ATOM   2907 C  C     . SER A 1 400 ? 19.878 65.599 -16.005 1.00 22.48 ? 400  SER A C     1 
ATOM   2908 O  O     . SER A 1 400 ? 19.566 66.191 -17.039 1.00 22.73 ? 400  SER A O     1 
ATOM   2909 C  CB    . SER A 1 400 ? 19.305 63.274 -15.381 1.00 22.01 ? 400  SER A CB    1 
ATOM   2910 O  OG    . SER A 1 400 ? 19.147 62.808 -16.703 1.00 25.07 ? 400  SER A OG    1 
ATOM   2911 N  N     . THR A 1 401 ? 21.062 65.713 -15.426 1.00 22.20 ? 401  THR A N     1 
ATOM   2912 C  CA    . THR A 1 401 ? 22.084 66.569 -15.979 1.00 21.40 ? 401  THR A CA    1 
ATOM   2913 C  C     . THR A 1 401 ? 23.437 66.113 -15.493 1.00 22.26 ? 401  THR A C     1 
ATOM   2914 O  O     . THR A 1 401 ? 23.551 65.340 -14.537 1.00 23.27 ? 401  THR A O     1 
ATOM   2915 C  CB    . THR A 1 401 ? 21.865 68.053 -15.609 1.00 20.05 ? 401  THR A CB    1 
ATOM   2916 O  OG1   . THR A 1 401 ? 22.678 68.869 -16.455 1.00 22.36 ? 401  THR A OG1   1 
ATOM   2917 C  CG2   . THR A 1 401 ? 22.232 68.326 -14.159 1.00 19.34 ? 401  THR A CG2   1 
ATOM   2918 N  N     . SER A 1 402 ? 24.459 66.564 -16.198 1.00 21.19 ? 402  SER A N     1 
ATOM   2919 C  CA    . SER A 1 402 ? 25.813 66.158 -15.925 1.00 22.06 ? 402  SER A CA    1 
ATOM   2920 C  C     . SER A 1 402 ? 26.653 67.292 -16.442 1.00 21.08 ? 402  SER A C     1 
ATOM   2921 O  O     . SER A 1 402 ? 26.471 67.727 -17.574 1.00 21.39 ? 402  SER A O     1 
ATOM   2922 C  CB    . SER A 1 402 ? 26.134 64.865 -16.678 1.00 24.02 ? 402  SER A CB    1 
ATOM   2923 O  OG    . SER A 1 402 ? 27.485 64.487 -16.485 1.00 28.41 ? 402  SER A OG    1 
ATOM   2924 N  N     . PHE A 1 403 ? 27.522 67.815 -15.588 1.00 19.75 ? 403  PHE A N     1 
ATOM   2925 C  CA    . PHE A 1 403 ? 28.387 68.922 -15.966 1.00 19.76 ? 403  PHE A CA    1 
ATOM   2926 C  C     . PHE A 1 403 ? 29.648 68.905 -15.106 1.00 19.04 ? 403  PHE A C     1 
ATOM   2927 O  O     . PHE A 1 403 ? 29.720 68.218 -14.091 1.00 17.35 ? 403  PHE A O     1 
ATOM   2928 C  CB    . PHE A 1 403 ? 27.653 70.271 -15.830 1.00 19.21 ? 403  PHE A CB    1 
ATOM   2929 C  CG    . PHE A 1 403 ? 27.158 70.568 -14.433 1.00 19.47 ? 403  PHE A CG    1 
ATOM   2930 C  CD1   . PHE A 1 403 ? 26.001 69.972 -13.943 1.00 20.30 ? 403  PHE A CD1   1 
ATOM   2931 C  CD2   . PHE A 1 403 ? 27.862 71.431 -13.599 1.00 20.79 ? 403  PHE A CD2   1 
ATOM   2932 C  CE1   . PHE A 1 403 ? 25.556 70.229 -12.641 1.00 20.06 ? 403  PHE A CE1   1 
ATOM   2933 C  CE2   . PHE A 1 403 ? 27.417 71.690 -12.298 1.00 19.97 ? 403  PHE A CE2   1 
ATOM   2934 C  CZ    . PHE A 1 403 ? 26.266 71.086 -11.825 1.00 20.67 ? 403  PHE A CZ    1 
ATOM   2935 N  N     . THR A 1 404 ? 30.652 69.645 -15.541 1.00 19.11 ? 404  THR A N     1 
ATOM   2936 C  CA    . THR A 1 404 ? 31.847 69.833 -14.747 1.00 20.38 ? 404  THR A CA    1 
ATOM   2937 C  C     . THR A 1 404 ? 31.747 71.168 -14.019 1.00 19.40 ? 404  THR A C     1 
ATOM   2938 O  O     . THR A 1 404 ? 31.608 72.213 -14.654 1.00 19.82 ? 404  THR A O     1 
ATOM   2939 C  CB    . THR A 1 404 ? 33.099 69.777 -15.649 1.00 20.45 ? 404  THR A CB    1 
ATOM   2940 O  OG1   . THR A 1 404 ? 33.199 68.467 -16.219 1.00 20.74 ? 404  THR A OG1   1 
ATOM   2941 C  CG2   . THR A 1 404 ? 34.368 70.078 -14.854 1.00 20.20 ? 404  THR A CG2   1 
ATOM   2942 N  N     . PRO A 1 405 ? 31.747 71.138 -12.672 1.00 18.55 ? 405  PRO A N     1 
ATOM   2943 C  CA    . PRO A 1 405 ? 31.694 72.362 -11.863 1.00 19.11 ? 405  PRO A CA    1 
ATOM   2944 C  C     . PRO A 1 405 ? 32.746 73.385 -12.291 1.00 19.39 ? 405  PRO A C     1 
ATOM   2945 O  O     . PRO A 1 405 ? 33.856 73.023 -12.688 1.00 18.78 ? 405  PRO A O     1 
ATOM   2946 C  CB    . PRO A 1 405 ? 31.963 71.868 -10.437 1.00 17.44 ? 405  PRO A CB    1 
ATOM   2947 C  CG    . PRO A 1 405 ? 31.595 70.441 -10.449 1.00 16.91 ? 405  PRO A CG    1 
ATOM   2948 C  CD    . PRO A 1 405 ? 31.817 69.927 -11.837 1.00 16.64 ? 405  PRO A CD    1 
ATOM   2949 N  N     . MET A 1 406 ? 32.393 74.659 -12.185 1.00 19.59 ? 406  MET A N     1 
ATOM   2950 C  CA    . MET A 1 406 ? 33.278 75.748 -12.583 1.00 21.00 ? 406  MET A CA    1 
ATOM   2951 C  C     . MET A 1 406 ? 34.572 75.765 -11.761 1.00 20.35 ? 406  MET A C     1 
ATOM   2952 O  O     . MET A 1 406 ? 35.599 76.259 -12.219 1.00 21.42 ? 406  MET A O     1 
ATOM   2953 C  CB    . MET A 1 406 ? 32.542 77.079 -12.442 1.00 21.81 ? 406  MET A CB    1 
ATOM   2954 C  CG    . MET A 1 406 ? 33.245 78.258 -13.082 1.00 26.05 ? 406  MET A CG    1 
ATOM   2955 S  SD    . MET A 1 406 ? 32.419 79.789 -12.580 1.00 30.54 ? 406  MET A SD    1 
ATOM   2956 C  CE    . MET A 1 406 ? 30.830 79.629 -13.491 1.00 26.22 ? 406  MET A CE    1 
ATOM   2957 N  N     . TYR A 1 407 ? 34.527 75.202 -10.556 1.00 19.83 ? 407  TYR A N     1 
ATOM   2958 C  CA    . TYR A 1 407 ? 35.741 74.955 -9.792  1.00 19.58 ? 407  TYR A CA    1 
ATOM   2959 C  C     . TYR A 1 407 ? 36.824 74.361 -10.691 1.00 19.96 ? 407  TYR A C     1 
ATOM   2960 O  O     . TYR A 1 407 ? 37.982 74.757 -10.627 1.00 19.22 ? 407  TYR A O     1 
ATOM   2961 C  CB    . TYR A 1 407 ? 35.467 74.012 -8.621  1.00 17.83 ? 407  TYR A CB    1 
ATOM   2962 C  CG    . TYR A 1 407 ? 36.729 73.681 -7.872  1.00 18.64 ? 407  TYR A CG    1 
ATOM   2963 C  CD1   . TYR A 1 407 ? 37.305 74.608 -6.997  1.00 18.92 ? 407  TYR A CD1   1 
ATOM   2964 C  CD2   . TYR A 1 407 ? 37.412 72.492 -8.114  1.00 17.04 ? 407  TYR A CD2   1 
ATOM   2965 C  CE1   . TYR A 1 407 ? 38.541 74.362 -6.394  1.00 18.98 ? 407  TYR A CE1   1 
ATOM   2966 C  CE2   . TYR A 1 407 ? 38.642 72.238 -7.518  1.00 18.55 ? 407  TYR A CE2   1 
ATOM   2967 C  CZ    . TYR A 1 407 ? 39.203 73.177 -6.665  1.00 19.17 ? 407  TYR A CZ    1 
ATOM   2968 O  OH    . TYR A 1 407 ? 40.443 72.942 -6.115  1.00 20.58 ? 407  TYR A OH    1 
ATOM   2969 N  N     . HIS A 1 408 ? 36.418 73.427 -11.544 1.00 19.60 ? 408  HIS A N     1 
ATOM   2970 C  CA    . HIS A 1 408 ? 37.339 72.615 -12.327 1.00 20.26 ? 408  HIS A CA    1 
ATOM   2971 C  C     . HIS A 1 408 ? 37.645 73.201 -13.707 1.00 22.06 ? 408  HIS A C     1 
ATOM   2972 O  O     . HIS A 1 408 ? 38.402 72.605 -14.475 1.00 22.88 ? 408  HIS A O     1 
ATOM   2973 C  CB    . HIS A 1 408 ? 36.786 71.197 -12.483 1.00 18.62 ? 408  HIS A CB    1 
ATOM   2974 C  CG    . HIS A 1 408 ? 36.957 70.343 -11.265 1.00 18.10 ? 408  HIS A CG    1 
ATOM   2975 N  ND1   . HIS A 1 408 ? 38.168 70.200 -10.617 1.00 19.12 ? 408  HIS A ND1   1 
ATOM   2976 C  CD2   . HIS A 1 408 ? 36.074 69.582 -10.576 1.00 18.58 ? 408  HIS A CD2   1 
ATOM   2977 C  CE1   . HIS A 1 408 ? 38.022 69.386 -9.585  1.00 19.57 ? 408  HIS A CE1   1 
ATOM   2978 N  NE2   . HIS A 1 408 ? 36.759 68.998 -9.539  1.00 18.79 ? 408  HIS A NE2   1 
ATOM   2979 N  N     . ALA A 1 409 ? 37.085 74.373 -14.009 1.00 23.11 ? 409  ALA A N     1 
ATOM   2980 C  CA    . ALA A 1 409 ? 37.335 75.055 -15.279 1.00 23.94 ? 409  ALA A CA    1 
ATOM   2981 C  C     . ALA A 1 409 ? 38.828 75.323 -15.481 1.00 25.17 ? 409  ALA A C     1 
ATOM   2982 O  O     . ALA A 1 409 ? 39.321 75.294 -16.614 1.00 25.82 ? 409  ALA A O     1 
ATOM   2983 C  CB    . ALA A 1 409 ? 36.554 76.361 -15.341 1.00 23.29 ? 409  ALA A CB    1 
ATOM   2984 N  N     . VAL A 1 410 ? 39.543 75.555 -14.382 1.00 23.89 ? 410  VAL A N     1 
ATOM   2985 C  CA    . VAL A 1 410 ? 40.967 75.883 -14.439 1.00 24.54 ? 410  VAL A CA    1 
ATOM   2986 C  C     . VAL A 1 410 ? 41.885 74.831 -13.808 1.00 24.66 ? 410  VAL A C     1 
ATOM   2987 O  O     . VAL A 1 410 ? 43.073 75.102 -13.584 1.00 24.64 ? 410  VAL A O     1 
ATOM   2988 C  CB    . VAL A 1 410 ? 41.277 77.239 -13.755 1.00 23.93 ? 410  VAL A CB    1 
ATOM   2989 C  CG1   . VAL A 1 410 ? 40.389 78.337 -14.311 1.00 23.47 ? 410  VAL A CG1   1 
ATOM   2990 C  CG2   . VAL A 1 410 ? 41.120 77.112 -12.250 1.00 24.38 ? 410  VAL A CG2   1 
ATOM   2991 N  N     . THR A 1 411 ? 41.349 73.648 -13.515 1.00 24.21 ? 411  THR A N     1 
ATOM   2992 C  CA    . THR A 1 411 ? 42.176 72.554 -13.004 1.00 23.01 ? 411  THR A CA    1 
ATOM   2993 C  C     . THR A 1 411 ? 42.367 71.407 -14.014 1.00 23.71 ? 411  THR A C     1 
ATOM   2994 O  O     . THR A 1 411 ? 41.539 71.209 -14.899 1.00 23.37 ? 411  THR A O     1 
ATOM   2995 C  CB    . THR A 1 411 ? 41.612 71.983 -11.673 1.00 22.59 ? 411  THR A CB    1 
ATOM   2996 O  OG1   . THR A 1 411 ? 40.399 71.274 -11.935 1.00 20.33 ? 411  THR A OG1   1 
ATOM   2997 C  CG2   . THR A 1 411 ? 41.347 73.094 -10.660 1.00 19.49 ? 411  THR A CG2   1 
ATOM   2998 N  N     . LYS A 1 412 ? 43.435 70.629 -13.839 1.00 23.93 ? 412  LYS A N     1 
ATOM   2999 C  CA    . LYS A 1 412 ? 43.701 69.456 -14.672 1.00 26.47 ? 412  LYS A CA    1 
ATOM   3000 C  C     . LYS A 1 412 ? 42.808 68.310 -14.231 1.00 26.38 ? 412  LYS A C     1 
ATOM   3001 O  O     . LYS A 1 412 ? 42.204 67.624 -15.061 1.00 25.80 ? 412  LYS A O     1 
ATOM   3002 C  CB    . LYS A 1 412 ? 45.164 69.021 -14.538 1.00 28.87 ? 412  LYS A CB    1 
ATOM   3003 C  CG    . LYS A 1 412 ? 45.962 69.084 -15.832 1.00 34.13 ? 412  LYS A CG    1 
ATOM   3004 C  CD    . LYS A 1 412 ? 46.263 70.530 -16.246 1.00 36.85 ? 412  LYS A CD    1 
ATOM   3005 C  CE    . LYS A 1 412 ? 45.654 70.895 -17.629 1.00 40.33 ? 412  LYS A CE    1 
ATOM   3006 N  NZ    . LYS A 1 412 ? 45.131 69.716 -18.429 1.00 40.46 ? 412  LYS A NZ    1 
ATOM   3007 N  N     . ARG A 1 413 ? 42.752 68.114 -12.913 1.00 25.76 ? 413  ARG A N     1 
ATOM   3008 C  CA    . ARG A 1 413 ? 41.835 67.172 -12.284 1.00 25.55 ? 413  ARG A CA    1 
ATOM   3009 C  C     . ARG A 1 413 ? 40.402 67.571 -12.581 1.00 25.61 ? 413  ARG A C     1 
ATOM   3010 O  O     . ARG A 1 413 ? 40.074 68.758 -12.594 1.00 26.14 ? 413  ARG A O     1 
ATOM   3011 C  CB    . ARG A 1 413 ? 42.057 67.160 -10.772 1.00 24.49 ? 413  ARG A CB    1 
ATOM   3012 C  CG    . ARG A 1 413 ? 41.358 66.027 -10.038 1.00 23.75 ? 413  ARG A CG    1 
ATOM   3013 C  CD    . ARG A 1 413 ? 41.902 65.913 -8.625  1.00 22.86 ? 413  ARG A CD    1 
ATOM   3014 N  NE    . ARG A 1 413 ? 41.541 67.065 -7.808  1.00 22.73 ? 413  ARG A NE    1 
ATOM   3015 C  CZ    . ARG A 1 413 ? 40.377 67.192 -7.174  1.00 24.25 ? 413  ARG A CZ    1 
ATOM   3016 N  NH1   . ARG A 1 413 ? 39.447 66.244 -7.280  1.00 22.99 ? 413  ARG A NH1   1 
ATOM   3017 N  NH2   . ARG A 1 413 ? 40.145 68.255 -6.422  1.00 20.49 ? 413  ARG A NH2   1 
ATOM   3018 N  N     . LYS A 1 414 ? 39.565 66.574 -12.843 1.00 25.39 ? 414  LYS A N     1 
ATOM   3019 C  CA    . LYS A 1 414 ? 38.147 66.798 -13.105 1.00 24.77 ? 414  LYS A CA    1 
ATOM   3020 C  C     . LYS A 1 414 ? 37.314 65.910 -12.190 1.00 23.85 ? 414  LYS A C     1 
ATOM   3021 O  O     . LYS A 1 414 ? 37.643 64.741 -11.957 1.00 24.08 ? 414  LYS A O     1 
ATOM   3022 C  CB    . LYS A 1 414 ? 37.821 66.487 -14.572 1.00 25.33 ? 414  LYS A CB    1 
ATOM   3023 C  CG    . LYS A 1 414 ? 38.521 67.386 -15.580 1.00 25.18 ? 414  LYS A CG    1 
ATOM   3024 C  CD    . LYS A 1 414 ? 38.102 68.825 -15.393 1.00 26.00 ? 414  LYS A CD    1 
ATOM   3025 C  CE    . LYS A 1 414 ? 38.473 69.673 -16.596 1.00 27.20 ? 414  LYS A CE    1 
ATOM   3026 N  NZ    . LYS A 1 414 ? 39.554 70.653 -16.262 1.00 26.86 ? 414  LYS A NZ    1 
ATOM   3027 N  N     . THR A 1 415 ? 36.234 66.469 -11.670 1.00 23.23 ? 415  THR A N     1 
ATOM   3028 C  CA    . THR A 1 415 ? 35.093 65.665 -11.270 1.00 21.90 ? 415  THR A CA    1 
ATOM   3029 C  C     . THR A 1 415 ? 33.824 66.160 -11.956 1.00 21.93 ? 415  THR A C     1 
ATOM   3030 O  O     . THR A 1 415 ? 33.749 67.317 -12.386 1.00 20.28 ? 415  THR A O     1 
ATOM   3031 C  CB    . THR A 1 415 ? 34.905 65.661 -9.724  1.00 20.67 ? 415  THR A CB    1 
ATOM   3032 O  OG1   . THR A 1 415 ? 34.741 67.003 -9.239  1.00 19.75 ? 415  THR A OG1   1 
ATOM   3033 C  CG2   . THR A 1 415 ? 36.109 65.024 -9.039  1.00 19.51 ? 415  THR A CG2   1 
ATOM   3034 N  N     . LYS A 1 416 ? 32.855 65.255 -12.076 1.00 21.50 ? 416  LYS A N     1 
ATOM   3035 C  CA    . LYS A 1 416 ? 31.534 65.567 -12.586 1.00 22.06 ? 416  LYS A CA    1 
ATOM   3036 C  C     . LYS A 1 416 ? 30.650 66.016 -11.438 1.00 19.72 ? 416  LYS A C     1 
ATOM   3037 O  O     . LYS A 1 416 ? 30.893 65.683 -10.287 1.00 20.46 ? 416  LYS A O     1 
ATOM   3038 C  CB    . LYS A 1 416 ? 30.913 64.327 -13.236 1.00 24.52 ? 416  LYS A CB    1 
ATOM   3039 C  CG    . LYS A 1 416 ? 31.461 63.993 -14.610 1.00 31.28 ? 416  LYS A CG    1 
ATOM   3040 C  CD    . LYS A 1 416 ? 31.344 62.494 -14.903 1.00 35.88 ? 416  LYS A CD    1 
ATOM   3041 C  CE    . LYS A 1 416 ? 30.388 62.223 -16.084 1.00 38.84 ? 416  LYS A CE    1 
ATOM   3042 N  NZ    . LYS A 1 416 ? 29.162 61.426 -15.699 1.00 41.35 ? 416  LYS A NZ    1 
ATOM   3043 N  N     . CYS A 1 417 ? 29.616 66.773 -11.768 1.00 18.92 ? 417  CYS A N     1 
ATOM   3044 C  CA    . CYS A 1 417 ? 28.397 66.801 -10.991 1.00 17.84 ? 417  CYS A CA    1 
ATOM   3045 C  C     . CYS A 1 417 ? 27.279 66.168 -11.811 1.00 18.18 ? 417  CYS A C     1 
ATOM   3046 O  O     . CYS A 1 417 ? 26.960 66.641 -12.902 1.00 18.11 ? 417  CYS A O     1 
ATOM   3047 C  CB    . CYS A 1 417 ? 28.056 68.246 -10.649 1.00 18.23 ? 417  CYS A CB    1 
ATOM   3048 S  SG    . CYS A 1 417 ? 26.612 68.449 -9.598  1.00 20.60 ? 417  CYS A SG    1 
ATOM   3049 N  N     . VAL A 1 418 ? 26.699 65.089 -11.295 1.00 17.46 ? 418  VAL A N     1 
ATOM   3050 C  CA    . VAL A 1 418 ? 25.454 64.567 -11.845 1.00 16.87 ? 418  VAL A CA    1 
ATOM   3051 C  C     . VAL A 1 418 ? 24.265 64.791 -10.911 1.00 18.00 ? 418  VAL A C     1 
ATOM   3052 O  O     . VAL A 1 418 ? 24.335 64.537 -9.702  1.00 17.07 ? 418  VAL A O     1 
ATOM   3053 C  CB    . VAL A 1 418 ? 25.563 63.061 -12.195 1.00 17.35 ? 418  VAL A CB    1 
ATOM   3054 C  CG1   . VAL A 1 418 ? 26.624 62.848 -13.247 1.00 15.42 ? 418  VAL A CG1   1 
ATOM   3055 C  CG2   . VAL A 1 418 ? 25.872 62.244 -10.965 1.00 16.95 ? 418  VAL A CG2   1 
ATOM   3056 N  N     . MET A 1 419 ? 23.170 65.272 -11.486 1.00 17.19 ? 419  MET A N     1 
ATOM   3057 C  CA    . MET A 1 419 ? 21.931 65.437 -10.745 1.00 17.69 ? 419  MET A CA    1 
ATOM   3058 C  C     . MET A 1 419 ? 20.770 64.737 -11.438 1.00 18.78 ? 419  MET A C     1 
ATOM   3059 O  O     . MET A 1 419 ? 20.712 64.684 -12.670 1.00 19.75 ? 419  MET A O     1 
ATOM   3060 C  CB    . MET A 1 419 ? 21.618 66.912 -10.591 1.00 17.90 ? 419  MET A CB    1 
ATOM   3061 C  CG    . MET A 1 419 ? 22.636 67.666 -9.800  1.00 17.98 ? 419  MET A CG    1 
ATOM   3062 S  SD    . MET A 1 419 ? 22.297 69.425 -9.882  1.00 23.57 ? 419  MET A SD    1 
ATOM   3063 C  CE    . MET A 1 419 ? 23.601 70.074 -8.804  1.00 19.99 ? 419  MET A CE    1 
ATOM   3064 N  N     . LYS A 1 420 ? 19.835 64.220 -10.645 1.00 17.83 ? 420  LYS A N     1 
ATOM   3065 C  CA    . LYS A 1 420 ? 18.648 63.568 -11.187 1.00 18.91 ? 420  LYS A CA    1 
ATOM   3066 C  C     . LYS A 1 420 ? 17.401 63.860 -10.355 1.00 19.90 ? 420  LYS A C     1 
ATOM   3067 O  O     . LYS A 1 420 ? 17.402 63.723 -9.133  1.00 19.22 ? 420  LYS A O     1 
ATOM   3068 C  CB    . LYS A 1 420 ? 18.862 62.061 -11.303 1.00 17.38 ? 420  LYS A CB    1 
ATOM   3069 C  CG    . LYS A 1 420 ? 17.839 61.368 -12.166 1.00 18.55 ? 420  LYS A CG    1 
ATOM   3070 C  CD    . LYS A 1 420 ? 17.651 59.922 -11.744 1.00 17.21 ? 420  LYS A CD    1 
ATOM   3071 C  CE    . LYS A 1 420 ? 18.355 58.987 -12.699 1.00 16.49 ? 420  LYS A CE    1 
ATOM   3072 N  NZ    . LYS A 1 420 ? 17.971 57.582 -12.469 1.00 17.25 ? 420  LYS A NZ    1 
ATOM   3073 N  N     . MET A 1 421 ? 16.349 64.286 -11.039 1.00 18.66 ? 421  MET A N     1 
ATOM   3074 C  CA    . MET A 1 421 ? 15.055 64.518 -10.424 1.00 18.32 ? 421  MET A CA    1 
ATOM   3075 C  C     . MET A 1 421 ? 14.090 63.453 -10.949 1.00 17.46 ? 421  MET A C     1 
ATOM   3076 O  O     . MET A 1 421 ? 13.891 63.308 -12.158 1.00 17.26 ? 421  MET A O     1 
ATOM   3077 C  CB    . MET A 1 421 ? 14.575 65.928 -10.782 1.00 19.22 ? 421  MET A CB    1 
ATOM   3078 C  CG    . MET A 1 421 ? 13.194 66.307 -10.265 1.00 20.35 ? 421  MET A CG    1 
ATOM   3079 S  SD    . MET A 1 421 ? 12.778 67.989 -10.759 1.00 22.24 ? 421  MET A SD    1 
ATOM   3080 C  CE    . MET A 1 421 ? 13.500 68.898 -9.442  1.00 19.18 ? 421  MET A CE    1 
ATOM   3081 N  N     . VAL A 1 422 ? 13.558 62.660 -10.030 1.00 17.37 ? 422  VAL A N     1 
ATOM   3082 C  CA    . VAL A 1 422 ? 12.503 61.712 -10.349 1.00 18.49 ? 422  VAL A CA    1 
ATOM   3083 C  C     . VAL A 1 422 ? 11.117 62.310 -10.066 1.00 20.23 ? 422  VAL A C     1 
ATOM   3084 O  O     . VAL A 1 422 ? 10.847 62.794 -8.962  1.00 21.48 ? 422  VAL A O     1 
ATOM   3085 C  CB    . VAL A 1 422 ? 12.696 60.416 -9.555  1.00 17.05 ? 422  VAL A CB    1 
ATOM   3086 C  CG1   . VAL A 1 422 ? 11.721 59.358 -10.044 1.00 16.46 ? 422  VAL A CG1   1 
ATOM   3087 C  CG2   . VAL A 1 422 ? 14.149 59.932 -9.704  1.00 16.88 ? 422  VAL A CG2   1 
ATOM   3088 N  N     . CYS A 1 423 ? 10.250 62.314 -11.076 1.00 20.37 ? 423  CYS A N     1 
ATOM   3089 C  CA    . CYS A 1 423 ? 8.956  62.991 -10.971 1.00 20.45 ? 423  CYS A CA    1 
ATOM   3090 C  C     . CYS A 1 423 ? 7.820  62.001 -11.166 1.00 21.83 ? 423  CYS A C     1 
ATOM   3091 O  O     . CYS A 1 423 ? 7.946  61.040 -11.924 1.00 21.14 ? 423  CYS A O     1 
ATOM   3092 C  CB    . CYS A 1 423 ? 8.852  64.113 -12.004 1.00 20.31 ? 423  CYS A CB    1 
ATOM   3093 S  SG    . CYS A 1 423 ? 9.790  65.591 -11.573 1.00 19.25 ? 423  CYS A SG    1 
ATOM   3094 N  N     . ALA A 1 424 ? 6.714  62.232 -10.468 1.00 23.57 ? 424  ALA A N     1 
ATOM   3095 C  CA    . ALA A 1 424 ? 5.560  61.345 -10.546 1.00 25.76 ? 424  ALA A CA    1 
ATOM   3096 C  C     . ALA A 1 424 ? 4.316  62.100 -11.019 1.00 26.05 ? 424  ALA A C     1 
ATOM   3097 O  O     . ALA A 1 424 ? 3.961  63.167 -10.492 1.00 25.90 ? 424  ALA A O     1 
ATOM   3098 C  CB    . ALA A 1 424 ? 5.305  60.694 -9.196  1.00 25.31 ? 424  ALA A CB    1 
ATOM   3099 N  N     . ASN A 1 425 ? 3.681  61.535 -12.041 1.00 27.34 ? 425  ASN A N     1 
ATOM   3100 C  CA    . ASN A 1 425 ? 2.277  61.776 -12.360 1.00 27.33 ? 425  ASN A CA    1 
ATOM   3101 C  C     . ASN A 1 425 ? 2.162  63.069 -13.129 1.00 28.57 ? 425  ASN A C     1 
ATOM   3102 O  O     . ASN A 1 425 ? 3.174  63.616 -13.589 1.00 27.57 ? 425  ASN A O     1 
ATOM   3103 C  CB    . ASN A 1 425 ? 1.400  61.793 -11.101 1.00 25.88 ? 425  ASN A CB    1 
ATOM   3104 C  CG    . ASN A 1 425 ? 1.194  60.395 -10.516 1.00 25.98 ? 425  ASN A CG    1 
ATOM   3105 O  OD1   . ASN A 1 425 ? 0.969  60.232 -9.316  1.00 26.63 ? 425  ASN A OD1   1 
ATOM   3106 N  ND2   . ASN A 1 425 ? 1.299  59.382 -11.365 1.00 25.92 ? 425  ASN A ND2   1 
ATOM   3107 N  N     . LYS A 1 426 ? 0.929  63.510 -13.352 1.00 30.08 ? 426  LYS A N     1 
ATOM   3108 C  CA    . LYS A 1 426 ? 0.690  64.552 -14.335 1.00 31.01 ? 426  LYS A CA    1 
ATOM   3109 C  C     . LYS A 1 426 ? 1.290  65.862 -13.802 1.00 29.89 ? 426  LYS A C     1 
ATOM   3110 O  O     . LYS A 1 426 ? 1.966  66.593 -14.534 1.00 29.94 ? 426  LYS A O     1 
ATOM   3111 C  CB    . LYS A 1 426 ? -0.817 64.697 -14.596 1.00 34.57 ? 426  LYS A CB    1 
ATOM   3112 C  CG    . LYS A 1 426 ? -1.188 65.808 -15.595 1.00 37.42 ? 426  LYS A CG    1 
ATOM   3113 C  CD    . LYS A 1 426 ? -2.449 65.476 -16.430 1.00 42.13 ? 426  LYS A CD    1 
ATOM   3114 C  CE    . LYS A 1 426 ? -3.471 64.590 -15.677 1.00 43.71 ? 426  LYS A CE    1 
ATOM   3115 N  NZ    . LYS A 1 426 ? -3.995 65.235 -14.416 1.00 44.70 ? 426  LYS A NZ    1 
ATOM   3116 N  N     . GLU A 1 427 ? 1.083  66.120 -12.511 1.00 28.88 ? 427  GLU A N     1 
ATOM   3117 C  CA    . GLU A 1 427 ? 1.579  67.339 -11.891 1.00 27.80 ? 427  GLU A CA    1 
ATOM   3118 C  C     . GLU A 1 427 ? 3.099  67.305 -11.673 1.00 26.28 ? 427  GLU A C     1 
ATOM   3119 O  O     . GLU A 1 427 ? 3.710  68.330 -11.386 1.00 24.34 ? 427  GLU A O     1 
ATOM   3120 C  CB    . GLU A 1 427 ? 0.830  67.616 -10.581 1.00 29.93 ? 427  GLU A CB    1 
ATOM   3121 C  CG    . GLU A 1 427 ? 1.260  66.778 -9.389  1.00 34.21 ? 427  GLU A CG    1 
ATOM   3122 C  CD    . GLU A 1 427 ? 0.405  65.524 -9.195  1.00 38.68 ? 427  GLU A CD    1 
ATOM   3123 O  OE1   . GLU A 1 427 ? -0.355 65.141 -10.131 1.00 40.56 ? 427  GLU A OE1   1 
ATOM   3124 O  OE2   . GLU A 1 427 ? 0.498  64.907 -8.100  1.00 41.02 ? 427  GLU A OE2   1 
ATOM   3125 N  N     . GLU A 1 428 ? 3.706  66.137 -11.881 1.00 25.68 ? 428  GLU A N     1 
ATOM   3126 C  CA    . GLU A 1 428 ? 5.148  65.954 -11.715 1.00 24.33 ? 428  GLU A CA    1 
ATOM   3127 C  C     . GLU A 1 428 ? 5.546  66.365 -10.309 1.00 23.35 ? 428  GLU A C     1 
ATOM   3128 O  O     . GLU A 1 428 ? 6.345  67.286 -10.121 1.00 22.94 ? 428  GLU A O     1 
ATOM   3129 C  CB    . GLU A 1 428 ? 5.934  66.779 -12.743 1.00 25.55 ? 428  GLU A CB    1 
ATOM   3130 C  CG    . GLU A 1 428 ? 5.751  66.339 -14.189 1.00 27.42 ? 428  GLU A CG    1 
ATOM   3131 C  CD    . GLU A 1 428 ? 6.746  66.993 -15.133 1.00 28.38 ? 428  GLU A CD    1 
ATOM   3132 O  OE1   . GLU A 1 428 ? 6.965  68.216 -15.035 1.00 29.69 ? 428  GLU A OE1   1 
ATOM   3133 O  OE2   . GLU A 1 428 ? 7.322  66.287 -15.983 1.00 30.81 ? 428  GLU A OE2   1 
ATOM   3134 N  N     . LYS A 1 429 ? 4.925  65.723 -9.327  1.00 22.03 ? 429  LYS A N     1 
ATOM   3135 C  CA    . LYS A 1 429 ? 5.442  65.706 -7.968  1.00 22.28 ? 429  LYS A CA    1 
ATOM   3136 C  C     . LYS A 1 429 ? 6.887  65.220 -7.980  1.00 21.27 ? 429  LYS A C     1 
ATOM   3137 O  O     . LYS A 1 429 ? 7.197  64.195 -8.596  1.00 22.30 ? 429  LYS A O     1 
ATOM   3138 C  CB    . LYS A 1 429 ? 4.598  64.775 -7.100  1.00 22.96 ? 429  LYS A CB    1 
ATOM   3139 C  CG    . LYS A 1 429 ? 4.378  65.293 -5.708  1.00 26.30 ? 429  LYS A CG    1 
ATOM   3140 C  CD    . LYS A 1 429 ? 4.755  64.237 -4.705  1.00 29.39 ? 429  LYS A CD    1 
ATOM   3141 C  CE    . LYS A 1 429 ? 3.562  63.357 -4.378  1.00 31.66 ? 429  LYS A CE    1 
ATOM   3142 N  NZ    . LYS A 1 429 ? 3.247  63.428 -2.918  1.00 34.35 ? 429  LYS A NZ    1 
ATOM   3143 N  N     . VAL A 1 430 ? 7.768  65.962 -7.317  1.00 19.88 ? 430  VAL A N     1 
ATOM   3144 C  CA    . VAL A 1 430 ? 9.138  65.515 -7.118  1.00 17.97 ? 430  VAL A CA    1 
ATOM   3145 C  C     . VAL A 1 430 ? 9.151  64.474 -6.007  1.00 17.23 ? 430  VAL A C     1 
ATOM   3146 O  O     . VAL A 1 430 ? 8.925  64.811 -4.842  1.00 17.37 ? 430  VAL A O     1 
ATOM   3147 C  CB    . VAL A 1 430 ? 10.063 66.695 -6.742  1.00 18.12 ? 430  VAL A CB    1 
ATOM   3148 C  CG1   . VAL A 1 430 ? 11.501 66.215 -6.590  1.00 16.54 ? 430  VAL A CG1   1 
ATOM   3149 C  CG2   . VAL A 1 430 ? 9.981  67.761 -7.806  1.00 17.40 ? 430  VAL A CG2   1 
ATOM   3150 N  N     . VAL A 1 431 ? 9.364  63.212 -6.377  1.00 15.29 ? 431  VAL A N     1 
ATOM   3151 C  CA    . VAL A 1 431 ? 9.438  62.131 -5.397  1.00 14.66 ? 431  VAL A CA    1 
ATOM   3152 C  C     . VAL A 1 431 ? 10.859 61.618 -5.161  1.00 15.92 ? 431  VAL A C     1 
ATOM   3153 O  O     . VAL A 1 431 ? 11.076 60.778 -4.298  1.00 15.97 ? 431  VAL A O     1 
ATOM   3154 C  CB    . VAL A 1 431 ? 8.521  60.931 -5.785  1.00 15.66 ? 431  VAL A CB    1 
ATOM   3155 C  CG1   . VAL A 1 431 ? 7.068  61.386 -5.870  1.00 14.59 ? 431  VAL A CG1   1 
ATOM   3156 C  CG2   . VAL A 1 431 ? 8.975  60.295 -7.099  1.00 12.94 ? 431  VAL A CG2   1 
ATOM   3157 N  N     . GLY A 1 432 ? 11.823 62.145 -5.910  1.00 16.15 ? 432  GLY A N     1 
ATOM   3158 C  CA    . GLY A 1 432 ? 13.203 61.712 -5.771  1.00 15.40 ? 432  GLY A CA    1 
ATOM   3159 C  C     . GLY A 1 432 ? 14.178 62.768 -6.250  1.00 16.38 ? 432  GLY A C     1 
ATOM   3160 O  O     . GLY A 1 432 ? 13.985 63.366 -7.305  1.00 16.19 ? 432  GLY A O     1 
ATOM   3161 N  N     . ILE A 1 433 ? 15.209 63.024 -5.454  1.00 17.89 ? 433  ILE A N     1 
ATOM   3162 C  CA    . ILE A 1 433 ? 16.400 63.743 -5.913  1.00 17.74 ? 433  ILE A CA    1 
ATOM   3163 C  C     . ILE A 1 433 ? 17.657 62.940 -5.595  1.00 18.65 ? 433  ILE A C     1 
ATOM   3164 O  O     . ILE A 1 433 ? 17.799 62.385 -4.503  1.00 18.20 ? 433  ILE A O     1 
ATOM   3165 C  CB    . ILE A 1 433 ? 16.533 65.144 -5.243  1.00 18.60 ? 433  ILE A CB    1 
ATOM   3166 C  CG1   . ILE A 1 433 ? 15.320 66.007 -5.577  1.00 18.96 ? 433  ILE A CG1   1 
ATOM   3167 C  CG2   . ILE A 1 433 ? 17.803 65.856 -5.710  1.00 18.98 ? 433  ILE A CG2   1 
ATOM   3168 C  CD1   . ILE A 1 433 ? 15.080 67.098 -4.593  1.00 17.79 ? 433  ILE A CD1   1 
ATOM   3169 N  N     . HIS A 1 434 ? 18.561 62.883 -6.565  1.00 18.31 ? 434  HIS A N     1 
ATOM   3170 C  CA    . HIS A 1 434 ? 19.809 62.142 -6.441  1.00 17.12 ? 434  HIS A CA    1 
ATOM   3171 C  C     . HIS A 1 434 ? 20.935 62.920 -7.115  1.00 17.35 ? 434  HIS A C     1 
ATOM   3172 O  O     . HIS A 1 434 ? 20.824 63.319 -8.274  1.00 16.35 ? 434  HIS A O     1 
ATOM   3173 C  CB    . HIS A 1 434 ? 19.673 60.766 -7.092  1.00 15.21 ? 434  HIS A CB    1 
ATOM   3174 C  CG    . HIS A 1 434 ? 18.416 60.051 -6.715  1.00 17.04 ? 434  HIS A CG    1 
ATOM   3175 N  ND1   . HIS A 1 434 ? 18.288 59.338 -5.544  1.00 15.73 ? 434  HIS A ND1   1 
ATOM   3176 C  CD2   . HIS A 1 434 ? 17.217 59.967 -7.340  1.00 17.58 ? 434  HIS A CD2   1 
ATOM   3177 C  CE1   . HIS A 1 434 ? 17.065 58.846 -5.460  1.00 17.82 ? 434  HIS A CE1   1 
ATOM   3178 N  NE2   . HIS A 1 434 ? 16.395 59.215 -6.537  1.00 16.47 ? 434  HIS A NE2   1 
ATOM   3179 N  N     . MET A 1 435 ? 22.025 63.130 -6.388  1.00 17.65 ? 435  MET A N     1 
ATOM   3180 C  CA    . MET A 1 435 ? 23.154 63.861 -6.935  1.00 16.67 ? 435  MET A CA    1 
ATOM   3181 C  C     . MET A 1 435 ? 24.479 63.403 -6.352  1.00 15.99 ? 435  MET A C     1 
ATOM   3182 O  O     . MET A 1 435 ? 24.544 62.881 -5.233  1.00 13.88 ? 435  MET A O     1 
ATOM   3183 C  CB    . MET A 1 435 ? 22.980 65.357 -6.718  1.00 18.76 ? 435  MET A CB    1 
ATOM   3184 C  CG    . MET A 1 435 ? 22.715 65.737 -5.283  1.00 22.54 ? 435  MET A CG    1 
ATOM   3185 S  SD    . MET A 1 435 ? 22.007 67.378 -5.203  1.00 25.94 ? 435  MET A SD    1 
ATOM   3186 C  CE    . MET A 1 435 ? 22.072 67.649 -3.467  1.00 24.36 ? 435  MET A CE    1 
ATOM   3187 N  N     . GLN A 1 436 ? 25.531 63.590 -7.135  1.00 13.09 ? 436  GLN A N     1 
ATOM   3188 C  CA    . GLN A 1 436 ? 26.889 63.537 -6.631  1.00 13.54 ? 436  GLN A CA    1 
ATOM   3189 C  C     . GLN A 1 436 ? 27.668 64.685 -7.258  1.00 12.31 ? 436  GLN A C     1 
ATOM   3190 O  O     . GLN A 1 436 ? 27.605 64.900 -8.466  1.00 12.50 ? 436  GLN A O     1 
ATOM   3191 C  CB    . GLN A 1 436 ? 27.513 62.195 -6.999  1.00 11.85 ? 436  GLN A CB    1 
ATOM   3192 C  CG    . GLN A 1 436 ? 28.946 61.994 -6.564  1.00 12.11 ? 436  GLN A CG    1 
ATOM   3193 C  CD    . GLN A 1 436 ? 29.335 60.531 -6.613  1.00 13.92 ? 436  GLN A CD    1 
ATOM   3194 O  OE1   . GLN A 1 436 ? 28.674 59.731 -7.272  1.00 15.52 ? 436  GLN A OE1   1 
ATOM   3195 N  NE2   . GLN A 1 436 ? 30.389 60.168 -5.894  1.00 13.85 ? 436  GLN A NE2   1 
ATOM   3196 N  N     . GLY A 1 437 ? 28.363 65.446 -6.425  1.00 13.73 ? 437  GLY A N     1 
ATOM   3197 C  CA    . GLY A 1 437 ? 29.141 66.563 -6.917  1.00 15.02 ? 437  GLY A CA    1 
ATOM   3198 C  C     . GLY A 1 437 ? 29.761 67.325 -5.768  1.00 15.62 ? 437  GLY A C     1 
ATOM   3199 O  O     . GLY A 1 437 ? 29.437 67.075 -4.603  1.00 17.04 ? 437  GLY A O     1 
ATOM   3200 N  N     . LEU A 1 438 ? 30.672 68.237 -6.093  1.00 15.36 ? 438  LEU A N     1 
ATOM   3201 C  CA    . LEU A 1 438 ? 31.148 69.234 -5.143  1.00 15.72 ? 438  LEU A CA    1 
ATOM   3202 C  C     . LEU A 1 438 ? 30.002 70.043 -4.540  1.00 15.08 ? 438  LEU A C     1 
ATOM   3203 O  O     . LEU A 1 438 ? 29.184 70.618 -5.259  1.00 14.49 ? 438  LEU A O     1 
ATOM   3204 C  CB    . LEU A 1 438 ? 32.156 70.168 -5.817  1.00 18.86 ? 438  LEU A CB    1 
ATOM   3205 C  CG    . LEU A 1 438 ? 33.587 69.655 -6.015  1.00 21.95 ? 438  LEU A CG    1 
ATOM   3206 C  CD1   . LEU A 1 438 ? 34.507 70.856 -6.182  1.00 23.96 ? 438  LEU A CD1   1 
ATOM   3207 C  CD2   . LEU A 1 438 ? 34.043 68.788 -4.822  1.00 22.53 ? 438  LEU A CD2   1 
ATOM   3208 N  N     . GLY A 1 439 ? 29.921 70.026 -3.214  1.00 13.60 ? 439  GLY A N     1 
ATOM   3209 C  CA    . GLY A 1 439 ? 28.995 70.894 -2.510  1.00 13.14 ? 439  GLY A CA    1 
ATOM   3210 C  C     . GLY A 1 439 ? 27.671 70.225 -2.203  1.00 12.62 ? 439  GLY A C     1 
ATOM   3211 O  O     . GLY A 1 439 ? 26.824 70.805 -1.517  1.00 13.23 ? 439  GLY A O     1 
ATOM   3212 N  N     . CYS A 1 440 ? 27.488 69.008 -2.708  1.00 12.07 ? 440  CYS A N     1 
ATOM   3213 C  CA    . CYS A 1 440 ? 26.199 68.333 -2.647  1.00 13.58 ? 440  CYS A CA    1 
ATOM   3214 C  C     . CYS A 1 440 ? 25.851 67.904 -1.227  1.00 14.10 ? 440  CYS A C     1 
ATOM   3215 O  O     . CYS A 1 440 ? 24.703 67.613 -0.933  1.00 14.78 ? 440  CYS A O     1 
ATOM   3216 C  CB    . CYS A 1 440 ? 26.188 67.115 -3.566  1.00 14.10 ? 440  CYS A CB    1 
ATOM   3217 S  SG    . CYS A 1 440 ? 25.976 67.516 -5.323  1.00 17.69 ? 440  CYS A SG    1 
ATOM   3218 N  N     . ASP A 1 441 ? 26.850 67.863 -0.353  1.00 13.14 ? 441  ASP A N     1 
ATOM   3219 C  CA    . ASP A 1 441 ? 26.638 67.622 1.067   1.00 13.46 ? 441  ASP A CA    1 
ATOM   3220 C  C     . ASP A 1 441 ? 25.881 68.723 1.822   1.00 14.23 ? 441  ASP A C     1 
ATOM   3221 O  O     . ASP A 1 441 ? 25.066 68.415 2.684   1.00 15.07 ? 441  ASP A O     1 
ATOM   3222 C  CB    . ASP A 1 441 ? 27.970 67.316 1.761   1.00 12.76 ? 441  ASP A CB    1 
ATOM   3223 C  CG    . ASP A 1 441 ? 29.011 68.417 1.572   1.00 13.02 ? 441  ASP A CG    1 
ATOM   3224 O  OD1   . ASP A 1 441 ? 29.187 68.910 0.440   1.00 13.90 ? 441  ASP A OD1   1 
ATOM   3225 O  OD2   . ASP A 1 441 ? 29.676 68.765 2.562   1.00 11.30 ? 441  ASP A OD2   1 
ATOM   3226 N  N     . GLU A 1 442 ? 26.137 69.988 1.495   1.00 13.47 ? 442  GLU A N     1 
ATOM   3227 C  CA    . GLU A 1 442 ? 25.365 71.114 2.049   1.00 14.49 ? 442  GLU A CA    1 
ATOM   3228 C  C     . GLU A 1 442 ? 24.150 71.522 1.202   1.00 14.56 ? 442  GLU A C     1 
ATOM   3229 O  O     . GLU A 1 442 ? 23.313 72.318 1.630   1.00 15.09 ? 442  GLU A O     1 
ATOM   3230 C  CB    . GLU A 1 442 ? 26.279 72.322 2.250   1.00 14.21 ? 442  GLU A CB    1 
ATOM   3231 C  CG    . GLU A 1 442 ? 27.446 72.049 3.183   1.00 12.24 ? 442  GLU A CG    1 
ATOM   3232 C  CD    . GLU A 1 442 ? 27.027 71.854 4.635   1.00 14.56 ? 442  GLU A CD    1 
ATOM   3233 O  OE1   . GLU A 1 442 ? 25.838 72.057 4.971   1.00 14.66 ? 442  GLU A OE1   1 
ATOM   3234 O  OE2   . GLU A 1 442 ? 27.892 71.500 5.462   1.00 15.99 ? 442  GLU A OE2   1 
ATOM   3235 N  N     . MET A 1 443 ? 24.063 70.953 0.005   1.00 15.33 ? 443  MET A N     1 
ATOM   3236 C  CA    . MET A 1 443 ? 22.988 71.228 -0.933  1.00 15.76 ? 443  MET A CA    1 
ATOM   3237 C  C     . MET A 1 443 ? 21.654 70.604 -0.524  1.00 16.64 ? 443  MET A C     1 
ATOM   3238 O  O     . MET A 1 443 ? 20.597 71.158 -0.802  1.00 17.14 ? 443  MET A O     1 
ATOM   3239 C  CB    . MET A 1 443 ? 23.389 70.714 -2.312  1.00 17.28 ? 443  MET A CB    1 
ATOM   3240 C  CG    . MET A 1 443 ? 22.977 71.598 -3.452  1.00 17.75 ? 443  MET A CG    1 
ATOM   3241 S  SD    . MET A 1 443 ? 23.625 70.965 -5.004  1.00 20.49 ? 443  MET A SD    1 
ATOM   3242 C  CE    . MET A 1 443 ? 25.299 71.618 -4.983  1.00 12.25 ? 443  MET A CE    1 
ATOM   3243 N  N     . LEU A 1 444 ? 21.701 69.432 0.099   1.00 16.37 ? 444  LEU A N     1 
ATOM   3244 C  CA    . LEU A 1 444 ? 20.557 68.536 0.082   1.00 14.96 ? 444  LEU A CA    1 
ATOM   3245 C  C     . LEU A 1 444 ? 19.454 68.989 1.037   1.00 15.15 ? 444  LEU A C     1 
ATOM   3246 O  O     . LEU A 1 444 ? 18.278 68.906 0.693   1.00 16.25 ? 444  LEU A O     1 
ATOM   3247 C  CB    . LEU A 1 444 ? 20.975 67.096 0.387   1.00 15.28 ? 444  LEU A CB    1 
ATOM   3248 C  CG    . LEU A 1 444 ? 19.870 66.040 0.230   1.00 14.18 ? 444  LEU A CG    1 
ATOM   3249 C  CD1   . LEU A 1 444 ? 19.436 65.937 -1.214  1.00 14.70 ? 444  LEU A CD1   1 
ATOM   3250 C  CD2   . LEU A 1 444 ? 20.345 64.692 0.717   1.00 15.42 ? 444  LEU A CD2   1 
ATOM   3251 N  N     . GLN A 1 445 ? 19.818 69.485 2.220   1.00 14.87 ? 445  GLN A N     1 
ATOM   3252 C  CA    . GLN A 1 445 ? 18.837 69.698 3.287   1.00 14.25 ? 445  GLN A CA    1 
ATOM   3253 C  C     . GLN A 1 445 ? 17.654 70.553 2.842   1.00 14.28 ? 445  GLN A C     1 
ATOM   3254 O  O     . GLN A 1 445 ? 16.508 70.192 3.085   1.00 17.04 ? 445  GLN A O     1 
ATOM   3255 C  CB    . GLN A 1 445 ? 19.481 70.326 4.517   1.00 12.76 ? 445  GLN A CB    1 
ATOM   3256 C  CG    . GLN A 1 445 ? 18.545 70.392 5.720   1.00 12.68 ? 445  GLN A CG    1 
ATOM   3257 C  CD    . GLN A 1 445 ? 18.384 69.046 6.411   1.00 13.63 ? 445  GLN A CD    1 
ATOM   3258 O  OE1   . GLN A 1 445 ? 19.273 68.604 7.133   1.00 14.88 ? 445  GLN A OE1   1 
ATOM   3259 N  NE2   . GLN A 1 445 ? 17.252 68.388 6.187   1.00 11.67 ? 445  GLN A NE2   1 
ATOM   3260 N  N     . GLY A 1 446 ? 17.932 71.658 2.161   1.00 13.76 ? 446  GLY A N     1 
ATOM   3261 C  CA    . GLY A 1 446 ? 16.876 72.533 1.697   1.00 12.07 ? 446  GLY A CA    1 
ATOM   3262 C  C     . GLY A 1 446 ? 15.934 71.855 0.726   1.00 13.42 ? 446  GLY A C     1 
ATOM   3263 O  O     . GLY A 1 446 ? 14.718 72.019 0.805   1.00 13.37 ? 446  GLY A O     1 
ATOM   3264 N  N     . PHE A 1 447 ? 16.498 71.062 -0.177  1.00 14.42 ? 447  PHE A N     1 
ATOM   3265 C  CA    . PHE A 1 447 ? 15.707 70.390 -1.194  1.00 15.28 ? 447  PHE A CA    1 
ATOM   3266 C  C     . PHE A 1 447 ? 14.839 69.290 -0.573  1.00 17.11 ? 447  PHE A C     1 
ATOM   3267 O  O     . PHE A 1 447 ? 13.743 69.011 -1.048  1.00 17.71 ? 447  PHE A O     1 
ATOM   3268 C  CB    . PHE A 1 447 ? 16.624 69.815 -2.284  1.00 16.50 ? 447  PHE A CB    1 
ATOM   3269 C  CG    . PHE A 1 447 ? 17.187 70.859 -3.223  1.00 16.33 ? 447  PHE A CG    1 
ATOM   3270 C  CD1   . PHE A 1 447 ? 16.339 71.633 -4.022  1.00 15.88 ? 447  PHE A CD1   1 
ATOM   3271 C  CD2   . PHE A 1 447 ? 18.556 71.084 -3.298  1.00 16.59 ? 447  PHE A CD2   1 
ATOM   3272 C  CE1   . PHE A 1 447 ? 16.850 72.614 -4.877  1.00 15.95 ? 447  PHE A CE1   1 
ATOM   3273 C  CE2   . PHE A 1 447 ? 19.075 72.063 -4.151  1.00 16.47 ? 447  PHE A CE2   1 
ATOM   3274 C  CZ    . PHE A 1 447 ? 18.218 72.827 -4.940  1.00 16.87 ? 447  PHE A CZ    1 
ATOM   3275 N  N     . ALA A 1 448 ? 15.315 68.700 0.516   1.00 15.95 ? 448  ALA A N     1 
ATOM   3276 C  CA    . ALA A 1 448 ? 14.586 67.643 1.192   1.00 15.68 ? 448  ALA A CA    1 
ATOM   3277 C  C     . ALA A 1 448 ? 13.406 68.196 1.983   1.00 16.20 ? 448  ALA A C     1 
ATOM   3278 O  O     . ALA A 1 448 ? 12.383 67.526 2.128   1.00 16.69 ? 448  ALA A O     1 
ATOM   3279 C  CB    . ALA A 1 448 ? 15.517 66.876 2.108   1.00 15.46 ? 448  ALA A CB    1 
ATOM   3280 N  N     . VAL A 1 449 ? 13.556 69.417 2.490   1.00 16.35 ? 449  VAL A N     1 
ATOM   3281 C  CA    . VAL A 1 449 ? 12.426 70.206 2.990   1.00 17.34 ? 449  VAL A CA    1 
ATOM   3282 C  C     . VAL A 1 449 ? 11.312 70.366 1.948   1.00 18.57 ? 449  VAL A C     1 
ATOM   3283 O  O     . VAL A 1 449 ? 10.157 70.065 2.221   1.00 19.21 ? 449  VAL A O     1 
ATOM   3284 C  CB    . VAL A 1 449 ? 12.878 71.614 3.453   1.00 16.55 ? 449  VAL A CB    1 
ATOM   3285 C  CG1   . VAL A 1 449 ? 11.666 72.479 3.792   1.00 17.09 ? 449  VAL A CG1   1 
ATOM   3286 C  CG2   . VAL A 1 449 ? 13.816 71.503 4.660   1.00 16.98 ? 449  VAL A CG2   1 
ATOM   3287 N  N     . ALA A 1 450 ? 11.676 70.847 0.762   1.00 19.25 ? 450  ALA A N     1 
ATOM   3288 C  CA    . ALA A 1 450 ? 10.761 70.946 -0.371  1.00 19.34 ? 450  ALA A CA    1 
ATOM   3289 C  C     . ALA A 1 450 ? 10.086 69.626 -0.718  1.00 19.17 ? 450  ALA A C     1 
ATOM   3290 O  O     . ALA A 1 450 ? 8.889  69.590 -0.989  1.00 19.50 ? 450  ALA A O     1 
ATOM   3291 C  CB    . ALA A 1 450 ? 11.494 71.488 -1.582  1.00 19.39 ? 450  ALA A CB    1 
ATOM   3292 N  N     . VAL A 1 451 ? 10.853 68.543 -0.708  1.00 19.29 ? 451  VAL A N     1 
ATOM   3293 C  CA    . VAL A 1 451 ? 10.337 67.247 -1.110  1.00 19.66 ? 451  VAL A CA    1 
ATOM   3294 C  C     . VAL A 1 451 ? 9.339  66.711 -0.073  1.00 22.16 ? 451  VAL A C     1 
ATOM   3295 O  O     . VAL A 1 451 ? 8.331  66.100 -0.446  1.00 22.98 ? 451  VAL A O     1 
ATOM   3296 C  CB    . VAL A 1 451 ? 11.484 66.240 -1.351  1.00 19.62 ? 451  VAL A CB    1 
ATOM   3297 C  CG1   . VAL A 1 451 ? 10.957 64.802 -1.340  1.00 20.63 ? 451  VAL A CG1   1 
ATOM   3298 C  CG2   . VAL A 1 451 ? 12.163 66.537 -2.679  1.00 18.64 ? 451  VAL A CG2   1 
ATOM   3299 N  N     . LYS A 1 452 ? 9.594  66.983 1.211   1.00 21.48 ? 452  LYS A N     1 
ATOM   3300 C  CA    . LYS A 1 452 ? 8.660  66.619 2.279   1.00 22.33 ? 452  LYS A CA    1 
ATOM   3301 C  C     . LYS A 1 452 ? 7.353  67.398 2.218   1.00 23.01 ? 452  LYS A C     1 
ATOM   3302 O  O     . LYS A 1 452 ? 6.337  66.965 2.769   1.00 24.56 ? 452  LYS A O     1 
ATOM   3303 C  CB    . LYS A 1 452 ? 9.293  66.832 3.654   1.00 22.89 ? 452  LYS A CB    1 
ATOM   3304 C  CG    . LYS A 1 452 ? 9.200  65.608 4.559   1.00 25.24 ? 452  LYS A CG    1 
ATOM   3305 C  CD    . LYS A 1 452 ? 8.247  65.818 5.732   1.00 27.48 ? 452  LYS A CD    1 
ATOM   3306 C  CE    . LYS A 1 452 ? 8.167  64.568 6.620   1.00 28.21 ? 452  LYS A CE    1 
ATOM   3307 N  NZ    . LYS A 1 452 ? 8.410  63.305 5.853   1.00 29.30 ? 452  LYS A NZ    1 
ATOM   3308 N  N     . MET A 1 453 ? 7.386  68.562 1.576   1.00 22.41 ? 453  MET A N     1 
ATOM   3309 C  CA    . MET A 1 453 ? 6.176  69.357 1.359   1.00 22.59 ? 453  MET A CA    1 
ATOM   3310 C  C     . MET A 1 453 ? 5.343  68.929 0.156   1.00 22.03 ? 453  MET A C     1 
ATOM   3311 O  O     . MET A 1 453 ? 4.307  69.525 -0.110  1.00 23.16 ? 453  MET A O     1 
ATOM   3312 C  CB    . MET A 1 453 ? 6.539  70.833 1.234   1.00 21.40 ? 453  MET A CB    1 
ATOM   3313 C  CG    . MET A 1 453 ? 7.226  71.360 2.467   1.00 23.13 ? 453  MET A CG    1 
ATOM   3314 S  SD    . MET A 1 453 ? 7.654  73.082 2.324   1.00 24.80 ? 453  MET A SD    1 
ATOM   3315 C  CE    . MET A 1 453 ? 5.969  73.816 2.118   1.00 26.21 ? 453  MET A CE    1 
ATOM   3316 N  N     . GLY A 1 454 ? 5.795  67.903 -0.565  1.00 22.21 ? 454  GLY A N     1 
ATOM   3317 C  CA    . GLY A 1 454 ? 5.197  67.553 -1.844  1.00 20.48 ? 454  GLY A CA    1 
ATOM   3318 C  C     . GLY A 1 454 ? 5.431  68.551 -2.967  1.00 21.01 ? 454  GLY A C     1 
ATOM   3319 O  O     . GLY A 1 454 ? 4.509  68.849 -3.731  1.00 21.84 ? 454  GLY A O     1 
ATOM   3320 N  N     . ALA A 1 455 ? 6.649  69.078 -3.074  1.00 19.79 ? 455  ALA A N     1 
ATOM   3321 C  CA    . ALA A 1 455 ? 6.972  70.038 -4.125  1.00 18.92 ? 455  ALA A CA    1 
ATOM   3322 C  C     . ALA A 1 455 ? 6.850  69.371 -5.490  1.00 19.96 ? 455  ALA A C     1 
ATOM   3323 O  O     . ALA A 1 455 ? 7.125  68.172 -5.644  1.00 20.81 ? 455  ALA A O     1 
ATOM   3324 C  CB    . ALA A 1 455 ? 8.381  70.598 -3.929  1.00 19.06 ? 455  ALA A CB    1 
ATOM   3325 N  N     . THR A 1 456 ? 6.380  70.135 -6.466  1.00 19.88 ? 456  THR A N     1 
ATOM   3326 C  CA    . THR A 1 456 ? 6.275  69.644 -7.836  1.00 20.35 ? 456  THR A CA    1 
ATOM   3327 C  C     . THR A 1 456 ? 7.354  70.339 -8.640  1.00 20.12 ? 456  THR A C     1 
ATOM   3328 O  O     . THR A 1 456 ? 7.946  71.305 -8.164  1.00 19.83 ? 456  THR A O     1 
ATOM   3329 C  CB    . THR A 1 456 ? 4.890  69.976 -8.458  1.00 21.89 ? 456  THR A CB    1 
ATOM   3330 O  OG1   . THR A 1 456 ? 4.701  71.399 -8.484  1.00 24.17 ? 456  THR A OG1   1 
ATOM   3331 C  CG2   . THR A 1 456 ? 3.767  69.323 -7.654  1.00 21.21 ? 456  THR A CG2   1 
ATOM   3332 N  N     . LYS A 1 457 ? 7.617  69.869 -9.854  1.00 20.00 ? 457  LYS A N     1 
ATOM   3333 C  CA    . LYS A 1 457 ? 8.700  70.466 -10.617 1.00 20.93 ? 457  LYS A CA    1 
ATOM   3334 C  C     . LYS A 1 457 ? 8.449  71.935 -10.891 1.00 22.26 ? 457  LYS A C     1 
ATOM   3335 O  O     . LYS A 1 457 ? 9.392  72.719 -10.942 1.00 22.46 ? 457  LYS A O     1 
ATOM   3336 C  CB    . LYS A 1 457 ? 8.961  69.739 -11.928 1.00 20.44 ? 457  LYS A CB    1 
ATOM   3337 C  CG    . LYS A 1 457 ? 10.336 70.085 -12.483 1.00 19.80 ? 457  LYS A CG    1 
ATOM   3338 C  CD    . LYS A 1 457 ? 10.487 69.673 -13.921 1.00 21.06 ? 457  LYS A CD    1 
ATOM   3339 C  CE    . LYS A 1 457 ? 11.892 69.948 -14.409 1.00 20.81 ? 457  LYS A CE    1 
ATOM   3340 N  NZ    . LYS A 1 457 ? 12.046 71.359 -14.808 1.00 22.83 ? 457  LYS A NZ    1 
ATOM   3341 N  N     . ALA A 1 458 ? 7.175  72.312 -11.025 1.00 22.94 ? 458  ALA A N     1 
ATOM   3342 C  CA    . ALA A 1 458 ? 6.799  73.714 -11.188 1.00 22.52 ? 458  ALA A CA    1 
ATOM   3343 C  C     . ALA A 1 458 ? 7.340  74.577 -10.040 1.00 23.10 ? 458  ALA A C     1 
ATOM   3344 O  O     . ALA A 1 458 ? 7.949  75.626 -10.275 1.00 23.82 ? 458  ALA A O     1 
ATOM   3345 C  CB    . ALA A 1 458 ? 5.280  73.848 -11.294 1.00 22.57 ? 458  ALA A CB    1 
ATOM   3346 N  N     . ASP A 1 459 ? 7.168  74.110 -8.807  1.00 21.78 ? 459  ASP A N     1 
ATOM   3347 C  CA    . ASP A 1 459 ? 7.703  74.813 -7.649  1.00 22.03 ? 459  ASP A CA    1 
ATOM   3348 C  C     . ASP A 1 459 ? 9.206  75.045 -7.765  1.00 21.66 ? 459  ASP A C     1 
ATOM   3349 O  O     . ASP A 1 459 ? 9.701  76.118 -7.423  1.00 21.44 ? 459  ASP A O     1 
ATOM   3350 C  CB    . ASP A 1 459 ? 7.384  74.050 -6.363  1.00 21.67 ? 459  ASP A CB    1 
ATOM   3351 C  CG    . ASP A 1 459 ? 5.897  74.019 -6.062  1.00 24.72 ? 459  ASP A CG    1 
ATOM   3352 O  OD1   . ASP A 1 459 ? 5.266  75.106 -6.065  1.00 24.61 ? 459  ASP A OD1   1 
ATOM   3353 O  OD2   . ASP A 1 459 ? 5.354  72.909 -5.835  1.00 26.06 ? 459  ASP A OD2   1 
ATOM   3354 N  N     . PHE A 1 460 ? 9.923  74.053 -8.287  1.00 21.41 ? 460  PHE A N     1 
ATOM   3355 C  CA    . PHE A 1 460 ? 11.360 74.185 -8.504  1.00 20.92 ? 460  PHE A CA    1 
ATOM   3356 C  C     . PHE A 1 460 ? 11.642 75.216 -9.583  1.00 21.34 ? 460  PHE A C     1 
ATOM   3357 O  O     . PHE A 1 460 ? 12.482 76.097 -9.419  1.00 21.48 ? 460  PHE A O     1 
ATOM   3358 C  CB    . PHE A 1 460 ? 11.970 72.842 -8.900  1.00 20.02 ? 460  PHE A CB    1 
ATOM   3359 C  CG    . PHE A 1 460 ? 12.329 71.963 -7.730  1.00 20.87 ? 460  PHE A CG    1 
ATOM   3360 C  CD1   . PHE A 1 460 ? 11.341 71.459 -6.888  1.00 20.75 ? 460  PHE A CD1   1 
ATOM   3361 C  CD2   . PHE A 1 460 ? 13.657 71.622 -7.476  1.00 20.38 ? 460  PHE A CD2   1 
ATOM   3362 C  CE1   . PHE A 1 460 ? 11.671 70.626 -5.813  1.00 22.11 ? 460  PHE A CE1   1 
ATOM   3363 C  CE2   . PHE A 1 460 ? 13.987 70.793 -6.406  1.00 20.65 ? 460  PHE A CE2   1 
ATOM   3364 C  CZ    . PHE A 1 460 ? 12.992 70.295 -5.575  1.00 18.92 ? 460  PHE A CZ    1 
ATOM   3365 N  N     . ASP A 1 461 ? 10.910 75.112 -10.684 1.00 23.17 ? 461  ASP A N     1 
ATOM   3366 C  CA    . ASP A 1 461 ? 11.173 75.922 -11.868 1.00 25.04 ? 461  ASP A CA    1 
ATOM   3367 C  C     . ASP A 1 461 ? 10.889 77.400 -11.631 1.00 24.87 ? 461  ASP A C     1 
ATOM   3368 O  O     . ASP A 1 461 ? 11.457 78.251 -12.307 1.00 23.54 ? 461  ASP A O     1 
ATOM   3369 C  CB    . ASP A 1 461 ? 10.348 75.417 -13.054 1.00 27.20 ? 461  ASP A CB    1 
ATOM   3370 C  CG    . ASP A 1 461 ? 10.919 74.143 -13.665 1.00 29.49 ? 461  ASP A CG    1 
ATOM   3371 O  OD1   . ASP A 1 461 ? 12.006 73.682 -13.225 1.00 31.12 ? 461  ASP A OD1   1 
ATOM   3372 O  OD2   . ASP A 1 461 ? 10.275 73.596 -14.593 1.00 31.20 ? 461  ASP A OD2   1 
ATOM   3373 N  N     . ASN A 1 462 ? 10.034 77.701 -10.654 1.00 25.28 ? 462  ASN A N     1 
ATOM   3374 C  CA    . ASN A 1 462 ? 9.642  79.087 -10.371 1.00 26.46 ? 462  ASN A CA    1 
ATOM   3375 C  C     . ASN A 1 462 ? 10.365 79.676 -9.173  1.00 24.45 ? 462  ASN A C     1 
ATOM   3376 O  O     . ASN A 1 462 ? 10.046 80.780 -8.711  1.00 24.48 ? 462  ASN A O     1 
ATOM   3377 C  CB    . ASN A 1 462 ? 8.129  79.186 -10.170 1.00 29.14 ? 462  ASN A CB    1 
ATOM   3378 C  CG    . ASN A 1 462 ? 7.384  79.094 -11.480 1.00 32.45 ? 462  ASN A CG    1 
ATOM   3379 O  OD1   . ASN A 1 462 ? 7.360  80.057 -12.270 1.00 33.28 ? 462  ASN A OD1   1 
ATOM   3380 N  ND2   . ASN A 1 462 ? 6.845  77.909 -11.768 1.00 32.54 ? 462  ASN A ND2   1 
ATOM   3381 N  N     . THR A 1 463 ? 11.363 78.947 -8.691  1.00 22.50 ? 463  THR A N     1 
ATOM   3382 C  CA    . THR A 1 463 ? 12.369 79.541 -7.832  1.00 19.59 ? 463  THR A CA    1 
ATOM   3383 C  C     . THR A 1 463 ? 13.529 80.098 -8.667  1.00 18.64 ? 463  THR A C     1 
ATOM   3384 O  O     . THR A 1 463 ? 14.127 79.391 -9.479  1.00 17.83 ? 463  THR A O     1 
ATOM   3385 C  CB    . THR A 1 463 ? 12.862 78.518 -6.798  1.00 17.99 ? 463  THR A CB    1 
ATOM   3386 O  OG1   . THR A 1 463 ? 11.728 77.872 -6.207  1.00 18.63 ? 463  THR A OG1   1 
ATOM   3387 C  CG2   . THR A 1 463 ? 13.670 79.202 -5.714  1.00 16.04 ? 463  THR A CG2   1 
ATOM   3388 N  N     . VAL A 1 464 ? 13.827 81.378 -8.466  1.00 16.82 ? 464  VAL A N     1 
ATOM   3389 C  CA    . VAL A 1 464 ? 14.946 82.018 -9.136  1.00 15.21 ? 464  VAL A CA    1 
ATOM   3390 C  C     . VAL A 1 464 ? 16.279 81.385 -8.749  1.00 15.16 ? 464  VAL A C     1 
ATOM   3391 O  O     . VAL A 1 464 ? 16.499 81.031 -7.594  1.00 15.12 ? 464  VAL A O     1 
ATOM   3392 C  CB    . VAL A 1 464 ? 14.962 83.539 -8.868  1.00 13.54 ? 464  VAL A CB    1 
ATOM   3393 C  CG1   . VAL A 1 464 ? 16.216 84.183 -9.457  1.00 11.60 ? 464  VAL A CG1   1 
ATOM   3394 C  CG2   . VAL A 1 464 ? 13.717 84.174 -9.475  1.00 13.43 ? 464  VAL A CG2   1 
ATOM   3395 N  N     . ALA A 1 465 ? 17.141 81.218 -9.746  1.00 15.34 ? 465  ALA A N     1 
ATOM   3396 C  CA    . ALA A 1 465 ? 18.410 80.513 -9.603  1.00 15.87 ? 465  ALA A CA    1 
ATOM   3397 C  C     . ALA A 1 465 ? 19.430 81.380 -8.858  1.00 16.76 ? 465  ALA A C     1 
ATOM   3398 O  O     . ALA A 1 465 ? 19.345 82.612 -8.882  1.00 17.32 ? 465  ALA A O     1 
ATOM   3399 C  CB    . ALA A 1 465 ? 18.946 80.130 -10.988 1.00 14.12 ? 465  ALA A CB    1 
ATOM   3400 N  N     . ILE A 1 466 ? 20.380 80.732 -8.189  1.00 16.20 ? 466  ILE A N     1 
ATOM   3401 C  CA    . ILE A 1 466 ? 21.536 81.423 -7.632  1.00 16.53 ? 466  ILE A CA    1 
ATOM   3402 C  C     . ILE A 1 466 ? 22.762 81.144 -8.482  1.00 15.73 ? 466  ILE A C     1 
ATOM   3403 O  O     . ILE A 1 466 ? 23.182 79.999 -8.642  1.00 17.23 ? 466  ILE A O     1 
ATOM   3404 C  CB    . ILE A 1 466 ? 21.835 80.997 -6.177  1.00 17.53 ? 466  ILE A CB    1 
ATOM   3405 C  CG1   . ILE A 1 466 ? 20.632 81.291 -5.284  1.00 17.64 ? 466  ILE A CG1   1 
ATOM   3406 C  CG2   . ILE A 1 466 ? 23.049 81.739 -5.641  1.00 16.63 ? 466  ILE A CG2   1 
ATOM   3407 C  CD1   . ILE A 1 466 ? 20.556 80.387 -4.060  1.00 18.42 ? 466  ILE A CD1   1 
ATOM   3408 N  N     . HIS A 1 467 ? 23.322 82.208 -9.028  1.00 14.72 ? 467  HIS A N     1 
ATOM   3409 C  CA    . HIS A 1 467 ? 24.405 82.104 -9.978  1.00 15.31 ? 467  HIS A CA    1 
ATOM   3410 C  C     . HIS A 1 467 ? 25.611 82.826 -9.370  1.00 15.37 ? 467  HIS A C     1 
ATOM   3411 O  O     . HIS A 1 467 ? 25.449 83.786 -8.608  1.00 16.63 ? 467  HIS A O     1 
ATOM   3412 C  CB    . HIS A 1 467 ? 23.967 82.735 -11.306 1.00 14.56 ? 467  HIS A CB    1 
ATOM   3413 C  CG    . HIS A 1 467 ? 24.956 82.581 -12.419 1.00 16.70 ? 467  HIS A CG    1 
ATOM   3414 N  ND1   . HIS A 1 467 ? 25.262 81.363 -12.989 1.00 16.33 ? 467  HIS A ND1   1 
ATOM   3415 C  CD2   . HIS A 1 467 ? 25.701 83.501 -13.079 1.00 16.48 ? 467  HIS A CD2   1 
ATOM   3416 C  CE1   . HIS A 1 467 ? 26.152 81.539 -13.950 1.00 17.58 ? 467  HIS A CE1   1 
ATOM   3417 N  NE2   . HIS A 1 467 ? 26.434 82.828 -14.026 1.00 17.07 ? 467  HIS A NE2   1 
ATOM   3418 N  N     . PRO A 1 468 ? 26.835 82.352 -9.668  1.00 15.54 ? 468  PRO A N     1 
ATOM   3419 C  CA    . PRO A 1 468 ? 27.117 80.995 -10.159 1.00 14.86 ? 468  PRO A CA    1 
ATOM   3420 C  C     . PRO A 1 468 ? 27.288 79.977 -9.034  1.00 15.18 ? 468  PRO A C     1 
ATOM   3421 O  O     . PRO A 1 468 ? 28.170 80.115 -8.187  1.00 14.55 ? 468  PRO A O     1 
ATOM   3422 C  CB    . PRO A 1 468 ? 28.410 81.165 -10.954 1.00 13.63 ? 468  PRO A CB    1 
ATOM   3423 C  CG    . PRO A 1 468 ? 29.049 82.428 -10.416 1.00 12.86 ? 468  PRO A CG    1 
ATOM   3424 C  CD    . PRO A 1 468 ? 28.071 83.142 -9.518  1.00 14.99 ? 468  PRO A CD    1 
ATOM   3425 N  N     . THR A 1 469 ? 26.411 78.980 -9.002  1.00 15.03 ? 469  THR A N     1 
ATOM   3426 C  CA    . THR A 1 469 ? 26.590 77.831 -8.117  1.00 15.46 ? 469  THR A CA    1 
ATOM   3427 C  C     . THR A 1 469 ? 26.336 76.537 -8.901  1.00 15.33 ? 469  THR A C     1 
ATOM   3428 O  O     . THR A 1 469 ? 25.812 76.578 -10.017 1.00 14.47 ? 469  THR A O     1 
ATOM   3429 C  CB    . THR A 1 469 ? 25.632 77.898 -6.883  1.00 15.61 ? 469  THR A CB    1 
ATOM   3430 O  OG1   . THR A 1 469 ? 24.265 77.829 -7.319  1.00 13.38 ? 469  THR A OG1   1 
ATOM   3431 C  CG2   . THR A 1 469 ? 25.862 79.177 -6.078  1.00 14.45 ? 469  THR A CG2   1 
ATOM   3432 N  N     . SER A 1 470 ? 26.718 75.399 -8.321  1.00 14.81 ? 470  SER A N     1 
ATOM   3433 C  CA    . SER A 1 470 ? 26.223 74.096 -8.762  1.00 14.57 ? 470  SER A CA    1 
ATOM   3434 C  C     . SER A 1 470 ? 24.734 73.921 -8.506  1.00 14.83 ? 470  SER A C     1 
ATOM   3435 O  O     . SER A 1 470 ? 24.029 73.331 -9.320  1.00 15.46 ? 470  SER A O     1 
ATOM   3436 C  CB    . SER A 1 470 ? 26.997 72.968 -8.089  1.00 14.59 ? 470  SER A CB    1 
ATOM   3437 O  OG    . SER A 1 470 ? 28.297 72.855 -8.633  1.00 14.72 ? 470  SER A OG    1 
ATOM   3438 N  N     . SER A 1 471 ? 24.253 74.460 -7.390  1.00 14.85 ? 471  SER A N     1 
ATOM   3439 C  CA    . SER A 1 471 ? 22.910 74.145 -6.909  1.00 15.06 ? 471  SER A CA    1 
ATOM   3440 C  C     . SER A 1 471 ? 21.802 74.659 -7.835  1.00 15.22 ? 471  SER A C     1 
ATOM   3441 O  O     . SER A 1 471 ? 20.721 74.062 -7.911  1.00 15.65 ? 471  SER A O     1 
ATOM   3442 C  CB    . SER A 1 471 ? 22.707 74.669 -5.480  1.00 12.82 ? 471  SER A CB    1 
ATOM   3443 O  OG    . SER A 1 471 ? 22.762 76.077 -5.431  1.00 13.93 ? 471  SER A OG    1 
ATOM   3444 N  N     . GLU A 1 472 ? 22.092 75.737 -8.561  1.00 14.90 ? 472  GLU A N     1 
ATOM   3445 C  CA    . GLU A 1 472 ? 21.124 76.360 -9.471  1.00 17.50 ? 472  GLU A CA    1 
ATOM   3446 C  C     . GLU A 1 472 ? 20.689 75.450 -10.631 1.00 17.69 ? 472  GLU A C     1 
ATOM   3447 O  O     . GLU A 1 472 ? 19.667 75.697 -11.261 1.00 18.52 ? 472  GLU A O     1 
ATOM   3448 C  CB    . GLU A 1 472 ? 21.683 77.664 -10.038 1.00 15.58 ? 472  GLU A CB    1 
ATOM   3449 C  CG    . GLU A 1 472 ? 22.857 77.455 -10.977 1.00 18.43 ? 472  GLU A CG    1 
ATOM   3450 C  CD    . GLU A 1 472 ? 23.313 78.728 -11.667 1.00 21.57 ? 472  GLU A CD    1 
ATOM   3451 O  OE1   . GLU A 1 472 ? 22.457 79.497 -12.156 1.00 23.56 ? 472  GLU A OE1   1 
ATOM   3452 O  OE2   . GLU A 1 472 ? 24.537 78.962 -11.739 1.00 22.74 ? 472  GLU A OE2   1 
ATOM   3453 N  N     . GLU A 1 473 ? 21.462 74.402 -10.906 1.00 18.59 ? 473  GLU A N     1 
ATOM   3454 C  CA    . GLU A 1 473 ? 21.116 73.444 -11.956 1.00 20.04 ? 473  GLU A CA    1 
ATOM   3455 C  C     . GLU A 1 473 ? 19.858 72.627 -11.645 1.00 19.93 ? 473  GLU A C     1 
ATOM   3456 O  O     . GLU A 1 473 ? 19.167 72.190 -12.561 1.00 20.82 ? 473  GLU A O     1 
ATOM   3457 C  CB    . GLU A 1 473 ? 22.291 72.490 -12.224 1.00 21.30 ? 473  GLU A CB    1 
ATOM   3458 C  CG    . GLU A 1 473 ? 23.576 73.173 -12.682 1.00 24.07 ? 473  GLU A CG    1 
ATOM   3459 C  CD    . GLU A 1 473 ? 23.418 73.931 -13.996 1.00 27.42 ? 473  GLU A CD    1 
ATOM   3460 O  OE1   . GLU A 1 473 ? 22.692 73.460 -14.904 1.00 27.79 ? 473  GLU A OE1   1 
ATOM   3461 O  OE2   . GLU A 1 473 ? 24.034 75.010 -14.121 1.00 29.44 ? 473  GLU A OE2   1 
ATOM   3462 N  N     . LEU A 1 474 ? 19.557 72.429 -10.359 1.00 19.89 ? 474  LEU A N     1 
ATOM   3463 C  CA    . LEU A 1 474 ? 18.382 71.652 -9.958  1.00 21.28 ? 474  LEU A CA    1 
ATOM   3464 C  C     . LEU A 1 474 ? 17.086 72.427 -10.174 1.00 21.97 ? 474  LEU A C     1 
ATOM   3465 O  O     . LEU A 1 474 ? 15.998 71.843 -10.151 1.00 24.54 ? 474  LEU A O     1 
ATOM   3466 C  CB    . LEU A 1 474 ? 18.480 71.227 -8.486  1.00 22.23 ? 474  LEU A CB    1 
ATOM   3467 C  CG    . LEU A 1 474 ? 18.930 69.795 -8.167  1.00 24.17 ? 474  LEU A CG    1 
ATOM   3468 C  CD1   . LEU A 1 474 ? 18.932 69.560 -6.668  1.00 22.02 ? 474  LEU A CD1   1 
ATOM   3469 C  CD2   . LEU A 1 474 ? 18.015 68.788 -8.844  1.00 24.96 ? 474  LEU A CD2   1 
ATOM   3470 N  N     . VAL A 1 475 ? 17.198 73.742 -10.361 1.00 21.20 ? 475  VAL A N     1 
ATOM   3471 C  CA    . VAL A 1 475 ? 16.030 74.577 -10.623 1.00 20.60 ? 475  VAL A CA    1 
ATOM   3472 C  C     . VAL A 1 475 ? 15.952 75.038 -12.083 1.00 20.50 ? 475  VAL A C     1 
ATOM   3473 O  O     . VAL A 1 475 ? 15.067 75.816 -12.446 1.00 21.33 ? 475  VAL A O     1 
ATOM   3474 C  CB    . VAL A 1 475 ? 15.987 75.808 -9.679  1.00 21.22 ? 475  VAL A CB    1 
ATOM   3475 C  CG1   . VAL A 1 475 ? 15.903 75.356 -8.228  1.00 20.97 ? 475  VAL A CG1   1 
ATOM   3476 C  CG2   . VAL A 1 475 ? 17.207 76.696 -9.903  1.00 20.67 ? 475  VAL A CG2   1 
ATOM   3477 N  N     . THR A 1 476 ? 16.845 74.519 -12.924 1.00 19.29 ? 476  THR A N     1 
ATOM   3478 C  CA    . THR A 1 476 ? 16.873 74.882 -14.337 1.00 20.23 ? 476  THR A CA    1 
ATOM   3479 C  C     . THR A 1 476 ? 16.908 73.664 -15.285 1.00 20.25 ? 476  THR A C     1 
ATOM   3480 O  O     . THR A 1 476 ? 17.300 73.787 -16.450 1.00 20.90 ? 476  THR A O     1 
ATOM   3481 C  CB    . THR A 1 476 ? 18.087 75.808 -14.642 1.00 21.40 ? 476  THR A CB    1 
ATOM   3482 O  OG1   . THR A 1 476 ? 19.302 75.115 -14.351 1.00 22.60 ? 476  THR A OG1   1 
ATOM   3483 C  CG2   . THR A 1 476 ? 18.036 77.070 -13.801 1.00 20.71 ? 476  THR A CG2   1 
ATOM   3484 N  N     . LEU A 1 477 ? 16.501 72.493 -14.786 1.00 22.06 ? 477  LEU A N     1 
ATOM   3485 C  CA    . LEU A 1 477 ? 16.397 71.278 -15.605 1.00 23.80 ? 477  LEU A CA    1 
ATOM   3486 C  C     . LEU A 1 477 ? 15.281 71.385 -16.653 1.00 26.35 ? 477  LEU A C     1 
ATOM   3487 O  O     . LEU A 1 477 ? 14.244 72.002 -16.404 1.00 25.80 ? 477  LEU A O     1 
ATOM   3488 C  CB    . LEU A 1 477 ? 16.146 70.055 -14.714 1.00 23.51 ? 477  LEU A CB    1 
ATOM   3489 C  CG    . LEU A 1 477 ? 17.185 69.704 -13.645 1.00 22.20 ? 477  LEU A CG    1 
ATOM   3490 C  CD1   . LEU A 1 477 ? 16.672 68.582 -12.769 1.00 22.57 ? 477  LEU A CD1   1 
ATOM   3491 C  CD2   . LEU A 1 477 ? 18.494 69.307 -14.295 1.00 22.88 ? 477  LEU A CD2   1 
ATOM   3492 N  N     . ARG A 1 478 ? 15.509 70.801 -17.827 1.00 29.82 ? 478  ARG A N     1 
ATOM   3493 C  CA    . ARG A 1 478 ? 14.626 70.998 -18.982 1.00 32.48 ? 478  ARG A CA    1 
ATOM   3494 C  C     . ARG A 1 478 ? 14.232 69.653 -19.597 1.00 33.45 ? 478  ARG A C     1 
ATOM   3495 O  O     . ARG A 1 478 ? 13.029 69.479 -19.931 1.00 34.19 ? 478  ARG A O     1 
ATOM   3496 C  CB    . ARG A 1 478 ? 15.301 71.872 -20.048 1.00 34.59 ? 478  ARG A CB    1 
ATOM   3497 C  CG    . ARG A 1 478 ? 14.889 73.357 -20.011 1.00 39.21 ? 478  ARG A CG    1 
ATOM   3498 C  CD    . ARG A 1 478 ? 13.657 73.667 -20.889 1.00 42.03 ? 478  ARG A CD    1 
ATOM   3499 N  NE    . ARG A 1 478 ? 13.713 74.998 -21.511 1.00 43.15 ? 478  ARG A NE    1 
ATOM   3500 C  CZ    . ARG A 1 478 ? 13.740 75.213 -22.835 1.00 44.82 ? 478  ARG A CZ    1 
ATOM   3501 N  NH1   . ARG A 1 478 ? 14.909 75.248 -23.489 1.00 44.63 ? 478  ARG A NH1   1 
ATOM   3502 N  NH2   . ARG A 1 478 ? 12.604 75.401 -23.516 1.00 44.18 ? 478  ARG A NH2   1 
ATOM   3503 O  OXT   . ARG A 1 478 ? 15.129 68.785 -19.723 1.00 32.69 ? 478  ARG A OXT   1 
HETATM 3504 CL CL    . CL  B 2 .   ? 31.800 58.957 28.769  1.00 16.94 ? 3000 CL  A CL    1 
HETATM 3505 P  PA    . FAD C 3 .   ? 24.603 53.992 19.177  1.00 9.89  ? 479  FAD A PA    1 
HETATM 3506 O  O1A   . FAD C 3 .   ? 25.387 52.803 18.770  1.00 12.30 ? 479  FAD A O1A   1 
HETATM 3507 O  O2A   . FAD C 3 .   ? 25.007 55.218 18.839  1.00 11.79 ? 479  FAD A O2A   1 
HETATM 3508 O  O5B   . FAD C 3 .   ? 24.590 53.883 20.687  1.00 8.86  ? 479  FAD A O5B   1 
HETATM 3509 C  C5B   . FAD C 3 .   ? 24.261 52.676 21.433  1.00 8.46  ? 479  FAD A C5B   1 
HETATM 3510 C  C4B   . FAD C 3 .   ? 24.993 52.845 22.774  1.00 9.78  ? 479  FAD A C4B   1 
HETATM 3511 O  O4B   . FAD C 3 .   ? 24.575 51.742 23.633  1.00 11.50 ? 479  FAD A O4B   1 
HETATM 3512 C  C3B   . FAD C 3 .   ? 26.535 52.783 22.724  1.00 9.48  ? 479  FAD A C3B   1 
HETATM 3513 O  O3B   . FAD C 3 .   ? 27.212 53.872 23.234  1.00 10.27 ? 479  FAD A O3B   1 
HETATM 3514 C  C2B   . FAD C 3 .   ? 26.834 51.422 23.360  1.00 12.43 ? 479  FAD A C2B   1 
HETATM 3515 O  O2B   . FAD C 3 .   ? 28.111 51.372 23.921  1.00 12.80 ? 479  FAD A O2B   1 
HETATM 3516 C  C1B   . FAD C 3 .   ? 25.761 51.320 24.374  1.00 11.32 ? 479  FAD A C1B   1 
HETATM 3517 N  N9A   . FAD C 3 .   ? 25.406 49.980 24.815  1.00 10.37 ? 479  FAD A N9A   1 
HETATM 3518 C  C8A   . FAD C 3 .   ? 25.263 48.876 24.026  1.00 12.99 ? 479  FAD A C8A   1 
HETATM 3519 N  N7A   . FAD C 3 .   ? 24.667 47.879 24.664  1.00 12.78 ? 479  FAD A N7A   1 
HETATM 3520 C  C5A   . FAD C 3 .   ? 24.669 48.264 25.984  1.00 12.33 ? 479  FAD A C5A   1 
HETATM 3521 C  C6A   . FAD C 3 .   ? 24.282 47.549 27.205  1.00 13.95 ? 479  FAD A C6A   1 
HETATM 3522 N  N6A   . FAD C 3 .   ? 23.859 46.307 27.233  1.00 12.31 ? 479  FAD A N6A   1 
HETATM 3523 N  N1A   . FAD C 3 .   ? 24.399 48.295 28.347  1.00 13.74 ? 479  FAD A N1A   1 
HETATM 3524 C  C2A   . FAD C 3 .   ? 24.955 49.542 28.353  1.00 13.93 ? 479  FAD A C2A   1 
HETATM 3525 N  N3A   . FAD C 3 .   ? 25.306 50.275 27.293  1.00 10.11 ? 479  FAD A N3A   1 
HETATM 3526 C  C4A   . FAD C 3 .   ? 25.147 49.589 26.122  1.00 11.70 ? 479  FAD A C4A   1 
HETATM 3527 N  N1    . FAD C 3 .   ? 24.924 58.314 10.528  1.00 14.34 ? 479  FAD A N1    1 
HETATM 3528 C  C2    . FAD C 3 .   ? 24.731 59.549 10.122  1.00 14.12 ? 479  FAD A C2    1 
HETATM 3529 O  O2    . FAD C 3 .   ? 23.721 60.131 10.351  1.00 12.61 ? 479  FAD A O2    1 
HETATM 3530 N  N3    . FAD C 3 .   ? 25.707 60.261 9.386   1.00 14.26 ? 479  FAD A N3    1 
HETATM 3531 C  C4    . FAD C 3 .   ? 26.985 59.787 9.276   1.00 15.17 ? 479  FAD A C4    1 
HETATM 3532 O  O4    . FAD C 3 .   ? 27.847 60.487 8.790   1.00 19.08 ? 479  FAD A O4    1 
HETATM 3533 C  C4X   . FAD C 3 .   ? 27.232 58.453 9.770   1.00 14.90 ? 479  FAD A C4X   1 
HETATM 3534 N  N5    . FAD C 3 .   ? 28.437 57.889 9.594   1.00 14.10 ? 479  FAD A N5    1 
HETATM 3535 C  C5X   . FAD C 3 .   ? 28.668 56.703 10.228  1.00 13.02 ? 479  FAD A C5X   1 
HETATM 3536 C  C6    . FAD C 3 .   ? 29.971 56.178 10.161  1.00 12.67 ? 479  FAD A C6    1 
HETATM 3537 C  C7    . FAD C 3 .   ? 30.250 54.935 10.643  1.00 12.83 ? 479  FAD A C7    1 
HETATM 3538 C  C7M   . FAD C 3 .   ? 31.594 54.285 10.376  1.00 12.71 ? 479  FAD A C7M   1 
HETATM 3539 C  C8    . FAD C 3 .   ? 29.270 54.234 11.423  1.00 11.08 ? 479  FAD A C8    1 
HETATM 3540 C  C8M   . FAD C 3 .   ? 29.612 52.958 12.140  1.00 10.56 ? 479  FAD A C8M   1 
HETATM 3541 C  C9    . FAD C 3 .   ? 27.971 54.751 11.518  1.00 9.77  ? 479  FAD A C9    1 
HETATM 3542 C  C9A   . FAD C 3 .   ? 27.680 55.981 10.941  1.00 11.83 ? 479  FAD A C9A   1 
HETATM 3543 N  N10   . FAD C 3 .   ? 26.391 56.585 11.026  1.00 13.25 ? 479  FAD A N10   1 
HETATM 3544 C  C10   . FAD C 3 .   ? 26.157 57.767 10.458  1.00 13.15 ? 479  FAD A C10   1 
HETATM 3545 C  "C1'" . FAD C 3 .   ? 25.318 55.883 11.757  1.00 12.58 ? 479  FAD A "C1'" 1 
HETATM 3546 C  "C2'" . FAD C 3 .   ? 25.188 56.428 13.207  1.00 12.07 ? 479  FAD A "C2'" 1 
HETATM 3547 O  "O2'" . FAD C 3 .   ? 26.471 56.306 13.816  1.00 12.64 ? 479  FAD A "O2'" 1 
HETATM 3548 C  "C3'" . FAD C 3 .   ? 24.167 55.566 13.922  1.00 12.14 ? 479  FAD A "C3'" 1 
HETATM 3549 O  "O3'" . FAD C 3 .   ? 23.030 55.437 13.088  1.00 12.42 ? 479  FAD A "O3'" 1 
HETATM 3550 C  "C4'" . FAD C 3 .   ? 23.702 56.207 15.214  1.00 12.13 ? 479  FAD A "C4'" 1 
HETATM 3551 O  "O4'" . FAD C 3 .   ? 24.796 56.328 16.150  1.00 14.98 ? 479  FAD A "O4'" 1 
HETATM 3552 C  "C5'" . FAD C 3 .   ? 22.576 55.334 15.769  1.00 11.96 ? 479  FAD A "C5'" 1 
HETATM 3553 O  "O5'" . FAD C 3 .   ? 22.399 55.639 17.318  1.00 12.49 ? 479  FAD A "O5'" 1 
HETATM 3554 P  P     . FAD C 3 .   ? 21.958 54.558 18.280  1.00 13.40 ? 479  FAD A P     1 
HETATM 3555 O  O1P   . FAD C 3 .   ? 21.343 55.365 19.438  1.00 12.86 ? 479  FAD A O1P   1 
HETATM 3556 O  O2P   . FAD C 3 .   ? 21.110 53.632 17.701  1.00 12.17 ? 479  FAD A O2P   1 
HETATM 3557 O  O3P   . FAD C 3 .   ? 23.121 53.737 18.691  1.00 11.90 ? 479  FAD A O3P   1 
HETATM 3558 S  S5    . AJ3 D 4 .   ? 26.217 61.601 18.383  0.80 42.56 ? 4058 AJ3 A S5    1 
HETATM 3559 C  C6B   . AJ3 D 4 .   ? 25.139 62.968 18.700  0.80 41.73 ? 4058 AJ3 A C6B   1 
HETATM 3560 C  C7    . AJ3 D 4 .   ? 24.395 62.963 19.809  0.80 44.02 ? 4058 AJ3 A C7    1 
HETATM 3561 C  C8B   . AJ3 D 4 .   ? 23.708 64.210 20.277  0.80 46.73 ? 4058 AJ3 A C8B   1 
HETATM 3562 S  S9    . AJ3 D 4 .   ? 22.199 63.804 21.270  0.80 50.29 ? 4058 AJ3 A S9    1 
HETATM 3563 C  C10   . AJ3 D 4 .   ? 20.834 64.944 20.788  0.80 47.83 ? 4058 AJ3 A C10   1 
HETATM 3564 C  C11   . AJ3 D 4 .   ? 20.224 65.560 21.993  0.80 47.33 ? 4058 AJ3 A C11   1 
HETATM 3565 C  C12   . AJ3 D 4 .   ? 20.985 66.130 22.901  0.80 47.30 ? 4058 AJ3 A C12   1 
HETATM 3566 O  O13   . AJ3 D 4 .   ? 21.764 62.373 20.988  0.80 47.43 ? 4058 AJ3 A O13   1 
HETATM 3567 O  O     . HOH E 5 .   ? 24.360 42.936 34.589  1.00 40.97 ? 4059 HOH A O     1 
HETATM 3568 O  O     . HOH E 5 .   ? 25.521 57.771 18.272  1.00 42.87 ? 4060 HOH A O     1 
HETATM 3569 O  O     . HOH E 5 .   ? 41.772 52.497 -10.361 1.00 29.15 ? 4061 HOH A O     1 
HETATM 3570 O  O     . HOH E 5 .   ? 27.022 44.188 -2.976  1.00 17.65 ? 4062 HOH A O     1 
HETATM 3571 O  O     . HOH E 5 .   ? 17.918 54.579 -2.412  1.00 30.31 ? 4063 HOH A O     1 
HETATM 3572 O  O     . HOH E 5 .   ? 45.871 47.355 9.975   1.00 30.79 ? 4064 HOH A O     1 
HETATM 3573 O  O     . HOH E 5 .   ? 52.889 47.461 2.429   1.00 35.19 ? 4065 HOH A O     1 
HETATM 3574 O  O     . HOH E 5 .   ? 8.208  62.587 11.433  1.00 27.61 ? 4066 HOH A O     1 
HETATM 3575 O  O     . HOH E 5 .   ? 29.994 77.951 -9.776  1.00 25.58 ? 4067 HOH A O     1 
HETATM 3576 O  O     . HOH E 5 .   ? 19.808 51.608 18.991  1.00 7.66  ? 4068 HOH A O     1 
HETATM 3577 O  O     . HOH E 5 .   ? 21.500 55.295 22.226  1.00 5.03  ? 4069 HOH A O     1 
HETATM 3578 O  O     . HOH E 5 .   ? 37.241 78.194 -10.683 1.00 15.29 ? 4070 HOH A O     1 
HETATM 3579 O  O     . HOH E 5 .   ? 30.815 49.395 10.784  1.00 16.33 ? 4071 HOH A O     1 
HETATM 3580 O  O     . HOH E 5 .   ? 25.276 51.691 16.154  1.00 8.88  ? 4072 HOH A O     1 
HETATM 3581 O  O     . HOH E 5 .   ? 42.683 56.470 13.294  1.00 16.89 ? 4073 HOH A O     1 
HETATM 3582 O  O     . HOH E 5 .   ? 25.630 52.376 11.977  1.00 19.25 ? 4074 HOH A O     1 
HETATM 3583 O  O     . HOH E 5 .   ? 21.911 81.833 -13.751 1.00 26.66 ? 4075 HOH A O     1 
HETATM 3584 O  O     . HOH E 5 .   ? 27.547 59.289 5.767   1.00 12.52 ? 4076 HOH A O     1 
HETATM 3585 O  O     . HOH E 5 .   ? 6.152  57.370 19.595  1.00 18.02 ? 4077 HOH A O     1 
HETATM 3586 O  O     . HOH E 5 .   ? 16.504 65.539 22.779  1.00 18.90 ? 4078 HOH A O     1 
HETATM 3587 O  O     . HOH E 5 .   ? 20.457 72.994 1.990   1.00 23.45 ? 4079 HOH A O     1 
HETATM 3588 O  O     . HOH E 5 .   ? 31.772 44.972 8.574   1.00 17.82 ? 4080 HOH A O     1 
HETATM 3589 O  O     . HOH E 5 .   ? 8.224  56.659 15.784  1.00 20.53 ? 4081 HOH A O     1 
HETATM 3590 O  O     . HOH E 5 .   ? 23.816 61.221 5.992   1.00 15.93 ? 4082 HOH A O     1 
HETATM 3591 O  O     . HOH E 5 .   ? 35.771 59.632 1.767   1.00 18.15 ? 4083 HOH A O     1 
HETATM 3592 O  O     . HOH E 5 .   ? 31.754 70.375 2.810   1.00 20.05 ? 4084 HOH A O     1 
HETATM 3593 O  O     . HOH E 5 .   ? 32.725 69.669 8.511   1.00 17.01 ? 4085 HOH A O     1 
HETATM 3594 O  O     . HOH E 5 .   ? 24.425 49.410 13.469  1.00 16.73 ? 4086 HOH A O     1 
HETATM 3595 O  O     . HOH E 5 .   ? 28.876 70.176 -8.164  1.00 23.35 ? 4087 HOH A O     1 
HETATM 3596 O  O     . HOH E 5 .   ? 44.052 44.541 8.967   1.00 17.69 ? 4088 HOH A O     1 
HETATM 3597 O  O     . HOH E 5 .   ? 44.905 54.066 -3.887  1.00 22.62 ? 4089 HOH A O     1 
HETATM 3598 O  O     . HOH E 5 .   ? 38.679 46.409 14.450  1.00 24.56 ? 4090 HOH A O     1 
HETATM 3599 O  O     . HOH E 5 .   ? 24.898 51.334 2.063   1.00 16.66 ? 4091 HOH A O     1 
HETATM 3600 O  O     . HOH E 5 .   ? 14.326 72.252 -12.462 1.00 22.44 ? 4092 HOH A O     1 
HETATM 3601 O  O     . HOH E 5 .   ? 33.073 69.715 5.730   1.00 23.23 ? 4093 HOH A O     1 
HETATM 3602 O  O     . HOH E 5 .   ? 6.194  56.414 8.351   1.00 31.30 ? 4094 HOH A O     1 
HETATM 3603 O  O     . HOH E 5 .   ? 39.589 59.404 -2.558  1.00 22.04 ? 4095 HOH A O     1 
HETATM 3604 O  O     . HOH E 5 .   ? 8.825  57.826 18.368  1.00 26.88 ? 4096 HOH A O     1 
HETATM 3605 O  O     . HOH E 5 .   ? 16.233 81.804 -12.462 1.00 30.92 ? 4097 HOH A O     1 
HETATM 3606 O  O     . HOH E 5 .   ? 15.943 63.362 34.917  1.00 25.02 ? 4098 HOH A O     1 
HETATM 3607 O  O     . HOH E 5 .   ? 26.198 47.778 -2.953  1.00 19.33 ? 4099 HOH A O     1 
HETATM 3608 O  O     . HOH E 5 .   ? 13.210 57.259 3.812   1.00 17.17 ? 4100 HOH A O     1 
HETATM 3609 O  O     . HOH E 5 .   ? 46.759 73.864 -1.138  1.00 32.59 ? 4101 HOH A O     1 
HETATM 3610 O  O     . HOH E 5 .   ? 12.485 41.975 33.926  1.00 28.17 ? 4102 HOH A O     1 
HETATM 3611 O  O     . HOH E 5 .   ? 11.408 57.815 1.216   1.00 31.57 ? 4103 HOH A O     1 
HETATM 3612 O  O     . HOH E 5 .   ? 31.677 53.501 20.857  1.00 25.18 ? 4104 HOH A O     1 
HETATM 3613 O  O     . HOH E 5 .   ? 40.919 36.878 -8.445  1.00 27.04 ? 4105 HOH A O     1 
HETATM 3614 O  O     . HOH E 5 .   ? 30.737 53.659 30.681  1.00 15.42 ? 4106 HOH A O     1 
HETATM 3615 O  O     . HOH E 5 .   ? 36.445 60.355 27.429  1.00 14.34 ? 4107 HOH A O     1 
HETATM 3616 O  O     . HOH E 5 .   ? 52.603 39.439 1.454   1.00 27.29 ? 4108 HOH A O     1 
HETATM 3617 O  O     . HOH E 5 .   ? 34.722 38.757 0.682   1.00 19.75 ? 4109 HOH A O     1 
HETATM 3618 O  O     . HOH E 5 .   ? 1.464  53.410 21.475  1.00 31.23 ? 4110 HOH A O     1 
HETATM 3619 O  O     . HOH E 5 .   ? 46.382 56.394 -2.768  1.00 27.57 ? 4111 HOH A O     1 
HETATM 3620 O  O     . HOH E 5 .   ? 31.124 37.751 -6.456  1.00 26.88 ? 4112 HOH A O     1 
HETATM 3621 O  O     . HOH E 5 .   ? 28.909 46.248 33.925  1.00 29.64 ? 4113 HOH A O     1 
HETATM 3622 O  O     . HOH E 5 .   ? 36.727 35.801 -13.667 1.00 17.92 ? 4114 HOH A O     1 
HETATM 3623 O  O     . HOH E 5 .   ? 34.463 52.429 24.798  1.00 31.79 ? 4115 HOH A O     1 
HETATM 3624 O  O     . HOH E 5 .   ? 16.214 68.087 24.295  1.00 34.33 ? 4116 HOH A O     1 
HETATM 3625 O  O     . HOH E 5 .   ? 24.158 50.404 -0.890  1.00 27.61 ? 4117 HOH A O     1 
HETATM 3626 O  O     . HOH E 5 .   ? 51.481 59.176 8.441   1.00 33.38 ? 4118 HOH A O     1 
HETATM 3627 O  O     . HOH E 5 .   ? 22.527 69.082 3.199   1.00 16.50 ? 4119 HOH A O     1 
HETATM 3628 O  O     . HOH E 5 .   ? 19.817 61.669 7.786   1.00 11.13 ? 4120 HOH A O     1 
HETATM 3629 O  O     . HOH E 5 .   ? 19.788 54.997 13.956  1.00 13.56 ? 4121 HOH A O     1 
HETATM 3630 O  O     . HOH E 5 .   ? 29.261 69.027 5.131   1.00 16.04 ? 4122 HOH A O     1 
HETATM 3631 O  O     . HOH E 5 .   ? 32.849 52.039 13.522  1.00 11.91 ? 4123 HOH A O     1 
HETATM 3632 O  O     . HOH E 5 .   ? 17.167 54.098 13.087  1.00 18.98 ? 4124 HOH A O     1 
HETATM 3633 O  O     . HOH E 5 .   ? 22.367 47.452 13.884  1.00 20.35 ? 4125 HOH A O     1 
HETATM 3634 O  O     . HOH E 5 .   ? 22.510 61.949 8.521   1.00 12.89 ? 4126 HOH A O     1 
HETATM 3635 O  O     . HOH E 5 .   ? 29.872 43.706 -2.156  1.00 23.27 ? 4127 HOH A O     1 
HETATM 3636 O  O     . HOH E 5 .   ? 32.037 67.613 -8.653  1.00 12.98 ? 4128 HOH A O     1 
HETATM 3637 O  O     . HOH E 5 .   ? 44.195 69.621 -10.954 1.00 25.18 ? 4129 HOH A O     1 
HETATM 3638 O  O     . HOH E 5 .   ? 30.428 47.679 8.509   1.00 15.07 ? 4130 HOH A O     1 
HETATM 3639 O  O     . HOH E 5 .   ? 33.368 47.984 9.197   1.00 17.73 ? 4131 HOH A O     1 
HETATM 3640 O  O     . HOH E 5 .   ? 30.838 62.730 -9.409  1.00 22.64 ? 4132 HOH A O     1 
HETATM 3641 O  O     . HOH E 5 .   ? 29.824 73.461 -5.520  1.00 22.36 ? 4133 HOH A O     1 
HETATM 3642 O  O     . HOH E 5 .   ? 29.881 49.272 3.446   1.00 22.62 ? 4134 HOH A O     1 
HETATM 3643 O  O     . HOH E 5 .   ? 15.707 51.388 13.283  1.00 17.29 ? 4135 HOH A O     1 
HETATM 3644 O  O     . HOH E 5 .   ? 6.763  55.254 12.687  1.00 26.55 ? 4136 HOH A O     1 
HETATM 3645 O  O     . HOH E 5 .   ? 21.802 46.132 11.288  1.00 19.95 ? 4137 HOH A O     1 
HETATM 3646 O  O     . HOH E 5 .   ? 30.051 54.082 23.292  1.00 10.13 ? 4138 HOH A O     1 
HETATM 3647 O  O     . HOH E 5 .   ? 10.370 62.113 7.371   1.00 24.15 ? 4139 HOH A O     1 
HETATM 3648 O  O     . HOH E 5 .   ? 19.209 78.993 -16.839 1.00 41.64 ? 4140 HOH A O     1 
HETATM 3649 O  O     . HOH E 5 .   ? 42.897 49.193 14.415  1.00 28.60 ? 4141 HOH A O     1 
HETATM 3650 O  O     . HOH E 5 .   ? 34.856 57.792 -1.874  1.00 22.93 ? 4142 HOH A O     1 
HETATM 3651 O  O     . HOH E 5 .   ? 28.677 48.427 6.539   1.00 17.57 ? 4143 HOH A O     1 
HETATM 3652 O  O     . HOH E 5 .   ? 27.766 50.483 4.731   1.00 14.29 ? 4144 HOH A O     1 
HETATM 3653 O  O     . HOH E 5 .   ? 30.249 71.638 -17.762 1.00 22.36 ? 4145 HOH A O     1 
HETATM 3654 O  O     . HOH E 5 .   ? 19.634 57.067 -4.397  1.00 21.41 ? 4146 HOH A O     1 
HETATM 3655 O  O     . HOH E 5 .   ? 27.220 53.293 38.078  1.00 16.90 ? 4147 HOH A O     1 
HETATM 3656 O  O     . HOH E 5 .   ? 8.734  52.097 13.622  1.00 32.93 ? 4148 HOH A O     1 
HETATM 3657 O  O     . HOH E 5 .   ? 26.924 44.329 34.569  1.00 23.38 ? 4149 HOH A O     1 
HETATM 3658 O  O     . HOH E 5 .   ? 24.270 41.132 19.428  1.00 34.02 ? 4150 HOH A O     1 
HETATM 3659 O  O     . HOH E 5 .   ? 36.560 61.212 -8.500  1.00 23.11 ? 4151 HOH A O     1 
HETATM 3660 O  O     . HOH E 5 .   ? 28.698 44.916 -5.555  1.00 28.28 ? 4152 HOH A O     1 
HETATM 3661 O  O     . HOH E 5 .   ? 36.419 57.699 22.028  1.00 26.94 ? 4153 HOH A O     1 
HETATM 3662 O  O     . HOH E 5 .   ? 17.370 53.635 -10.135 1.00 20.88 ? 4154 HOH A O     1 
HETATM 3663 O  O     . HOH E 5 .   ? 14.342 80.922 -16.530 1.00 31.54 ? 4155 HOH A O     1 
HETATM 3664 O  O     . HOH E 5 .   ? 37.388 59.571 24.140  1.00 13.94 ? 4156 HOH A O     1 
HETATM 3665 O  O     . HOH E 5 .   ? 14.185 78.498 -11.952 1.00 21.43 ? 4157 HOH A O     1 
HETATM 3666 O  O     . HOH E 5 .   ? 9.002  76.986 -4.791  1.00 34.97 ? 4158 HOH A O     1 
HETATM 3667 O  O     . HOH E 5 .   ? 35.394 65.523 -1.941  1.00 29.41 ? 4159 HOH A O     1 
HETATM 3668 O  O     . HOH E 5 .   ? 26.373 49.393 19.985  1.00 30.20 ? 4160 HOH A O     1 
HETATM 3669 O  O     . HOH E 5 .   ? 17.812 58.718 2.014   1.00 29.86 ? 4161 HOH A O     1 
HETATM 3670 O  O     . HOH E 5 .   ? 45.974 52.130 18.991  1.00 34.83 ? 4162 HOH A O     1 
HETATM 3671 O  O     . HOH E 5 .   ? 23.980 44.830 24.362  1.00 25.49 ? 4163 HOH A O     1 
HETATM 3672 O  O     . HOH E 5 .   ? 4.723  70.692 -11.907 1.00 20.97 ? 4164 HOH A O     1 
HETATM 3673 O  O     . HOH E 5 .   ? 17.558 67.514 29.238  1.00 29.31 ? 4165 HOH A O     1 
HETATM 3674 O  O     . HOH E 5 .   ? 29.465 74.797 -10.737 1.00 32.03 ? 4166 HOH A O     1 
HETATM 3675 O  O     . HOH E 5 .   ? 9.904  43.474 20.080  1.00 22.57 ? 4167 HOH A O     1 
HETATM 3676 O  O     . HOH E 5 .   ? 5.716  48.750 24.450  1.00 28.69 ? 4168 HOH A O     1 
HETATM 3677 O  O     . HOH E 5 .   ? 13.110 52.120 14.522  1.00 16.48 ? 4169 HOH A O     1 
HETATM 3678 O  O     . HOH E 5 .   ? 30.488 50.715 15.539  1.00 23.11 ? 4170 HOH A O     1 
HETATM 3679 O  O     . HOH E 5 .   ? 12.512 64.077 6.223   1.00 18.75 ? 4171 HOH A O     1 
HETATM 3680 O  O     . HOH E 5 .   ? 24.214 38.381 -3.945  1.00 23.22 ? 4172 HOH A O     1 
HETATM 3681 O  O     . HOH E 5 .   ? 31.520 69.147 -1.231  1.00 21.23 ? 4173 HOH A O     1 
HETATM 3682 O  O     . HOH E 5 .   ? 32.412 55.632 7.145   1.00 42.65 ? 4174 HOH A O     1 
HETATM 3683 O  O     . HOH E 5 .   ? 24.071 62.973 36.382  1.00 22.83 ? 4175 HOH A O     1 
HETATM 3684 O  O     . HOH E 5 .   ? 15.067 54.963 15.233  1.00 21.17 ? 4176 HOH A O     1 
HETATM 3685 O  O     . HOH E 5 .   ? 24.832 53.224 9.378   1.00 14.84 ? 4177 HOH A O     1 
HETATM 3686 O  O     . HOH E 5 .   ? 28.197 63.011 36.136  1.00 22.72 ? 4178 HOH A O     1 
HETATM 3687 O  O     . HOH E 5 .   ? 29.549 58.930 35.057  1.00 23.75 ? 4179 HOH A O     1 
HETATM 3688 O  O     . HOH E 5 .   ? 39.168 60.298 26.893  1.00 16.76 ? 4180 HOH A O     1 
HETATM 3689 O  O     . HOH E 5 .   ? 14.276 59.238 1.478   1.00 20.12 ? 4181 HOH A O     1 
HETATM 3690 O  O     . HOH E 5 .   ? 33.738 49.296 28.131  1.00 32.70 ? 4182 HOH A O     1 
HETATM 3691 O  O     . HOH E 5 .   ? 48.582 66.567 17.066  1.00 38.64 ? 4183 HOH A O     1 
HETATM 3692 O  O     . HOH E 5 .   ? 40.871 68.653 19.083  1.00 21.08 ? 4184 HOH A O     1 
HETATM 3693 O  O     . HOH E 5 .   ? 17.418 36.928 37.266  1.00 42.58 ? 4185 HOH A O     1 
HETATM 3694 O  O     . HOH E 5 .   ? 4.274  51.214 31.212  1.00 35.65 ? 4186 HOH A O     1 
HETATM 3695 O  O     . HOH E 5 .   ? 19.684 51.810 6.970   1.00 38.04 ? 4187 HOH A O     1 
HETATM 3696 O  O     . HOH E 5 .   ? 24.211 46.545 7.258   1.00 28.36 ? 4188 HOH A O     1 
HETATM 3697 O  O     . HOH E 5 .   ? 39.350 59.377 17.203  1.00 28.31 ? 4189 HOH A O     1 
HETATM 3698 O  O     . HOH E 5 .   ? 31.363 48.729 -13.214 1.00 28.79 ? 4190 HOH A O     1 
HETATM 3699 O  O     . HOH E 5 .   ? 39.492 49.831 -10.699 1.00 28.25 ? 4191 HOH A O     1 
HETATM 3700 O  O     . HOH E 5 .   ? 33.292 41.148 -1.674  1.00 28.97 ? 4192 HOH A O     1 
HETATM 3701 O  O     . HOH E 5 .   ? 33.628 36.119 -6.696  1.00 22.22 ? 4193 HOH A O     1 
HETATM 3702 O  O     . HOH E 5 .   ? 52.169 50.980 6.434   1.00 30.30 ? 4194 HOH A O     1 
HETATM 3703 O  O     . HOH E 5 .   ? 11.276 42.767 10.894  1.00 29.18 ? 4195 HOH A O     1 
HETATM 3704 O  O     . HOH E 5 .   ? 0.676  59.248 24.443  1.00 39.53 ? 4196 HOH A O     1 
HETATM 3705 O  O     . HOH E 5 .   ? 16.800 58.316 -1.287  1.00 23.99 ? 4197 HOH A O     1 
HETATM 3706 O  O     . HOH E 5 .   ? 15.863 51.034 -6.865  1.00 24.51 ? 4198 HOH A O     1 
HETATM 3707 O  O     . HOH E 5 .   ? 7.073  65.151 -2.784  1.00 36.69 ? 4199 HOH A O     1 
HETATM 3708 O  O     . HOH E 5 .   ? 19.918 72.366 -15.276 1.00 34.01 ? 4200 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   CYS 2   2   ?   ?   ?   A . n 
A 1 3   ARG 3   3   ?   ?   ?   A . n 
A 1 4   GLN 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   PRO 6   6   ?   ?   ?   A . n 
A 1 7   GLN 7   7   ?   ?   ?   A . n 
A 1 8   PRO 8   8   ?   ?   ?   A . n 
A 1 9   GLN 9   9   ?   ?   ?   A . n 
A 1 10  GLY 10  10  ?   ?   ?   A . n 
A 1 11  PRO 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  ?   ?   ?   A . n 
A 1 13  PRO 13  13  ?   ?   ?   A . n 
A 1 14  ALA 14  14  ?   ?   ?   A . n 
A 1 15  ALA 15  15  ?   ?   ?   A . n 
A 1 16  GLY 16  16  ?   ?   ?   A . n 
A 1 17  ALA 17  17  ?   ?   ?   A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  TYR 21  21  21  TYR TYR A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  TYR 23  23  23  TYR TYR A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  HIS 52  52  52  HIS HIS A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  CYS 63  63  63  CYS CYS A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  MET 69  69  69  MET MET A . n 
A 1 70  TRP 70  70  70  TRP TRP A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  HIS 75  75  75  HIS HIS A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  MET 79  79  79  MET MET A . n 
A 1 80  HIS 80  80  80  HIS HIS A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  CYS 90  90  90  CYS CYS A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  TRP 96  96  96  TRP TRP A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 ASP 104 104 104 ASP ASP A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 TYR 106 106 106 TYR TYR A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 HIS 122 122 122 HIS HIS A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 HIS 129 129 129 HIS HIS A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 THR 133 133 133 THR THR A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 ASP 135 135 135 ASP ASP A . n 
A 1 136 PRO 136 136 136 PRO PRO A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 TYR 147 147 147 TYR TYR A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 HIS 151 151 151 HIS HIS A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 MET 159 159 159 MET MET A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 THR 162 162 162 THR THR A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 HIS 164 164 164 HIS HIS A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 GLN 167 167 167 GLN GLN A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 THR 176 176 176 THR THR A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 PHE 181 181 181 PHE PHE A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 ARG 189 189 189 ARG ARG A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 GLY 194 194 194 GLY GLY A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 TYR 197 197 197 TYR TYR A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 MET 202 202 202 MET MET A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 ILE 205 205 205 ILE ILE A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 LYS 212 212 212 LYS LYS A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 SER 214 214 214 SER SER A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 MET 216 216 216 MET MET A . n 
A 1 217 ILE 217 217 217 ILE ILE A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 HIS 219 219 219 HIS HIS A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 LEU 223 223 223 LEU LEU A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 PHE 226 226 226 PHE PHE A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 MET 229 229 229 MET MET A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 THR 232 232 232 THR THR A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 CYS 234 234 234 CYS CYS A . n 
A 1 235 THR 235 235 235 THR THR A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 LEU 238 238 238 LEU LEU A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 ASN 240 240 240 ASN ASN A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 GLU 244 244 244 GLU GLU A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 PHE 248 248 248 PHE PHE A . n 
A 1 249 SER 249 249 249 SER SER A . n 
A 1 250 GLN 250 250 250 GLN GLN A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 LYS 252 252 252 LYS LYS A . n 
A 1 253 GLU 253 253 253 GLU GLU A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 LYS 256 256 256 LYS LYS A . n 
A 1 257 THR 257 257 257 THR THR A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 SER 259 259 259 SER SER A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 SER 264 264 264 SER SER A . n 
A 1 265 MET 265 265 265 MET MET A . n 
A 1 266 VAL 266 266 266 VAL VAL A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 GLY 271 271 271 GLY GLY A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 PRO 274 274 274 PRO PRO A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 MET 276 276 276 MET MET A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 MET 278 278 278 MET MET A . n 
A 1 279 ILE 279 279 279 ILE ILE A . n 
A 1 280 PRO 280 280 280 PRO PRO A . n 
A 1 281 ASP 281 281 281 ASP ASP A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 CYS 284 284 284 CYS CYS A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 TRP 287 287 287 TRP TRP A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 GLY 290 290 290 GLY GLY A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 THR 295 295 295 THR THR A . n 
A 1 296 LYS 296 296 296 LYS LYS A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 SER 299 299 299 SER SER A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 ASN 301 301 301 ASN ASN A . n 
A 1 302 LYS 302 302 302 LYS LYS A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 GLY 304 304 304 GLY GLY A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 GLN 306 306 306 GLN GLN A . n 
A 1 307 THR 307 307 307 THR THR A . n 
A 1 308 ASP 308 308 308 ASP ASP A . n 
A 1 309 ASP 309 309 309 ASP ASP A . n 
A 1 310 LYS 310 310 310 LYS LYS A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 HIS 312 312 312 HIS HIS A . n 
A 1 313 ILE 313 313 313 ILE ILE A . n 
A 1 314 ILE 314 314 314 ILE ILE A . n 
A 1 315 VAL 315 315 315 VAL VAL A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 GLU 317 317 317 GLU GLU A . n 
A 1 318 PHE 318 318 318 PHE PHE A . n 
A 1 319 GLN 319 319 319 GLN GLN A . n 
A 1 320 ASN 320 320 320 ASN ASN A . n 
A 1 321 THR 321 321 321 THR THR A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 LYS 324 324 324 LYS LYS A . n 
A 1 325 GLY 325 325 325 GLY GLY A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 TYR 327 327 327 TYR TYR A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 VAL 329 329 329 VAL VAL A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 ASP 331 331 331 ASP ASP A . n 
A 1 332 VAL 332 332 332 VAL VAL A . n 
A 1 333 CYS 333 333 333 CYS CYS A . n 
A 1 334 GLY 334 334 334 GLY GLY A . n 
A 1 335 LYS 335 335 335 LYS LYS A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 LEU 337 337 337 LEU LEU A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 THR 339 339 339 THR THR A . n 
A 1 340 PRO 340 340 340 PRO PRO A . n 
A 1 341 VAL 341 341 341 VAL VAL A . n 
A 1 342 ALA 342 342 342 ALA ALA A . n 
A 1 343 ILE 343 343 343 ILE ILE A . n 
A 1 344 ALA 344 344 344 ALA ALA A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 GLY 346 346 346 GLY GLY A . n 
A 1 347 ARG 347 347 347 ARG ARG A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 ALA 350 350 350 ALA ALA A . n 
A 1 351 HIS 351 351 351 HIS HIS A . n 
A 1 352 ARG 352 352 352 ARG ARG A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 PHE 354 354 354 PHE PHE A . n 
A 1 355 GLU 355 355 355 GLU GLU A . n 
A 1 356 TYR 356 356 356 TYR TYR A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 GLU 358 358 358 GLU GLU A . n 
A 1 359 ASP 359 359 359 ASP ASP A . n 
A 1 360 SER 360 360 360 SER SER A . n 
A 1 361 LYS 361 361 361 LYS LYS A . n 
A 1 362 LEU 362 362 362 LEU LEU A . n 
A 1 363 ASP 363 363 363 ASP ASP A . n 
A 1 364 TYR 364 364 364 TYR TYR A . n 
A 1 365 ASN 365 365 365 ASN ASN A . n 
A 1 366 ASN 366 366 366 ASN ASN A . n 
A 1 367 ILE 367 367 367 ILE ILE A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 VAL 370 370 370 VAL VAL A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 PHE 372 372 372 PHE PHE A . n 
A 1 373 SER 373 373 373 SER SER A . n 
A 1 374 HIS 374 374 374 HIS HIS A . n 
A 1 375 PRO 375 375 375 PRO PRO A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 GLY 378 378 378 GLY GLY A . n 
A 1 379 THR 379 379 379 THR THR A . n 
A 1 380 VAL 380 380 380 VAL VAL A . n 
A 1 381 GLY 381 381 381 GLY GLY A . n 
A 1 382 LEU 382 382 382 LEU LEU A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 GLU 384 384 384 GLU GLU A . n 
A 1 385 ASP 385 385 385 ASP ASP A . n 
A 1 386 GLU 386 386 386 GLU GLU A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 ILE 388 388 388 ILE ILE A . n 
A 1 389 HIS 389 389 389 HIS HIS A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 TYR 391 391 391 TYR TYR A . n 
A 1 392 GLY 392 392 392 GLY GLY A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 GLU 394 394 394 GLU GLU A . n 
A 1 395 ASN 395 395 395 ASN ASN A . n 
A 1 396 VAL 396 396 396 VAL VAL A . n 
A 1 397 LYS 397 397 397 LYS LYS A . n 
A 1 398 THR 398 398 398 THR THR A . n 
A 1 399 TYR 399 399 399 TYR TYR A . n 
A 1 400 SER 400 400 400 SER SER A . n 
A 1 401 THR 401 401 401 THR THR A . n 
A 1 402 SER 402 402 402 SER SER A . n 
A 1 403 PHE 403 403 403 PHE PHE A . n 
A 1 404 THR 404 404 404 THR THR A . n 
A 1 405 PRO 405 405 405 PRO PRO A . n 
A 1 406 MET 406 406 406 MET MET A . n 
A 1 407 TYR 407 407 407 TYR TYR A . n 
A 1 408 HIS 408 408 408 HIS HIS A . n 
A 1 409 ALA 409 409 409 ALA ALA A . n 
A 1 410 VAL 410 410 410 VAL VAL A . n 
A 1 411 THR 411 411 411 THR THR A . n 
A 1 412 LYS 412 412 412 LYS LYS A . n 
A 1 413 ARG 413 413 413 ARG ARG A . n 
A 1 414 LYS 414 414 414 LYS LYS A . n 
A 1 415 THR 415 415 415 THR THR A . n 
A 1 416 LYS 416 416 416 LYS LYS A . n 
A 1 417 CYS 417 417 417 CYS CYS A . n 
A 1 418 VAL 418 418 418 VAL VAL A . n 
A 1 419 MET 419 419 419 MET MET A . n 
A 1 420 LYS 420 420 420 LYS LYS A . n 
A 1 421 MET 421 421 421 MET MET A . n 
A 1 422 VAL 422 422 422 VAL VAL A . n 
A 1 423 CYS 423 423 423 CYS CYS A . n 
A 1 424 ALA 424 424 424 ALA ALA A . n 
A 1 425 ASN 425 425 425 ASN ASN A . n 
A 1 426 LYS 426 426 426 LYS LYS A . n 
A 1 427 GLU 427 427 427 GLU GLU A . n 
A 1 428 GLU 428 428 428 GLU GLU A . n 
A 1 429 LYS 429 429 429 LYS LYS A . n 
A 1 430 VAL 430 430 430 VAL VAL A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 ILE 433 433 433 ILE ILE A . n 
A 1 434 HIS 434 434 434 HIS HIS A . n 
A 1 435 MET 435 435 435 MET MET A . n 
A 1 436 GLN 436 436 436 GLN GLN A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 LEU 438 438 438 LEU LEU A . n 
A 1 439 GLY 439 439 439 GLY GLY A . n 
A 1 440 CYS 440 440 440 CYS CYS A . n 
A 1 441 ASP 441 441 441 ASP ASP A . n 
A 1 442 GLU 442 442 442 GLU GLU A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 LEU 444 444 444 LEU LEU A . n 
A 1 445 GLN 445 445 445 GLN GLN A . n 
A 1 446 GLY 446 446 446 GLY GLY A . n 
A 1 447 PHE 447 447 447 PHE PHE A . n 
A 1 448 ALA 448 448 448 ALA ALA A . n 
A 1 449 VAL 449 449 449 VAL VAL A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 VAL 451 451 451 VAL VAL A . n 
A 1 452 LYS 452 452 452 LYS LYS A . n 
A 1 453 MET 453 453 453 MET MET A . n 
A 1 454 GLY 454 454 454 GLY GLY A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 THR 456 456 456 THR THR A . n 
A 1 457 LYS 457 457 457 LYS LYS A . n 
A 1 458 ALA 458 458 458 ALA ALA A . n 
A 1 459 ASP 459 459 459 ASP ASP A . n 
A 1 460 PHE 460 460 460 PHE PHE A . n 
A 1 461 ASP 461 461 461 ASP ASP A . n 
A 1 462 ASN 462 462 462 ASN ASN A . n 
A 1 463 THR 463 463 463 THR THR A . n 
A 1 464 VAL 464 464 464 VAL VAL A . n 
A 1 465 ALA 465 465 465 ALA ALA A . n 
A 1 466 ILE 466 466 466 ILE ILE A . n 
A 1 467 HIS 467 467 467 HIS HIS A . n 
A 1 468 PRO 468 468 468 PRO PRO A . n 
A 1 469 THR 469 469 469 THR THR A . n 
A 1 470 SER 470 470 470 SER SER A . n 
A 1 471 SER 471 471 471 SER SER A . n 
A 1 472 GLU 472 472 472 GLU GLU A . n 
A 1 473 GLU 473 473 473 GLU GLU A . n 
A 1 474 LEU 474 474 474 LEU LEU A . n 
A 1 475 VAL 475 475 475 VAL VAL A . n 
A 1 476 THR 476 476 476 THR THR A . n 
A 1 477 LEU 477 477 477 LEU LEU A . n 
A 1 478 ARG 478 478 478 ARG ARG A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10890 ? 
1 MORE         -106  ? 
1 'SSA (A^2)'  36350 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_565 x,-y+1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 146.9000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-07-20 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XDS    'data scaling'   .     ? 1 
AMoRE  phasing          .     ? 2 
X-PLOR refinement       3.851 ? 3 
XDS    'data reduction' .     ? 4 
# 
_pdbx_entry_details.entry_id             1BWC 
_pdbx_entry_details.compound_details     
;GLUTATHIONE REDUCTASE IS ACTIVE AS A DIMER OF TWO IDENTICAL
SUBUNITS, WHICH ARE COVALENTLY CONNECTED BY AN
INTERMOLECULAR CYS 90 - CYS 90' DISULFIDE
BOND.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 52  ? ? -128.10 -112.91 
2  1 SER A 89  ? ? -48.07  107.31  
3  1 SER A 143 ? ? 40.45   73.26   
4  1 HIS A 219 ? ? -122.97 -147.37 
5  1 PRO A 270 ? ? -6.95   108.49  
6  1 ASP A 281 ? ? 73.03   34.39   
7  1 THR A 321 ? ? -69.46  -178.07 
8  1 ALA A 336 ? ? 53.45   80.63   
9  1 LYS A 357 ? ? -68.53  94.16   
10 1 ASN A 425 ? ? 81.37   -172.10 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 CYS A 90  ? ? GLU A 91  ? ? -76.36  
2 1 GLY A 92  ? ? LYS A 93  ? ? -122.86 
3 1 ALA A 130 ? ? ALA A 131 ? ? 149.05  
4 1 SER A 143 ? ? GLY A 144 ? ? -115.56 
5 1 GLY A 144 ? ? LYS A 145 ? ? 140.82  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ARG A 37  ? ? 0.271 'SIDE CHAIN' 
2 1 ARG A 45  ? ? 0.152 'SIDE CHAIN' 
3 1 ARG A 97  ? ? 0.298 'SIDE CHAIN' 
4 1 ARG A 127 ? ? 0.158 'SIDE CHAIN' 
5 1 ARG A 218 ? ? 0.255 'SIDE CHAIN' 
6 1 ARG A 224 ? ? 0.154 'SIDE CHAIN' 
7 1 ARG A 272 ? ? 0.296 'SIDE CHAIN' 
8 1 ARG A 347 ? ? 0.176 'SIDE CHAIN' 
9 1 ARG A 478 ? ? 0.297 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 1  ? A ALA 1  
2  1 Y 1 A CYS 2  ? A CYS 2  
3  1 Y 1 A ARG 3  ? A ARG 3  
4  1 Y 1 A GLN 4  ? A GLN 4  
5  1 Y 1 A GLU 5  ? A GLU 5  
6  1 Y 1 A PRO 6  ? A PRO 6  
7  1 Y 1 A GLN 7  ? A GLN 7  
8  1 Y 1 A PRO 8  ? A PRO 8  
9  1 Y 1 A GLN 9  ? A GLN 9  
10 1 Y 1 A GLY 10 ? A GLY 10 
11 1 Y 1 A PRO 11 ? A PRO 11 
12 1 Y 1 A PRO 12 ? A PRO 12 
13 1 Y 1 A PRO 13 ? A PRO 13 
14 1 Y 1 A ALA 14 ? A ALA 14 
15 1 Y 1 A ALA 15 ? A ALA 15 
16 1 Y 1 A GLY 16 ? A GLY 16 
17 1 Y 1 A ALA 17 ? A ALA 17 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION'                              CL  
3 'FLAVIN-ADENINE DINUCLEOTIDE'               FAD 
4 '3-(PROP-2-ENE-1-SULFINYL)-PROPENE-1-THIOL' AJ3 
5 water                                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1   3000 3000 CL  CL  A . 
C 3 FAD 1   479  479  FAD FAD A . 
D 4 AJ3 1   4058 4058 AJ3 AJ3 A . 
E 5 HOH 1   4059 2    HOH HOH A . 
E 5 HOH 2   4060 4    HOH HOH A . 
E 5 HOH 3   4061 5    HOH HOH A . 
E 5 HOH 4   4062 6    HOH HOH A . 
E 5 HOH 5   4063 7    HOH HOH A . 
E 5 HOH 6   4064 8    HOH HOH A . 
E 5 HOH 7   4065 9    HOH HOH A . 
E 5 HOH 8   4066 10   HOH HOH A . 
E 5 HOH 9   4067 11   HOH HOH A . 
E 5 HOH 10  4068 484  HOH HOH A . 
E 5 HOH 11  4069 486  HOH HOH A . 
E 5 HOH 12  4070 488  HOH HOH A . 
E 5 HOH 13  4071 490  HOH HOH A . 
E 5 HOH 14  4072 492  HOH HOH A . 
E 5 HOH 15  4073 494  HOH HOH A . 
E 5 HOH 16  4074 496  HOH HOH A . 
E 5 HOH 17  4075 498  HOH HOH A . 
E 5 HOH 18  4076 500  HOH HOH A . 
E 5 HOH 19  4077 502  HOH HOH A . 
E 5 HOH 20  4078 504  HOH HOH A . 
E 5 HOH 21  4079 506  HOH HOH A . 
E 5 HOH 22  4080 508  HOH HOH A . 
E 5 HOH 23  4081 510  HOH HOH A . 
E 5 HOH 24  4082 512  HOH HOH A . 
E 5 HOH 25  4083 514  HOH HOH A . 
E 5 HOH 26  4084 519  HOH HOH A . 
E 5 HOH 27  4085 521  HOH HOH A . 
E 5 HOH 28  4086 523  HOH HOH A . 
E 5 HOH 29  4087 527  HOH HOH A . 
E 5 HOH 30  4088 529  HOH HOH A . 
E 5 HOH 31  4089 532  HOH HOH A . 
E 5 HOH 32  4090 534  HOH HOH A . 
E 5 HOH 33  4091 537  HOH HOH A . 
E 5 HOH 34  4092 540  HOH HOH A . 
E 5 HOH 35  4093 543  HOH HOH A . 
E 5 HOH 36  4094 546  HOH HOH A . 
E 5 HOH 37  4095 553  HOH HOH A . 
E 5 HOH 38  4096 556  HOH HOH A . 
E 5 HOH 39  4097 562  HOH HOH A . 
E 5 HOH 40  4098 566  HOH HOH A . 
E 5 HOH 41  4099 569  HOH HOH A . 
E 5 HOH 42  4100 575  HOH HOH A . 
E 5 HOH 43  4101 579  HOH HOH A . 
E 5 HOH 44  4102 581  HOH HOH A . 
E 5 HOH 45  4103 585  HOH HOH A . 
E 5 HOH 46  4104 588  HOH HOH A . 
E 5 HOH 47  4105 590  HOH HOH A . 
E 5 HOH 48  4106 599  HOH HOH A . 
E 5 HOH 49  4107 614  HOH HOH A . 
E 5 HOH 50  4108 616  HOH HOH A . 
E 5 HOH 51  4109 620  HOH HOH A . 
E 5 HOH 52  4110 627  HOH HOH A . 
E 5 HOH 53  4111 647  HOH HOH A . 
E 5 HOH 54  4112 656  HOH HOH A . 
E 5 HOH 55  4113 722  HOH HOH A . 
E 5 HOH 56  4114 762  HOH HOH A . 
E 5 HOH 57  4115 768  HOH HOH A . 
E 5 HOH 58  4116 778  HOH HOH A . 
E 5 HOH 59  4117 793  HOH HOH A . 
E 5 HOH 60  4118 797  HOH HOH A . 
E 5 HOH 61  4119 483  HOH HOH A . 
E 5 HOH 62  4120 485  HOH HOH A . 
E 5 HOH 63  4121 487  HOH HOH A . 
E 5 HOH 64  4122 489  HOH HOH A . 
E 5 HOH 65  4123 491  HOH HOH A . 
E 5 HOH 66  4124 493  HOH HOH A . 
E 5 HOH 67  4125 495  HOH HOH A . 
E 5 HOH 68  4126 497  HOH HOH A . 
E 5 HOH 69  4127 501  HOH HOH A . 
E 5 HOH 70  4128 505  HOH HOH A . 
E 5 HOH 71  4129 507  HOH HOH A . 
E 5 HOH 72  4130 509  HOH HOH A . 
E 5 HOH 73  4131 513  HOH HOH A . 
E 5 HOH 74  4132 518  HOH HOH A . 
E 5 HOH 75  4133 520  HOH HOH A . 
E 5 HOH 76  4134 522  HOH HOH A . 
E 5 HOH 77  4135 526  HOH HOH A . 
E 5 HOH 78  4136 531  HOH HOH A . 
E 5 HOH 79  4137 533  HOH HOH A . 
E 5 HOH 80  4138 536  HOH HOH A . 
E 5 HOH 81  4139 539  HOH HOH A . 
E 5 HOH 82  4140 541  HOH HOH A . 
E 5 HOH 83  4141 550  HOH HOH A . 
E 5 HOH 84  4142 552  HOH HOH A . 
E 5 HOH 85  4143 554  HOH HOH A . 
E 5 HOH 86  4144 560  HOH HOH A . 
E 5 HOH 87  4145 563  HOH HOH A . 
E 5 HOH 88  4146 565  HOH HOH A . 
E 5 HOH 89  4147 567  HOH HOH A . 
E 5 HOH 90  4148 572  HOH HOH A . 
E 5 HOH 91  4149 580  HOH HOH A . 
E 5 HOH 92  4150 583  HOH HOH A . 
E 5 HOH 93  4151 587  HOH HOH A . 
E 5 HOH 94  4152 594  HOH HOH A . 
E 5 HOH 95  4153 601  HOH HOH A . 
E 5 HOH 96  4154 604  HOH HOH A . 
E 5 HOH 97  4155 613  HOH HOH A . 
E 5 HOH 98  4156 615  HOH HOH A . 
E 5 HOH 99  4157 621  HOH HOH A . 
E 5 HOH 100 4158 626  HOH HOH A . 
E 5 HOH 101 4159 629  HOH HOH A . 
E 5 HOH 102 4160 632  HOH HOH A . 
E 5 HOH 103 4161 699  HOH HOH A . 
E 5 HOH 104 4162 755  HOH HOH A . 
E 5 HOH 105 4163 792  HOH HOH A . 
E 5 HOH 106 4164 814  HOH HOH A . 
E 5 HOH 107 4165 826  HOH HOH A . 
E 5 HOH 108 4166 981  HOH HOH A . 
E 5 HOH 109 4167 524  HOH HOH A . 
E 5 HOH 110 4168 525  HOH HOH A . 
E 5 HOH 111 4169 574  HOH HOH A . 
E 5 HOH 112 4170 503  HOH HOH A . 
E 5 HOH 113 4171 516  HOH HOH A . 
E 5 HOH 114 4172 551  HOH HOH A . 
E 5 HOH 115 4173 528  HOH HOH A . 
E 5 HOH 116 4174 1    HOH HOH A . 
E 5 HOH 117 4175 825  HOH HOH A . 
E 5 HOH 118 4176 1003 HOH HOH A . 
E 5 HOH 119 4177 1004 HOH HOH A . 
E 5 HOH 120 4178 1005 HOH HOH A . 
E 5 HOH 121 4179 1007 HOH HOH A . 
E 5 HOH 122 4180 1008 HOH HOH A . 
E 5 HOH 123 4181 1010 HOH HOH A . 
E 5 HOH 124 4182 982  HOH HOH A . 
E 5 HOH 125 4183 985  HOH HOH A . 
E 5 HOH 126 4184 986  HOH HOH A . 
E 5 HOH 127 4185 989  HOH HOH A . 
E 5 HOH 128 4186 990  HOH HOH A . 
E 5 HOH 129 4187 991  HOH HOH A . 
E 5 HOH 130 4188 992  HOH HOH A . 
E 5 HOH 131 4189 994  HOH HOH A . 
E 5 HOH 132 4190 997  HOH HOH A . 
E 5 HOH 133 4191 999  HOH HOH A . 
E 5 HOH 134 4192 1011 HOH HOH A . 
E 5 HOH 135 4193 1012 HOH HOH A . 
E 5 HOH 136 4194 1015 HOH HOH A . 
E 5 HOH 137 4195 1016 HOH HOH A . 
E 5 HOH 138 4196 1017 HOH HOH A . 
E 5 HOH 139 4197 1002 HOH HOH A . 
E 5 HOH 140 4198 1006 HOH HOH A . 
E 5 HOH 141 4199 1009 HOH HOH A . 
E 5 HOH 142 4200 3    HOH HOH A . 
#