data_1BWN
# 
_entry.id   1BWN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BWN         
WWPDB D_1000172123 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BWN 
_pdbx_database_status.recvd_initial_deposition_date   1998-09-25 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Djinovic Carugo, K.' 1 
'Baraldi, E.'         2 
'Hyvoenen, M.'        3 
'Lo Surdo, P.'        4 
'Riley, A.'           5 
'Potter, B.'          6 
'Saraste, M.'         7 
# 
_citation.id                        primary 
_citation.title                     
;Structure of the PH domain from Bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate.
;
_citation.journal_abbrev            'Structure Fold.Des.' 
_citation.journal_volume            7 
_citation.page_first                449 
_citation.page_last                 460 
_citation.year                      1999 
_citation.journal_id_ASTM           FODEFH 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            1263 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10196129 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(99)80057-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Baraldi, E.'   1 
primary 'Carugo, K.D.'  2 
primary 'Hyvonen, M.'   3 
primary 'Surdo, P.L.'   4 
primary 'Riley, A.M.'   5 
primary 'Potter, B.V.'  6 
primary 
;O'Brien, R.
;
7 
primary 'Ladbury, J.E.' 8 
primary 'Saraste, M.'   9 
# 
_cell.entry_id           1BWN 
_cell.length_a           110.784 
_cell.length_b           110.784 
_cell.length_c           215.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BWN 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;BRUTON'S TYROSINE KINASE
;
19983.078 2   2.7.1.112 E41K 'PH DOMAIN AND BTK MOTIF' ? 
2 non-polymer syn 'ZINC ION'                             65.409    2   ?         ?    ?                         ? 
3 non-polymer syn 'INOSITOL-(1,3,4,5)-TETRAKISPHOSPHATE' 500.075   4   ?         ?    ?                         ? 
4 water       nat water                                  18.015    273 ?         ?    ?                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;BRUTON'S AGAMMAGLOBULINEMIA TYROSINE KINASE, BTK
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPR
RGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKN
AMGCQILEN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPR
RGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKN
AMGCQILEN
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ALA n 
1 3   VAL n 
1 4   ILE n 
1 5   LEU n 
1 6   GLU n 
1 7   SER n 
1 8   ILE n 
1 9   PHE n 
1 10  LEU n 
1 11  LYS n 
1 12  ARG n 
1 13  SER n 
1 14  GLN n 
1 15  GLN n 
1 16  LYS n 
1 17  LYS n 
1 18  LYS n 
1 19  THR n 
1 20  SER n 
1 21  PRO n 
1 22  LEU n 
1 23  ASN n 
1 24  PHE n 
1 25  LYS n 
1 26  LYS n 
1 27  ARG n 
1 28  LEU n 
1 29  PHE n 
1 30  LEU n 
1 31  LEU n 
1 32  THR n 
1 33  VAL n 
1 34  HIS n 
1 35  LYS n 
1 36  LEU n 
1 37  SER n 
1 38  TYR n 
1 39  TYR n 
1 40  LYS n 
1 41  TYR n 
1 42  ASP n 
1 43  PHE n 
1 44  GLU n 
1 45  ARG n 
1 46  GLY n 
1 47  ARG n 
1 48  ARG n 
1 49  GLY n 
1 50  SER n 
1 51  LYS n 
1 52  LYS n 
1 53  GLY n 
1 54  SER n 
1 55  ILE n 
1 56  ASP n 
1 57  VAL n 
1 58  GLU n 
1 59  LYS n 
1 60  ILE n 
1 61  THR n 
1 62  CYS n 
1 63  VAL n 
1 64  GLU n 
1 65  THR n 
1 66  VAL n 
1 67  VAL n 
1 68  PRO n 
1 69  GLU n 
1 70  LYS n 
1 71  ASN n 
1 72  PRO n 
1 73  PRO n 
1 74  PRO n 
1 75  GLU n 
1 76  ARG n 
1 77  GLN n 
1 78  ILE n 
1 79  PRO n 
1 80  ARG n 
1 81  ARG n 
1 82  GLY n 
1 83  GLU n 
1 84  GLU n 
1 85  SER n 
1 86  SER n 
1 87  GLU n 
1 88  MET n 
1 89  GLU n 
1 90  GLN n 
1 91  ILE n 
1 92  SER n 
1 93  ILE n 
1 94  ILE n 
1 95  GLU n 
1 96  ARG n 
1 97  PHE n 
1 98  PRO n 
1 99  TYR n 
1 100 PRO n 
1 101 PHE n 
1 102 GLN n 
1 103 VAL n 
1 104 VAL n 
1 105 TYR n 
1 106 ASP n 
1 107 GLU n 
1 108 GLY n 
1 109 PRO n 
1 110 LEU n 
1 111 TYR n 
1 112 VAL n 
1 113 PHE n 
1 114 SER n 
1 115 PRO n 
1 116 THR n 
1 117 GLU n 
1 118 GLU n 
1 119 LEU n 
1 120 ARG n 
1 121 LYS n 
1 122 ARG n 
1 123 TRP n 
1 124 ILE n 
1 125 HIS n 
1 126 GLN n 
1 127 LEU n 
1 128 LYS n 
1 129 ASN n 
1 130 VAL n 
1 131 ILE n 
1 132 ARG n 
1 133 TYR n 
1 134 ASN n 
1 135 SER n 
1 136 ASP n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 LYS n 
1 141 TYR n 
1 142 HIS n 
1 143 PRO n 
1 144 CYS n 
1 145 PHE n 
1 146 TRP n 
1 147 ILE n 
1 148 ASP n 
1 149 GLY n 
1 150 GLN n 
1 151 TYR n 
1 152 LEU n 
1 153 CYS n 
1 154 CYS n 
1 155 SER n 
1 156 GLN n 
1 157 THR n 
1 158 ALA n 
1 159 LYS n 
1 160 ASN n 
1 161 ALA n 
1 162 MET n 
1 163 GLY n 
1 164 CYS n 
1 165 GLN n 
1 166 ILE n 
1 167 LEU n 
1 168 GLU n 
1 169 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            BL21 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 B-LYMPHOCYTE 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PBAT4 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PBAT4-BTK3E41K 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BTK_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q06187 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIP
RRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAK
NAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVF
AKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPK
DLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFP
VRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADE
RPTFKILLSNILDVMDEES
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BWN A 1 ? 169 ? Q06187 2 ? 170 ? 2 170 
2 1 1BWN B 1 ? 169 ? Q06187 2 ? 170 ? 2 170 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1BWN LYS A 40 ? UNP Q06187 GLU 41 ENGINEERED 41 1 
2 1BWN LYS B 40 ? UNP Q06187 GLU 41 ENGINEERED 41 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4IP non-polymer         . 'INOSITOL-(1,3,4,5)-TETRAKISPHOSPHATE' ? 'C6 H16 O18 P4'  500.075 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                             ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1BWN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.12 
_exptl_crystal.density_percent_sol   70.1 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.947 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-3' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-3 
_diffrn_source.pdbx_wavelength             0.947 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BWN 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.0 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   39294 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0370000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        37.9 
_reflns.pdbx_redundancy              3.2 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.14 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.3220000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1BWN 
_refine.ls_number_reflns_obs                     39294 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.0 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    99.4 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2140000 
_refine.ls_R_factor_R_free                       0.2900000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 6. 
_refine.ls_number_reflns_R_free                  1971 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS AND KRETSINGER (J.MOL.BIOL. (1975), 91, 201-228)' 
_refine.solvent_model_param_ksol                 0.844 
_refine.solvent_model_param_bsol                 262.7 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1BWN 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             'TNT BCORREL' 
_refine.pdbx_stereochemistry_target_values       'TNT PROTGEO' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2714 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         114 
_refine_hist.number_atoms_solvent             273 
_refine_hist.number_atoms_total               3101 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        35.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.020 ? 4.1  5670 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.10  ? 5.9  7638 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 19.6  ? 0    3294 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct 0     ? ?    ?    'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ?    ?    'X-RAY DIFFRACTION' ? 
t_trig_c_planes    0.020 ? 3.5  136  'X-RAY DIFFRACTION' ? 
t_gen_planes       0.028 ? 10.0 778  'X-RAY DIFFRACTION' ? 
t_it               4.73  ? 10.0 2895 'X-RAY DIFFRACTION' ? 
t_nbd              0.128 ? 12.0 107  'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.331013 
_struct_ncs_oper.matrix[1][2]   0.942566 
_struct_ncs_oper.matrix[1][3]   -0.044724 
_struct_ncs_oper.matrix[2][1]   0.941286 
_struct_ncs_oper.matrix[2][2]   0.333157 
_struct_ncs_oper.matrix[2][3]   0.054651 
_struct_ncs_oper.matrix[3][1]   0.066412 
_struct_ncs_oper.matrix[3][2]   -0.024008 
_struct_ncs_oper.matrix[3][3]   -0.997504 
_struct_ncs_oper.vector[1]      1.47688 
_struct_ncs_oper.vector[2]      -1.89803 
_struct_ncs_oper.vector[3]      108.86600 
# 
_struct.entry_id                  1BWN 
_struct.title                     
;PH DOMAIN AND BTK MOTIF FROM BRUTON'S TYROSINE KINASE MUTANT E41K IN COMPLEX WITH INS(1,3,4,5)P4
;
_struct.pdbx_descriptor           
;BRUTON'S TYROSINE KINASE, INOSITOL-(1,3,4,5)-TETRAKISPHOSPHATE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BWN 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;TRANSFERASE, PH DOMAIN, BTK MOTIF, INOSITOL-(1, 3, 4, 5)-TETRAKISPHOSPHATE, ZINC BINDING, X-LINKED AGAMMAGLOBULINEMIA, TYROSINE-PROTEIN KINASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 57  ? LYS A 59  ? VAL A 58  LYS A 60  5 ? 3  
HELX_P HELX_P2 2 PRO A 74  ? ARG A 76  ? PRO A 75  ARG A 77  5 ? 3  
HELX_P HELX_P3 3 GLU A 87  ? ILE A 94  ? GLU A 88  ILE A 95  1 ? 8  
HELX_P HELX_P4 4 GLU A 117 ? ILE A 131 ? GLU A 118 ILE A 132 1 ? 15 
HELX_P HELX_P5 5 VAL B 57  ? LYS B 59  ? VAL B 58  LYS B 60  5 ? 3  
HELX_P HELX_P6 6 PRO B 74  ? ARG B 76  ? PRO B 75  ARG B 77  5 ? 3  
HELX_P HELX_P7 7 MET B 88  ? ILE B 94  ? MET B 89  ILE B 95  5 ? 7  
HELX_P HELX_P8 8 GLU B 117 ? ILE B 131 ? GLU B 118 ILE B 132 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? D 4IP . OPH ? ? ? 1_555 A SER 20  OG  ? ? A 4IP 1   A SER 21  1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc1 metalc ? ? C ZN  . ZN  ? ? ? 1_555 A HIS 142 ND1 ? ? A ZN  171 A HIS 143 1_555 ? ? ? ? ? ? ? 2.053 ? 
metalc2 metalc ? ? C ZN  . ZN  ? ? ? 1_555 A CYS 153 SG  ? ? A ZN  171 A CYS 154 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc3 metalc ? ? C ZN  . ZN  ? ? ? 1_555 A CYS 154 SG  ? ? A ZN  171 A CYS 155 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc4 metalc ? ? C ZN  . ZN  ? ? ? 1_555 A CYS 164 SG  ? ? A ZN  171 A CYS 165 1_555 ? ? ? ? ? ? ? 2.209 ? 
covale2 covale ? ? G 4IP . OPH ? ? ? 1_555 B SER 20  OG  ? ? B 4IP 1   B SER 21  1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc5 metalc ? ? F ZN  . ZN  ? ? ? 1_555 B HIS 142 ND1 ? ? B ZN  171 B HIS 143 1_555 ? ? ? ? ? ? ? 1.973 ? 
metalc6 metalc ? ? F ZN  . ZN  ? ? ? 1_555 B CYS 153 SG  ? ? B ZN  171 B CYS 154 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc7 metalc ? ? F ZN  . ZN  ? ? ? 1_555 B CYS 154 SG  ? ? B ZN  171 B CYS 155 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc8 metalc ? ? F ZN  . ZN  ? ? ? 1_555 B CYS 164 SG  ? ? B ZN  171 B CYS 165 1_555 ? ? ? ? ? ? ? 2.398 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 4 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 5   ? ARG A 12  ? LEU A 6   ARG A 13  
A 2 PHE A 24  ? LEU A 31  ? PHE A 25  LEU A 32  
A 3 LYS A 35  ? TYR A 39  ? LYS A 36  TYR A 40  
A 4 LYS A 51  ? ASP A 56  ? LYS A 52  ASP A 57  
B 1 PRO A 109 ? SER A 114 ? PRO A 110 SER A 115 
B 2 TYR A 99  ? TYR A 105 ? TYR A 100 TYR A 106 
B 3 ILE A 60  ? THR A 65  ? ILE A 61  THR A 66  
C 1 LEU B 5   ? ARG B 12  ? LEU B 6   ARG B 13  
C 2 PHE B 24  ? LEU B 31  ? PHE B 25  LEU B 32  
C 3 LYS B 35  ? TYR B 39  ? LYS B 36  TYR B 40  
C 4 LYS B 51  ? ASP B 56  ? LYS B 52  ASP B 57  
D 1 GLY B 108 ? SER B 114 ? GLY B 109 SER B 115 
D 2 TYR B 99  ? TYR B 105 ? TYR B 100 TYR B 106 
D 3 ILE B 60  ? THR B 65  ? ILE B 61  THR B 66  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 5   ? O LEU A 6   N LEU A 31  ? N LEU A 32  
A 2 3 O LEU A 28  ? O LEU A 29  N TYR A 39  ? N TYR A 40  
A 3 4 O LEU A 36  ? O LEU A 37  N ILE A 55  ? N ILE A 56  
B 1 2 O LEU A 110 ? O LEU A 111 N VAL A 103 ? N VAL A 104 
B 2 3 O GLN A 102 ? O GLN A 103 N GLU A 64  ? N GLU A 65  
C 1 2 O LEU B 5   ? O LEU B 6   N LEU B 31  ? N LEU B 32  
C 2 3 O LEU B 28  ? O LEU B 29  N TYR B 39  ? N TYR B 40  
C 3 4 O LEU B 36  ? O LEU B 37  N ILE B 55  ? N ILE B 56  
D 1 2 O GLY B 108 ? O GLY B 109 N TYR B 105 ? N TYR B 106 
D 2 3 O GLN B 102 ? O GLN B 103 N GLU B 64  ? N GLU B 65  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
ZN1 Unknown  ? ? ? ? 5  'ZN BINDING SITE IN THE BTK MOTIF, CHAIN A' 
ZN2 Unknown  ? ? ? ? 5  'ZN BINDING SITE IN THE BTK MOTIF, CHAIN B' 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 171'         
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 171'         
AC3 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE 4IP A 1'          
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 4IP A 172'        
AC5 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE 4IP B 1'          
AC6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 4IP B 172'        
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  ZN1 5  ZN  C .   ? ZN  A 171 . ? 1_555  ? 
2  ZN1 5  HIS A 142 ? HIS A 143 . ? 1_555  ? 
3  ZN1 5  CYS A 153 ? CYS A 154 . ? 1_555  ? 
4  ZN1 5  CYS A 154 ? CYS A 155 . ? 1_555  ? 
5  ZN1 5  CYS A 164 ? CYS A 165 . ? 1_555  ? 
6  ZN2 5  ZN  F .   ? ZN  B 171 . ? 1_555  ? 
7  ZN2 5  HIS B 142 ? HIS B 143 . ? 1_555  ? 
8  ZN2 5  CYS B 153 ? CYS B 154 . ? 1_555  ? 
9  ZN2 5  CYS B 154 ? CYS B 155 . ? 1_555  ? 
10 ZN2 5  CYS B 164 ? CYS B 165 . ? 1_555  ? 
11 AC1 4  HIS A 142 ? HIS A 143 . ? 1_555  ? 
12 AC1 4  CYS A 153 ? CYS A 154 . ? 1_555  ? 
13 AC1 4  CYS A 154 ? CYS A 155 . ? 1_555  ? 
14 AC1 4  CYS A 164 ? CYS A 165 . ? 1_555  ? 
15 AC2 4  HIS B 142 ? HIS B 143 . ? 1_555  ? 
16 AC2 4  CYS B 153 ? CYS B 154 . ? 1_555  ? 
17 AC2 4  CYS B 154 ? CYS B 155 . ? 1_555  ? 
18 AC2 4  CYS B 164 ? CYS B 165 . ? 1_555  ? 
19 AC3 23 LYS A 11  ? LYS A 12  . ? 1_555  ? 
20 AC3 23 SER A 13  ? SER A 14  . ? 1_555  ? 
21 AC3 23 GLN A 14  ? GLN A 15  . ? 1_555  ? 
22 AC3 23 GLN A 15  ? GLN A 16  . ? 1_555  ? 
23 AC3 23 LYS A 16  ? LYS A 17  . ? 1_555  ? 
24 AC3 23 LYS A 17  ? LYS A 18  . ? 10_555 ? 
25 AC3 23 LYS A 17  ? LYS A 18  . ? 1_555  ? 
26 AC3 23 SER A 20  ? SER A 21  . ? 1_555  ? 
27 AC3 23 PRO A 21  ? PRO A 22  . ? 1_555  ? 
28 AC3 23 ASN A 23  ? ASN A 24  . ? 1_555  ? 
29 AC3 23 LYS A 25  ? LYS A 26  . ? 1_555  ? 
30 AC3 23 ARG A 27  ? ARG A 28  . ? 1_555  ? 
31 AC3 23 TYR A 38  ? TYR A 39  . ? 1_555  ? 
32 AC3 23 LYS A 52  ? LYS A 53  . ? 1_555  ? 
33 AC3 23 4IP E .   ? 4IP A 172 . ? 10_555 ? 
34 AC3 23 HOH I .   ? HOH A 187 . ? 1_555  ? 
35 AC3 23 HOH I .   ? HOH A 195 . ? 1_555  ? 
36 AC3 23 HOH I .   ? HOH A 196 . ? 1_555  ? 
37 AC3 23 HOH I .   ? HOH A 222 . ? 10_555 ? 
38 AC3 23 HOH I .   ? HOH A 251 . ? 10_555 ? 
39 AC3 23 HOH I .   ? HOH A 261 . ? 1_555  ? 
40 AC3 23 HOH I .   ? HOH A 271 . ? 1_555  ? 
41 AC3 23 HOH I .   ? HOH A 338 . ? 1_555  ? 
42 AC4 12 4IP D .   ? 4IP A 1   . ? 10_555 ? 
43 AC4 12 LYS A 25  ? LYS A 26  . ? 10_555 ? 
44 AC4 12 ARG A 27  ? ARG A 28  . ? 10_555 ? 
45 AC4 12 LYS A 40  ? LYS A 41  . ? 10_555 ? 
46 AC4 12 LYS A 40  ? LYS A 41  . ? 1_555  ? 
47 AC4 12 SER A 50  ? SER A 51  . ? 10_555 ? 
48 AC4 12 LYS A 52  ? LYS A 53  . ? 10_555 ? 
49 AC4 12 LYS A 52  ? LYS A 53  . ? 1_555  ? 
50 AC4 12 HOH I .   ? HOH A 196 . ? 10_555 ? 
51 AC4 12 HOH I .   ? HOH A 222 . ? 10_555 ? 
52 AC4 12 HOH I .   ? HOH A 260 . ? 1_555  ? 
53 AC4 12 GLU B 44  ? GLU B 45  . ? 1_555  ? 
54 AC5 23 LYS B 11  ? LYS B 12  . ? 1_555  ? 
55 AC5 23 SER B 13  ? SER B 14  . ? 1_555  ? 
56 AC5 23 GLN B 14  ? GLN B 15  . ? 1_555  ? 
57 AC5 23 GLN B 15  ? GLN B 16  . ? 1_555  ? 
58 AC5 23 LYS B 16  ? LYS B 17  . ? 1_555  ? 
59 AC5 23 LYS B 17  ? LYS B 18  . ? 1_555  ? 
60 AC5 23 LYS B 17  ? LYS B 18  . ? 10_555 ? 
61 AC5 23 SER B 20  ? SER B 21  . ? 1_555  ? 
62 AC5 23 PRO B 21  ? PRO B 22  . ? 1_555  ? 
63 AC5 23 ASN B 23  ? ASN B 24  . ? 1_555  ? 
64 AC5 23 ARG B 27  ? ARG B 28  . ? 1_555  ? 
65 AC5 23 TYR B 38  ? TYR B 39  . ? 1_555  ? 
66 AC5 23 LYS B 52  ? LYS B 53  . ? 10_555 ? 
67 AC5 23 LYS B 52  ? LYS B 53  . ? 1_555  ? 
68 AC5 23 4IP H .   ? 4IP B 172 . ? 1_555  ? 
69 AC5 23 4IP H .   ? 4IP B 172 . ? 10_555 ? 
70 AC5 23 HOH J .   ? HOH B 174 . ? 1_555  ? 
71 AC5 23 HOH J .   ? HOH B 192 . ? 1_555  ? 
72 AC5 23 HOH J .   ? HOH B 196 . ? 1_555  ? 
73 AC5 23 HOH J .   ? HOH B 200 . ? 1_555  ? 
74 AC5 23 HOH J .   ? HOH B 204 . ? 10_555 ? 
75 AC5 23 HOH J .   ? HOH B 225 . ? 1_555  ? 
76 AC5 23 HOH J .   ? HOH B 252 . ? 1_555  ? 
77 AC6 14 GLU A 44  ? GLU A 45  . ? 1_555  ? 
78 AC6 14 4IP G .   ? 4IP B 1   . ? 10_555 ? 
79 AC6 14 4IP G .   ? 4IP B 1   . ? 1_555  ? 
80 AC6 14 LYS B 25  ? LYS B 26  . ? 10_555 ? 
81 AC6 14 LYS B 25  ? LYS B 26  . ? 1_555  ? 
82 AC6 14 ARG B 27  ? ARG B 28  . ? 10_555 ? 
83 AC6 14 LYS B 40  ? LYS B 41  . ? 1_555  ? 
84 AC6 14 LYS B 40  ? LYS B 41  . ? 10_555 ? 
85 AC6 14 SER B 50  ? SER B 51  . ? 10_555 ? 
86 AC6 14 LYS B 52  ? LYS B 53  . ? 1_555  ? 
87 AC6 14 LYS B 52  ? LYS B 53  . ? 10_555 ? 
88 AC6 14 HOH J .   ? HOH B 179 . ? 1_555  ? 
89 AC6 14 HOH J .   ? HOH B 254 . ? 10_555 ? 
90 AC6 14 HOH J .   ? HOH B 268 . ? 10_555 ? 
# 
_database_PDB_matrix.entry_id          1BWN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BWN 
_atom_sites.fract_transf_matrix[1][1]   0.009027 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009027 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004638 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1   ? 24.454 1.260  38.921 1.00 59.21 ? 2   ALA A N   1 
ATOM   2    C  CA  . ALA A 1 1   ? 25.383 2.400  38.912 1.00 56.82 ? 2   ALA A CA  1 
ATOM   3    C  C   . ALA A 1 1   ? 25.125 3.316  40.101 1.00 60.00 ? 2   ALA A C   1 
ATOM   4    O  O   . ALA A 1 1   ? 24.130 3.133  40.821 1.00 60.00 ? 2   ALA A O   1 
ATOM   5    C  CB  . ALA A 1 1   ? 25.250 3.200  37.629 1.00 56.19 ? 2   ALA A CB  1 
ATOM   6    N  N   . ALA A 1 2   ? 26.002 4.306  40.303 1.00 39.23 ? 3   ALA A N   1 
ATOM   7    C  CA  . ALA A 1 2   ? 25.787 5.248  41.386 1.00 29.79 ? 3   ALA A CA  1 
ATOM   8    C  C   . ALA A 1 2   ? 24.463 6.041  41.201 1.00 42.50 ? 3   ALA A C   1 
ATOM   9    O  O   . ALA A 1 2   ? 23.962 6.259  40.084 1.00 44.91 ? 3   ALA A O   1 
ATOM   10   C  CB  . ALA A 1 2   ? 26.951 6.203  41.470 1.00 28.99 ? 3   ALA A CB  1 
ATOM   11   N  N   . VAL A 1 3   ? 23.886 6.455  42.313 1.00 37.93 ? 4   VAL A N   1 
ATOM   12   C  CA  . VAL A 1 3   ? 22.717 7.235  42.279 1.00 30.48 ? 4   VAL A CA  1 
ATOM   13   C  C   . VAL A 1 3   ? 23.256 8.604  42.168 1.00 32.60 ? 4   VAL A C   1 
ATOM   14   O  O   . VAL A 1 3   ? 24.062 8.972  42.981 1.00 41.39 ? 4   VAL A O   1 
ATOM   15   C  CB  . VAL A 1 3   ? 21.963 7.155  43.571 1.00 30.74 ? 4   VAL A CB  1 
ATOM   16   C  CG1 . VAL A 1 3   ? 20.761 8.060  43.471 1.00 27.84 ? 4   VAL A CG1 1 
ATOM   17   C  CG2 . VAL A 1 3   ? 21.491 5.737  43.746 1.00 28.00 ? 4   VAL A CG2 1 
ATOM   18   N  N   . ILE A 1 4   ? 22.833 9.346  41.146 1.00 34.94 ? 5   ILE A N   1 
ATOM   19   C  CA  . ILE A 1 4   ? 23.275 10.729 40.930 1.00 27.64 ? 5   ILE A CA  1 
ATOM   20   C  C   . ILE A 1 4   ? 22.428 11.678 41.742 1.00 24.26 ? 5   ILE A C   1 
ATOM   21   O  O   . ILE A 1 4   ? 22.911 12.661 42.259 1.00 34.25 ? 5   ILE A O   1 
ATOM   22   C  CB  . ILE A 1 4   ? 23.185 11.135 39.432 1.00 34.20 ? 5   ILE A CB  1 
ATOM   23   C  CG1 . ILE A 1 4   ? 24.076 10.256 38.545 1.00 34.17 ? 5   ILE A CG1 1 
ATOM   24   C  CG2 . ILE A 1 4   ? 23.472 12.633 39.252 1.00 33.97 ? 5   ILE A CG2 1 
ATOM   25   C  CD1 . ILE A 1 4   ? 23.502 9.952  37.154 1.00 26.99 ? 5   ILE A CD1 1 
ATOM   26   N  N   . LEU A 1 5   ? 21.133 11.398 41.802 1.00 24.01 ? 6   LEU A N   1 
ATOM   27   C  CA  . LEU A 1 5   ? 20.212 12.222 42.534 1.00 25.21 ? 6   LEU A CA  1 
ATOM   28   C  C   . LEU A 1 5   ? 19.169 11.297 43.086 1.00 24.07 ? 6   LEU A C   1 
ATOM   29   O  O   . LEU A 1 5   ? 18.868 10.263 42.485 1.00 27.84 ? 6   LEU A O   1 
ATOM   30   C  CB  . LEU A 1 5   ? 19.522 13.280 41.638 1.00 26.23 ? 6   LEU A CB  1 
ATOM   31   C  CG  . LEU A 1 5   ? 20.313 14.524 41.252 1.00 26.45 ? 6   LEU A CG  1 
ATOM   32   C  CD1 . LEU A 1 5   ? 19.531 15.340 40.237 1.00 23.38 ? 6   LEU A CD1 1 
ATOM   33   C  CD2 . LEU A 1 5   ? 20.632 15.364 42.468 1.00 23.97 ? 6   LEU A CD2 1 
ATOM   34   N  N   . GLU A 1 6   ? 18.538 11.730 44.179 1.00 25.07 ? 7   GLU A N   1 
ATOM   35   C  CA  . GLU A 1 6   ? 17.468 10.984 44.789 1.00 27.55 ? 7   GLU A CA  1 
ATOM   36   C  C   . GLU A 1 6   ? 16.520 11.917 45.543 1.00 29.02 ? 7   GLU A C   1 
ATOM   37   O  O   . GLU A 1 6   ? 16.960 12.715 46.348 1.00 31.63 ? 7   GLU A O   1 
ATOM   38   C  CB  . GLU A 1 6   ? 18.081 9.927  45.713 1.00 32.74 ? 7   GLU A CB  1 
ATOM   39   C  CG  . GLU A 1 6   ? 17.060 9.121  46.486 1.00 40.97 ? 7   GLU A CG  1 
ATOM   40   C  CD  . GLU A 1 6   ? 17.714 8.207  47.479 1.00 60.00 ? 7   GLU A CD  1 
ATOM   41   O  OE1 . GLU A 1 6   ? 18.130 7.093  47.034 1.00 60.00 ? 7   GLU A OE1 1 
ATOM   42   O  OE2 . GLU A 1 6   ? 17.805 8.531  48.664 1.00 60.00 ? 7   GLU A OE2 1 
ATOM   43   N  N   . SER A 1 7   ? 15.224 11.875 45.257 1.00 22.57 ? 8   SER A N   1 
ATOM   44   C  CA  . SER A 1 7   ? 14.340 12.797 45.925 1.00 19.42 ? 8   SER A CA  1 
ATOM   45   C  C   . SER A 1 7   ? 12.985 12.241 45.968 1.00 23.01 ? 8   SER A C   1 
ATOM   46   O  O   . SER A 1 7   ? 12.647 11.348 45.216 1.00 25.79 ? 8   SER A O   1 
ATOM   47   C  CB  . SER A 1 7   ? 14.224 14.138 45.173 1.00 23.51 ? 8   SER A CB  1 
ATOM   48   O  OG  . SER A 1 7   ? 15.492 14.744 44.935 1.00 30.82 ? 8   SER A OG  1 
ATOM   49   N  N   . ILE A 1 8   ? 12.154 12.896 46.762 1.00 25.24 ? 9   ILE A N   1 
ATOM   50   C  CA  . ILE A 1 8   ? 10.717 12.586 46.818 1.00 27.30 ? 9   ILE A CA  1 
ATOM   51   C  C   . ILE A 1 8   ? 9.928  13.643 46.033 1.00 33.32 ? 9   ILE A C   1 
ATOM   52   O  O   . ILE A 1 8   ? 9.944  14.841 46.352 1.00 29.01 ? 9   ILE A O   1 
ATOM   53   C  CB  . ILE A 1 8   ? 10.141 12.492 48.280 1.00 25.94 ? 9   ILE A CB  1 
ATOM   54   C  CG1 . ILE A 1 8   ? 10.730 11.243 48.955 1.00 26.56 ? 9   ILE A CG1 1 
ATOM   55   C  CG2 . ILE A 1 8   ? 8.548  12.444 48.301 1.00 11.73 ? 9   ILE A CG2 1 
ATOM   56   C  CD1 . ILE A 1 8   ? 10.900 11.351 50.448 1.00 28.41 ? 9   ILE A CD1 1 
ATOM   57   N  N   . PHE A 1 9   ? 9.182  13.171 45.039 1.00 26.70 ? 10  PHE A N   1 
ATOM   58   C  CA  . PHE A 1 9   ? 8.429  14.071 44.213 1.00 21.82 ? 10  PHE A CA  1 
ATOM   59   C  C   . PHE A 1 9   ? 7.033  13.542 44.095 1.00 18.16 ? 10  PHE A C   1 
ATOM   60   O  O   . PHE A 1 9   ? 6.776  12.387 44.372 1.00 25.36 ? 10  PHE A O   1 
ATOM   61   C  CB  . PHE A 1 9   ? 9.032  14.067 42.799 1.00 22.84 ? 10  PHE A CB  1 
ATOM   62   C  CG  . PHE A 1 9   ? 10.365 14.752 42.668 1.00 24.96 ? 10  PHE A CG  1 
ATOM   63   C  CD1 . PHE A 1 9   ? 10.598 16.001 43.247 1.00 19.39 ? 10  PHE A CD1 1 
ATOM   64   C  CD2 . PHE A 1 9   ? 11.333 14.207 41.816 1.00 20.82 ? 10  PHE A CD2 1 
ATOM   65   C  CE1 . PHE A 1 9   ? 11.798 16.677 43.021 1.00 20.31 ? 10  PHE A CE1 1 
ATOM   66   C  CE2 . PHE A 1 9   ? 12.536 14.866 41.593 1.00 15.77 ? 10  PHE A CE2 1 
ATOM   67   C  CZ  . PHE A 1 9   ? 12.764 16.113 42.197 1.00 21.57 ? 10  PHE A CZ  1 
ATOM   68   N  N   . LEU A 1 10  ? 6.148  14.382 43.613 1.00 20.64 ? 11  LEU A N   1 
ATOM   69   C  CA  . LEU A 1 10  ? 4.797  14.009 43.306 1.00 18.71 ? 11  LEU A CA  1 
ATOM   70   C  C   . LEU A 1 10  ? 4.695  13.912 41.752 1.00 29.60 ? 11  LEU A C   1 
ATOM   71   O  O   . LEU A 1 10  ? 5.178  14.793 41.046 1.00 31.66 ? 11  LEU A O   1 
ATOM   72   C  CB  . LEU A 1 10  ? 3.890  15.118 43.846 1.00 17.92 ? 11  LEU A CB  1 
ATOM   73   C  CG  . LEU A 1 10  ? 2.447  14.912 43.470 1.00 29.29 ? 11  LEU A CG  1 
ATOM   74   C  CD1 . LEU A 1 10  ? 1.839  13.885 44.436 1.00 26.18 ? 11  LEU A CD1 1 
ATOM   75   C  CD2 . LEU A 1 10  ? 1.708  16.240 43.482 1.00 24.16 ? 11  LEU A CD2 1 
ATOM   76   N  N   . LYS A 1 11  ? 4.165  12.822 41.204 1.00 23.78 ? 12  LYS A N   1 
ATOM   77   C  CA  . LYS A 1 11  ? 4.127  12.698 39.734 1.00 21.70 ? 12  LYS A CA  1 
ATOM   78   C  C   . LYS A 1 11  ? 2.730  12.392 39.326 1.00 31.23 ? 12  LYS A C   1 
ATOM   79   O  O   . LYS A 1 11  ? 2.000  11.830 40.118 1.00 28.30 ? 12  LYS A O   1 
ATOM   80   C  CB  . LYS A 1 11  ? 5.012  11.554 39.295 1.00 17.09 ? 12  LYS A CB  1 
ATOM   81   C  CG  . LYS A 1 11  ? 4.491  10.247 39.838 1.00 23.36 ? 12  LYS A CG  1 
ATOM   82   C  CD  . LYS A 1 11  ? 5.188  9.057  39.217 1.00 28.09 ? 12  LYS A CD  1 
ATOM   83   C  CE  . LYS A 1 11  ? 4.372  8.542  38.039 1.00 20.96 ? 12  LYS A CE  1 
ATOM   84   N  NZ  . LYS A 1 11  ? 3.038  7.931  38.295 1.00 18.08 ? 12  LYS A NZ  1 
ATOM   85   N  N   . ARG A 1 12  ? 2.352  12.730 38.090 1.00 23.22 ? 13  ARG A N   1 
ATOM   86   C  CA  . ARG A 1 12  ? 1.012  12.409 37.600 1.00 23.72 ? 13  ARG A CA  1 
ATOM   87   C  C   . ARG A 1 12  ? 0.997  11.049 36.875 1.00 22.10 ? 13  ARG A C   1 
ATOM   88   O  O   . ARG A 1 12  ? 1.972  10.712 36.224 1.00 22.71 ? 13  ARG A O   1 
ATOM   89   C  CB  . ARG A 1 12  ? 0.627  13.501 36.608 1.00 25.42 ? 13  ARG A CB  1 
ATOM   90   C  CG  . ARG A 1 12  ? -0.833 13.596 36.268 1.00 23.84 ? 13  ARG A CG  1 
ATOM   91   C  CD  . ARG A 1 12  ? -1.095 14.776 35.331 1.00 22.22 ? 13  ARG A CD  1 
ATOM   92   N  NE  . ARG A 1 12  ? -0.965 14.398 33.930 1.00 28.42 ? 13  ARG A NE  1 
ATOM   93   C  CZ  . ARG A 1 12  ? -1.335 15.159 32.898 1.00 27.37 ? 13  ARG A CZ  1 
ATOM   94   N  NH1 . ARG A 1 12  ? -1.797 16.378 33.061 1.00 23.86 ? 13  ARG A NH1 1 
ATOM   95   N  NH2 . ARG A 1 12  ? -1.167 14.714 31.666 1.00 35.86 ? 13  ARG A NH2 1 
ATOM   96   N  N   . SER A 1 13  ? -0.116 10.308 36.906 1.00 20.29 ? 14  SER A N   1 
ATOM   97   C  CA  . SER A 1 13  ? -0.106 9.012  36.230 1.00 27.17 ? 14  SER A CA  1 
ATOM   98   C  C   . SER A 1 13  ? 0.124  9.231  34.755 1.00 36.32 ? 14  SER A C   1 
ATOM   99   O  O   . SER A 1 13  ? -0.370 10.198 34.231 1.00 31.57 ? 14  SER A O   1 
ATOM   100  C  CB  . SER A 1 13  ? -1.411 8.275  36.370 1.00 28.56 ? 14  SER A CB  1 
ATOM   101  O  OG  . SER A 1 13  ? -2.449 9.156  36.118 1.00 38.38 ? 14  SER A OG  1 
ATOM   102  N  N   . GLN A 1 14  ? 0.842  8.330  34.090 1.00 31.24 ? 15  GLN A N   1 
ATOM   103  C  CA  . GLN A 1 14  ? 1.076  8.467  32.677 1.00 20.65 ? 15  GLN A CA  1 
ATOM   104  C  C   . GLN A 1 14  ? -0.060 7.945  31.916 1.00 24.71 ? 15  GLN A C   1 
ATOM   105  O  O   . GLN A 1 14  ? -0.122 8.127  30.726 1.00 32.46 ? 15  GLN A O   1 
ATOM   106  C  CB  . GLN A 1 14  ? 2.301  7.729  32.296 1.00 19.39 ? 15  GLN A CB  1 
ATOM   107  C  CG  . GLN A 1 14  ? 3.443  8.355  33.041 1.00 19.66 ? 15  GLN A CG  1 
ATOM   108  C  CD  . GLN A 1 14  ? 4.743  7.870  32.551 1.00 29.29 ? 15  GLN A CD  1 
ATOM   109  O  OE1 . GLN A 1 14  ? 5.142  8.206  31.455 1.00 34.08 ? 15  GLN A OE1 1 
ATOM   110  N  NE2 . GLN A 1 14  ? 5.402  7.022  33.334 1.00 26.89 ? 15  GLN A NE2 1 
ATOM   111  N  N   . GLN A 1 15  ? -0.993 7.346  32.625 1.00 25.25 ? 16  GLN A N   1 
ATOM   112  C  CA  . GLN A 1 15  ? -2.187 6.747  32.029 1.00 26.84 ? 16  GLN A CA  1 
ATOM   113  C  C   . GLN A 1 15  ? -1.874 5.934  30.778 1.00 41.42 ? 16  GLN A C   1 
ATOM   114  O  O   . GLN A 1 15  ? -2.484 6.097  29.724 1.00 38.28 ? 16  GLN A O   1 
ATOM   115  C  CB  . GLN A 1 15  ? -3.191 7.798  31.680 1.00 26.35 ? 16  GLN A CB  1 
ATOM   116  C  CG  . GLN A 1 15  ? -4.036 8.185  32.845 1.00 32.18 ? 16  GLN A CG  1 
ATOM   117  C  CD  . GLN A 1 15  ? -5.075 9.212  32.438 1.00 33.95 ? 16  GLN A CD  1 
ATOM   118  O  OE1 . GLN A 1 15  ? -4.758 10.336 32.023 1.00 36.35 ? 16  GLN A OE1 1 
ATOM   119  N  NE2 . GLN A 1 15  ? -6.316 8.887  32.688 1.00 32.28 ? 16  GLN A NE2 1 
ATOM   120  N  N   . LYS A 1 16  ? -0.925 5.038  30.901 1.00 37.29 ? 17  LYS A N   1 
ATOM   121  C  CA  . LYS A 1 16  ? -0.595 4.208  29.806 1.00 29.70 ? 17  LYS A CA  1 
ATOM   122  C  C   . LYS A 1 16  ? -1.720 3.239  29.555 1.00 33.45 ? 17  LYS A C   1 
ATOM   123  O  O   . LYS A 1 16  ? -1.887 2.796  28.454 1.00 39.70 ? 17  LYS A O   1 
ATOM   124  C  CB  . LYS A 1 16  ? 0.692  3.482  30.074 1.00 25.50 ? 17  LYS A CB  1 
ATOM   125  C  CG  . LYS A 1 16  ? 1.866  4.310  29.751 1.00 28.72 ? 17  LYS A CG  1 
ATOM   126  C  CD  . LYS A 1 16  ? 3.072  3.900  30.521 1.00 30.54 ? 17  LYS A CD  1 
ATOM   127  C  CE  . LYS A 1 16  ? 4.275  4.673  30.023 1.00 29.13 ? 17  LYS A CE  1 
ATOM   128  N  NZ  . LYS A 1 16  ? 5.598  4.099  30.413 1.00 51.37 ? 17  LYS A NZ  1 
ATOM   129  N  N   . LYS A 1 17  ? -2.519 2.923  30.552 1.00 29.66 ? 18  LYS A N   1 
ATOM   130  C  CA  . LYS A 1 17  ? -3.586 2.013  30.288 1.00 21.06 ? 18  LYS A CA  1 
ATOM   131  C  C   . LYS A 1 17  ? -4.820 2.791  30.233 1.00 28.97 ? 18  LYS A C   1 
ATOM   132  O  O   . LYS A 1 17  ? -4.938 3.833  30.836 1.00 33.05 ? 18  LYS A O   1 
ATOM   133  C  CB  . LYS A 1 17  ? -3.667 0.875  31.309 1.00 25.18 ? 18  LYS A CB  1 
ATOM   134  C  CG  . LYS A 1 17  ? -2.272 0.315  31.631 1.00 23.38 ? 18  LYS A CG  1 
ATOM   135  C  CD  . LYS A 1 17  ? -2.231 -0.869 32.567 1.00 26.63 ? 18  LYS A CD  1 
ATOM   136  C  CE  . LYS A 1 17  ? -2.789 -0.592 33.926 1.00 27.25 ? 18  LYS A CE  1 
ATOM   137  N  NZ  . LYS A 1 17  ? -2.306 -1.614 34.889 1.00 34.25 ? 18  LYS A NZ  1 
ATOM   138  N  N   . LYS A 1 18  ? -5.699 2.332  29.383 1.00 34.23 ? 19  LYS A N   1 
ATOM   139  C  CA  . LYS A 1 18  ? -6.982 2.969  29.154 1.00 37.92 ? 19  LYS A CA  1 
ATOM   140  C  C   . LYS A 1 18  ? -7.836 3.178  30.416 1.00 33.81 ? 19  LYS A C   1 
ATOM   141  O  O   . LYS A 1 18  ? -8.510 4.177  30.567 1.00 38.20 ? 19  LYS A O   1 
ATOM   142  C  CB  . LYS A 1 18  ? -7.770 2.178  28.083 1.00 45.56 ? 19  LYS A CB  1 
ATOM   143  C  CG  . LYS A 1 18  ? -8.448 0.876  28.526 1.00 60.00 ? 19  LYS A CG  1 
ATOM   144  C  CD  . LYS A 1 18  ? -9.473 0.419  27.506 0.00 60.00 ? 19  LYS A CD  1 
ATOM   145  C  CE  . LYS A 1 18  ? -8.907 -0.639 26.576 0.00 60.00 ? 19  LYS A CE  1 
ATOM   146  N  NZ  . LYS A 1 18  ? -9.485 -0.568 25.220 0.00 60.00 ? 19  LYS A NZ  1 
ATOM   147  N  N   . THR A 1 19  ? -7.810 2.200  31.305 1.00 33.90 ? 20  THR A N   1 
ATOM   148  C  CA  . THR A 1 19  ? -8.607 2.190  32.515 1.00 27.07 ? 20  THR A CA  1 
ATOM   149  C  C   . THR A 1 19  ? -8.006 3.065  33.583 1.00 37.76 ? 20  THR A C   1 
ATOM   150  O  O   . THR A 1 19  ? -8.619 3.231  34.632 1.00 43.97 ? 20  THR A O   1 
ATOM   151  C  CB  . THR A 1 19  ? -8.655 0.773  33.108 1.00 31.99 ? 20  THR A CB  1 
ATOM   152  O  OG1 . THR A 1 19  ? -7.369 0.188  32.974 1.00 35.25 ? 20  THR A OG1 1 
ATOM   153  C  CG2 . THR A 1 19  ? -9.602 -0.100 32.347 1.00 42.60 ? 20  THR A CG2 1 
ATOM   154  N  N   . SER A 1 20  ? -6.773 3.537  33.380 1.00 31.28 ? 21  SER A N   1 
ATOM   155  C  CA  . SER A 1 20  ? -6.089 4.300  34.427 1.00 28.53 ? 21  SER A CA  1 
ATOM   156  C  C   . SER A 1 20  ? -6.668 5.654  34.685 1.00 31.65 ? 21  SER A C   1 
ATOM   157  O  O   . SER A 1 20  ? -6.952 6.387  33.760 1.00 38.31 ? 21  SER A O   1 
ATOM   158  C  CB  . SER A 1 20  ? -4.611 4.462  34.125 1.00 25.80 ? 21  SER A CB  1 
ATOM   159  O  OG  . SER A 1 20  ? -3.929 3.390  34.704 1.00 29.45 ? 21  SER A OG  1 
ATOM   160  N  N   . PRO A 1 21  ? -6.695 6.038  35.949 1.00 34.45 ? 22  PRO A N   1 
ATOM   161  C  CA  . PRO A 1 21  ? -7.156 7.365  36.318 1.00 34.42 ? 22  PRO A CA  1 
ATOM   162  C  C   . PRO A 1 21  ? -6.012 8.395  36.208 1.00 33.10 ? 22  PRO A C   1 
ATOM   163  O  O   . PRO A 1 21  ? -4.823 8.056  36.167 1.00 28.56 ? 22  PRO A O   1 
ATOM   164  C  CB  . PRO A 1 21  ? -7.477 7.202  37.800 1.00 33.50 ? 22  PRO A CB  1 
ATOM   165  C  CG  . PRO A 1 21  ? -6.421 6.225  38.293 1.00 32.00 ? 22  PRO A CG  1 
ATOM   166  C  CD  . PRO A 1 21  ? -6.227 5.265  37.130 1.00 31.76 ? 22  PRO A CD  1 
ATOM   167  N  N   . LEU A 1 22  ? -6.396 9.664  36.211 1.00 28.94 ? 23  LEU A N   1 
ATOM   168  C  CA  . LEU A 1 22  ? -5.445 10.724 36.251 1.00 30.21 ? 23  LEU A CA  1 
ATOM   169  C  C   . LEU A 1 22  ? -5.273 11.129 37.682 1.00 36.16 ? 23  LEU A C   1 
ATOM   170  O  O   . LEU A 1 22  ? -6.092 11.829 38.223 1.00 46.04 ? 23  LEU A O   1 
ATOM   171  C  CB  . LEU A 1 22  ? -5.938 11.933 35.452 1.00 30.64 ? 23  LEU A CB  1 
ATOM   172  C  CG  . LEU A 1 22  ? -4.745 12.872 35.160 1.00 37.60 ? 23  LEU A CG  1 
ATOM   173  C  CD1 . LEU A 1 22  ? -3.709 12.280 34.195 1.00 32.79 ? 23  LEU A CD1 1 
ATOM   174  C  CD2 . LEU A 1 22  ? -5.286 14.134 34.565 1.00 43.72 ? 23  LEU A CD2 1 
ATOM   175  N  N   . ASN A 1 23  ? -4.237 10.650 38.319 1.00 36.24 ? 24  ASN A N   1 
ATOM   176  C  CA  . ASN A 1 23  ? -4.031 11.003 39.674 1.00 29.98 ? 24  ASN A CA  1 
ATOM   177  C  C   . ASN A 1 23  ? -2.583 11.200 39.908 1.00 27.71 ? 24  ASN A C   1 
ATOM   178  O  O   . ASN A 1 23  ? -1.765 11.094 38.988 1.00 25.27 ? 24  ASN A O   1 
ATOM   179  C  CB  . ASN A 1 23  ? -4.638 9.956  40.584 1.00 23.45 ? 24  ASN A CB  1 
ATOM   180  C  CG  . ASN A 1 23  ? -4.103 8.575  40.325 1.00 24.09 ? 24  ASN A CG  1 
ATOM   181  O  OD1 . ASN A 1 23  ? -4.781 7.613  40.617 1.00 32.07 ? 24  ASN A OD1 1 
ATOM   182  N  ND2 . ASN A 1 23  ? -2.845 8.467  39.949 1.00 23.03 ? 24  ASN A ND2 1 
ATOM   183  N  N   . PHE A 1 24  ? -2.293 11.657 41.110 1.00 23.86 ? 25  PHE A N   1 
ATOM   184  C  CA  . PHE A 1 24  ? -0.956 12.000 41.499 1.00 19.63 ? 25  PHE A CA  1 
ATOM   185  C  C   . PHE A 1 24  ? -0.469 11.111 42.613 1.00 22.68 ? 25  PHE A C   1 
ATOM   186  O  O   . PHE A 1 24  ? -1.218 10.838 43.511 1.00 24.54 ? 25  PHE A O   1 
ATOM   187  C  CB  . PHE A 1 24  ? -0.983 13.441 41.965 1.00 21.03 ? 25  PHE A CB  1 
ATOM   188  C  CG  . PHE A 1 24  ? -1.333 14.392 40.885 1.00 22.48 ? 25  PHE A CG  1 
ATOM   189  C  CD1 . PHE A 1 24  ? -2.658 14.527 40.472 1.00 26.11 ? 25  PHE A CD1 1 
ATOM   190  C  CD2 . PHE A 1 24  ? -0.333 15.130 40.238 1.00 23.89 ? 25  PHE A CD2 1 
ATOM   191  C  CE1 . PHE A 1 24  ? -3.003 15.392 39.429 1.00 21.21 ? 25  PHE A CE1 1 
ATOM   192  C  CE2 . PHE A 1 24  ? -0.653 15.992 39.189 1.00 21.27 ? 25  PHE A CE2 1 
ATOM   193  C  CZ  . PHE A 1 24  ? -1.995 16.125 38.795 1.00 24.85 ? 25  PHE A CZ  1 
ATOM   194  N  N   . LYS A 1 25  ? 0.806  10.744 42.609 1.00 22.11 ? 26  LYS A N   1 
ATOM   195  C  CA  . LYS A 1 25  ? 1.353  9.858  43.629 1.00 22.41 ? 26  LYS A CA  1 
ATOM   196  C  C   . LYS A 1 25  ? 2.665  10.431 44.061 1.00 26.46 ? 26  LYS A C   1 
ATOM   197  O  O   . LYS A 1 25  ? 3.400  10.843 43.200 1.00 29.31 ? 26  LYS A O   1 
ATOM   198  C  CB  . LYS A 1 25  ? 1.694  8.498  43.016 1.00 20.17 ? 26  LYS A CB  1 
ATOM   199  C  CG  . LYS A 1 25  ? 0.517  7.720  42.599 1.00 26.02 ? 26  LYS A CG  1 
ATOM   200  C  CD  . LYS A 1 25  ? -0.428 7.430  43.751 1.00 30.97 ? 26  LYS A CD  1 
ATOM   201  C  CE  . LYS A 1 25  ? -1.696 6.771  43.239 1.00 27.30 ? 26  LYS A CE  1 
ATOM   202  N  NZ  . LYS A 1 25  ? -2.619 6.522  44.317 1.00 37.55 ? 26  LYS A NZ  1 
ATOM   203  N  N   . LYS A 1 26  ? 3.037  10.257 45.340 1.00 24.33 ? 27  LYS A N   1 
ATOM   204  C  CA  . LYS A 1 26  ? 4.354  10.630 45.846 1.00 20.92 ? 27  LYS A CA  1 
ATOM   205  C  C   . LYS A 1 26  ? 5.233  9.446  45.659 1.00 19.43 ? 27  LYS A C   1 
ATOM   206  O  O   . LYS A 1 26  ? 4.840  8.331  45.957 1.00 23.26 ? 27  LYS A O   1 
ATOM   207  C  CB  . LYS A 1 26  ? 4.357  10.932 47.334 1.00 23.87 ? 27  LYS A CB  1 
ATOM   208  C  CG  . LYS A 1 26  ? 3.631  12.204 47.708 1.00 25.94 ? 27  LYS A CG  1 
ATOM   209  C  CD  . LYS A 1 26  ? 3.779  12.501 49.215 1.00 41.20 ? 27  LYS A CD  1 
ATOM   210  C  CE  . LYS A 1 26  ? 2.494  12.993 49.867 1.00 43.66 ? 27  LYS A CE  1 
ATOM   211  N  NZ  . LYS A 1 26  ? 2.720  14.160 50.741 0.00 53.45 ? 27  LYS A NZ  1 
ATOM   212  N  N   . ARG A 1 27  ? 6.422  9.699  45.099 1.00 22.00 ? 28  ARG A N   1 
ATOM   213  C  CA  . ARG A 1 27  ? 7.355  8.654  44.825 1.00 16.97 ? 28  ARG A CA  1 
ATOM   214  C  C   . ARG A 1 27  ? 8.768  9.036  45.113 1.00 17.52 ? 28  ARG A C   1 
ATOM   215  O  O   . ARG A 1 27  ? 9.168  10.179 45.016 1.00 25.60 ? 28  ARG A O   1 
ATOM   216  C  CB  . ARG A 1 27  ? 7.249  8.240  43.376 1.00 21.75 ? 28  ARG A CB  1 
ATOM   217  C  CG  . ARG A 1 27  ? 5.868  7.812  42.972 1.00 18.20 ? 28  ARG A CG  1 
ATOM   218  C  CD  . ARG A 1 27  ? 5.710  6.358  43.304 1.00 22.31 ? 28  ARG A CD  1 
ATOM   219  N  NE  . ARG A 1 27  ? 4.345  5.865  43.089 1.00 22.43 ? 28  ARG A NE  1 
ATOM   220  C  CZ  . ARG A 1 27  ? 3.501  5.456  44.037 1.00 24.65 ? 28  ARG A CZ  1 
ATOM   221  N  NH1 . ARG A 1 27  ? 3.714  5.747  45.304 1.00 27.41 ? 28  ARG A NH1 1 
ATOM   222  N  NH2 . ARG A 1 27  ? 2.361  4.869  43.693 1.00 20.87 ? 28  ARG A NH2 1 
ATOM   223  N  N   . LEU A 1 28  ? 9.561  8.040  45.404 1.00 19.11 ? 29  LEU A N   1 
ATOM   224  C  CA  . LEU A 1 28  ? 10.961 8.296  45.545 1.00 19.15 ? 29  LEU A CA  1 
ATOM   225  C  C   . LEU A 1 28  ? 11.565 8.155  44.130 1.00 27.36 ? 29  LEU A C   1 
ATOM   226  O  O   . LEU A 1 28  ? 11.486 7.098  43.493 1.00 23.77 ? 29  LEU A O   1 
ATOM   227  C  CB  . LEU A 1 28  ? 11.572 7.224  46.459 1.00 18.10 ? 29  LEU A CB  1 
ATOM   228  C  CG  . LEU A 1 28  ? 13.097 7.323  46.628 1.00 32.52 ? 29  LEU A CG  1 
ATOM   229  C  CD1 . LEU A 1 28  ? 13.438 8.427  47.578 1.00 40.19 ? 29  LEU A CD1 1 
ATOM   230  C  CD2 . LEU A 1 28  ? 13.722 6.034  47.143 1.00 34.45 ? 29  LEU A CD2 1 
ATOM   231  N  N   . PHE A 1 29  ? 12.182 9.214  43.635 1.00 31.37 ? 30  PHE A N   1 
ATOM   232  C  CA  . PHE A 1 29  ? 12.828 9.126  42.343 1.00 22.36 ? 30  PHE A CA  1 
ATOM   233  C  C   . PHE A 1 29  ? 14.303 8.945  42.524 1.00 23.74 ? 30  PHE A C   1 
ATOM   234  O  O   . PHE A 1 29  ? 14.903 9.620  43.328 1.00 23.69 ? 30  PHE A O   1 
ATOM   235  C  CB  . PHE A 1 29  ? 12.633 10.419 41.571 1.00 18.48 ? 30  PHE A CB  1 
ATOM   236  C  CG  . PHE A 1 29  ? 11.298 10.502 40.923 1.00 23.49 ? 30  PHE A CG  1 
ATOM   237  C  CD1 . PHE A 1 29  ? 10.170 10.768 41.702 1.00 20.86 ? 30  PHE A CD1 1 
ATOM   238  C  CD2 . PHE A 1 29  ? 11.158 10.311 39.548 1.00 18.43 ? 30  PHE A CD2 1 
ATOM   239  C  CE1 . PHE A 1 29  ? 8.896  10.786 41.141 1.00 22.60 ? 30  PHE A CE1 1 
ATOM   240  C  CE2 . PHE A 1 29  ? 9.892  10.354 38.973 1.00 19.95 ? 30  PHE A CE2 1 
ATOM   241  C  CZ  . PHE A 1 29  ? 8.759  10.588 39.771 1.00 24.69 ? 30  PHE A CZ  1 
ATOM   242  N  N   . LEU A 1 30  ? 14.902 8.057  41.747 1.00 28.19 ? 31  LEU A N   1 
ATOM   243  C  CA  . LEU A 1 30  ? 16.345 8.006  41.660 1.00 25.07 ? 31  LEU A CA  1 
ATOM   244  C  C   . LEU A 1 30  ? 16.781 8.151  40.203 1.00 32.77 ? 31  LEU A C   1 
ATOM   245  O  O   . LEU A 1 30  ? 16.147 7.631  39.264 1.00 32.99 ? 31  LEU A O   1 
ATOM   246  C  CB  . LEU A 1 30  ? 16.997 6.740  42.222 1.00 27.57 ? 31  LEU A CB  1 
ATOM   247  C  CG  . LEU A 1 30  ? 16.299 5.860  43.220 1.00 36.93 ? 31  LEU A CG  1 
ATOM   248  C  CD1 . LEU A 1 30  ? 17.309 4.807  43.618 1.00 29.36 ? 31  LEU A CD1 1 
ATOM   249  C  CD2 . LEU A 1 30  ? 15.867 6.668  44.418 1.00 44.35 ? 31  LEU A CD2 1 
ATOM   250  N  N   . LEU A 1 31  ? 17.933 8.765  40.049 1.00 27.49 ? 32  LEU A N   1 
ATOM   251  C  CA  . LEU A 1 31  ? 18.532 8.895  38.750 1.00 25.20 ? 32  LEU A CA  1 
ATOM   252  C  C   . LEU A 1 31  ? 19.895 8.241  38.717 1.00 26.44 ? 32  LEU A C   1 
ATOM   253  O  O   . LEU A 1 31  ? 20.771 8.637  39.464 1.00 25.07 ? 32  LEU A O   1 
ATOM   254  C  CB  . LEU A 1 31  ? 18.704 10.408 38.417 1.00 24.57 ? 32  LEU A CB  1 
ATOM   255  C  CG  . LEU A 1 31  ? 19.396 10.795 37.086 1.00 21.72 ? 32  LEU A CG  1 
ATOM   256  C  CD1 . LEU A 1 31  ? 18.512 10.331 35.971 1.00 20.51 ? 32  LEU A CD1 1 
ATOM   257  C  CD2 . LEU A 1 31  ? 19.573 12.272 37.015 1.00 19.39 ? 32  LEU A CD2 1 
ATOM   258  N  N   . THR A 1 32  ? 20.103 7.338  37.765 1.00 25.47 ? 33  THR A N   1 
ATOM   259  C  CA  . THR A 1 32  ? 21.440 6.886  37.419 1.00 24.22 ? 33  THR A CA  1 
ATOM   260  C  C   . THR A 1 32  ? 21.690 7.198  35.947 1.00 34.43 ? 33  THR A C   1 
ATOM   261  O  O   . THR A 1 32  ? 20.827 7.671  35.223 1.00 30.01 ? 33  THR A O   1 
ATOM   262  C  CB  . THR A 1 32  ? 21.628 5.380  37.600 1.00 28.89 ? 33  THR A CB  1 
ATOM   263  O  OG1 . THR A 1 32  ? 20.798 4.671  36.689 1.00 29.42 ? 33  THR A OG1 1 
ATOM   264  C  CG2 . THR A 1 32  ? 21.294 4.972  39.034 1.00 26.32 ? 33  THR A CG2 1 
ATOM   265  N  N   . VAL A 1 33  ? 22.848 6.835  35.472 1.00 31.07 ? 34  VAL A N   1 
ATOM   266  C  CA  . VAL A 1 33  ? 23.113 6.974  34.066 1.00 30.01 ? 34  VAL A CA  1 
ATOM   267  C  C   . VAL A 1 33  ? 22.304 6.019  33.219 1.00 35.55 ? 34  VAL A C   1 
ATOM   268  O  O   . VAL A 1 33  ? 22.143 6.205  32.018 1.00 34.27 ? 34  VAL A O   1 
ATOM   269  C  CB  . VAL A 1 33  ? 24.583 6.744  33.766 1.00 30.78 ? 34  VAL A CB  1 
ATOM   270  C  CG1 . VAL A 1 33  ? 25.414 7.830  34.447 1.00 23.77 ? 34  VAL A CG1 1 
ATOM   271  C  CG2 . VAL A 1 33  ? 24.995 5.294  34.070 1.00 28.71 ? 34  VAL A CG2 1 
ATOM   272  N  N   . HIS A 1 34  ? 21.802 4.975  33.815 1.00 28.14 ? 35  HIS A N   1 
ATOM   273  C  CA  . HIS A 1 34  ? 20.945 4.129  33.049 1.00 24.74 ? 35  HIS A CA  1 
ATOM   274  C  C   . HIS A 1 34  ? 19.489 4.555  32.998 1.00 32.99 ? 35  HIS A C   1 
ATOM   275  O  O   . HIS A 1 34  ? 18.780 4.347  31.979 1.00 31.70 ? 35  HIS A O   1 
ATOM   276  C  CB  . HIS A 1 34  ? 20.897 2.824  33.689 1.00 32.05 ? 35  HIS A CB  1 
ATOM   277  C  CG  . HIS A 1 34  ? 22.037 2.006  33.346 1.00 40.38 ? 35  HIS A CG  1 
ATOM   278  N  ND1 . HIS A 1 34  ? 22.035 1.215  32.221 1.00 46.32 ? 35  HIS A ND1 1 
ATOM   279  C  CD2 . HIS A 1 34  ? 23.254 1.911  33.913 1.00 45.24 ? 35  HIS A CD2 1 
ATOM   280  C  CE1 . HIS A 1 34  ? 23.188 0.579  32.172 1.00 47.73 ? 35  HIS A CE1 1 
ATOM   281  N  NE2 . HIS A 1 34  ? 23.942 0.981  33.189 1.00 47.98 ? 35  HIS A NE2 1 
ATOM   282  N  N   . LYS A 1 35  ? 18.956 4.879  34.180 1.00 36.06 ? 36  LYS A N   1 
ATOM   283  C  CA  . LYS A 1 35  ? 17.532 5.181  34.274 1.00 28.81 ? 36  LYS A CA  1 
ATOM   284  C  C   . LYS A 1 35  ? 17.129 6.237  35.228 1.00 25.50 ? 36  LYS A C   1 
ATOM   285  O  O   . LYS A 1 35  ? 17.775 6.476  36.227 1.00 27.09 ? 36  LYS A O   1 
ATOM   286  C  CB  . LYS A 1 35  ? 16.744 3.987  34.703 1.00 25.90 ? 36  LYS A CB  1 
ATOM   287  C  CG  . LYS A 1 35  ? 17.044 2.728  34.025 1.00 23.27 ? 36  LYS A CG  1 
ATOM   288  C  CD  . LYS A 1 35  ? 15.861 1.836  34.266 1.00 36.76 ? 36  LYS A CD  1 
ATOM   289  C  CE  . LYS A 1 35  ? 16.161 0.387  33.938 1.00 60.00 ? 36  LYS A CE  1 
ATOM   290  N  NZ  . LYS A 1 35  ? 17.177 0.252  32.849 1.00 60.00 ? 36  LYS A NZ  1 
ATOM   291  N  N   . LEU A 1 36  ? 15.951 6.744  34.952 1.00 21.83 ? 37  LEU A N   1 
ATOM   292  C  CA  . LEU A 1 36  ? 15.249 7.535  35.891 1.00 25.73 ? 37  LEU A CA  1 
ATOM   293  C  C   . LEU A 1 36  ? 14.129 6.606  36.360 1.00 24.60 ? 37  LEU A C   1 
ATOM   294  O  O   . LEU A 1 36  ? 13.284 6.162  35.552 1.00 23.74 ? 37  LEU A O   1 
ATOM   295  C  CB  . LEU A 1 36  ? 14.692 8.794  35.252 1.00 22.74 ? 37  LEU A CB  1 
ATOM   296  C  CG  . LEU A 1 36  ? 13.740 9.485  36.193 1.00 24.13 ? 37  LEU A CG  1 
ATOM   297  C  CD1 . LEU A 1 36  ? 14.527 10.265 37.233 1.00 17.41 ? 37  LEU A CD1 1 
ATOM   298  C  CD2 . LEU A 1 36  ? 12.823 10.391 35.415 1.00 19.13 ? 37  LEU A CD2 1 
ATOM   299  N  N   . SER A 1 37  ? 14.219 6.193  37.624 1.00 20.60 ? 38  SER A N   1 
ATOM   300  C  CA  . SER A 1 37  ? 13.265 5.265  38.155 1.00 22.50 ? 38  SER A CA  1 
ATOM   301  C  C   . SER A 1 37  ? 12.565 5.875  39.296 1.00 26.34 ? 38  SER A C   1 
ATOM   302  O  O   . SER A 1 37  ? 13.094 6.729  39.962 1.00 26.97 ? 38  SER A O   1 
ATOM   303  C  CB  . SER A 1 37  ? 13.944 4.072  38.731 1.00 28.72 ? 38  SER A CB  1 
ATOM   304  O  OG  . SER A 1 37  ? 14.777 3.508  37.801 1.00 33.14 ? 38  SER A OG  1 
ATOM   305  N  N   . TYR A 1 38  ? 11.393 5.342  39.570 1.00 26.57 ? 39  TYR A N   1 
ATOM   306  C  CA  . TYR A 1 38  ? 10.616 5.815  40.689 1.00 25.53 ? 39  TYR A CA  1 
ATOM   307  C  C   . TYR A 1 38  ? 10.002 4.638  41.448 1.00 26.15 ? 39  TYR A C   1 
ATOM   308  O  O   . TYR A 1 38  ? 9.525  3.666  40.862 1.00 25.14 ? 39  TYR A O   1 
ATOM   309  C  CB  . TYR A 1 38  ? 9.560  6.886  40.300 1.00 19.28 ? 39  TYR A CB  1 
ATOM   310  C  CG  . TYR A 1 38  ? 8.592  6.508  39.168 1.00 21.05 ? 39  TYR A CG  1 
ATOM   311  C  CD1 . TYR A 1 38  ? 8.903  6.797  37.825 1.00 24.31 ? 39  TYR A CD1 1 
ATOM   312  C  CD2 . TYR A 1 38  ? 7.350  5.936  39.449 1.00 17.73 ? 39  TYR A CD2 1 
ATOM   313  C  CE1 . TYR A 1 38  ? 8.007  6.501  36.793 1.00 20.10 ? 39  TYR A CE1 1 
ATOM   314  C  CE2 . TYR A 1 38  ? 6.412  5.709  38.443 1.00 20.14 ? 39  TYR A CE2 1 
ATOM   315  C  CZ  . TYR A 1 38  ? 6.765  5.959  37.109 1.00 32.54 ? 39  TYR A CZ  1 
ATOM   316  O  OH  . TYR A 1 38  ? 5.869  5.729  36.090 1.00 27.91 ? 39  TYR A OH  1 
ATOM   317  N  N   . TYR A 1 39  ? 9.948  4.802  42.758 1.00 27.07 ? 40  TYR A N   1 
ATOM   318  C  CA  . TYR A 1 39  ? 9.444  3.783  43.655 1.00 25.90 ? 40  TYR A CA  1 
ATOM   319  C  C   . TYR A 1 39  ? 8.423  4.311  44.645 1.00 20.14 ? 40  TYR A C   1 
ATOM   320  O  O   . TYR A 1 39  ? 8.427  5.475  44.981 1.00 26.47 ? 40  TYR A O   1 
ATOM   321  C  CB  . TYR A 1 39  ? 10.631 3.374  44.510 1.00 23.66 ? 40  TYR A CB  1 
ATOM   322  C  CG  . TYR A 1 39  ? 11.826 2.924  43.720 1.00 23.16 ? 40  TYR A CG  1 
ATOM   323  C  CD1 . TYR A 1 39  ? 12.709 3.862  43.201 1.00 23.59 ? 40  TYR A CD1 1 
ATOM   324  C  CD2 . TYR A 1 39  ? 12.026 1.571  43.433 1.00 20.80 ? 40  TYR A CD2 1 
ATOM   325  C  CE1 . TYR A 1 39  ? 13.760 3.453  42.386 1.00 23.78 ? 40  TYR A CE1 1 
ATOM   326  C  CE2 . TYR A 1 39  ? 13.118 1.143  42.685 1.00 19.32 ? 40  TYR A CE2 1 
ATOM   327  C  CZ  . TYR A 1 39  ? 13.965 2.094  42.127 1.00 32.83 ? 40  TYR A CZ  1 
ATOM   328  O  OH  . TYR A 1 39  ? 15.125 1.689  41.460 1.00 37.32 ? 40  TYR A OH  1 
ATOM   329  N  N   . LYS A 1 40  ? 7.663  3.397  45.219 1.00 22.29 ? 41  LYS A N   1 
ATOM   330  C  CA  . LYS A 1 40  ? 6.856  3.644  46.401 1.00 25.03 ? 41  LYS A CA  1 
ATOM   331  C  C   . LYS A 1 40  ? 7.845  3.945  47.564 1.00 30.00 ? 41  LYS A C   1 
ATOM   332  O  O   . LYS A 1 40  ? 8.922  3.370  47.634 1.00 31.12 ? 41  LYS A O   1 
ATOM   333  C  CB  . LYS A 1 40  ? 6.040  2.392  46.744 1.00 26.54 ? 41  LYS A CB  1 
ATOM   334  C  CG  . LYS A 1 40  ? 4.640  2.726  47.204 1.00 44.27 ? 41  LYS A CG  1 
ATOM   335  C  CD  . LYS A 1 40  ? 3.972  1.592  47.957 1.00 60.00 ? 41  LYS A CD  1 
ATOM   336  C  CE  . LYS A 1 40  ? 2.991  2.090  49.011 1.00 60.00 ? 41  LYS A CE  1 
ATOM   337  N  NZ  . LYS A 1 40  ? 3.645  2.327  50.353 1.00 60.00 ? 41  LYS A NZ  1 
ATOM   338  N  N   . TYR A 1 41  ? 7.544  4.925  48.407 1.00 25.82 ? 42  TYR A N   1 
ATOM   339  C  CA  . TYR A 1 41  ? 8.463  5.245  49.457 1.00 22.10 ? 42  TYR A CA  1 
ATOM   340  C  C   . TYR A 1 41  ? 7.905  4.727  50.763 1.00 27.84 ? 42  TYR A C   1 
ATOM   341  O  O   . TYR A 1 41  ? 6.763  4.975  51.115 1.00 25.49 ? 42  TYR A O   1 
ATOM   342  C  CB  . TYR A 1 41  ? 8.612  6.733  49.562 1.00 27.30 ? 42  TYR A CB  1 
ATOM   343  C  CG  . TYR A 1 41  ? 9.542  7.086  50.666 1.00 34.62 ? 42  TYR A CG  1 
ATOM   344  C  CD1 . TYR A 1 41  ? 10.858 6.620  50.691 1.00 33.13 ? 42  TYR A CD1 1 
ATOM   345  C  CD2 . TYR A 1 41  ? 9.064  7.795  51.759 1.00 36.33 ? 42  TYR A CD2 1 
ATOM   346  C  CE1 . TYR A 1 41  ? 11.719 6.932  51.743 1.00 27.90 ? 42  TYR A CE1 1 
ATOM   347  C  CE2 . TYR A 1 41  ? 9.924  8.186  52.773 1.00 30.65 ? 42  TYR A CE2 1 
ATOM   348  C  CZ  . TYR A 1 41  ? 11.225 7.722  52.781 1.00 34.04 ? 42  TYR A CZ  1 
ATOM   349  O  OH  . TYR A 1 41  ? 11.975 8.154  53.826 1.00 47.82 ? 42  TYR A OH  1 
ATOM   350  N  N   . ASP A 1 42  ? 8.674  3.926  51.439 1.00 24.85 ? 43  ASP A N   1 
ATOM   351  C  CA  . ASP A 1 42  ? 8.160  3.311  52.621 1.00 25.52 ? 43  ASP A CA  1 
ATOM   352  C  C   . ASP A 1 42  ? 8.570  4.150  53.779 1.00 26.44 ? 43  ASP A C   1 
ATOM   353  O  O   . ASP A 1 42  ? 9.691  4.042  54.294 1.00 27.21 ? 43  ASP A O   1 
ATOM   354  C  CB  . ASP A 1 42  ? 8.845  2.006  52.772 1.00 29.38 ? 43  ASP A CB  1 
ATOM   355  C  CG  . ASP A 1 42  ? 8.590  1.435  54.090 1.00 52.72 ? 43  ASP A CG  1 
ATOM   356  O  OD1 . ASP A 1 42  ? 7.670  1.990  54.779 1.00 60.00 ? 43  ASP A OD1 1 
ATOM   357  O  OD2 . ASP A 1 42  ? 9.126  0.387  54.379 1.00 55.14 ? 43  ASP A OD2 1 
ATOM   358  N  N   . PHE A 1 43  ? 7.706  5.080  54.092 1.00 26.29 ? 44  PHE A N   1 
ATOM   359  C  CA  . PHE A 1 43  ? 8.005  6.066  55.092 1.00 32.36 ? 44  PHE A CA  1 
ATOM   360  C  C   . PHE A 1 43  ? 8.334  5.506  56.442 1.00 40.72 ? 44  PHE A C   1 
ATOM   361  O  O   . PHE A 1 43  ? 9.354  5.844  57.042 1.00 38.51 ? 44  PHE A O   1 
ATOM   362  C  CB  . PHE A 1 43  ? 6.867  7.018  55.228 1.00 33.02 ? 44  PHE A CB  1 
ATOM   363  C  CG  . PHE A 1 43  ? 6.982  7.916  56.406 1.00 32.75 ? 44  PHE A CG  1 
ATOM   364  C  CD1 . PHE A 1 43  ? 7.647  9.123  56.297 1.00 31.68 ? 44  PHE A CD1 1 
ATOM   365  C  CD2 . PHE A 1 43  ? 6.318  7.619  57.590 1.00 36.58 ? 44  PHE A CD2 1 
ATOM   366  C  CE1 . PHE A 1 43  ? 7.593  10.056 57.324 1.00 36.56 ? 44  PHE A CE1 1 
ATOM   367  C  CE2 . PHE A 1 43  ? 6.242  8.547  58.624 1.00 41.80 ? 44  PHE A CE2 1 
ATOM   368  C  CZ  . PHE A 1 43  ? 6.886  9.768  58.494 1.00 39.15 ? 44  PHE A CZ  1 
ATOM   369  N  N   . GLU A 1 44  ? 7.426  4.672  56.916 1.00 34.38 ? 45  GLU A N   1 
ATOM   370  C  CA  . GLU A 1 44  ? 7.610  3.997  58.159 1.00 37.39 ? 45  GLU A CA  1 
ATOM   371  C  C   . GLU A 1 44  ? 9.006  3.470  58.305 1.00 46.23 ? 45  GLU A C   1 
ATOM   372  O  O   . GLU A 1 44  ? 9.692  3.838  59.231 1.00 59.03 ? 45  GLU A O   1 
ATOM   373  C  CB  . GLU A 1 44  ? 6.580  2.896  58.389 1.00 37.96 ? 45  GLU A CB  1 
ATOM   374  C  CG  . GLU A 1 44  ? 5.192  3.488  58.682 1.00 60.00 ? 45  GLU A CG  1 
ATOM   375  C  CD  . GLU A 1 44  ? 5.108  4.205  60.029 1.00 60.00 ? 45  GLU A CD  1 
ATOM   376  O  OE1 . GLU A 1 44  ? 5.623  3.681  61.048 1.00 50.66 ? 45  GLU A OE1 1 
ATOM   377  O  OE2 . GLU A 1 44  ? 4.358  5.270  60.066 1.00 55.26 ? 45  GLU A OE2 1 
ATOM   378  N  N   . ARG A 1 45  ? 9.461  2.636  57.393 1.00 43.64 ? 46  ARG A N   1 
ATOM   379  C  CA  . ARG A 1 45  ? 10.805 2.073  57.549 1.00 36.86 ? 46  ARG A CA  1 
ATOM   380  C  C   . ARG A 1 45  ? 11.824 2.959  56.988 1.00 40.78 ? 46  ARG A C   1 
ATOM   381  O  O   . ARG A 1 45  ? 12.985 2.587  56.883 1.00 47.97 ? 46  ARG A O   1 
ATOM   382  C  CB  . ARG A 1 45  ? 10.973 0.734  56.883 1.00 45.16 ? 46  ARG A CB  1 
ATOM   383  C  CG  . ARG A 1 45  ? 10.259 -0.388 57.608 1.00 57.05 ? 46  ARG A CG  1 
ATOM   384  C  CD  . ARG A 1 45  ? 9.847  -1.537 56.685 1.00 60.00 ? 46  ARG A CD  1 
ATOM   385  N  NE  . ARG A 1 45  ? 8.424  -1.448 56.313 1.00 60.00 ? 46  ARG A NE  1 
ATOM   386  C  CZ  . ARG A 1 45  ? 7.604  -2.489 56.215 0.00 60.00 ? 46  ARG A CZ  1 
ATOM   387  N  NH1 . ARG A 1 45  ? 8.028  -3.712 56.492 0.00 47.47 ? 46  ARG A NH1 1 
ATOM   388  N  NH2 . ARG A 1 45  ? 6.339  -2.302 55.861 0.00 46.88 ? 46  ARG A NH2 1 
ATOM   389  N  N   . GLY A 1 46  ? 11.400 4.131  56.586 1.00 40.21 ? 47  GLY A N   1 
ATOM   390  C  CA  . GLY A 1 46  ? 12.356 5.036  56.031 1.00 38.90 ? 47  GLY A CA  1 
ATOM   391  C  C   . GLY A 1 46  ? 13.112 4.364  54.896 1.00 47.23 ? 47  GLY A C   1 
ATOM   392  O  O   . GLY A 1 46  ? 14.344 4.421  54.824 1.00 43.80 ? 47  GLY A O   1 
ATOM   393  N  N   . ARG A 1 47  ? 12.403 3.745  53.966 1.00 45.17 ? 48  ARG A N   1 
ATOM   394  C  CA  . ARG A 1 47  ? 13.144 3.241  52.841 1.00 40.99 ? 48  ARG A CA  1 
ATOM   395  C  C   . ARG A 1 47  ? 12.381 3.125  51.561 1.00 40.46 ? 48  ARG A C   1 
ATOM   396  O  O   . ARG A 1 47  ? 11.142 3.252  51.504 1.00 40.98 ? 48  ARG A O   1 
ATOM   397  C  CB  . ARG A 1 47  ? 13.785 1.934  53.139 1.00 36.29 ? 48  ARG A CB  1 
ATOM   398  C  CG  . ARG A 1 47  ? 12.761 0.860  53.302 1.00 37.54 ? 48  ARG A CG  1 
ATOM   399  C  CD  . ARG A 1 47  ? 13.434 -0.343 53.893 1.00 51.57 ? 48  ARG A CD  1 
ATOM   400  N  NE  . ARG A 1 47  ? 12.967 -1.575 53.322 0.00 52.67 ? 48  ARG A NE  1 
ATOM   401  C  CZ  . ARG A 1 47  ? 13.303 -2.750 53.818 0.00 60.00 ? 48  ARG A CZ  1 
ATOM   402  N  NH1 . ARG A 1 47  ? 14.096 -2.826 54.880 0.00 47.34 ? 48  ARG A NH1 1 
ATOM   403  N  NH2 . ARG A 1 47  ? 12.848 -3.861 53.253 0.00 47.20 ? 48  ARG A NH2 1 
ATOM   404  N  N   . ARG A 1 48  ? 13.154 2.760  50.558 1.00 29.45 ? 49  ARG A N   1 
ATOM   405  C  CA  . ARG A 1 48  ? 12.613 2.637  49.252 1.00 29.37 ? 49  ARG A CA  1 
ATOM   406  C  C   . ARG A 1 48  ? 11.771 1.438  49.121 1.00 27.44 ? 49  ARG A C   1 
ATOM   407  O  O   . ARG A 1 48  ? 12.261 0.349  49.239 1.00 43.82 ? 49  ARG A O   1 
ATOM   408  C  CB  . ARG A 1 48  ? 13.711 2.574  48.236 1.00 40.19 ? 49  ARG A CB  1 
ATOM   409  C  CG  . ARG A 1 48  ? 13.207 1.976  46.970 1.00 39.59 ? 49  ARG A CG  1 
ATOM   410  C  CD  . ARG A 1 48  ? 14.057 2.421  45.817 1.00 51.20 ? 49  ARG A CD  1 
ATOM   411  N  NE  . ARG A 1 48  ? 15.472 2.331  46.114 1.00 45.17 ? 49  ARG A NE  1 
ATOM   412  C  CZ  . ARG A 1 48  ? 16.245 1.272  45.847 1.00 60.00 ? 49  ARG A CZ  1 
ATOM   413  N  NH1 . ARG A 1 48  ? 15.739 0.149  45.340 1.00 58.67 ? 49  ARG A NH1 1 
ATOM   414  N  NH2 . ARG A 1 48  ? 17.547 1.324  46.162 1.00 60.00 ? 49  ARG A NH2 1 
ATOM   415  N  N   . GLY A 1 49  ? 10.554 1.635  48.685 1.00 24.57 ? 50  GLY A N   1 
ATOM   416  C  CA  . GLY A 1 49  ? 9.650  0.526  48.511 1.00 23.73 ? 50  GLY A CA  1 
ATOM   417  C  C   . GLY A 1 49  ? 9.754  -0.077 47.122 1.00 28.02 ? 50  GLY A C   1 
ATOM   418  O  O   . GLY A 1 49  ? 10.814 -0.033 46.511 1.00 27.76 ? 50  GLY A O   1 
ATOM   419  N  N   . SER A 1 50  ? 8.660  -0.667 46.653 1.00 21.08 ? 51  SER A N   1 
ATOM   420  C  CA  . SER A 1 50  ? 8.636  -1.341 45.370 1.00 27.11 ? 51  SER A CA  1 
ATOM   421  C  C   . SER A 1 50  ? 8.733  -0.360 44.182 1.00 32.42 ? 51  SER A C   1 
ATOM   422  O  O   . SER A 1 50  ? 8.152  0.720  44.182 1.00 33.59 ? 51  SER A O   1 
ATOM   423  C  CB  . SER A 1 50  ? 7.328  -2.108 45.215 1.00 30.29 ? 51  SER A CB  1 
ATOM   424  O  OG  . SER A 1 50  ? 6.331  -1.527 46.029 1.00 60.00 ? 51  SER A OG  1 
ATOM   425  N  N   . LYS A 1 51  ? 9.386  -0.800 43.125 1.00 31.64 ? 52  LYS A N   1 
ATOM   426  C  CA  . LYS A 1 51  ? 9.518  0.011  41.937 1.00 28.39 ? 52  LYS A CA  1 
ATOM   427  C  C   . LYS A 1 51  ? 8.206  0.193  41.242 1.00 25.94 ? 52  LYS A C   1 
ATOM   428  O  O   . LYS A 1 51  ? 7.443  -0.755 41.073 1.00 26.72 ? 52  LYS A O   1 
ATOM   429  C  CB  . LYS A 1 51  ? 10.515 -0.579 40.974 1.00 24.87 ? 52  LYS A CB  1 
ATOM   430  C  CG  . LYS A 1 51  ? 10.542 0.257  39.717 1.00 33.62 ? 52  LYS A CG  1 
ATOM   431  C  CD  . LYS A 1 51  ? 11.853 0.199  38.991 1.00 37.51 ? 52  LYS A CD  1 
ATOM   432  C  CE  . LYS A 1 51  ? 11.637 -0.529 37.666 1.00 49.49 ? 52  LYS A CE  1 
ATOM   433  N  NZ  . LYS A 1 51  ? 12.530 -0.122 36.544 1.00 60.00 ? 52  LYS A NZ  1 
ATOM   434  N  N   . LYS A 1 52  ? 7.907  1.431  40.899 1.00 18.40 ? 53  LYS A N   1 
ATOM   435  C  CA  . LYS A 1 52  ? 6.675  1.722  40.231 1.00 20.61 ? 53  LYS A CA  1 
ATOM   436  C  C   . LYS A 1 52  ? 6.838  1.995  38.746 1.00 21.30 ? 53  LYS A C   1 
ATOM   437  O  O   . LYS A 1 52  ? 5.885  1.950  38.040 1.00 23.48 ? 53  LYS A O   1 
ATOM   438  C  CB  . LYS A 1 52  ? 6.042  2.920  40.886 1.00 22.13 ? 53  LYS A CB  1 
ATOM   439  C  CG  . LYS A 1 52  ? 5.473  2.553  42.237 1.00 22.81 ? 53  LYS A CG  1 
ATOM   440  C  CD  . LYS A 1 52  ? 4.300  1.643  42.048 1.00 25.35 ? 53  LYS A CD  1 
ATOM   441  C  CE  . LYS A 1 52  ? 3.798  1.042  43.341 1.00 33.99 ? 53  LYS A CE  1 
ATOM   442  N  NZ  . LYS A 1 52  ? 2.509  0.314  43.180 1.00 36.95 ? 53  LYS A NZ  1 
ATOM   443  N  N   . GLY A 1 53  ? 8.019  2.377  38.300 1.00 25.03 ? 54  GLY A N   1 
ATOM   444  C  CA  . GLY A 1 53  ? 8.198  2.690  36.893 1.00 24.64 ? 54  GLY A CA  1 
ATOM   445  C  C   . GLY A 1 53  ? 9.574  3.218  36.673 1.00 26.80 ? 54  GLY A C   1 
ATOM   446  O  O   . GLY A 1 53  ? 10.315 3.462  37.629 1.00 25.46 ? 54  GLY A O   1 
ATOM   447  N  N   . SER A 1 54  ? 9.962  3.355  35.412 1.00 26.13 ? 55  SER A N   1 
ATOM   448  C  CA  . SER A 1 54  ? 11.277 3.896  35.104 1.00 25.87 ? 55  SER A CA  1 
ATOM   449  C  C   . SER A 1 54  ? 11.337 4.320  33.689 1.00 28.54 ? 55  SER A C   1 
ATOM   450  O  O   . SER A 1 54  ? 10.508 3.891  32.913 1.00 28.35 ? 55  SER A O   1 
ATOM   451  C  CB  . SER A 1 54  ? 12.417 2.907  35.344 1.00 28.40 ? 55  SER A CB  1 
ATOM   452  O  OG  . SER A 1 54  ? 12.209 1.720  34.601 1.00 28.54 ? 55  SER A OG  1 
ATOM   453  N  N   . ILE A 1 55  ? 12.353 5.105  33.359 1.00 23.80 ? 56  ILE A N   1 
ATOM   454  C  CA  . ILE A 1 55  ? 12.535 5.518  31.995 1.00 21.72 ? 56  ILE A CA  1 
ATOM   455  C  C   . ILE A 1 55  ? 13.988 5.368  31.687 1.00 24.76 ? 56  ILE A C   1 
ATOM   456  O  O   . ILE A 1 55  ? 14.793 5.749  32.511 1.00 29.65 ? 56  ILE A O   1 
ATOM   457  C  CB  . ILE A 1 55  ? 12.159 6.981  31.821 1.00 24.16 ? 56  ILE A CB  1 
ATOM   458  C  CG1 . ILE A 1 55  ? 10.652 7.155  31.895 1.00 16.32 ? 56  ILE A CG1 1 
ATOM   459  C  CG2 . ILE A 1 55  ? 12.630 7.509  30.467 1.00 30.21 ? 56  ILE A CG2 1 
ATOM   460  C  CD1 . ILE A 1 55  ? 10.328 8.590  32.208 1.00 18.51 ? 56  ILE A CD1 1 
ATOM   461  N  N   . ASP A 1 56  ? 14.339 4.783  30.535 1.00 22.88 ? 57  ASP A N   1 
ATOM   462  C  CA  . ASP A 1 56  ? 15.768 4.619  30.185 1.00 23.08 ? 57  ASP A CA  1 
ATOM   463  C  C   . ASP A 1 56  ? 16.284 5.910  29.731 1.00 21.58 ? 57  ASP A C   1 
ATOM   464  O  O   . ASP A 1 56  ? 15.611 6.612  28.987 1.00 22.45 ? 57  ASP A O   1 
ATOM   465  C  CB  . ASP A 1 56  ? 15.996 3.562  29.084 1.00 28.43 ? 57  ASP A CB  1 
ATOM   466  C  CG  . ASP A 1 56  ? 15.586 2.176  29.547 1.00 41.72 ? 57  ASP A CG  1 
ATOM   467  O  OD1 . ASP A 1 56  ? 15.524 1.922  30.749 1.00 56.37 ? 57  ASP A OD1 1 
ATOM   468  O  OD2 . ASP A 1 56  ? 15.128 1.378  28.676 1.00 46.18 ? 57  ASP A OD2 1 
ATOM   469  N  N   . VAL A 1 57  ? 17.380 6.316  30.348 1.00 23.37 ? 58  VAL A N   1 
ATOM   470  C  CA  . VAL A 1 57  ? 17.902 7.613  30.084 1.00 26.56 ? 58  VAL A CA  1 
ATOM   471  C  C   . VAL A 1 57  ? 18.181 7.817  28.600 1.00 35.64 ? 58  VAL A C   1 
ATOM   472  O  O   . VAL A 1 57  ? 18.045 8.908  28.091 1.00 33.88 ? 58  VAL A O   1 
ATOM   473  C  CB  . VAL A 1 57  ? 19.167 7.845  30.873 1.00 29.23 ? 58  VAL A CB  1 
ATOM   474  C  CG1 . VAL A 1 57  ? 19.814 9.113  30.408 1.00 23.55 ? 58  VAL A CG1 1 
ATOM   475  C  CG2 . VAL A 1 57  ? 18.829 8.017  32.328 1.00 32.42 ? 58  VAL A CG2 1 
ATOM   476  N  N   . GLU A 1 58  ? 18.539 6.779  27.879 1.00 24.76 ? 59  GLU A N   1 
ATOM   477  C  CA  . GLU A 1 58  ? 18.847 7.035  26.499 1.00 29.16 ? 59  GLU A CA  1 
ATOM   478  C  C   . GLU A 1 58  ? 17.631 7.215  25.671 1.00 29.10 ? 59  GLU A C   1 
ATOM   479  O  O   . GLU A 1 58  ? 17.734 7.561  24.506 1.00 34.72 ? 59  GLU A O   1 
ATOM   480  C  CB  . GLU A 1 58  ? 19.630 5.889  25.952 1.00 31.42 ? 59  GLU A CB  1 
ATOM   481  C  CG  . GLU A 1 58  ? 18.858 4.619  26.171 1.00 34.56 ? 59  GLU A CG  1 
ATOM   482  C  CD  . GLU A 1 58  ? 19.559 3.429  25.599 1.00 60.00 ? 59  GLU A CD  1 
ATOM   483  O  OE1 . GLU A 1 58  ? 20.771 3.518  25.359 1.00 60.00 ? 59  GLU A OE1 1 
ATOM   484  O  OE2 . GLU A 1 58  ? 18.859 2.349  25.447 1.00 58.77 ? 59  GLU A OE2 1 
ATOM   485  N  N   . LYS A 1 59  ? 16.467 6.998  26.260 1.00 21.79 ? 60  LYS A N   1 
ATOM   486  C  CA  . LYS A 1 59  ? 15.239 7.204  25.510 1.00 17.94 ? 60  LYS A CA  1 
ATOM   487  C  C   . LYS A 1 59  ? 14.618 8.609  25.711 1.00 22.59 ? 60  LYS A C   1 
ATOM   488  O  O   . LYS A 1 59  ? 13.608 9.014  25.125 1.00 31.54 ? 60  LYS A O   1 
ATOM   489  C  CB  . LYS A 1 59  ? 14.263 6.112  25.811 1.00 20.48 ? 60  LYS A CB  1 
ATOM   490  C  CG  . LYS A 1 59  ? 14.580 4.854  25.027 1.00 31.25 ? 60  LYS A CG  1 
ATOM   491  C  CD  . LYS A 1 59  ? 13.456 3.847  25.093 1.00 50.75 ? 60  LYS A CD  1 
ATOM   492  C  CE  . LYS A 1 59  ? 13.789 2.596  24.302 0.00 56.88 ? 60  LYS A CE  1 
ATOM   493  N  NZ  . LYS A 1 59  ? 12.840 2.361  23.198 0.00 60.00 ? 60  LYS A NZ  1 
ATOM   494  N  N   . ILE A 1 60  ? 15.230 9.384  26.567 1.00 22.50 ? 61  ILE A N   1 
ATOM   495  C  CA  . ILE A 1 60  ? 14.673 10.674 26.870 1.00 25.10 ? 61  ILE A CA  1 
ATOM   496  C  C   . ILE A 1 60  ? 14.992 11.660 25.750 1.00 31.00 ? 61  ILE A C   1 
ATOM   497  O  O   . ILE A 1 60  ? 16.147 11.755 25.319 1.00 24.99 ? 61  ILE A O   1 
ATOM   498  C  CB  . ILE A 1 60  ? 15.210 11.186 28.217 1.00 24.58 ? 61  ILE A CB  1 
ATOM   499  C  CG1 . ILE A 1 60  ? 14.636 10.347 29.372 1.00 29.43 ? 61  ILE A CG1 1 
ATOM   500  C  CG2 . ILE A 1 60  ? 14.891 12.683 28.400 1.00 19.04 ? 61  ILE A CG2 1 
ATOM   501  C  CD1 . ILE A 1 60  ? 15.435 10.517 30.645 1.00 21.80 ? 61  ILE A CD1 1 
ATOM   502  N  N   . THR A 1 61  ? 14.005 12.398 25.280 1.00 22.46 ? 62  THR A N   1 
ATOM   503  C  CA  . THR A 1 61  ? 14.278 13.281 24.195 1.00 19.45 ? 62  THR A CA  1 
ATOM   504  C  C   . THR A 1 61  ? 14.220 14.699 24.634 1.00 26.96 ? 62  THR A C   1 
ATOM   505  O  O   . THR A 1 61  ? 14.640 15.584 23.915 1.00 28.13 ? 62  THR A O   1 
ATOM   506  C  CB  . THR A 1 61  ? 13.236 13.095 23.172 1.00 20.97 ? 62  THR A CB  1 
ATOM   507  O  OG1 . THR A 1 61  ? 12.041 13.415 23.806 1.00 26.25 ? 62  THR A OG1 1 
ATOM   508  C  CG2 . THR A 1 61  ? 13.150 11.639 22.800 1.00 17.37 ? 62  THR A CG2 1 
ATOM   509  N  N   . CYS A 1 62  ? 13.725 14.949 25.838 1.00 28.57 ? 63  CYS A N   1 
ATOM   510  C  CA  . CYS A 1 62  ? 13.594 16.339 26.311 1.00 26.76 ? 63  CYS A CA  1 
ATOM   511  C  C   . CYS A 1 62  ? 13.240 16.414 27.782 1.00 20.51 ? 63  CYS A C   1 
ATOM   512  O  O   . CYS A 1 62  ? 12.370 15.636 28.243 1.00 22.68 ? 63  CYS A O   1 
ATOM   513  C  CB  . CYS A 1 62  ? 12.456 17.066 25.522 1.00 24.44 ? 63  CYS A CB  1 
ATOM   514  S  SG  . CYS A 1 62  ? 12.223 18.825 25.913 1.00 31.65 ? 63  CYS A SG  1 
ATOM   515  N  N   . VAL A 1 63  ? 13.831 17.418 28.423 1.00 22.42 ? 64  VAL A N   1 
ATOM   516  C  CA  . VAL A 1 63  ? 13.593 17.769 29.831 1.00 28.58 ? 64  VAL A CA  1 
ATOM   517  C  C   . VAL A 1 63  ? 13.469 19.291 30.000 1.00 24.49 ? 64  VAL A C   1 
ATOM   518  O  O   . VAL A 1 63  ? 14.433 20.003 29.819 1.00 26.52 ? 64  VAL A O   1 
ATOM   519  C  CB  . VAL A 1 63  ? 14.717 17.218 30.779 1.00 25.92 ? 64  VAL A CB  1 
ATOM   520  C  CG1 . VAL A 1 63  ? 14.515 17.723 32.212 1.00 23.88 ? 64  VAL A CG1 1 
ATOM   521  C  CG2 . VAL A 1 63  ? 14.632 15.703 30.826 1.00 23.12 ? 64  VAL A CG2 1 
ATOM   522  N  N   . GLU A 1 64  ? 12.292 19.766 30.443 1.00 22.10 ? 65  GLU A N   1 
ATOM   523  C  CA  . GLU A 1 64  ? 12.012 21.194 30.701 1.00 23.43 ? 65  GLU A CA  1 
ATOM   524  C  C   . GLU A 1 64  ? 11.031 21.411 31.868 1.00 23.83 ? 65  GLU A C   1 
ATOM   525  O  O   . GLU A 1 64  ? 10.419 20.482 32.368 1.00 18.95 ? 65  GLU A O   1 
ATOM   526  C  CB  . GLU A 1 64  ? 11.395 21.893 29.449 1.00 26.18 ? 65  GLU A CB  1 
ATOM   527  C  CG  . GLU A 1 64  ? 12.237 21.697 28.173 1.00 41.79 ? 65  GLU A CG  1 
ATOM   528  C  CD  . GLU A 1 64  ? 13.505 22.539 28.182 1.00 49.99 ? 65  GLU A CD  1 
ATOM   529  O  OE1 . GLU A 1 64  ? 13.610 23.544 28.909 1.00 45.16 ? 65  GLU A OE1 1 
ATOM   530  O  OE2 . GLU A 1 64  ? 14.424 22.162 27.386 1.00 40.50 ? 65  GLU A OE2 1 
ATOM   531  N  N   . THR A 1 65  ? 10.808 22.672 32.224 1.00 25.24 ? 66  THR A N   1 
ATOM   532  C  CA  . THR A 1 65  ? 9.769  22.994 33.160 1.00 21.50 ? 66  THR A CA  1 
ATOM   533  C  C   . THR A 1 65  ? 8.450  22.874 32.394 1.00 23.23 ? 66  THR A C   1 
ATOM   534  O  O   . THR A 1 65  ? 8.410  22.543 31.234 1.00 23.50 ? 66  THR A O   1 
ATOM   535  C  CB  . THR A 1 65  ? 9.968  24.411 33.751 1.00 20.02 ? 66  THR A CB  1 
ATOM   536  O  OG1 . THR A 1 65  ? 10.101 25.313 32.691 1.00 28.20 ? 66  THR A OG1 1 
ATOM   537  C  CG2 . THR A 1 65  ? 11.277 24.498 34.496 1.00 14.67 ? 66  THR A CG2 1 
ATOM   538  N  N   . VAL A 1 66  ? 7.357  23.057 33.075 1.00 22.51 ? 67  VAL A N   1 
ATOM   539  C  CA  . VAL A 1 66  ? 6.085  23.030 32.428 1.00 20.67 ? 67  VAL A CA  1 
ATOM   540  C  C   . VAL A 1 66  ? 5.419  24.264 32.962 1.00 23.58 ? 67  VAL A C   1 
ATOM   541  O  O   . VAL A 1 66  ? 5.710  24.683 34.051 1.00 28.08 ? 67  VAL A O   1 
ATOM   542  C  CB  . VAL A 1 66  ? 5.219  21.831 32.870 1.00 23.06 ? 67  VAL A CB  1 
ATOM   543  C  CG1 . VAL A 1 66  ? 3.893  21.883 32.109 1.00 22.74 ? 67  VAL A CG1 1 
ATOM   544  C  CG2 . VAL A 1 66  ? 5.935  20.510 32.641 1.00 21.26 ? 67  VAL A CG2 1 
ATOM   545  N  N   . VAL A 1 67  ? 4.564  24.868 32.181 1.00 26.51 ? 68  VAL A N   1 
ATOM   546  C  CA  . VAL A 1 67  ? 3.768  25.997 32.624 1.00 28.56 ? 68  VAL A CA  1 
ATOM   547  C  C   . VAL A 1 67  ? 2.816  25.417 33.701 1.00 31.37 ? 68  VAL A C   1 
ATOM   548  O  O   . VAL A 1 67  ? 2.245  24.362 33.521 1.00 30.82 ? 68  VAL A O   1 
ATOM   549  C  CB  . VAL A 1 67  ? 2.924  26.615 31.431 1.00 24.67 ? 68  VAL A CB  1 
ATOM   550  C  CG1 . VAL A 1 67  ? 1.892  27.582 31.947 1.00 21.87 ? 68  VAL A CG1 1 
ATOM   551  C  CG2 . VAL A 1 67  ? 3.783  27.302 30.366 1.00 15.90 ? 68  VAL A CG2 1 
ATOM   552  N  N   . PRO A 1 68  ? 2.655  26.102 34.820 1.00 29.06 ? 69  PRO A N   1 
ATOM   553  C  CA  . PRO A 1 68  ? 1.836  25.576 35.901 1.00 29.57 ? 69  PRO A CA  1 
ATOM   554  C  C   . PRO A 1 68  ? 0.390  25.452 35.591 1.00 21.62 ? 69  PRO A C   1 
ATOM   555  O  O   . PRO A 1 68  ? -0.166 26.246 34.816 1.00 27.46 ? 69  PRO A O   1 
ATOM   556  C  CB  . PRO A 1 68  ? 1.997  26.605 37.047 1.00 30.98 ? 69  PRO A CB  1 
ATOM   557  C  CG  . PRO A 1 68  ? 3.144  27.451 36.681 1.00 32.42 ? 69  PRO A CG  1 
ATOM   558  C  CD  . PRO A 1 68  ? 3.253  27.407 35.171 1.00 27.86 ? 69  PRO A CD  1 
ATOM   559  N  N   . GLU A 1 69  ? -0.255 24.576 36.360 1.00 25.00 ? 70  GLU A N   1 
ATOM   560  C  CA  . GLU A 1 69  ? -1.718 24.465 36.321 1.00 27.52 ? 70  GLU A CA  1 
ATOM   561  C  C   . GLU A 1 69  ? -2.278 25.802 36.696 1.00 30.46 ? 70  GLU A C   1 
ATOM   562  O  O   . GLU A 1 69  ? -1.756 26.466 37.603 1.00 30.42 ? 70  GLU A O   1 
ATOM   563  C  CB  . GLU A 1 69  ? -2.198 23.544 37.414 1.00 26.39 ? 70  GLU A CB  1 
ATOM   564  C  CG  . GLU A 1 69  ? -1.832 22.139 37.183 1.00 41.58 ? 70  GLU A CG  1 
ATOM   565  C  CD  . GLU A 1 69  ? -1.846 21.401 38.472 1.00 32.91 ? 70  GLU A CD  1 
ATOM   566  O  OE1 . GLU A 1 69  ? -0.922 21.550 39.237 1.00 44.72 ? 70  GLU A OE1 1 
ATOM   567  O  OE2 . GLU A 1 69  ? -2.871 20.678 38.713 1.00 48.10 ? 70  GLU A OE2 1 
ATOM   568  N  N   . LYS A 1 70  ? -3.376 26.174 36.061 1.00 30.74 ? 71  LYS A N   1 
ATOM   569  C  CA  . LYS A 1 70  ? -3.955 27.471 36.337 1.00 31.75 ? 71  LYS A CA  1 
ATOM   570  C  C   . LYS A 1 70  ? -4.619 27.538 37.692 1.00 44.61 ? 71  LYS A C   1 
ATOM   571  O  O   . LYS A 1 70  ? -4.529 28.528 38.385 1.00 51.99 ? 71  LYS A O   1 
ATOM   572  C  CB  . LYS A 1 70  ? -4.890 27.857 35.227 1.00 30.20 ? 71  LYS A CB  1 
ATOM   573  C  CG  . LYS A 1 70  ? -4.123 28.518 34.103 1.00 28.26 ? 71  LYS A CG  1 
ATOM   574  C  CD  . LYS A 1 70  ? -4.961 28.650 32.885 1.00 33.56 ? 71  LYS A CD  1 
ATOM   575  C  CE  . LYS A 1 70  ? -4.319 29.500 31.827 1.00 37.72 ? 71  LYS A CE  1 
ATOM   576  N  NZ  . LYS A 1 70  ? -5.258 29.698 30.720 1.00 29.68 ? 71  LYS A NZ  1 
ATOM   577  N  N   . ASN A 1 71  ? -5.181 26.420 38.102 1.00 40.96 ? 72  ASN A N   1 
ATOM   578  C  CA  . ASN A 1 71  ? -5.843 26.346 39.395 1.00 41.41 ? 72  ASN A CA  1 
ATOM   579  C  C   . ASN A 1 71  ? -5.494 25.104 40.195 1.00 38.55 ? 72  ASN A C   1 
ATOM   580  O  O   . ASN A 1 71  ? -6.360 24.259 40.374 1.00 33.89 ? 72  ASN A O   1 
ATOM   581  C  CB  . ASN A 1 71  ? -7.339 26.331 39.166 1.00 41.59 ? 72  ASN A CB  1 
ATOM   582  C  CG  . ASN A 1 71  ? -7.974 27.565 39.699 1.00 60.00 ? 72  ASN A CG  1 
ATOM   583  O  OD1 . ASN A 1 71  ? -8.150 27.650 40.938 1.00 60.00 ? 72  ASN A OD1 1 
ATOM   584  N  ND2 . ASN A 1 71  ? -7.957 28.638 38.885 1.00 60.00 ? 72  ASN A ND2 1 
ATOM   585  N  N   . PRO A 1 72  ? -4.231 24.971 40.628 1.00 33.41 ? 73  PRO A N   1 
ATOM   586  C  CA  . PRO A 1 72  ? -3.818 23.785 41.361 1.00 32.79 ? 73  PRO A CA  1 
ATOM   587  C  C   . PRO A 1 72  ? -4.546 23.660 42.704 1.00 47.59 ? 73  PRO A C   1 
ATOM   588  O  O   . PRO A 1 72  ? -4.861 24.642 43.385 1.00 45.49 ? 73  PRO A O   1 
ATOM   589  C  CB  . PRO A 1 72  ? -2.352 24.055 41.669 1.00 29.47 ? 73  PRO A CB  1 
ATOM   590  C  CG  . PRO A 1 72  ? -2.181 25.546 41.607 1.00 31.01 ? 73  PRO A CG  1 
ATOM   591  C  CD  . PRO A 1 72  ? -3.204 26.038 40.636 1.00 29.23 ? 73  PRO A CD  1 
ATOM   592  N  N   . PRO A 1 73  ? -4.714 22.442 43.145 1.00 37.32 ? 74  PRO A N   1 
ATOM   593  C  CA  . PRO A 1 73  ? -5.192 22.250 44.457 1.00 31.80 ? 74  PRO A CA  1 
ATOM   594  C  C   . PRO A 1 73  ? -4.033 22.584 45.368 1.00 34.46 ? 74  PRO A C   1 
ATOM   595  O  O   . PRO A 1 73  ? -2.862 22.666 44.987 1.00 40.67 ? 74  PRO A O   1 
ATOM   596  C  CB  . PRO A 1 73  ? -5.413 20.753 44.506 1.00 35.65 ? 74  PRO A CB  1 
ATOM   597  C  CG  . PRO A 1 73  ? -4.367 20.192 43.597 1.00 36.63 ? 74  PRO A CG  1 
ATOM   598  C  CD  . PRO A 1 73  ? -4.477 21.158 42.460 1.00 34.84 ? 74  PRO A CD  1 
ATOM   599  N  N   . PRO A 1 74  ? -4.361 22.686 46.617 1.00 31.79 ? 75  PRO A N   1 
ATOM   600  C  CA  . PRO A 1 74  ? -3.410 23.063 47.591 1.00 29.07 ? 75  PRO A CA  1 
ATOM   601  C  C   . PRO A 1 74  ? -2.151 22.232 47.603 1.00 32.90 ? 75  PRO A C   1 
ATOM   602  O  O   . PRO A 1 74  ? -1.094 22.750 47.884 1.00 35.36 ? 75  PRO A O   1 
ATOM   603  C  CB  . PRO A 1 74  ? -4.182 22.945 48.898 1.00 35.30 ? 75  PRO A CB  1 
ATOM   604  C  CG  . PRO A 1 74  ? -5.613 23.058 48.526 1.00 36.02 ? 75  PRO A CG  1 
ATOM   605  C  CD  . PRO A 1 74  ? -5.674 22.415 47.189 1.00 35.98 ? 75  PRO A CD  1 
ATOM   606  N  N   . GLU A 1 75  ? -2.242 20.938 47.352 1.00 34.71 ? 76  GLU A N   1 
ATOM   607  C  CA  . GLU A 1 75  ? -1.015 20.152 47.375 1.00 29.62 ? 76  GLU A CA  1 
ATOM   608  C  C   . GLU A 1 75  ? -0.023 20.664 46.346 1.00 30.78 ? 76  GLU A C   1 
ATOM   609  O  O   . GLU A 1 75  ? 1.163  20.382 46.438 1.00 37.97 ? 76  GLU A O   1 
ATOM   610  C  CB  . GLU A 1 75  ? -1.260 18.639 47.197 1.00 24.67 ? 76  GLU A CB  1 
ATOM   611  C  CG  . GLU A 1 75  ? -1.926 18.210 45.870 1.00 54.73 ? 76  GLU A CG  1 
ATOM   612  C  CD  . GLU A 1 75  ? -1.691 16.714 45.613 1.00 60.00 ? 76  GLU A CD  1 
ATOM   613  O  OE1 . GLU A 1 75  ? -0.930 16.139 46.502 1.00 60.00 ? 76  GLU A OE1 1 
ATOM   614  O  OE2 . GLU A 1 75  ? -2.283 16.078 44.684 1.00 60.00 ? 76  GLU A OE2 1 
ATOM   615  N  N   . ARG A 1 76  ? -0.523 21.388 45.348 1.00 25.69 ? 77  ARG A N   1 
ATOM   616  C  CA  . ARG A 1 76  ? 0.384  21.848 44.353 1.00 24.02 ? 77  ARG A CA  1 
ATOM   617  C  C   . ARG A 1 76  ? 0.347  23.337 44.238 1.00 35.16 ? 77  ARG A C   1 
ATOM   618  O  O   . ARG A 1 76  ? 0.718  23.887 43.232 1.00 36.48 ? 77  ARG A O   1 
ATOM   619  C  CB  . ARG A 1 76  ? 0.103  21.171 43.056 1.00 27.39 ? 77  ARG A CB  1 
ATOM   620  C  CG  . ARG A 1 76  ? 0.111  19.681 43.233 1.00 33.34 ? 77  ARG A CG  1 
ATOM   621  C  CD  . ARG A 1 76  ? 0.043  19.029 41.896 1.00 22.31 ? 77  ARG A CD  1 
ATOM   622  N  NE  . ARG A 1 76  ? -1.180 19.322 41.142 1.00 23.90 ? 77  ARG A NE  1 
ATOM   623  C  CZ  . ARG A 1 76  ? -2.270 18.597 41.265 1.00 23.16 ? 77  ARG A CZ  1 
ATOM   624  N  NH1 . ARG A 1 76  ? -2.325 17.665 42.204 1.00 26.94 ? 77  ARG A NH1 1 
ATOM   625  N  NH2 . ARG A 1 76  ? -3.311 18.787 40.477 1.00 20.39 ? 77  ARG A NH2 1 
ATOM   626  N  N   . GLN A 1 77  ? -0.030 23.999 45.318 1.00 33.23 ? 78  GLN A N   1 
ATOM   627  C  CA  . GLN A 1 77  ? 0.009  25.454 45.375 1.00 33.53 ? 78  GLN A CA  1 
ATOM   628  C  C   . GLN A 1 77  ? 1.361  26.071 45.889 1.00 38.55 ? 78  GLN A C   1 
ATOM   629  O  O   . GLN A 1 77  ? 1.935  25.616 46.885 1.00 39.05 ? 78  GLN A O   1 
ATOM   630  C  CB  . GLN A 1 77  ? -1.196 26.014 46.191 1.00 32.49 ? 78  GLN A CB  1 
ATOM   631  C  CG  . GLN A 1 77  ? -2.583 25.584 45.694 1.00 60.00 ? 78  GLN A CG  1 
ATOM   632  C  CD  . GLN A 1 77  ? -3.722 26.240 46.475 1.00 51.43 ? 78  GLN A CD  1 
ATOM   633  O  OE1 . GLN A 1 77  ? -3.500 27.140 47.291 1.00 53.88 ? 78  GLN A OE1 1 
ATOM   634  N  NE2 . GLN A 1 77  ? -4.945 25.777 46.229 1.00 48.19 ? 78  GLN A NE2 1 
ATOM   635  N  N   . ILE A 1 78  ? 1.817  27.178 45.262 1.00 32.90 ? 79  ILE A N   1 
ATOM   636  C  CA  . ILE A 1 78  ? 3.014  27.831 45.741 1.00 32.40 ? 79  ILE A CA  1 
ATOM   637  C  C   . ILE A 1 78  ? 2.685  28.344 47.127 1.00 52.01 ? 79  ILE A C   1 
ATOM   638  O  O   . ILE A 1 78  ? 1.559  28.804 47.429 1.00 45.49 ? 79  ILE A O   1 
ATOM   639  C  CB  . ILE A 1 78  ? 3.488  28.986 44.865 1.00 40.55 ? 79  ILE A CB  1 
ATOM   640  C  CG1 . ILE A 1 78  ? 2.310  29.676 44.182 1.00 54.39 ? 79  ILE A CG1 1 
ATOM   641  C  CG2 . ILE A 1 78  ? 4.444  28.516 43.806 1.00 37.48 ? 79  ILE A CG2 1 
ATOM   642  C  CD1 . ILE A 1 78  ? 2.163  31.163 44.556 1.00 57.88 ? 79  ILE A CD1 1 
ATOM   643  N  N   . PRO A 1 79  ? 3.609  28.075 48.013 1.00 58.92 ? 80  PRO A N   1 
ATOM   644  C  CA  . PRO A 1 79  ? 3.571  28.614 49.362 1.00 60.00 ? 80  PRO A CA  1 
ATOM   645  C  C   . PRO A 1 79  ? 2.952  30.031 49.275 1.00 60.00 ? 80  PRO A C   1 
ATOM   646  O  O   . PRO A 1 79  ? 3.299  30.869 48.369 1.00 60.00 ? 80  PRO A O   1 
ATOM   647  C  CB  . PRO A 1 79  ? 5.052  28.729 49.754 1.00 60.00 ? 80  PRO A CB  1 
ATOM   648  C  CG  . PRO A 1 79  ? 5.888  28.363 48.510 1.00 60.00 ? 80  PRO A CG  1 
ATOM   649  C  CD  . PRO A 1 79  ? 4.960  27.714 47.528 1.00 58.84 ? 80  PRO A CD  1 
ATOM   650  N  N   . ARG A 1 80  ? 2.015  30.303 50.202 1.00 60.00 ? 81  ARG A N   1 
ATOM   651  C  CA  . ARG A 1 80  ? 1.195  31.506 50.098 1.00 60.00 ? 81  ARG A CA  1 
ATOM   652  C  C   . ARG A 1 80  ? 1.706  32.860 50.586 1.00 60.00 ? 81  ARG A C   1 
ATOM   653  O  O   . ARG A 1 80  ? 1.764  33.859 49.812 1.00 60.00 ? 81  ARG A O   1 
ATOM   654  C  CB  . ARG A 1 80  ? -0.223 31.280 50.598 1.00 60.00 ? 81  ARG A CB  1 
ATOM   655  C  CG  . ARG A 1 80  ? -1.042 32.509 50.299 1.00 60.00 ? 81  ARG A CG  1 
ATOM   656  C  CD  . ARG A 1 80  ? -2.093 32.198 49.236 1.00 60.00 ? 81  ARG A CD  1 
ATOM   657  N  NE  . ARG A 1 80  ? -3.389 31.915 49.880 1.00 60.00 ? 81  ARG A NE  1 
ATOM   658  C  CZ  . ARG A 1 80  ? -3.991 32.721 50.811 1.00 60.00 ? 81  ARG A CZ  1 
ATOM   659  N  NH1 . ARG A 1 80  ? -3.430 33.902 51.210 1.00 60.00 ? 81  ARG A NH1 1 
ATOM   660  N  NH2 . ARG A 1 80  ? -5.172 32.328 51.383 1.00 60.00 ? 81  ARG A NH2 1 
ATOM   661  N  N   . ARG A 1 81  ? 1.862  32.941 51.905 1.00 60.00 ? 82  ARG A N   1 
ATOM   662  C  CA  . ARG A 1 81  ? 2.236  34.221 52.554 1.00 60.00 ? 82  ARG A CA  1 
ATOM   663  C  C   . ARG A 1 81  ? 2.618  34.001 54.067 1.00 60.00 ? 82  ARG A C   1 
ATOM   664  O  O   . ARG A 1 81  ? 3.799  34.272 54.490 1.00 60.00 ? 82  ARG A O   1 
ATOM   665  C  CB  . ARG A 1 81  ? 1.092  35.255 52.375 1.00 60.00 ? 82  ARG A CB  1 
ATOM   666  C  CG  . ARG A 1 81  ? 1.521  36.605 51.795 1.00 60.00 ? 82  ARG A CG  1 
ATOM   667  C  CD  . ARG A 1 81  ? 2.715  36.469 50.830 1.00 60.00 ? 82  ARG A CD  1 
ATOM   668  N  NE  . ARG A 1 81  ? 3.086  37.793 50.231 1.00 60.00 ? 82  ARG A NE  1 
ATOM   669  C  CZ  . ARG A 1 81  ? 4.107  37.993 49.338 1.00 60.00 ? 82  ARG A CZ  1 
ATOM   670  N  NH1 . ARG A 1 81  ? 4.920  36.936 48.979 1.00 60.00 ? 82  ARG A NH1 1 
ATOM   671  N  NH2 . ARG A 1 81  ? 4.344  39.258 48.810 1.00 60.00 ? 82  ARG A NH2 1 
ATOM   672  N  N   . GLY A 1 82  ? 1.646  33.454 54.858 1.00 60.00 ? 83  GLY A N   1 
ATOM   673  C  CA  . GLY A 1 82  ? 1.850  33.128 56.275 1.00 60.00 ? 83  GLY A CA  1 
ATOM   674  C  C   . GLY A 1 82  ? 1.694  31.600 56.534 1.00 60.00 ? 83  GLY A C   1 
ATOM   675  O  O   . GLY A 1 82  ? 1.810  30.741 55.621 1.00 60.00 ? 83  GLY A O   1 
ATOM   676  N  N   . SER A 1 86  ? 9.192  27.550 58.966 1.00 60.00 ? 87  SER A N   1 
ATOM   677  C  CA  . SER A 1 86  ? 10.298 26.553 58.974 1.00 60.00 ? 87  SER A CA  1 
ATOM   678  C  C   . SER A 1 86  ? 9.948  25.151 59.539 1.00 60.00 ? 87  SER A C   1 
ATOM   679  O  O   . SER A 1 86  ? 10.325 24.139 58.934 1.00 60.00 ? 87  SER A O   1 
ATOM   680  C  CB  . SER A 1 86  ? 11.603 27.126 59.622 1.00 60.00 ? 87  SER A CB  1 
ATOM   681  N  N   . GLU A 1 87  ? 9.249  25.068 60.696 1.00 60.00 ? 88  GLU A N   1 
ATOM   682  C  CA  . GLU A 1 87  ? 8.853  23.759 61.272 1.00 60.00 ? 88  GLU A CA  1 
ATOM   683  C  C   . GLU A 1 87  ? 8.112  23.016 60.153 1.00 60.00 ? 88  GLU A C   1 
ATOM   684  O  O   . GLU A 1 87  ? 8.381  21.816 59.837 1.00 60.00 ? 88  GLU A O   1 
ATOM   685  C  CB  . GLU A 1 87  ? 7.948  23.893 62.578 1.00 56.08 ? 88  GLU A CB  1 
ATOM   686  N  N   . MET A 1 88  ? 7.210  23.758 59.498 1.00 60.00 ? 89  MET A N   1 
ATOM   687  C  CA  . MET A 1 88  ? 6.505  23.234 58.335 1.00 60.00 ? 89  MET A CA  1 
ATOM   688  C  C   . MET A 1 88  ? 7.518  22.686 57.316 1.00 59.07 ? 89  MET A C   1 
ATOM   689  O  O   . MET A 1 88  ? 7.386  21.565 56.826 1.00 60.00 ? 89  MET A O   1 
ATOM   690  C  CB  . MET A 1 88  ? 5.689  24.363 57.695 1.00 60.00 ? 89  MET A CB  1 
ATOM   691  C  CG  . MET A 1 88  ? 4.579  24.900 58.586 0.00 60.00 ? 89  MET A CG  1 
ATOM   692  S  SD  . MET A 1 88  ? 2.986  24.093 58.300 0.00 60.00 ? 89  MET A SD  1 
ATOM   693  C  CE  . MET A 1 88  ? 3.517  22.574 57.475 0.00 56.69 ? 89  MET A CE  1 
ATOM   694  N  N   . GLU A 1 89  ? 8.547  23.480 57.036 1.00 41.37 ? 90  GLU A N   1 
ATOM   695  C  CA  . GLU A 1 89  ? 9.483  23.068 56.052 1.00 43.53 ? 90  GLU A CA  1 
ATOM   696  C  C   . GLU A 1 89  ? 9.678  21.579 56.043 1.00 47.55 ? 90  GLU A C   1 
ATOM   697  O  O   . GLU A 1 89  ? 9.517  20.947 54.991 1.00 45.20 ? 90  GLU A O   1 
ATOM   698  C  CB  . GLU A 1 89  ? 10.793 23.868 56.033 1.00 44.25 ? 90  GLU A CB  1 
ATOM   699  C  CG  . GLU A 1 89  ? 11.831 23.371 54.962 1.00 60.00 ? 90  GLU A CG  1 
ATOM   700  C  CD  . GLU A 1 89  ? 11.861 24.207 53.616 1.00 60.00 ? 90  GLU A CD  1 
ATOM   701  O  OE1 . GLU A 1 89  ? 10.914 25.059 53.361 1.00 60.00 ? 90  GLU A OE1 1 
ATOM   702  O  OE2 . GLU A 1 89  ? 12.907 23.960 52.788 1.00 60.00 ? 90  GLU A OE2 1 
ATOM   703  N  N   . GLN A 1 90  ? 10.004 21.004 57.197 1.00 43.06 ? 91  GLN A N   1 
ATOM   704  C  CA  . GLN A 1 90  ? 10.222 19.558 57.236 1.00 40.04 ? 91  GLN A CA  1 
ATOM   705  C  C   . GLN A 1 90  ? 9.044  18.834 56.596 1.00 41.41 ? 91  GLN A C   1 
ATOM   706  O  O   . GLN A 1 90  ? 9.171  17.805 55.935 1.00 41.22 ? 91  GLN A O   1 
ATOM   707  C  CB  . GLN A 1 90  ? 10.402 19.037 58.662 1.00 42.59 ? 91  GLN A CB  1 
ATOM   708  C  CG  . GLN A 1 90  ? 10.795 17.540 58.718 1.00 35.04 ? 91  GLN A CG  1 
ATOM   709  C  CD  . GLN A 1 90  ? 10.410 16.942 60.040 1.00 29.22 ? 91  GLN A CD  1 
ATOM   710  O  OE1 . GLN A 1 90  ? 9.427  17.364 60.630 1.00 32.11 ? 91  GLN A OE1 1 
ATOM   711  N  NE2 . GLN A 1 90  ? 11.208 16.021 60.536 1.00 29.11 ? 91  GLN A NE2 1 
ATOM   712  N  N   . ILE A 1 91  ? 7.879  19.396 56.785 1.00 33.63 ? 92  ILE A N   1 
ATOM   713  C  CA  . ILE A 1 91  ? 6.711  18.729 56.354 1.00 38.70 ? 92  ILE A CA  1 
ATOM   714  C  C   . ILE A 1 91  ? 6.218  19.129 54.982 1.00 38.16 ? 92  ILE A C   1 
ATOM   715  O  O   . ILE A 1 91  ? 5.744  18.276 54.249 1.00 34.64 ? 92  ILE A O   1 
ATOM   716  C  CB  . ILE A 1 91  ? 5.637  18.819 57.444 1.00 40.21 ? 92  ILE A CB  1 
ATOM   717  C  CG1 . ILE A 1 91  ? 5.991  17.872 58.566 1.00 42.10 ? 92  ILE A CG1 1 
ATOM   718  C  CG2 . ILE A 1 91  ? 4.289  18.395 56.920 1.00 40.46 ? 92  ILE A CG2 1 
ATOM   719  C  CD1 . ILE A 1 91  ? 5.056  18.057 59.690 1.00 43.05 ? 92  ILE A CD1 1 
ATOM   720  N  N   . SER A 1 92  ? 6.302  20.416 54.661 1.00 29.41 ? 93  SER A N   1 
ATOM   721  C  CA  . SER A 1 92  ? 5.766  20.942 53.420 1.00 32.32 ? 93  SER A CA  1 
ATOM   722  C  C   . SER A 1 92  ? 6.515  20.359 52.229 1.00 28.69 ? 93  SER A C   1 
ATOM   723  O  O   . SER A 1 92  ? 5.963  20.112 51.150 1.00 29.33 ? 93  SER A O   1 
ATOM   724  C  CB  . SER A 1 92  ? 5.940  22.448 53.441 1.00 34.41 ? 93  SER A CB  1 
ATOM   725  O  OG  . SER A 1 92  ? 7.265  22.733 53.837 1.00 48.27 ? 93  SER A OG  1 
ATOM   726  N  N   . ILE A 1 93  ? 7.783  20.138 52.494 1.00 24.68 ? 94  ILE A N   1 
ATOM   727  C  CA  . ILE A 1 93  ? 8.735  19.634 51.561 1.00 29.51 ? 94  ILE A CA  1 
ATOM   728  C  C   . ILE A 1 93  ? 8.444  18.205 51.189 1.00 34.76 ? 94  ILE A C   1 
ATOM   729  O  O   . ILE A 1 93  ? 9.071  17.656 50.276 1.00 31.02 ? 94  ILE A O   1 
ATOM   730  C  CB  . ILE A 1 93  ? 10.152 19.830 52.098 1.00 34.40 ? 94  ILE A CB  1 
ATOM   731  C  CG1 . ILE A 1 93  ? 11.100 20.173 50.972 1.00 35.42 ? 94  ILE A CG1 1 
ATOM   732  C  CG2 . ILE A 1 93  ? 10.705 18.613 52.862 1.00 36.68 ? 94  ILE A CG2 1 
ATOM   733  C  CD1 . ILE A 1 93  ? 12.544 19.873 51.343 1.00 55.86 ? 94  ILE A CD1 1 
ATOM   734  N  N   . ILE A 1 94  ? 7.468  17.603 51.878 1.00 28.29 ? 95  ILE A N   1 
ATOM   735  C  CA  . ILE A 1 94  ? 7.013  16.271 51.501 1.00 27.22 ? 95  ILE A CA  1 
ATOM   736  C  C   . ILE A 1 94  ? 5.525  16.243 51.336 1.00 25.05 ? 95  ILE A C   1 
ATOM   737  O  O   . ILE A 1 94  ? 4.959  15.191 51.069 1.00 32.63 ? 95  ILE A O   1 
ATOM   738  C  CB  . ILE A 1 94  ? 7.430  15.130 52.381 1.00 30.21 ? 95  ILE A CB  1 
ATOM   739  C  CG1 . ILE A 1 94  ? 6.992  15.402 53.813 1.00 35.35 ? 95  ILE A CG1 1 
ATOM   740  C  CG2 . ILE A 1 94  ? 8.905  14.846 52.206 1.00 25.37 ? 95  ILE A CG2 1 
ATOM   741  C  CD1 . ILE A 1 94  ? 7.103  14.175 54.709 1.00 31.99 ? 95  ILE A CD1 1 
ATOM   742  N  N   . GLU A 1 95  ? 4.920  17.419 51.370 1.00 22.17 ? 96  GLU A N   1 
ATOM   743  C  CA  . GLU A 1 95  ? 3.510  17.489 51.152 1.00 22.66 ? 96  GLU A CA  1 
ATOM   744  C  C   . GLU A 1 95  ? 3.170  18.441 50.046 1.00 27.31 ? 96  GLU A C   1 
ATOM   745  O  O   . GLU A 1 95  ? 2.074  18.371 49.522 1.00 31.99 ? 96  GLU A O   1 
ATOM   746  C  CB  . GLU A 1 95  ? 2.739  17.935 52.404 1.00 21.21 ? 96  GLU A CB  1 
ATOM   747  C  CG  . GLU A 1 95  ? 2.748  16.934 53.543 1.00 34.83 ? 96  GLU A CG  1 
ATOM   748  C  CD  . GLU A 1 95  ? 1.712  17.218 54.618 1.00 50.37 ? 96  GLU A CD  1 
ATOM   749  O  OE1 . GLU A 1 95  ? 0.920  18.156 54.498 1.00 54.62 ? 96  GLU A OE1 1 
ATOM   750  O  OE2 . GLU A 1 95  ? 1.649  16.364 55.566 1.00 51.72 ? 96  GLU A OE2 1 
ATOM   751  N  N   . ARG A 1 96  ? 3.958  19.488 49.868 1.00 34.05 ? 97  ARG A N   1 
ATOM   752  C  CA  . ARG A 1 96  ? 3.582  20.515 48.873 1.00 31.16 ? 97  ARG A CA  1 
ATOM   753  C  C   . ARG A 1 96  ? 4.558  20.448 47.671 1.00 31.68 ? 97  ARG A C   1 
ATOM   754  O  O   . ARG A 1 96  ? 5.792  20.527 47.835 1.00 25.82 ? 97  ARG A O   1 
ATOM   755  C  CB  . ARG A 1 96  ? 3.651  21.902 49.529 1.00 32.91 ? 97  ARG A CB  1 
ATOM   756  C  CG  . ARG A 1 96  ? 2.405  22.760 49.362 1.00 47.80 ? 97  ARG A CG  1 
ATOM   757  C  CD  . ARG A 1 96  ? 2.707  24.263 49.282 1.00 60.00 ? 97  ARG A CD  1 
ATOM   758  N  NE  . ARG A 1 96  ? 3.158  24.838 50.560 1.00 60.00 ? 97  ARG A NE  1 
ATOM   759  C  CZ  . ARG A 1 96  ? 4.428  25.234 50.835 1.00 60.00 ? 97  ARG A CZ  1 
ATOM   760  N  NH1 . ARG A 1 96  ? 5.414  25.130 49.898 1.00 60.00 ? 97  ARG A NH1 1 
ATOM   761  N  NH2 . ARG A 1 96  ? 4.740  25.730 52.059 1.00 60.00 ? 97  ARG A NH2 1 
ATOM   762  N  N   . PHE A 1 97  ? 4.003  20.219 46.479 1.00 26.82 ? 98  PHE A N   1 
ATOM   763  C  CA  . PHE A 1 97  ? 4.821  20.081 45.265 1.00 29.20 ? 98  PHE A CA  1 
ATOM   764  C  C   . PHE A 1 97  ? 4.322  20.989 44.142 1.00 31.46 ? 98  PHE A C   1 
ATOM   765  O  O   . PHE A 1 97  ? 3.552  20.569 43.272 1.00 28.04 ? 98  PHE A O   1 
ATOM   766  C  CB  . PHE A 1 97  ? 4.761  18.629 44.812 1.00 27.61 ? 98  PHE A CB  1 
ATOM   767  C  CG  . PHE A 1 97  ? 5.151  17.668 45.887 1.00 24.65 ? 98  PHE A CG  1 
ATOM   768  C  CD1 . PHE A 1 97  ? 6.484  17.333 46.093 1.00 22.17 ? 98  PHE A CD1 1 
ATOM   769  C  CD2 . PHE A 1 97  ? 4.188  17.147 46.731 1.00 25.91 ? 98  PHE A CD2 1 
ATOM   770  C  CE1 . PHE A 1 97  ? 6.873  16.439 47.069 1.00 22.66 ? 98  PHE A CE1 1 
ATOM   771  C  CE2 . PHE A 1 97  ? 4.565  16.319 47.776 1.00 24.39 ? 98  PHE A CE2 1 
ATOM   772  C  CZ  . PHE A 1 97  ? 5.899  15.937 47.921 1.00 20.56 ? 98  PHE A CZ  1 
ATOM   773  N  N   . PRO A 1 98  ? 4.709  22.256 44.213 1.00 29.73 ? 99  PRO A N   1 
ATOM   774  C  CA  . PRO A 1 98  ? 4.198  23.263 43.291 1.00 30.57 ? 99  PRO A CA  1 
ATOM   775  C  C   . PRO A 1 98  ? 4.926  23.468 41.948 1.00 25.91 ? 99  PRO A C   1 
ATOM   776  O  O   . PRO A 1 98  ? 4.349  24.104 41.100 1.00 29.04 ? 99  PRO A O   1 
ATOM   777  C  CB  . PRO A 1 98  ? 4.281  24.576 44.103 1.00 22.59 ? 99  PRO A CB  1 
ATOM   778  C  CG  . PRO A 1 98  ? 4.841  24.194 45.466 1.00 20.16 ? 99  PRO A CG  1 
ATOM   779  C  CD  . PRO A 1 98  ? 5.542  22.872 45.265 1.00 25.75 ? 99  PRO A CD  1 
ATOM   780  N  N   . TYR A 1 99  ? 6.122  22.898 41.769 1.00 18.84 ? 100 TYR A N   1 
ATOM   781  C  CA  . TYR A 1 99  ? 7.033  23.171 40.628 1.00 25.65 ? 100 TYR A CA  1 
ATOM   782  C  C   . TYR A 1 99  ? 7.219  21.971 39.657 1.00 21.11 ? 100 TYR A C   1 
ATOM   783  O  O   . TYR A 1 99  ? 8.119  21.155 39.848 1.00 25.77 ? 100 TYR A O   1 
ATOM   784  C  CB  . TYR A 1 99  ? 8.431  23.558 41.203 1.00 26.10 ? 100 TYR A CB  1 
ATOM   785  C  CG  . TYR A 1 99  ? 8.363  24.752 42.097 1.00 29.47 ? 100 TYR A CG  1 
ATOM   786  C  CD1 . TYR A 1 99  ? 7.935  25.978 41.594 1.00 32.92 ? 100 TYR A CD1 1 
ATOM   787  C  CD2 . TYR A 1 99  ? 8.528  24.618 43.470 1.00 27.56 ? 100 TYR A CD2 1 
ATOM   788  C  CE1 . TYR A 1 99  ? 7.648  27.059 42.427 1.00 29.05 ? 100 TYR A CE1 1 
ATOM   789  C  CE2 . TYR A 1 99  ? 8.251  25.684 44.325 1.00 30.19 ? 100 TYR A CE2 1 
ATOM   790  C  CZ  . TYR A 1 99  ? 7.831  26.906 43.793 1.00 34.85 ? 100 TYR A CZ  1 
ATOM   791  O  OH  . TYR A 1 99  ? 7.526  27.950 44.604 1.00 37.78 ? 100 TYR A OH  1 
ATOM   792  N  N   . PRO A 1 100 ? 6.458  21.916 38.585 1.00 19.33 ? 101 PRO A N   1 
ATOM   793  C  CA  . PRO A 1 100 ? 6.500  20.762 37.699 1.00 22.82 ? 101 PRO A CA  1 
ATOM   794  C  C   . PRO A 1 100 ? 7.575  20.812 36.627 1.00 25.12 ? 101 PRO A C   1 
ATOM   795  O  O   . PRO A 1 100 ? 7.945  21.885 36.172 1.00 24.94 ? 101 PRO A O   1 
ATOM   796  C  CB  . PRO A 1 100 ? 5.141  20.798 37.021 1.00 18.19 ? 101 PRO A CB  1 
ATOM   797  C  CG  . PRO A 1 100 ? 4.815  22.281 36.932 1.00 22.72 ? 101 PRO A CG  1 
ATOM   798  C  CD  . PRO A 1 100 ? 5.514  22.947 38.104 1.00 22.12 ? 101 PRO A CD  1 
ATOM   799  N  N   . PHE A 1 101 ? 8.034  19.635 36.216 1.00 23.81 ? 102 PHE A N   1 
ATOM   800  C  CA  . PHE A 1 101 ? 8.908  19.464 35.078 1.00 19.83 ? 102 PHE A CA  1 
ATOM   801  C  C   . PHE A 1 101 ? 8.487  18.264 34.335 1.00 19.74 ? 102 PHE A C   1 
ATOM   802  O  O   . PHE A 1 101 ? 7.636  17.537 34.787 1.00 22.54 ? 102 PHE A O   1 
ATOM   803  C  CB  . PHE A 1 101 ? 10.401 19.476 35.399 1.00 19.71 ? 102 PHE A CB  1 
ATOM   804  C  CG  . PHE A 1 101 ? 10.865 18.377 36.298 1.00 23.50 ? 102 PHE A CG  1 
ATOM   805  C  CD1 . PHE A 1 101 ? 10.801 18.530 37.685 1.00 29.50 ? 102 PHE A CD1 1 
ATOM   806  C  CD2 . PHE A 1 101 ? 11.527 17.278 35.784 1.00 23.62 ? 102 PHE A CD2 1 
ATOM   807  C  CE1 . PHE A 1 101 ? 11.352 17.587 38.557 1.00 25.15 ? 102 PHE A CE1 1 
ATOM   808  C  CE2 . PHE A 1 101 ? 12.003 16.293 36.641 1.00 28.86 ? 102 PHE A CE2 1 
ATOM   809  C  CZ  . PHE A 1 101 ? 11.955 16.450 38.029 1.00 23.32 ? 102 PHE A CZ  1 
ATOM   810  N  N   . GLN A 1 102 ? 8.927  18.168 33.109 1.00 21.72 ? 103 GLN A N   1 
ATOM   811  C  CA  . GLN A 1 102 ? 8.468  17.124 32.241 1.00 17.59 ? 103 GLN A CA  1 
ATOM   812  C  C   . GLN A 1 102 ? 9.658  16.398 31.682 1.00 21.17 ? 103 GLN A C   1 
ATOM   813  O  O   . GLN A 1 102 ? 10.701 16.984 31.457 1.00 20.82 ? 103 GLN A O   1 
ATOM   814  C  CB  . GLN A 1 102 ? 7.571  17.712 31.134 1.00 24.12 ? 103 GLN A CB  1 
ATOM   815  C  CG  . GLN A 1 102 ? 8.245  18.774 30.184 1.00 27.30 ? 103 GLN A CG  1 
ATOM   816  C  CD  . GLN A 1 102 ? 7.294  19.468 29.188 1.00 23.25 ? 103 GLN A CD  1 
ATOM   817  O  OE1 . GLN A 1 102 ? 7.190  20.702 29.158 1.00 29.97 ? 103 GLN A OE1 1 
ATOM   818  N  NE2 . GLN A 1 102 ? 6.638  18.682 28.346 1.00 14.94 ? 103 GLN A NE2 1 
ATOM   819  N  N   . VAL A 1 103 ? 9.583  15.080 31.669 1.00 22.92 ? 104 VAL A N   1 
ATOM   820  C  CA  . VAL A 1 103 ? 10.665 14.274 31.102 1.00 23.49 ? 104 VAL A CA  1 
ATOM   821  C  C   . VAL A 1 103 ? 10.037 13.616 29.905 1.00 30.14 ? 104 VAL A C   1 
ATOM   822  O  O   . VAL A 1 103 ? 9.071  12.850 30.070 1.00 24.74 ? 104 VAL A O   1 
ATOM   823  C  CB  . VAL A 1 103 ? 11.139 13.196 32.036 1.00 23.94 ? 104 VAL A CB  1 
ATOM   824  C  CG1 . VAL A 1 103 ? 12.181 12.321 31.351 1.00 24.89 ? 104 VAL A CG1 1 
ATOM   825  C  CG2 . VAL A 1 103 ? 11.728 13.851 33.270 1.00 21.50 ? 104 VAL A CG2 1 
ATOM   826  N  N   . VAL A 1 104 ? 10.440 14.063 28.701 1.00 22.86 ? 105 VAL A N   1 
ATOM   827  C  CA  . VAL A 1 104 ? 9.788  13.557 27.511 1.00 20.97 ? 105 VAL A CA  1 
ATOM   828  C  C   . VAL A 1 104 ? 10.555 12.456 26.910 1.00 23.17 ? 105 VAL A C   1 
ATOM   829  O  O   . VAL A 1 104 ? 11.764 12.517 26.864 1.00 26.95 ? 105 VAL A O   1 
ATOM   830  C  CB  . VAL A 1 104 ? 9.693  14.613 26.501 1.00 26.58 ? 105 VAL A CB  1 
ATOM   831  C  CG1 . VAL A 1 104 ? 8.803  14.118 25.371 1.00 29.40 ? 105 VAL A CG1 1 
ATOM   832  C  CG2 . VAL A 1 104 ? 9.103  15.820 27.168 1.00 22.06 ? 105 VAL A CG2 1 
ATOM   833  N  N   . TYR A 1 105 ? 9.853  11.406 26.523 1.00 22.88 ? 106 TYR A N   1 
ATOM   834  C  CA  . TYR A 1 105 ? 10.542 10.309 25.924 1.00 23.31 ? 106 TYR A CA  1 
ATOM   835  C  C   . TYR A 1 105 ? 9.605  9.705  24.986 1.00 30.03 ? 106 TYR A C   1 
ATOM   836  O  O   . TYR A 1 105 ? 8.470  10.137 24.876 1.00 31.83 ? 106 TYR A O   1 
ATOM   837  C  CB  . TYR A 1 105 ? 11.099 9.259  26.902 1.00 28.90 ? 106 TYR A CB  1 
ATOM   838  C  CG  . TYR A 1 105 ? 10.038 8.525  27.670 1.00 28.75 ? 106 TYR A CG  1 
ATOM   839  C  CD1 . TYR A 1 105 ? 9.196  9.227  28.536 1.00 29.91 ? 106 TYR A CD1 1 
ATOM   840  C  CD2 . TYR A 1 105 ? 9.776  7.173  27.431 1.00 30.28 ? 106 TYR A CD2 1 
ATOM   841  C  CE1 . TYR A 1 105 ? 8.194  8.575  29.246 1.00 24.50 ? 106 TYR A CE1 1 
ATOM   842  C  CE2 . TYR A 1 105 ? 8.715  6.527  28.054 1.00 32.22 ? 106 TYR A CE2 1 
ATOM   843  C  CZ  . TYR A 1 105 ? 8.014  7.208  29.045 1.00 37.50 ? 106 TYR A CZ  1 
ATOM   844  O  OH  . TYR A 1 105 ? 7.094  6.544  29.776 1.00 29.51 ? 106 TYR A OH  1 
ATOM   845  N  N   . ASP A 1 106 ? 10.092 8.722  24.265 1.00 40.65 ? 107 ASP A N   1 
ATOM   846  C  CA  . ASP A 1 106 ? 9.345  8.182  23.155 1.00 45.74 ? 107 ASP A CA  1 
ATOM   847  C  C   . ASP A 1 106 ? 7.887  7.943  23.416 1.00 44.45 ? 107 ASP A C   1 
ATOM   848  O  O   . ASP A 1 106 ? 7.095  7.979  22.487 1.00 56.92 ? 107 ASP A O   1 
ATOM   849  C  CB  . ASP A 1 106 ? 10.021 6.936  22.632 1.00 51.18 ? 107 ASP A CB  1 
ATOM   850  C  CG  . ASP A 1 106 ? 10.004 5.813  23.627 1.00 60.00 ? 107 ASP A CG  1 
ATOM   851  O  OD1 . ASP A 1 106 ? 10.167 6.026  24.853 1.00 60.00 ? 107 ASP A OD1 1 
ATOM   852  O  OD2 . ASP A 1 106 ? 9.805  4.654  23.094 1.00 60.00 ? 107 ASP A OD2 1 
ATOM   853  N  N   . GLU A 1 107 ? 7.525  7.641  24.654 1.00 36.66 ? 108 GLU A N   1 
ATOM   854  C  CA  . GLU A 1 107 ? 6.132  7.339  24.940 1.00 36.79 ? 108 GLU A CA  1 
ATOM   855  C  C   . GLU A 1 107 ? 5.205  8.542  25.184 1.00 60.00 ? 108 GLU A C   1 
ATOM   856  O  O   . GLU A 1 107 ? 4.123  8.678  24.581 1.00 60.00 ? 108 GLU A O   1 
ATOM   857  C  CB  . GLU A 1 107 ? 6.021  6.233  25.983 1.00 35.71 ? 108 GLU A CB  1 
ATOM   858  C  CG  . GLU A 1 107 ? 6.866  5.029  25.566 1.00 35.71 ? 108 GLU A CG  1 
ATOM   859  C  CD  . GLU A 1 107 ? 6.683  3.821  26.444 1.00 46.08 ? 108 GLU A CD  1 
ATOM   860  O  OE1 . GLU A 1 107 ? 5.561  3.461  26.778 1.00 56.10 ? 108 GLU A OE1 1 
ATOM   861  O  OE2 . GLU A 1 107 ? 7.738  3.154  26.717 1.00 60.00 ? 108 GLU A OE2 1 
ATOM   862  N  N   . GLY A 1 108 ? 5.664  9.480  25.986 1.00 59.17 ? 109 GLY A N   1 
ATOM   863  C  CA  . GLY A 1 108 ? 4.875  10.655 26.255 1.00 53.75 ? 109 GLY A CA  1 
ATOM   864  C  C   . GLY A 1 108 ? 5.697  11.442 27.213 1.00 50.13 ? 109 GLY A C   1 
ATOM   865  O  O   . GLY A 1 108 ? 6.910  11.186 27.368 1.00 48.05 ? 109 GLY A O   1 
ATOM   866  N  N   . PRO A 1 109 ? 5.072  12.416 27.847 1.00 33.00 ? 110 PRO A N   1 
ATOM   867  C  CA  . PRO A 1 109 ? 5.760  13.135 28.895 1.00 31.69 ? 110 PRO A CA  1 
ATOM   868  C  C   . PRO A 1 109 ? 5.454  12.490 30.255 1.00 29.74 ? 110 PRO A C   1 
ATOM   869  O  O   . PRO A 1 109 ? 4.338  12.083 30.542 1.00 26.11 ? 110 PRO A O   1 
ATOM   870  C  CB  . PRO A 1 109 ? 5.155  14.538 28.841 1.00 22.64 ? 110 PRO A CB  1 
ATOM   871  C  CG  . PRO A 1 109 ? 3.847  14.374 28.070 1.00 25.68 ? 110 PRO A CG  1 
ATOM   872  C  CD  . PRO A 1 109 ? 3.735  12.950 27.614 1.00 23.60 ? 110 PRO A CD  1 
ATOM   873  N  N   . LEU A 1 110 ? 6.452  12.447 31.089 1.00 26.36 ? 111 LEU A N   1 
ATOM   874  C  CA  . LEU A 1 110 ? 6.225  12.114 32.468 1.00 27.54 ? 111 LEU A CA  1 
ATOM   875  C  C   . LEU A 1 110 ? 6.219  13.440 33.202 1.00 23.84 ? 111 LEU A C   1 
ATOM   876  O  O   . LEU A 1 110 ? 7.192  14.151 33.087 1.00 20.74 ? 111 LEU A O   1 
ATOM   877  C  CB  . LEU A 1 110 ? 7.397  11.312 33.013 1.00 25.99 ? 111 LEU A CB  1 
ATOM   878  C  CG  . LEU A 1 110 ? 7.406  11.241 34.534 1.00 28.67 ? 111 LEU A CG  1 
ATOM   879  C  CD1 . LEU A 1 110 ? 6.156  10.556 35.031 1.00 21.94 ? 111 LEU A CD1 1 
ATOM   880  C  CD2 . LEU A 1 110 ? 8.620  10.491 35.039 1.00 21.49 ? 111 LEU A CD2 1 
ATOM   881  N  N   . TYR A 1 111 ? 5.172  13.736 33.986 1.00 20.97 ? 112 TYR A N   1 
ATOM   882  C  CA  . TYR A 1 111 ? 5.089  14.972 34.760 1.00 19.10 ? 112 TYR A CA  1 
ATOM   883  C  C   . TYR A 1 111 ? 5.477  14.788 36.219 1.00 20.05 ? 112 TYR A C   1 
ATOM   884  O  O   . TYR A 1 111 ? 4.870  13.994 36.943 1.00 23.14 ? 112 TYR A O   1 
ATOM   885  C  CB  . TYR A 1 111 ? 3.677  15.533 34.673 1.00 19.16 ? 112 TYR A CB  1 
ATOM   886  C  CG  . TYR A 1 111 ? 3.353  16.000 33.284 1.00 20.19 ? 112 TYR A CG  1 
ATOM   887  C  CD1 . TYR A 1 111 ? 4.115  16.995 32.664 1.00 22.45 ? 112 TYR A CD1 1 
ATOM   888  C  CD2 . TYR A 1 111 ? 2.345  15.398 32.544 1.00 21.58 ? 112 TYR A CD2 1 
ATOM   889  C  CE1 . TYR A 1 111 ? 3.803  17.429 31.366 1.00 22.53 ? 112 TYR A CE1 1 
ATOM   890  C  CE2 . TYR A 1 111 ? 2.006  15.838 31.264 1.00 19.86 ? 112 TYR A CE2 1 
ATOM   891  C  CZ  . TYR A 1 111 ? 2.762  16.830 30.650 1.00 23.36 ? 112 TYR A CZ  1 
ATOM   892  O  OH  . TYR A 1 111 ? 2.425  17.246 29.364 1.00 23.71 ? 112 TYR A OH  1 
ATOM   893  N  N   . VAL A 1 112 ? 6.464  15.550 36.645 1.00 20.78 ? 113 VAL A N   1 
ATOM   894  C  CA  . VAL A 1 112 ? 6.979  15.406 37.994 1.00 22.99 ? 113 VAL A CA  1 
ATOM   895  C  C   . VAL A 1 112 ? 6.887  16.742 38.707 1.00 30.74 ? 113 VAL A C   1 
ATOM   896  O  O   . VAL A 1 112 ? 7.300  17.739 38.138 1.00 28.20 ? 113 VAL A O   1 
ATOM   897  C  CB  . VAL A 1 112 ? 8.445  14.990 37.883 1.00 20.20 ? 113 VAL A CB  1 
ATOM   898  C  CG1 . VAL A 1 112 ? 9.016  14.595 39.213 1.00 18.53 ? 113 VAL A CG1 1 
ATOM   899  C  CG2 . VAL A 1 112 ? 8.564  13.805 36.981 1.00 16.81 ? 113 VAL A CG2 1 
ATOM   900  N  N   . PHE A 1 113 ? 6.387  16.789 39.949 1.00 24.87 ? 114 PHE A N   1 
ATOM   901  C  CA  . PHE A 1 113 ? 6.325  18.052 40.674 1.00 21.46 ? 114 PHE A CA  1 
ATOM   902  C  C   . PHE A 1 113 ? 7.261  18.131 41.807 1.00 23.47 ? 114 PHE A C   1 
ATOM   903  O  O   . PHE A 1 113 ? 7.217  17.264 42.649 1.00 26.21 ? 114 PHE A O   1 
ATOM   904  C  CB  . PHE A 1 113 ? 4.960  18.237 41.209 1.00 21.06 ? 114 PHE A CB  1 
ATOM   905  C  CG  . PHE A 1 113 ? 3.962  18.377 40.134 1.00 20.13 ? 114 PHE A CG  1 
ATOM   906  C  CD1 . PHE A 1 113 ? 3.667  17.285 39.328 1.00 28.00 ? 114 PHE A CD1 1 
ATOM   907  C  CD2 . PHE A 1 113 ? 3.363  19.600 39.875 1.00 22.68 ? 114 PHE A CD2 1 
ATOM   908  C  CE1 . PHE A 1 113 ? 2.664  17.355 38.374 1.00 22.86 ? 114 PHE A CE1 1 
ATOM   909  C  CE2 . PHE A 1 113 ? 2.337  19.690 38.943 1.00 27.07 ? 114 PHE A CE2 1 
ATOM   910  C  CZ  . PHE A 1 113 ? 2.010  18.567 38.176 1.00 24.04 ? 114 PHE A CZ  1 
ATOM   911  N  N   . SER A 1 114 ? 8.039  19.196 41.871 1.00 18.35 ? 115 SER A N   1 
ATOM   912  C  CA  . SER A 1 114 ? 9.031  19.406 42.913 1.00 18.99 ? 115 SER A CA  1 
ATOM   913  C  C   . SER A 1 114 ? 8.508  20.268 44.031 1.00 24.76 ? 115 SER A C   1 
ATOM   914  O  O   . SER A 1 114 ? 7.677  21.153 43.798 1.00 23.69 ? 115 SER A O   1 
ATOM   915  C  CB  . SER A 1 114 ? 10.249 20.086 42.342 1.00 21.44 ? 115 SER A CB  1 
ATOM   916  O  OG  . SER A 1 114 ? 11.308 20.178 43.272 1.00 24.71 ? 115 SER A OG  1 
ATOM   917  N  N   . PRO A 1 115 ? 9.038  20.043 45.250 1.00 29.53 ? 116 PRO A N   1 
ATOM   918  C  CA  . PRO A 1 115 ? 8.620  20.811 46.418 1.00 25.10 ? 116 PRO A CA  1 
ATOM   919  C  C   . PRO A 1 115 ? 9.253  22.169 46.369 1.00 30.40 ? 116 PRO A C   1 
ATOM   920  O  O   . PRO A 1 115 ? 8.655  23.094 46.785 1.00 33.41 ? 116 PRO A O   1 
ATOM   921  C  CB  . PRO A 1 115 ? 9.204  20.053 47.597 1.00 19.59 ? 116 PRO A CB  1 
ATOM   922  C  CG  . PRO A 1 115 ? 10.325 19.274 47.044 1.00 23.78 ? 116 PRO A CG  1 
ATOM   923  C  CD  . PRO A 1 115 ? 9.882  18.902 45.644 1.00 21.98 ? 116 PRO A CD  1 
ATOM   924  N  N   . THR A 1 116 ? 10.472 22.290 45.870 1.00 25.76 ? 117 THR A N   1 
ATOM   925  C  CA  . THR A 1 116 ? 11.059 23.599 45.725 1.00 23.03 ? 117 THR A CA  1 
ATOM   926  C  C   . THR A 1 116 ? 11.554 23.848 44.322 1.00 38.51 ? 117 THR A C   1 
ATOM   927  O  O   . THR A 1 116 ? 11.668 22.922 43.528 1.00 36.45 ? 117 THR A O   1 
ATOM   928  C  CB  . THR A 1 116 ? 12.239 23.733 46.637 1.00 24.83 ? 117 THR A CB  1 
ATOM   929  O  OG1 . THR A 1 116 ? 13.264 22.938 46.132 1.00 24.47 ? 117 THR A OG1 1 
ATOM   930  C  CG2 . THR A 1 116 ? 11.843 23.164 47.964 1.00 28.63 ? 117 THR A CG2 1 
ATOM   931  N  N   . GLU A 1 117 ? 11.880 25.100 44.036 1.00 33.44 ? 118 GLU A N   1 
ATOM   932  C  CA  . GLU A 1 117 ? 12.455 25.487 42.750 1.00 33.54 ? 118 GLU A CA  1 
ATOM   933  C  C   . GLU A 1 117 ? 13.906 25.044 42.658 1.00 34.45 ? 118 GLU A C   1 
ATOM   934  O  O   . GLU A 1 117 ? 14.378 24.576 41.605 1.00 32.16 ? 118 GLU A O   1 
ATOM   935  C  CB  . GLU A 1 117 ? 12.317 26.996 42.478 1.00 32.58 ? 118 GLU A CB  1 
ATOM   936  C  CG  . GLU A 1 117 ? 11.702 27.377 41.106 1.00 45.43 ? 118 GLU A CG  1 
ATOM   937  C  CD  . GLU A 1 117 ? 10.731 28.583 41.191 1.00 60.00 ? 118 GLU A CD  1 
ATOM   938  O  OE1 . GLU A 1 117 ? 10.760 29.314 42.245 1.00 60.00 ? 118 GLU A OE1 1 
ATOM   939  O  OE2 . GLU A 1 117 ? 9.977  28.873 40.256 1.00 60.00 ? 118 GLU A OE2 1 
ATOM   940  N  N   . GLU A 1 118 ? 14.570 25.022 43.804 1.00 27.39 ? 119 GLU A N   1 
ATOM   941  C  CA  . GLU A 1 118 ? 15.955 24.616 43.746 1.00 27.41 ? 119 GLU A CA  1 
ATOM   942  C  C   . GLU A 1 118 ? 16.147 23.175 43.296 1.00 33.03 ? 119 GLU A C   1 
ATOM   943  O  O   . GLU A 1 118 ? 17.096 22.820 42.597 1.00 36.63 ? 119 GLU A O   1 
ATOM   944  C  CB  . GLU A 1 118 ? 16.724 24.903 45.053 1.00 30.82 ? 119 GLU A CB  1 
ATOM   945  C  CG  . GLU A 1 118 ? 18.231 25.144 44.812 1.00 60.00 ? 119 GLU A CG  1 
ATOM   946  C  CD  . GLU A 1 118 ? 18.579 25.993 43.526 1.00 60.00 ? 119 GLU A CD  1 
ATOM   947  O  OE1 . GLU A 1 118 ? 18.357 27.250 43.420 1.00 60.00 ? 119 GLU A OE1 1 
ATOM   948  O  OE2 . GLU A 1 118 ? 19.339 25.363 42.677 1.00 60.00 ? 119 GLU A OE2 1 
ATOM   949  N  N   . LEU A 1 119 ? 15.224 22.353 43.730 1.00 32.04 ? 120 LEU A N   1 
ATOM   950  C  CA  . LEU A 1 119 ? 15.254 20.924 43.496 1.00 31.19 ? 120 LEU A CA  1 
ATOM   951  C  C   . LEU A 1 119 ? 14.974 20.664 42.036 1.00 23.27 ? 120 LEU A C   1 
ATOM   952  O  O   . LEU A 1 119 ? 15.512 19.726 41.432 1.00 32.72 ? 120 LEU A O   1 
ATOM   953  C  CB  . LEU A 1 119 ? 14.158 20.248 44.373 1.00 34.57 ? 120 LEU A CB  1 
ATOM   954  C  CG  . LEU A 1 119 ? 14.430 18.884 45.003 1.00 34.69 ? 120 LEU A CG  1 
ATOM   955  C  CD1 . LEU A 1 119 ? 15.885 18.586 45.063 1.00 27.29 ? 120 LEU A CD1 1 
ATOM   956  C  CD2 . LEU A 1 119 ? 13.839 18.755 46.390 1.00 31.72 ? 120 LEU A CD2 1 
ATOM   957  N  N   . ARG A 1 120 ? 14.100 21.481 41.491 1.00 24.89 ? 121 ARG A N   1 
ATOM   958  C  CA  . ARG A 1 120 ? 13.705 21.286 40.119 1.00 23.66 ? 121 ARG A CA  1 
ATOM   959  C  C   . ARG A 1 120 ? 14.865 21.660 39.208 1.00 27.46 ? 121 ARG A C   1 
ATOM   960  O  O   . ARG A 1 120 ? 15.308 20.852 38.414 1.00 32.49 ? 121 ARG A O   1 
ATOM   961  C  CB  . ARG A 1 120 ? 12.438 22.064 39.807 1.00 18.33 ? 121 ARG A CB  1 
ATOM   962  C  CG  . ARG A 1 120 ? 12.043 21.903 38.361 1.00 21.09 ? 121 ARG A CG  1 
ATOM   963  C  CD  . ARG A 1 120 ? 10.767 22.656 38.086 1.00 20.14 ? 121 ARG A CD  1 
ATOM   964  N  NE  . ARG A 1 120 ? 10.892 24.082 38.310 1.00 22.53 ? 121 ARG A NE  1 
ATOM   965  C  CZ  . ARG A 1 120 ? 9.936  24.930 37.977 1.00 20.12 ? 121 ARG A CZ  1 
ATOM   966  N  NH1 . ARG A 1 120 ? 8.814  24.491 37.460 1.00 25.27 ? 121 ARG A NH1 1 
ATOM   967  N  NH2 . ARG A 1 120 ? 10.041 26.215 38.276 1.00 28.34 ? 121 ARG A NH2 1 
ATOM   968  N  N   . LYS A 1 121 ? 15.494 22.786 39.505 1.00 26.28 ? 122 LYS A N   1 
ATOM   969  C  CA  . LYS A 1 121 ? 16.621 23.265 38.754 1.00 19.10 ? 122 LYS A CA  1 
ATOM   970  C  C   . LYS A 1 121 ? 17.691 22.225 38.782 1.00 28.26 ? 122 LYS A C   1 
ATOM   971  O  O   . LYS A 1 121 ? 18.262 21.816 37.744 1.00 32.90 ? 122 LYS A O   1 
ATOM   972  C  CB  . LYS A 1 121 ? 17.103 24.538 39.440 1.00 23.66 ? 122 LYS A CB  1 
ATOM   973  C  CG  . LYS A 1 121 ? 18.240 25.245 38.719 1.00 45.68 ? 122 LYS A CG  1 
ATOM   974  C  CD  . LYS A 1 121 ? 18.527 26.617 39.293 0.00 50.51 ? 122 LYS A CD  1 
ATOM   975  C  CE  . LYS A 1 121 ? 19.708 27.270 38.598 0.00 55.94 ? 122 LYS A CE  1 
ATOM   976  N  NZ  . LYS A 1 121 ? 20.131 28.521 39.252 0.00 60.00 ? 122 LYS A NZ  1 
ATOM   977  N  N   . ARG A 1 122 ? 17.974 21.746 39.982 1.00 28.21 ? 123 ARG A N   1 
ATOM   978  C  CA  . ARG A 1 122 ? 18.956 20.672 40.142 1.00 25.91 ? 123 ARG A CA  1 
ATOM   979  C  C   . ARG A 1 122 ? 18.685 19.498 39.234 1.00 29.10 ? 123 ARG A C   1 
ATOM   980  O  O   . ARG A 1 122 ? 19.579 18.934 38.648 1.00 31.67 ? 123 ARG A O   1 
ATOM   981  C  CB  . ARG A 1 122 ? 18.857 20.091 41.522 1.00 30.71 ? 123 ARG A CB  1 
ATOM   982  C  CG  . ARG A 1 122 ? 20.147 19.890 42.245 1.00 42.30 ? 123 ARG A CG  1 
ATOM   983  C  CD  . ARG A 1 122 ? 20.192 20.742 43.545 1.00 60.00 ? 123 ARG A CD  1 
ATOM   984  N  NE  . ARG A 1 122 ? 20.173 19.926 44.744 0.00 56.59 ? 123 ARG A NE  1 
ATOM   985  C  CZ  . ARG A 1 122 ? 21.250 19.349 45.253 0.00 60.00 ? 123 ARG A CZ  1 
ATOM   986  N  NH1 . ARG A 1 122 ? 22.431 19.502 44.669 0.00 47.87 ? 123 ARG A NH1 1 
ATOM   987  N  NH2 . ARG A 1 122 ? 21.154 18.617 46.355 0.00 47.30 ? 123 ARG A NH2 1 
ATOM   988  N  N   . TRP A 1 123 ? 17.511 18.937 39.366 1.00 23.66 ? 124 TRP A N   1 
ATOM   989  C  CA  . TRP A 1 123 ? 17.180 17.747 38.602 1.00 20.63 ? 124 TRP A CA  1 
ATOM   990  C  C   . TRP A 1 123 ? 17.205 18.005 37.054 1.00 28.85 ? 124 TRP A C   1 
ATOM   991  O  O   . TRP A 1 123 ? 17.576 17.154 36.261 1.00 26.20 ? 124 TRP A O   1 
ATOM   992  C  CB  . TRP A 1 123 ? 15.802 17.250 39.077 1.00 20.77 ? 124 TRP A CB  1 
ATOM   993  C  CG  . TRP A 1 123 ? 15.866 16.283 40.279 1.00 25.57 ? 124 TRP A CG  1 
ATOM   994  C  CD1 . TRP A 1 123 ? 16.033 16.604 41.608 1.00 26.98 ? 124 TRP A CD1 1 
ATOM   995  C  CD2 . TRP A 1 123 ? 15.744 14.839 40.228 1.00 24.42 ? 124 TRP A CD2 1 
ATOM   996  N  NE1 . TRP A 1 123 ? 16.170 15.442 42.354 1.00 23.62 ? 124 TRP A NE1 1 
ATOM   997  C  CE2 . TRP A 1 123 ? 15.999 14.353 41.523 1.00 25.03 ? 124 TRP A CE2 1 
ATOM   998  C  CE3 . TRP A 1 123 ? 15.595 13.906 39.175 1.00 22.76 ? 124 TRP A CE3 1 
ATOM   999  C  CZ2 . TRP A 1 123 ? 16.021 12.990 41.796 1.00 25.03 ? 124 TRP A CZ2 1 
ATOM   1000 C  CZ3 . TRP A 1 123 ? 15.660 12.562 39.451 1.00 18.71 ? 124 TRP A CZ3 1 
ATOM   1001 C  CH2 . TRP A 1 123 ? 15.899 12.114 40.726 1.00 17.37 ? 124 TRP A CH2 1 
ATOM   1002 N  N   . ILE A 1 124 ? 16.735 19.156 36.618 1.00 29.28 ? 125 ILE A N   1 
ATOM   1003 C  CA  . ILE A 1 124 ? 16.721 19.471 35.209 1.00 23.81 ? 125 ILE A CA  1 
ATOM   1004 C  C   . ILE A 1 124 ? 18.127 19.564 34.698 1.00 19.44 ? 125 ILE A C   1 
ATOM   1005 O  O   . ILE A 1 124 ? 18.496 18.921 33.754 1.00 27.15 ? 125 ILE A O   1 
ATOM   1006 C  CB  . ILE A 1 124 ? 15.949 20.751 34.973 1.00 23.69 ? 125 ILE A CB  1 
ATOM   1007 C  CG1 . ILE A 1 124 ? 14.447 20.452 35.046 1.00 19.02 ? 125 ILE A CG1 1 
ATOM   1008 C  CG2 . ILE A 1 124 ? 16.314 21.333 33.629 1.00 24.36 ? 125 ILE A CG2 1 
ATOM   1009 C  CD1 . ILE A 1 124 ? 13.566 21.717 34.997 1.00 15.63 ? 125 ILE A CD1 1 
ATOM   1010 N  N   . HIS A 1 125 ? 18.975 20.152 35.474 1.00 22.92 ? 126 HIS A N   1 
ATOM   1011 C  CA  . HIS A 1 125 ? 20.357 20.189 35.088 1.00 21.88 ? 126 HIS A CA  1 
ATOM   1012 C  C   . HIS A 1 125 ? 21.035 18.846 34.953 1.00 30.21 ? 126 HIS A C   1 
ATOM   1013 O  O   . HIS A 1 125 ? 21.671 18.553 33.982 1.00 34.17 ? 126 HIS A O   1 
ATOM   1014 C  CB  . HIS A 1 125 ? 21.083 21.029 36.068 1.00 25.73 ? 126 HIS A CB  1 
ATOM   1015 C  CG  . HIS A 1 125 ? 22.510 21.263 35.697 1.00 40.51 ? 126 HIS A CG  1 
ATOM   1016 N  ND1 . HIS A 1 125 ? 22.873 22.041 34.616 1.00 44.57 ? 126 HIS A ND1 1 
ATOM   1017 C  CD2 . HIS A 1 125 ? 23.668 20.889 36.311 1.00 43.04 ? 126 HIS A CD2 1 
ATOM   1018 C  CE1 . HIS A 1 125 ? 24.196 22.096 34.558 1.00 42.75 ? 126 HIS A CE1 1 
ATOM   1019 N  NE2 . HIS A 1 125 ? 24.697 21.440 35.594 1.00 42.82 ? 126 HIS A NE2 1 
ATOM   1020 N  N   . GLN A 1 126 ? 20.940 18.016 35.955 1.00 29.02 ? 127 GLN A N   1 
ATOM   1021 C  CA  . GLN A 1 126 ? 21.508 16.700 35.857 1.00 23.11 ? 127 GLN A CA  1 
ATOM   1022 C  C   . GLN A 1 126 ? 20.862 15.922 34.767 1.00 21.32 ? 127 GLN A C   1 
ATOM   1023 O  O   . GLN A 1 126 ? 21.477 15.080 34.151 1.00 30.10 ? 127 GLN A O   1 
ATOM   1024 C  CB  . GLN A 1 126 ? 21.313 15.951 37.182 1.00 29.71 ? 127 GLN A CB  1 
ATOM   1025 C  CG  . GLN A 1 126 ? 22.108 16.605 38.278 1.00 38.99 ? 127 GLN A CG  1 
ATOM   1026 C  CD  . GLN A 1 126 ? 23.569 16.687 37.921 1.00 49.58 ? 127 GLN A CD  1 
ATOM   1027 O  OE1 . GLN A 1 126 ? 24.192 15.697 37.557 1.00 43.55 ? 127 GLN A OE1 1 
ATOM   1028 N  NE2 . GLN A 1 126 ? 24.124 17.873 38.022 1.00 36.05 ? 127 GLN A NE2 1 
ATOM   1029 N  N   . LEU A 1 127 ? 19.579 16.078 34.592 1.00 21.74 ? 128 LEU A N   1 
ATOM   1030 C  CA  . LEU A 1 127 ? 18.971 15.267 33.569 1.00 28.00 ? 128 LEU A CA  1 
ATOM   1031 C  C   . LEU A 1 127 ? 19.516 15.734 32.225 1.00 31.40 ? 128 LEU A C   1 
ATOM   1032 O  O   . LEU A 1 127 ? 19.715 14.955 31.297 1.00 26.12 ? 128 LEU A O   1 
ATOM   1033 C  CB  . LEU A 1 127 ? 17.442 15.366 33.624 1.00 28.77 ? 128 LEU A CB  1 
ATOM   1034 C  CG  . LEU A 1 127 ? 16.781 14.435 34.654 1.00 25.62 ? 128 LEU A CG  1 
ATOM   1035 C  CD1 . LEU A 1 127 ? 15.352 14.818 34.951 1.00 23.49 ? 128 LEU A CD1 1 
ATOM   1036 C  CD2 . LEU A 1 127 ? 16.803 13.018 34.167 1.00 19.65 ? 128 LEU A CD2 1 
ATOM   1037 N  N   . LYS A 1 128 ? 19.768 17.020 32.133 1.00 27.33 ? 129 LYS A N   1 
ATOM   1038 C  CA  . LYS A 1 128 ? 20.327 17.542 30.935 1.00 29.61 ? 129 LYS A CA  1 
ATOM   1039 C  C   . LYS A 1 128 ? 21.674 16.938 30.685 1.00 31.08 ? 129 LYS A C   1 
ATOM   1040 O  O   . LYS A 1 128 ? 21.963 16.460 29.594 1.00 35.85 ? 129 LYS A O   1 
ATOM   1041 C  CB  . LYS A 1 128 ? 20.409 19.052 30.978 1.00 23.19 ? 129 LYS A CB  1 
ATOM   1042 C  CG  . LYS A 1 128 ? 19.062 19.687 31.148 1.00 32.85 ? 129 LYS A CG  1 
ATOM   1043 C  CD  . LYS A 1 128 ? 18.410 20.123 29.897 1.00 26.34 ? 129 LYS A CD  1 
ATOM   1044 C  CE  . LYS A 1 128 ? 17.811 21.505 30.087 1.00 35.73 ? 129 LYS A CE  1 
ATOM   1045 N  NZ  . LYS A 1 128 ? 16.728 21.740 29.139 1.00 53.88 ? 129 LYS A NZ  1 
ATOM   1046 N  N   . ASN A 1 129 ? 22.473 16.881 31.712 1.00 25.49 ? 130 ASN A N   1 
ATOM   1047 C  CA  . ASN A 1 129 ? 23.774 16.245 31.593 1.00 24.68 ? 130 ASN A CA  1 
ATOM   1048 C  C   . ASN A 1 129 ? 23.715 14.822 31.128 1.00 31.91 ? 130 ASN A C   1 
ATOM   1049 O  O   . ASN A 1 129 ? 24.502 14.419 30.306 1.00 39.03 ? 130 ASN A O   1 
ATOM   1050 C  CB  . ASN A 1 129 ? 24.481 16.229 32.928 1.00 36.48 ? 130 ASN A CB  1 
ATOM   1051 C  CG  . ASN A 1 129 ? 24.975 17.589 33.321 1.00 33.33 ? 130 ASN A CG  1 
ATOM   1052 O  OD1 . ASN A 1 129 ? 25.263 18.410 32.461 1.00 40.92 ? 130 ASN A OD1 1 
ATOM   1053 N  ND2 . ASN A 1 129 ? 25.113 17.824 34.630 1.00 45.70 ? 130 ASN A ND2 1 
ATOM   1054 N  N   . VAL A 1 130 ? 22.882 14.009 31.724 1.00 29.67 ? 131 VAL A N   1 
ATOM   1055 C  CA  . VAL A 1 130 ? 22.904 12.640 31.264 1.00 25.01 ? 131 VAL A CA  1 
ATOM   1056 C  C   . VAL A 1 130 ? 22.340 12.460 29.856 1.00 27.80 ? 131 VAL A C   1 
ATOM   1057 O  O   . VAL A 1 130 ? 22.518 11.407 29.237 1.00 27.91 ? 131 VAL A O   1 
ATOM   1058 C  CB  . VAL A 1 130 ? 22.263 11.678 32.245 1.00 25.99 ? 131 VAL A CB  1 
ATOM   1059 C  CG1 . VAL A 1 130 ? 23.076 11.698 33.484 1.00 25.11 ? 131 VAL A CG1 1 
ATOM   1060 C  CG2 . VAL A 1 130 ? 20.841 12.084 32.551 1.00 24.09 ? 131 VAL A CG2 1 
ATOM   1061 N  N   . ILE A 1 131 ? 21.640 13.459 29.341 1.00 31.88 ? 132 ILE A N   1 
ATOM   1062 C  CA  . ILE A 1 131 ? 21.023 13.281 28.027 1.00 34.15 ? 132 ILE A CA  1 
ATOM   1063 C  C   . ILE A 1 131 ? 21.740 14.006 26.848 1.00 34.12 ? 132 ILE A C   1 
ATOM   1064 O  O   . ILE A 1 131 ? 21.322 13.923 25.691 1.00 28.27 ? 132 ILE A O   1 
ATOM   1065 C  CB  . ILE A 1 131 ? 19.512 13.637 28.037 1.00 30.47 ? 132 ILE A CB  1 
ATOM   1066 C  CG1 . ILE A 1 131 ? 19.270 15.129 28.219 1.00 23.57 ? 132 ILE A CG1 1 
ATOM   1067 C  CG2 . ILE A 1 131 ? 18.743 12.857 29.102 1.00 28.68 ? 132 ILE A CG2 1 
ATOM   1068 C  CD1 . ILE A 1 131 ? 17.782 15.474 28.125 1.00 17.83 ? 132 ILE A CD1 1 
ATOM   1069 N  N   . ARG A 1 132 ? 22.768 14.764 27.174 1.00 32.89 ? 133 ARG A N   1 
ATOM   1070 C  CA  . ARG A 1 132 ? 23.434 15.607 26.222 1.00 30.01 ? 133 ARG A CA  1 
ATOM   1071 C  C   . ARG A 1 132 ? 23.772 14.928 24.902 1.00 38.27 ? 133 ARG A C   1 
ATOM   1072 O  O   . ARG A 1 132 ? 23.557 15.503 23.843 1.00 39.19 ? 133 ARG A O   1 
ATOM   1073 C  CB  . ARG A 1 132 ? 24.632 16.242 26.871 1.00 25.65 ? 133 ARG A CB  1 
ATOM   1074 C  CG  . ARG A 1 132 ? 25.494 16.899 25.828 1.00 37.66 ? 133 ARG A CG  1 
ATOM   1075 C  CD  . ARG A 1 132 ? 25.835 18.333 26.177 1.00 60.00 ? 133 ARG A CD  1 
ATOM   1076 N  NE  . ARG A 1 132 ? 27.148 18.771 25.638 1.00 60.00 ? 133 ARG A NE  1 
ATOM   1077 C  CZ  . ARG A 1 132 ? 28.065 19.479 26.349 1.00 60.00 ? 133 ARG A CZ  1 
ATOM   1078 N  NH1 . ARG A 1 132 ? 27.831 19.860 27.642 1.00 60.00 ? 133 ARG A NH1 1 
ATOM   1079 N  NH2 . ARG A 1 132 ? 29.235 19.810 25.774 1.00 60.00 ? 133 ARG A NH2 1 
ATOM   1080 N  N   . TYR A 1 133 ? 24.178 13.662 24.932 1.00 32.61 ? 134 TYR A N   1 
ATOM   1081 C  CA  . TYR A 1 133 ? 24.555 12.972 23.704 1.00 26.13 ? 134 TYR A CA  1 
ATOM   1082 C  C   . TYR A 1 133 ? 23.575 11.974 23.212 1.00 35.95 ? 134 TYR A C   1 
ATOM   1083 O  O   . TYR A 1 133 ? 23.969 11.034 22.537 1.00 37.38 ? 134 TYR A O   1 
ATOM   1084 C  CB  . TYR A 1 133 ? 25.905 12.286 23.871 1.00 24.66 ? 134 TYR A CB  1 
ATOM   1085 C  CG  . TYR A 1 133 ? 26.936 13.306 24.142 1.00 23.86 ? 134 TYR A CG  1 
ATOM   1086 C  CD1 . TYR A 1 133 ? 27.401 14.125 23.108 1.00 33.27 ? 134 TYR A CD1 1 
ATOM   1087 C  CD2 . TYR A 1 133 ? 27.243 13.645 25.452 1.00 24.41 ? 134 TYR A CD2 1 
ATOM   1088 C  CE1 . TYR A 1 133 ? 28.274 15.180 23.357 1.00 37.25 ? 134 TYR A CE1 1 
ATOM   1089 C  CE2 . TYR A 1 133 ? 28.076 14.722 25.732 1.00 22.24 ? 134 TYR A CE2 1 
ATOM   1090 C  CZ  . TYR A 1 133 ? 28.571 15.500 24.686 1.00 46.89 ? 134 TYR A CZ  1 
ATOM   1091 O  OH  . TYR A 1 133 ? 29.459 16.506 24.963 1.00 48.97 ? 134 TYR A OH  1 
ATOM   1092 N  N   . ASN A 1 134 ? 22.314 12.101 23.607 1.00 30.92 ? 135 ASN A N   1 
ATOM   1093 C  CA  . ASN A 1 134 ? 21.325 11.144 23.141 1.00 28.41 ? 135 ASN A CA  1 
ATOM   1094 C  C   . ASN A 1 134 ? 21.104 11.338 21.675 1.00 27.21 ? 135 ASN A C   1 
ATOM   1095 O  O   . ASN A 1 134 ? 21.319 12.410 21.118 1.00 27.81 ? 135 ASN A O   1 
ATOM   1096 C  CB  . ASN A 1 134 ? 19.980 11.243 23.886 1.00 25.47 ? 135 ASN A CB  1 
ATOM   1097 C  CG  . ASN A 1 134 ? 20.017 10.602 25.257 1.00 31.75 ? 135 ASN A CG  1 
ATOM   1098 O  OD1 . ASN A 1 134 ? 21.053 10.139 25.730 1.00 29.85 ? 135 ASN A OD1 1 
ATOM   1099 N  ND2 . ASN A 1 134 ? 18.874 10.531 25.879 1.00 22.11 ? 135 ASN A ND2 1 
ATOM   1100 N  N   . SER A 1 135 ? 20.514 10.340 21.100 1.00 29.67 ? 136 SER A N   1 
ATOM   1101 C  CA  . SER A 1 135 ? 20.339 10.330 19.693 1.00 32.88 ? 136 SER A CA  1 
ATOM   1102 C  C   . SER A 1 135 ? 19.069 10.977 19.263 1.00 42.75 ? 136 SER A C   1 
ATOM   1103 O  O   . SER A 1 135 ? 19.012 11.490 18.157 1.00 60.00 ? 136 SER A O   1 
ATOM   1104 C  CB  . SER A 1 135 ? 20.395 8.904  19.218 1.00 34.92 ? 136 SER A CB  1 
ATOM   1105 O  OG  . SER A 1 135 ? 19.608 8.107  20.072 1.00 60.00 ? 136 SER A OG  1 
ATOM   1106 N  N   . ASP A 1 136 ? 18.033 10.963 20.101 1.00 34.32 ? 137 ASP A N   1 
ATOM   1107 C  CA  . ASP A 1 136 ? 16.785 11.628 19.703 1.00 23.84 ? 137 ASP A CA  1 
ATOM   1108 C  C   . ASP A 1 136 ? 16.305 12.889 20.411 1.00 29.41 ? 137 ASP A C   1 
ATOM   1109 O  O   . ASP A 1 136 ? 15.113 13.144 20.465 1.00 33.28 ? 137 ASP A O   1 
ATOM   1110 C  CB  . ASP A 1 136 ? 15.649 10.672 19.565 1.00 26.33 ? 137 ASP A CB  1 
ATOM   1111 C  CG  . ASP A 1 136 ? 15.952 9.619  18.549 1.00 60.00 ? 137 ASP A CG  1 
ATOM   1112 O  OD1 . ASP A 1 136 ? 16.032 9.933  17.340 1.00 60.00 ? 137 ASP A OD1 1 
ATOM   1113 O  OD2 . ASP A 1 136 ? 16.278 8.476  19.033 1.00 60.00 ? 137 ASP A OD2 1 
ATOM   1114 N  N   . LEU A 1 137 ? 17.227 13.741 20.815 1.00 26.32 ? 138 LEU A N   1 
ATOM   1115 C  CA  . LEU A 1 137 ? 16.849 14.999 21.394 1.00 25.48 ? 138 LEU A CA  1 
ATOM   1116 C  C   . LEU A 1 137 ? 15.948 15.781 20.458 1.00 31.66 ? 138 LEU A C   1 
ATOM   1117 O  O   . LEU A 1 137 ? 16.227 15.916 19.302 1.00 40.96 ? 138 LEU A O   1 
ATOM   1118 C  CB  . LEU A 1 137 ? 18.107 15.810 21.750 1.00 27.27 ? 138 LEU A CB  1 
ATOM   1119 C  CG  . LEU A 1 137 ? 19.022 15.078 22.740 1.00 37.11 ? 138 LEU A CG  1 
ATOM   1120 C  CD1 . LEU A 1 137 ? 20.093 15.970 23.355 1.00 35.27 ? 138 LEU A CD1 1 
ATOM   1121 C  CD2 . LEU A 1 137 ? 18.188 14.450 23.844 1.00 32.08 ? 138 LEU A CD2 1 
ATOM   1122 N  N   . VAL A 1 138 ? 14.873 16.349 20.956 1.00 26.81 ? 139 VAL A N   1 
ATOM   1123 C  CA  . VAL A 1 138 ? 14.059 17.221 20.152 1.00 24.69 ? 139 VAL A CA  1 
ATOM   1124 C  C   . VAL A 1 138 ? 14.352 18.686 20.446 1.00 37.94 ? 139 VAL A C   1 
ATOM   1125 O  O   . VAL A 1 138 ? 14.722 19.040 21.576 1.00 34.21 ? 139 VAL A O   1 
ATOM   1126 C  CB  . VAL A 1 138 ? 12.602 16.970 20.359 1.00 25.73 ? 139 VAL A CB  1 
ATOM   1127 C  CG1 . VAL A 1 138 ? 12.249 15.624 19.860 1.00 28.50 ? 139 VAL A CG1 1 
ATOM   1128 C  CG2 . VAL A 1 138 ? 12.219 17.089 21.819 1.00 25.99 ? 139 VAL A CG2 1 
ATOM   1129 N  N   . GLN A 1 139 ? 14.130 19.543 19.445 1.00 43.04 ? 140 GLN A N   1 
ATOM   1130 C  CA  . GLN A 1 139 ? 14.357 20.977 19.571 1.00 47.42 ? 140 GLN A CA  1 
ATOM   1131 C  C   . GLN A 1 139 ? 13.042 21.699 19.885 1.00 43.23 ? 140 GLN A C   1 
ATOM   1132 O  O   . GLN A 1 139 ? 13.020 22.835 20.379 1.00 47.49 ? 140 GLN A O   1 
ATOM   1133 C  CB  . GLN A 1 139 ? 15.028 21.563 18.287 1.00 57.42 ? 140 GLN A CB  1 
ATOM   1134 C  CG  . GLN A 1 139 ? 16.265 20.792 17.718 1.00 60.00 ? 140 GLN A CG  1 
ATOM   1135 C  CD  . GLN A 1 139 ? 17.122 20.090 18.805 1.00 60.00 ? 140 GLN A CD  1 
ATOM   1136 O  OE1 . GLN A 1 139 ? 17.674 20.761 19.724 1.00 60.00 ? 140 GLN A OE1 1 
ATOM   1137 N  NE2 . GLN A 1 139 ? 17.347 18.750 18.635 1.00 60.00 ? 140 GLN A NE2 1 
ATOM   1138 N  N   . LYS A 1 140 ? 11.934 21.007 19.650 1.00 31.33 ? 141 LYS A N   1 
ATOM   1139 C  CA  . LYS A 1 140 ? 10.639 21.566 19.949 1.00 28.49 ? 141 LYS A CA  1 
ATOM   1140 C  C   . LYS A 1 140 ? 9.999  20.830 21.105 1.00 30.86 ? 141 LYS A C   1 
ATOM   1141 O  O   . LYS A 1 140 ? 10.061 19.618 21.105 1.00 27.69 ? 141 LYS A O   1 
ATOM   1142 C  CB  . LYS A 1 140 ? 9.759  21.381 18.736 1.00 32.16 ? 141 LYS A CB  1 
ATOM   1143 C  CG  . LYS A 1 140 ? 10.030 22.369 17.627 1.00 45.18 ? 141 LYS A CG  1 
ATOM   1144 C  CD  . LYS A 1 140 ? 8.835  22.424 16.710 1.00 60.00 ? 141 LYS A CD  1 
ATOM   1145 C  CE  . LYS A 1 140 ? 8.983  21.349 15.672 1.00 60.00 ? 141 LYS A CE  1 
ATOM   1146 N  NZ  . LYS A 1 140 ? 8.729  21.887 14.321 1.00 60.00 ? 141 LYS A NZ  1 
ATOM   1147 N  N   . TYR A 1 141 ? 9.252  21.535 21.984 1.00 29.43 ? 142 TYR A N   1 
ATOM   1148 C  CA  . TYR A 1 141 ? 8.487  20.920 23.080 1.00 24.79 ? 142 TYR A CA  1 
ATOM   1149 C  C   . TYR A 1 141 ? 7.098  21.551 23.290 1.00 29.05 ? 142 TYR A C   1 
ATOM   1150 O  O   . TYR A 1 141 ? 6.723  22.528 22.635 1.00 26.40 ? 142 TYR A O   1 
ATOM   1151 C  CB  . TYR A 1 141 ? 9.310  20.832 24.409 1.00 22.48 ? 142 TYR A CB  1 
ATOM   1152 C  CG  . TYR A 1 141 ? 9.291  22.052 25.300 1.00 27.73 ? 142 TYR A CG  1 
ATOM   1153 C  CD1 . TYR A 1 141 ? 9.530  23.327 24.778 1.00 32.09 ? 142 TYR A CD1 1 
ATOM   1154 C  CD2 . TYR A 1 141 ? 9.038  21.945 26.670 1.00 24.80 ? 142 TYR A CD2 1 
ATOM   1155 C  CE1 . TYR A 1 141 ? 9.445  24.479 25.571 1.00 23.66 ? 142 TYR A CE1 1 
ATOM   1156 C  CE2 . TYR A 1 141 ? 8.949  23.083 27.471 1.00 19.28 ? 142 TYR A CE2 1 
ATOM   1157 C  CZ  . TYR A 1 141 ? 9.198  24.345 26.931 1.00 15.25 ? 142 TYR A CZ  1 
ATOM   1158 O  OH  . TYR A 1 141 ? 9.190  25.444 27.734 1.00 26.93 ? 142 TYR A OH  1 
ATOM   1159 N  N   . HIS A 1 142 ? 6.311  20.926 24.154 1.00 23.77 ? 143 HIS A N   1 
ATOM   1160 C  CA  . HIS A 1 142 ? 5.028  21.450 24.607 1.00 16.45 ? 143 HIS A CA  1 
ATOM   1161 C  C   . HIS A 1 142 ? 5.223  22.024 25.994 1.00 25.53 ? 143 HIS A C   1 
ATOM   1162 O  O   . HIS A 1 142 ? 5.471  21.324 26.960 1.00 33.95 ? 143 HIS A O   1 
ATOM   1163 C  CB  . HIS A 1 142 ? 4.037  20.297 24.728 1.00 16.22 ? 143 HIS A CB  1 
ATOM   1164 C  CG  . HIS A 1 142 ? 3.764  19.648 23.420 1.00 23.37 ? 143 HIS A CG  1 
ATOM   1165 N  ND1 . HIS A 1 142 ? 3.037  20.293 22.428 1.00 22.84 ? 143 HIS A ND1 1 
ATOM   1166 C  CD2 . HIS A 1 142 ? 4.233  18.503 22.885 1.00 24.40 ? 143 HIS A CD2 1 
ATOM   1167 C  CE1 . HIS A 1 142 ? 2.951  19.483 21.400 1.00 28.96 ? 143 HIS A CE1 1 
ATOM   1168 N  NE2 . HIS A 1 142 ? 3.682  18.398 21.646 1.00 28.51 ? 143 HIS A NE2 1 
ATOM   1169 N  N   . PRO A 1 143 ? 5.162  23.315 26.086 1.00 25.07 ? 144 PRO A N   1 
ATOM   1170 C  CA  . PRO A 1 143 ? 5.356  23.999 27.366 1.00 24.93 ? 144 PRO A CA  1 
ATOM   1171 C  C   . PRO A 1 143 ? 4.237  23.782 28.374 1.00 27.67 ? 144 PRO A C   1 
ATOM   1172 O  O   . PRO A 1 143 ? 4.407  24.035 29.542 1.00 27.24 ? 144 PRO A O   1 
ATOM   1173 C  CB  . PRO A 1 143 ? 5.454  25.486 27.006 1.00 19.92 ? 144 PRO A CB  1 
ATOM   1174 C  CG  . PRO A 1 143 ? 5.381  25.553 25.519 1.00 25.31 ? 144 PRO A CG  1 
ATOM   1175 C  CD  . PRO A 1 143 ? 4.963  24.212 24.956 1.00 21.42 ? 144 PRO A CD  1 
ATOM   1176 N  N   . CYS A 1 144 ? 3.081  23.370 27.912 1.00 22.80 ? 145 CYS A N   1 
ATOM   1177 C  CA  . CYS A 1 144 ? 1.960  23.162 28.803 1.00 24.42 ? 145 CYS A CA  1 
ATOM   1178 C  C   . CYS A 1 144 ? 1.669  21.686 28.934 1.00 29.16 ? 145 CYS A C   1 
ATOM   1179 O  O   . CYS A 1 144 ? 2.181  20.857 28.186 1.00 27.33 ? 145 CYS A O   1 
ATOM   1180 C  CB  . CYS A 1 144 ? 0.718  23.892 28.280 1.00 22.32 ? 145 CYS A CB  1 
ATOM   1181 S  SG  . CYS A 1 144 ? 0.946  25.671 28.129 1.00 27.85 ? 145 CYS A SG  1 
ATOM   1182 N  N   . PHE A 1 145 ? 0.830  21.351 29.889 1.00 20.05 ? 146 PHE A N   1 
ATOM   1183 C  CA  . PHE A 1 145 ? 0.519  19.951 30.112 1.00 24.13 ? 146 PHE A CA  1 
ATOM   1184 C  C   . PHE A 1 145 ? -0.315 19.417 29.009 1.00 29.35 ? 146 PHE A C   1 
ATOM   1185 O  O   . PHE A 1 145 ? -1.209 20.086 28.528 1.00 28.41 ? 146 PHE A O   1 
ATOM   1186 C  CB  . PHE A 1 145 ? -0.381 19.786 31.358 1.00 23.48 ? 146 PHE A CB  1 
ATOM   1187 C  CG  . PHE A 1 145 ? 0.320  20.056 32.650 1.00 27.32 ? 146 PHE A CG  1 
ATOM   1188 C  CD1 . PHE A 1 145 ? 1.263  19.163 33.145 1.00 21.82 ? 146 PHE A CD1 1 
ATOM   1189 C  CD2 . PHE A 1 145 ? 0.093  21.248 33.340 1.00 29.42 ? 146 PHE A CD2 1 
ATOM   1190 C  CE1 . PHE A 1 145 ? 1.900  19.410 34.359 1.00 21.40 ? 146 PHE A CE1 1 
ATOM   1191 C  CE2 . PHE A 1 145 ? 0.804  21.549 34.502 1.00 26.14 ? 146 PHE A CE2 1 
ATOM   1192 C  CZ  . PHE A 1 145 ? 1.714  20.631 35.015 1.00 19.04 ? 146 PHE A CZ  1 
ATOM   1193 N  N   . TRP A 1 146 ? -0.249 18.117 28.882 1.00 28.40 ? 147 TRP A N   1 
ATOM   1194 C  CA  . TRP A 1 146 ? -1.209 17.384 28.091 1.00 29.54 ? 147 TRP A CA  1 
ATOM   1195 C  C   . TRP A 1 146 ? -2.366 17.106 29.025 1.00 36.54 ? 147 TRP A C   1 
ATOM   1196 O  O   . TRP A 1 146 ? -2.163 16.744 30.186 1.00 35.97 ? 147 TRP A O   1 
ATOM   1197 C  CB  . TRP A 1 146 ? -0.577 16.071 27.628 1.00 32.20 ? 147 TRP A CB  1 
ATOM   1198 C  CG  . TRP A 1 146 ? -1.441 15.338 26.667 1.00 40.53 ? 147 TRP A CG  1 
ATOM   1199 C  CD1 . TRP A 1 146 ? -1.447 15.406 25.308 1.00 44.00 ? 147 TRP A CD1 1 
ATOM   1200 C  CD2 . TRP A 1 146 ? -2.447 14.481 27.013 1.00 42.77 ? 147 TRP A CD2 1 
ATOM   1201 N  NE1 . TRP A 1 146 ? -2.430 14.639 24.785 1.00 39.21 ? 147 TRP A NE1 1 
ATOM   1202 C  CE2 . TRP A 1 146 ? -3.074 14.055 25.817 1.00 45.41 ? 147 TRP A CE2 1 
ATOM   1203 C  CE3 . TRP A 1 146 ? -2.926 14.053 28.223 1.00 45.61 ? 147 TRP A CE3 1 
ATOM   1204 C  CZ2 . TRP A 1 146 ? -4.109 13.176 25.807 1.00 50.02 ? 147 TRP A CZ2 1 
ATOM   1205 C  CZ3 . TRP A 1 146 ? -4.024 13.279 28.223 1.00 56.09 ? 147 TRP A CZ3 1 
ATOM   1206 C  CH2 . TRP A 1 146 ? -4.591 12.800 27.031 1.00 59.85 ? 147 TRP A CH2 1 
ATOM   1207 N  N   . ILE A 1 147 ? -3.578 17.371 28.604 1.00 32.01 ? 148 ILE A N   1 
ATOM   1208 C  CA  . ILE A 1 147 ? -4.624 17.161 29.539 1.00 33.78 ? 148 ILE A CA  1 
ATOM   1209 C  C   . ILE A 1 147 ? -5.987 17.158 28.938 1.00 40.29 ? 148 ILE A C   1 
ATOM   1210 O  O   . ILE A 1 147 ? -6.279 17.940 28.056 1.00 39.06 ? 148 ILE A O   1 
ATOM   1211 C  CB  . ILE A 1 147 ? -4.535 18.212 30.597 1.00 38.45 ? 148 ILE A CB  1 
ATOM   1212 C  CG1 . ILE A 1 147 ? -4.717 17.581 31.968 1.00 42.94 ? 148 ILE A CG1 1 
ATOM   1213 C  CG2 . ILE A 1 147 ? -5.469 19.355 30.308 1.00 31.49 ? 148 ILE A CG2 1 
ATOM   1214 C  CD1 . ILE A 1 147 ? -5.947 18.040 32.674 1.00 47.53 ? 148 ILE A CD1 1 
ATOM   1215 N  N   . ASP A 1 148 ? -6.821 16.245 29.403 1.00 42.37 ? 149 ASP A N   1 
ATOM   1216 C  CA  . ASP A 1 148 ? -8.183 16.199 28.921 1.00 41.47 ? 149 ASP A CA  1 
ATOM   1217 C  C   . ASP A 1 148 ? -8.166 15.923 27.463 1.00 43.51 ? 149 ASP A C   1 
ATOM   1218 O  O   . ASP A 1 148 ? -8.889 16.581 26.715 1.00 50.78 ? 149 ASP A O   1 
ATOM   1219 C  CB  . ASP A 1 148 ? -8.850 17.567 29.076 1.00 47.74 ? 149 ASP A CB  1 
ATOM   1220 C  CG  . ASP A 1 148 ? -9.454 17.758 30.439 1.00 60.00 ? 149 ASP A CG  1 
ATOM   1221 O  OD1 . ASP A 1 148 ? -9.791 16.748 31.085 1.00 60.00 ? 149 ASP A OD1 1 
ATOM   1222 O  OD2 . ASP A 1 148 ? -9.476 18.966 30.905 1.00 60.00 ? 149 ASP A OD2 1 
ATOM   1223 N  N   . GLY A 1 149 ? -7.191 15.137 27.039 1.00 43.16 ? 150 GLY A N   1 
ATOM   1224 C  CA  . GLY A 1 149 ? -7.121 14.726 25.645 1.00 44.70 ? 150 GLY A CA  1 
ATOM   1225 C  C   . GLY A 1 149 ? -6.219 15.500 24.720 1.00 43.44 ? 150 GLY A C   1 
ATOM   1226 O  O   . GLY A 1 149 ? -6.090 15.141 23.566 1.00 42.70 ? 150 GLY A O   1 
ATOM   1227 N  N   . GLN A 1 150 ? -5.581 16.544 25.196 1.00 36.09 ? 151 GLN A N   1 
ATOM   1228 C  CA  . GLN A 1 150 ? -4.692 17.213 24.293 1.00 36.18 ? 151 GLN A CA  1 
ATOM   1229 C  C   . GLN A 1 150 ? -3.825 18.182 25.041 1.00 33.44 ? 151 GLN A C   1 
ATOM   1230 O  O   . GLN A 1 150 ? -4.116 18.536 26.167 1.00 30.65 ? 151 GLN A O   1 
ATOM   1231 C  CB  . GLN A 1 150 ? -5.553 18.006 23.336 1.00 39.81 ? 151 GLN A CB  1 
ATOM   1232 C  CG  . GLN A 1 150 ? -6.779 18.526 24.073 1.00 47.08 ? 151 GLN A CG  1 
ATOM   1233 C  CD  . GLN A 1 150 ? -7.367 19.736 23.406 1.00 60.00 ? 151 GLN A CD  1 
ATOM   1234 O  OE1 . GLN A 1 150 ? -7.761 19.666 22.235 1.00 60.00 ? 151 GLN A OE1 1 
ATOM   1235 N  NE2 . GLN A 1 150 ? -7.345 20.882 24.106 1.00 59.95 ? 151 GLN A NE2 1 
ATOM   1236 N  N   . TYR A 1 151 ? -2.825 18.695 24.340 1.00 25.89 ? 152 TYR A N   1 
ATOM   1237 C  CA  . TYR A 1 151 ? -1.973 19.687 24.879 1.00 21.80 ? 152 TYR A CA  1 
ATOM   1238 C  C   . TYR A 1 151 ? -2.620 21.002 24.932 1.00 29.16 ? 152 TYR A C   1 
ATOM   1239 O  O   . TYR A 1 151 ? -3.229 21.432 23.960 1.00 34.37 ? 152 TYR A O   1 
ATOM   1240 C  CB  . TYR A 1 151 ? -0.751 19.780 24.045 1.00 21.42 ? 152 TYR A CB  1 
ATOM   1241 C  CG  . TYR A 1 151 ? 0.164  18.633 24.314 1.00 23.14 ? 152 TYR A CG  1 
ATOM   1242 C  CD1 . TYR A 1 151 ? 0.914  18.597 25.490 1.00 22.10 ? 152 TYR A CD1 1 
ATOM   1243 C  CD2 . TYR A 1 151 ? 0.283  17.578 23.410 1.00 25.12 ? 152 TYR A CD2 1 
ATOM   1244 C  CE1 . TYR A 1 151 ? 1.789  17.548 25.754 1.00 23.04 ? 152 TYR A CE1 1 
ATOM   1245 C  CE2 . TYR A 1 151 ? 1.192  16.536 23.636 1.00 29.12 ? 152 TYR A CE2 1 
ATOM   1246 C  CZ  . TYR A 1 151 ? 1.889  16.498 24.847 1.00 30.64 ? 152 TYR A CZ  1 
ATOM   1247 O  OH  . TYR A 1 151 ? 2.786  15.496 25.085 1.00 30.94 ? 152 TYR A OH  1 
ATOM   1248 N  N   . LEU A 1 152 ? -2.462 21.657 26.066 1.00 28.55 ? 153 LEU A N   1 
ATOM   1249 C  CA  . LEU A 1 152 ? -3.074 22.946 26.267 1.00 29.38 ? 153 LEU A CA  1 
ATOM   1250 C  C   . LEU A 1 152 ? -2.489 23.931 25.329 1.00 28.61 ? 153 LEU A C   1 
ATOM   1251 O  O   . LEU A 1 152 ? -3.097 24.946 25.029 1.00 33.82 ? 153 LEU A O   1 
ATOM   1252 C  CB  . LEU A 1 152 ? -2.816 23.465 27.693 1.00 30.34 ? 153 LEU A CB  1 
ATOM   1253 C  CG  . LEU A 1 152 ? -3.735 22.836 28.719 1.00 41.37 ? 153 LEU A CG  1 
ATOM   1254 C  CD1 . LEU A 1 152 ? -3.246 23.139 30.134 1.00 42.18 ? 153 LEU A CD1 1 
ATOM   1255 C  CD2 . LEU A 1 152 ? -5.114 23.391 28.481 1.00 34.19 ? 153 LEU A CD2 1 
ATOM   1256 N  N   . CYS A 1 153 ? -1.207 23.754 25.070 1.00 30.87 ? 154 CYS A N   1 
ATOM   1257 C  CA  . CYS A 1 153 ? -0.502 24.762 24.294 1.00 25.06 ? 154 CYS A CA  1 
ATOM   1258 C  C   . CYS A 1 153 ? -0.948 24.874 22.830 1.00 28.62 ? 154 CYS A C   1 
ATOM   1259 O  O   . CYS A 1 153 ? -0.962 25.980 22.254 1.00 31.04 ? 154 CYS A O   1 
ATOM   1260 C  CB  . CYS A 1 153 ? 1.015  24.529 24.400 1.00 23.02 ? 154 CYS A CB  1 
ATOM   1261 S  SG  . CYS A 1 153 ? 1.420  22.776 24.505 1.00 27.69 ? 154 CYS A SG  1 
ATOM   1262 N  N   . CYS A 1 154 ? -1.202 23.730 22.194 1.00 30.65 ? 155 CYS A N   1 
ATOM   1263 C  CA  . CYS A 1 154 ? -1.382 23.742 20.763 1.00 27.91 ? 155 CYS A CA  1 
ATOM   1264 C  C   . CYS A 1 154 ? -2.524 22.906 20.404 1.00 29.31 ? 155 CYS A C   1 
ATOM   1265 O  O   . CYS A 1 154 ? -2.757 22.667 19.249 1.00 35.72 ? 155 CYS A O   1 
ATOM   1266 C  CB  . CYS A 1 154 ? -0.171 23.123 20.108 1.00 28.04 ? 155 CYS A CB  1 
ATOM   1267 S  SG  . CYS A 1 154 ? 0.293  21.548 20.867 1.00 30.46 ? 155 CYS A SG  1 
ATOM   1268 N  N   . SER A 1 155 ? -3.102 22.297 21.403 1.00 27.71 ? 156 SER A N   1 
ATOM   1269 C  CA  . SER A 1 155 ? -4.262 21.470 21.191 1.00 30.80 ? 156 SER A CA  1 
ATOM   1270 C  C   . SER A 1 155 ? -4.036 20.130 20.550 1.00 42.09 ? 156 SER A C   1 
ATOM   1271 O  O   . SER A 1 155 ? -4.994 19.422 20.287 1.00 46.66 ? 156 SER A O   1 
ATOM   1272 C  CB  . SER A 1 155 ? -5.347 22.181 20.393 1.00 28.83 ? 156 SER A CB  1 
ATOM   1273 O  OG  . SER A 1 155 ? -6.108 23.036 21.236 1.00 41.61 ? 156 SER A OG  1 
ATOM   1274 N  N   . GLN A 1 156 ? -2.800 19.762 20.303 1.00 36.40 ? 157 GLN A N   1 
ATOM   1275 C  CA  . GLN A 1 156 ? -2.571 18.433 19.761 1.00 32.03 ? 157 GLN A CA  1 
ATOM   1276 C  C   . GLN A 1 156 ? -3.108 17.306 20.699 1.00 36.24 ? 157 GLN A C   1 
ATOM   1277 O  O   . GLN A 1 156 ? -3.092 17.391 21.918 1.00 33.24 ? 157 GLN A O   1 
ATOM   1278 C  CB  . GLN A 1 156 ? -1.099 18.240 19.302 1.00 33.69 ? 157 GLN A CB  1 
ATOM   1279 C  CG  . GLN A 1 156 ? -0.665 19.204 18.154 1.00 31.78 ? 157 GLN A CG  1 
ATOM   1280 C  CD  . GLN A 1 156 ? 0.777  19.029 17.653 1.00 47.84 ? 157 GLN A CD  1 
ATOM   1281 O  OE1 . GLN A 1 156 ? 1.027  18.286 16.691 1.00 41.43 ? 157 GLN A OE1 1 
ATOM   1282 N  NE2 . GLN A 1 156 ? 1.680  19.869 18.157 1.00 36.36 ? 157 GLN A NE2 1 
ATOM   1283 N  N   . THR A 1 157 ? -3.647 16.264 20.101 1.00 41.51 ? 158 THR A N   1 
ATOM   1284 C  CA  . THR A 1 157 ? -4.254 15.184 20.866 1.00 47.64 ? 158 THR A CA  1 
ATOM   1285 C  C   . THR A 1 157 ? -3.275 14.096 21.313 1.00 58.18 ? 158 THR A C   1 
ATOM   1286 O  O   . THR A 1 157 ? -3.276 13.646 22.484 1.00 60.00 ? 158 THR A O   1 
ATOM   1287 C  CB  . THR A 1 157 ? -5.298 14.508 20.000 1.00 52.28 ? 158 THR A CB  1 
ATOM   1288 O  OG1 . THR A 1 157 ? -4.690 14.150 18.764 1.00 60.00 ? 158 THR A OG1 1 
ATOM   1289 C  CG2 . THR A 1 157 ? -6.422 15.499 19.746 1.00 44.57 ? 158 THR A CG2 1 
ATOM   1290 N  N   . ALA A 1 158 ? -2.495 13.626 20.342 1.00 39.56 ? 159 ALA A N   1 
ATOM   1291 C  CA  . ALA A 1 158 ? -1.507 12.605 20.578 1.00 35.53 ? 159 ALA A CA  1 
ATOM   1292 C  C   . ALA A 1 158 ? -0.502 13.023 21.614 1.00 41.79 ? 159 ALA A C   1 
ATOM   1293 O  O   . ALA A 1 158 ? 0.249  13.975 21.390 1.00 41.42 ? 159 ALA A O   1 
ATOM   1294 C  CB  . ALA A 1 158 ? -0.775 12.285 19.289 1.00 33.87 ? 159 ALA A CB  1 
ATOM   1295 N  N   . LYS A 1 159 ? -0.335 12.185 22.632 1.00 42.03 ? 160 LYS A N   1 
ATOM   1296 C  CA  . LYS A 1 159 ? 0.652  12.469 23.676 1.00 43.90 ? 160 LYS A CA  1 
ATOM   1297 C  C   . LYS A 1 159 ? 2.027  12.640 23.109 1.00 41.26 ? 160 LYS A C   1 
ATOM   1298 O  O   . LYS A 1 159 ? 2.857  13.381 23.624 1.00 43.58 ? 160 LYS A O   1 
ATOM   1299 C  CB  . LYS A 1 159 ? 0.643  11.443 24.800 1.00 36.87 ? 160 LYS A CB  1 
ATOM   1300 C  CG  . LYS A 1 159 ? -0.245 11.844 25.959 1.00 40.65 ? 160 LYS A CG  1 
ATOM   1301 C  CD  . LYS A 1 159 ? -0.399 10.672 26.897 1.00 60.00 ? 160 LYS A CD  1 
ATOM   1302 C  CE  . LYS A 1 159 ? -1.631 10.753 27.795 1.00 60.00 ? 160 LYS A CE  1 
ATOM   1303 N  NZ  . LYS A 1 159 ? -2.105 9.370  28.149 1.00 60.00 ? 160 LYS A NZ  1 
ATOM   1304 N  N   . ASN A 1 160 ? 2.276  12.002 22.003 1.00 33.14 ? 161 ASN A N   1 
ATOM   1305 C  CA  . ASN A 1 160 ? 3.570  12.203 21.439 1.00 30.95 ? 161 ASN A CA  1 
ATOM   1306 C  C   . ASN A 1 160 ? 3.581  13.083 20.215 1.00 31.44 ? 161 ASN A C   1 
ATOM   1307 O  O   . ASN A 1 160 ? 4.520  13.096 19.449 1.00 40.91 ? 161 ASN A O   1 
ATOM   1308 C  CB  . ASN A 1 160 ? 4.452  10.950 21.372 1.00 54.94 ? 161 ASN A CB  1 
ATOM   1309 C  CG  . ASN A 1 160 ? 4.161  10.062 20.160 1.00 60.00 ? 161 ASN A CG  1 
ATOM   1310 O  OD1 . ASN A 1 160 ? 3.099  10.197 19.483 1.00 60.00 ? 161 ASN A OD1 1 
ATOM   1311 N  ND2 . ASN A 1 160 ? 5.087  9.101  19.897 1.00 60.00 ? 161 ASN A ND2 1 
ATOM   1312 N  N   . ALA A 1 161 ? 2.623  13.966 20.165 1.00 34.78 ? 162 ALA A N   1 
ATOM   1313 C  CA  . ALA A 1 161 ? 2.609  15.003 19.169 1.00 30.48 ? 162 ALA A CA  1 
ATOM   1314 C  C   . ALA A 1 161 ? 3.921  15.784 19.205 1.00 33.10 ? 162 ALA A C   1 
ATOM   1315 O  O   . ALA A 1 161 ? 4.386  16.178 20.248 1.00 40.13 ? 162 ALA A O   1 
ATOM   1316 C  CB  . ALA A 1 161 ? 1.461  15.929 19.494 1.00 29.00 ? 162 ALA A CB  1 
ATOM   1317 N  N   . MET A 1 162 ? 4.465  16.114 18.051 1.00 28.20 ? 163 MET A N   1 
ATOM   1318 C  CA  . MET A 1 162 ? 5.639  16.937 18.001 1.00 28.49 ? 163 MET A CA  1 
ATOM   1319 C  C   . MET A 1 162 ? 5.360  18.240 18.742 1.00 28.11 ? 163 MET A C   1 
ATOM   1320 O  O   . MET A 1 162 ? 4.288  18.791 18.635 1.00 32.86 ? 163 MET A O   1 
ATOM   1321 C  CB  . MET A 1 162 ? 5.981  17.239 16.545 1.00 34.31 ? 163 MET A CB  1 
ATOM   1322 C  CG  . MET A 1 162 ? 6.403  18.671 16.312 1.00 45.14 ? 163 MET A CG  1 
ATOM   1323 S  SD  . MET A 1 162 ? 7.326  18.959 14.740 1.00 60.00 ? 163 MET A SD  1 
ATOM   1324 C  CE  . MET A 1 162 ? 7.663  17.247 14.136 1.00 60.00 ? 163 MET A CE  1 
ATOM   1325 N  N   . GLY A 1 163 ? 6.363  18.781 19.410 1.00 24.35 ? 164 GLY A N   1 
ATOM   1326 C  CA  . GLY A 1 163 ? 6.202  19.970 20.215 1.00 26.14 ? 164 GLY A CA  1 
ATOM   1327 C  C   . GLY A 1 163 ? 5.819  21.159 19.421 1.00 26.22 ? 164 GLY A C   1 
ATOM   1328 O  O   . GLY A 1 163 ? 6.123  21.289 18.267 1.00 36.43 ? 164 GLY A O   1 
ATOM   1329 N  N   . CYS A 1 164 ? 5.185  22.075 20.069 1.00 26.99 ? 165 CYS A N   1 
ATOM   1330 C  CA  . CYS A 1 164 ? 4.719  23.234 19.403 1.00 27.06 ? 165 CYS A CA  1 
ATOM   1331 C  C   . CYS A 1 164 ? 5.650  24.390 19.610 1.00 32.04 ? 165 CYS A C   1 
ATOM   1332 O  O   . CYS A 1 164 ? 5.546  25.385 18.924 1.00 33.82 ? 165 CYS A O   1 
ATOM   1333 C  CB  . CYS A 1 164 ? 3.299  23.577 19.860 1.00 27.95 ? 165 CYS A CB  1 
ATOM   1334 S  SG  . CYS A 1 164 ? 3.148  23.856 21.655 1.00 30.12 ? 165 CYS A SG  1 
ATOM   1335 N  N   . GLN A 1 165 ? 6.580  24.281 20.545 1.00 31.70 ? 166 GLN A N   1 
ATOM   1336 C  CA  . GLN A 1 165 ? 7.453  25.418 20.733 1.00 22.21 ? 166 GLN A CA  1 
ATOM   1337 C  C   . GLN A 1 165 ? 8.899  25.171 20.649 1.00 33.37 ? 166 GLN A C   1 
ATOM   1338 O  O   . GLN A 1 165 ? 9.427  24.256 21.251 1.00 28.33 ? 166 GLN A O   1 
ATOM   1339 C  CB  . GLN A 1 165 ? 7.247  26.122 22.016 1.00 21.86 ? 166 GLN A CB  1 
ATOM   1340 C  CG  . GLN A 1 165 ? 7.732  27.555 21.878 1.00 29.60 ? 166 GLN A CG  1 
ATOM   1341 C  CD  . GLN A 1 165 ? 7.757  28.127 23.216 1.00 34.85 ? 166 GLN A CD  1 
ATOM   1342 O  OE1 . GLN A 1 165 ? 7.434  27.434 24.175 1.00 38.80 ? 166 GLN A OE1 1 
ATOM   1343 N  NE2 . GLN A 1 165 ? 8.151  29.359 23.336 1.00 26.22 ? 166 GLN A NE2 1 
ATOM   1344 N  N   . ILE A 1 166 ? 9.574  26.067 19.999 1.00 26.52 ? 167 ILE A N   1 
ATOM   1345 C  CA  . ILE A 1 166 ? 10.975 25.877 19.924 1.00 31.53 ? 167 ILE A CA  1 
ATOM   1346 C  C   . ILE A 1 166 ? 11.674 26.664 20.950 1.00 38.47 ? 167 ILE A C   1 
ATOM   1347 O  O   . ILE A 1 166 ? 11.341 27.815 21.157 1.00 46.08 ? 167 ILE A O   1 
ATOM   1348 C  CB  . ILE A 1 166 ? 11.502 26.375 18.618 1.00 39.27 ? 167 ILE A CB  1 
ATOM   1349 C  CG1 . ILE A 1 166 ? 11.199 25.344 17.584 1.00 47.00 ? 167 ILE A CG1 1 
ATOM   1350 C  CG2 . ILE A 1 166 ? 12.986 26.434 18.692 1.00 41.17 ? 167 ILE A CG2 1 
ATOM   1351 C  CD1 . ILE A 1 166 ? 11.036 25.975 16.229 1.00 60.00 ? 167 ILE A CD1 1 
ATOM   1352 N  N   . LEU A 1 167 ? 12.755 26.098 21.460 1.00 44.84 ? 168 LEU A N   1 
ATOM   1353 C  CA  . LEU A 1 167 ? 13.592 26.858 22.347 1.00 48.40 ? 168 LEU A CA  1 
ATOM   1354 C  C   . LEU A 1 167 ? 14.907 27.247 21.661 1.00 48.27 ? 168 LEU A C   1 
ATOM   1355 O  O   . LEU A 1 167 ? 15.636 26.379 21.147 1.00 44.31 ? 168 LEU A O   1 
ATOM   1356 C  CB  . LEU A 1 167 ? 13.789 26.119 23.676 1.00 52.42 ? 168 LEU A CB  1 
ATOM   1357 C  CG  . LEU A 1 167 ? 12.543 26.223 24.595 1.00 60.00 ? 168 LEU A CG  1 
ATOM   1358 C  CD1 . LEU A 1 167 ? 12.858 26.526 26.082 1.00 60.00 ? 168 LEU A CD1 1 
ATOM   1359 C  CD2 . LEU A 1 167 ? 11.560 27.278 24.061 1.00 60.00 ? 168 LEU A CD2 1 
ATOM   1360 N  N   . GLU A 1 168 ? 15.156 28.555 21.540 1.00 42.01 ? 169 GLU A N   1 
ATOM   1361 C  CA  . GLU A 1 168 ? 16.389 28.983 20.908 1.00 43.34 ? 169 GLU A CA  1 
ATOM   1362 C  C   . GLU A 1 168 ? 17.102 30.139 21.566 1.00 46.45 ? 169 GLU A C   1 
ATOM   1363 O  O   . GLU A 1 168 ? 16.503 30.952 22.270 1.00 51.82 ? 169 GLU A O   1 
ATOM   1364 C  CB  . GLU A 1 168 ? 16.313 29.124 19.374 1.00 46.26 ? 169 GLU A CB  1 
ATOM   1365 C  CG  . GLU A 1 168 ? 15.203 30.036 18.834 1.00 32.28 ? 169 GLU A CG  1 
ATOM   1366 C  CD  . GLU A 1 168 ? 14.675 29.541 17.491 1.00 54.11 ? 169 GLU A CD  1 
ATOM   1367 O  OE1 . GLU A 1 168 ? 15.225 28.597 16.910 1.00 60.00 ? 169 GLU A OE1 1 
ATOM   1368 O  OE2 . GLU A 1 168 ? 13.728 30.194 16.951 1.00 52.96 ? 169 GLU A OE2 1 
ATOM   1369 N  N   . ASN A 1 169 ? 18.415 30.166 21.402 1.00 40.88 ? 170 ASN A N   1 
ATOM   1370 C  CA  . ASN A 1 169 ? 19.233 31.246 21.951 1.00 59.97 ? 170 ASN A CA  1 
ATOM   1371 C  C   . ASN A 1 169 ? 20.059 31.783 20.790 1.00 35.41 ? 170 ASN A C   1 
ATOM   1372 O  O   . ASN A 1 169 ? 19.522 31.888 19.667 1.00 60.00 ? 170 ASN A O   1 
ATOM   1373 C  CB  . ASN A 1 169 ? 20.124 30.742 23.100 1.00 45.32 ? 170 ASN A CB  1 
ATOM   1374 C  CG  . ASN A 1 169 ? 20.114 29.210 23.210 1.00 60.00 ? 170 ASN A CG  1 
ATOM   1375 O  OD1 . ASN A 1 169 ? 19.229 28.619 23.904 1.00 60.00 ? 170 ASN A OD1 1 
ATOM   1376 N  ND2 . ASN A 1 169 ? 20.996 28.551 22.419 1.00 60.00 ? 170 ASN A ND2 1 
ATOM   1377 N  N   . ALA B 1 1   ? -7.493 24.519 71.896 1.00 60.00 ? 2   ALA B N   1 
ATOM   1378 C  CA  . ALA B 1 1   ? -6.060 24.554 71.611 1.00 60.00 ? 2   ALA B CA  1 
ATOM   1379 C  C   . ALA B 1 1   ? -5.714 24.555 70.081 1.00 60.00 ? 2   ALA B C   1 
ATOM   1380 O  O   . ALA B 1 1   ? -6.257 23.785 69.284 1.00 60.00 ? 2   ALA B O   1 
ATOM   1381 C  CB  . ALA B 1 1   ? -5.370 23.394 72.340 1.00 60.00 ? 2   ALA B CB  1 
ATOM   1382 N  N   . ALA B 1 2   ? -4.809 25.437 69.678 1.00 60.00 ? 3   ALA B N   1 
ATOM   1383 C  CA  . ALA B 1 2   ? -4.393 25.520 68.288 1.00 56.61 ? 3   ALA B CA  1 
ATOM   1384 C  C   . ALA B 1 2   ? -3.016 24.957 68.251 1.00 55.73 ? 3   ALA B C   1 
ATOM   1385 O  O   . ALA B 1 2   ? -2.333 24.880 69.276 1.00 60.00 ? 3   ALA B O   1 
ATOM   1386 C  CB  . ALA B 1 2   ? -4.374 26.970 67.804 1.00 56.84 ? 3   ALA B CB  1 
ATOM   1387 N  N   . VAL B 1 3   ? -2.579 24.554 67.085 1.00 47.47 ? 4   VAL B N   1 
ATOM   1388 C  CA  . VAL B 1 3   ? -1.266 23.973 67.081 1.00 43.78 ? 4   VAL B CA  1 
ATOM   1389 C  C   . VAL B 1 3   ? -0.147 24.957 67.269 1.00 45.32 ? 4   VAL B C   1 
ATOM   1390 O  O   . VAL B 1 3   ? 0.114  25.818 66.446 1.00 51.75 ? 4   VAL B O   1 
ATOM   1391 C  CB  . VAL B 1 3   ? -1.072 22.952 65.956 1.00 40.50 ? 4   VAL B CB  1 
ATOM   1392 C  CG1 . VAL B 1 3   ? 0.250  22.212 66.044 1.00 29.22 ? 4   VAL B CG1 1 
ATOM   1393 C  CG2 . VAL B 1 3   ? -2.179 21.955 66.043 1.00 41.79 ? 4   VAL B CG2 1 
ATOM   1394 N  N   . ILE B 1 4   ? 0.506  24.835 68.392 1.00 48.89 ? 5   ILE B N   1 
ATOM   1395 C  CA  . ILE B 1 4   ? 1.706  25.587 68.588 1.00 47.07 ? 5   ILE B CA  1 
ATOM   1396 C  C   . ILE B 1 4   ? 2.746  25.069 67.575 1.00 50.89 ? 5   ILE B C   1 
ATOM   1397 O  O   . ILE B 1 4   ? 3.119  25.784 66.700 1.00 55.84 ? 5   ILE B O   1 
ATOM   1398 C  CB  . ILE B 1 4   ? 2.201  25.419 70.021 1.00 48.82 ? 5   ILE B CB  1 
ATOM   1399 C  CG1 . ILE B 1 4   ? 1.274  26.134 70.977 1.00 42.75 ? 5   ILE B CG1 1 
ATOM   1400 C  CG2 . ILE B 1 4   ? 3.629  25.931 70.190 1.00 38.97 ? 5   ILE B CG2 1 
ATOM   1401 C  CD1 . ILE B 1 4   ? 2.014  26.490 72.252 1.00 57.70 ? 5   ILE B CD1 1 
ATOM   1402 N  N   . LEU B 1 5   ? 3.186  23.819 67.663 1.00 45.06 ? 6   LEU B N   1 
ATOM   1403 C  CA  . LEU B 1 5   ? 4.134  23.284 66.682 1.00 39.29 ? 6   LEU B CA  1 
ATOM   1404 C  C   . LEU B 1 5   ? 3.654  21.980 65.999 1.00 47.47 ? 6   LEU B C   1 
ATOM   1405 O  O   . LEU B 1 5   ? 2.731  21.338 66.467 1.00 39.01 ? 6   LEU B O   1 
ATOM   1406 C  CB  . LEU B 1 5   ? 5.453  22.924 67.336 1.00 34.71 ? 6   LEU B CB  1 
ATOM   1407 C  CG  . LEU B 1 5   ? 6.296  24.048 67.825 1.00 41.44 ? 6   LEU B CG  1 
ATOM   1408 C  CD1 . LEU B 1 5   ? 7.667  23.459 68.138 1.00 46.48 ? 6   LEU B CD1 1 
ATOM   1409 C  CD2 . LEU B 1 5   ? 6.415  25.020 66.710 1.00 40.57 ? 6   LEU B CD2 1 
ATOM   1410 N  N   . GLU B 1 6   ? 4.447  21.481 65.050 1.00 37.86 ? 7   GLU B N   1 
ATOM   1411 C  CA  . GLU B 1 6   ? 4.154  20.237 64.386 1.00 27.97 ? 7   GLU B CA  1 
ATOM   1412 C  C   . GLU B 1 6   ? 5.379  19.732 63.644 1.00 29.68 ? 7   GLU B C   1 
ATOM   1413 O  O   . GLU B 1 6   ? 5.859  20.357 62.757 1.00 36.09 ? 7   GLU B O   1 
ATOM   1414 C  CB  . GLU B 1 6   ? 3.018  20.455 63.439 1.00 31.95 ? 7   GLU B CB  1 
ATOM   1415 C  CG  . GLU B 1 6   ? 2.585  19.196 62.760 1.00 47.16 ? 7   GLU B CG  1 
ATOM   1416 C  CD  . GLU B 1 6   ? 1.285  19.399 62.049 1.00 60.00 ? 7   GLU B CD  1 
ATOM   1417 O  OE1 . GLU B 1 6   ? 0.388  20.005 62.640 1.00 60.00 ? 7   GLU B OE1 1 
ATOM   1418 O  OE2 . GLU B 1 6   ? 1.185  18.980 60.827 1.00 60.00 ? 7   GLU B OE2 1 
ATOM   1419 N  N   . SER B 1 7   ? 5.866  18.571 64.010 1.00 22.64 ? 8   SER B N   1 
ATOM   1420 C  CA  . SER B 1 7   ? 7.029  18.059 63.379 1.00 16.68 ? 8   SER B CA  1 
ATOM   1421 C  C   . SER B 1 7   ? 6.939  16.580 63.311 1.00 26.98 ? 8   SER B C   1 
ATOM   1422 O  O   . SER B 1 7   ? 6.122  15.995 63.976 1.00 29.53 ? 8   SER B O   1 
ATOM   1423 C  CB  . SER B 1 7   ? 8.220  18.469 64.194 1.00 18.99 ? 8   SER B CB  1 
ATOM   1424 O  OG  . SER B 1 7   ? 8.211  19.875 64.141 1.00 29.18 ? 8   SER B OG  1 
ATOM   1425 N  N   . ILE B 1 8   ? 7.812  15.975 62.537 1.00 29.81 ? 9   ILE B N   1 
ATOM   1426 C  CA  . ILE B 1 8   ? 7.893  14.531 62.453 1.00 30.65 ? 9   ILE B CA  1 
ATOM   1427 C  C   . ILE B 1 8   ? 9.134  14.162 63.197 1.00 28.60 ? 9   ILE B C   1 
ATOM   1428 O  O   . ILE B 1 8   ? 10.191 14.702 62.877 1.00 27.45 ? 9   ILE B O   1 
ATOM   1429 C  CB  . ILE B 1 8   ? 8.037  14.027 60.980 1.00 31.90 ? 9   ILE B CB  1 
ATOM   1430 C  CG1 . ILE B 1 8   ? 6.653  13.867 60.351 1.00 37.93 ? 9   ILE B CG1 1 
ATOM   1431 C  CG2 . ILE B 1 8   ? 8.778  12.692 60.892 1.00 19.90 ? 9   ILE B CG2 1 
ATOM   1432 C  CD1 . ILE B 1 8   ? 6.557  14.350 58.907 1.00 41.05 ? 9   ILE B CD1 1 
ATOM   1433 N  N   . PHE B 1 9   ? 9.014  13.261 64.193 1.00 24.38 ? 10  PHE B N   1 
ATOM   1434 C  CA  . PHE B 1 9   ? 10.151 12.810 64.986 1.00 22.27 ? 10  PHE B CA  1 
ATOM   1435 C  C   . PHE B 1 9   ? 10.092 11.322 65.079 1.00 25.00 ? 10  PHE B C   1 
ATOM   1436 O  O   . PHE B 1 9   ? 9.056  10.722 64.797 1.00 36.31 ? 10  PHE B O   1 
ATOM   1437 C  CB  . PHE B 1 9   ? 10.096 13.332 66.445 1.00 29.56 ? 10  PHE B CB  1 
ATOM   1438 C  CG  . PHE B 1 9   ? 10.249 14.839 66.593 1.00 31.42 ? 10  PHE B CG  1 
ATOM   1439 C  CD1 . PHE B 1 9   ? 11.374 15.495 66.098 1.00 30.41 ? 10  PHE B CD1 1 
ATOM   1440 C  CD2 . PHE B 1 9   ? 9.304  15.605 67.292 1.00 31.45 ? 10  PHE B CD2 1 
ATOM   1441 C  CE1 . PHE B 1 9   ? 11.523 16.881 66.238 1.00 27.31 ? 10  PHE B CE1 1 
ATOM   1442 C  CE2 . PHE B 1 9   ? 9.436  16.996 67.424 1.00 33.41 ? 10  PHE B CE2 1 
ATOM   1443 C  CZ  . PHE B 1 9   ? 10.572 17.636 66.927 1.00 35.79 ? 10  PHE B CZ  1 
ATOM   1444 N  N   . LEU B 1 10  ? 11.212 10.759 65.532 1.00 27.35 ? 11  LEU B N   1 
ATOM   1445 C  CA  . LEU B 1 10  ? 11.361 9.346  65.885 1.00 30.49 ? 11  LEU B CA  1 
ATOM   1446 C  C   . LEU B 1 10  ? 11.186 9.313  67.406 1.00 35.54 ? 11  LEU B C   1 
ATOM   1447 O  O   . LEU B 1 10  ? 11.546 10.252 68.051 1.00 36.39 ? 11  LEU B O   1 
ATOM   1448 C  CB  . LEU B 1 10  ? 12.792 8.853  65.542 1.00 32.02 ? 11  LEU B CB  1 
ATOM   1449 C  CG  . LEU B 1 10  ? 12.948 7.348  65.755 1.00 36.72 ? 11  LEU B CG  1 
ATOM   1450 C  CD1 . LEU B 1 10  ? 12.201 6.647  64.666 1.00 33.89 ? 11  LEU B CD1 1 
ATOM   1451 C  CD2 . LEU B 1 10  ? 14.387 6.934  65.732 1.00 31.96 ? 11  LEU B CD2 1 
ATOM   1452 N  N   . LYS B 1 11  ? 10.562 8.313  67.992 1.00 30.95 ? 12  LYS B N   1 
ATOM   1453 C  CA  . LYS B 1 11  ? 10.389 8.348  69.441 1.00 26.14 ? 12  LYS B CA  1 
ATOM   1454 C  C   . LYS B 1 11  ? 10.492 6.941  69.881 1.00 28.06 ? 12  LYS B C   1 
ATOM   1455 O  O   . LYS B 1 11  ? 10.194 6.023  69.116 1.00 30.98 ? 12  LYS B O   1 
ATOM   1456 C  CB  . LYS B 1 11  ? 9.030  8.855  69.793 1.00 24.86 ? 12  LYS B CB  1 
ATOM   1457 C  CG  . LYS B 1 11  ? 7.986  7.809  69.398 1.00 29.01 ? 12  LYS B CG  1 
ATOM   1458 C  CD  . LYS B 1 11  ? 6.632  8.123  69.999 1.00 31.44 ? 12  LYS B CD  1 
ATOM   1459 C  CE  . LYS B 1 11  ? 6.254  7.128  71.113 1.00 22.58 ? 12  LYS B CE  1 
ATOM   1460 N  NZ  . LYS B 1 11  ? 6.437  5.684  70.737 1.00 31.85 ? 12  LYS B NZ  1 
ATOM   1461 N  N   . ARG B 1 12  ? 11.075 6.758  71.050 1.00 33.70 ? 13  ARG B N   1 
ATOM   1462 C  CA  . ARG B 1 12  ? 11.298 5.397  71.578 1.00 37.43 ? 13  ARG B CA  1 
ATOM   1463 C  C   . ARG B 1 12  ? 10.045 4.851  72.281 1.00 33.83 ? 13  ARG B C   1 
ATOM   1464 O  O   . ARG B 1 12  ? 9.279  5.621  72.875 1.00 30.69 ? 13  ARG B O   1 
ATOM   1465 C  CB  . ARG B 1 12  ? 12.493 5.396  72.536 1.00 28.86 ? 13  ARG B CB  1 
ATOM   1466 C  CG  . ARG B 1 12  ? 13.011 4.016  72.851 1.00 27.19 ? 13  ARG B CG  1 
ATOM   1467 C  CD  . ARG B 1 12  ? 14.078 4.066  73.957 1.00 34.70 ? 13  ARG B CD  1 
ATOM   1468 N  NE  . ARG B 1 12  ? 13.556 4.156  75.331 1.00 44.24 ? 13  ARG B NE  1 
ATOM   1469 C  CZ  . ARG B 1 12  ? 14.283 4.445  76.428 1.00 40.71 ? 13  ARG B CZ  1 
ATOM   1470 N  NH1 . ARG B 1 12  ? 15.562 4.661  76.375 1.00 49.72 ? 13  ARG B NH1 1 
ATOM   1471 N  NH2 . ARG B 1 12  ? 13.711 4.500  77.609 1.00 60.00 ? 13  ARG B NH2 1 
ATOM   1472 N  N   . SER B 1 13  ? 9.804  3.542  72.211 1.00 31.76 ? 14  SER B N   1 
ATOM   1473 C  CA  . SER B 1 13  ? 8.632  2.983  72.931 1.00 31.32 ? 14  SER B CA  1 
ATOM   1474 C  C   . SER B 1 13  ? 8.720  3.357  74.389 1.00 33.53 ? 14  SER B C   1 
ATOM   1475 O  O   . SER B 1 13  ? 9.797  3.316  74.997 1.00 35.86 ? 14  SER B O   1 
ATOM   1476 C  CB  . SER B 1 13  ? 8.463  1.452  72.839 1.00 28.26 ? 14  SER B CB  1 
ATOM   1477 O  OG  . SER B 1 13  ? 9.700  0.813  73.055 1.00 47.01 ? 14  SER B OG  1 
ATOM   1478 N  N   . GLN B 1 14  ? 7.570  3.707  74.937 1.00 31.70 ? 15  GLN B N   1 
ATOM   1479 C  CA  . GLN B 1 14  ? 7.450  4.015  76.338 1.00 28.79 ? 15  GLN B CA  1 
ATOM   1480 C  C   . GLN B 1 14  ? 7.333  2.759  77.172 1.00 42.34 ? 15  GLN B C   1 
ATOM   1481 O  O   . GLN B 1 14  ? 7.604  2.798  78.381 1.00 44.94 ? 15  GLN B O   1 
ATOM   1482 C  CB  . GLN B 1 14  ? 6.297  4.967  76.611 1.00 29.96 ? 15  GLN B CB  1 
ATOM   1483 C  CG  . GLN B 1 14  ? 6.684  6.406  76.308 1.00 23.55 ? 15  GLN B CG  1 
ATOM   1484 C  CD  . GLN B 1 14  ? 5.633  7.367  76.770 1.00 27.44 ? 15  GLN B CD  1 
ATOM   1485 O  OE1 . GLN B 1 14  ? 5.632  7.760  77.940 1.00 48.32 ? 15  GLN B OE1 1 
ATOM   1486 N  NE2 . GLN B 1 14  ? 4.659  7.674  75.894 1.00 30.19 ? 15  GLN B NE2 1 
ATOM   1487 N  N   . GLN B 1 15  ? 7.066  1.633  76.499 1.00 52.36 ? 16  GLN B N   1 
ATOM   1488 C  CA  . GLN B 1 15  ? 6.996  0.305  77.135 1.00 46.21 ? 16  GLN B CA  1 
ATOM   1489 C  C   . GLN B 1 15  ? 6.131  0.344  78.377 1.00 39.80 ? 16  GLN B C   1 
ATOM   1490 O  O   . GLN B 1 15  ? 6.578  -0.018 79.430 1.00 41.25 ? 16  GLN B O   1 
ATOM   1491 C  CB  . GLN B 1 15  ? 8.397  -0.200 77.534 1.00 41.67 ? 16  GLN B CB  1 
ATOM   1492 C  CG  . GLN B 1 15  ? 9.012  -1.192 76.543 1.00 46.24 ? 16  GLN B CG  1 
ATOM   1493 C  CD  . GLN B 1 15  ? 10.493 -1.480 76.787 1.00 47.65 ? 16  GLN B CD  1 
ATOM   1494 O  OE1 . GLN B 1 15  ? 11.233 -0.652 77.329 1.00 48.30 ? 16  GLN B OE1 1 
ATOM   1495 N  NE2 . GLN B 1 15  ? 10.957 -2.598 76.242 1.00 48.58 ? 16  GLN B NE2 1 
ATOM   1496 N  N   . LYS B 1 16  ? 4.965  0.943  78.274 1.00 36.36 ? 17  LYS B N   1 
ATOM   1497 C  CA  . LYS B 1 16  ? 4.049  0.990  79.376 1.00 33.23 ? 17  LYS B CA  1 
ATOM   1498 C  C   . LYS B 1 16  ? 3.407  -0.382 79.592 1.00 44.60 ? 17  LYS B C   1 
ATOM   1499 O  O   . LYS B 1 16  ? 2.604  -0.551 80.484 1.00 49.42 ? 17  LYS B O   1 
ATOM   1500 C  CB  . LYS B 1 16  ? 2.971  2.024  79.141 1.00 28.25 ? 17  LYS B CB  1 
ATOM   1501 C  CG  . LYS B 1 16  ? 3.472  3.469  79.368 1.00 39.99 ? 17  LYS B CG  1 
ATOM   1502 C  CD  . LYS B 1 16  ? 2.458  4.443  78.814 1.00 35.28 ? 17  LYS B CD  1 
ATOM   1503 C  CE  . LYS B 1 16  ? 2.780  5.909  79.042 1.00 30.42 ? 17  LYS B CE  1 
ATOM   1504 N  NZ  . LYS B 1 16  ? 1.530  6.691  78.837 1.00 35.81 ? 17  LYS B NZ  1 
ATOM   1505 N  N   . LYS B 1 17  ? 3.716  -1.343 78.732 1.00 42.27 ? 18  LYS B N   1 
ATOM   1506 C  CA  . LYS B 1 17  ? 3.208  -2.695 78.895 1.00 30.63 ? 18  LYS B CA  1 
ATOM   1507 C  C   . LYS B 1 17  ? 4.384  -3.649 78.937 1.00 48.00 ? 18  LYS B C   1 
ATOM   1508 O  O   . LYS B 1 17  ? 5.334  -3.488 78.180 1.00 50.49 ? 18  LYS B O   1 
ATOM   1509 C  CB  . LYS B 1 17  ? 2.228  -3.051 77.809 1.00 24.99 ? 18  LYS B CB  1 
ATOM   1510 C  CG  . LYS B 1 17  ? 0.933  -2.294 78.008 1.00 29.07 ? 18  LYS B CG  1 
ATOM   1511 C  CD  . LYS B 1 17  ? 0.251  -1.878 76.696 1.00 43.93 ? 18  LYS B CD  1 
ATOM   1512 C  CE  . LYS B 1 17  ? 0.257  -2.929 75.598 1.00 29.78 ? 18  LYS B CE  1 
ATOM   1513 N  NZ  . LYS B 1 17  ? -0.672 -2.533 74.508 1.00 34.16 ? 18  LYS B NZ  1 
ATOM   1514 N  N   . LYS B 1 18  ? 4.370  -4.564 79.909 1.00 51.72 ? 19  LYS B N   1 
ATOM   1515 C  CA  . LYS B 1 18  ? 5.455  -5.533 80.103 1.00 53.69 ? 19  LYS B CA  1 
ATOM   1516 C  C   . LYS B 1 18  ? 5.848  -6.261 78.815 1.00 49.49 ? 19  LYS B C   1 
ATOM   1517 O  O   . LYS B 1 18  ? 6.978  -6.758 78.643 1.00 45.87 ? 19  LYS B O   1 
ATOM   1518 C  CB  . LYS B 1 18  ? 5.052  -6.558 81.157 1.00 58.26 ? 19  LYS B CB  1 
ATOM   1519 C  CG  . LYS B 1 18  ? 3.870  -6.133 82.008 1.00 60.00 ? 19  LYS B CG  1 
ATOM   1520 C  CD  . LYS B 1 18  ? 3.789  -6.958 83.282 0.00 60.00 ? 19  LYS B CD  1 
ATOM   1521 C  CE  . LYS B 1 18  ? 2.766  -6.416 84.262 0.00 60.00 ? 19  LYS B CE  1 
ATOM   1522 N  NZ  . LYS B 1 18  ? 2.505  -7.350 85.373 0.00 60.00 ? 19  LYS B NZ  1 
ATOM   1523 N  N   . THR B 1 19  ? 4.870  -6.368 77.940 1.00 42.86 ? 20  THR B N   1 
ATOM   1524 C  CA  . THR B 1 19  ? 5.044  -7.029 76.663 1.00 44.54 ? 20  THR B CA  1 
ATOM   1525 C  C   . THR B 1 19  ? 5.805  -6.147 75.638 1.00 42.04 ? 20  THR B C   1 
ATOM   1526 O  O   . THR B 1 19  ? 6.659  -6.617 74.888 1.00 48.57 ? 20  THR B O   1 
ATOM   1527 C  CB  . THR B 1 19  ? 3.629  -7.428 76.167 1.00 60.00 ? 20  THR B CB  1 
ATOM   1528 O  OG1 . THR B 1 19  ? 2.650  -6.604 76.822 1.00 60.00 ? 20  THR B OG1 1 
ATOM   1529 C  CG2 . THR B 1 19  ? 3.335  -8.870 76.551 1.00 60.00 ? 20  THR B CG2 1 
ATOM   1530 N  N   . SER B 1 20  ? 5.507  -4.857 75.635 1.00 36.08 ? 21  SER B N   1 
ATOM   1531 C  CA  . SER B 1 20  ? 6.122  -3.965 74.692 1.00 35.06 ? 21  SER B CA  1 
ATOM   1532 C  C   . SER B 1 20  ? 7.628  -4.144 74.556 1.00 43.86 ? 21  SER B C   1 
ATOM   1533 O  O   . SER B 1 20  ? 8.390  -4.070 75.519 1.00 46.66 ? 21  SER B O   1 
ATOM   1534 C  CB  . SER B 1 20  ? 5.798  -2.529 75.029 1.00 33.57 ? 21  SER B CB  1 
ATOM   1535 O  OG  . SER B 1 20  ? 4.428  -2.294 74.888 1.00 43.82 ? 21  SER B OG  1 
ATOM   1536 N  N   . PRO B 1 21  ? 8.067  -4.216 73.318 1.00 43.60 ? 22  PRO B N   1 
ATOM   1537 C  CA  . PRO B 1 21  ? 9.495  -4.250 73.002 1.00 43.40 ? 22  PRO B CA  1 
ATOM   1538 C  C   . PRO B 1 21  ? 10.033 -2.841 73.034 1.00 42.23 ? 22  PRO B C   1 
ATOM   1539 O  O   . PRO B 1 21  ? 9.277  -1.867 73.058 1.00 40.26 ? 22  PRO B O   1 
ATOM   1540 C  CB  . PRO B 1 21  ? 9.514  -4.648 71.559 1.00 42.00 ? 22  PRO B CB  1 
ATOM   1541 C  CG  . PRO B 1 21  ? 8.266  -4.015 71.018 1.00 45.04 ? 22  PRO B CG  1 
ATOM   1542 C  CD  . PRO B 1 21  ? 7.228  -4.032 72.123 1.00 39.66 ? 22  PRO B CD  1 
ATOM   1543 N  N   . LEU B 1 22  ? 11.348 -2.707 72.988 1.00 40.92 ? 23  LEU B N   1 
ATOM   1544 C  CA  . LEU B 1 22  ? 11.874 -1.355 73.016 1.00 42.06 ? 23  LEU B CA  1 
ATOM   1545 C  C   . LEU B 1 22  ? 12.081 -0.963 71.605 1.00 52.15 ? 23  LEU B C   1 
ATOM   1546 O  O   . LEU B 1 22  ? 12.887 -1.576 70.915 1.00 60.00 ? 23  LEU B O   1 
ATOM   1547 C  CB  . LEU B 1 22  ? 13.220 -1.293 73.722 1.00 43.78 ? 23  LEU B CB  1 
ATOM   1548 C  CG  . LEU B 1 22  ? 13.623 0.129  74.046 1.00 51.94 ? 23  LEU B CG  1 
ATOM   1549 C  CD1 . LEU B 1 22  ? 12.595 0.738  74.991 1.00 60.00 ? 23  LEU B CD1 1 
ATOM   1550 C  CD2 . LEU B 1 22  ? 14.982 0.122  74.710 1.00 50.75 ? 23  LEU B CD2 1 
ATOM   1551 N  N   . ASN B 1 23  ? 11.305 -0.012 71.120 1.00 45.84 ? 24  ASN B N   1 
ATOM   1552 C  CA  . ASN B 1 23  ? 11.442 0.343  69.729 1.00 38.98 ? 24  ASN B CA  1 
ATOM   1553 C  C   . ASN B 1 23  ? 11.199 1.783  69.414 1.00 38.80 ? 24  ASN B C   1 
ATOM   1554 O  O   . ASN B 1 23  ? 10.810 2.572  70.303 1.00 43.11 ? 24  ASN B O   1 
ATOM   1555 C  CB  . ASN B 1 23  ? 10.688 -0.614 68.799 1.00 38.81 ? 24  ASN B CB  1 
ATOM   1556 C  CG  . ASN B 1 23  ? 9.215  -0.725 69.124 1.00 41.83 ? 24  ASN B CG  1 
ATOM   1557 O  OD1 . ASN B 1 23  ? 8.560  -1.717 68.756 1.00 46.45 ? 24  ASN B OD1 1 
ATOM   1558 N  ND2 . ASN B 1 23  ? 8.641  0.359  69.648 1.00 40.34 ? 24  ASN B ND2 1 
ATOM   1559 N  N   . PHE B 1 24  ? 11.579 2.152  68.180 1.00 34.01 ? 25  PHE B N   1 
ATOM   1560 C  CA  . PHE B 1 24  ? 11.484 3.537  67.723 1.00 30.20 ? 25  PHE B CA  1 
ATOM   1561 C  C   . PHE B 1 24  ? 10.499 3.578  66.620 1.00 30.92 ? 25  PHE B C   1 
ATOM   1562 O  O   . PHE B 1 24  ? 10.593 2.750  65.736 1.00 34.28 ? 25  PHE B O   1 
ATOM   1563 C  CB  . PHE B 1 24  ? 12.804 3.973  67.139 1.00 29.50 ? 25  PHE B CB  1 
ATOM   1564 C  CG  . PHE B 1 24  ? 13.870 3.915  68.125 1.00 33.00 ? 25  PHE B CG  1 
ATOM   1565 C  CD1 . PHE B 1 24  ? 14.363 2.675  68.508 1.00 47.99 ? 25  PHE B CD1 1 
ATOM   1566 C  CD2 . PHE B 1 24  ? 14.231 5.038  68.864 1.00 40.31 ? 25  PHE B CD2 1 
ATOM   1567 C  CE1 . PHE B 1 24  ? 15.316 2.567  69.520 1.00 44.40 ? 25  PHE B CE1 1 
ATOM   1568 C  CE2 . PHE B 1 24  ? 15.165 4.941  69.905 1.00 34.85 ? 25  PHE B CE2 1 
ATOM   1569 C  CZ  . PHE B 1 24  ? 15.705 3.700  70.228 1.00 34.56 ? 25  PHE B CZ  1 
ATOM   1570 N  N   . LYS B 1 25  ? 9.657  4.609  66.610 1.00 31.91 ? 26  LYS B N   1 
ATOM   1571 C  CA  . LYS B 1 25  ? 8.641  4.822  65.578 1.00 28.93 ? 26  LYS B CA  1 
ATOM   1572 C  C   . LYS B 1 25  ? 8.668  6.256  65.173 1.00 27.54 ? 26  LYS B C   1 
ATOM   1573 O  O   . LYS B 1 25  ? 8.827  7.106  66.018 1.00 29.89 ? 26  LYS B O   1 
ATOM   1574 C  CB  . LYS B 1 25  ? 7.239  4.476  66.111 1.00 27.90 ? 26  LYS B CB  1 
ATOM   1575 C  CG  . LYS B 1 25  ? 7.119  3.023  66.592 1.00 30.63 ? 26  LYS B CG  1 
ATOM   1576 C  CD  . LYS B 1 25  ? 6.629  2.104  65.486 1.00 41.56 ? 26  LYS B CD  1 
ATOM   1577 C  CE  . LYS B 1 25  ? 7.144  0.667  65.564 1.00 35.26 ? 26  LYS B CE  1 
ATOM   1578 N  NZ  . LYS B 1 25  ? 6.524  -0.217 64.544 1.00 49.20 ? 26  LYS B NZ  1 
ATOM   1579 N  N   . LYS B 1 26  ? 8.404  6.528  63.901 1.00 25.53 ? 27  LYS B N   1 
ATOM   1580 C  CA  . LYS B 1 26  ? 8.344  7.896  63.395 1.00 20.61 ? 27  LYS B CA  1 
ATOM   1581 C  C   . LYS B 1 26  ? 6.995  8.282  63.666 1.00 20.61 ? 27  LYS B C   1 
ATOM   1582 O  O   . LYS B 1 26  ? 6.083  7.541  63.294 1.00 23.67 ? 27  LYS B O   1 
ATOM   1583 C  CB  . LYS B 1 26  ? 8.480  7.977  61.870 1.00 26.91 ? 27  LYS B CB  1 
ATOM   1584 C  CG  . LYS B 1 26  ? 9.863  8.336  61.302 1.00 30.23 ? 27  LYS B CG  1 
ATOM   1585 C  CD  . LYS B 1 26  ? 10.460 7.155  60.514 1.00 37.42 ? 27  LYS B CD  1 
ATOM   1586 C  CE  . LYS B 1 26  ? 11.406 7.618  59.386 1.00 60.00 ? 27  LYS B CE  1 
ATOM   1587 N  NZ  . LYS B 1 26  ? 11.403 6.781  58.142 1.00 60.00 ? 27  LYS B NZ  1 
ATOM   1588 N  N   . ARG B 1 27  ? 6.847  9.505  64.140 1.00 19.02 ? 28  ARG B N   1 
ATOM   1589 C  CA  . ARG B 1 27  ? 5.544  10.006 64.450 1.00 19.27 ? 28  ARG B CA  1 
ATOM   1590 C  C   . ARG B 1 27  ? 5.476  11.467 64.149 1.00 16.23 ? 28  ARG B C   1 
ATOM   1591 O  O   . ARG B 1 27  ? 6.444  12.163 64.235 1.00 24.32 ? 28  ARG B O   1 
ATOM   1592 C  CB  . ARG B 1 27  ? 5.225  9.751  65.946 1.00 20.99 ? 28  ARG B CB  1 
ATOM   1593 C  CG  . ARG B 1 27  ? 5.354  8.284  66.363 1.00 18.47 ? 28  ARG B CG  1 
ATOM   1594 C  CD  . ARG B 1 27  ? 4.027  7.610  65.951 1.00 24.96 ? 28  ARG B CD  1 
ATOM   1595 N  NE  . ARG B 1 27  ? 3.914  6.183  66.239 1.00 35.60 ? 28  ARG B NE  1 
ATOM   1596 C  CZ  . ARG B 1 27  ? 3.878  5.224  65.318 1.00 40.01 ? 28  ARG B CZ  1 
ATOM   1597 N  NH1 . ARG B 1 27  ? 4.055  5.494  64.029 1.00 36.67 ? 28  ARG B NH1 1 
ATOM   1598 N  NH2 . ARG B 1 27  ? 3.691  3.967  65.682 1.00 25.29 ? 28  ARG B NH2 1 
ATOM   1599 N  N   . LEU B 1 28  ? 4.297  11.919 63.806 1.00 19.08 ? 29  LEU B N   1 
ATOM   1600 C  CA  . LEU B 1 28  ? 4.029  13.324 63.700 1.00 23.77 ? 29  LEU B CA  1 
ATOM   1601 C  C   . LEU B 1 28  ? 3.617  13.851 65.106 1.00 35.89 ? 29  LEU B C   1 
ATOM   1602 O  O   . LEU B 1 28  ? 2.615  13.376 65.678 1.00 29.22 ? 29  LEU B O   1 
ATOM   1603 C  CB  . LEU B 1 28  ? 2.770  13.445 62.851 1.00 19.95 ? 29  LEU B CB  1 
ATOM   1604 C  CG  . LEU B 1 28  ? 2.331  14.877 62.757 1.00 23.52 ? 29  LEU B CG  1 
ATOM   1605 C  CD1 . LEU B 1 28  ? 3.479  15.607 62.093 1.00 21.43 ? 29  LEU B CD1 1 
ATOM   1606 C  CD2 . LEU B 1 28  ? 1.141  14.943 61.871 1.00 35.02 ? 29  LEU B CD2 1 
ATOM   1607 N  N   . PHE B 1 29  ? 4.306  14.870 65.629 1.00 30.55 ? 30  PHE B N   1 
ATOM   1608 C  CA  . PHE B 1 29  ? 3.998  15.429 66.963 1.00 20.53 ? 30  PHE B CA  1 
ATOM   1609 C  C   . PHE B 1 29  ? 3.348  16.743 66.831 1.00 26.30 ? 30  PHE B C   1 
ATOM   1610 O  O   . PHE B 1 29  ? 3.779  17.552 66.068 1.00 37.24 ? 30  PHE B O   1 
ATOM   1611 C  CB  . PHE B 1 29  ? 5.294  15.678 67.744 1.00 22.39 ? 30  PHE B CB  1 
ATOM   1612 C  CG  . PHE B 1 29  ? 5.836  14.443 68.399 1.00 26.34 ? 30  PHE B CG  1 
ATOM   1613 C  CD1 . PHE B 1 29  ? 6.444  13.432 67.655 1.00 24.41 ? 30  PHE B CD1 1 
ATOM   1614 C  CD2 . PHE B 1 29  ? 5.628  14.220 69.758 1.00 29.80 ? 30  PHE B CD2 1 
ATOM   1615 C  CE1 . PHE B 1 29  ? 6.974  12.290 68.259 1.00 26.06 ? 30  PHE B CE1 1 
ATOM   1616 C  CE2 . PHE B 1 29  ? 6.141  13.075 70.373 1.00 30.66 ? 30  PHE B CE2 1 
ATOM   1617 C  CZ  . PHE B 1 29  ? 6.811  12.102 69.627 1.00 30.44 ? 30  PHE B CZ  1 
ATOM   1618 N  N   . LEU B 1 30  ? 2.336  16.981 67.618 1.00 29.14 ? 31  LEU B N   1 
ATOM   1619 C  CA  . LEU B 1 30  ? 1.662  18.250 67.644 1.00 27.72 ? 31  LEU B CA  1 
ATOM   1620 C  C   . LEU B 1 30  ? 1.685  18.778 69.072 1.00 38.85 ? 31  LEU B C   1 
ATOM   1621 O  O   . LEU B 1 30  ? 1.410  18.054 70.020 1.00 35.52 ? 31  LEU B O   1 
ATOM   1622 C  CB  . LEU B 1 30  ? 0.208  18.103 67.263 1.00 27.48 ? 31  LEU B CB  1 
ATOM   1623 C  CG  . LEU B 1 30  ? -0.026 17.602 65.862 1.00 38.11 ? 31  LEU B CG  1 
ATOM   1624 C  CD1 . LEU B 1 30  ? -1.539 17.572 65.548 1.00 40.23 ? 31  LEU B CD1 1 
ATOM   1625 C  CD2 . LEU B 1 30  ? 0.700  18.565 64.947 1.00 47.29 ? 31  LEU B CD2 1 
ATOM   1626 N  N   . LEU B 1 31  ? 1.881  20.076 69.188 1.00 38.99 ? 32  LEU B N   1 
ATOM   1627 C  CA  . LEU B 1 31  ? 1.952  20.742 70.458 1.00 35.79 ? 32  LEU B CA  1 
ATOM   1628 C  C   . LEU B 1 31  ? 0.948  21.824 70.573 1.00 40.56 ? 32  LEU B C   1 
ATOM   1629 O  O   . LEU B 1 31  ? 0.907  22.749 69.773 1.00 36.54 ? 32  LEU B O   1 
ATOM   1630 C  CB  . LEU B 1 31  ? 3.298  21.379 70.646 1.00 35.83 ? 32  LEU B CB  1 
ATOM   1631 C  CG  . LEU B 1 31  ? 3.294  22.178 71.940 1.00 40.25 ? 32  LEU B CG  1 
ATOM   1632 C  CD1 . LEU B 1 31  ? 2.640  21.367 73.038 1.00 35.67 ? 32  LEU B CD1 1 
ATOM   1633 C  CD2 . LEU B 1 31  ? 4.725  22.485 72.332 1.00 33.77 ? 32  LEU B CD2 1 
ATOM   1634 N  N   . THR B 1 32  ? 0.066  21.647 71.534 1.00 37.51 ? 33  THR B N   1 
ATOM   1635 C  CA  . THR B 1 32  ? -0.880 22.673 71.838 1.00 38.62 ? 33  THR B CA  1 
ATOM   1636 C  C   . THR B 1 32  ? -0.624 23.087 73.256 1.00 49.36 ? 33  THR B C   1 
ATOM   1637 O  O   . THR B 1 32  ? 0.361  22.640 73.852 1.00 41.37 ? 33  THR B O   1 
ATOM   1638 C  CB  . THR B 1 32  ? -2.326 22.268 71.682 1.00 39.49 ? 33  THR B CB  1 
ATOM   1639 O  OG1 . THR B 1 32  ? -2.789 21.641 72.881 1.00 57.27 ? 33  THR B OG1 1 
ATOM   1640 C  CG2 . THR B 1 32  ? -2.462 21.366 70.484 1.00 49.87 ? 33  THR B CG2 1 
ATOM   1641 N  N   . VAL B 1 33  ? -1.485 23.955 73.788 1.00 44.97 ? 34  VAL B N   1 
ATOM   1642 C  CA  . VAL B 1 33  ? -1.278 24.419 75.140 1.00 52.11 ? 34  VAL B CA  1 
ATOM   1643 C  C   . VAL B 1 33  ? -1.667 23.361 76.158 1.00 48.66 ? 34  VAL B C   1 
ATOM   1644 O  O   . VAL B 1 33  ? -1.028 23.156 77.196 1.00 55.45 ? 34  VAL B O   1 
ATOM   1645 C  CB  . VAL B 1 33  ? -1.978 25.742 75.394 1.00 58.45 ? 34  VAL B CB  1 
ATOM   1646 C  CG1 . VAL B 1 33  ? -2.411 25.830 76.845 1.00 60.00 ? 34  VAL B CG1 1 
ATOM   1647 C  CG2 . VAL B 1 33  ? -1.026 26.880 75.064 1.00 54.26 ? 34  VAL B CG2 1 
ATOM   1648 N  N   . HIS B 1 34  ? -2.630 22.574 75.782 1.00 42.46 ? 35  HIS B N   1 
ATOM   1649 C  CA  . HIS B 1 34  ? -3.048 21.534 76.678 1.00 47.10 ? 35  HIS B CA  1 
ATOM   1650 C  C   . HIS B 1 34  ? -2.358 20.203 76.483 1.00 42.57 ? 35  HIS B C   1 
ATOM   1651 O  O   . HIS B 1 34  ? -2.112 19.477 77.435 1.00 42.43 ? 35  HIS B O   1 
ATOM   1652 C  CB  . HIS B 1 34  ? -4.580 21.462 76.675 1.00 52.52 ? 35  HIS B CB  1 
ATOM   1653 C  CG  . HIS B 1 34  ? -5.191 22.807 76.931 1.00 60.00 ? 35  HIS B CG  1 
ATOM   1654 N  ND1 . HIS B 1 34  ? -4.694 23.662 77.909 1.00 60.00 ? 35  HIS B ND1 1 
ATOM   1655 C  CD2 . HIS B 1 34  ? -6.142 23.505 76.257 1.00 60.00 ? 35  HIS B CD2 1 
ATOM   1656 C  CE1 . HIS B 1 34  ? -5.365 24.804 77.860 1.00 60.00 ? 35  HIS B CE1 1 
ATOM   1657 N  NE2 . HIS B 1 34  ? -6.242 24.739 76.862 1.00 60.00 ? 35  HIS B NE2 1 
ATOM   1658 N  N   . LYS B 1 35  ? -1.961 19.905 75.262 1.00 37.98 ? 36  LYS B N   1 
ATOM   1659 C  CA  . LYS B 1 35  ? -1.384 18.601 75.029 1.00 34.12 ? 36  LYS B CA  1 
ATOM   1660 C  C   . LYS B 1 35  ? -0.242 18.550 74.099 1.00 30.98 ? 36  LYS B C   1 
ATOM   1661 O  O   . LYS B 1 35  ? -0.113 19.316 73.176 1.00 36.08 ? 36  LYS B O   1 
ATOM   1662 C  CB  . LYS B 1 35  ? -2.392 17.669 74.396 1.00 40.87 ? 36  LYS B CB  1 
ATOM   1663 C  CG  . LYS B 1 35  ? -3.824 17.841 74.825 1.00 35.71 ? 36  LYS B CG  1 
ATOM   1664 C  CD  . LYS B 1 35  ? -4.213 16.685 75.745 1.00 50.45 ? 36  LYS B CD  1 
ATOM   1665 C  CE  . LYS B 1 35  ? -5.712 16.613 75.955 0.00 54.80 ? 36  LYS B CE  1 
ATOM   1666 N  NZ  . LYS B 1 35  ? -6.331 15.475 75.247 0.00 60.00 ? 36  LYS B NZ  1 
ATOM   1667 N  N   . LEU B 1 36  ? 0.539  17.543 74.339 1.00 28.10 ? 37  LEU B N   1 
ATOM   1668 C  CA  . LEU B 1 36  ? 1.537  17.125 73.465 1.00 24.00 ? 37  LEU B CA  1 
ATOM   1669 C  C   . LEU B 1 36  ? 1.070  15.743 72.973 1.00 32.95 ? 37  LEU B C   1 
ATOM   1670 O  O   . LEU B 1 36  ? 1.162  14.782 73.680 1.00 32.02 ? 37  LEU B O   1 
ATOM   1671 C  CB  . LEU B 1 36  ? 2.822  16.943 74.203 1.00 20.53 ? 37  LEU B CB  1 
ATOM   1672 C  CG  . LEU B 1 36  ? 3.892  16.394 73.270 1.00 20.71 ? 37  LEU B CG  1 
ATOM   1673 C  CD1 . LEU B 1 36  ? 4.143  17.325 72.103 1.00 23.73 ? 37  LEU B CD1 1 
ATOM   1674 C  CD2 . LEU B 1 36  ? 5.185  16.168 73.994 1.00 19.46 ? 37  LEU B CD2 1 
ATOM   1675 N  N   . SER B 1 37  ? 0.629  15.655 71.731 1.00 30.76 ? 38  SER B N   1 
ATOM   1676 C  CA  . SER B 1 37  ? 0.159  14.433 71.149 1.00 25.60 ? 38  SER B CA  1 
ATOM   1677 C  C   . SER B 1 37  ? 1.051  13.897 70.046 1.00 34.01 ? 38  SER B C   1 
ATOM   1678 O  O   . SER B 1 37  ? 1.770  14.609 69.405 1.00 39.06 ? 38  SER B O   1 
ATOM   1679 C  CB  . SER B 1 37  ? -1.159 14.771 70.531 1.00 27.81 ? 38  SER B CB  1 
ATOM   1680 O  OG  . SER B 1 37  ? -2.000 15.285 71.516 1.00 55.90 ? 38  SER B OG  1 
ATOM   1681 N  N   . TYR B 1 38  ? 0.932  12.631 69.755 1.00 27.69 ? 39  TYR B N   1 
ATOM   1682 C  CA  . TYR B 1 38  ? 1.640  12.133 68.608 1.00 23.20 ? 39  TYR B CA  1 
ATOM   1683 C  C   . TYR B 1 38  ? 0.844  11.088 67.793 1.00 36.80 ? 39  TYR B C   1 
ATOM   1684 O  O   . TYR B 1 38  ? -0.075 10.430 68.306 1.00 32.47 ? 39  TYR B O   1 
ATOM   1685 C  CB  . TYR B 1 38  ? 3.020  11.660 68.951 1.00 18.53 ? 39  TYR B CB  1 
ATOM   1686 C  CG  . TYR B 1 38  ? 3.046  10.606 70.038 1.00 35.68 ? 39  TYR B CG  1 
ATOM   1687 C  CD1 . TYR B 1 38  ? 2.983  9.235  69.737 1.00 26.74 ? 39  TYR B CD1 1 
ATOM   1688 C  CD2 . TYR B 1 38  ? 3.245  10.984 71.369 1.00 41.56 ? 39  TYR B CD2 1 
ATOM   1689 C  CE1 . TYR B 1 38  ? 3.108  8.271  70.738 1.00 31.14 ? 39  TYR B CE1 1 
ATOM   1690 C  CE2 . TYR B 1 38  ? 3.300  10.036 72.389 1.00 38.55 ? 39  TYR B CE2 1 
ATOM   1691 C  CZ  . TYR B 1 38  ? 3.242  8.678  72.072 1.00 48.33 ? 39  TYR B CZ  1 
ATOM   1692 O  OH  . TYR B 1 38  ? 3.423  7.756  73.089 1.00 32.49 ? 39  TYR B OH  1 
ATOM   1693 N  N   . TYR B 1 39  ? 1.131  11.021 66.493 1.00 28.73 ? 40  TYR B N   1 
ATOM   1694 C  CA  . TYR B 1 39  ? 0.323  10.230 65.609 1.00 20.44 ? 40  TYR B CA  1 
ATOM   1695 C  C   . TYR B 1 39  ? 1.107  9.502  64.597 1.00 25.83 ? 40  TYR B C   1 
ATOM   1696 O  O   . TYR B 1 39  ? 2.212  9.841  64.211 1.00 30.70 ? 40  TYR B O   1 
ATOM   1697 C  CB  . TYR B 1 39  ? -0.627 11.129 64.817 1.00 22.02 ? 40  TYR B CB  1 
ATOM   1698 C  CG  . TYR B 1 39  ? -1.489 12.091 65.618 1.00 25.60 ? 40  TYR B CG  1 
ATOM   1699 C  CD1 . TYR B 1 39  ? -0.948 13.211 66.255 1.00 29.81 ? 40  TYR B CD1 1 
ATOM   1700 C  CD2 . TYR B 1 39  ? -2.858 11.891 65.713 1.00 30.16 ? 40  TYR B CD2 1 
ATOM   1701 C  CE1 . TYR B 1 39  ? -1.739 14.105 66.988 1.00 24.41 ? 40  TYR B CE1 1 
ATOM   1702 C  CE2 . TYR B 1 39  ? -3.661 12.752 66.470 1.00 36.18 ? 40  TYR B CE2 1 
ATOM   1703 C  CZ  . TYR B 1 39  ? -3.100 13.865 67.104 1.00 35.16 ? 40  TYR B CZ  1 
ATOM   1704 O  OH  . TYR B 1 39  ? -3.895 14.735 67.809 1.00 42.93 ? 40  TYR B OH  1 
ATOM   1705 N  N   . LYS B 1 40  ? 0.422  8.566  64.033 1.00 33.66 ? 41  LYS B N   1 
ATOM   1706 C  CA  . LYS B 1 40  ? 0.921  7.913  62.867 1.00 34.50 ? 41  LYS B CA  1 
ATOM   1707 C  C   . LYS B 1 40  ? 0.909  8.958  61.731 1.00 31.29 ? 41  LYS B C   1 
ATOM   1708 O  O   . LYS B 1 40  ? -0.042 9.748  61.638 1.00 26.59 ? 41  LYS B O   1 
ATOM   1709 C  CB  . LYS B 1 40  ? -0.062 6.822  62.509 1.00 37.71 ? 41  LYS B CB  1 
ATOM   1710 C  CG  . LYS B 1 40  ? 0.615  5.510  62.368 1.00 37.23 ? 41  LYS B CG  1 
ATOM   1711 C  CD  . LYS B 1 40  ? 0.219  4.883  61.066 1.00 54.50 ? 41  LYS B CD  1 
ATOM   1712 C  CE  . LYS B 1 40  ? 0.391  3.392  61.120 1.00 60.00 ? 41  LYS B CE  1 
ATOM   1713 N  NZ  . LYS B 1 40  ? 1.507  2.960  60.265 1.00 60.00 ? 41  LYS B NZ  1 
ATOM   1714 N  N   . TYR B 1 41  ? 1.949  8.989  60.884 1.00 26.04 ? 42  TYR B N   1 
ATOM   1715 C  CA  . TYR B 1 41  ? 1.939  9.924  59.753 1.00 27.12 ? 42  TYR B CA  1 
ATOM   1716 C  C   . TYR B 1 41  ? 1.506  9.201  58.454 1.00 33.12 ? 42  TYR B C   1 
ATOM   1717 O  O   . TYR B 1 41  ? 2.102  8.196  58.058 1.00 29.41 ? 42  TYR B O   1 
ATOM   1718 C  CB  . TYR B 1 41  ? 3.313  10.558 59.556 1.00 22.78 ? 42  TYR B CB  1 
ATOM   1719 C  CG  . TYR B 1 41  ? 3.280  11.569 58.442 1.00 26.87 ? 42  TYR B CG  1 
ATOM   1720 C  CD1 . TYR B 1 41  ? 2.428  12.671 58.489 1.00 28.21 ? 42  TYR B CD1 1 
ATOM   1721 C  CD2 . TYR B 1 41  ? 4.051  11.357 57.303 1.00 25.41 ? 42  TYR B CD2 1 
ATOM   1722 C  CE1 . TYR B 1 41  ? 2.372  13.573 57.438 1.00 31.97 ? 42  TYR B CE1 1 
ATOM   1723 C  CE2 . TYR B 1 41  ? 4.047  12.276 56.269 1.00 23.48 ? 42  TYR B CE2 1 
ATOM   1724 C  CZ  . TYR B 1 41  ? 3.211  13.373 56.351 1.00 33.32 ? 42  TYR B CZ  1 
ATOM   1725 O  OH  . TYR B 1 41  ? 3.185  14.231 55.321 1.00 46.41 ? 42  TYR B OH  1 
ATOM   1726 N  N   . ASP B 1 42  ? 0.437  9.670  57.830 1.00 30.75 ? 43  ASP B N   1 
ATOM   1727 C  CA  . ASP B 1 42  ? -0.024 9.040  56.597 1.00 33.66 ? 43  ASP B CA  1 
ATOM   1728 C  C   . ASP B 1 42  ? 0.738  9.734  55.463 1.00 31.18 ? 43  ASP B C   1 
ATOM   1729 O  O   . ASP B 1 42  ? 0.322  10.810 55.037 1.00 31.54 ? 43  ASP B O   1 
ATOM   1730 C  CB  . ASP B 1 42  ? -1.522 9.312  56.400 1.00 35.71 ? 43  ASP B CB  1 
ATOM   1731 C  CG  . ASP B 1 42  ? -2.120 8.443  55.327 1.00 58.91 ? 43  ASP B CG  1 
ATOM   1732 O  OD1 . ASP B 1 42  ? -1.411 7.881  54.487 1.00 54.88 ? 43  ASP B OD1 1 
ATOM   1733 O  OD2 . ASP B 1 42  ? -3.348 8.176  55.462 1.00 60.00 ? 43  ASP B OD2 1 
ATOM   1734 N  N   . PHE B 1 43  ? 1.888  9.162  55.077 1.00 24.88 ? 44  PHE B N   1 
ATOM   1735 C  CA  . PHE B 1 43  ? 2.794  9.730  54.059 1.00 30.99 ? 44  PHE B CA  1 
ATOM   1736 C  C   . PHE B 1 43  ? 2.181  9.885  52.668 1.00 42.62 ? 44  PHE B C   1 
ATOM   1737 O  O   . PHE B 1 43  ? 2.261  10.954 52.058 1.00 38.04 ? 44  PHE B O   1 
ATOM   1738 C  CB  . PHE B 1 43  ? 4.099  8.941  53.956 1.00 31.83 ? 44  PHE B CB  1 
ATOM   1739 C  CG  . PHE B 1 43  ? 4.953  9.320  52.770 1.00 35.73 ? 44  PHE B CG  1 
ATOM   1740 C  CD1 . PHE B 1 43  ? 5.772  10.438 52.800 1.00 42.24 ? 44  PHE B CD1 1 
ATOM   1741 C  CD2 . PHE B 1 43  ? 4.969  8.527  51.632 1.00 33.70 ? 44  PHE B CD2 1 
ATOM   1742 C  CE1 . PHE B 1 43  ? 6.586  10.755 51.717 1.00 39.34 ? 44  PHE B CE1 1 
ATOM   1743 C  CE2 . PHE B 1 43  ? 5.770  8.840  50.546 1.00 35.07 ? 44  PHE B CE2 1 
ATOM   1744 C  CZ  . PHE B 1 43  ? 6.596  9.945  50.589 1.00 33.44 ? 44  PHE B CZ  1 
ATOM   1745 N  N   . GLU B 1 44  ? 1.605  8.790  52.169 1.00 42.29 ? 45  GLU B N   1 
ATOM   1746 C  CA  . GLU B 1 44  ? 0.955  8.799  50.874 1.00 38.39 ? 45  GLU B CA  1 
ATOM   1747 C  C   . GLU B 1 44  ? -0.004 9.935  50.857 1.00 45.56 ? 45  GLU B C   1 
ATOM   1748 O  O   . GLU B 1 44  ? 0.226  10.945 50.183 1.00 57.69 ? 45  GLU B O   1 
ATOM   1749 C  CB  . GLU B 1 44  ? 0.221  7.480  50.639 1.00 36.63 ? 45  GLU B CB  1 
ATOM   1750 C  CG  . GLU B 1 44  ? 1.164  6.310  50.280 1.00 56.28 ? 45  GLU B CG  1 
ATOM   1751 C  CD  . GLU B 1 44  ? 1.987  6.562  49.012 1.00 60.00 ? 45  GLU B CD  1 
ATOM   1752 O  OE1 . GLU B 1 44  ? 1.455  7.093  48.012 1.00 60.00 ? 45  GLU B OE1 1 
ATOM   1753 O  OE2 . GLU B 1 44  ? 3.231  6.186  49.040 1.00 44.36 ? 45  GLU B OE2 1 
ATOM   1754 N  N   . ARG B 1 45  ? -0.977 9.825  51.747 1.00 44.13 ? 46  ARG B N   1 
ATOM   1755 C  CA  . ARG B 1 45  ? -2.045 10.788 51.881 1.00 40.48 ? 46  ARG B CA  1 
ATOM   1756 C  C   . ARG B 1 45  ? -1.540 12.095 52.341 1.00 41.82 ? 46  ARG B C   1 
ATOM   1757 O  O   . ARG B 1 45  ? -2.257 13.071 52.311 1.00 56.87 ? 46  ARG B O   1 
ATOM   1758 C  CB  . ARG B 1 45  ? -3.140 10.305 52.824 1.00 50.49 ? 46  ARG B CB  1 
ATOM   1759 C  CG  . ARG B 1 45  ? -3.815 9.022  52.338 1.00 60.00 ? 46  ARG B CG  1 
ATOM   1760 C  CD  . ARG B 1 45  ? -5.005 8.631  53.212 1.00 60.00 ? 46  ARG B CD  1 
ATOM   1761 N  NE  . ARG B 1 45  ? -6.163 8.196  52.429 1.00 60.00 ? 46  ARG B NE  1 
ATOM   1762 C  CZ  . ARG B 1 45  ? -7.156 9.003  52.064 0.00 60.00 ? 46  ARG B CZ  1 
ATOM   1763 N  NH1 . ARG B 1 45  ? -7.143 10.285 52.405 0.00 47.47 ? 46  ARG B NH1 1 
ATOM   1764 N  NH2 . ARG B 1 45  ? -8.168 8.526  51.349 0.00 46.88 ? 46  ARG B NH2 1 
ATOM   1765 N  N   . GLY B 1 46  ? -0.318 12.153 52.779 1.00 36.75 ? 47  GLY B N   1 
ATOM   1766 C  CA  . GLY B 1 46  ? 0.153  13.446 53.227 1.00 39.71 ? 47  GLY B CA  1 
ATOM   1767 C  C   . GLY B 1 46  ? -0.714 13.983 54.374 1.00 50.88 ? 47  GLY B C   1 
ATOM   1768 O  O   . GLY B 1 46  ? -1.137 15.146 54.386 1.00 44.97 ? 47  GLY B O   1 
ATOM   1769 N  N   . ARG B 1 47  ? -0.994 13.135 55.342 1.00 48.80 ? 48  ARG B N   1 
ATOM   1770 C  CA  . ARG B 1 47  ? -1.699 13.652 56.462 1.00 46.77 ? 48  ARG B CA  1 
ATOM   1771 C  C   . ARG B 1 47  ? -1.416 12.920 57.725 1.00 43.70 ? 48  ARG B C   1 
ATOM   1772 O  O   . ARG B 1 47  ? -0.873 11.814 57.760 1.00 39.45 ? 48  ARG B O   1 
ATOM   1773 C  CB  . ARG B 1 47  ? -3.180 13.626 56.217 1.00 42.77 ? 48  ARG B CB  1 
ATOM   1774 C  CG  . ARG B 1 47  ? -3.704 12.283 55.752 1.00 51.60 ? 48  ARG B CG  1 
ATOM   1775 C  CD  . ARG B 1 47  ? -5.103 12.492 55.130 1.00 60.00 ? 48  ARG B CD  1 
ATOM   1776 N  NE  . ARG B 1 47  ? -5.887 11.268 55.075 0.00 56.59 ? 48  ARG B NE  1 
ATOM   1777 C  CZ  . ARG B 1 47  ? -7.142 11.148 55.478 0.00 60.00 ? 48  ARG B CZ  1 
ATOM   1778 N  NH1 . ARG B 1 47  ? -7.729 12.151 56.094 0.00 47.87 ? 48  ARG B NH1 1 
ATOM   1779 N  NH2 . ARG B 1 47  ? -7.748 9.969  55.382 0.00 47.30 ? 48  ARG B NH2 1 
ATOM   1780 N  N   . ARG B 1 48  ? -1.988 13.502 58.734 1.00 38.81 ? 49  ARG B N   1 
ATOM   1781 C  CA  . ARG B 1 48  ? -2.024 12.940 60.041 1.00 37.81 ? 49  ARG B CA  1 
ATOM   1782 C  C   . ARG B 1 48  ? -2.798 11.655 60.037 1.00 38.34 ? 49  ARG B C   1 
ATOM   1783 O  O   . ARG B 1 48  ? -3.935 11.586 59.571 1.00 39.87 ? 49  ARG B O   1 
ATOM   1784 C  CB  . ARG B 1 48  ? -2.794 13.885 60.907 1.00 44.83 ? 49  ARG B CB  1 
ATOM   1785 C  CG  . ARG B 1 48  ? -2.134 14.144 62.202 1.00 37.20 ? 49  ARG B CG  1 
ATOM   1786 C  CD  . ARG B 1 48  ? -3.187 14.190 63.231 1.00 36.14 ? 49  ARG B CD  1 
ATOM   1787 N  NE  . ARG B 1 48  ? -3.807 15.482 63.313 1.00 41.33 ? 49  ARG B NE  1 
ATOM   1788 C  CZ  . ARG B 1 48  ? -5.064 15.602 63.693 1.00 60.00 ? 49  ARG B CZ  1 
ATOM   1789 N  NH1 . ARG B 1 48  ? -5.763 14.500 63.987 1.00 47.74 ? 49  ARG B NH1 1 
ATOM   1790 N  NH2 . ARG B 1 48  ? -5.635 16.801 63.765 1.00 60.00 ? 49  ARG B NH2 1 
ATOM   1791 N  N   . GLY B 1 49  ? -2.251 10.666 60.696 1.00 32.20 ? 50  GLY B N   1 
ATOM   1792 C  CA  . GLY B 1 49  ? -2.974 9.425  60.828 1.00 32.02 ? 50  GLY B CA  1 
ATOM   1793 C  C   . GLY B 1 49  ? -3.566 9.264  62.216 1.00 29.94 ? 50  GLY B C   1 
ATOM   1794 O  O   . GLY B 1 49  ? -4.001 10.241 62.832 1.00 37.65 ? 50  GLY B O   1 
ATOM   1795 N  N   . SER B 1 50  ? -3.687 8.007  62.632 1.00 31.09 ? 51  SER B N   1 
ATOM   1796 C  CA  . SER B 1 50  ? -4.262 7.684  63.924 1.00 37.68 ? 51  SER B CA  1 
ATOM   1797 C  C   . SER B 1 50  ? -3.386 8.119  65.089 1.00 31.82 ? 51  SER B C   1 
ATOM   1798 O  O   . SER B 1 50  ? -2.151 8.011  65.032 1.00 25.76 ? 51  SER B O   1 
ATOM   1799 C  CB  . SER B 1 50  ? -4.660 6.209  64.047 1.00 37.66 ? 51  SER B CB  1 
ATOM   1800 O  OG  . SER B 1 50  ? -4.043 5.414  63.062 1.00 60.00 ? 51  SER B OG  1 
ATOM   1801 N  N   . LYS B 1 51  ? -4.052 8.673  66.102 1.00 33.36 ? 52  LYS B N   1 
ATOM   1802 C  CA  . LYS B 1 51  ? -3.408 9.100  67.324 1.00 30.11 ? 52  LYS B CA  1 
ATOM   1803 C  C   . LYS B 1 51  ? -2.823 7.908  68.039 1.00 29.65 ? 52  LYS B C   1 
ATOM   1804 O  O   . LYS B 1 51  ? -3.451 6.856  68.171 1.00 35.31 ? 52  LYS B O   1 
ATOM   1805 C  CB  . LYS B 1 51  ? -4.355 9.865  68.229 1.00 28.44 ? 52  LYS B CB  1 
ATOM   1806 C  CG  . LYS B 1 51  ? -3.643 10.352 69.462 1.00 29.45 ? 52  LYS B CG  1 
ATOM   1807 C  CD  . LYS B 1 51  ? -4.593 10.922 70.544 1.00 38.59 ? 52  LYS B CD  1 
ATOM   1808 C  CE  . LYS B 1 51  ? -5.388 12.171 70.108 1.00 60.00 ? 52  LYS B CE  1 
ATOM   1809 N  NZ  . LYS B 1 51  ? -5.374 13.327 71.074 1.00 60.00 ? 52  LYS B NZ  1 
ATOM   1810 N  N   . LYS B 1 52  ? -1.559 8.035  68.382 1.00 26.91 ? 53  LYS B N   1 
ATOM   1811 C  CA  . LYS B 1 52  ? -0.826 6.974  69.023 1.00 27.93 ? 53  LYS B CA  1 
ATOM   1812 C  C   . LYS B 1 52  ? -0.549 7.290  70.518 1.00 36.82 ? 53  LYS B C   1 
ATOM   1813 O  O   . LYS B 1 52  ? -0.343 6.404  71.331 1.00 35.12 ? 53  LYS B O   1 
ATOM   1814 C  CB  . LYS B 1 52  ? 0.500  6.813  68.280 1.00 30.45 ? 53  LYS B CB  1 
ATOM   1815 C  CG  . LYS B 1 52  ? 0.387  5.988  67.017 1.00 27.48 ? 53  LYS B CG  1 
ATOM   1816 C  CD  . LYS B 1 52  ? -0.141 4.585  67.304 1.00 34.58 ? 53  LYS B CD  1 
ATOM   1817 C  CE  . LYS B 1 52  ? -0.629 3.886  66.042 1.00 40.66 ? 53  LYS B CE  1 
ATOM   1818 N  NZ  . LYS B 1 52  ? -0.922 2.434  66.207 1.00 38.11 ? 53  LYS B NZ  1 
ATOM   1819 N  N   . GLY B 1 53  ? -0.446 8.562  70.866 1.00 36.68 ? 54  GLY B N   1 
ATOM   1820 C  CA  . GLY B 1 53  ? -0.105 8.933  72.227 1.00 34.49 ? 54  GLY B CA  1 
ATOM   1821 C  C   . GLY B 1 53  ? -0.387 10.420 72.532 1.00 39.25 ? 54  GLY B C   1 
ATOM   1822 O  O   . GLY B 1 53  ? -0.624 11.264 71.632 1.00 30.23 ? 54  GLY B O   1 
ATOM   1823 N  N   . SER B 1 54  ? -0.355 10.718 73.829 1.00 32.12 ? 55  SER B N   1 
ATOM   1824 C  CA  . SER B 1 54  ? -0.642 12.023 74.333 1.00 28.46 ? 55  SER B CA  1 
ATOM   1825 C  C   . SER B 1 54  ? -0.078 12.171 75.699 1.00 41.47 ? 55  SER B C   1 
ATOM   1826 O  O   . SER B 1 54  ? 0.124  11.194 76.409 1.00 45.42 ? 55  SER B O   1 
ATOM   1827 C  CB  . SER B 1 54  ? -2.112 12.215 74.438 1.00 27.80 ? 55  SER B CB  1 
ATOM   1828 O  OG  . SER B 1 54  ? -2.407 13.569 74.171 1.00 49.11 ? 55  SER B OG  1 
ATOM   1829 N  N   . ILE B 1 55  ? 0.110  13.432 76.055 1.00 40.30 ? 56  ILE B N   1 
ATOM   1830 C  CA  . ILE B 1 55  ? 0.589  13.874 77.349 1.00 27.51 ? 56  ILE B CA  1 
ATOM   1831 C  C   . ILE B 1 55  ? 0.002  15.203 77.668 1.00 34.35 ? 56  ILE B C   1 
ATOM   1832 O  O   . ILE B 1 55  ? 0.034  16.124 76.844 1.00 38.56 ? 56  ILE B O   1 
ATOM   1833 C  CB  . ILE B 1 55  ? 2.036  14.019 77.362 1.00 26.35 ? 56  ILE B CB  1 
ATOM   1834 C  CG1 . ILE B 1 55  ? 2.616  12.681 77.018 1.00 24.05 ? 56  ILE B CG1 1 
ATOM   1835 C  CG2 . ILE B 1 55  ? 2.419  14.456 78.748 1.00 32.70 ? 56  ILE B CG2 1 
ATOM   1836 C  CD1 . ILE B 1 55  ? 4.126  12.696 76.881 1.00 29.34 ? 56  ILE B CD1 1 
ATOM   1837 N  N   . ASP B 1 56  ? -0.690 15.275 78.788 1.00 37.02 ? 57  ASP B N   1 
ATOM   1838 C  CA  . ASP B 1 56  ? -1.314 16.517 79.168 1.00 35.77 ? 57  ASP B CA  1 
ATOM   1839 C  C   . ASP B 1 56  ? -0.240 17.506 79.530 1.00 38.26 ? 57  ASP B C   1 
ATOM   1840 O  O   . ASP B 1 56  ? 0.719  17.175 80.210 1.00 40.06 ? 57  ASP B O   1 
ATOM   1841 C  CB  . ASP B 1 56  ? -2.220 16.282 80.334 1.00 37.63 ? 57  ASP B CB  1 
ATOM   1842 C  CG  . ASP B 1 56  ? -3.502 15.736 79.906 1.00 60.00 ? 57  ASP B CG  1 
ATOM   1843 O  OD1 . ASP B 1 56  ? -3.862 15.857 78.712 1.00 60.00 ? 57  ASP B OD1 1 
ATOM   1844 O  OD2 . ASP B 1 56  ? -4.180 15.189 80.845 1.00 60.00 ? 57  ASP B OD2 1 
ATOM   1845 N  N   . VAL B 1 57  ? -0.304 18.661 78.921 1.00 32.07 ? 58  VAL B N   1 
ATOM   1846 C  CA  . VAL B 1 57  ? 0.756  19.618 79.101 1.00 39.67 ? 58  VAL B CA  1 
ATOM   1847 C  C   . VAL B 1 57  ? 1.078  19.886 80.605 1.00 46.09 ? 58  VAL B C   1 
ATOM   1848 O  O   . VAL B 1 57  ? 2.259  19.919 81.014 1.00 38.61 ? 58  VAL B O   1 
ATOM   1849 C  CB  . VAL B 1 57  ? 0.374  20.878 78.306 1.00 42.88 ? 58  VAL B CB  1 
ATOM   1850 C  CG1 . VAL B 1 57  ? 1.145  22.097 78.796 1.00 43.97 ? 58  VAL B CG1 1 
ATOM   1851 C  CG2 . VAL B 1 57  ? 0.533  20.626 76.820 1.00 39.24 ? 58  VAL B CG2 1 
ATOM   1852 N  N   . GLU B 1 58  ? 0.030  20.000 81.441 1.00 39.15 ? 59  GLU B N   1 
ATOM   1853 C  CA  . GLU B 1 58  ? 0.233  20.287 82.870 1.00 40.35 ? 59  GLU B CA  1 
ATOM   1854 C  C   . GLU B 1 58  ? 0.818  19.178 83.700 1.00 36.44 ? 59  GLU B C   1 
ATOM   1855 O  O   . GLU B 1 58  ? 1.283  19.422 84.798 1.00 39.55 ? 59  GLU B O   1 
ATOM   1856 C  CB  . GLU B 1 58  ? -1.023 20.775 83.548 1.00 44.97 ? 59  GLU B CB  1 
ATOM   1857 C  CG  . GLU B 1 58  ? -1.930 19.597 83.954 1.00 60.00 ? 59  GLU B CG  1 
ATOM   1858 C  CD  . GLU B 1 58  ? -3.403 19.855 83.674 1.00 60.00 ? 59  GLU B CD  1 
ATOM   1859 O  OE1 . GLU B 1 58  ? -3.747 20.858 83.040 0.00 55.05 ? 59  GLU B OE1 1 
ATOM   1860 O  OE2 . GLU B 1 58  ? -4.240 19.035 84.190 0.00 54.79 ? 59  GLU B OE2 1 
ATOM   1861 N  N   . LYS B 1 59  ? 0.847  17.962 83.169 1.00 36.35 ? 60  LYS B N   1 
ATOM   1862 C  CA  . LYS B 1 59  ? 1.457  16.822 83.869 1.00 29.44 ? 60  LYS B CA  1 
ATOM   1863 C  C   . LYS B 1 59  ? 2.937  16.710 83.590 1.00 30.03 ? 60  LYS B C   1 
ATOM   1864 O  O   . LYS B 1 59  ? 3.613  15.772 84.047 1.00 33.65 ? 60  LYS B O   1 
ATOM   1865 C  CB  . LYS B 1 59  ? 0.745  15.482 83.545 1.00 28.85 ? 60  LYS B CB  1 
ATOM   1866 C  CG  . LYS B 1 59  ? -0.786 15.528 83.689 1.00 41.61 ? 60  LYS B CG  1 
ATOM   1867 C  CD  . LYS B 1 59  ? -1.424 14.181 84.094 1.00 60.00 ? 60  LYS B CD  1 
ATOM   1868 C  CE  . LYS B 1 59  ? -1.894 13.292 82.873 1.00 60.00 ? 60  LYS B CE  1 
ATOM   1869 N  NZ  . LYS B 1 59  ? -1.072 12.032 82.531 1.00 60.00 ? 60  LYS B NZ  1 
ATOM   1870 N  N   . ILE B 1 60  ? 3.442  17.611 82.748 1.00 31.35 ? 61  ILE B N   1 
ATOM   1871 C  CA  . ILE B 1 60  ? 4.881  17.569 82.450 1.00 37.79 ? 61  ILE B CA  1 
ATOM   1872 C  C   . ILE B 1 60  ? 5.620  18.297 83.560 1.00 40.93 ? 61  ILE B C   1 
ATOM   1873 O  O   . ILE B 1 60  ? 5.306  19.473 83.898 1.00 34.21 ? 61  ILE B O   1 
ATOM   1874 C  CB  . ILE B 1 60  ? 5.286  18.244 81.104 1.00 48.15 ? 61  ILE B CB  1 
ATOM   1875 C  CG1 . ILE B 1 60  ? 4.751  17.494 79.879 1.00 54.84 ? 61  ILE B CG1 1 
ATOM   1876 C  CG2 . ILE B 1 60  ? 6.803  18.334 80.981 1.00 30.98 ? 61  ILE B CG2 1 
ATOM   1877 C  CD1 . ILE B 1 60  ? 4.066  18.420 78.872 1.00 38.28 ? 61  ILE B CD1 1 
ATOM   1878 N  N   . THR B 1 61  ? 6.635  17.615 84.062 1.00 32.22 ? 62  THR B N   1 
ATOM   1879 C  CA  . THR B 1 61  ? 7.450  18.134 85.122 1.00 36.41 ? 62  THR B CA  1 
ATOM   1880 C  C   . THR B 1 61  ? 8.811  18.573 84.607 1.00 52.24 ? 62  THR B C   1 
ATOM   1881 O  O   . THR B 1 61  ? 9.522  19.313 85.286 1.00 49.79 ? 62  THR B O   1 
ATOM   1882 C  CB  . THR B 1 61  ? 7.748  17.015 86.105 1.00 53.09 ? 62  THR B CB  1 
ATOM   1883 O  OG1 . THR B 1 61  ? 8.745  16.137 85.559 1.00 42.44 ? 62  THR B OG1 1 
ATOM   1884 C  CG2 . THR B 1 61  ? 6.480  16.262 86.403 1.00 40.78 ? 62  THR B CG2 1 
ATOM   1885 N  N   . CYS B 1 62  ? 9.214  18.027 83.460 1.00 46.02 ? 63  CYS B N   1 
ATOM   1886 C  CA  . CYS B 1 62  ? 10.521 18.323 82.916 1.00 39.74 ? 63  CYS B CA  1 
ATOM   1887 C  C   . CYS B 1 62  ? 10.733 18.004 81.412 1.00 57.42 ? 63  CYS B C   1 
ATOM   1888 O  O   . CYS B 1 62  ? 10.567 16.862 80.982 1.00 60.00 ? 63  CYS B O   1 
ATOM   1889 C  CB  . CYS B 1 62  ? 11.569 17.618 83.719 1.00 30.60 ? 63  CYS B CB  1 
ATOM   1890 S  SG  . CYS B 1 62  ? 13.196 17.990 83.038 1.00 43.76 ? 63  CYS B SG  1 
ATOM   1891 N  N   . VAL B 1 63  ? 11.212 18.999 80.659 1.00 48.15 ? 64  VAL B N   1 
ATOM   1892 C  CA  . VAL B 1 63  ? 11.538 18.863 79.229 1.00 44.98 ? 64  VAL B CA  1 
ATOM   1893 C  C   . VAL B 1 63  ? 12.983 19.245 79.127 1.00 45.28 ? 64  VAL B C   1 
ATOM   1894 O  O   . VAL B 1 63  ? 13.349 20.366 79.463 1.00 48.48 ? 64  VAL B O   1 
ATOM   1895 C  CB  . VAL B 1 63  ? 10.846 19.937 78.373 1.00 41.87 ? 64  VAL B CB  1 
ATOM   1896 C  CG1 . VAL B 1 63  ? 11.298 19.841 76.915 1.00 37.90 ? 64  VAL B CG1 1 
ATOM   1897 C  CG2 . VAL B 1 63  ? 9.337  19.880 78.484 1.00 40.93 ? 64  VAL B CG2 1 
ATOM   1898 N  N   . GLU B 1 64  ? 13.813 18.369 78.637 1.00 34.15 ? 65  GLU B N   1 
ATOM   1899 C  CA  . GLU B 1 64  ? 15.202 18.708 78.571 1.00 25.10 ? 65  GLU B CA  1 
ATOM   1900 C  C   . GLU B 1 64  ? 15.832 17.871 77.494 1.00 43.26 ? 65  GLU B C   1 
ATOM   1901 O  O   . GLU B 1 64  ? 15.234 16.918 76.979 1.00 46.21 ? 65  GLU B O   1 
ATOM   1902 C  CB  . GLU B 1 64  ? 15.863 18.355 79.913 1.00 30.11 ? 65  GLU B CB  1 
ATOM   1903 C  CG  . GLU B 1 64  ? 15.941 19.503 80.934 1.00 39.95 ? 65  GLU B CG  1 
ATOM   1904 C  CD  . GLU B 1 64  ? 16.800 20.657 80.407 1.00 60.00 ? 65  GLU B CD  1 
ATOM   1905 O  OE1 . GLU B 1 64  ? 17.896 20.393 79.857 1.00 60.00 ? 65  GLU B OE1 1 
ATOM   1906 O  OE2 . GLU B 1 64  ? 16.268 21.853 80.413 1.00 60.00 ? 65  GLU B OE2 1 
ATOM   1907 N  N   . THR B 1 65  ? 17.097 18.165 77.244 1.00 46.77 ? 66  THR B N   1 
ATOM   1908 C  CA  . THR B 1 65  ? 17.896 17.358 76.362 1.00 39.61 ? 66  THR B CA  1 
ATOM   1909 C  C   . THR B 1 65  ? 18.287 16.133 77.087 1.00 36.65 ? 66  THR B C   1 
ATOM   1910 O  O   . THR B 1 65  ? 18.186 16.036 78.294 1.00 41.17 ? 66  THR B O   1 
ATOM   1911 C  CB  . THR B 1 65  ? 19.197 18.034 75.900 1.00 55.11 ? 66  THR B CB  1 
ATOM   1912 O  OG1 . THR B 1 65  ? 19.889 18.597 77.010 1.00 60.00 ? 66  THR B OG1 1 
ATOM   1913 C  CG2 . THR B 1 65  ? 18.900 19.139 74.900 1.00 54.72 ? 66  THR B CG2 1 
ATOM   1914 N  N   . VAL B 1 66  ? 18.823 15.217 76.324 1.00 38.49 ? 67  VAL B N   1 
ATOM   1915 C  CA  . VAL B 1 66  ? 19.200 13.974 76.866 1.00 37.74 ? 67  VAL B CA  1 
ATOM   1916 C  C   . VAL B 1 66  ? 20.508 13.737 76.319 1.00 46.78 ? 67  VAL B C   1 
ATOM   1917 O  O   . VAL B 1 66  ? 20.809 14.197 75.221 1.00 40.72 ? 67  VAL B O   1 
ATOM   1918 C  CB  . VAL B 1 66  ? 18.363 12.855 76.273 1.00 43.85 ? 67  VAL B CB  1 
ATOM   1919 C  CG1 . VAL B 1 66  ? 18.776 11.511 76.901 1.00 37.66 ? 67  VAL B CG1 1 
ATOM   1920 C  CG2 . VAL B 1 66  ? 16.889 13.178 76.467 1.00 45.36 ? 67  VAL B CG2 1 
ATOM   1921 N  N   . VAL B 1 67  ? 21.189 12.873 77.036 1.00 59.14 ? 68  VAL B N   1 
ATOM   1922 C  CA  . VAL B 1 67  ? 22.476 12.412 76.652 1.00 60.00 ? 68  VAL B CA  1 
ATOM   1923 C  C   . VAL B 1 67  ? 22.321 11.421 75.599 1.00 50.62 ? 68  VAL B C   1 
ATOM   1924 O  O   . VAL B 1 67  ? 21.877 10.292 75.822 1.00 60.00 ? 68  VAL B O   1 
ATOM   1925 C  CB  . VAL B 1 67  ? 23.270 11.723 77.762 1.00 60.00 ? 68  VAL B CB  1 
ATOM   1926 C  CG1 . VAL B 1 67  ? 23.940 10.416 77.231 1.00 60.00 ? 68  VAL B CG1 1 
ATOM   1927 C  CG2 . VAL B 1 67  ? 24.339 12.693 78.257 1.00 58.31 ? 68  VAL B CG2 1 
ATOM   1928 N  N   . PRO B 1 68  ? 22.907 11.843 74.517 1.00 44.50 ? 69  PRO B N   1 
ATOM   1929 C  CA  . PRO B 1 68  ? 23.071 11.087 73.313 1.00 46.09 ? 69  PRO B CA  1 
ATOM   1930 C  C   . PRO B 1 68  ? 23.592 9.683  73.537 1.00 45.81 ? 69  PRO B C   1 
ATOM   1931 O  O   . PRO B 1 68  ? 24.374 9.411  74.461 1.00 44.90 ? 69  PRO B O   1 
ATOM   1932 C  CB  . PRO B 1 68  ? 24.047 11.935 72.517 1.00 45.73 ? 69  PRO B CB  1 
ATOM   1933 C  CG  . PRO B 1 68  ? 23.765 13.375 72.970 1.00 38.73 ? 69  PRO B CG  1 
ATOM   1934 C  CD  . PRO B 1 68  ? 23.296 13.264 74.386 1.00 36.83 ? 69  PRO B CD  1 
ATOM   1935 N  N   . GLU B 1 69  ? 22.967 8.789  72.761 1.00 60.00 ? 70  GLU B N   1 
ATOM   1936 C  CA  . GLU B 1 69  ? 23.243 7.350  72.659 1.00 57.19 ? 70  GLU B CA  1 
ATOM   1937 C  C   . GLU B 1 69  ? 24.697 7.175  72.375 1.00 60.00 ? 70  GLU B C   1 
ATOM   1938 O  O   . GLU B 1 69  ? 25.271 7.903  71.541 1.00 60.00 ? 70  GLU B O   1 
ATOM   1939 C  CB  . GLU B 1 69  ? 22.581 6.808  71.399 1.00 56.59 ? 70  GLU B CB  1 
ATOM   1940 C  CG  . GLU B 1 69  ? 21.232 6.159  71.571 1.00 60.00 ? 70  GLU B CG  1 
ATOM   1941 C  CD  . GLU B 1 69  ? 20.706 5.666  70.250 1.00 60.00 ? 70  GLU B CD  1 
ATOM   1942 O  OE1 . GLU B 1 69  ? 20.078 6.477  69.548 1.00 60.00 ? 70  GLU B OE1 1 
ATOM   1943 O  OE2 . GLU B 1 69  ? 21.042 4.458  69.901 1.00 58.65 ? 70  GLU B OE2 1 
ATOM   1944 N  N   . LYS B 1 70  ? 25.264 6.139  72.957 1.00 60.00 ? 71  LYS B N   1 
ATOM   1945 C  CA  . LYS B 1 70  ? 26.664 5.874  72.714 1.00 60.00 ? 71  LYS B CA  1 
ATOM   1946 C  C   . LYS B 1 70  ? 26.927 5.598  71.226 1.00 60.00 ? 71  LYS B C   1 
ATOM   1947 O  O   . LYS B 1 70  ? 27.779 6.253  70.593 1.00 60.00 ? 71  LYS B O   1 
ATOM   1948 C  CB  . LYS B 1 70  ? 27.165 4.728  73.596 1.00 60.00 ? 71  LYS B CB  1 
ATOM   1949 C  CG  . LYS B 1 70  ? 27.588 5.198  74.986 1.00 60.00 ? 71  LYS B CG  1 
ATOM   1950 C  CD  . LYS B 1 70  ? 29.010 5.737  74.992 1.00 60.00 ? 71  LYS B CD  1 
ATOM   1951 C  CE  . LYS B 1 70  ? 29.665 5.505  76.377 1.00 60.00 ? 71  LYS B CE  1 
ATOM   1952 N  NZ  . LYS B 1 70  ? 30.843 4.555  76.448 1.00 60.00 ? 71  LYS B NZ  1 
ATOM   1953 N  N   . ASN B 1 71  ? 26.167 4.667  70.649 1.00 60.00 ? 72  ASN B N   1 
ATOM   1954 C  CA  . ASN B 1 71  ? 26.450 4.257  69.273 1.00 60.00 ? 72  ASN B CA  1 
ATOM   1955 C  C   . ASN B 1 71  ? 25.244 4.292  68.350 1.00 60.00 ? 72  ASN B C   1 
ATOM   1956 O  O   . ASN B 1 71  ? 24.884 3.295  67.691 1.00 60.00 ? 72  ASN B O   1 
ATOM   1957 C  CB  . ASN B 1 71  ? 27.185 2.897  69.294 1.00 60.00 ? 72  ASN B CB  1 
ATOM   1958 C  CG  . ASN B 1 71  ? 28.268 2.849  70.408 1.00 60.00 ? 72  ASN B CG  1 
ATOM   1959 O  OD1 . ASN B 1 71  ? 28.013 2.316  71.560 1.00 60.00 ? 72  ASN B OD1 1 
ATOM   1960 N  ND2 . ASN B 1 71  ? 29.445 3.508  70.134 1.00 60.00 ? 72  ASN B ND2 1 
ATOM   1961 N  N   . PRO B 1 72  ? 24.610 5.458  68.320 1.00 53.19 ? 73  PRO B N   1 
ATOM   1962 C  CA  . PRO B 1 72  ? 23.422 5.594  67.522 1.00 56.67 ? 73  PRO B CA  1 
ATOM   1963 C  C   . PRO B 1 72  ? 23.606 4.673  66.328 1.00 60.00 ? 73  PRO B C   1 
ATOM   1964 O  O   . PRO B 1 72  ? 24.710 4.544  65.796 1.00 60.00 ? 73  PRO B O   1 
ATOM   1965 C  CB  . PRO B 1 72  ? 23.420 7.086  67.081 1.00 55.82 ? 73  PRO B CB  1 
ATOM   1966 C  CG  . PRO B 1 72  ? 24.818 7.626  67.322 1.00 54.95 ? 73  PRO B CG  1 
ATOM   1967 C  CD  . PRO B 1 72  ? 25.518 6.627  68.230 1.00 47.66 ? 73  PRO B CD  1 
ATOM   1968 N  N   . PRO B 1 73  ? 22.534 4.019  65.923 1.00 57.61 ? 74  PRO B N   1 
ATOM   1969 C  CA  . PRO B 1 73  ? 22.567 3.332  64.665 1.00 54.03 ? 74  PRO B CA  1 
ATOM   1970 C  C   . PRO B 1 73  ? 22.377 4.444  63.643 1.00 60.00 ? 74  PRO B C   1 
ATOM   1971 O  O   . PRO B 1 73  ? 21.921 5.570  63.934 1.00 60.00 ? 74  PRO B O   1 
ATOM   1972 C  CB  . PRO B 1 73  ? 21.314 2.430  64.666 1.00 54.73 ? 74  PRO B CB  1 
ATOM   1973 C  CG  . PRO B 1 73  ? 20.515 2.794  65.883 1.00 60.00 ? 74  PRO B CG  1 
ATOM   1974 C  CD  . PRO B 1 73  ? 21.496 3.481  66.824 1.00 60.00 ? 74  PRO B CD  1 
ATOM   1975 N  N   . PRO B 1 74  ? 22.742 4.124  62.436 1.00 57.35 ? 75  PRO B N   1 
ATOM   1976 C  CA  . PRO B 1 74  ? 22.566 5.054  61.339 1.00 57.80 ? 75  PRO B CA  1 
ATOM   1977 C  C   . PRO B 1 74  ? 21.416 5.995  61.607 1.00 60.00 ? 75  PRO B C   1 
ATOM   1978 O  O   . PRO B 1 74  ? 21.603 7.207  61.675 1.00 58.77 ? 75  PRO B O   1 
ATOM   1979 C  CB  . PRO B 1 74  ? 22.202 4.160  60.155 1.00 58.38 ? 75  PRO B CB  1 
ATOM   1980 C  CG  . PRO B 1 74  ? 22.163 2.728  60.679 1.00 60.00 ? 75  PRO B CG  1 
ATOM   1981 C  CD  . PRO B 1 74  ? 22.795 2.714  62.031 1.00 54.31 ? 75  PRO B CD  1 
ATOM   1982 N  N   . GLU B 1 75  ? 20.229 5.407  61.765 1.00 58.00 ? 76  GLU B N   1 
ATOM   1983 C  CA  . GLU B 1 75  ? 19.004 6.167  61.947 1.00 52.77 ? 76  GLU B CA  1 
ATOM   1984 C  C   . GLU B 1 75  ? 19.173 7.281  62.943 1.00 52.10 ? 76  GLU B C   1 
ATOM   1985 O  O   . GLU B 1 75  ? 18.583 8.364  62.838 1.00 45.04 ? 76  GLU B O   1 
ATOM   1986 C  CB  . GLU B 1 75  ? 17.813 5.265  62.304 1.00 51.98 ? 76  GLU B CB  1 
ATOM   1987 C  CG  . GLU B 1 75  ? 17.269 5.450  63.723 0.00 57.82 ? 76  GLU B CG  1 
ATOM   1988 C  CD  . GLU B 1 75  ? 15.902 4.835  63.887 0.00 60.00 ? 76  GLU B CD  1 
ATOM   1989 O  OE1 . GLU B 1 75  ? 15.047 5.109  62.977 0.00 53.86 ? 76  GLU B OE1 1 
ATOM   1990 O  OE2 . GLU B 1 75  ? 15.666 4.074  64.828 0.00 54.12 ? 76  GLU B OE2 1 
ATOM   1991 N  N   . ARG B 1 76  ? 20.014 7.062  63.919 1.00 52.33 ? 77  ARG B N   1 
ATOM   1992 C  CA  . ARG B 1 76  ? 20.171 8.159  64.810 1.00 55.85 ? 77  ARG B CA  1 
ATOM   1993 C  C   . ARG B 1 76  ? 21.589 8.697  64.806 1.00 60.00 ? 77  ARG B C   1 
ATOM   1994 O  O   . ARG B 1 76  ? 22.039 9.271  65.795 1.00 60.00 ? 77  ARG B O   1 
ATOM   1995 C  CB  . ARG B 1 76  ? 19.646 7.847  66.199 1.00 50.74 ? 77  ARG B CB  1 
ATOM   1996 C  CG  . ARG B 1 76  ? 18.197 7.421  66.224 1.00 42.57 ? 77  ARG B CG  1 
ATOM   1997 C  CD  . ARG B 1 76  ? 17.781 7.131  67.632 1.00 32.58 ? 77  ARG B CD  1 
ATOM   1998 N  NE  . ARG B 1 76  ? 18.297 5.828  68.049 1.00 41.35 ? 77  ARG B NE  1 
ATOM   1999 C  CZ  . ARG B 1 76  ? 17.882 4.671  67.545 1.00 46.02 ? 77  ARG B CZ  1 
ATOM   2000 N  NH1 . ARG B 1 76  ? 16.964 4.644  66.598 1.00 51.62 ? 77  ARG B NH1 1 
ATOM   2001 N  NH2 . ARG B 1 76  ? 18.360 3.527  68.022 1.00 37.79 ? 77  ARG B NH2 1 
ATOM   2002 N  N   . GLN B 1 77  ? 22.337 8.509  63.727 1.00 57.43 ? 78  GLN B N   1 
ATOM   2003 C  CA  . GLN B 1 77  ? 23.656 9.076  63.803 1.00 55.01 ? 78  GLN B CA  1 
ATOM   2004 C  C   . GLN B 1 77  ? 23.752 10.378 63.174 1.00 57.96 ? 78  GLN B C   1 
ATOM   2005 O  O   . GLN B 1 77  ? 22.834 10.841 62.530 1.00 60.00 ? 78  GLN B O   1 
ATOM   2006 C  CB  . GLN B 1 77  ? 24.715 8.222  63.213 1.00 51.38 ? 78  GLN B CB  1 
ATOM   2007 C  CG  . GLN B 1 77  ? 24.633 6.837  63.785 1.00 60.00 ? 78  GLN B CG  1 
ATOM   2008 C  CD  . GLN B 1 77  ? 25.538 5.942  62.975 1.00 60.00 ? 78  GLN B CD  1 
ATOM   2009 O  OE1 . GLN B 1 77  ? 26.115 6.431  61.970 1.00 60.00 ? 78  GLN B OE1 1 
ATOM   2010 N  NE2 . GLN B 1 77  ? 25.537 4.619  63.297 1.00 60.00 ? 78  GLN B NE2 1 
ATOM   2011 N  N   . ILE B 1 78  ? 24.924 10.955 63.306 1.00 60.00 ? 79  ILE B N   1 
ATOM   2012 C  CA  . ILE B 1 78  ? 25.135 12.231 62.636 1.00 60.00 ? 79  ILE B CA  1 
ATOM   2013 C  C   . ILE B 1 78  ? 25.875 12.062 61.287 1.00 60.00 ? 79  ILE B C   1 
ATOM   2014 O  O   . ILE B 1 78  ? 25.255 12.057 60.194 1.00 60.00 ? 79  ILE B O   1 
ATOM   2015 C  CB  . ILE B 1 78  ? 25.793 13.302 63.550 1.00 60.00 ? 79  ILE B CB  1 
ATOM   2016 C  CG1 . ILE B 1 78  ? 25.354 13.146 65.008 1.00 60.00 ? 79  ILE B CG1 1 
ATOM   2017 C  CG2 . ILE B 1 78  ? 25.380 14.722 63.116 1.00 60.00 ? 79  ILE B CG2 1 
ATOM   2018 C  CD1 . ILE B 1 78  ? 24.951 14.513 65.599 1.00 60.00 ? 79  ILE B CD1 1 
ATOM   2019 N  N   . GLU B 1 87  ? 22.377 18.061 49.258 1.00 60.00 ? 88  GLU B N   1 
ATOM   2020 C  CA  . GLU B 1 87  ? 20.936 17.966 49.750 1.00 60.00 ? 88  GLU B CA  1 
ATOM   2021 C  C   . GLU B 1 87  ? 20.005 16.681 49.718 1.00 60.00 ? 88  GLU B C   1 
ATOM   2022 O  O   . GLU B 1 87  ? 18.764 16.730 49.409 1.00 60.00 ? 88  GLU B O   1 
ATOM   2023 C  CB  . GLU B 1 87  ? 20.128 19.290 49.689 1.00 60.00 ? 88  GLU B CB  1 
ATOM   2024 N  N   . MET B 1 88  ? 20.586 15.590 50.246 1.00 60.00 ? 89  MET B N   1 
ATOM   2025 C  CA  . MET B 1 88  ? 19.863 14.397 50.555 1.00 51.68 ? 89  MET B CA  1 
ATOM   2026 C  C   . MET B 1 88  ? 18.925 14.807 51.689 1.00 59.11 ? 89  MET B C   1 
ATOM   2027 O  O   . MET B 1 88  ? 18.168 13.982 52.234 1.00 60.00 ? 89  MET B O   1 
ATOM   2028 C  CB  . MET B 1 88  ? 20.819 13.282 51.004 0.00 53.66 ? 89  MET B CB  1 
ATOM   2029 C  CG  . MET B 1 88  ? 20.362 11.855 50.645 0.00 57.21 ? 89  MET B CG  1 
ATOM   2030 S  SD  . MET B 1 88  ? 21.009 11.166 49.088 0.00 60.00 ? 89  MET B SD  1 
ATOM   2031 C  CE  . MET B 1 88  ? 19.486 10.614 48.269 0.00 56.69 ? 89  MET B CE  1 
ATOM   2032 N  N   . GLU B 1 89  ? 18.931 16.127 51.951 1.00 49.02 ? 90  GLU B N   1 
ATOM   2033 C  CA  . GLU B 1 89  ? 18.215 16.857 53.013 1.00 47.08 ? 90  GLU B CA  1 
ATOM   2034 C  C   . GLU B 1 89  ? 16.753 16.525 53.148 1.00 42.42 ? 90  GLU B C   1 
ATOM   2035 O  O   . GLU B 1 89  ? 16.354 15.940 54.149 1.00 47.29 ? 90  GLU B O   1 
ATOM   2036 C  CB  . GLU B 1 89  ? 18.392 18.367 52.841 1.00 44.42 ? 90  GLU B CB  1 
ATOM   2037 C  CG  . GLU B 1 89  ? 17.874 19.170 54.026 1.00 57.75 ? 90  GLU B CG  1 
ATOM   2038 C  CD  . GLU B 1 89  ? 16.831 20.243 53.619 1.00 60.00 ? 90  GLU B CD  1 
ATOM   2039 O  OE1 . GLU B 1 89  ? 16.142 20.043 52.509 1.00 60.00 ? 90  GLU B OE1 1 
ATOM   2040 O  OE2 . GLU B 1 89  ? 16.685 21.299 54.326 1.00 60.00 ? 90  GLU B OE2 1 
ATOM   2041 N  N   . GLN B 1 90  ? 15.992 16.839 52.098 1.00 39.58 ? 91  GLN B N   1 
ATOM   2042 C  CA  . GLN B 1 90  ? 14.582 16.479 52.006 1.00 36.61 ? 91  GLN B CA  1 
ATOM   2043 C  C   . GLN B 1 90  ? 14.303 15.098 52.603 1.00 32.38 ? 91  GLN B C   1 
ATOM   2044 O  O   . GLN B 1 90  ? 13.266 14.840 53.160 1.00 31.43 ? 91  GLN B O   1 
ATOM   2045 C  CB  . GLN B 1 90  ? 14.107 16.464 50.544 1.00 34.55 ? 91  GLN B CB  1 
ATOM   2046 C  CG  . GLN B 1 90  ? 12.630 15.984 50.435 1.00 35.29 ? 91  GLN B CG  1 
ATOM   2047 C  CD  . GLN B 1 90  ? 12.213 15.646 49.018 1.00 33.65 ? 91  GLN B CD  1 
ATOM   2048 O  OE1 . GLN B 1 90  ? 13.018 15.119 48.256 1.00 37.78 ? 91  GLN B OE1 1 
ATOM   2049 N  NE2 . GLN B 1 90  ? 10.958 15.929 48.666 1.00 27.84 ? 91  GLN B NE2 1 
ATOM   2050 N  N   . ILE B 1 91  ? 15.240 14.202 52.474 1.00 26.91 ? 92  ILE B N   1 
ATOM   2051 C  CA  . ILE B 1 91  ? 15.019 12.861 52.907 1.00 30.79 ? 92  ILE B CA  1 
ATOM   2052 C  C   . ILE B 1 91  ? 15.654 12.598 54.259 1.00 40.66 ? 92  ILE B C   1 
ATOM   2053 O  O   . ILE B 1 91  ? 15.109 11.881 55.109 1.00 39.87 ? 92  ILE B O   1 
ATOM   2054 C  CB  . ILE B 1 91  ? 15.610 11.966 51.820 1.00 35.04 ? 92  ILE B CB  1 
ATOM   2055 C  CG1 . ILE B 1 91  ? 14.718 12.092 50.593 1.00 39.87 ? 92  ILE B CG1 1 
ATOM   2056 C  CG2 . ILE B 1 91  ? 15.632 10.494 52.222 1.00 38.34 ? 92  ILE B CG2 1 
ATOM   2057 C  CD1 . ILE B 1 91  ? 15.243 11.340 49.418 1.00 34.37 ? 92  ILE B CD1 1 
ATOM   2058 N  N   . SER B 1 92  ? 16.814 13.195 54.460 1.00 36.26 ? 93  SER B N   1 
ATOM   2059 C  CA  . SER B 1 92  ? 17.575 12.960 55.666 1.00 39.58 ? 93  SER B CA  1 
ATOM   2060 C  C   . SER B 1 92  ? 16.745 13.443 56.852 1.00 36.35 ? 93  SER B C   1 
ATOM   2061 O  O   . SER B 1 92  ? 16.587 12.777 57.850 1.00 48.39 ? 93  SER B O   1 
ATOM   2062 C  CB  . SER B 1 92  ? 18.889 13.709 55.572 1.00 39.04 ? 93  SER B CB  1 
ATOM   2063 O  OG  . SER B 1 92  ? 18.598 15.083 55.751 1.00 60.00 ? 93  SER B OG  1 
ATOM   2064 N  N   . ILE B 1 93  ? 16.145 14.586 56.659 1.00 27.81 ? 94  ILE B N   1 
ATOM   2065 C  CA  . ILE B 1 93  ? 15.269 15.188 57.634 1.00 37.23 ? 94  ILE B CA  1 
ATOM   2066 C  C   . ILE B 1 93  ? 14.054 14.313 58.072 1.00 43.30 ? 94  ILE B C   1 
ATOM   2067 O  O   . ILE B 1 93  ? 13.361 14.618 59.045 1.00 37.95 ? 94  ILE B O   1 
ATOM   2068 C  CB  . ILE B 1 93  ? 14.796 16.581 57.115 1.00 42.89 ? 94  ILE B CB  1 
ATOM   2069 C  CG1 . ILE B 1 93  ? 14.725 17.594 58.244 1.00 35.22 ? 94  ILE B CG1 1 
ATOM   2070 C  CG2 . ILE B 1 93  ? 13.455 16.533 56.365 1.00 51.85 ? 94  ILE B CG2 1 
ATOM   2071 C  CD1 . ILE B 1 93  ? 14.045 18.890 57.848 1.00 60.00 ? 94  ILE B CD1 1 
ATOM   2072 N  N   . ILE B 1 94  ? 13.684 13.318 57.287 1.00 40.83 ? 95  ILE B N   1 
ATOM   2073 C  CA  . ILE B 1 94  ? 12.587 12.464 57.718 1.00 33.64 ? 95  ILE B CA  1 
ATOM   2074 C  C   . ILE B 1 94  ? 13.088 11.062 57.769 1.00 35.52 ? 95  ILE B C   1 
ATOM   2075 O  O   . ILE B 1 94  ? 12.287 10.155 57.784 1.00 40.95 ? 95  ILE B O   1 
ATOM   2076 C  CB  . ILE B 1 94  ? 11.387 12.437 56.795 1.00 33.20 ? 95  ILE B CB  1 
ATOM   2077 C  CG1 . ILE B 1 94  ? 11.756 11.711 55.509 1.00 32.28 ? 95  ILE B CG1 1 
ATOM   2078 C  CG2 . ILE B 1 94  ? 10.789 13.815 56.621 1.00 36.33 ? 95  ILE B CG2 1 
ATOM   2079 C  CD1 . ILE B 1 94  ? 10.688 11.707 54.440 1.00 29.01 ? 95  ILE B CD1 1 
ATOM   2080 N  N   . GLU B 1 95  ? 14.410 10.872 57.773 1.00 29.80 ? 96  GLU B N   1 
ATOM   2081 C  CA  . GLU B 1 95  ? 14.949 9.551  57.946 1.00 31.47 ? 96  GLU B CA  1 
ATOM   2082 C  C   . GLU B 1 95  ? 15.979 9.438  59.062 1.00 40.22 ? 96  GLU B C   1 
ATOM   2083 O  O   . GLU B 1 95  ? 16.100 8.375  59.668 1.00 46.13 ? 96  GLU B O   1 
ATOM   2084 C  CB  . GLU B 1 95  ? 15.511 8.988  56.651 1.00 34.77 ? 96  GLU B CB  1 
ATOM   2085 C  CG  . GLU B 1 95  ? 14.500 8.940  55.512 1.00 44.25 ? 96  GLU B CG  1 
ATOM   2086 C  CD  . GLU B 1 95  ? 14.923 7.983  54.411 1.00 60.00 ? 96  GLU B CD  1 
ATOM   2087 O  OE1 . GLU B 1 95  ? 16.102 7.663  54.298 1.00 58.33 ? 96  GLU B OE1 1 
ATOM   2088 O  OE2 . GLU B 1 95  ? 14.014 7.557  53.610 1.00 60.00 ? 96  GLU B OE2 1 
ATOM   2089 N  N   . ARG B 1 96  ? 16.702 10.536 59.318 1.00 39.56 ? 97  ARG B N   1 
ATOM   2090 C  CA  . ARG B 1 96  ? 17.728 10.622 60.362 1.00 35.53 ? 97  ARG B CA  1 
ATOM   2091 C  C   . ARG B 1 96  ? 17.355 11.565 61.511 1.00 34.71 ? 97  ARG B C   1 
ATOM   2092 O  O   . ARG B 1 96  ? 17.069 12.755 61.331 1.00 37.51 ? 97  ARG B O   1 
ATOM   2093 C  CB  . ARG B 1 96  ? 19.069 11.023 59.777 1.00 42.56 ? 97  ARG B CB  1 
ATOM   2094 C  CG  . ARG B 1 96  ? 20.040 9.842  59.584 1.00 60.00 ? 97  ARG B CG  1 
ATOM   2095 C  CD  . ARG B 1 96  ? 21.422 10.337 59.196 1.00 57.14 ? 97  ARG B CD  1 
ATOM   2096 N  NE  . ARG B 1 96  ? 21.253 11.630 58.527 1.00 60.00 ? 97  ARG B NE  1 
ATOM   2097 C  CZ  . ARG B 1 96  ? 22.230 12.499 58.162 1.00 60.00 ? 97  ARG B CZ  1 
ATOM   2098 N  NH1 . ARG B 1 96  ? 23.540 12.245 58.429 1.00 60.00 ? 97  ARG B NH1 1 
ATOM   2099 N  NH2 . ARG B 1 96  ? 21.901 13.654 57.512 1.00 60.00 ? 97  ARG B NH2 1 
ATOM   2100 N  N   . PHE B 1 97  ? 17.365 11.019 62.710 1.00 39.95 ? 98  PHE B N   1 
ATOM   2101 C  CA  . PHE B 1 97  ? 16.945 11.778 63.879 1.00 42.73 ? 98  PHE B CA  1 
ATOM   2102 C  C   . PHE B 1 97  ? 17.932 11.481 64.934 1.00 54.51 ? 98  PHE B C   1 
ATOM   2103 O  O   . PHE B 1 97  ? 17.968 10.391 65.481 1.00 60.00 ? 98  PHE B O   1 
ATOM   2104 C  CB  . PHE B 1 97  ? 15.587 11.288 64.334 1.00 39.17 ? 98  PHE B CB  1 
ATOM   2105 C  CG  . PHE B 1 97  ? 14.611 11.192 63.223 1.00 31.46 ? 98  PHE B CG  1 
ATOM   2106 C  CD1 . PHE B 1 97  ? 14.589 10.073 62.403 1.00 31.21 ? 98  PHE B CD1 1 
ATOM   2107 C  CD2 . PHE B 1 97  ? 13.729 12.238 62.988 1.00 29.20 ? 98  PHE B CD2 1 
ATOM   2108 C  CE1 . PHE B 1 97  ? 13.659 9.982  61.386 1.00 32.81 ? 98  PHE B CE1 1 
ATOM   2109 C  CE2 . PHE B 1 97  ? 12.818 12.176 61.937 1.00 31.81 ? 98  PHE B CE2 1 
ATOM   2110 C  CZ  . PHE B 1 97  ? 12.785 11.039 61.145 1.00 27.36 ? 98  PHE B CZ  1 
ATOM   2111 N  N   . PRO B 1 98  ? 18.800 12.427 65.163 1.00 48.40 ? 99  PRO B N   1 
ATOM   2112 C  CA  . PRO B 1 98  ? 19.902 12.141 66.026 1.00 49.26 ? 99  PRO B CA  1 
ATOM   2113 C  C   . PRO B 1 98  ? 19.942 13.074 67.257 1.00 46.61 ? 99  PRO B C   1 
ATOM   2114 O  O   . PRO B 1 98  ? 20.752 12.899 68.143 1.00 39.86 ? 99  PRO B O   1 
ATOM   2115 C  CB  . PRO B 1 98  ? 21.109 12.286 65.085 1.00 49.64 ? 99  PRO B CB  1 
ATOM   2116 C  CG  . PRO B 1 98  ? 20.572 12.815 63.767 1.00 51.99 ? 99  PRO B CG  1 
ATOM   2117 C  CD  . PRO B 1 98  ? 19.185 13.310 64.056 1.00 45.14 ? 99  PRO B CD  1 
ATOM   2118 N  N   . TYR B 1 99  ? 18.945 13.935 67.393 1.00 38.99 ? 100 TYR B N   1 
ATOM   2119 C  CA  . TYR B 1 99  ? 18.916 14.879 68.487 1.00 41.70 ? 100 TYR B CA  1 
ATOM   2120 C  C   . TYR B 1 99  ? 17.837 14.626 69.530 1.00 44.92 ? 100 TYR B C   1 
ATOM   2121 O  O   . TYR B 1 99  ? 16.710 15.113 69.374 1.00 40.49 ? 100 TYR B O   1 
ATOM   2122 C  CB  . TYR B 1 99  ? 18.822 16.293 67.919 1.00 46.35 ? 100 TYR B CB  1 
ATOM   2123 C  CG  . TYR B 1 99  ? 19.932 16.502 66.933 1.00 56.77 ? 100 TYR B CG  1 
ATOM   2124 C  CD1 . TYR B 1 99  ? 21.133 15.826 67.135 1.00 60.00 ? 100 TYR B CD1 1 
ATOM   2125 C  CD2 . TYR B 1 99  ? 19.735 17.170 65.721 1.00 58.04 ? 100 TYR B CD2 1 
ATOM   2126 C  CE1 . TYR B 1 99  ? 22.163 15.859 66.207 1.00 60.00 ? 100 TYR B CE1 1 
ATOM   2127 C  CE2 . TYR B 1 99  ? 20.754 17.208 64.767 1.00 60.00 ? 100 TYR B CE2 1 
ATOM   2128 C  CZ  . TYR B 1 99  ? 21.971 16.551 65.019 1.00 60.00 ? 100 TYR B CZ  1 
ATOM   2129 O  OH  . TYR B 1 99  ? 23.091 16.647 64.185 1.00 60.00 ? 100 TYR B OH  1 
ATOM   2130 N  N   . PRO B 1 100 ? 18.185 13.926 70.633 1.00 43.67 ? 101 PRO B N   1 
ATOM   2131 C  CA  . PRO B 1 100 ? 17.155 13.592 71.621 1.00 40.95 ? 101 PRO B CA  1 
ATOM   2132 C  C   . PRO B 1 100 ? 16.809 14.633 72.657 1.00 48.98 ? 101 PRO B C   1 
ATOM   2133 O  O   . PRO B 1 100 ? 17.664 15.338 73.133 1.00 55.53 ? 101 PRO B O   1 
ATOM   2134 C  CB  . PRO B 1 100 ? 17.658 12.316 72.293 1.00 35.98 ? 101 PRO B CB  1 
ATOM   2135 C  CG  . PRO B 1 100 ? 19.127 12.288 72.054 1.00 41.44 ? 101 PRO B CG  1 
ATOM   2136 C  CD  . PRO B 1 100 ? 19.378 13.068 70.783 1.00 38.37 ? 101 PRO B CD  1 
ATOM   2137 N  N   . PHE B 1 101 ? 15.523 14.759 72.954 1.00 36.42 ? 102 PHE B N   1 
ATOM   2138 C  CA  . PHE B 1 101 ? 15.085 15.489 74.103 1.00 28.95 ? 102 PHE B CA  1 
ATOM   2139 C  C   . PHE B 1 101 ? 14.139 14.647 74.876 1.00 44.01 ? 102 PHE B C   1 
ATOM   2140 O  O   . PHE B 1 101 ? 13.830 13.525 74.469 1.00 42.40 ? 102 PHE B O   1 
ATOM   2141 C  CB  . PHE B 1 101 ? 14.479 16.794 73.811 1.00 23.23 ? 102 PHE B CB  1 
ATOM   2142 C  CG  . PHE B 1 101 ? 13.278 16.711 72.938 1.00 35.04 ? 102 PHE B CG  1 
ATOM   2143 C  CD1 . PHE B 1 101 ? 13.407 16.522 71.560 1.00 36.66 ? 102 PHE B CD1 1 
ATOM   2144 C  CD2 . PHE B 1 101 ? 12.036 17.077 73.452 1.00 34.43 ? 102 PHE B CD2 1 
ATOM   2145 C  CE1 . PHE B 1 101 ? 12.304 16.675 70.726 1.00 32.44 ? 102 PHE B CE1 1 
ATOM   2146 C  CE2 . PHE B 1 101 ? 10.916 17.206 72.634 1.00 40.22 ? 102 PHE B CE2 1 
ATOM   2147 C  CZ  . PHE B 1 101 ? 11.058 17.002 71.263 1.00 35.00 ? 102 PHE B CZ  1 
ATOM   2148 N  N   . GLN B 1 102 ? 13.806 15.103 76.080 1.00 32.05 ? 103 GLN B N   1 
ATOM   2149 C  CA  . GLN B 1 102 ? 12.981 14.274 76.907 1.00 26.06 ? 103 GLN B CA  1 
ATOM   2150 C  C   . GLN B 1 102 ? 11.834 15.010 77.475 1.00 37.97 ? 103 GLN B C   1 
ATOM   2151 O  O   . GLN B 1 102 ? 11.950 16.201 77.818 1.00 38.43 ? 103 GLN B O   1 
ATOM   2152 C  CB  . GLN B 1 102 ? 13.821 13.624 77.967 1.00 31.83 ? 103 GLN B CB  1 
ATOM   2153 C  CG  . GLN B 1 102 ? 14.146 14.529 79.155 1.00 47.88 ? 103 GLN B CG  1 
ATOM   2154 C  CD  . GLN B 1 102 ? 15.258 13.945 80.038 1.00 44.65 ? 103 GLN B CD  1 
ATOM   2155 O  OE1 . GLN B 1 102 ? 16.409 14.367 79.898 1.00 60.00 ? 103 GLN B OE1 1 
ATOM   2156 N  NE2 . GLN B 1 102 ? 14.983 12.812 80.724 1.00 51.08 ? 103 GLN B NE2 1 
ATOM   2157 N  N   . VAL B 1 103 ? 10.698 14.319 77.532 1.00 31.58 ? 104 VAL B N   1 
ATOM   2158 C  CA  . VAL B 1 103 ? 9.513  14.920 78.106 1.00 26.79 ? 104 VAL B CA  1 
ATOM   2159 C  C   . VAL B 1 103 ? 9.080  14.116 79.259 1.00 37.13 ? 104 VAL B C   1 
ATOM   2160 O  O   . VAL B 1 103 ? 8.685  12.980 79.111 1.00 42.03 ? 104 VAL B O   1 
ATOM   2161 C  CB  . VAL B 1 103 ? 8.392  14.992 77.154 1.00 30.01 ? 104 VAL B CB  1 
ATOM   2162 C  CG1 . VAL B 1 103 ? 7.206  15.765 77.771 1.00 26.88 ? 104 VAL B CG1 1 
ATOM   2163 C  CG2 . VAL B 1 103 ? 8.884  15.690 75.886 1.00 34.58 ? 104 VAL B CG2 1 
ATOM   2164 N  N   . VAL B 1 104 ? 9.287  14.693 80.431 1.00 33.98 ? 105 VAL B N   1 
ATOM   2165 C  CA  . VAL B 1 104 ? 8.993  14.030 81.658 1.00 27.72 ? 105 VAL B CA  1 
ATOM   2166 C  C   . VAL B 1 104 ? 7.670  14.468 82.252 1.00 33.00 ? 105 VAL B C   1 
ATOM   2167 O  O   . VAL B 1 104 ? 7.316  15.651 82.285 1.00 38.24 ? 105 VAL B O   1 
ATOM   2168 C  CB  . VAL B 1 104 ? 10.163 14.113 82.595 1.00 33.61 ? 105 VAL B CB  1 
ATOM   2169 C  CG1 . VAL B 1 104 ? 9.946  13.129 83.688 1.00 40.54 ? 105 VAL B CG1 1 
ATOM   2170 C  CG2 . VAL B 1 104 ? 11.460 13.703 81.889 1.00 33.77 ? 105 VAL B CG2 1 
ATOM   2171 N  N   . TYR B 1 105 ? 6.853  13.473 82.530 1.00 32.25 ? 106 TYR B N   1 
ATOM   2172 C  CA  . TYR B 1 105 ? 5.504  13.685 83.068 1.00 40.62 ? 106 TYR B CA  1 
ATOM   2173 C  C   . TYR B 1 105 ? 5.272  12.554 84.081 1.00 47.78 ? 106 TYR B C   1 
ATOM   2174 O  O   . TYR B 1 105 ? 6.185  11.729 84.268 1.00 42.41 ? 106 TYR B O   1 
ATOM   2175 C  CB  . TYR B 1 105 ? 4.431  13.642 81.935 1.00 46.18 ? 106 TYR B CB  1 
ATOM   2176 C  CG  . TYR B 1 105 ? 4.329  12.305 81.179 1.00 38.89 ? 106 TYR B CG  1 
ATOM   2177 C  CD1 . TYR B 1 105 ? 5.422  11.768 80.488 1.00 33.86 ? 106 TYR B CD1 1 
ATOM   2178 C  CD2 . TYR B 1 105 ? 3.121  11.609 81.150 1.00 38.91 ? 106 TYR B CD2 1 
ATOM   2179 C  CE1 . TYR B 1 105 ? 5.323  10.555 79.808 1.00 37.58 ? 106 TYR B CE1 1 
ATOM   2180 C  CE2 . TYR B 1 105 ? 2.994  10.423 80.433 1.00 43.50 ? 106 TYR B CE2 1 
ATOM   2181 C  CZ  . TYR B 1 105 ? 4.099  9.884  79.776 1.00 49.35 ? 106 TYR B CZ  1 
ATOM   2182 O  OH  . TYR B 1 105 ? 3.988  8.664  79.143 1.00 46.74 ? 106 TYR B OH  1 
ATOM   2183 N  N   . ASP B 1 106 ? 4.064  12.459 84.685 1.00 51.78 ? 107 ASP B N   1 
ATOM   2184 C  CA  . ASP B 1 106 ? 3.810  11.424 85.723 1.00 48.56 ? 107 ASP B CA  1 
ATOM   2185 C  C   . ASP B 1 106 ? 4.434  10.067 85.474 1.00 48.73 ? 107 ASP B C   1 
ATOM   2186 O  O   . ASP B 1 106 ? 5.166  9.540  86.296 1.00 59.36 ? 107 ASP B O   1 
ATOM   2187 C  CB  . ASP B 1 106 ? 2.340  11.215 86.071 1.00 49.87 ? 107 ASP B CB  1 
ATOM   2188 C  CG  . ASP B 1 106 ? 1.387  11.571 84.954 1.00 60.00 ? 107 ASP B CG  1 
ATOM   2189 O  OD1 . ASP B 1 106 ? 1.865  11.818 83.780 1.00 60.00 ? 107 ASP B OD1 1 
ATOM   2190 O  OD2 . ASP B 1 106 ? 0.167  11.554 85.203 1.00 60.00 ? 107 ASP B OD2 1 
ATOM   2191 N  N   . GLU B 1 107 ? 4.163  9.525  84.303 1.00 39.34 ? 108 GLU B N   1 
ATOM   2192 C  CA  . GLU B 1 107 ? 4.641  8.213  83.916 1.00 35.90 ? 108 GLU B CA  1 
ATOM   2193 C  C   . GLU B 1 107 ? 6.128  8.037  83.712 1.00 57.31 ? 108 GLU B C   1 
ATOM   2194 O  O   . GLU B 1 107 ? 6.697  6.956  83.976 1.00 60.00 ? 108 GLU B O   1 
ATOM   2195 C  CB  . GLU B 1 107 ? 3.771  7.731  82.772 1.00 36.00 ? 108 GLU B CB  1 
ATOM   2196 C  CG  . GLU B 1 107 ? 2.472  8.542  82.864 1.00 39.75 ? 108 GLU B CG  1 
ATOM   2197 C  CD  . GLU B 1 107 ? 1.230  7.801  82.507 1.00 50.32 ? 108 GLU B CD  1 
ATOM   2198 O  OE1 . GLU B 1 107 ? 1.367  6.544  82.380 1.00 56.10 ? 108 GLU B OE1 1 
ATOM   2199 O  OE2 . GLU B 1 107 ? 0.179  8.429  82.254 1.00 60.00 ? 108 GLU B OE2 1 
ATOM   2200 N  N   . GLY B 1 108 ? 6.782  9.131  83.377 1.00 52.59 ? 109 GLY B N   1 
ATOM   2201 C  CA  . GLY B 1 108 ? 8.193  9.068  83.194 1.00 49.07 ? 109 GLY B CA  1 
ATOM   2202 C  C   . GLY B 1 108 ? 8.528  9.825  81.973 1.00 39.91 ? 109 GLY B C   1 
ATOM   2203 O  O   . GLY B 1 108 ? 7.771  10.684 81.501 1.00 39.75 ? 109 GLY B O   1 
ATOM   2204 N  N   . PRO B 1 109 ? 9.687  9.494  81.471 1.00 33.12 ? 110 PRO B N   1 
ATOM   2205 C  CA  . PRO B 1 109 ? 10.304 10.190 80.343 1.00 41.83 ? 110 PRO B CA  1 
ATOM   2206 C  C   . PRO B 1 109 ? 9.876  9.675  78.956 1.00 49.70 ? 110 PRO B C   1 
ATOM   2207 O  O   . PRO B 1 109 ? 9.997  8.489  78.627 1.00 45.24 ? 110 PRO B O   1 
ATOM   2208 C  CB  . PRO B 1 109 ? 11.785 9.850  80.526 1.00 38.90 ? 110 PRO B CB  1 
ATOM   2209 C  CG  . PRO B 1 109 ? 11.751 8.430  81.172 1.00 32.49 ? 110 PRO B CG  1 
ATOM   2210 C  CD  . PRO B 1 109 ? 10.332 8.195  81.711 1.00 28.56 ? 110 PRO B CD  1 
ATOM   2211 N  N   . LEU B 1 110 ? 9.406  10.583 78.126 1.00 41.09 ? 111 LEU B N   1 
ATOM   2212 C  CA  . LEU B 1 110 ? 9.139  10.232 76.742 1.00 31.90 ? 111 LEU B CA  1 
ATOM   2213 C  C   . LEU B 1 110 ? 10.366 10.715 75.988 1.00 30.66 ? 111 LEU B C   1 
ATOM   2214 O  O   . LEU B 1 110 ? 10.824 11.856 76.156 1.00 34.54 ? 111 LEU B O   1 
ATOM   2215 C  CB  . LEU B 1 110 ? 7.819  10.878 76.218 1.00 31.07 ? 111 LEU B CB  1 
ATOM   2216 C  CG  . LEU B 1 110 ? 7.689  11.112 74.691 1.00 30.70 ? 111 LEU B CG  1 
ATOM   2217 C  CD1 . LEU B 1 110 ? 7.710  9.823  73.919 1.00 26.03 ? 111 LEU B CD1 1 
ATOM   2218 C  CD2 . LEU B 1 110 ? 6.490  11.965 74.306 1.00 27.00 ? 111 LEU B CD2 1 
ATOM   2219 N  N   . TYR B 1 111 ? 10.972 9.786  75.272 1.00 35.00 ? 112 TYR B N   1 
ATOM   2220 C  CA  . TYR B 1 111 ? 12.173 10.037 74.471 1.00 41.58 ? 112 TYR B CA  1 
ATOM   2221 C  C   . TYR B 1 111 ? 11.888 10.393 72.955 1.00 43.33 ? 112 TYR B C   1 
ATOM   2222 O  O   . TYR B 1 111 ? 11.451 9.548  72.164 1.00 43.45 ? 112 TYR B O   1 
ATOM   2223 C  CB  . TYR B 1 111 ? 13.146 8.848  74.638 1.00 39.54 ? 112 TYR B CB  1 
ATOM   2224 C  CG  . TYR B 1 111 ? 13.717 8.753  76.043 1.00 43.26 ? 112 TYR B CG  1 
ATOM   2225 C  CD1 . TYR B 1 111 ? 14.261 9.877  76.659 1.00 44.41 ? 112 TYR B CD1 1 
ATOM   2226 C  CD2 . TYR B 1 111 ? 13.620 7.580  76.798 1.00 43.67 ? 112 TYR B CD2 1 
ATOM   2227 C  CE1 . TYR B 1 111 ? 14.734 9.825  77.970 1.00 49.04 ? 112 TYR B CE1 1 
ATOM   2228 C  CE2 . TYR B 1 111 ? 14.156 7.495  78.089 1.00 42.53 ? 112 TYR B CE2 1 
ATOM   2229 C  CZ  . TYR B 1 111 ? 14.675 8.639  78.695 1.00 50.50 ? 112 TYR B CZ  1 
ATOM   2230 O  OH  . TYR B 1 111 ? 15.108 8.638  80.011 1.00 59.41 ? 112 TYR B OH  1 
ATOM   2231 N  N   . VAL B 1 112 ? 12.155 11.646 72.583 1.00 31.64 ? 113 VAL B N   1 
ATOM   2232 C  CA  . VAL B 1 112 ? 11.969 12.152 71.226 1.00 25.92 ? 113 VAL B CA  1 
ATOM   2233 C  C   . VAL B 1 112 ? 13.276 12.509 70.489 1.00 37.08 ? 113 VAL B C   1 
ATOM   2234 O  O   . VAL B 1 112 ? 14.163 13.148 71.022 1.00 41.90 ? 113 VAL B O   1 
ATOM   2235 C  CB  . VAL B 1 112 ? 11.121 13.363 71.307 1.00 28.70 ? 113 VAL B CB  1 
ATOM   2236 C  CG1 . VAL B 1 112 ? 10.667 13.811 69.947 1.00 26.79 ? 113 VAL B CG1 1 
ATOM   2237 C  CG2 . VAL B 1 112 ? 9.944  13.109 72.204 1.00 27.96 ? 113 VAL B CG2 1 
ATOM   2238 N  N   . PHE B 1 113 ? 13.346 12.185 69.217 1.00 36.78 ? 114 PHE B N   1 
ATOM   2239 C  CA  . PHE B 1 113 ? 14.519 12.533 68.415 1.00 33.79 ? 114 PHE B CA  1 
ATOM   2240 C  C   . PHE B 1 113 ? 14.254 13.450 67.278 1.00 35.17 ? 114 PHE B C   1 
ATOM   2241 O  O   . PHE B 1 113 ? 13.381 13.190 66.465 1.00 37.04 ? 114 PHE B O   1 
ATOM   2242 C  CB  . PHE B 1 113 ? 15.155 11.319 67.876 1.00 32.16 ? 114 PHE B CB  1 
ATOM   2243 C  CG  . PHE B 1 113 ? 15.505 10.407 68.936 1.00 36.40 ? 114 PHE B CG  1 
ATOM   2244 C  CD1 . PHE B 1 113 ? 14.493 9.894  69.747 1.00 43.10 ? 114 PHE B CD1 1 
ATOM   2245 C  CD2 . PHE B 1 113 ? 16.846 10.211 69.271 1.00 38.77 ? 114 PHE B CD2 1 
ATOM   2246 C  CE1 . PHE B 1 113 ? 14.818 9.000  70.759 1.00 41.69 ? 114 PHE B CE1 1 
ATOM   2247 C  CE2 . PHE B 1 113 ? 17.191 9.369  70.318 1.00 43.90 ? 114 PHE B CE2 1 
ATOM   2248 C  CZ  . PHE B 1 113 ? 16.167 8.747  71.036 1.00 40.83 ? 114 PHE B CZ  1 
ATOM   2249 N  N   . SER B 1 114 ? 15.079 14.482 67.217 1.00 29.29 ? 115 SER B N   1 
ATOM   2250 C  CA  . SER B 1 114 ? 15.013 15.487 66.196 1.00 31.32 ? 115 SER B CA  1 
ATOM   2251 C  C   . SER B 1 114 ? 16.020 15.158 65.125 1.00 33.00 ? 115 SER B C   1 
ATOM   2252 O  O   . SER B 1 114 ? 16.996 14.468 65.374 1.00 37.98 ? 115 SER B O   1 
ATOM   2253 C  CB  . SER B 1 114 ? 15.325 16.844 66.769 1.00 32.56 ? 115 SER B CB  1 
ATOM   2254 O  OG  . SER B 1 114 ? 14.855 17.891 65.938 1.00 33.86 ? 115 SER B OG  1 
ATOM   2255 N  N   . PRO B 1 115 ? 15.669 15.491 63.896 1.00 34.99 ? 116 PRO B N   1 
ATOM   2256 C  CA  . PRO B 1 115 ? 16.549 15.273 62.778 1.00 34.71 ? 116 PRO B CA  1 
ATOM   2257 C  C   . PRO B 1 115 ? 17.529 16.447 62.771 1.00 41.11 ? 116 PRO B C   1 
ATOM   2258 O  O   . PRO B 1 115 ? 18.636 16.325 62.294 1.00 46.69 ? 116 PRO B O   1 
ATOM   2259 C  CB  . PRO B 1 115 ? 15.612 15.341 61.590 1.00 34.12 ? 116 PRO B CB  1 
ATOM   2260 C  CG  . PRO B 1 115 ? 14.494 16.250 62.003 1.00 28.63 ? 116 PRO B CG  1 
ATOM   2261 C  CD  . PRO B 1 115 ? 14.352 16.014 63.472 1.00 29.48 ? 116 PRO B CD  1 
ATOM   2262 N  N   . THR B 1 116 ? 17.178 17.501 63.507 1.00 44.21 ? 117 THR B N   1 
ATOM   2263 C  CA  . THR B 1 116 ? 18.054 18.655 63.743 1.00 41.77 ? 117 THR B CA  1 
ATOM   2264 C  C   . THR B 1 116 ? 18.034 19.389 65.098 1.00 52.04 ? 117 THR B C   1 
ATOM   2265 O  O   . THR B 1 116 ? 17.014 19.472 65.821 1.00 52.10 ? 117 THR B O   1 
ATOM   2266 C  CB  . THR B 1 116 ? 17.933 19.684 62.648 1.00 39.74 ? 117 THR B CB  1 
ATOM   2267 O  OG1 . THR B 1 116 ? 16.740 20.452 62.829 1.00 44.77 ? 117 THR B OG1 1 
ATOM   2268 C  CG2 . THR B 1 116 ? 17.918 18.968 61.296 1.00 41.25 ? 117 THR B CG2 1 
ATOM   2269 N  N   . GLU B 1 117 ? 19.183 20.029 65.352 1.00 45.49 ? 118 GLU B N   1 
ATOM   2270 C  CA  . GLU B 1 117 ? 19.411 20.862 66.513 1.00 33.71 ? 118 GLU B CA  1 
ATOM   2271 C  C   . GLU B 1 117 ? 18.441 22.033 66.522 1.00 39.02 ? 118 GLU B C   1 
ATOM   2272 O  O   . GLU B 1 117 ? 17.713 22.303 67.460 1.00 43.18 ? 118 GLU B O   1 
ATOM   2273 C  CB  . GLU B 1 117 ? 20.818 21.395 66.444 1.00 39.76 ? 118 GLU B CB  1 
ATOM   2274 C  CG  . GLU B 1 117 ? 21.712 21.090 67.680 1.00 60.00 ? 118 GLU B CG  1 
ATOM   2275 C  CD  . GLU B 1 117 ? 22.180 19.658 67.729 0.00 60.00 ? 118 GLU B CD  1 
ATOM   2276 O  OE1 . GLU B 1 117 ? 21.466 18.782 68.225 0.00 54.04 ? 118 GLU B OE1 1 
ATOM   2277 O  OE2 . GLU B 1 117 ? 23.363 19.438 67.313 0.00 53.78 ? 118 GLU B OE2 1 
ATOM   2278 N  N   . GLU B 1 118 ? 18.317 22.695 65.423 1.00 32.42 ? 119 GLU B N   1 
ATOM   2279 C  CA  . GLU B 1 118 ? 17.378 23.783 65.476 1.00 34.52 ? 119 GLU B CA  1 
ATOM   2280 C  C   . GLU B 1 118 ? 15.992 23.339 65.898 1.00 41.49 ? 119 GLU B C   1 
ATOM   2281 O  O   . GLU B 1 118 ? 15.286 24.056 66.630 1.00 40.45 ? 119 GLU B O   1 
ATOM   2282 C  CB  . GLU B 1 118 ? 17.299 24.527 64.127 1.00 33.96 ? 119 GLU B CB  1 
ATOM   2283 C  CG  . GLU B 1 118 ? 16.136 25.532 64.077 1.00 49.68 ? 119 GLU B CG  1 
ATOM   2284 C  CD  . GLU B 1 118 ? 15.337 25.465 62.758 1.00 60.00 ? 119 GLU B CD  1 
ATOM   2285 O  OE1 . GLU B 1 118 ? 14.367 24.638 62.626 1.00 60.00 ? 119 GLU B OE1 1 
ATOM   2286 O  OE2 . GLU B 1 118 ? 15.680 26.364 61.841 1.00 60.00 ? 119 GLU B OE2 1 
ATOM   2287 N  N   . LEU B 1 119 ? 15.543 22.239 65.284 1.00 35.69 ? 120 LEU B N   1 
ATOM   2288 C  CA  . LEU B 1 119 ? 14.179 21.783 65.491 1.00 37.68 ? 120 LEU B CA  1 
ATOM   2289 C  C   . LEU B 1 119 ? 14.055 21.444 66.917 1.00 40.96 ? 120 LEU B C   1 
ATOM   2290 O  O   . LEU B 1 119 ? 13.104 21.823 67.589 1.00 40.04 ? 120 LEU B O   1 
ATOM   2291 C  CB  . LEU B 1 119 ? 13.878 20.525 64.702 1.00 36.47 ? 120 LEU B CB  1 
ATOM   2292 C  CG  . LEU B 1 119 ? 12.682 20.866 63.840 1.00 37.78 ? 120 LEU B CG  1 
ATOM   2293 C  CD1 . LEU B 1 119 ? 11.882 19.649 63.433 1.00 48.24 ? 120 LEU B CD1 1 
ATOM   2294 C  CD2 . LEU B 1 119 ? 11.811 21.871 64.528 1.00 31.83 ? 120 LEU B CD2 1 
ATOM   2295 N  N   . ARG B 1 120 ? 15.065 20.719 67.360 1.00 27.70 ? 121 ARG B N   1 
ATOM   2296 C  CA  . ARG B 1 120 ? 15.113 20.363 68.730 1.00 37.62 ? 121 ARG B CA  1 
ATOM   2297 C  C   . ARG B 1 120 ? 14.986 21.604 69.645 1.00 51.08 ? 121 ARG B C   1 
ATOM   2298 O  O   . ARG B 1 120 ? 14.067 21.720 70.498 1.00 43.38 ? 121 ARG B O   1 
ATOM   2299 C  CB  . ARG B 1 120 ? 16.384 19.638 69.032 1.00 29.01 ? 121 ARG B CB  1 
ATOM   2300 C  CG  . ARG B 1 120 ? 16.406 19.420 70.535 1.00 26.29 ? 121 ARG B CG  1 
ATOM   2301 C  CD  . ARG B 1 120 ? 17.401 18.321 70.847 1.00 32.38 ? 121 ARG B CD  1 
ATOM   2302 N  NE  . ARG B 1 120 ? 18.728 18.870 70.792 1.00 46.51 ? 121 ARG B NE  1 
ATOM   2303 C  CZ  . ARG B 1 120 ? 19.805 18.179 71.073 1.00 50.20 ? 121 ARG B CZ  1 
ATOM   2304 N  NH1 . ARG B 1 120 ? 19.681 16.897 71.356 1.00 39.11 ? 121 ARG B NH1 1 
ATOM   2305 N  NH2 . ARG B 1 120 ? 21.001 18.774 71.022 1.00 60.00 ? 121 ARG B NH2 1 
ATOM   2306 N  N   . LYS B 1 121 ? 15.896 22.548 69.427 1.00 40.14 ? 122 LYS B N   1 
ATOM   2307 C  CA  . LYS B 1 121 ? 15.947 23.728 70.235 1.00 35.70 ? 122 LYS B CA  1 
ATOM   2308 C  C   . LYS B 1 121 ? 14.632 24.455 70.147 1.00 47.31 ? 122 LYS B C   1 
ATOM   2309 O  O   . LYS B 1 121 ? 14.152 25.066 71.114 1.00 60.00 ? 122 LYS B O   1 
ATOM   2310 C  CB  . LYS B 1 121 ? 17.071 24.622 69.741 1.00 51.68 ? 122 LYS B CB  1 
ATOM   2311 C  CG  . LYS B 1 121 ? 16.897 26.120 70.047 1.00 60.00 ? 122 LYS B CG  1 
ATOM   2312 C  CD  . LYS B 1 121 ? 18.217 26.884 69.846 1.00 60.00 ? 122 LYS B CD  1 
ATOM   2313 C  CE  . LYS B 1 121 ? 18.222 28.277 70.501 1.00 60.00 ? 122 LYS B CE  1 
ATOM   2314 N  NZ  . LYS B 1 121 ? 18.803 29.343 69.603 1.00 60.00 ? 122 LYS B NZ  1 
ATOM   2315 N  N   . ARG B 1 122 ? 14.045 24.428 68.971 1.00 40.19 ? 123 ARG B N   1 
ATOM   2316 C  CA  . ARG B 1 122 ? 12.790 25.124 68.800 1.00 40.99 ? 123 ARG B CA  1 
ATOM   2317 C  C   . ARG B 1 122 ? 11.735 24.504 69.731 1.00 47.84 ? 123 ARG B C   1 
ATOM   2318 O  O   . ARG B 1 122 ? 10.893 25.210 70.313 1.00 35.62 ? 123 ARG B O   1 
ATOM   2319 C  CB  . ARG B 1 122 ? 12.355 24.970 67.355 1.00 35.78 ? 123 ARG B CB  1 
ATOM   2320 C  CG  . ARG B 1 122 ? 11.972 26.246 66.698 1.00 49.29 ? 123 ARG B CG  1 
ATOM   2321 C  CD  . ARG B 1 122 ? 12.217 26.192 65.148 1.00 60.00 ? 123 ARG B CD  1 
ATOM   2322 N  NE  . ARG B 1 122 ? 11.149 26.969 64.463 1.00 60.00 ? 123 ARG B NE  1 
ATOM   2323 C  CZ  . ARG B 1 122 ? 10.112 26.457 63.769 1.00 60.00 ? 123 ARG B CZ  1 
ATOM   2324 N  NH1 . ARG B 1 122 ? 10.118 25.138 63.432 1.00 60.00 ? 123 ARG B NH1 1 
ATOM   2325 N  NH2 . ARG B 1 122 ? 9.105  27.271 63.347 1.00 60.00 ? 123 ARG B NH2 1 
ATOM   2326 N  N   . TRP B 1 123 ? 11.725 23.164 69.758 1.00 45.26 ? 124 TRP B N   1 
ATOM   2327 C  CA  . TRP B 1 123 ? 10.711 22.399 70.464 1.00 41.16 ? 124 TRP B CA  1 
ATOM   2328 C  C   . TRP B 1 123 ? 10.849 22.613 71.972 1.00 36.30 ? 124 TRP B C   1 
ATOM   2329 O  O   . TRP B 1 123 ? 9.885  23.019 72.598 1.00 37.67 ? 124 TRP B O   1 
ATOM   2330 C  CB  . TRP B 1 123 ? 10.691 20.892 70.038 1.00 38.82 ? 124 TRP B CB  1 
ATOM   2331 C  CG  . TRP B 1 123 ? 9.720  20.618 68.887 1.00 41.18 ? 124 TRP B CG  1 
ATOM   2332 C  CD1 . TRP B 1 123 ? 9.959  20.840 67.559 1.00 38.97 ? 124 TRP B CD1 1 
ATOM   2333 C  CD2 . TRP B 1 123 ? 8.328  20.216 68.972 1.00 41.55 ? 124 TRP B CD2 1 
ATOM   2334 N  NE1 . TRP B 1 123 ? 8.809  20.686 66.837 1.00 33.52 ? 124 TRP B NE1 1 
ATOM   2335 C  CE2 . TRP B 1 123 ? 7.802  20.262 67.656 1.00 36.39 ? 124 TRP B CE2 1 
ATOM   2336 C  CE3 . TRP B 1 123 ? 7.498  19.740 70.008 1.00 39.75 ? 124 TRP B CE3 1 
ATOM   2337 C  CZ2 . TRP B 1 123 ? 6.471  19.905 67.359 1.00 34.84 ? 124 TRP B CZ2 1 
ATOM   2338 C  CZ3 . TRP B 1 123 ? 6.169  19.363 69.702 1.00 39.34 ? 124 TRP B CZ3 1 
ATOM   2339 C  CH2 . TRP B 1 123 ? 5.687  19.404 68.383 1.00 38.45 ? 124 TRP B CH2 1 
ATOM   2340 N  N   . ILE B 1 124 ? 12.030 22.366 72.543 1.00 28.32 ? 125 ILE B N   1 
ATOM   2341 C  CA  . ILE B 1 124 ? 12.256 22.638 73.969 1.00 32.40 ? 125 ILE B CA  1 
ATOM   2342 C  C   . ILE B 1 124 ? 11.744 24.020 74.454 1.00 44.37 ? 125 ILE B C   1 
ATOM   2343 O  O   . ILE B 1 124 ? 11.057 24.171 75.484 1.00 44.14 ? 125 ILE B O   1 
ATOM   2344 C  CB  . ILE B 1 124 ? 13.714 22.527 74.237 1.00 29.37 ? 125 ILE B CB  1 
ATOM   2345 C  CG1 . ILE B 1 124 ? 14.113 21.151 73.705 1.00 25.17 ? 125 ILE B CG1 1 
ATOM   2346 C  CG2 . ILE B 1 124 ? 14.038 22.806 75.722 1.00 27.46 ? 125 ILE B CG2 1 
ATOM   2347 C  CD1 . ILE B 1 124 ? 15.264 20.468 74.443 1.00 30.47 ? 125 ILE B CD1 1 
ATOM   2348 N  N   . HIS B 1 125 ? 12.013 25.009 73.650 1.00 27.67 ? 126 HIS B N   1 
ATOM   2349 C  CA  . HIS B 1 125 ? 11.672 26.346 73.982 1.00 35.03 ? 126 HIS B CA  1 
ATOM   2350 C  C   . HIS B 1 125 ? 10.163 26.643 74.101 1.00 43.00 ? 126 HIS B C   1 
ATOM   2351 O  O   . HIS B 1 125 ? 9.702  27.403 74.980 1.00 36.07 ? 126 HIS B O   1 
ATOM   2352 C  CB  . HIS B 1 125 ? 12.306 27.217 72.906 1.00 42.42 ? 126 HIS B CB  1 
ATOM   2353 C  CG  . HIS B 1 125 ? 12.181 28.677 73.166 1.00 46.50 ? 126 HIS B CG  1 
ATOM   2354 N  ND1 . HIS B 1 125 ? 13.226 29.430 73.688 1.00 47.36 ? 126 HIS B ND1 1 
ATOM   2355 C  CD2 . HIS B 1 125 ? 11.127 29.522 72.984 1.00 44.43 ? 126 HIS B CD2 1 
ATOM   2356 C  CE1 . HIS B 1 125 ? 12.809 30.687 73.796 1.00 47.55 ? 126 HIS B CE1 1 
ATOM   2357 N  NE2 . HIS B 1 125 ? 11.550 30.773 73.359 1.00 42.90 ? 126 HIS B NE2 1 
ATOM   2358 N  N   . GLN B 1 126 ? 9.395  26.128 73.154 1.00 40.76 ? 127 GLN B N   1 
ATOM   2359 C  CA  . GLN B 1 126 ? 7.963  26.267 73.236 1.00 43.96 ? 127 GLN B CA  1 
ATOM   2360 C  C   . GLN B 1 126 ? 7.429  25.348 74.369 1.00 43.44 ? 127 GLN B C   1 
ATOM   2361 O  O   . GLN B 1 126 ? 6.340  25.594 74.931 1.00 29.31 ? 127 GLN B O   1 
ATOM   2362 C  CB  . GLN B 1 126 ? 7.321  25.874 71.901 1.00 40.35 ? 127 GLN B CB  1 
ATOM   2363 C  CG  . GLN B 1 126 ? 7.343  26.997 70.869 1.00 55.38 ? 127 GLN B CG  1 
ATOM   2364 C  CD  . GLN B 1 126 ? 6.499  28.190 71.288 1.00 60.00 ? 127 GLN B CD  1 
ATOM   2365 O  OE1 . GLN B 1 126 ? 5.313  28.074 71.654 1.00 60.00 ? 127 GLN B OE1 1 
ATOM   2366 N  NE2 . GLN B 1 126 ? 7.104  29.362 71.175 1.00 60.00 ? 127 GLN B NE2 1 
ATOM   2367 N  N   . LEU B 1 127 ? 8.164  24.259 74.633 1.00 34.22 ? 128 LEU B N   1 
ATOM   2368 C  CA  . LEU B 1 127 ? 7.790  23.284 75.639 1.00 39.09 ? 128 LEU B CA  1 
ATOM   2369 C  C   . LEU B 1 127 ? 7.929  24.008 76.973 1.00 43.03 ? 128 LEU B C   1 
ATOM   2370 O  O   . LEU B 1 127 ? 6.919  24.298 77.645 1.00 37.43 ? 128 LEU B O   1 
ATOM   2371 C  CB  . LEU B 1 127 ? 8.654  21.989 75.540 1.00 35.21 ? 128 LEU B CB  1 
ATOM   2372 C  CG  . LEU B 1 127 ? 8.172  20.976 74.470 1.00 30.53 ? 128 LEU B CG  1 
ATOM   2373 C  CD1 . LEU B 1 127 ? 8.990  19.676 74.378 1.00 22.67 ? 128 LEU B CD1 1 
ATOM   2374 C  CD2 . LEU B 1 127 ? 6.758  20.615 74.754 1.00 30.48 ? 128 LEU B CD2 1 
ATOM   2375 N  N   . LYS B 1 128 ? 9.148  24.453 77.257 1.00 35.33 ? 129 LYS B N   1 
ATOM   2376 C  CA  . LYS B 1 128 ? 9.348  25.284 78.421 1.00 34.27 ? 129 LYS B CA  1 
ATOM   2377 C  C   . LYS B 1 128 ? 8.231  26.306 78.550 1.00 36.41 ? 129 LYS B C   1 
ATOM   2378 O  O   . LYS B 1 128 ? 7.604  26.459 79.585 1.00 32.51 ? 129 LYS B O   1 
ATOM   2379 C  CB  . LYS B 1 128 ? 10.603 26.041 78.270 1.00 23.62 ? 129 LYS B CB  1 
ATOM   2380 C  CG  . LYS B 1 128 ? 11.769 25.137 78.166 1.00 31.67 ? 129 LYS B CG  1 
ATOM   2381 C  CD  . LYS B 1 128 ? 11.984 24.323 79.409 1.00 29.26 ? 129 LYS B CD  1 
ATOM   2382 C  CE  . LYS B 1 128 ? 13.365 23.641 79.405 1.00 30.86 ? 129 LYS B CE  1 
ATOM   2383 N  NZ  . LYS B 1 128 ? 13.790 23.067 80.730 1.00 38.73 ? 129 LYS B NZ  1 
ATOM   2384 N  N   . ASN B 1 129 ? 8.044  27.106 77.538 1.00 33.39 ? 130 ASN B N   1 
ATOM   2385 C  CA  . ASN B 1 129 ? 7.019  28.100 77.670 1.00 38.00 ? 130 ASN B CA  1 
ATOM   2386 C  C   . ASN B 1 129 ? 5.701  27.487 78.112 1.00 57.94 ? 130 ASN B C   1 
ATOM   2387 O  O   . ASN B 1 129 ? 4.848  28.187 78.692 1.00 55.89 ? 130 ASN B O   1 
ATOM   2388 C  CB  . ASN B 1 129 ? 6.713  28.852 76.353 1.00 27.66 ? 130 ASN B CB  1 
ATOM   2389 C  CG  . ASN B 1 129 ? 7.773  29.791 75.963 1.00 32.97 ? 130 ASN B CG  1 
ATOM   2390 O  OD1 . ASN B 1 129 ? 8.797  29.896 76.643 1.00 42.12 ? 130 ASN B OD1 1 
ATOM   2391 N  ND2 . ASN B 1 129 ? 7.516  30.543 74.904 1.00 40.09 ? 130 ASN B ND2 1 
ATOM   2392 N  N   . VAL B 1 130 ? 5.388  26.290 77.627 1.00 50.04 ? 131 VAL B N   1 
ATOM   2393 C  CA  . VAL B 1 130 ? 4.019  25.839 77.841 1.00 46.90 ? 131 VAL B CA  1 
ATOM   2394 C  C   . VAL B 1 130 ? 3.770  25.330 79.252 1.00 33.79 ? 131 VAL B C   1 
ATOM   2395 O  O   . VAL B 1 130 ? 2.652  25.401 79.781 1.00 33.67 ? 131 VAL B O   1 
ATOM   2396 C  CB  . VAL B 1 130 ? 3.562  24.854 76.749 1.00 54.69 ? 131 VAL B CB  1 
ATOM   2397 C  CG1 . VAL B 1 130 ? 3.565  25.540 75.371 1.00 59.08 ? 131 VAL B CG1 1 
ATOM   2398 C  CG2 . VAL B 1 130 ? 4.433  23.590 76.751 1.00 50.74 ? 131 VAL B CG2 1 
ATOM   2399 N  N   . ILE B 1 131 ? 4.843  24.845 79.840 1.00 23.37 ? 132 ILE B N   1 
ATOM   2400 C  CA  . ILE B 1 131 ? 4.741  24.269 81.129 1.00 32.40 ? 132 ILE B CA  1 
ATOM   2401 C  C   . ILE B 1 131 ? 5.183  25.226 82.203 1.00 40.62 ? 132 ILE B C   1 
ATOM   2402 O  O   . ILE B 1 131 ? 5.375  24.820 83.335 1.00 38.00 ? 132 ILE B O   1 
ATOM   2403 C  CB  . ILE B 1 131 ? 5.665  23.059 81.154 1.00 31.92 ? 132 ILE B CB  1 
ATOM   2404 C  CG1 . ILE B 1 131 ? 7.100  23.491 80.991 1.00 24.11 ? 132 ILE B CG1 1 
ATOM   2405 C  CG2 . ILE B 1 131 ? 5.254  22.114 80.030 1.00 35.84 ? 132 ILE B CG2 1 
ATOM   2406 C  CD1 . ILE B 1 131 ? 8.082  22.323 81.069 1.00 17.83 ? 132 ILE B CD1 1 
ATOM   2407 N  N   . ARG B 1 132 ? 5.513  26.451 81.792 1.00 42.69 ? 133 ARG B N   1 
ATOM   2408 C  CA  . ARG B 1 132 ? 6.169  27.400 82.681 1.00 37.74 ? 133 ARG B CA  1 
ATOM   2409 C  C   . ARG B 1 132 ? 5.393  27.656 83.943 1.00 44.33 ? 133 ARG B C   1 
ATOM   2410 O  O   . ARG B 1 132 ? 5.972  27.836 84.987 1.00 46.05 ? 133 ARG B O   1 
ATOM   2411 C  CB  . ARG B 1 132 ? 6.622  28.697 82.018 1.00 22.30 ? 133 ARG B CB  1 
ATOM   2412 C  CG  . ARG B 1 132 ? 5.447  29.602 81.680 1.00 31.35 ? 133 ARG B CG  1 
ATOM   2413 C  CD  . ARG B 1 132 ? 5.908  30.810 80.867 1.00 36.53 ? 133 ARG B CD  1 
ATOM   2414 N  NE  . ARG B 1 132 ? 7.042  31.441 81.531 1.00 41.55 ? 133 ARG B NE  1 
ATOM   2415 C  CZ  . ARG B 1 132 ? 7.802  32.382 81.007 1.00 40.03 ? 133 ARG B CZ  1 
ATOM   2416 N  NH1 . ARG B 1 132 ? 7.611  32.808 79.778 1.00 35.99 ? 133 ARG B NH1 1 
ATOM   2417 N  NH2 . ARG B 1 132 ? 8.807  32.866 81.702 1.00 33.12 ? 133 ARG B NH2 1 
ATOM   2418 N  N   . TYR B 1 133 ? 4.083  27.580 83.881 1.00 33.29 ? 134 TYR B N   1 
ATOM   2419 C  CA  . TYR B 1 133 ? 3.318  27.810 85.068 1.00 33.03 ? 134 TYR B CA  1 
ATOM   2420 C  C   . TYR B 1 133 ? 2.759  26.553 85.731 1.00 46.66 ? 134 TYR B C   1 
ATOM   2421 O  O   . TYR B 1 133 ? 1.824  26.583 86.566 1.00 47.89 ? 134 TYR B O   1 
ATOM   2422 C  CB  . TYR B 1 133 ? 2.226  28.784 84.756 1.00 36.84 ? 134 TYR B CB  1 
ATOM   2423 C  CG  . TYR B 1 133 ? 2.706  30.017 84.041 1.00 41.58 ? 134 TYR B CG  1 
ATOM   2424 C  CD1 . TYR B 1 133 ? 3.752  30.790 84.539 1.00 40.60 ? 134 TYR B CD1 1 
ATOM   2425 C  CD2 . TYR B 1 133 ? 1.998  30.488 82.935 1.00 46.18 ? 134 TYR B CD2 1 
ATOM   2426 C  CE1 . TYR B 1 133 ? 4.092  31.988 83.923 1.00 38.71 ? 134 TYR B CE1 1 
ATOM   2427 C  CE2 . TYR B 1 133 ? 2.316  31.688 82.308 1.00 45.08 ? 134 TYR B CE2 1 
ATOM   2428 C  CZ  . TYR B 1 133 ? 3.389  32.420 82.799 1.00 47.71 ? 134 TYR B CZ  1 
ATOM   2429 O  OH  . TYR B 1 133 ? 3.783  33.530 82.116 1.00 46.65 ? 134 TYR B OH  1 
ATOM   2430 N  N   . ASN B 1 134 ? 3.329  25.435 85.344 1.00 44.49 ? 135 ASN B N   1 
ATOM   2431 C  CA  . ASN B 1 134 ? 2.924  24.192 85.933 1.00 45.94 ? 135 ASN B CA  1 
ATOM   2432 C  C   . ASN B 1 134 ? 3.270  24.300 87.394 1.00 51.70 ? 135 ASN B C   1 
ATOM   2433 O  O   . ASN B 1 134 ? 4.151  25.075 87.762 1.00 49.31 ? 135 ASN B O   1 
ATOM   2434 C  CB  . ASN B 1 134 ? 3.712  23.034 85.306 1.00 37.84 ? 135 ASN B CB  1 
ATOM   2435 C  CG  . ASN B 1 134 ? 3.129  22.584 83.995 1.00 40.16 ? 135 ASN B CG  1 
ATOM   2436 O  OD1 . ASN B 1 134 ? 2.252  23.249 83.411 1.00 37.21 ? 135 ASN B OD1 1 
ATOM   2437 N  ND2 . ASN B 1 134 ? 3.662  21.479 83.489 1.00 41.07 ? 135 ASN B ND2 1 
ATOM   2438 N  N   . SER B 1 135 ? 2.711  23.387 88.187 1.00 58.72 ? 136 SER B N   1 
ATOM   2439 C  CA  . SER B 1 135 ? 2.938  23.344 89.634 1.00 60.00 ? 136 SER B CA  1 
ATOM   2440 C  C   . SER B 1 135 ? 3.933  22.281 90.134 1.00 56.62 ? 136 SER B C   1 
ATOM   2441 O  O   . SER B 1 135 ? 4.406  22.322 91.287 1.00 55.40 ? 136 SER B O   1 
ATOM   2442 C  CB  . SER B 1 135 ? 1.609  23.284 90.387 1.00 60.00 ? 136 SER B CB  1 
ATOM   2443 O  OG  . SER B 1 135 ? 0.596  22.733 89.568 1.00 60.00 ? 136 SER B OG  1 
ATOM   2444 N  N   . ASP B 1 136 ? 4.290  21.358 89.257 1.00 46.48 ? 137 ASP B N   1 
ATOM   2445 C  CA  . ASP B 1 136 ? 5.272  20.367 89.641 1.00 42.35 ? 137 ASP B CA  1 
ATOM   2446 C  C   . ASP B 1 136 ? 6.503  20.357 88.785 1.00 37.90 ? 137 ASP B C   1 
ATOM   2447 O  O   . ASP B 1 136 ? 7.132  19.331 88.626 1.00 37.58 ? 137 ASP B O   1 
ATOM   2448 C  CB  . ASP B 1 136 ? 4.708  18.954 89.776 1.00 49.05 ? 137 ASP B CB  1 
ATOM   2449 C  CG  . ASP B 1 136 ? 5.770  17.950 90.258 1.00 60.00 ? 137 ASP B CG  1 
ATOM   2450 O  OD1 . ASP B 1 136 ? 6.924  18.338 90.477 1.00 60.00 ? 137 ASP B OD1 1 
ATOM   2451 O  OD2 . ASP B 1 136 ? 5.464  16.704 90.320 1.00 60.00 ? 137 ASP B OD2 1 
ATOM   2452 N  N   . LEU B 1 137 ? 6.889  21.495 88.236 1.00 47.50 ? 138 LEU B N   1 
ATOM   2453 C  CA  . LEU B 1 137 ? 8.109  21.444 87.454 1.00 50.77 ? 138 LEU B CA  1 
ATOM   2454 C  C   . LEU B 1 137 ? 9.151  21.053 88.481 1.00 42.77 ? 138 LEU B C   1 
ATOM   2455 O  O   . LEU B 1 137 ? 9.059  21.495 89.596 1.00 54.37 ? 138 LEU B O   1 
ATOM   2456 C  CB  . LEU B 1 137 ? 8.412  22.784 86.719 1.00 50.16 ? 138 LEU B CB  1 
ATOM   2457 C  CG  . LEU B 1 137 ? 7.243  23.329 85.872 1.00 50.57 ? 138 LEU B CG  1 
ATOM   2458 C  CD1 . LEU B 1 137 ? 7.531  24.692 85.254 1.00 40.41 ? 138 LEU B CD1 1 
ATOM   2459 C  CD2 . LEU B 1 137 ? 6.808  22.324 84.813 1.00 52.34 ? 138 LEU B CD2 1 
ATOM   2460 N  N   . VAL B 1 138 ? 10.014 20.096 88.160 1.00 39.48 ? 139 VAL B N   1 
ATOM   2461 C  CA  . VAL B 1 138 ? 11.052 19.588 89.059 1.00 39.60 ? 139 VAL B CA  1 
ATOM   2462 C  C   . VAL B 1 138 ? 12.357 20.298 88.760 1.00 52.47 ? 139 VAL B C   1 
ATOM   2463 O  O   . VAL B 1 138 ? 12.625 20.626 87.615 1.00 53.83 ? 139 VAL B O   1 
ATOM   2464 C  CB  . VAL B 1 138 ? 11.281 18.087 88.830 1.00 41.98 ? 139 VAL B CB  1 
ATOM   2465 C  CG1 . VAL B 1 138 ? 9.994  17.318 89.041 1.00 42.66 ? 139 VAL B CG1 1 
ATOM   2466 C  CG2 . VAL B 1 138 ? 11.773 17.849 87.410 1.00 42.09 ? 139 VAL B CG2 1 
ATOM   2467 N  N   . GLN B 1 139 ? 13.199 20.488 89.764 1.00 50.53 ? 140 GLN B N   1 
ATOM   2468 C  CA  . GLN B 1 139 ? 14.458 21.179 89.526 1.00 51.00 ? 140 GLN B CA  1 
ATOM   2469 C  C   . GLN B 1 139 ? 15.650 20.227 89.626 1.00 57.56 ? 140 GLN B C   1 
ATOM   2470 O  O   . GLN B 1 139 ? 16.808 20.651 89.756 1.00 57.31 ? 140 GLN B O   1 
ATOM   2471 C  CB  . GLN B 1 139 ? 14.604 22.397 90.444 1.00 54.10 ? 140 GLN B CB  1 
ATOM   2472 C  CG  . GLN B 1 139 ? 13.382 23.342 90.419 1.00 60.00 ? 140 GLN B CG  1 
ATOM   2473 C  CD  . GLN B 1 139 ? 13.693 24.790 90.873 1.00 60.00 ? 140 GLN B CD  1 
ATOM   2474 O  OE1 . GLN B 1 139 ? 14.819 25.330 90.639 1.00 60.00 ? 140 GLN B OE1 1 
ATOM   2475 N  NE2 . GLN B 1 139 ? 12.679 25.453 91.477 1.00 60.00 ? 140 GLN B NE2 1 
ATOM   2476 N  N   . LYS B 1 140 ? 15.328 18.930 89.581 1.00 48.76 ? 141 LYS B N   1 
ATOM   2477 C  CA  . LYS B 1 140 ? 16.296 17.838 89.542 1.00 48.95 ? 141 LYS B CA  1 
ATOM   2478 C  C   . LYS B 1 140 ? 15.890 16.973 88.291 1.00 51.86 ? 141 LYS B C   1 
ATOM   2479 O  O   . LYS B 1 140 ? 14.707 16.922 87.895 1.00 45.44 ? 141 LYS B O   1 
ATOM   2480 C  CB  . LYS B 1 140 ? 16.383 17.081 90.918 1.00 45.91 ? 141 LYS B CB  1 
ATOM   2481 C  CG  . LYS B 1 140 ? 15.135 17.206 91.833 1.00 44.79 ? 141 LYS B CG  1 
ATOM   2482 C  CD  . LYS B 1 140 ? 14.301 15.941 92.029 0.00 54.22 ? 141 LYS B CD  1 
ATOM   2483 C  CE  . LYS B 1 140 ? 12.809 16.248 92.252 0.00 58.87 ? 141 LYS B CE  1 
ATOM   2484 N  NZ  . LYS B 1 140 ? 12.047 15.089 92.738 0.00 60.00 ? 141 LYS B NZ  1 
ATOM   2485 N  N   . TYR B 1 141 ? 16.850 16.332 87.641 1.00 43.21 ? 142 TYR B N   1 
ATOM   2486 C  CA  . TYR B 1 141 ? 16.494 15.582 86.471 1.00 45.56 ? 142 TYR B CA  1 
ATOM   2487 C  C   . TYR B 1 141 ? 17.607 14.690 85.989 1.00 51.75 ? 142 TYR B C   1 
ATOM   2488 O  O   . TYR B 1 141 ? 18.760 14.847 86.367 1.00 57.99 ? 142 TYR B O   1 
ATOM   2489 C  CB  . TYR B 1 141 ? 16.090 16.573 85.360 1.00 59.20 ? 142 TYR B CB  1 
ATOM   2490 C  CG  . TYR B 1 141 ? 17.215 16.962 84.421 1.00 60.00 ? 142 TYR B CG  1 
ATOM   2491 C  CD1 . TYR B 1 141 ? 18.312 17.685 84.877 1.00 60.00 ? 142 TYR B CD1 1 
ATOM   2492 C  CD2 . TYR B 1 141 ? 17.187 16.595 83.075 1.00 55.71 ? 142 TYR B CD2 1 
ATOM   2493 C  CE1 . TYR B 1 141 ? 19.365 18.003 84.019 1.00 59.21 ? 142 TYR B CE1 1 
ATOM   2494 C  CE2 . TYR B 1 141 ? 18.232 16.895 82.205 1.00 49.95 ? 142 TYR B CE2 1 
ATOM   2495 C  CZ  . TYR B 1 141 ? 19.331 17.596 82.684 1.00 60.00 ? 142 TYR B CZ  1 
ATOM   2496 O  OH  . TYR B 1 141 ? 20.334 17.937 81.822 1.00 60.00 ? 142 TYR B OH  1 
ATOM   2497 N  N   . HIS B 1 142 ? 17.282 13.775 85.095 1.00 40.78 ? 143 HIS B N   1 
ATOM   2498 C  CA  . HIS B 1 142 ? 18.316 12.909 84.575 1.00 43.63 ? 143 HIS B CA  1 
ATOM   2499 C  C   . HIS B 1 142 ? 18.723 13.294 83.194 1.00 53.00 ? 143 HIS B C   1 
ATOM   2500 O  O   . HIS B 1 142 ? 17.996 13.133 82.239 1.00 59.34 ? 143 HIS B O   1 
ATOM   2501 C  CB  . HIS B 1 142 ? 17.845 11.450 84.573 1.00 49.71 ? 143 HIS B CB  1 
ATOM   2502 C  CG  . HIS B 1 142 ? 17.313 10.993 85.895 1.00 52.85 ? 143 HIS B CG  1 
ATOM   2503 N  ND1 . HIS B 1 142 ? 18.103 10.325 86.816 1.00 51.58 ? 143 HIS B ND1 1 
ATOM   2504 C  CD2 . HIS B 1 142 ? 16.098 11.171 86.474 1.00 44.63 ? 143 HIS B CD2 1 
ATOM   2505 C  CE1 . HIS B 1 142 ? 17.381 10.089 87.891 1.00 52.10 ? 143 HIS B CE1 1 
ATOM   2506 N  NE2 . HIS B 1 142 ? 16.165 10.588 87.711 1.00 49.34 ? 143 HIS B NE2 1 
ATOM   2507 N  N   . PRO B 1 143 ? 19.945 13.657 83.050 1.00 52.55 ? 144 PRO B N   1 
ATOM   2508 C  CA  . PRO B 1 143 ? 20.425 13.994 81.732 1.00 54.76 ? 144 PRO B CA  1 
ATOM   2509 C  C   . PRO B 1 143 ? 20.514 12.782 80.775 1.00 52.74 ? 144 PRO B C   1 
ATOM   2510 O  O   . PRO B 1 143 ? 20.638 12.970 79.571 1.00 51.28 ? 144 PRO B O   1 
ATOM   2511 C  CB  . PRO B 1 143 ? 21.785 14.663 81.999 1.00 59.66 ? 144 PRO B CB  1 
ATOM   2512 C  CG  . PRO B 1 143 ? 21.987 14.597 83.507 1.00 60.00 ? 144 PRO B CG  1 
ATOM   2513 C  CD  . PRO B 1 143 ? 20.618 14.403 84.106 1.00 55.48 ? 144 PRO B CD  1 
ATOM   2514 N  N   . CYS B 1 144 ? 20.466 11.545 81.264 1.00 45.07 ? 145 CYS B N   1 
ATOM   2515 C  CA  . CYS B 1 144 ? 20.505 10.456 80.315 1.00 51.54 ? 145 CYS B CA  1 
ATOM   2516 C  C   . CYS B 1 144 ? 19.254 9.645  80.219 1.00 60.00 ? 145 CYS B C   1 
ATOM   2517 O  O   . CYS B 1 144 ? 18.213 9.943  80.846 1.00 60.00 ? 145 CYS B O   1 
ATOM   2518 C  CB  . CYS B 1 144 ? 21.661 9.516  80.530 1.00 52.68 ? 145 CYS B CB  1 
ATOM   2519 S  SG  . CYS B 1 144 ? 23.081 10.494 80.938 1.00 58.78 ? 145 CYS B SG  1 
ATOM   2520 N  N   . PHE B 1 145 ? 19.431 8.543  79.490 1.00 50.82 ? 146 PHE B N   1 
ATOM   2521 C  CA  . PHE B 1 145 ? 18.350 7.638  79.208 1.00 52.12 ? 146 PHE B CA  1 
ATOM   2522 C  C   . PHE B 1 145 ? 18.176 6.655  80.285 1.00 56.05 ? 146 PHE B C   1 
ATOM   2523 O  O   . PHE B 1 145 ? 19.134 6.185  80.853 1.00 59.17 ? 146 PHE B O   1 
ATOM   2524 C  CB  . PHE B 1 145 ? 18.611 6.834  77.942 1.00 57.37 ? 146 PHE B CB  1 
ATOM   2525 C  CG  . PHE B 1 145 ? 18.601 7.667  76.698 1.00 59.28 ? 146 PHE B CG  1 
ATOM   2526 C  CD1 . PHE B 1 145 ? 17.404 8.182  76.217 1.00 59.19 ? 146 PHE B CD1 1 
ATOM   2527 C  CD2 . PHE B 1 145 ? 19.788 8.018  76.053 1.00 60.00 ? 146 PHE B CD2 1 
ATOM   2528 C  CE1 . PHE B 1 145 ? 17.386 9.000  75.083 1.00 60.00 ? 146 PHE B CE1 1 
ATOM   2529 C  CE2 . PHE B 1 145 ? 19.773 8.815  74.908 1.00 60.00 ? 146 PHE B CE2 1 
ATOM   2530 C  CZ  . PHE B 1 145 ? 18.573 9.338  74.435 1.00 59.36 ? 146 PHE B CZ  1 
ATOM   2531 N  N   . TRP B 1 146 ? 16.938 6.270  80.485 1.00 50.64 ? 147 TRP B N   1 
ATOM   2532 C  CA  . TRP B 1 146 ? 16.642 5.194  81.362 1.00 49.61 ? 147 TRP B CA  1 
ATOM   2533 C  C   . TRP B 1 146 ? 16.636 4.038  80.396 1.00 42.78 ? 147 TRP B C   1 
ATOM   2534 O  O   . TRP B 1 146 ? 16.347 4.249  79.233 1.00 48.66 ? 147 TRP B O   1 
ATOM   2535 C  CB  . TRP B 1 146 ? 15.290 5.444  82.032 1.00 53.88 ? 147 TRP B CB  1 
ATOM   2536 C  CG  . TRP B 1 146 ? 14.924 4.382  83.043 1.00 60.00 ? 147 TRP B CG  1 
ATOM   2537 C  CD1 . TRP B 1 146 ? 14.980 4.430  84.442 1.00 60.00 ? 147 TRP B CD1 1 
ATOM   2538 C  CD2 . TRP B 1 146 ? 14.465 3.120  82.714 1.00 59.47 ? 147 TRP B CD2 1 
ATOM   2539 N  NE1 . TRP B 1 146 ? 14.543 3.249  84.979 1.00 60.00 ? 147 TRP B NE1 1 
ATOM   2540 C  CE2 . TRP B 1 146 ? 14.267 2.409  83.936 1.00 60.00 ? 147 TRP B CE2 1 
ATOM   2541 C  CE3 . TRP B 1 146 ? 14.308 2.467  81.502 1.00 60.00 ? 147 TRP B CE3 1 
ATOM   2542 C  CZ2 . TRP B 1 146 ? 13.913 1.082  83.956 1.00 60.00 ? 147 TRP B CZ2 1 
ATOM   2543 C  CZ3 . TRP B 1 146 ? 13.977 1.148  81.508 1.00 60.00 ? 147 TRP B CZ3 1 
ATOM   2544 C  CH2 . TRP B 1 146 ? 13.786 0.453  82.731 1.00 60.00 ? 147 TRP B CH2 1 
ATOM   2545 N  N   . ILE B 1 147 ? 17.180 2.900  80.773 1.00 49.91 ? 148 ILE B N   1 
ATOM   2546 C  CA  . ILE B 1 147 ? 17.352 1.828  79.799 1.00 49.66 ? 148 ILE B CA  1 
ATOM   2547 C  C   . ILE B 1 147 ? 17.868 0.510  80.342 1.00 60.00 ? 148 ILE B C   1 
ATOM   2548 O  O   . ILE B 1 147 ? 18.675 0.466  81.276 1.00 60.00 ? 148 ILE B O   1 
ATOM   2549 C  CB  . ILE B 1 147 ? 18.297 2.245  78.708 1.00 50.08 ? 148 ILE B CB  1 
ATOM   2550 C  CG1 . ILE B 1 147 ? 18.694 1.035  77.891 1.00 54.25 ? 148 ILE B CG1 1 
ATOM   2551 C  CG2 . ILE B 1 147 ? 19.527 2.911  79.283 1.00 45.06 ? 148 ILE B CG2 1 
ATOM   2552 C  CD1 . ILE B 1 147 ? 17.593 0.593  76.924 1.00 59.96 ? 148 ILE B CD1 1 
ATOM   2553 N  N   . ASP B 1 148 ? 17.460 -0.562 79.675 1.00 59.92 ? 149 ASP B N   1 
ATOM   2554 C  CA  . ASP B 1 148 ? 17.790 -1.931 80.049 1.00 58.91 ? 149 ASP B CA  1 
ATOM   2555 C  C   . ASP B 1 148 ? 17.582 -2.193 81.503 1.00 60.00 ? 149 ASP B C   1 
ATOM   2556 O  O   . ASP B 1 148 ? 18.102 -3.192 82.000 1.00 60.00 ? 149 ASP B O   1 
ATOM   2557 C  CB  . ASP B 1 148 ? 19.238 -2.284 79.751 1.00 60.00 ? 149 ASP B CB  1 
ATOM   2558 C  CG  . ASP B 1 148 ? 19.524 -2.361 78.288 1.00 60.00 ? 149 ASP B CG  1 
ATOM   2559 O  OD1 . ASP B 1 148 ? 18.534 -2.737 77.510 1.00 60.00 ? 149 ASP B OD1 1 
ATOM   2560 O  OD2 . ASP B 1 148 ? 20.667 -1.989 77.903 1.00 60.00 ? 149 ASP B OD2 1 
ATOM   2561 N  N   . GLY B 1 149 ? 16.941 -1.258 82.209 1.00 60.00 ? 150 GLY B N   1 
ATOM   2562 C  CA  . GLY B 1 149 ? 16.724 -1.423 83.635 1.00 54.03 ? 150 GLY B CA  1 
ATOM   2563 C  C   . GLY B 1 149 ? 16.971 -0.146 84.426 1.00 60.00 ? 150 GLY B C   1 
ATOM   2564 O  O   . GLY B 1 149 ? 16.194 0.160  85.351 1.00 60.00 ? 150 GLY B O   1 
ATOM   2565 N  N   . GLN B 1 150 ? 18.012 0.631  84.074 1.00 56.65 ? 151 GLN B N   1 
ATOM   2566 C  CA  . GLN B 1 150 ? 18.341 1.784  84.902 1.00 56.94 ? 151 GLN B CA  1 
ATOM   2567 C  C   . GLN B 1 150 ? 18.733 3.123  84.256 1.00 60.00 ? 151 GLN B C   1 
ATOM   2568 O  O   . GLN B 1 150 ? 19.330 3.161  83.185 1.00 60.00 ? 151 GLN B O   1 
ATOM   2569 C  CB  . GLN B 1 150 ? 19.389 1.383  85.946 0.00 58.06 ? 151 GLN B CB  1 
ATOM   2570 C  CG  . GLN B 1 150 ? 20.625 0.689  85.368 0.00 58.45 ? 151 GLN B CG  1 
ATOM   2571 C  CD  . GLN B 1 150 ? 21.627 0.310  86.444 0.00 60.00 ? 151 GLN B CD  1 
ATOM   2572 O  OE1 . GLN B 1 150 ? 22.515 1.096  86.784 0.00 55.65 ? 151 GLN B OE1 1 
ATOM   2573 N  NE2 . GLN B 1 150 ? 21.465 -0.885 87.000 0.00 52.29 ? 151 GLN B NE2 1 
ATOM   2574 N  N   . TYR B 1 151 ? 18.519 4.211  85.008 1.00 55.65 ? 152 TYR B N   1 
ATOM   2575 C  CA  . TYR B 1 151 ? 18.931 5.550  84.599 1.00 55.21 ? 152 TYR B CA  1 
ATOM   2576 C  C   . TYR B 1 151 ? 20.410 5.756  84.448 1.00 60.00 ? 152 TYR B C   1 
ATOM   2577 O  O   . TYR B 1 151 ? 21.043 6.433  85.270 1.00 60.00 ? 152 TYR B O   1 
ATOM   2578 C  CB  . TYR B 1 151 ? 18.456 6.593  85.582 1.00 57.02 ? 152 TYR B CB  1 
ATOM   2579 C  CG  . TYR B 1 151 ? 17.120 7.095  85.243 1.00 54.79 ? 152 TYR B CG  1 
ATOM   2580 C  CD1 . TYR B 1 151 ? 16.881 7.691  84.004 1.00 55.30 ? 152 TYR B CD1 1 
ATOM   2581 C  CD2 . TYR B 1 151 ? 16.064 6.886  86.119 1.00 52.34 ? 152 TYR B CD2 1 
ATOM   2582 C  CE1 . TYR B 1 151 ? 15.606 8.128  83.670 1.00 56.01 ? 152 TYR B CE1 1 
ATOM   2583 C  CE2 . TYR B 1 151 ? 14.797 7.360  85.823 1.00 53.72 ? 152 TYR B CE2 1 
ATOM   2584 C  CZ  . TYR B 1 151 ? 14.565 7.942  84.582 1.00 59.04 ? 152 TYR B CZ  1 
ATOM   2585 O  OH  . TYR B 1 151 ? 13.313 8.424  84.320 1.00 60.00 ? 152 TYR B OH  1 
ATOM   2586 N  N   . LEU B 1 152 ? 20.901 5.366  83.291 1.00 56.99 ? 153 LEU B N   1 
ATOM   2587 C  CA  . LEU B 1 152 ? 22.289 5.527  82.908 1.00 55.78 ? 153 LEU B CA  1 
ATOM   2588 C  C   . LEU B 1 152 ? 23.038 6.610  83.604 1.00 60.00 ? 153 LEU B C   1 
ATOM   2589 O  O   . LEU B 1 152 ? 24.247 6.651  83.450 1.00 60.00 ? 153 LEU B O   1 
ATOM   2590 C  CB  . LEU B 1 152 ? 22.387 5.867  81.427 1.00 54.45 ? 153 LEU B CB  1 
ATOM   2591 C  CG  . LEU B 1 152 ? 21.695 4.809  80.584 1.00 60.00 ? 153 LEU B CG  1 
ATOM   2592 C  CD1 . LEU B 1 152 ? 21.183 5.374  79.233 1.00 60.00 ? 153 LEU B CD1 1 
ATOM   2593 C  CD2 . LEU B 1 152 ? 22.636 3.598  80.401 1.00 60.00 ? 153 LEU B CD2 1 
ATOM   2594 N  N   . CYS B 1 153 ? 22.348 7.609  84.154 1.00 55.29 ? 154 CYS B N   1 
ATOM   2595 C  CA  . CYS B 1 153 ? 23.075 8.717  84.734 1.00 56.65 ? 154 CYS B CA  1 
ATOM   2596 C  C   . CYS B 1 153 ? 23.316 8.490  86.207 1.00 60.00 ? 154 CYS B C   1 
ATOM   2597 O  O   . CYS B 1 153 ? 24.445 8.339  86.677 1.00 60.00 ? 154 CYS B O   1 
ATOM   2598 C  CB  . CYS B 1 153 ? 22.384 10.059 84.478 1.00 55.81 ? 154 CYS B CB  1 
ATOM   2599 S  SG  . CYS B 1 153 ? 20.611 9.866  84.561 1.00 60.00 ? 154 CYS B SG  1 
ATOM   2600 N  N   . CYS B 1 154 ? 22.252 8.429  86.946 1.00 54.59 ? 155 CYS B N   1 
ATOM   2601 C  CA  . CYS B 1 154 ? 22.423 8.246  88.345 1.00 55.06 ? 155 CYS B CA  1 
ATOM   2602 C  C   . CYS B 1 154 ? 22.501 6.736  88.619 1.00 60.00 ? 155 CYS B C   1 
ATOM   2603 O  O   . CYS B 1 154 ? 22.515 6.306  89.774 1.00 60.00 ? 155 CYS B O   1 
ATOM   2604 C  CB  . CYS B 1 154 ? 21.154 8.763  88.943 1.00 56.08 ? 155 CYS B CB  1 
ATOM   2605 S  SG  . CYS B 1 154 ? 19.907 8.189  87.776 1.00 60.00 ? 155 CYS B SG  1 
ATOM   2606 N  N   . SER B 1 155 ? 22.437 5.924  87.575 1.00 56.29 ? 156 SER B N   1 
ATOM   2607 C  CA  . SER B 1 155 ? 22.419 4.477  87.785 1.00 53.91 ? 156 SER B CA  1 
ATOM   2608 C  C   . SER B 1 155 ? 21.202 3.969  88.600 1.00 52.66 ? 156 SER B C   1 
ATOM   2609 O  O   . SER B 1 155 ? 21.046 2.775  88.808 1.00 44.07 ? 156 SER B O   1 
ATOM   2610 C  CB  . SER B 1 155 ? 23.721 3.994  88.402 1.00 50.46 ? 156 SER B CB  1 
ATOM   2611 O  OG  . SER B 1 155 ? 24.228 2.871  87.690 1.00 60.00 ? 156 SER B OG  1 
ATOM   2612 N  N   . GLN B 1 156 ? 20.292 4.858  89.001 1.00 51.90 ? 157 GLN B N   1 
ATOM   2613 C  CA  . GLN B 1 156 ? 19.092 4.412  89.745 1.00 51.75 ? 157 GLN B CA  1 
ATOM   2614 C  C   . GLN B 1 156 ? 18.268 3.277  89.088 1.00 60.00 ? 157 GLN B C   1 
ATOM   2615 O  O   . GLN B 1 156 ? 18.760 2.664  88.154 1.00 60.00 ? 157 GLN B O   1 
ATOM   2616 C  CB  . GLN B 1 156 ? 18.238 5.603  90.163 1.00 55.22 ? 157 GLN B CB  1 
ATOM   2617 C  CG  . GLN B 1 156 ? 19.045 6.613  90.997 1.00 59.63 ? 157 GLN B CG  1 
ATOM   2618 C  CD  . GLN B 1 156 ? 18.177 7.723  91.577 1.00 60.00 ? 157 GLN B CD  1 
ATOM   2619 O  OE1 . GLN B 1 156 ? 17.405 7.515  92.544 1.00 60.00 ? 157 GLN B OE1 1 
ATOM   2620 N  NE2 . GLN B 1 156 ? 18.252 8.919  90.944 1.00 60.00 ? 157 GLN B NE2 1 
ATOM   2621 N  N   . THR B 1 157 ? 17.067 2.918  89.598 1.00 59.90 ? 158 THR B N   1 
ATOM   2622 C  CA  . THR B 1 157 ? 16.341 1.766  89.016 1.00 56.04 ? 158 THR B CA  1 
ATOM   2623 C  C   . THR B 1 157 ? 14.866 1.939  88.861 1.00 60.00 ? 158 THR B C   1 
ATOM   2624 O  O   . THR B 1 157 ? 14.085 0.980  88.918 1.00 60.00 ? 158 THR B O   1 
ATOM   2625 C  CB  . THR B 1 157 ? 16.469 0.465  89.826 1.00 60.00 ? 158 THR B CB  1 
ATOM   2626 O  OG1 . THR B 1 157 ? 16.140 0.712  91.201 1.00 60.00 ? 158 THR B OG1 1 
ATOM   2627 C  CG2 . THR B 1 157 ? 17.859 -0.162 89.657 1.00 60.00 ? 158 THR B CG2 1 
ATOM   2628 N  N   . ALA B 1 158 ? 14.456 3.138  88.620 1.00 59.66 ? 159 ALA B N   1 
ATOM   2629 C  CA  . ALA B 1 158 ? 13.067 3.310  88.442 1.00 54.09 ? 159 ALA B CA  1 
ATOM   2630 C  C   . ALA B 1 158 ? 12.873 4.468  87.520 1.00 60.00 ? 159 ALA B C   1 
ATOM   2631 O  O   . ALA B 1 158 ? 13.417 5.547  87.762 1.00 60.00 ? 159 ALA B O   1 
ATOM   2632 C  CB  . ALA B 1 158 ? 12.438 3.586  89.777 1.00 50.97 ? 159 ALA B CB  1 
ATOM   2633 N  N   . LYS B 1 159 ? 12.118 4.238  86.457 1.00 60.00 ? 160 LYS B N   1 
ATOM   2634 C  CA  . LYS B 1 159 ? 11.786 5.301  85.522 1.00 60.00 ? 160 LYS B CA  1 
ATOM   2635 C  C   . LYS B 1 159 ? 11.414 6.586  86.289 1.00 60.00 ? 160 LYS B C   1 
ATOM   2636 O  O   . LYS B 1 159 ? 11.774 7.713  85.915 1.00 60.00 ? 160 LYS B O   1 
ATOM   2637 C  CB  . LYS B 1 159 ? 10.620 4.872  84.619 1.00 60.00 ? 160 LYS B CB  1 
ATOM   2638 C  CG  . LYS B 1 159 ? 11.031 4.034  83.395 1.00 60.00 ? 160 LYS B CG  1 
ATOM   2639 C  CD  . LYS B 1 159 ? 9.821  3.827  82.424 1.00 60.00 ? 160 LYS B CD  1 
ATOM   2640 C  CE  . LYS B 1 159 ? 9.623  2.355  81.966 1.00 60.00 ? 160 LYS B CE  1 
ATOM   2641 N  NZ  . LYS B 1 159 ? 8.494  2.192  81.031 0.00 60.00 ? 160 LYS B NZ  1 
ATOM   2642 N  N   . ASN B 1 160 ? 10.742 6.421  87.409 1.00 59.01 ? 161 ASN B N   1 
ATOM   2643 C  CA  . ASN B 1 160 ? 10.309 7.594  88.150 1.00 60.00 ? 161 ASN B CA  1 
ATOM   2644 C  C   . ASN B 1 160 ? 11.288 8.052  89.265 1.00 60.00 ? 161 ASN B C   1 
ATOM   2645 O  O   . ASN B 1 160 ? 10.963 8.929  90.069 1.00 60.00 ? 161 ASN B O   1 
ATOM   2646 C  CB  . ASN B 1 160 ? 8.836  7.444  88.628 1.00 60.00 ? 161 ASN B CB  1 
ATOM   2647 C  CG  . ASN B 1 160 ? 7.894  8.411  87.926 0.00 60.00 ? 161 ASN B CG  1 
ATOM   2648 O  OD1 . ASN B 1 160 ? 8.111  8.741  86.766 0.00 54.58 ? 161 ASN B OD1 1 
ATOM   2649 N  ND2 . ASN B 1 160 ? 6.854  8.811  88.634 0.00 52.21 ? 161 ASN B ND2 1 
ATOM   2650 N  N   . ALA B 1 161 ? 12.515 7.528  89.257 1.00 52.50 ? 162 ALA B N   1 
ATOM   2651 C  CA  . ALA B 1 161 ? 13.538 7.919  90.246 1.00 56.10 ? 162 ALA B CA  1 
ATOM   2652 C  C   . ALA B 1 161 ? 13.818 9.406  90.180 1.00 60.00 ? 162 ALA B C   1 
ATOM   2653 O  O   . ALA B 1 161 ? 13.941 9.961  89.080 1.00 60.00 ? 162 ALA B O   1 
ATOM   2654 C  CB  . ALA B 1 161 ? 14.847 7.152  89.992 1.00 59.77 ? 162 ALA B CB  1 
ATOM   2655 N  N   . MET B 1 162 ? 14.062 10.019 91.334 1.00 58.22 ? 163 MET B N   1 
ATOM   2656 C  CA  . MET B 1 162 ? 14.333 11.438 91.353 1.00 56.95 ? 163 MET B CA  1 
ATOM   2657 C  C   . MET B 1 162 ? 15.524 11.877 90.467 1.00 59.22 ? 163 MET B C   1 
ATOM   2658 O  O   . MET B 1 162 ? 16.479 11.130 90.296 1.00 58.97 ? 163 MET B O   1 
ATOM   2659 C  CB  . MET B 1 162 ? 14.469 11.921 92.802 1.00 60.00 ? 163 MET B CB  1 
ATOM   2660 C  CG  . MET B 1 162 ? 15.360 13.171 92.960 1.00 60.00 ? 163 MET B CG  1 
ATOM   2661 S  SD  . MET B 1 162 ? 15.645 13.768 94.695 1.00 60.00 ? 163 MET B SD  1 
ATOM   2662 C  CE  . MET B 1 162 ? 13.958 14.519 95.003 1.00 60.00 ? 163 MET B CE  1 
ATOM   2663 N  N   . GLY B 1 163 ? 15.442 13.078 89.885 1.00 50.39 ? 164 GLY B N   1 
ATOM   2664 C  CA  . GLY B 1 163 ? 16.532 13.587 89.069 1.00 51.52 ? 164 GLY B CA  1 
ATOM   2665 C  C   . GLY B 1 163 ? 17.856 13.557 89.829 1.00 59.36 ? 164 GLY B C   1 
ATOM   2666 O  O   . GLY B 1 163 ? 17.999 14.113 90.920 1.00 60.00 ? 164 GLY B O   1 
ATOM   2667 N  N   . CYS B 1 164 ? 18.831 12.896 89.243 1.00 57.44 ? 165 CYS B N   1 
ATOM   2668 C  CA  . CYS B 1 164 ? 20.134 12.825 89.834 1.00 55.09 ? 165 CYS B CA  1 
ATOM   2669 C  C   . CYS B 1 164 ? 20.903 14.086 89.511 1.00 54.14 ? 165 CYS B C   1 
ATOM   2670 O  O   . CYS B 1 164 ? 22.122 14.114 89.610 1.00 60.00 ? 165 CYS B O   1 
ATOM   2671 C  CB  . CYS B 1 164 ? 20.891 11.681 89.193 1.00 58.08 ? 165 CYS B CB  1 
ATOM   2672 S  SG  . CYS B 1 164 ? 21.345 12.097 87.485 1.00 60.00 ? 165 CYS B SG  1 
ATOM   2673 N  N   . GLN B 1 165 ? 20.228 15.097 88.996 1.00 52.91 ? 166 GLN B N   1 
ATOM   2674 C  CA  . GLN B 1 165 ? 20.926 16.310 88.524 1.00 55.30 ? 166 GLN B CA  1 
ATOM   2675 C  C   . GLN B 1 165 ? 20.135 17.606 88.589 1.00 60.00 ? 166 GLN B C   1 
ATOM   2676 O  O   . GLN B 1 165 ? 18.891 17.642 88.615 1.00 59.91 ? 166 GLN B O   1 
ATOM   2677 C  CB  . GLN B 1 165 ? 21.514 16.154 87.122 1.00 53.04 ? 166 GLN B CB  1 
ATOM   2678 C  CG  . GLN B 1 165 ? 22.897 16.777 86.980 1.00 52.10 ? 166 GLN B CG  1 
ATOM   2679 C  CD  . GLN B 1 165 ? 24.020 15.793 87.482 1.00 60.00 ? 166 GLN B CD  1 
ATOM   2680 O  OE1 . GLN B 1 165 ? 24.454 14.827 86.762 1.00 60.00 ? 166 GLN B OE1 1 
ATOM   2681 N  NE2 . GLN B 1 165 ? 24.459 16.002 88.758 1.00 60.00 ? 166 GLN B NE2 1 
ATOM   2682 N  N   . ILE B 1 166 ? 20.852 18.705 88.631 1.00 52.86 ? 167 ILE B N   1 
ATOM   2683 C  CA  . ILE B 1 166 ? 20.098 19.897 88.837 1.00 55.86 ? 167 ILE B CA  1 
ATOM   2684 C  C   . ILE B 1 166 ? 19.697 20.706 87.668 1.00 60.00 ? 167 ILE B C   1 
ATOM   2685 O  O   . ILE B 1 166 ? 20.471 20.890 86.720 1.00 60.00 ? 167 ILE B O   1 
ATOM   2686 C  CB  . ILE B 1 166 ? 20.440 20.715 90.105 1.00 60.00 ? 167 ILE B CB  1 
ATOM   2687 C  CG1 . ILE B 1 166 ? 20.559 22.230 89.814 1.00 60.00 ? 167 ILE B CG1 1 
ATOM   2688 C  CG2 . ILE B 1 166 ? 21.653 20.142 90.820 1.00 60.00 ? 167 ILE B CG2 1 
ATOM   2689 C  CD1 . ILE B 1 166 ? 19.626 23.124 90.662 1.00 60.00 ? 167 ILE B CD1 1 
ATOM   2690 N  N   . LEU B 1 167 ? 18.444 21.147 87.735 1.00 60.00 ? 168 LEU B N   1 
ATOM   2691 C  CA  . LEU B 1 167 ? 17.846 21.986 86.732 1.00 60.00 ? 168 LEU B CA  1 
ATOM   2692 C  C   . LEU B 1 167 ? 17.227 23.137 87.502 1.00 57.47 ? 168 LEU B C   1 
ATOM   2693 O  O   . LEU B 1 167 ? 16.467 22.931 88.464 1.00 47.12 ? 168 LEU B O   1 
ATOM   2694 C  CB  . LEU B 1 167 ? 16.795 21.214 85.869 1.00 60.00 ? 168 LEU B CB  1 
ATOM   2695 C  CG  . LEU B 1 167 ? 16.086 22.010 84.744 1.00 60.00 ? 168 LEU B CG  1 
ATOM   2696 C  CD1 . LEU B 1 167 ? 17.038 22.506 83.633 1.00 53.50 ? 168 LEU B CD1 1 
ATOM   2697 C  CD2 . LEU B 1 167 ? 14.910 21.217 84.176 1.00 51.41 ? 168 LEU B CD2 1 
ATOM   2698 N  N   . GLU B 1 168 ? 17.650 24.329 87.082 1.00 53.62 ? 169 GLU B N   1 
ATOM   2699 C  CA  . GLU B 1 168 ? 17.246 25.620 87.615 1.00 59.80 ? 169 GLU B CA  1 
ATOM   2700 C  C   . GLU B 1 168 ? 16.475 26.367 86.521 1.00 60.00 ? 169 GLU B C   1 
ATOM   2701 O  O   . GLU B 1 168 ? 15.525 27.134 86.781 1.00 54.41 ? 169 GLU B O   1 
ATOM   2702 C  CB  . GLU B 1 168 ? 18.526 26.452 87.776 1.00 60.00 ? 169 GLU B CB  1 
ATOM   2703 C  CG  . GLU B 1 168 ? 19.472 26.113 88.920 1.00 60.00 ? 169 GLU B CG  1 
ATOM   2704 C  CD  . GLU B 1 168 ? 20.429 27.273 89.115 1.00 60.00 ? 169 GLU B CD  1 
ATOM   2705 O  OE1 . GLU B 1 168 ? 20.068 28.275 89.754 1.00 60.00 ? 169 GLU B OE1 1 
ATOM   2706 O  OE2 . GLU B 1 168 ? 21.468 27.276 88.357 1.00 60.00 ? 169 GLU B OE2 1 
ATOM   2707 N  N   . ASN B 1 169 ? 17.067 26.229 85.321 1.00 60.00 ? 170 ASN B N   1 
ATOM   2708 C  CA  . ASN B 1 169 ? 16.706 26.890 84.074 1.00 60.00 ? 170 ASN B CA  1 
ATOM   2709 C  C   . ASN B 1 169 ? 17.646 27.984 83.566 1.00 60.00 ? 170 ASN B C   1 
ATOM   2710 O  O   . ASN B 1 169 ? 17.334 28.677 82.590 1.00 60.00 ? 170 ASN B O   1 
ATOM   2711 C  CB  . ASN B 1 169 ? 15.247 27.278 84.018 1.00 44.25 ? 170 ASN B CB  1 
ATOM   2712 C  CG  . ASN B 1 169 ? 14.511 26.334 83.126 1.00 60.00 ? 170 ASN B CG  1 
ATOM   2713 O  OD1 . ASN B 1 169 ? 14.961 25.158 83.002 1.00 50.71 ? 170 ASN B OD1 1 
ATOM   2714 N  ND2 . ASN B 1 169 ? 13.681 26.901 82.236 1.00 59.03 ? 170 ASN B ND2 1 
HETATM 2715 ZN ZN  . ZN  C 2 .   ? 2.027  22.078 22.334 1.00 27.02 ? 171 ZN  A ZN  1 
HETATM 2716 C  C1  . 4IP D 3 .   ? -2.057 4.457  38.908 1.00 25.80 ? 1   4IP A C1  1 
HETATM 2717 O  O1  . 4IP D 3 .   ? -3.375 4.757  39.551 1.00 29.94 ? 1   4IP A O1  1 
HETATM 2718 C  C2  . 4IP D 3 .   ? -0.922 5.344  39.322 1.00 26.48 ? 1   4IP A C2  1 
HETATM 2719 O  O2  . 4IP D 3 .   ? -1.240 6.736  39.057 1.00 28.30 ? 1   4IP A O2  1 
HETATM 2720 C  C3  . 4IP D 3 .   ? 0.286  4.855  38.602 1.00 26.80 ? 1   4IP A C3  1 
HETATM 2721 O  O3  . 4IP D 3 .   ? 1.416  5.454  39.134 1.00 24.45 ? 1   4IP A O3  1 
HETATM 2722 C  C4  . 4IP D 3 .   ? 0.140  4.986  37.044 1.00 23.61 ? 1   4IP A C4  1 
HETATM 2723 O  O4  . 4IP D 3 .   ? 1.348  4.449  36.464 1.00 23.46 ? 1   4IP A O4  1 
HETATM 2724 C  C5  . 4IP D 3 .   ? -1.018 4.123  36.627 1.00 23.48 ? 1   4IP A C5  1 
HETATM 2725 O  O5  . 4IP D 3 .   ? -1.286 4.402  35.194 1.00 31.40 ? 1   4IP A O5  1 
HETATM 2726 C  C6  . 4IP D 3 .   ? -2.284 4.546  37.401 1.00 25.78 ? 1   4IP A C6  1 
HETATM 2727 O  O6  . 4IP D 3 .   ? -3.405 3.732  37.059 1.00 27.40 ? 1   4IP A O6  1 
HETATM 2728 P  P1  . 4IP D 3 .   ? -3.866 3.965  40.926 1.00 35.20 ? 1   4IP A P1  1 
HETATM 2729 O  O1P . 4IP D 3 .   ? -5.075 4.584  41.329 1.00 34.03 ? 1   4IP A O1P 1 
HETATM 2730 O  O2P . 4IP D 3 .   ? -2.750 4.101  41.892 1.00 42.75 ? 1   4IP A O2P 1 
HETATM 2731 O  O3P . 4IP D 3 .   ? -3.951 2.615  40.458 1.00 37.50 ? 1   4IP A O3P 1 
HETATM 2732 P  P3  . 4IP D 3 .   ? 2.596  4.697  39.791 1.00 27.30 ? 1   4IP A P3  1 
HETATM 2733 O  O4P . 4IP D 3 .   ? 3.536  5.730  40.119 1.00 24.52 ? 1   4IP A O4P 1 
HETATM 2734 O  O5P . 4IP D 3 .   ? 1.772  4.139  40.838 1.00 30.11 ? 1   4IP A O5P 1 
HETATM 2735 O  O6P . 4IP D 3 .   ? 3.077  3.715  38.817 1.00 27.66 ? 1   4IP A O6P 1 
HETATM 2736 P  P4  . 4IP D 3 .   ? 2.470  5.261  35.756 1.00 27.06 ? 1   4IP A P4  1 
HETATM 2737 O  O7P . 4IP D 3 .   ? 2.054  6.681  35.926 1.00 23.76 ? 1   4IP A O7P 1 
HETATM 2738 O  O8P . 4IP D 3 .   ? 3.707  4.905  36.437 1.00 24.85 ? 1   4IP A O8P 1 
HETATM 2739 O  O9P . 4IP D 3 .   ? 2.441  4.804  34.395 1.00 29.71 ? 1   4IP A O9P 1 
HETATM 2740 P  P5  . 4IP D 3 .   ? -0.762 3.551  33.958 1.00 28.76 ? 1   4IP A P5  1 
HETATM 2741 O  OPF . 4IP D 3 .   ? 0.291  4.343  33.403 1.00 26.96 ? 1   4IP A OPF 1 
HETATM 2742 O  OPG . 4IP D 3 .   ? -0.239 2.412  34.606 1.00 26.26 ? 1   4IP A OPG 1 
HETATM 2743 O  OPH . 4IP D 3 .   ? -2.018 3.507  33.230 1.00 25.10 ? 1   4IP A OPH 1 
HETATM 2744 C  C1  . 4IP E 3 .   ? 0.754  -0.955 46.545 0.50 43.87 ? 172 4IP A C1  1 
HETATM 2745 O  O1  . 4IP E 3 .   ? 1.945  -1.526 45.910 0.50 60.00 ? 172 4IP A O1  1 
HETATM 2746 C  C2  . 4IP E 3 .   ? 0.169  0.155  45.798 0.50 28.21 ? 172 4IP A C2  1 
HETATM 2747 O  O2  . 4IP E 3 .   ? 1.204  1.135  45.695 0.50 30.29 ? 172 4IP A O2  1 
HETATM 2748 C  C3  . 4IP E 3 .   ? -1.013 0.636  46.553 0.50 43.20 ? 172 4IP A C3  1 
HETATM 2749 O  O3  . 4IP E 3 .   ? -1.638 1.576  45.752 0.50 60.00 ? 172 4IP A O3  1 
HETATM 2750 C  C4  . 4IP E 3 .   ? -0.594 1.156  48.010 0.50 55.56 ? 172 4IP A C4  1 
HETATM 2751 O  O4  . 4IP E 3 .   ? -1.813 1.509  48.656 0.50 60.00 ? 172 4IP A O4  1 
HETATM 2752 C  C5  . 4IP E 3 .   ? -0.053 -0.039 48.734 0.50 60.00 ? 172 4IP A C5  1 
HETATM 2753 O  O5  . 4IP E 3 .   ? 0.483  0.431  50.056 0.50 60.00 ? 172 4IP A O5  1 
HETATM 2754 C  C6  . 4IP E 3 .   ? 1.130  -0.576 47.965 0.50 55.68 ? 172 4IP A C6  1 
HETATM 2755 O  O6  . 4IP E 3 .   ? 1.670  -1.745 48.562 0.50 60.00 ? 172 4IP A O6  1 
HETATM 2756 P  P1  . 4IP E 3 .   ? 1.755  -2.981 45.038 0.50 60.00 ? 172 4IP A P1  1 
HETATM 2757 O  O1P . 4IP E 3 .   ? 2.406  -2.793 43.792 0.50 58.27 ? 172 4IP A O1P 1 
HETATM 2758 O  O2P . 4IP E 3 .   ? 0.246  -3.276 44.718 0.50 59.19 ? 172 4IP A O2P 1 
HETATM 2759 O  O3P . 4IP E 3 .   ? 2.398  -3.783 46.044 0.50 60.00 ? 172 4IP A O3P 1 
HETATM 2760 P  P3  . 4IP E 3 .   ? -3.231 1.746  45.675 0.50 60.00 ? 172 4IP A P3  1 
HETATM 2761 O  O4P . 4IP E 3 .   ? -3.368 3.169  45.836 0.50 46.17 ? 172 4IP A O4P 1 
HETATM 2762 O  O5P . 4IP E 3 .   ? -3.313 1.248  44.379 0.50 60.00 ? 172 4IP A O5P 1 
HETATM 2763 O  O6P . 4IP E 3 .   ? -3.715 0.906  46.750 0.50 60.00 ? 172 4IP A O6P 1 
HETATM 2764 P  P4  . 4IP E 3 .   ? -2.186 2.911  49.279 0.50 60.00 ? 172 4IP A P4  1 
HETATM 2765 O  O7P . 4IP E 3 .   ? -1.005 3.792  49.070 0.50 60.00 ? 172 4IP A O7P 1 
HETATM 2766 O  O8P . 4IP E 3 .   ? -3.332 3.401  48.459 0.50 60.00 ? 172 4IP A O8P 1 
HETATM 2767 O  O9P . 4IP E 3 .   ? -2.412 2.620  50.719 0.50 60.00 ? 172 4IP A O9P 1 
HETATM 2768 P  P5  . 4IP E 3 .   ? -0.371 0.441  51.404 0.50 60.00 ? 172 4IP A P5  1 
HETATM 2769 O  OPF . 4IP E 3 .   ? -0.007 1.662  52.093 0.50 60.00 ? 172 4IP A OPF 1 
HETATM 2770 O  OPG . 4IP E 3 .   ? -1.638 0.533  50.942 0.50 50.43 ? 172 4IP A OPG 1 
HETATM 2771 O  OPH . 4IP E 3 .   ? 0.027  -0.872 51.860 0.50 60.00 ? 172 4IP A OPH 1 
HETATM 2772 ZN ZN  . ZN  F 2 .   ? 20.071 10.199 86.760 1.00 58.57 ? 171 ZN  B ZN  1 
HETATM 2773 C  C1  . 4IP G 3 .   ? 4.799  -0.329 70.364 1.00 37.59 ? 1   4IP B C1  1 
HETATM 2774 O  O1  . 4IP G 3 .   ? 5.567  -1.395 69.639 1.00 43.20 ? 1   4IP B O1  1 
HETATM 2775 C  C2  . 4IP G 3 .   ? 5.165  1.094  69.907 1.00 29.16 ? 1   4IP B C2  1 
HETATM 2776 O  O2  . 4IP G 3 .   ? 6.521  1.430  70.111 1.00 30.06 ? 1   4IP B O2  1 
HETATM 2777 C  C3  . 4IP G 3 .   ? 4.334  2.031  70.641 1.00 30.67 ? 1   4IP B C3  1 
HETATM 2778 O  O3  . 4IP G 3 .   ? 4.545  3.266  70.053 1.00 27.78 ? 1   4IP B O3  1 
HETATM 2779 C  C4  . 4IP G 3 .   ? 4.667  1.970  72.155 1.00 33.08 ? 1   4IP B C4  1 
HETATM 2780 O  O4  . 4IP G 3 .   ? 3.778  2.955  72.770 1.00 25.26 ? 1   4IP B O4  1 
HETATM 2781 C  C5  . 4IP G 3 .   ? 4.286  0.517  72.638 1.00 35.75 ? 1   4IP B C5  1 
HETATM 2782 O  O5  . 4IP G 3 .   ? 4.594  0.313  74.048 1.00 34.85 ? 1   4IP B O5  1 
HETATM 2783 C  C6  . 4IP G 3 .   ? 5.006  -0.537 71.877 1.00 32.80 ? 1   4IP B C6  1 
HETATM 2784 O  O6  . 4IP G 3 .   ? 4.367  -1.692 72.240 1.00 33.94 ? 1   4IP B O6  1 
HETATM 2785 P  P1  . 4IP G 3 .   ? 4.874  -2.329 68.487 1.00 44.09 ? 1   4IP B P1  1 
HETATM 2786 O  O1P . 4IP G 3 .   ? 5.939  -2.984 67.735 1.00 45.18 ? 1   4IP B O1P 1 
HETATM 2787 O  O2P . 4IP G 3 .   ? 4.114  -1.410 67.616 1.00 49.52 ? 1   4IP B O2P 1 
HETATM 2788 O  O3P . 4IP G 3 .   ? 4.079  -3.145 69.494 1.00 54.62 ? 1   4IP B O3P 1 
HETATM 2789 P  P3  . 4IP G 3 .   ? 3.464  4.166  69.410 1.00 29.76 ? 1   4IP B P3  1 
HETATM 2790 O  O4P . 4IP G 3 .   ? 4.218  5.367  69.051 1.00 30.08 ? 1   4IP B O4P 1 
HETATM 2791 O  O5P . 4IP G 3 .   ? 3.039  3.351  68.278 1.00 36.34 ? 1   4IP B O5P 1 
HETATM 2792 O  O6P . 4IP G 3 .   ? 2.426  4.285  70.425 1.00 30.57 ? 1   4IP B O6P 1 
HETATM 2793 P  P4  . 4IP G 3 .   ? 4.026  4.278  73.535 1.00 29.95 ? 1   4IP B P4  1 
HETATM 2794 O  O7P . 4IP G 3 .   ? 5.444  4.335  73.411 1.00 20.28 ? 1   4IP B O7P 1 
HETATM 2795 O  O8P . 4IP G 3 .   ? 3.303  5.270  72.805 1.00 21.93 ? 1   4IP B O8P 1 
HETATM 2796 O  O9P . 4IP G 3 .   ? 3.453  4.089  74.883 1.00 32.51 ? 1   4IP B O9P 1 
HETATM 2797 P  P5  . 4IP G 3 .   ? 3.611  0.647  75.248 1.00 34.19 ? 1   4IP B P5  1 
HETATM 2798 O  OPF . 4IP G 3 .   ? 4.086  2.009  75.717 1.00 38.12 ? 1   4IP B OPF 1 
HETATM 2799 O  OPG . 4IP G 3 .   ? 2.275  0.704  74.770 1.00 26.01 ? 1   4IP B OPG 1 
HETATM 2800 O  OPH . 4IP G 3 .   ? 3.932  -0.471 76.053 1.00 37.92 ? 1   4IP B OPH 1 
HETATM 2801 C  C1  . 4IP H 3 .   ? -1.086 0.302  62.782 0.50 46.04 ? 172 4IP B C1  1 
HETATM 2802 O  O1  . 4IP H 3 .   ? -2.024 1.206  63.452 0.50 60.00 ? 172 4IP B O1  1 
HETATM 2803 C  C2  . 4IP H 3 .   ? 0.184  0.154  63.488 0.50 34.54 ? 172 4IP B C2  1 
HETATM 2804 O  O2  . 4IP H 3 .   ? 0.730  1.471  63.579 0.50 32.03 ? 172 4IP B O2  1 
HETATM 2805 C  C3  . 4IP H 3 .   ? 1.034  -0.773 62.702 0.50 46.38 ? 172 4IP B C3  1 
HETATM 2806 O  O3  . 4IP H 3 .   ? 2.159  -1.022 63.465 0.50 60.00 ? 172 4IP B O3  1 
HETATM 2807 C  C4  . 4IP H 3 .   ? 1.320  -0.190 61.236 0.50 56.75 ? 172 4IP B C4  1 
HETATM 2808 O  O4  . 4IP H 3 .   ? 2.067  -1.197 60.562 0.50 60.00 ? 172 4IP B O4  1 
HETATM 2809 C  C5  . 4IP H 3 .   ? -0.010 -0.110 60.557 0.50 60.00 ? 172 4IP B C5  1 
HETATM 2810 O  O5  . 4IP H 3 .   ? 0.191  0.565  59.229 0.50 60.00 ? 172 4IP B O5  1 
HETATM 2811 C  C6  . 4IP H 3 .   ? -0.912 0.796  61.359 0.50 55.74 ? 172 4IP B C6  1 
HETATM 2812 O  O6  . 4IP H 3 .   ? -2.216 0.881  60.805 0.50 60.00 ? 172 4IP B O6  1 
HETATM 2813 P  P1  . 4IP H 3 .   ? -3.500 0.547  64.003 0.50 60.00 ? 172 4IP B P1  1 
HETATM 2814 O  O1P . 4IP H 3 .   ? -3.793 1.184  65.234 0.50 55.54 ? 172 4IP B O1P 1 
HETATM 2815 O  O2P . 4IP H 3 .   ? -3.373 -0.988 64.311 0.50 60.00 ? 172 4IP B O2P 1 
HETATM 2816 O  O3P . 4IP H 3 .   ? -4.228 0.937  62.827 0.50 60.00 ? 172 4IP B O3P 1 
HETATM 2817 P  P3  . 4IP H 3 .   ? 3.032  -2.363 63.336 0.50 60.00 ? 172 4IP B P3  1 
HETATM 2818 O  O4P . 4IP H 3 .   ? 4.365  -1.824 63.275 0.50 60.00 ? 172 4IP B O4P 1 
HETATM 2819 O  O5P . 4IP H 3 .   ? 2.613  -2.862 64.565 0.50 60.00 ? 172 4IP B O5P 1 
HETATM 2820 O  O6P . 4IP H 3 .   ? 2.514  -2.992 62.141 0.50 55.68 ? 172 4IP B O6P 1 
HETATM 2821 P  P4  . 4IP H 3 .   ? 3.489  -1.038 59.893 0.50 60.00 ? 172 4IP B P4  1 
HETATM 2822 O  O7P . 4IP H 3 .   ? 3.893  0.379  60.096 0.50 60.00 ? 172 4IP B O7P 1 
HETATM 2823 O  O8P . 4IP H 3 .   ? 4.383  -1.935 60.680 0.50 60.00 ? 172 4IP B O8P 1 
HETATM 2824 O  O9P . 4IP H 3 .   ? 3.251  -1.348 58.459 0.50 60.00 ? 172 4IP B O9P 1 
HETATM 2825 P  P5  . 4IP H 3 .   ? -0.879 0.525  58.045 0.50 56.87 ? 172 4IP B P5  1 
HETATM 2826 O  OPF . 4IP H 3 .   ? -0.136 0.180  56.851 0.50 60.00 ? 172 4IP B OPF 1 
HETATM 2827 O  OPG . 4IP H 3 .   ? -1.674 -0.507 58.408 0.50 37.64 ? 172 4IP B OPG 1 
HETATM 2828 O  OPH . 4IP H 3 .   ? -1.429 1.841  58.280 0.50 58.95 ? 172 4IP B OPH 1 
HETATM 2829 O  O   . HOH I 4 .   ? 2.962  12.055 34.166 1.00 22.76 ? 173 HOH A O   1 
HETATM 2830 O  O   . HOH I 4 .   ? 6.979  18.288 25.617 1.00 20.53 ? 174 HOH A O   1 
HETATM 2831 O  O   . HOH I 4 .   ? 4.057  18.954 28.153 1.00 20.44 ? 175 HOH A O   1 
HETATM 2832 O  O   . HOH I 4 .   ? 0.698  23.080 38.316 1.00 24.95 ? 176 HOH A O   1 
HETATM 2833 O  O   . HOH I 4 .   ? -1.548 25.330 32.518 1.00 24.34 ? 177 HOH A O   1 
HETATM 2834 O  O   . HOH I 4 .   ? 0.517  23.809 31.584 1.00 26.41 ? 178 HOH A O   1 
HETATM 2835 O  O   . HOH I 4 .   ? 5.816  16.034 25.051 1.00 23.57 ? 179 HOH A O   1 
HETATM 2836 O  O   . HOH I 4 .   ? -0.367 28.862 34.385 1.00 26.98 ? 180 HOH A O   1 
HETATM 2837 O  O   . HOH I 4 .   ? 9.037  17.685 19.873 1.00 28.29 ? 181 HOH A O   1 
HETATM 2838 O  O   . HOH I 4 .   ? 12.921 29.503 14.697 1.00 27.48 ? 182 HOH A O   1 
HETATM 2839 O  O   . HOH I 4 .   ? 23.480 7.731  30.261 1.00 28.93 ? 183 HOH A O   1 
HETATM 2840 O  O   . HOH I 4 .   ? 17.056 10.489 22.718 1.00 28.89 ? 184 HOH A O   1 
HETATM 2841 O  O   . HOH I 4 .   ? 24.871 6.524  37.644 1.00 32.09 ? 185 HOH A O   1 
HETATM 2842 O  O   . HOH I 4 .   ? 4.213  7.514  61.150 1.00 31.89 ? 186 HOH A O   1 
HETATM 2843 O  O   . HOH I 4 .   ? 0.694  8.678  39.385 1.00 31.60 ? 187 HOH A O   1 
HETATM 2844 O  O   . HOH I 4 .   ? 12.050 -2.451 34.711 1.00 60.00 ? 188 HOH A O   1 
HETATM 2845 O  O   . HOH I 4 .   ? 17.313 4.575  38.344 1.00 30.07 ? 189 HOH A O   1 
HETATM 2846 O  O   . HOH I 4 .   ? -5.705 0.959  35.016 1.00 27.72 ? 190 HOH A O   1 
HETATM 2847 O  O   . HOH I 4 .   ? -4.547 12.320 42.870 1.00 32.27 ? 191 HOH A O   1 
HETATM 2848 O  O   . HOH I 4 .   ? 6.102  14.877 22.599 1.00 34.52 ? 192 HOH A O   1 
HETATM 2849 O  O   . HOH I 4 .   ? 14.121 26.758 46.124 1.00 34.89 ? 193 HOH A O   1 
HETATM 2850 O  O   . HOH I 4 .   ? -7.209 -2.620 34.062 1.00 38.82 ? 194 HOH A O   1 
HETATM 2851 O  O   . HOH I 4 .   ? 5.063  2.419  35.540 1.00 31.90 ? 195 HOH A O   1 
HETATM 2852 O  O   . HOH I 4 .   ? 0.297  2.230  41.971 1.00 32.92 ? 196 HOH A O   1 
HETATM 2853 O  O   . HOH I 4 .   ? 8.528  15.615 21.573 1.00 38.88 ? 197 HOH A O   1 
HETATM 2854 O  O   . HOH I 4 .   ? -0.566 28.274 38.959 1.00 35.87 ? 198 HOH A O   1 
HETATM 2855 O  O   . HOH I 4 .   ? 22.820 14.531 21.749 1.00 33.51 ? 199 HOH A O   1 
HETATM 2856 O  O   . HOH I 4 .   ? 1.578  24.615 40.612 1.00 35.67 ? 200 HOH A O   1 
HETATM 2857 O  O   . HOH I 4 .   ? 19.212 4.407  29.104 1.00 34.03 ? 201 HOH A O   1 
HETATM 2858 O  O   . HOH I 4 .   ? -1.762 28.312 23.469 1.00 35.38 ? 202 HOH A O   1 
HETATM 2859 O  O   . HOH I 4 .   ? -4.205 24.850 33.644 1.00 36.91 ? 203 HOH A O   1 
HETATM 2860 O  O   . HOH I 4 .   ? 11.441 27.151 45.917 1.00 32.72 ? 204 HOH A O   1 
HETATM 2861 O  O   . HOH I 4 .   ? 20.338 7.989  22.976 1.00 37.10 ? 205 HOH A O   1 
HETATM 2862 O  O   . HOH I 4 .   ? 19.710 0.668  30.634 1.00 37.49 ? 206 HOH A O   1 
HETATM 2863 O  O   . HOH I 4 .   ? 8.187  4.022  62.014 1.00 35.98 ? 207 HOH A O   1 
HETATM 2864 O  O   . HOH I 4 .   ? -1.955 18.361 35.441 1.00 33.14 ? 208 HOH A O   1 
HETATM 2865 O  O   . HOH I 4 .   ? 13.028 24.665 31.229 1.00 37.30 ? 209 HOH A O   1 
HETATM 2866 O  O   . HOH I 4 .   ? 12.119 4.094  28.595 1.00 39.81 ? 210 HOH A O   1 
HETATM 2867 O  O   . HOH I 4 .   ? 1.382  27.399 40.413 1.00 41.35 ? 211 HOH A O   1 
HETATM 2868 O  O   . HOH I 4 .   ? 15.423 18.039 23.832 1.00 37.30 ? 212 HOH A O   1 
HETATM 2869 O  O   . HOH I 4 .   ? 12.965 1.470  31.964 1.00 40.44 ? 213 HOH A O   1 
HETATM 2870 O  O   . HOH I 4 .   ? 16.089 8.596  22.157 1.00 40.00 ? 214 HOH A O   1 
HETATM 2871 O  O   . HOH I 4 .   ? -7.725 -5.021 32.584 1.00 43.28 ? 215 HOH A O   1 
HETATM 2872 O  O   . HOH I 4 .   ? 15.620 19.176 26.949 1.00 37.35 ? 216 HOH A O   1 
HETATM 2873 O  O   . HOH I 4 .   ? 6.354  1.131  30.576 1.00 37.50 ? 217 HOH A O   1 
HETATM 2874 O  O   . HOH I 4 .   ? 13.427 22.569 23.581 1.00 39.86 ? 218 HOH A O   1 
HETATM 2875 O  O   . HOH I 4 .   ? 27.106 7.807  37.637 1.00 37.59 ? 219 HOH A O   1 
HETATM 2876 O  O   . HOH I 4 .   ? -6.299 25.133 31.840 1.00 36.88 ? 220 HOH A O   1 
HETATM 2877 O  O   . HOH I 4 .   ? 24.182 11.270 27.103 1.00 44.82 ? 221 HOH A O   1 
HETATM 2878 O  O   . HOH I 4 .   ? 5.498  -1.600 42.942 1.00 58.16 ? 222 HOH A O   1 
HETATM 2879 O  O   . HOH I 4 .   ? 26.823 9.633  28.428 1.00 40.93 ? 223 HOH A O   1 
HETATM 2880 O  O   . HOH I 4 .   ? 10.205 12.972 21.651 1.00 44.05 ? 224 HOH A O   1 
HETATM 2881 O  O   . HOH I 4 .   ? -0.035 30.098 36.799 1.00 45.19 ? 225 HOH A O   1 
HETATM 2882 O  O   . HOH I 4 .   ? -4.027 18.672 36.122 1.00 43.75 ? 226 HOH A O   1 
HETATM 2883 O  O   . HOH I 4 .   ? 20.418 13.538 45.819 1.00 48.30 ? 227 HOH A O   1 
HETATM 2884 O  O   . HOH I 4 .   ? 26.238 12.661 28.564 1.00 39.51 ? 228 HOH A O   1 
HETATM 2885 O  O   . HOH I 4 .   ? 31.791 18.118 23.162 1.00 52.81 ? 229 HOH A O   1 
HETATM 2886 O  O   . HOH I 4 .   ? 0.198  28.198 43.014 1.00 39.98 ? 230 HOH A O   1 
HETATM 2887 O  O   . HOH I 4 .   ? 0.821  12.208 32.793 1.00 45.76 ? 231 HOH A O   1 
HETATM 2888 O  O   . HOH I 4 .   ? 6.843  22.500 49.378 1.00 43.29 ? 232 HOH A O   1 
HETATM 2889 O  O   . HOH I 4 .   ? 4.563  4.760  50.900 1.00 39.91 ? 233 HOH A O   1 
HETATM 2890 O  O   . HOH I 4 .   ? 21.844 32.988 21.773 1.00 58.97 ? 234 HOH A O   1 
HETATM 2891 O  O   . HOH I 4 .   ? 1.854  11.542 30.407 1.00 47.95 ? 235 HOH A O   1 
HETATM 2892 O  O   . HOH I 4 .   ? 4.936  0.591  28.206 1.00 50.25 ? 236 HOH A O   1 
HETATM 2893 O  O   . HOH I 4 .   ? 16.007 26.211 28.855 1.00 51.38 ? 237 HOH A O   1 
HETATM 2894 O  O   . HOH I 4 .   ? 4.728  24.724 16.236 1.00 43.36 ? 238 HOH A O   1 
HETATM 2895 O  O   . HOH I 4 .   ? -0.399 16.750 57.928 1.00 52.01 ? 239 HOH A O   1 
HETATM 2896 O  O   . HOH I 4 .   ? -5.535 27.425 42.767 1.00 50.34 ? 240 HOH A O   1 
HETATM 2897 O  O   . HOH I 4 .   ? -4.299 19.237 47.234 1.00 46.75 ? 241 HOH A O   1 
HETATM 2898 O  O   . HOH I 4 .   ? 8.188  28.122 35.962 1.00 44.70 ? 242 HOH A O   1 
HETATM 2899 O  O   . HOH I 4 .   ? 5.519  2.978  55.368 1.00 47.97 ? 243 HOH A O   1 
HETATM 2900 O  O   . HOH I 4 .   ? 13.195 19.116 17.324 1.00 45.99 ? 244 HOH A O   1 
HETATM 2901 O  O   . HOH I 4 .   ? -5.584 16.634 41.566 1.00 59.83 ? 245 HOH A O   1 
HETATM 2902 O  O   . HOH I 4 .   ? 30.995 17.288 20.103 1.00 46.86 ? 246 HOH A O   1 
HETATM 2903 O  O   . HOH I 4 .   ? 21.283 17.991 27.060 1.00 42.33 ? 247 HOH A O   1 
HETATM 2904 O  O   . HOH I 4 .   ? 19.993 1.918  37.067 1.00 54.73 ? 248 HOH A O   1 
HETATM 2905 O  O   . HOH I 4 .   ? 28.740 14.953 19.623 1.00 45.92 ? 249 HOH A O   1 
HETATM 2906 O  O   . HOH I 4 .   ? 21.891 26.930 41.468 1.00 60.00 ? 250 HOH A O   1 
HETATM 2907 O  O   . HOH I 4 .   ? -3.588 -0.767 38.267 1.00 52.77 ? 251 HOH A O   1 
HETATM 2908 O  O   . HOH I 4 .   ? 6.707  26.092 36.262 1.00 45.86 ? 252 HOH A O   1 
HETATM 2909 O  O   . HOH I 4 .   ? 2.259  32.589 37.910 1.00 50.61 ? 253 HOH A O   1 
HETATM 2910 O  O   . HOH I 4 .   ? -1.795 14.882 17.201 1.00 46.13 ? 254 HOH A O   1 
HETATM 2911 O  O   . HOH I 4 .   ? 10.411 17.817 17.150 1.00 49.12 ? 255 HOH A O   1 
HETATM 2912 O  O   . HOH I 4 .   ? 19.739 13.893 19.193 1.00 46.73 ? 256 HOH A O   1 
HETATM 2913 O  O   . HOH I 4 .   ? 4.797  26.843 39.665 1.00 52.36 ? 257 HOH A O   1 
HETATM 2914 O  O   . HOH I 4 .   ? -6.446 20.472 27.065 1.00 53.81 ? 258 HOH A O   1 
HETATM 2915 O  O   . HOH I 4 .   ? 3.414  9.099  28.967 1.00 60.00 ? 259 HOH A O   1 
HETATM 2916 O  O   . HOH I 4 .   ? -1.145 -4.430 46.383 1.00 53.98 ? 260 HOH A O   1 
HETATM 2917 O  O   . HOH I 4 .   ? -1.658 0.750  40.403 1.00 52.62 ? 261 HOH A O   1 
HETATM 2918 O  O   . HOH I 4 .   ? 10.952 -1.907 52.321 1.00 60.00 ? 262 HOH A O   1 
HETATM 2919 O  O   . HOH I 4 .   ? 8.051  26.799 47.770 1.00 49.38 ? 263 HOH A O   1 
HETATM 2920 O  O   . HOH I 4 .   ? 22.496 19.351 39.231 1.00 55.19 ? 264 HOH A O   1 
HETATM 2921 O  O   . HOH I 4 .   ? 22.360 22.468 39.758 1.00 58.20 ? 265 HOH A O   1 
HETATM 2922 O  O   . HOH I 4 .   ? -2.351 31.317 36.931 1.00 51.17 ? 266 HOH A O   1 
HETATM 2923 O  O   . HOH I 4 .   ? 6.774  27.738 59.874 1.00 60.00 ? 267 HOH A O   1 
HETATM 2924 O  O   . HOH I 4 .   ? 24.540 5.229  45.173 1.00 56.74 ? 268 HOH A O   1 
HETATM 2925 O  O   . HOH I 4 .   ? 15.866 -0.957 40.431 1.00 59.05 ? 269 HOH A O   1 
HETATM 2926 O  O   . HOH I 4 .   ? 19.204 15.424 46.147 1.00 52.61 ? 270 HOH A O   1 
HETATM 2927 O  O   . HOH I 4 .   ? -5.169 1.730  38.410 1.00 47.35 ? 271 HOH A O   1 
HETATM 2928 O  O   . HOH I 4 .   ? -5.551 22.434 38.498 1.00 60.00 ? 272 HOH A O   1 
HETATM 2929 O  O   . HOH I 4 .   ? 18.721 19.225 25.648 1.00 60.00 ? 273 HOH A O   1 
HETATM 2930 O  O   . HOH I 4 .   ? 4.832  4.927  53.713 1.00 47.70 ? 274 HOH A O   1 
HETATM 2931 O  O   . HOH I 4 .   ? -6.935 0.602  49.199 1.00 58.10 ? 275 HOH A O   1 
HETATM 2932 O  O   . HOH I 4 .   ? -6.086 24.237 36.791 1.00 57.17 ? 276 HOH A O   1 
HETATM 2933 O  O   . HOH I 4 .   ? 27.473 11.461 33.277 1.00 52.76 ? 277 HOH A O   1 
HETATM 2934 O  O   . HOH I 4 .   ? 12.657 8.302  23.214 1.00 59.47 ? 278 HOH A O   1 
HETATM 2935 O  O   . HOH I 4 .   ? -5.280 22.054 34.623 1.00 60.00 ? 279 HOH A O   1 
HETATM 2936 O  O   . HOH I 4 .   ? 13.179 -1.561 45.413 1.00 50.43 ? 280 HOH A O   1 
HETATM 2937 O  O   . HOH I 4 .   ? -4.514 9.674  44.329 1.00 60.00 ? 281 HOH A O   1 
HETATM 2938 O  O   . HOH I 4 .   ? 4.095  21.099 16.037 1.00 58.44 ? 282 HOH A O   1 
HETATM 2939 O  O   . HOH I 4 .   ? 20.878 18.824 20.125 1.00 60.00 ? 283 HOH A O   1 
HETATM 2940 O  O   . HOH I 4 .   ? 15.286 29.066 45.191 1.00 58.29 ? 284 HOH A O   1 
HETATM 2941 O  O   . HOH I 4 .   ? -7.136 0.796  37.009 1.00 60.00 ? 285 HOH A O   1 
HETATM 2942 O  O   . HOH I 4 .   ? 14.890 0.568  37.769 1.00 60.00 ? 286 HOH A O   1 
HETATM 2943 O  O   . HOH I 4 .   ? -8.416 23.738 43.567 1.00 60.00 ? 287 HOH A O   1 
HETATM 2944 O  O   . HOH I 4 .   ? 9.245  17.075 23.942 1.00 60.00 ? 288 HOH A O   1 
HETATM 2945 O  O   . HOH I 4 .   ? 4.693  30.118 53.904 1.00 60.00 ? 289 HOH A O   1 
HETATM 2946 O  O   . HOH I 4 .   ? 16.420 3.421  50.382 1.00 60.00 ? 290 HOH A O   1 
HETATM 2947 O  O   . HOH I 4 .   ? -1.820 12.838 46.589 1.00 60.00 ? 291 HOH A O   1 
HETATM 2948 O  O   . HOH I 4 .   ? 18.465 27.761 20.178 1.00 60.00 ? 292 HOH A O   1 
HETATM 2949 O  O   . HOH I 4 .   ? 20.699 23.717 41.060 1.00 60.00 ? 293 HOH A O   1 
HETATM 2950 O  O   . HOH I 4 .   ? -1.456 29.521 53.006 1.00 60.00 ? 294 HOH A O   1 
HETATM 2951 O  O   . HOH I 4 .   ? 20.083 -0.194 27.862 1.00 60.00 ? 295 HOH A O   1 
HETATM 2952 O  O   . HOH I 4 .   ? 7.519  29.433 38.291 1.00 60.00 ? 296 HOH A O   1 
HETATM 2953 O  O   . HOH I 4 .   ? 3.395  15.496 15.402 1.00 56.87 ? 297 HOH A O   1 
HETATM 2954 O  O   . HOH I 4 .   ? 29.163 7.830  35.025 1.00 60.00 ? 298 HOH A O   1 
HETATM 2955 O  O   . HOH I 4 .   ? 15.417 22.886 47.715 1.00 58.45 ? 299 HOH A O   1 
HETATM 2956 O  O   . HOH I 4 .   ? 28.923 25.466 32.882 1.00 60.00 ? 300 HOH A O   1 
HETATM 2957 O  O   . HOH I 4 .   ? 15.814 27.979 41.685 1.00 60.00 ? 301 HOH A O   1 
HETATM 2958 O  O   . HOH I 4 .   ? 22.682 18.552 23.563 1.00 60.00 ? 302 HOH A O   1 
HETATM 2959 O  O   . HOH I 4 .   ? 4.277  22.170 60.224 1.00 60.00 ? 303 HOH A O   1 
HETATM 2960 O  O   . HOH I 4 .   ? 17.256 4.060  47.599 1.00 49.22 ? 304 HOH A O   1 
HETATM 2961 O  O   . HOH I 4 .   ? 19.549 26.062 22.138 1.00 60.00 ? 305 HOH A O   1 
HETATM 2962 O  O   . HOH I 4 .   ? 8.560  20.058 61.323 1.00 60.00 ? 306 HOH A O   1 
HETATM 2963 O  O   . HOH I 4 .   ? -5.173 5.750  27.385 1.00 60.00 ? 307 HOH A O   1 
HETATM 2964 O  O   . HOH I 4 .   ? -8.212 21.283 29.202 1.00 60.00 ? 308 HOH A O   1 
HETATM 2965 O  O   . HOH I 4 .   ? -8.802 19.505 33.423 1.00 60.00 ? 309 HOH A O   1 
HETATM 2966 O  O   . HOH I 4 .   ? 10.837 3.840  26.368 1.00 46.37 ? 310 HOH A O   1 
HETATM 2967 O  O   . HOH I 4 .   ? -2.239 29.120 42.384 1.00 60.00 ? 311 HOH A O   1 
HETATM 2968 O  O   . HOH I 4 .   ? 17.432 3.832  57.268 1.00 60.00 ? 312 HOH A O   1 
HETATM 2969 O  O   . HOH I 4 .   ? -9.219 9.889  36.460 1.00 60.00 ? 313 HOH A O   1 
HETATM 2970 O  O   . HOH I 4 .   ? 24.208 19.552 28.185 1.00 60.00 ? 314 HOH A O   1 
HETATM 2971 O  O   . HOH I 4 .   ? 3.785  6.844  21.496 1.00 60.00 ? 315 HOH A O   1 
HETATM 2972 O  O   . HOH I 4 .   ? 16.238 1.319  25.890 1.00 51.03 ? 316 HOH A O   1 
HETATM 2973 O  O   . HOH I 4 .   ? -5.490 16.757 45.803 1.00 60.00 ? 317 HOH A O   1 
HETATM 2974 O  O   . HOH I 4 .   ? -0.785 29.976 46.689 1.00 60.00 ? 318 HOH A O   1 
HETATM 2975 O  O   . HOH I 4 .   ? -8.096 20.637 40.943 1.00 60.00 ? 319 HOH A O   1 
HETATM 2976 O  O   . HOH I 4 .   ? -1.213 18.663 52.008 1.00 60.00 ? 320 HOH A O   1 
HETATM 2977 O  O   . HOH I 4 .   ? 8.974  -4.208 42.493 1.00 60.00 ? 321 HOH A O   1 
HETATM 2978 O  O   . HOH I 4 .   ? 6.774  11.806 22.945 1.00 57.92 ? 322 HOH A O   1 
HETATM 2979 O  O   . HOH I 4 .   ? 1.894  0.881  27.122 1.00 60.00 ? 323 HOH A O   1 
HETATM 2980 O  O   . HOH I 4 .   ? 9.632  2.826  29.918 1.00 59.18 ? 324 HOH A O   1 
HETATM 2981 O  O   . HOH I 4 .   ? 12.995 9.249  20.462 1.00 60.00 ? 325 HOH A O   1 
HETATM 2982 O  O   . HOH I 4 .   ? -1.591 11.297 31.216 1.00 60.00 ? 326 HOH A O   1 
HETATM 2983 O  O   . HOH I 4 .   ? 3.323  18.854 14.437 1.00 60.00 ? 327 HOH A O   1 
HETATM 2984 O  O   . HOH I 4 .   ? 7.199  30.250 44.063 1.00 57.22 ? 328 HOH A O   1 
HETATM 2985 O  O   . HOH I 4 .   ? -1.328 34.269 53.408 1.00 60.00 ? 329 HOH A O   1 
HETATM 2986 O  O   . HOH I 4 .   ? -4.192 10.323 22.467 1.00 60.00 ? 330 HOH A O   1 
HETATM 2987 O  O   . HOH I 4 .   ? 8.693  22.944 50.988 1.00 60.00 ? 331 HOH A O   1 
HETATM 2988 O  O   . HOH I 4 .   ? 8.055  26.564 53.113 1.00 60.00 ? 332 HOH A O   1 
HETATM 2989 O  O   . HOH I 4 .   ? 0.867  31.587 40.551 1.00 60.00 ? 333 HOH A O   1 
HETATM 2990 O  O   . HOH I 4 .   ? 1.194  22.095 54.093 1.00 60.00 ? 334 HOH A O   1 
HETATM 2991 O  O   . HOH I 4 .   ? 23.413 14.651 36.014 1.00 60.00 ? 335 HOH A O   1 
HETATM 2992 O  O   . HOH I 4 .   ? -6.202 12.407 22.513 1.00 60.00 ? 336 HOH A O   1 
HETATM 2993 O  O   . HOH I 4 .   ? 4.019  36.742 53.137 1.00 60.00 ? 337 HOH A O   1 
HETATM 2994 O  O   . HOH I 4 .   ? -5.447 5.121  44.260 1.00 60.00 ? 338 HOH A O   1 
HETATM 2995 O  O   . HOH I 4 .   ? 22.184 32.893 24.099 1.00 60.00 ? 339 HOH A O   1 
HETATM 2996 O  O   . HOH J 4 .   ? 5.440  6.527  47.983 1.00 25.29 ? 173 HOH B O   1 
HETATM 2997 O  O   . HOH J 4 .   ? 7.927  3.892  69.853 1.00 29.44 ? 174 HOH B O   1 
HETATM 2998 O  O   . HOH J 4 .   ? 20.743 21.220 62.953 1.00 60.00 ? 175 HOH B O   1 
HETATM 2999 O  O   . HOH J 4 .   ? 21.703 16.977 60.922 1.00 58.69 ? 176 HOH B O   1 
HETATM 3000 O  O   . HOH J 4 .   ? -6.841 14.404 68.710 1.00 60.00 ? 177 HOH B O   1 
HETATM 3001 O  O   . HOH J 4 .   ? 9.273  8.908  58.867 1.00 60.00 ? 178 HOH B O   1 
HETATM 3002 O  O   . HOH J 4 .   ? 3.292  -4.430 65.972 1.00 60.00 ? 179 HOH B O   1 
HETATM 3003 O  O   . HOH J 4 .   ? 17.226 1.189  67.161 1.00 60.00 ? 180 HOH B O   1 
HETATM 3004 O  O   . HOH J 4 .   ? 0.970  9.121  47.057 1.00 30.91 ? 181 HOH B O   1 
HETATM 3005 O  O   . HOH J 4 .   ? 9.192  29.925 79.754 1.00 33.75 ? 182 HOH B O   1 
HETATM 3006 O  O   . HOH J 4 .   ? 10.381 7.138  75.027 1.00 33.93 ? 183 HOH B O   1 
HETATM 3007 O  O   . HOH J 4 .   ? 11.837 20.703 84.999 1.00 42.17 ? 184 HOH B O   1 
HETATM 3008 O  O   . HOH J 4 .   ? 8.972  26.117 81.886 1.00 34.26 ? 185 HOH B O   1 
HETATM 3009 O  O   . HOH J 4 .   ? 15.717 15.831 47.865 1.00 36.42 ? 186 HOH B O   1 
HETATM 3010 O  O   . HOH J 4 .   ? 11.864 21.952 82.453 1.00 38.76 ? 187 HOH B O   1 
HETATM 3011 O  O   . HOH J 4 .   ? 11.087 24.867 82.825 1.00 44.39 ? 188 HOH B O   1 
HETATM 3012 O  O   . HOH J 4 .   ? 12.454 24.704 86.132 1.00 41.15 ? 189 HOH B O   1 
HETATM 3013 O  O   . HOH J 4 .   ? 3.172  -4.999 74.030 1.00 39.04 ? 190 HOH B O   1 
HETATM 3014 O  O   . HOH J 4 .   ? 2.267  9.204  76.436 1.00 39.59 ? 191 HOH B O   1 
HETATM 3015 O  O   . HOH J 4 .   ? 6.073  -5.698 67.861 1.00 41.16 ? 192 HOH B O   1 
HETATM 3016 O  O   . HOH J 4 .   ? 16.786 24.726 81.150 1.00 46.07 ? 193 HOH B O   1 
HETATM 3017 O  O   . HOH J 4 .   ? -2.770 5.971  60.017 1.00 39.04 ? 194 HOH B O   1 
HETATM 3018 O  O   . HOH J 4 .   ? 1.972  25.944 82.430 1.00 42.70 ? 195 HOH B O   1 
HETATM 3019 O  O   . HOH J 4 .   ? 2.044  5.767  76.101 1.00 48.52 ? 196 HOH B O   1 
HETATM 3020 O  O   . HOH J 4 .   ? 21.900 10.778 68.152 1.00 42.22 ? 197 HOH B O   1 
HETATM 3021 O  O   . HOH J 4 .   ? -1.839 18.104 70.930 1.00 46.43 ? 198 HOH B O   1 
HETATM 3022 O  O   . HOH J 4 .   ? 18.210 3.836  73.400 1.00 45.40 ? 199 HOH B O   1 
HETATM 3023 O  O   . HOH J 4 .   ? 0.697  5.681  73.789 1.00 45.58 ? 200 HOH B O   1 
HETATM 3024 O  O   . HOH J 4 .   ? -0.863 3.613  71.157 1.00 53.15 ? 201 HOH B O   1 
HETATM 3025 O  O   . HOH J 4 .   ? 14.638 13.089 84.162 1.00 46.22 ? 202 HOH B O   1 
HETATM 3026 O  O   . HOH J 4 .   ? 11.798 13.164 87.279 1.00 48.41 ? 203 HOH B O   1 
HETATM 3027 O  O   . HOH J 4 .   ? -1.728 -1.042 67.275 1.00 42.61 ? 204 HOH B O   1 
HETATM 3028 O  O   . HOH J 4 .   ? -1.663 4.733  81.135 1.00 44.59 ? 205 HOH B O   1 
HETATM 3029 O  O   . HOH J 4 .   ? 0.771  21.873 86.706 1.00 49.28 ? 206 HOH B O   1 
HETATM 3030 O  O   . HOH J 4 .   ? 10.948 5.370  78.046 1.00 53.59 ? 207 HOH B O   1 
HETATM 3031 O  O   . HOH J 4 .   ? 13.247 15.251 84.861 1.00 56.78 ? 208 HOH B O   1 
HETATM 3032 O  O   . HOH J 4 .   ? 15.590 6.177  50.982 1.00 55.67 ? 209 HOH B O   1 
HETATM 3033 O  O   . HOH J 4 .   ? 7.425  32.139 71.289 1.00 60.00 ? 210 HOH B O   1 
HETATM 3034 O  O   . HOH J 4 .   ? 5.724  23.708 88.528 1.00 59.88 ? 211 HOH B O   1 
HETATM 3035 O  O   . HOH J 4 .   ? 0.207  8.196  75.769 1.00 55.28 ? 212 HOH B O   1 
HETATM 3036 O  O   . HOH J 4 .   ? -0.663 12.848 80.545 1.00 34.09 ? 213 HOH B O   1 
HETATM 3037 O  O   . HOH J 4 .   ? 3.924  -6.565 71.911 1.00 54.37 ? 214 HOH B O   1 
HETATM 3038 O  O   . HOH J 4 .   ? 8.692  28.994 84.530 1.00 59.47 ? 215 HOH B O   1 
HETATM 3039 O  O   . HOH J 4 .   ? 9.719  10.135 85.943 1.00 55.49 ? 216 HOH B O   1 
HETATM 3040 O  O   . HOH J 4 .   ? -2.820 12.842 77.152 1.00 57.12 ? 217 HOH B O   1 
HETATM 3041 O  O   . HOH J 4 .   ? 2.188  27.752 89.054 1.00 60.00 ? 218 HOH B O   1 
HETATM 3042 O  O   . HOH J 4 .   ? 20.182 24.304 85.479 1.00 60.00 ? 219 HOH B O   1 
HETATM 3043 O  O   . HOH J 4 .   ? 12.556 11.126 83.971 1.00 51.42 ? 220 HOH B O   1 
HETATM 3044 O  O   . HOH J 4 .   ? 13.801 28.561 69.266 1.00 49.54 ? 221 HOH B O   1 
HETATM 3045 O  O   . HOH J 4 .   ? 18.280 12.814 49.322 1.00 60.00 ? 222 HOH B O   1 
HETATM 3046 O  O   . HOH J 4 .   ? 6.149  32.317 77.721 1.00 60.00 ? 223 HOH B O   1 
HETATM 3047 O  O   . HOH J 4 .   ? 2.696  15.247 86.803 1.00 60.00 ? 224 HOH B O   1 
HETATM 3048 O  O   . HOH J 4 .   ? 1.897  -2.307 68.601 1.00 60.00 ? 225 HOH B O   1 
HETATM 3049 O  O   . HOH J 4 .   ? 4.597  20.153 86.728 1.00 60.00 ? 226 HOH B O   1 
HETATM 3050 O  O   . HOH J 4 .   ? 19.298 8.744  55.655 1.00 60.00 ? 227 HOH B O   1 
HETATM 3051 O  O   . HOH J 4 .   ? 31.126 13.896 55.289 1.00 60.00 ? 228 HOH B O   1 
HETATM 3052 O  O   . HOH J 4 .   ? -2.993 18.078 62.152 1.00 60.00 ? 229 HOH B O   1 
HETATM 3053 O  O   . HOH J 4 .   ? 16.042 -2.670 77.423 1.00 58.97 ? 230 HOH B O   1 
HETATM 3054 O  O   . HOH J 4 .   ? -6.709 10.889 66.748 1.00 60.00 ? 231 HOH B O   1 
HETATM 3055 O  O   . HOH J 4 .   ? 18.444 27.864 91.855 1.00 60.00 ? 232 HOH B O   1 
HETATM 3056 O  O   . HOH J 4 .   ? 19.297 21.800 70.239 1.00 60.00 ? 233 HOH B O   1 
HETATM 3057 O  O   . HOH J 4 .   ? -0.175 24.563 62.500 1.00 60.00 ? 234 HOH B O   1 
HETATM 3058 O  O   . HOH J 4 .   ? 7.799  -8.193 70.441 1.00 60.00 ? 235 HOH B O   1 
HETATM 3059 O  O   . HOH J 4 .   ? 2.598  7.074  55.657 1.00 57.94 ? 236 HOH B O   1 
HETATM 3060 O  O   . HOH J 4 .   ? -7.109 13.786 80.391 1.00 60.00 ? 237 HOH B O   1 
HETATM 3061 O  O   . HOH J 4 .   ? 7.281  6.735  80.567 1.00 60.00 ? 238 HOH B O   1 
HETATM 3062 O  O   . HOH J 4 .   ? -4.039 9.883  81.522 1.00 60.00 ? 239 HOH B O   1 
HETATM 3063 O  O   . HOH J 4 .   ? 3.392  5.489  87.218 1.00 60.00 ? 240 HOH B O   1 
HETATM 3064 O  O   . HOH J 4 .   ? 19.701 17.743 57.166 1.00 60.00 ? 241 HOH B O   1 
HETATM 3065 O  O   . HOH J 4 .   ? 16.440 16.920 94.141 1.00 60.00 ? 242 HOH B O   1 
HETATM 3066 O  O   . HOH J 4 .   ? 9.338  31.919 73.469 1.00 60.00 ? 243 HOH B O   1 
HETATM 3067 O  O   . HOH J 4 .   ? 17.259 22.445 92.869 1.00 60.00 ? 244 HOH B O   1 
HETATM 3068 O  O   . HOH J 4 .   ? 7.809  -3.705 78.100 1.00 60.00 ? 245 HOH B O   1 
HETATM 3069 O  O   . HOH J 4 .   ? 23.253 25.580 84.846 1.00 60.00 ? 246 HOH B O   1 
HETATM 3070 O  O   . HOH J 4 .   ? 22.737 12.479 92.631 1.00 60.00 ? 247 HOH B O   1 
HETATM 3071 O  O   . HOH J 4 .   ? 0.805  6.316  53.717 1.00 60.00 ? 248 HOH B O   1 
HETATM 3072 O  O   . HOH J 4 .   ? 14.013 28.861 90.384 1.00 60.00 ? 249 HOH B O   1 
HETATM 3073 O  O   . HOH J 4 .   ? 10.151 -7.113 76.184 1.00 60.00 ? 250 HOH B O   1 
HETATM 3074 O  O   . HOH J 4 .   ? -5.939 18.817 66.938 1.00 60.00 ? 251 HOH B O   1 
HETATM 3075 O  O   . HOH J 4 .   ? 1.516  -0.690 72.859 1.00 60.00 ? 252 HOH B O   1 
HETATM 3076 O  O   . HOH J 4 .   ? -9.401 25.279 74.678 1.00 60.00 ? 253 HOH B O   1 
HETATM 3077 O  O   . HOH J 4 .   ? -6.439 3.190  64.401 1.00 60.00 ? 254 HOH B O   1 
HETATM 3078 O  O   . HOH J 4 .   ? 23.782 17.798 52.761 1.00 60.00 ? 255 HOH B O   1 
HETATM 3079 O  O   . HOH J 4 .   ? 12.326 18.945 92.289 1.00 60.00 ? 256 HOH B O   1 
HETATM 3080 O  O   . HOH J 4 .   ? 20.079 23.119 81.300 1.00 56.39 ? 257 HOH B O   1 
HETATM 3081 O  O   . HOH J 4 .   ? 18.702 14.644 60.337 1.00 60.00 ? 258 HOH B O   1 
HETATM 3082 O  O   . HOH J 4 .   ? 23.358 8.778  60.539 1.00 60.00 ? 259 HOH B O   1 
HETATM 3083 O  O   . HOH J 4 .   ? -0.533 25.498 79.112 1.00 60.00 ? 260 HOH B O   1 
HETATM 3084 O  O   . HOH J 4 .   ? 3.733  19.211 93.223 1.00 60.00 ? 261 HOH B O   1 
HETATM 3085 O  O   . HOH J 4 .   ? 14.812 -0.716 79.332 1.00 60.00 ? 262 HOH B O   1 
HETATM 3086 O  O   . HOH J 4 .   ? -7.033 6.906  61.197 1.00 60.00 ? 263 HOH B O   1 
HETATM 3087 O  O   . HOH J 4 .   ? -4.996 9.129  57.270 1.00 60.00 ? 264 HOH B O   1 
HETATM 3088 O  O   . HOH J 4 .   ? 22.565 19.959 74.454 1.00 60.00 ? 265 HOH B O   1 
HETATM 3089 O  O   . HOH J 4 .   ? -2.780 20.470 79.757 1.00 60.00 ? 266 HOH B O   1 
HETATM 3090 O  O   . HOH J 4 .   ? 4.840  30.141 73.309 1.00 60.00 ? 267 HOH B O   1 
HETATM 3091 O  O   . HOH J 4 .   ? -3.761 4.007  60.828 1.00 60.00 ? 268 HOH B O   1 
HETATM 3092 O  O   . HOH J 4 .   ? 13.257 0.517  65.970 1.00 46.14 ? 269 HOH B O   1 
HETATM 3093 O  O   . HOH J 4 .   ? 21.833 9.656  93.434 1.00 60.00 ? 270 HOH B O   1 
HETATM 3094 O  O   . HOH J 4 .   ? 2.104  19.271 87.377 1.00 58.51 ? 271 HOH B O   1 
HETATM 3095 O  O   . HOH J 4 .   ? -6.700 9.576  49.325 1.00 60.00 ? 272 HOH B O   1 
HETATM 3096 O  O   . HOH J 4 .   ? 23.103 18.998 65.154 1.00 60.00 ? 273 HOH B O   1 
HETATM 3097 O  O   . HOH J 4 .   ? 13.214 -4.531 76.627 1.00 60.00 ? 274 HOH B O   1 
HETATM 3098 O  O   . HOH J 4 .   ? 13.125 14.889 89.867 1.00 60.00 ? 275 HOH B O   1 
HETATM 3099 O  O   . HOH J 4 .   ? -3.097 26.018 71.655 1.00 60.00 ? 276 HOH B O   1 
HETATM 3100 O  O   . HOH J 4 .   ? 23.137 3.619  70.801 1.00 60.00 ? 277 HOH B O   1 
HETATM 3101 O  O   . HOH J 4 .   ? -0.433 10.186 79.046 1.00 60.00 ? 278 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   2   2   ALA ALA A . n 
A 1 2   ALA 2   3   3   ALA ALA A . n 
A 1 3   VAL 3   4   4   VAL VAL A . n 
A 1 4   ILE 4   5   5   ILE ILE A . n 
A 1 5   LEU 5   6   6   LEU LEU A . n 
A 1 6   GLU 6   7   7   GLU GLU A . n 
A 1 7   SER 7   8   8   SER SER A . n 
A 1 8   ILE 8   9   9   ILE ILE A . n 
A 1 9   PHE 9   10  10  PHE PHE A . n 
A 1 10  LEU 10  11  11  LEU LEU A . n 
A 1 11  LYS 11  12  12  LYS LYS A . n 
A 1 12  ARG 12  13  13  ARG ARG A . n 
A 1 13  SER 13  14  14  SER SER A . n 
A 1 14  GLN 14  15  15  GLN GLN A . n 
A 1 15  GLN 15  16  16  GLN GLN A . n 
A 1 16  LYS 16  17  17  LYS LYS A . n 
A 1 17  LYS 17  18  18  LYS LYS A . n 
A 1 18  LYS 18  19  19  LYS LYS A . n 
A 1 19  THR 19  20  20  THR THR A . n 
A 1 20  SER 20  21  21  SER SER A . n 
A 1 21  PRO 21  22  22  PRO PRO A . n 
A 1 22  LEU 22  23  23  LEU LEU A . n 
A 1 23  ASN 23  24  24  ASN ASN A . n 
A 1 24  PHE 24  25  25  PHE PHE A . n 
A 1 25  LYS 25  26  26  LYS LYS A . n 
A 1 26  LYS 26  27  27  LYS LYS A . n 
A 1 27  ARG 27  28  28  ARG ARG A . n 
A 1 28  LEU 28  29  29  LEU LEU A . n 
A 1 29  PHE 29  30  30  PHE PHE A . n 
A 1 30  LEU 30  31  31  LEU LEU A . n 
A 1 31  LEU 31  32  32  LEU LEU A . n 
A 1 32  THR 32  33  33  THR THR A . n 
A 1 33  VAL 33  34  34  VAL VAL A . n 
A 1 34  HIS 34  35  35  HIS HIS A . n 
A 1 35  LYS 35  36  36  LYS LYS A . n 
A 1 36  LEU 36  37  37  LEU LEU A . n 
A 1 37  SER 37  38  38  SER SER A . n 
A 1 38  TYR 38  39  39  TYR TYR A . n 
A 1 39  TYR 39  40  40  TYR TYR A . n 
A 1 40  LYS 40  41  41  LYS LYS A . n 
A 1 41  TYR 41  42  42  TYR TYR A . n 
A 1 42  ASP 42  43  43  ASP ASP A . n 
A 1 43  PHE 43  44  44  PHE PHE A . n 
A 1 44  GLU 44  45  45  GLU GLU A . n 
A 1 45  ARG 45  46  46  ARG ARG A . n 
A 1 46  GLY 46  47  47  GLY GLY A . n 
A 1 47  ARG 47  48  48  ARG ARG A . n 
A 1 48  ARG 48  49  49  ARG ARG A . n 
A 1 49  GLY 49  50  50  GLY GLY A . n 
A 1 50  SER 50  51  51  SER SER A . n 
A 1 51  LYS 51  52  52  LYS LYS A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  GLY 53  54  54  GLY GLY A . n 
A 1 54  SER 54  55  55  SER SER A . n 
A 1 55  ILE 55  56  56  ILE ILE A . n 
A 1 56  ASP 56  57  57  ASP ASP A . n 
A 1 57  VAL 57  58  58  VAL VAL A . n 
A 1 58  GLU 58  59  59  GLU GLU A . n 
A 1 59  LYS 59  60  60  LYS LYS A . n 
A 1 60  ILE 60  61  61  ILE ILE A . n 
A 1 61  THR 61  62  62  THR THR A . n 
A 1 62  CYS 62  63  63  CYS CYS A . n 
A 1 63  VAL 63  64  64  VAL VAL A . n 
A 1 64  GLU 64  65  65  GLU GLU A . n 
A 1 65  THR 65  66  66  THR THR A . n 
A 1 66  VAL 66  67  67  VAL VAL A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  PRO 68  69  69  PRO PRO A . n 
A 1 69  GLU 69  70  70  GLU GLU A . n 
A 1 70  LYS 70  71  71  LYS LYS A . n 
A 1 71  ASN 71  72  72  ASN ASN A . n 
A 1 72  PRO 72  73  73  PRO PRO A . n 
A 1 73  PRO 73  74  74  PRO PRO A . n 
A 1 74  PRO 74  75  75  PRO PRO A . n 
A 1 75  GLU 75  76  76  GLU GLU A . n 
A 1 76  ARG 76  77  77  ARG ARG A . n 
A 1 77  GLN 77  78  78  GLN GLN A . n 
A 1 78  ILE 78  79  79  ILE ILE A . n 
A 1 79  PRO 79  80  80  PRO PRO A . n 
A 1 80  ARG 80  81  81  ARG ARG A . n 
A 1 81  ARG 81  82  82  ARG ARG A . n 
A 1 82  GLY 82  83  83  GLY GLY A . n 
A 1 83  GLU 83  84  ?   ?   ?   A . n 
A 1 84  GLU 84  85  ?   ?   ?   A . n 
A 1 85  SER 85  86  ?   ?   ?   A . n 
A 1 86  SER 86  87  87  SER SER A . n 
A 1 87  GLU 87  88  88  GLU GLU A . n 
A 1 88  MET 88  89  89  MET MET A . n 
A 1 89  GLU 89  90  90  GLU GLU A . n 
A 1 90  GLN 90  91  91  GLN GLN A . n 
A 1 91  ILE 91  92  92  ILE ILE A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  ILE 93  94  94  ILE ILE A . n 
A 1 94  ILE 94  95  95  ILE ILE A . n 
A 1 95  GLU 95  96  96  GLU GLU A . n 
A 1 96  ARG 96  97  97  ARG ARG A . n 
A 1 97  PHE 97  98  98  PHE PHE A . n 
A 1 98  PRO 98  99  99  PRO PRO A . n 
A 1 99  TYR 99  100 100 TYR TYR A . n 
A 1 100 PRO 100 101 101 PRO PRO A . n 
A 1 101 PHE 101 102 102 PHE PHE A . n 
A 1 102 GLN 102 103 103 GLN GLN A . n 
A 1 103 VAL 103 104 104 VAL VAL A . n 
A 1 104 VAL 104 105 105 VAL VAL A . n 
A 1 105 TYR 105 106 106 TYR TYR A . n 
A 1 106 ASP 106 107 107 ASP ASP A . n 
A 1 107 GLU 107 108 108 GLU GLU A . n 
A 1 108 GLY 108 109 109 GLY GLY A . n 
A 1 109 PRO 109 110 110 PRO PRO A . n 
A 1 110 LEU 110 111 111 LEU LEU A . n 
A 1 111 TYR 111 112 112 TYR TYR A . n 
A 1 112 VAL 112 113 113 VAL VAL A . n 
A 1 113 PHE 113 114 114 PHE PHE A . n 
A 1 114 SER 114 115 115 SER SER A . n 
A 1 115 PRO 115 116 116 PRO PRO A . n 
A 1 116 THR 116 117 117 THR THR A . n 
A 1 117 GLU 117 118 118 GLU GLU A . n 
A 1 118 GLU 118 119 119 GLU GLU A . n 
A 1 119 LEU 119 120 120 LEU LEU A . n 
A 1 120 ARG 120 121 121 ARG ARG A . n 
A 1 121 LYS 121 122 122 LYS LYS A . n 
A 1 122 ARG 122 123 123 ARG ARG A . n 
A 1 123 TRP 123 124 124 TRP TRP A . n 
A 1 124 ILE 124 125 125 ILE ILE A . n 
A 1 125 HIS 125 126 126 HIS HIS A . n 
A 1 126 GLN 126 127 127 GLN GLN A . n 
A 1 127 LEU 127 128 128 LEU LEU A . n 
A 1 128 LYS 128 129 129 LYS LYS A . n 
A 1 129 ASN 129 130 130 ASN ASN A . n 
A 1 130 VAL 130 131 131 VAL VAL A . n 
A 1 131 ILE 131 132 132 ILE ILE A . n 
A 1 132 ARG 132 133 133 ARG ARG A . n 
A 1 133 TYR 133 134 134 TYR TYR A . n 
A 1 134 ASN 134 135 135 ASN ASN A . n 
A 1 135 SER 135 136 136 SER SER A . n 
A 1 136 ASP 136 137 137 ASP ASP A . n 
A 1 137 LEU 137 138 138 LEU LEU A . n 
A 1 138 VAL 138 139 139 VAL VAL A . n 
A 1 139 GLN 139 140 140 GLN GLN A . n 
A 1 140 LYS 140 141 141 LYS LYS A . n 
A 1 141 TYR 141 142 142 TYR TYR A . n 
A 1 142 HIS 142 143 143 HIS HIS A . n 
A 1 143 PRO 143 144 144 PRO PRO A . n 
A 1 144 CYS 144 145 145 CYS CYS A . n 
A 1 145 PHE 145 146 146 PHE PHE A . n 
A 1 146 TRP 146 147 147 TRP TRP A . n 
A 1 147 ILE 147 148 148 ILE ILE A . n 
A 1 148 ASP 148 149 149 ASP ASP A . n 
A 1 149 GLY 149 150 150 GLY GLY A . n 
A 1 150 GLN 150 151 151 GLN GLN A . n 
A 1 151 TYR 151 152 152 TYR TYR A . n 
A 1 152 LEU 152 153 153 LEU LEU A . n 
A 1 153 CYS 153 154 154 CYS CYS A . n 
A 1 154 CYS 154 155 155 CYS CYS A . n 
A 1 155 SER 155 156 156 SER SER A . n 
A 1 156 GLN 156 157 157 GLN GLN A . n 
A 1 157 THR 157 158 158 THR THR A . n 
A 1 158 ALA 158 159 159 ALA ALA A . n 
A 1 159 LYS 159 160 160 LYS LYS A . n 
A 1 160 ASN 160 161 161 ASN ASN A . n 
A 1 161 ALA 161 162 162 ALA ALA A . n 
A 1 162 MET 162 163 163 MET MET A . n 
A 1 163 GLY 163 164 164 GLY GLY A . n 
A 1 164 CYS 164 165 165 CYS CYS A . n 
A 1 165 GLN 165 166 166 GLN GLN A . n 
A 1 166 ILE 166 167 167 ILE ILE A . n 
A 1 167 LEU 167 168 168 LEU LEU A . n 
A 1 168 GLU 168 169 169 GLU GLU A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
B 1 1   ALA 1   2   2   ALA ALA B . n 
B 1 2   ALA 2   3   3   ALA ALA B . n 
B 1 3   VAL 3   4   4   VAL VAL B . n 
B 1 4   ILE 4   5   5   ILE ILE B . n 
B 1 5   LEU 5   6   6   LEU LEU B . n 
B 1 6   GLU 6   7   7   GLU GLU B . n 
B 1 7   SER 7   8   8   SER SER B . n 
B 1 8   ILE 8   9   9   ILE ILE B . n 
B 1 9   PHE 9   10  10  PHE PHE B . n 
B 1 10  LEU 10  11  11  LEU LEU B . n 
B 1 11  LYS 11  12  12  LYS LYS B . n 
B 1 12  ARG 12  13  13  ARG ARG B . n 
B 1 13  SER 13  14  14  SER SER B . n 
B 1 14  GLN 14  15  15  GLN GLN B . n 
B 1 15  GLN 15  16  16  GLN GLN B . n 
B 1 16  LYS 16  17  17  LYS LYS B . n 
B 1 17  LYS 17  18  18  LYS LYS B . n 
B 1 18  LYS 18  19  19  LYS LYS B . n 
B 1 19  THR 19  20  20  THR THR B . n 
B 1 20  SER 20  21  21  SER SER B . n 
B 1 21  PRO 21  22  22  PRO PRO B . n 
B 1 22  LEU 22  23  23  LEU LEU B . n 
B 1 23  ASN 23  24  24  ASN ASN B . n 
B 1 24  PHE 24  25  25  PHE PHE B . n 
B 1 25  LYS 25  26  26  LYS LYS B . n 
B 1 26  LYS 26  27  27  LYS LYS B . n 
B 1 27  ARG 27  28  28  ARG ARG B . n 
B 1 28  LEU 28  29  29  LEU LEU B . n 
B 1 29  PHE 29  30  30  PHE PHE B . n 
B 1 30  LEU 30  31  31  LEU LEU B . n 
B 1 31  LEU 31  32  32  LEU LEU B . n 
B 1 32  THR 32  33  33  THR THR B . n 
B 1 33  VAL 33  34  34  VAL VAL B . n 
B 1 34  HIS 34  35  35  HIS HIS B . n 
B 1 35  LYS 35  36  36  LYS LYS B . n 
B 1 36  LEU 36  37  37  LEU LEU B . n 
B 1 37  SER 37  38  38  SER SER B . n 
B 1 38  TYR 38  39  39  TYR TYR B . n 
B 1 39  TYR 39  40  40  TYR TYR B . n 
B 1 40  LYS 40  41  41  LYS LYS B . n 
B 1 41  TYR 41  42  42  TYR TYR B . n 
B 1 42  ASP 42  43  43  ASP ASP B . n 
B 1 43  PHE 43  44  44  PHE PHE B . n 
B 1 44  GLU 44  45  45  GLU GLU B . n 
B 1 45  ARG 45  46  46  ARG ARG B . n 
B 1 46  GLY 46  47  47  GLY GLY B . n 
B 1 47  ARG 47  48  48  ARG ARG B . n 
B 1 48  ARG 48  49  49  ARG ARG B . n 
B 1 49  GLY 49  50  50  GLY GLY B . n 
B 1 50  SER 50  51  51  SER SER B . n 
B 1 51  LYS 51  52  52  LYS LYS B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  GLY 53  54  54  GLY GLY B . n 
B 1 54  SER 54  55  55  SER SER B . n 
B 1 55  ILE 55  56  56  ILE ILE B . n 
B 1 56  ASP 56  57  57  ASP ASP B . n 
B 1 57  VAL 57  58  58  VAL VAL B . n 
B 1 58  GLU 58  59  59  GLU GLU B . n 
B 1 59  LYS 59  60  60  LYS LYS B . n 
B 1 60  ILE 60  61  61  ILE ILE B . n 
B 1 61  THR 61  62  62  THR THR B . n 
B 1 62  CYS 62  63  63  CYS CYS B . n 
B 1 63  VAL 63  64  64  VAL VAL B . n 
B 1 64  GLU 64  65  65  GLU GLU B . n 
B 1 65  THR 65  66  66  THR THR B . n 
B 1 66  VAL 66  67  67  VAL VAL B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  PRO 68  69  69  PRO PRO B . n 
B 1 69  GLU 69  70  70  GLU GLU B . n 
B 1 70  LYS 70  71  71  LYS LYS B . n 
B 1 71  ASN 71  72  72  ASN ASN B . n 
B 1 72  PRO 72  73  73  PRO PRO B . n 
B 1 73  PRO 73  74  74  PRO PRO B . n 
B 1 74  PRO 74  75  75  PRO PRO B . n 
B 1 75  GLU 75  76  76  GLU GLU B . n 
B 1 76  ARG 76  77  77  ARG ARG B . n 
B 1 77  GLN 77  78  78  GLN GLN B . n 
B 1 78  ILE 78  79  79  ILE ILE B . n 
B 1 79  PRO 79  80  ?   ?   ?   B . n 
B 1 80  ARG 80  81  ?   ?   ?   B . n 
B 1 81  ARG 81  82  ?   ?   ?   B . n 
B 1 82  GLY 82  83  ?   ?   ?   B . n 
B 1 83  GLU 83  84  ?   ?   ?   B . n 
B 1 84  GLU 84  85  ?   ?   ?   B . n 
B 1 85  SER 85  86  ?   ?   ?   B . n 
B 1 86  SER 86  87  ?   ?   ?   B . n 
B 1 87  GLU 87  88  88  GLU GLU B . n 
B 1 88  MET 88  89  89  MET MET B . n 
B 1 89  GLU 89  90  90  GLU GLU B . n 
B 1 90  GLN 90  91  91  GLN GLN B . n 
B 1 91  ILE 91  92  92  ILE ILE B . n 
B 1 92  SER 92  93  93  SER SER B . n 
B 1 93  ILE 93  94  94  ILE ILE B . n 
B 1 94  ILE 94  95  95  ILE ILE B . n 
B 1 95  GLU 95  96  96  GLU GLU B . n 
B 1 96  ARG 96  97  97  ARG ARG B . n 
B 1 97  PHE 97  98  98  PHE PHE B . n 
B 1 98  PRO 98  99  99  PRO PRO B . n 
B 1 99  TYR 99  100 100 TYR TYR B . n 
B 1 100 PRO 100 101 101 PRO PRO B . n 
B 1 101 PHE 101 102 102 PHE PHE B . n 
B 1 102 GLN 102 103 103 GLN GLN B . n 
B 1 103 VAL 103 104 104 VAL VAL B . n 
B 1 104 VAL 104 105 105 VAL VAL B . n 
B 1 105 TYR 105 106 106 TYR TYR B . n 
B 1 106 ASP 106 107 107 ASP ASP B . n 
B 1 107 GLU 107 108 108 GLU GLU B . n 
B 1 108 GLY 108 109 109 GLY GLY B . n 
B 1 109 PRO 109 110 110 PRO PRO B . n 
B 1 110 LEU 110 111 111 LEU LEU B . n 
B 1 111 TYR 111 112 112 TYR TYR B . n 
B 1 112 VAL 112 113 113 VAL VAL B . n 
B 1 113 PHE 113 114 114 PHE PHE B . n 
B 1 114 SER 114 115 115 SER SER B . n 
B 1 115 PRO 115 116 116 PRO PRO B . n 
B 1 116 THR 116 117 117 THR THR B . n 
B 1 117 GLU 117 118 118 GLU GLU B . n 
B 1 118 GLU 118 119 119 GLU GLU B . n 
B 1 119 LEU 119 120 120 LEU LEU B . n 
B 1 120 ARG 120 121 121 ARG ARG B . n 
B 1 121 LYS 121 122 122 LYS LYS B . n 
B 1 122 ARG 122 123 123 ARG ARG B . n 
B 1 123 TRP 123 124 124 TRP TRP B . n 
B 1 124 ILE 124 125 125 ILE ILE B . n 
B 1 125 HIS 125 126 126 HIS HIS B . n 
B 1 126 GLN 126 127 127 GLN GLN B . n 
B 1 127 LEU 127 128 128 LEU LEU B . n 
B 1 128 LYS 128 129 129 LYS LYS B . n 
B 1 129 ASN 129 130 130 ASN ASN B . n 
B 1 130 VAL 130 131 131 VAL VAL B . n 
B 1 131 ILE 131 132 132 ILE ILE B . n 
B 1 132 ARG 132 133 133 ARG ARG B . n 
B 1 133 TYR 133 134 134 TYR TYR B . n 
B 1 134 ASN 134 135 135 ASN ASN B . n 
B 1 135 SER 135 136 136 SER SER B . n 
B 1 136 ASP 136 137 137 ASP ASP B . n 
B 1 137 LEU 137 138 138 LEU LEU B . n 
B 1 138 VAL 138 139 139 VAL VAL B . n 
B 1 139 GLN 139 140 140 GLN GLN B . n 
B 1 140 LYS 140 141 141 LYS LYS B . n 
B 1 141 TYR 141 142 142 TYR TYR B . n 
B 1 142 HIS 142 143 143 HIS HIS B . n 
B 1 143 PRO 143 144 144 PRO PRO B . n 
B 1 144 CYS 144 145 145 CYS CYS B . n 
B 1 145 PHE 145 146 146 PHE PHE B . n 
B 1 146 TRP 146 147 147 TRP TRP B . n 
B 1 147 ILE 147 148 148 ILE ILE B . n 
B 1 148 ASP 148 149 149 ASP ASP B . n 
B 1 149 GLY 149 150 150 GLY GLY B . n 
B 1 150 GLN 150 151 151 GLN GLN B . n 
B 1 151 TYR 151 152 152 TYR TYR B . n 
B 1 152 LEU 152 153 153 LEU LEU B . n 
B 1 153 CYS 153 154 154 CYS CYS B . n 
B 1 154 CYS 154 155 155 CYS CYS B . n 
B 1 155 SER 155 156 156 SER SER B . n 
B 1 156 GLN 156 157 157 GLN GLN B . n 
B 1 157 THR 157 158 158 THR THR B . n 
B 1 158 ALA 158 159 159 ALA ALA B . n 
B 1 159 LYS 159 160 160 LYS LYS B . n 
B 1 160 ASN 160 161 161 ASN ASN B . n 
B 1 161 ALA 161 162 162 ALA ALA B . n 
B 1 162 MET 162 163 163 MET MET B . n 
B 1 163 GLY 163 164 164 GLY GLY B . n 
B 1 164 CYS 164 165 165 CYS CYS B . n 
B 1 165 GLN 165 166 166 GLN GLN B . n 
B 1 166 ILE 166 167 167 ILE ILE B . n 
B 1 167 LEU 167 168 168 LEU LEU B . n 
B 1 168 GLU 168 169 169 GLU GLU B . n 
B 1 169 ASN 169 170 170 ASN ASN B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  tetrameric 4 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,B,C,D,E,F,G,H,I,J 
2 1,3 A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 12230 ? 
2 MORE         -46   ? 
2 'SSA (A^2)'  32120 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z           1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 6_555  x,-y+1/2,-z+1/4 1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 
-1.0000000000 0.0000000000 55.3920000000 0.0000000000 0.0000000000 -1.0000000000 53.9000000000 
3 'crystal symmetry operation' 10_555 -x,-y,z         -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
-1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A 4IP 172 ? E 4IP . 
2 1 B 4IP 172 ? H 4IP . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? A HIS 142 ? A HIS 143 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 SG ? A CYS 153 ? A CYS 154 ? 1_555 110.0 ? 
2  ND1 ? A HIS 142 ? A HIS 143 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 SG ? A CYS 154 ? A CYS 155 ? 1_555 101.4 ? 
3  SG  ? A CYS 153 ? A CYS 154 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 SG ? A CYS 154 ? A CYS 155 ? 1_555 117.0 ? 
4  ND1 ? A HIS 142 ? A HIS 143 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 SG ? A CYS 164 ? A CYS 165 ? 1_555 117.7 ? 
5  SG  ? A CYS 153 ? A CYS 154 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 SG ? A CYS 164 ? A CYS 165 ? 1_555 100.1 ? 
6  SG  ? A CYS 154 ? A CYS 155 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 SG ? A CYS 164 ? A CYS 165 ? 1_555 111.5 ? 
7  ND1 ? B HIS 142 ? B HIS 143 ? 1_555 ZN ? F ZN . ? B ZN 171 ? 1_555 SG ? B CYS 153 ? B CYS 154 ? 1_555 105.8 ? 
8  ND1 ? B HIS 142 ? B HIS 143 ? 1_555 ZN ? F ZN . ? B ZN 171 ? 1_555 SG ? B CYS 154 ? B CYS 155 ? 1_555 88.4  ? 
9  SG  ? B CYS 153 ? B CYS 154 ? 1_555 ZN ? F ZN . ? B ZN 171 ? 1_555 SG ? B CYS 154 ? B CYS 155 ? 1_555 108.7 ? 
10 ND1 ? B HIS 142 ? B HIS 143 ? 1_555 ZN ? F ZN . ? B ZN 171 ? 1_555 SG ? B CYS 164 ? B CYS 165 ? 1_555 118.1 ? 
11 SG  ? B CYS 153 ? B CYS 154 ? 1_555 ZN ? F ZN . ? B ZN 171 ? 1_555 SG ? B CYS 164 ? B CYS 165 ? 1_555 106.3 ? 
12 SG  ? B CYS 154 ? B CYS 155 ? 1_555 ZN ? F ZN . ? B ZN 171 ? 1_555 SG ? B CYS 164 ? B CYS 165 ? 1_555 127.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-06-15 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .  ? 1 
TNT       refinement       5E ? 2 
DENZO     'data reduction' .  ? 3 
SCALEPACK 'data scaling'   .  ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLN 127 ? ? O   A HOH 335 ? ? 2.02 
2 1 O   B TYR 152 ? ? N   B CYS 154 ? ? 2.08 
3 1 OH  A TYR 42  ? ? OE2 B GLU 96  ? ? 2.14 
4 1 NZ  B LYS 60  ? ? O   B HOH 213 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O6P B 4IP 172 ? ? 1_555 O   B HOH 268 ? ? 10_555 2.08 
2 1 NZ  A LYS 53  ? ? 1_555 O5P A 4IP 172 ? ? 10_555 2.13 
3 1 O8P B 4IP 172 ? ? 1_555 O   B HOH 268 ? ? 10_555 2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 90  ? ? OE2 A GLU 90  ? ? 1.357 1.252 0.105 0.011 N 
2 1 CD B GLU 90  ? ? OE1 B GLU 90  ? ? 1.322 1.252 0.070 0.011 N 
3 1 CD B GLU 119 ? ? OE2 B GLU 119 ? ? 1.329 1.252 0.077 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  B ASN 72  ? ? N  B PRO 73  ? ? CD B PRO 73  ? ? 113.66 128.40 -14.74 2.10 Y 
2 1 CA B CYS 155 ? ? CB B CYS 155 ? ? SG B CYS 155 ? ? 102.60 114.00 -11.40 1.80 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 CYS A 63  ? ? -170.09 142.79  
2  1 PRO A 80  ? ? -34.21  134.53  
3  1 ARG A 82  ? ? -169.45 -59.15  
4  1 GLU B 7   ? ? -164.84 118.77  
5  1 PRO B 73  ? ? -32.07  141.25  
6  1 PRO B 75  ? ? -27.13  -60.50  
7  1 MET B 89  ? ? -66.36  7.06    
8  1 GLN B 91  ? ? -37.36  -33.73  
9  1 ASP B 149 ? ? 47.15   10.39   
10 1 TYR B 152 ? ? -63.58  83.01   
11 1 LEU B 153 ? ? -23.72  -22.11  
12 1 CYS B 154 ? ? -92.55  -63.67  
13 1 GLN B 157 ? ? -52.40  -171.49 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A LYS 19  ? CD  ? A LYS 18  CD  
2  1 Y 0 A LYS 19  ? CE  ? A LYS 18  CE  
3  1 Y 0 A LYS 19  ? NZ  ? A LYS 18  NZ  
4  1 Y 0 A LYS 27  ? NZ  ? A LYS 26  NZ  
5  1 Y 0 A ARG 46  ? CZ  ? A ARG 45  CZ  
6  1 Y 0 A ARG 46  ? NH1 ? A ARG 45  NH1 
7  1 Y 0 A ARG 46  ? NH2 ? A ARG 45  NH2 
8  1 Y 0 A ARG 48  ? NE  ? A ARG 47  NE  
9  1 Y 0 A ARG 48  ? CZ  ? A ARG 47  CZ  
10 1 Y 0 A ARG 48  ? NH1 ? A ARG 47  NH1 
11 1 Y 0 A ARG 48  ? NH2 ? A ARG 47  NH2 
12 1 Y 0 A LYS 60  ? CE  ? A LYS 59  CE  
13 1 Y 0 A LYS 60  ? NZ  ? A LYS 59  NZ  
14 1 Y 1 A SER 87  ? OG  ? A SER 86  OG  
15 1 Y 1 A GLU 88  ? CG  ? A GLU 87  CG  
16 1 Y 1 A GLU 88  ? CD  ? A GLU 87  CD  
17 1 Y 1 A GLU 88  ? OE1 ? A GLU 87  OE1 
18 1 Y 1 A GLU 88  ? OE2 ? A GLU 87  OE2 
19 1 Y 0 A MET 89  ? CG  ? A MET 88  CG  
20 1 Y 0 A MET 89  ? SD  ? A MET 88  SD  
21 1 Y 0 A MET 89  ? CE  ? A MET 88  CE  
22 1 Y 0 A LYS 122 ? CD  ? A LYS 121 CD  
23 1 Y 0 A LYS 122 ? CE  ? A LYS 121 CE  
24 1 Y 0 A LYS 122 ? NZ  ? A LYS 121 NZ  
25 1 Y 0 A ARG 123 ? NE  ? A ARG 122 NE  
26 1 Y 0 A ARG 123 ? CZ  ? A ARG 122 CZ  
27 1 Y 0 A ARG 123 ? NH1 ? A ARG 122 NH1 
28 1 Y 0 A ARG 123 ? NH2 ? A ARG 122 NH2 
29 1 Y 0 B LYS 19  ? CD  ? B LYS 18  CD  
30 1 Y 0 B LYS 19  ? CE  ? B LYS 18  CE  
31 1 Y 0 B LYS 19  ? NZ  ? B LYS 18  NZ  
32 1 Y 0 B LYS 36  ? CE  ? B LYS 35  CE  
33 1 Y 0 B LYS 36  ? NZ  ? B LYS 35  NZ  
34 1 Y 0 B ARG 46  ? CZ  ? B ARG 45  CZ  
35 1 Y 0 B ARG 46  ? NH1 ? B ARG 45  NH1 
36 1 Y 0 B ARG 46  ? NH2 ? B ARG 45  NH2 
37 1 Y 0 B ARG 48  ? NE  ? B ARG 47  NE  
38 1 Y 0 B ARG 48  ? CZ  ? B ARG 47  CZ  
39 1 Y 0 B ARG 48  ? NH1 ? B ARG 47  NH1 
40 1 Y 0 B ARG 48  ? NH2 ? B ARG 47  NH2 
41 1 Y 0 B GLU 59  ? OE1 ? B GLU 58  OE1 
42 1 Y 0 B GLU 59  ? OE2 ? B GLU 58  OE2 
43 1 Y 0 B GLU 76  ? CG  ? B GLU 75  CG  
44 1 Y 0 B GLU 76  ? CD  ? B GLU 75  CD  
45 1 Y 0 B GLU 76  ? OE1 ? B GLU 75  OE1 
46 1 Y 0 B GLU 76  ? OE2 ? B GLU 75  OE2 
47 1 Y 1 B GLU 88  ? CG  ? B GLU 87  CG  
48 1 Y 1 B GLU 88  ? CD  ? B GLU 87  CD  
49 1 Y 1 B GLU 88  ? OE1 ? B GLU 87  OE1 
50 1 Y 1 B GLU 88  ? OE2 ? B GLU 87  OE2 
51 1 Y 0 B MET 89  ? CB  ? B MET 88  CB  
52 1 Y 0 B MET 89  ? CG  ? B MET 88  CG  
53 1 Y 0 B MET 89  ? SD  ? B MET 88  SD  
54 1 Y 0 B MET 89  ? CE  ? B MET 88  CE  
55 1 Y 0 B GLU 118 ? CD  ? B GLU 117 CD  
56 1 Y 0 B GLU 118 ? OE1 ? B GLU 117 OE1 
57 1 Y 0 B GLU 118 ? OE2 ? B GLU 117 OE2 
58 1 Y 0 B LYS 141 ? CD  ? B LYS 140 CD  
59 1 Y 0 B LYS 141 ? CE  ? B LYS 140 CE  
60 1 Y 0 B LYS 141 ? NZ  ? B LYS 140 NZ  
61 1 Y 0 B GLN 151 ? CB  ? B GLN 150 CB  
62 1 Y 0 B GLN 151 ? CG  ? B GLN 150 CG  
63 1 Y 0 B GLN 151 ? CD  ? B GLN 150 CD  
64 1 Y 0 B GLN 151 ? OE1 ? B GLN 150 OE1 
65 1 Y 0 B GLN 151 ? NE2 ? B GLN 150 NE2 
66 1 Y 0 B LYS 160 ? NZ  ? B LYS 159 NZ  
67 1 Y 0 B ASN 161 ? CG  ? B ASN 160 CG  
68 1 Y 0 B ASN 161 ? OD1 ? B ASN 160 OD1 
69 1 Y 0 B ASN 161 ? ND2 ? B ASN 160 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 84 ? A GLU 83 
2  1 Y 1 A GLU 85 ? A GLU 84 
3  1 Y 1 A SER 86 ? A SER 85 
4  1 Y 1 B PRO 80 ? B PRO 79 
5  1 Y 1 B ARG 81 ? B ARG 80 
6  1 Y 1 B ARG 82 ? B ARG 81 
7  1 Y 1 B GLY 83 ? B GLY 82 
8  1 Y 1 B GLU 84 ? B GLU 83 
9  1 Y 1 B GLU 85 ? B GLU 84 
10 1 Y 1 B SER 86 ? B SER 85 
11 1 Y 1 B SER 87 ? B SER 86 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                             ZN  
3 'INOSITOL-(1,3,4,5)-TETRAKISPHOSPHATE' 4IP 
4 water                                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1   171 3   ZN  ZN  A . 
D 3 4IP 1   1   1   4IP 4IP A . 
E 3 4IP 1   172 2   4IP 4IP A . 
F 2 ZN  1   171 4   ZN  ZN  B . 
G 3 4IP 1   1   1   4IP 4IP B . 
H 3 4IP 1   172 2   4IP 4IP B . 
I 4 HOH 1   173 1   HOH HOH A . 
I 4 HOH 2   174 2   HOH HOH A . 
I 4 HOH 3   175 3   HOH HOH A . 
I 4 HOH 4   176 4   HOH HOH A . 
I 4 HOH 5   177 5   HOH HOH A . 
I 4 HOH 6   178 6   HOH HOH A . 
I 4 HOH 7   179 7   HOH HOH A . 
I 4 HOH 8   180 8   HOH HOH A . 
I 4 HOH 9   181 9   HOH HOH A . 
I 4 HOH 10  182 12  HOH HOH A . 
I 4 HOH 11  183 13  HOH HOH A . 
I 4 HOH 12  184 14  HOH HOH A . 
I 4 HOH 13  185 15  HOH HOH A . 
I 4 HOH 14  186 16  HOH HOH A . 
I 4 HOH 15  187 17  HOH HOH A . 
I 4 HOH 16  188 24  HOH HOH A . 
I 4 HOH 17  189 28  HOH HOH A . 
I 4 HOH 18  190 30  HOH HOH A . 
I 4 HOH 19  191 31  HOH HOH A . 
I 4 HOH 20  192 32  HOH HOH A . 
I 4 HOH 21  193 33  HOH HOH A . 
I 4 HOH 22  194 36  HOH HOH A . 
I 4 HOH 23  195 37  HOH HOH A . 
I 4 HOH 24  196 38  HOH HOH A . 
I 4 HOH 25  197 39  HOH HOH A . 
I 4 HOH 26  198 41  HOH HOH A . 
I 4 HOH 27  199 42  HOH HOH A . 
I 4 HOH 28  200 44  HOH HOH A . 
I 4 HOH 29  201 45  HOH HOH A . 
I 4 HOH 30  202 46  HOH HOH A . 
I 4 HOH 31  203 48  HOH HOH A . 
I 4 HOH 32  204 49  HOH HOH A . 
I 4 HOH 33  205 50  HOH HOH A . 
I 4 HOH 34  206 51  HOH HOH A . 
I 4 HOH 35  207 52  HOH HOH A . 
I 4 HOH 36  208 53  HOH HOH A . 
I 4 HOH 37  209 54  HOH HOH A . 
I 4 HOH 38  210 55  HOH HOH A . 
I 4 HOH 39  211 56  HOH HOH A . 
I 4 HOH 40  212 58  HOH HOH A . 
I 4 HOH 41  213 60  HOH HOH A . 
I 4 HOH 42  214 61  HOH HOH A . 
I 4 HOH 43  215 62  HOH HOH A . 
I 4 HOH 44  216 63  HOH HOH A . 
I 4 HOH 45  217 64  HOH HOH A . 
I 4 HOH 46  218 65  HOH HOH A . 
I 4 HOH 47  219 66  HOH HOH A . 
I 4 HOH 48  220 68  HOH HOH A . 
I 4 HOH 49  221 69  HOH HOH A . 
I 4 HOH 50  222 71  HOH HOH A . 
I 4 HOH 51  223 72  HOH HOH A . 
I 4 HOH 52  224 73  HOH HOH A . 
I 4 HOH 53  225 74  HOH HOH A . 
I 4 HOH 54  226 75  HOH HOH A . 
I 4 HOH 55  227 77  HOH HOH A . 
I 4 HOH 56  228 78  HOH HOH A . 
I 4 HOH 57  229 79  HOH HOH A . 
I 4 HOH 58  230 80  HOH HOH A . 
I 4 HOH 59  231 82  HOH HOH A . 
I 4 HOH 60  232 84  HOH HOH A . 
I 4 HOH 61  233 90  HOH HOH A . 
I 4 HOH 62  234 91  HOH HOH A . 
I 4 HOH 63  235 92  HOH HOH A . 
I 4 HOH 64  236 93  HOH HOH A . 
I 4 HOH 65  237 95  HOH HOH A . 
I 4 HOH 66  238 96  HOH HOH A . 
I 4 HOH 67  239 98  HOH HOH A . 
I 4 HOH 68  240 99  HOH HOH A . 
I 4 HOH 69  241 100 HOH HOH A . 
I 4 HOH 70  242 101 HOH HOH A . 
I 4 HOH 71  243 103 HOH HOH A . 
I 4 HOH 72  244 104 HOH HOH A . 
I 4 HOH 73  245 107 HOH HOH A . 
I 4 HOH 74  246 109 HOH HOH A . 
I 4 HOH 75  247 110 HOH HOH A . 
I 4 HOH 76  248 113 HOH HOH A . 
I 4 HOH 77  249 114 HOH HOH A . 
I 4 HOH 78  250 115 HOH HOH A . 
I 4 HOH 79  251 116 HOH HOH A . 
I 4 HOH 80  252 117 HOH HOH A . 
I 4 HOH 81  253 119 HOH HOH A . 
I 4 HOH 82  254 120 HOH HOH A . 
I 4 HOH 83  255 121 HOH HOH A . 
I 4 HOH 84  256 122 HOH HOH A . 
I 4 HOH 85  257 124 HOH HOH A . 
I 4 HOH 86  258 125 HOH HOH A . 
I 4 HOH 87  259 126 HOH HOH A . 
I 4 HOH 88  260 128 HOH HOH A . 
I 4 HOH 89  261 129 HOH HOH A . 
I 4 HOH 90  262 135 HOH HOH A . 
I 4 HOH 91  263 136 HOH HOH A . 
I 4 HOH 92  264 138 HOH HOH A . 
I 4 HOH 93  265 140 HOH HOH A . 
I 4 HOH 94  266 141 HOH HOH A . 
I 4 HOH 95  267 142 HOH HOH A . 
I 4 HOH 96  268 143 HOH HOH A . 
I 4 HOH 97  269 144 HOH HOH A . 
I 4 HOH 98  270 145 HOH HOH A . 
I 4 HOH 99  271 146 HOH HOH A . 
I 4 HOH 100 272 148 HOH HOH A . 
I 4 HOH 101 273 149 HOH HOH A . 
I 4 HOH 102 274 151 HOH HOH A . 
I 4 HOH 103 275 152 HOH HOH A . 
I 4 HOH 104 276 154 HOH HOH A . 
I 4 HOH 105 277 155 HOH HOH A . 
I 4 HOH 106 278 157 HOH HOH A . 
I 4 HOH 107 279 158 HOH HOH A . 
I 4 HOH 108 280 159 HOH HOH A . 
I 4 HOH 109 281 160 HOH HOH A . 
I 4 HOH 110 282 162 HOH HOH A . 
I 4 HOH 111 283 166 HOH HOH A . 
I 4 HOH 112 284 167 HOH HOH A . 
I 4 HOH 113 285 171 HOH HOH A . 
I 4 HOH 114 286 172 HOH HOH A . 
I 4 HOH 115 287 174 HOH HOH A . 
I 4 HOH 116 288 175 HOH HOH A . 
I 4 HOH 117 289 176 HOH HOH A . 
I 4 HOH 118 290 179 HOH HOH A . 
I 4 HOH 119 291 180 HOH HOH A . 
I 4 HOH 120 292 182 HOH HOH A . 
I 4 HOH 121 293 184 HOH HOH A . 
I 4 HOH 122 294 189 HOH HOH A . 
I 4 HOH 123 295 191 HOH HOH A . 
I 4 HOH 124 296 192 HOH HOH A . 
I 4 HOH 125 297 193 HOH HOH A . 
I 4 HOH 126 298 194 HOH HOH A . 
I 4 HOH 127 299 195 HOH HOH A . 
I 4 HOH 128 300 196 HOH HOH A . 
I 4 HOH 129 301 199 HOH HOH A . 
I 4 HOH 130 302 201 HOH HOH A . 
I 4 HOH 131 303 202 HOH HOH A . 
I 4 HOH 132 304 203 HOH HOH A . 
I 4 HOH 133 305 206 HOH HOH A . 
I 4 HOH 134 306 207 HOH HOH A . 
I 4 HOH 135 307 209 HOH HOH A . 
I 4 HOH 136 308 210 HOH HOH A . 
I 4 HOH 137 309 211 HOH HOH A . 
I 4 HOH 138 310 213 HOH HOH A . 
I 4 HOH 139 311 214 HOH HOH A . 
I 4 HOH 140 312 219 HOH HOH A . 
I 4 HOH 141 313 221 HOH HOH A . 
I 4 HOH 142 314 223 HOH HOH A . 
I 4 HOH 143 315 224 HOH HOH A . 
I 4 HOH 144 316 225 HOH HOH A . 
I 4 HOH 145 317 226 HOH HOH A . 
I 4 HOH 146 318 229 HOH HOH A . 
I 4 HOH 147 319 230 HOH HOH A . 
I 4 HOH 148 320 234 HOH HOH A . 
I 4 HOH 149 321 236 HOH HOH A . 
I 4 HOH 150 322 238 HOH HOH A . 
I 4 HOH 151 323 241 HOH HOH A . 
I 4 HOH 152 324 243 HOH HOH A . 
I 4 HOH 153 325 244 HOH HOH A . 
I 4 HOH 154 326 250 HOH HOH A . 
I 4 HOH 155 327 254 HOH HOH A . 
I 4 HOH 156 328 256 HOH HOH A . 
I 4 HOH 157 329 257 HOH HOH A . 
I 4 HOH 158 330 261 HOH HOH A . 
I 4 HOH 159 331 265 HOH HOH A . 
I 4 HOH 160 332 268 HOH HOH A . 
I 4 HOH 161 333 269 HOH HOH A . 
I 4 HOH 162 334 271 HOH HOH A . 
I 4 HOH 163 335 274 HOH HOH A . 
I 4 HOH 164 336 275 HOH HOH A . 
I 4 HOH 165 337 277 HOH HOH A . 
I 4 HOH 166 338 281 HOH HOH A . 
I 4 HOH 167 339 282 HOH HOH A . 
J 4 HOH 1   173 10  HOH HOH B . 
J 4 HOH 2   174 11  HOH HOH B . 
J 4 HOH 3   175 18  HOH HOH B . 
J 4 HOH 4   176 19  HOH HOH B . 
J 4 HOH 5   177 20  HOH HOH B . 
J 4 HOH 6   178 21  HOH HOH B . 
J 4 HOH 7   179 26  HOH HOH B . 
J 4 HOH 8   180 27  HOH HOH B . 
J 4 HOH 9   181 29  HOH HOH B . 
J 4 HOH 10  182 34  HOH HOH B . 
J 4 HOH 11  183 35  HOH HOH B . 
J 4 HOH 12  184 40  HOH HOH B . 
J 4 HOH 13  185 43  HOH HOH B . 
J 4 HOH 14  186 47  HOH HOH B . 
J 4 HOH 15  187 57  HOH HOH B . 
J 4 HOH 16  188 59  HOH HOH B . 
J 4 HOH 17  189 67  HOH HOH B . 
J 4 HOH 18  190 70  HOH HOH B . 
J 4 HOH 19  191 76  HOH HOH B . 
J 4 HOH 20  192 81  HOH HOH B . 
J 4 HOH 21  193 83  HOH HOH B . 
J 4 HOH 22  194 85  HOH HOH B . 
J 4 HOH 23  195 86  HOH HOH B . 
J 4 HOH 24  196 87  HOH HOH B . 
J 4 HOH 25  197 88  HOH HOH B . 
J 4 HOH 26  198 89  HOH HOH B . 
J 4 HOH 27  199 94  HOH HOH B . 
J 4 HOH 28  200 97  HOH HOH B . 
J 4 HOH 29  201 102 HOH HOH B . 
J 4 HOH 30  202 106 HOH HOH B . 
J 4 HOH 31  203 108 HOH HOH B . 
J 4 HOH 32  204 111 HOH HOH B . 
J 4 HOH 33  205 112 HOH HOH B . 
J 4 HOH 34  206 118 HOH HOH B . 
J 4 HOH 35  207 123 HOH HOH B . 
J 4 HOH 36  208 127 HOH HOH B . 
J 4 HOH 37  209 130 HOH HOH B . 
J 4 HOH 38  210 131 HOH HOH B . 
J 4 HOH 39  211 132 HOH HOH B . 
J 4 HOH 40  212 133 HOH HOH B . 
J 4 HOH 41  213 134 HOH HOH B . 
J 4 HOH 42  214 137 HOH HOH B . 
J 4 HOH 43  215 139 HOH HOH B . 
J 4 HOH 44  216 147 HOH HOH B . 
J 4 HOH 45  217 150 HOH HOH B . 
J 4 HOH 46  218 153 HOH HOH B . 
J 4 HOH 47  219 156 HOH HOH B . 
J 4 HOH 48  220 161 HOH HOH B . 
J 4 HOH 49  221 163 HOH HOH B . 
J 4 HOH 50  222 164 HOH HOH B . 
J 4 HOH 51  223 165 HOH HOH B . 
J 4 HOH 52  224 168 HOH HOH B . 
J 4 HOH 53  225 169 HOH HOH B . 
J 4 HOH 54  226 170 HOH HOH B . 
J 4 HOH 55  227 173 HOH HOH B . 
J 4 HOH 56  228 177 HOH HOH B . 
J 4 HOH 57  229 178 HOH HOH B . 
J 4 HOH 58  230 181 HOH HOH B . 
J 4 HOH 59  231 185 HOH HOH B . 
J 4 HOH 60  232 186 HOH HOH B . 
J 4 HOH 61  233 187 HOH HOH B . 
J 4 HOH 62  234 188 HOH HOH B . 
J 4 HOH 63  235 190 HOH HOH B . 
J 4 HOH 64  236 197 HOH HOH B . 
J 4 HOH 65  237 198 HOH HOH B . 
J 4 HOH 66  238 200 HOH HOH B . 
J 4 HOH 67  239 204 HOH HOH B . 
J 4 HOH 68  240 205 HOH HOH B . 
J 4 HOH 69  241 208 HOH HOH B . 
J 4 HOH 70  242 212 HOH HOH B . 
J 4 HOH 71  243 215 HOH HOH B . 
J 4 HOH 72  244 216 HOH HOH B . 
J 4 HOH 73  245 217 HOH HOH B . 
J 4 HOH 74  246 218 HOH HOH B . 
J 4 HOH 75  247 220 HOH HOH B . 
J 4 HOH 76  248 222 HOH HOH B . 
J 4 HOH 77  249 227 HOH HOH B . 
J 4 HOH 78  250 228 HOH HOH B . 
J 4 HOH 79  251 231 HOH HOH B . 
J 4 HOH 80  252 232 HOH HOH B . 
J 4 HOH 81  253 233 HOH HOH B . 
J 4 HOH 82  254 235 HOH HOH B . 
J 4 HOH 83  255 237 HOH HOH B . 
J 4 HOH 84  256 239 HOH HOH B . 
J 4 HOH 85  257 240 HOH HOH B . 
J 4 HOH 86  258 242 HOH HOH B . 
J 4 HOH 87  259 245 HOH HOH B . 
J 4 HOH 88  260 246 HOH HOH B . 
J 4 HOH 89  261 247 HOH HOH B . 
J 4 HOH 90  262 248 HOH HOH B . 
J 4 HOH 91  263 249 HOH HOH B . 
J 4 HOH 92  264 251 HOH HOH B . 
J 4 HOH 93  265 252 HOH HOH B . 
J 4 HOH 94  266 253 HOH HOH B . 
J 4 HOH 95  267 255 HOH HOH B . 
J 4 HOH 96  268 258 HOH HOH B . 
J 4 HOH 97  269 259 HOH HOH B . 
J 4 HOH 98  270 260 HOH HOH B . 
J 4 HOH 99  271 262 HOH HOH B . 
J 4 HOH 100 272 263 HOH HOH B . 
J 4 HOH 101 273 264 HOH HOH B . 
J 4 HOH 102 274 272 HOH HOH B . 
J 4 HOH 103 275 273 HOH HOH B . 
J 4 HOH 104 276 276 HOH HOH B . 
J 4 HOH 105 277 278 HOH HOH B . 
J 4 HOH 106 278 280 HOH HOH B . 
#