data_1C2B
# 
_entry.id   1C2B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1C2B         
RCSB  RCSB009403   
WWPDB D_1000009403 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1eea . unspecified 
PDB 1C2O . unspecified 
PDB 1maa . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1C2B 
_pdbx_database_status.recvd_initial_deposition_date   1999-07-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, Y.'  1 
'Marchot, P.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Conformational flexibility of the acetylcholinesterase tetramer suggested by x-ray crystallography.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            274 
_citation.page_first                30370 
_citation.page_last                 30376 
_citation.year                      1999 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10521413 
_citation.pdbx_database_id_DOI      10.1074/jbc.274.43.30370 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bourne, Y.'   1 ? 
primary 'Grassi, J.'   2 ? 
primary 'Bougis, P.E.' 3 ? 
primary 'Marchot, P.'  4 ? 
# 
_cell.entry_id           1C2B 
_cell.length_a           117.980 
_cell.length_b           215.870 
_cell.length_c           229.410 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1C2B 
_symmetry.space_group_name_H-M             'F 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                22 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           ACETYLCHOLINESTERASE 
_entity.formula_weight             59421.129 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.1.1.7 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'A4 FORM' 
_entity.details                    'SEE REMARK 450 FOR INFORMATION REGARDING THE SOURCE AND SEQUENCE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGT
EMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPG
SREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGE
ARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQD
LQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVG
DHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNF
ARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGT
EMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPG
SREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGE
ARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQD
LQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVG
DHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNF
ARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASP n 
1 3   PRO n 
1 4   GLN n 
1 5   LEU n 
1 6   LEU n 
1 7   VAL n 
1 8   ARG n 
1 9   VAL n 
1 10  ARG n 
1 11  GLY n 
1 12  GLY n 
1 13  GLN n 
1 14  LEU n 
1 15  ARG n 
1 16  GLY n 
1 17  ILE n 
1 18  ARG n 
1 19  LEU n 
1 20  LYS n 
1 21  ALA n 
1 22  PRO n 
1 23  GLY n 
1 24  GLY n 
1 25  PRO n 
1 26  VAL n 
1 27  SER n 
1 28  ALA n 
1 29  PHE n 
1 30  LEU n 
1 31  GLY n 
1 32  ILE n 
1 33  PRO n 
1 34  PHE n 
1 35  ALA n 
1 36  GLU n 
1 37  PRO n 
1 38  PRO n 
1 39  VAL n 
1 40  GLY n 
1 41  SER n 
1 42  ARG n 
1 43  ARG n 
1 44  PHE n 
1 45  MET n 
1 46  PRO n 
1 47  PRO n 
1 48  GLU n 
1 49  PRO n 
1 50  LYS n 
1 51  ARG n 
1 52  PRO n 
1 53  TRP n 
1 54  SER n 
1 55  GLY n 
1 56  VAL n 
1 57  LEU n 
1 58  ASP n 
1 59  ALA n 
1 60  THR n 
1 61  THR n 
1 62  PHE n 
1 63  GLN n 
1 64  ASN n 
1 65  VAL n 
1 66  CYS n 
1 67  TYR n 
1 68  GLN n 
1 69  TYR n 
1 70  VAL n 
1 71  ASP n 
1 72  THR n 
1 73  LEU n 
1 74  TYR n 
1 75  PRO n 
1 76  GLY n 
1 77  PHE n 
1 78  GLU n 
1 79  GLY n 
1 80  THR n 
1 81  GLU n 
1 82  MET n 
1 83  TRP n 
1 84  ASN n 
1 85  PRO n 
1 86  ASN n 
1 87  ARG n 
1 88  GLU n 
1 89  LEU n 
1 90  SER n 
1 91  GLU n 
1 92  ASP n 
1 93  CYS n 
1 94  LEU n 
1 95  TYR n 
1 96  LEU n 
1 97  ASN n 
1 98  VAL n 
1 99  TRP n 
1 100 THR n 
1 101 PRO n 
1 102 TYR n 
1 103 PRO n 
1 104 ARG n 
1 105 PRO n 
1 106 ALA n 
1 107 SER n 
1 108 PRO n 
1 109 THR n 
1 110 PRO n 
1 111 VAL n 
1 112 LEU n 
1 113 ILE n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 ALA n 
1 125 ALA n 
1 126 SER n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASP n 
1 132 GLY n 
1 133 ARG n 
1 134 PHE n 
1 135 LEU n 
1 136 ALA n 
1 137 GLN n 
1 138 VAL n 
1 139 GLU n 
1 140 GLY n 
1 141 ALA n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 MET n 
1 147 ASN n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 THR n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 PRO n 
1 160 GLY n 
1 161 SER n 
1 162 ARG n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 LEU n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 GLN n 
1 182 GLU n 
1 183 ASN n 
1 184 ILE n 
1 185 ALA n 
1 186 ALA n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 MET n 
1 193 SER n 
1 194 VAL n 
1 195 THR n 
1 196 LEU n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 ALA n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 LEU n 
1 214 PRO n 
1 215 SER n 
1 216 ARG n 
1 217 SER n 
1 218 LEU n 
1 219 PHE n 
1 220 HIS n 
1 221 ARG n 
1 222 ALA n 
1 223 VAL n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 THR n 
1 229 PRO n 
1 230 ASN n 
1 231 GLY n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 THR n 
1 236 VAL n 
1 237 SER n 
1 238 ALA n 
1 239 GLY n 
1 240 GLU n 
1 241 ALA n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 THR n 
1 247 LEU n 
1 248 LEU n 
1 249 ALA n 
1 250 ARG n 
1 251 LEU n 
1 252 VAL n 
1 253 GLY n 
1 254 CYS n 
1 255 PRO n 
1 256 PRO n 
1 257 GLY n 
1 258 GLY n 
1 259 ALA n 
1 260 GLY n 
1 261 GLY n 
1 262 ASN n 
1 263 ASP n 
1 264 THR n 
1 265 GLU n 
1 266 LEU n 
1 267 ILE n 
1 268 ALA n 
1 269 CYS n 
1 270 LEU n 
1 271 ARG n 
1 272 THR n 
1 273 ARG n 
1 274 PRO n 
1 275 ALA n 
1 276 GLN n 
1 277 ASP n 
1 278 LEU n 
1 279 VAL n 
1 280 ASP n 
1 281 HIS n 
1 282 GLU n 
1 283 TRP n 
1 284 HIS n 
1 285 VAL n 
1 286 LEU n 
1 287 PRO n 
1 288 GLN n 
1 289 GLU n 
1 290 SER n 
1 291 ILE n 
1 292 PHE n 
1 293 ARG n 
1 294 PHE n 
1 295 SER n 
1 296 PHE n 
1 297 VAL n 
1 298 PRO n 
1 299 VAL n 
1 300 VAL n 
1 301 ASP n 
1 302 GLY n 
1 303 ASP n 
1 304 PHE n 
1 305 LEU n 
1 306 SER n 
1 307 ASP n 
1 308 THR n 
1 309 PRO n 
1 310 GLU n 
1 311 ALA n 
1 312 LEU n 
1 313 ILE n 
1 314 ASN n 
1 315 THR n 
1 316 GLY n 
1 317 ASP n 
1 318 PHE n 
1 319 GLN n 
1 320 ASP n 
1 321 LEU n 
1 322 GLN n 
1 323 VAL n 
1 324 LEU n 
1 325 VAL n 
1 326 GLY n 
1 327 VAL n 
1 328 VAL n 
1 329 LYS n 
1 330 ASP n 
1 331 GLU n 
1 332 GLY n 
1 333 SER n 
1 334 TYR n 
1 335 PHE n 
1 336 LEU n 
1 337 VAL n 
1 338 TYR n 
1 339 GLY n 
1 340 VAL n 
1 341 PRO n 
1 342 GLY n 
1 343 PHE n 
1 344 SER n 
1 345 LYS n 
1 346 ASP n 
1 347 ASN n 
1 348 GLU n 
1 349 SER n 
1 350 LEU n 
1 351 ILE n 
1 352 SER n 
1 353 ARG n 
1 354 ALA n 
1 355 GLN n 
1 356 PHE n 
1 357 LEU n 
1 358 ALA n 
1 359 GLY n 
1 360 VAL n 
1 361 ARG n 
1 362 ILE n 
1 363 GLY n 
1 364 VAL n 
1 365 PRO n 
1 366 GLN n 
1 367 ALA n 
1 368 SER n 
1 369 ASP n 
1 370 LEU n 
1 371 ALA n 
1 372 ALA n 
1 373 GLU n 
1 374 ALA n 
1 375 VAL n 
1 376 VAL n 
1 377 LEU n 
1 378 HIS n 
1 379 TYR n 
1 380 THR n 
1 381 ASP n 
1 382 TRP n 
1 383 LEU n 
1 384 HIS n 
1 385 PRO n 
1 386 GLU n 
1 387 ASP n 
1 388 PRO n 
1 389 THR n 
1 390 HIS n 
1 391 LEU n 
1 392 ARG n 
1 393 ASP n 
1 394 ALA n 
1 395 MET n 
1 396 SER n 
1 397 ALA n 
1 398 VAL n 
1 399 VAL n 
1 400 GLY n 
1 401 ASP n 
1 402 HIS n 
1 403 ASN n 
1 404 VAL n 
1 405 VAL n 
1 406 CYS n 
1 407 PRO n 
1 408 VAL n 
1 409 ALA n 
1 410 GLN n 
1 411 LEU n 
1 412 ALA n 
1 413 GLY n 
1 414 ARG n 
1 415 LEU n 
1 416 ALA n 
1 417 ALA n 
1 418 GLN n 
1 419 GLY n 
1 420 ALA n 
1 421 ARG n 
1 422 VAL n 
1 423 TYR n 
1 424 ALA n 
1 425 TYR n 
1 426 ILE n 
1 427 PHE n 
1 428 GLU n 
1 429 HIS n 
1 430 ARG n 
1 431 ALA n 
1 432 SER n 
1 433 THR n 
1 434 LEU n 
1 435 THR n 
1 436 TRP n 
1 437 PRO n 
1 438 LEU n 
1 439 TRP n 
1 440 MET n 
1 441 GLY n 
1 442 VAL n 
1 443 PRO n 
1 444 HIS n 
1 445 GLY n 
1 446 TYR n 
1 447 GLU n 
1 448 ILE n 
1 449 GLU n 
1 450 PHE n 
1 451 ILE n 
1 452 PHE n 
1 453 GLY n 
1 454 LEU n 
1 455 PRO n 
1 456 LEU n 
1 457 ASP n 
1 458 PRO n 
1 459 SER n 
1 460 LEU n 
1 461 ASN n 
1 462 TYR n 
1 463 THR n 
1 464 THR n 
1 465 GLU n 
1 466 GLU n 
1 467 ARG n 
1 468 ILE n 
1 469 PHE n 
1 470 ALA n 
1 471 GLN n 
1 472 ARG n 
1 473 LEU n 
1 474 MET n 
1 475 LYS n 
1 476 TYR n 
1 477 TRP n 
1 478 THR n 
1 479 ASN n 
1 480 PHE n 
1 481 ALA n 
1 482 ARG n 
1 483 THR n 
1 484 GLY n 
1 485 ASP n 
1 486 PRO n 
1 487 ASN n 
1 488 ASP n 
1 489 PRO n 
1 490 ARG n 
1 491 ASP n 
1 492 SER n 
1 493 LYS n 
1 494 SER n 
1 495 PRO n 
1 496 GLN n 
1 497 TRP n 
1 498 PRO n 
1 499 PRO n 
1 500 TYR n 
1 501 THR n 
1 502 THR n 
1 503 ALA n 
1 504 ALA n 
1 505 GLN n 
1 506 GLN n 
1 507 TYR n 
1 508 VAL n 
1 509 SER n 
1 510 LEU n 
1 511 ASN n 
1 512 LEU n 
1 513 LYS n 
1 514 PRO n 
1 515 LEU n 
1 516 GLU n 
1 517 VAL n 
1 518 ARG n 
1 519 ARG n 
1 520 GLY n 
1 521 LEU n 
1 522 ARG n 
1 523 ALA n 
1 524 GLN n 
1 525 THR n 
1 526 CYS n 
1 527 ALA n 
1 528 PHE n 
1 529 TRP n 
1 530 ASN n 
1 531 ARG n 
1 532 PHE n 
1 533 LEU n 
1 534 PRO n 
1 535 LYS n 
1 536 LEU n 
1 537 LEU n 
1 538 SER n 
1 539 ALA n 
1 540 THR n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'electric eel' 
_entity_src_nat.pdbx_organism_scientific   'Electrophorus electricus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      8005 
_entity_src_nat.genus                      Electrophorus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    'A4 FORM' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           35 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1C2B 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 540 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P21836 
_struct_ref_seq.db_align_beg                  35 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  574 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       4 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1C2B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      6.15 
_exptl_crystal.density_percent_sol   79.99 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            279 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'NaKPO4, VAPOR DIFFUSION, pH 8.0, temperature 279K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           277 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-05-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1C2B 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             10 
_reflns.d_resolution_high            4.5 
_reflns.number_obs                   7742 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         74 
_reflns.pdbx_Rmerge_I_obs            0.2 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1C2B 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     7742 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            4.5 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.369 
_refine.ls_R_factor_R_free                       0.351 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4172 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4172 
_refine_hist.d_res_high                       4.5 
_refine_hist.d_res_low                        10.0 
# 
_struct.entry_id                  1C2B 
_struct.title                     'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C. 3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1C2B 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'SERINE HYDROLASE, ALPHA/BETA HYDROLASE, TETRAMER, HYDROLASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 39  ? ARG A 43  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P2  2  PHE A 77  ? MET A 82  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASP A 131 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? VAL A 138 ? GLY A 135 VAL A 141 1 ? 7  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P7  7  ALA A 185 ? PHE A 187 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P9  9  SER A 215 ? PHE A 219 ? SER A 218 PHE A 222 5 ? 5  
HELX_P HELX_P10 10 SER A 237 ? VAL A 252 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P11 11 ASN A 262 ? ARG A 271 ? ASN A 265 ARG A 274 1 ? 10 
HELX_P HELX_P12 12 PRO A 274 ? GLU A 282 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P13 13 TRP A 283 ? VAL A 285 ? TRP A 286 VAL A 288 5 ? 3  
HELX_P HELX_P14 14 THR A 308 ? GLY A 316 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P15 15 GLY A 332 ? TYR A 338 ? GLY A 335 TYR A 341 1 ? 7  
HELX_P HELX_P16 16 SER A 352 ? VAL A 364 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P17 17 SER A 368 ? THR A 380 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P18 18 ASP A 387 ? VAL A 404 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P19 19 VAL A 404 ? GLN A 418 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P20 20 PRO A 437 ? GLY A 441 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P21 21 GLU A 447 ? GLY A 453 ? GLU A 450 GLY A 456 1 ? 7  
HELX_P HELX_P22 22 LEU A 454 ? ASP A 457 ? LEU A 457 ASP A 460 5 ? 4  
HELX_P HELX_P23 23 THR A 463 ? THR A 483 ? THR A 466 THR A 486 1 ? 21 
HELX_P HELX_P24 24 ARG A 522 ? ARG A 531 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P25 25 ARG A 531 ? SER A 538 ? ARG A 534 SER A 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 66  SG ? ? ? 1_555 A CYS 93  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.013 ? ? 
disulf2 disulf ? ? A CYS 254 SG ? ? ? 1_555 A CYS 269 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.011 ? ? 
disulf3 disulf ? ? A CYS 406 SG ? ? ? 1_555 A CYS 526 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.066 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 102 A . ? TYR 105 A PRO 103 A ? PRO 106 A 1 5.73  
2 CYS 254 A . ? CYS 257 A PRO 255 A ? PRO 258 A 1 -9.78 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 15 ? 
C ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? parallel      
B 11 12 ? parallel      
B 12 13 ? parallel      
B 13 14 ? parallel      
B 14 15 ? anti-parallel 
C 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 6   ? VAL A 9   ? LEU A 9   VAL A 12  
A 2  GLY A 12  ? ARG A 15  ? GLY A 15  ARG A 18  
A 3  VAL A 56  ? ASP A 58  ? VAL A 59  ASP A 61  
B 1  ILE A 17  ? ALA A 21  ? ILE A 20  ALA A 24  
B 2  GLY A 24  ? ALA A 28  ? GLY A 27  ALA A 31  
B 3  TYR A 95  ? PRO A 101 ? TYR A 98  PRO A 104 
B 4  ILE A 32  ? PRO A 33  ? ILE A 35  PRO A 36  
B 5  TYR A 95  ? PRO A 101 ? TYR A 98  PRO A 104 
B 6  VAL A 142 ? MET A 146 ? VAL A 145 MET A 149 
B 7  THR A 109 ? ILE A 115 ? THR A 112 ILE A 118 
B 8  GLY A 189 ? GLU A 199 ? GLY A 192 GLU A 202 
B 9  ARG A 221 ? GLN A 225 ? ARG A 224 GLN A 228 
B 10 GLN A 322 ? VAL A 328 ? GLN A 325 VAL A 331 
B 11 ARG A 421 ? TYR A 423 ? ARG A 424 TYR A 426 
B 12 GLN A 322 ? VAL A 328 ? GLN A 325 VAL A 331 
B 13 TYR A 425 ? PHE A 427 ? TYR A 428 PHE A 430 
B 14 GLN A 506 ? LEU A 510 ? GLN A 509 LEU A 513 
B 15 ARG A 518 ? ARG A 519 ? ARG A 521 ARG A 522 
C 1  ALA A 35  ? GLU A 36  ? ALA A 38  GLU A 39  
C 2  GLU A 48  ? PRO A 49  ? GLU A 51  PRO A 52  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 9   ? N VAL A 12  O GLY A 12  ? O GLY A 15  
A 2  3  O GLN A 13  ? O GLN A 16  N LEU A 57  ? N LEU A 60  
B 1  2  O ALA A 21  ? O ALA A 24  N GLY A 24  ? N GLY A 27  
B 2  3  N SER A 27  ? N SER A 30  O THR A 100 ? O THR A 103 
B 3  4  O LEU A 96  ? O LEU A 99  N ILE A 32  ? N ILE A 35  
B 4  5  N ILE A 32  ? N ILE A 35  O LEU A 96  ? O LEU A 99  
B 5  6  N TRP A 99  ? N TRP A 102 O LEU A 143 ? O LEU A 146 
B 6  7  N VAL A 142 ? N VAL A 145 O PRO A 110 ? O PRO A 113 
B 7  8  O THR A 109 ? O THR A 112 N ASP A 190 ? N ASP A 193 
B 8  9  O VAL A 194 ? O VAL A 197 N ARG A 221 ? N ARG A 224 
B 9  10 N ALA A 222 ? N ALA A 225 O GLN A 322 ? O GLN A 325 
B 10 11 N VAL A 323 ? N VAL A 326 O ARG A 421 ? O ARG A 424 
B 11 12 O ARG A 421 ? O ARG A 424 N VAL A 323 ? N VAL A 326 
B 12 13 N VAL A 327 ? N VAL A 330 O TYR A 425 ? O TYR A 428 
B 13 14 N ILE A 426 ? N ILE A 429 O VAL A 508 ? O VAL A 511 
B 14 15 O TYR A 507 ? O TYR A 510 N ARG A 518 ? N ARG A 521 
C 1  2  N GLU A 36  ? N GLU A 39  O GLU A 48  ? O GLU A 51  
# 
_database_PDB_matrix.entry_id          1C2B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1C2B 
_atom_sites.fract_transf_matrix[1][1]   0.008476 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004632 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004359 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ASP A 1 2   ? 8.761  113.833 5.813  1.00 40.00 ? 5   ASP A N   1 
ATOM 2    C CA  . ASP A 1 2   ? 8.332  112.597 5.132  1.00 40.00 ? 5   ASP A CA  1 
ATOM 3    C C   . ASP A 1 2   ? 7.570  111.785 6.155  1.00 40.00 ? 5   ASP A C   1 
ATOM 4    O O   . ASP A 1 2   ? 8.119  111.438 7.211  1.00 40.00 ? 5   ASP A O   1 
ATOM 5    C CB  . ASP A 1 2   ? 9.568  111.881 4.600  1.00 40.00 ? 5   ASP A CB  1 
ATOM 6    C CG  . ASP A 1 2   ? 9.221  110.612 3.845  1.00 40.00 ? 5   ASP A CG  1 
ATOM 7    O OD1 . ASP A 1 2   ? 10.159 109.915 3.402  1.00 40.00 ? 5   ASP A OD1 1 
ATOM 8    O OD2 . ASP A 1 2   ? 8.008  110.330 3.702  1.00 40.00 ? 5   ASP A OD2 1 
ATOM 9    N N   . PRO A 1 3   ? 6.307  111.468 5.917  1.00 40.00 ? 6   PRO A N   1 
ATOM 10   C CA  . PRO A 1 3   ? 5.493  110.729 6.878  1.00 40.00 ? 6   PRO A CA  1 
ATOM 11   C C   . PRO A 1 3   ? 5.968  109.294 7.001  1.00 40.00 ? 6   PRO A C   1 
ATOM 12   O O   . PRO A 1 3   ? 5.639  108.554 7.923  1.00 40.00 ? 6   PRO A O   1 
ATOM 13   C CB  . PRO A 1 3   ? 4.086  110.787 6.304  1.00 40.00 ? 6   PRO A CB  1 
ATOM 14   C CG  . PRO A 1 3   ? 4.306  110.912 4.833  1.00 40.00 ? 6   PRO A CG  1 
ATOM 15   C CD  . PRO A 1 3   ? 5.532  111.792 4.701  1.00 40.00 ? 6   PRO A CD  1 
ATOM 16   N N   . GLN A 1 4   ? 6.764  108.904 5.990  1.00 40.00 ? 7   GLN A N   1 
ATOM 17   C CA  . GLN A 1 4   ? 7.338  107.565 5.983  1.00 40.00 ? 7   GLN A CA  1 
ATOM 18   C C   . GLN A 1 4   ? 8.275  107.505 7.188  1.00 40.00 ? 7   GLN A C   1 
ATOM 19   O O   . GLN A 1 4   ? 8.188  106.600 8.007  1.00 40.00 ? 7   GLN A O   1 
ATOM 20   C CB  . GLN A 1 4   ? 8.067  107.295 4.686  1.00 40.00 ? 7   GLN A CB  1 
ATOM 21   C CG  . GLN A 1 4   ? 7.196  107.082 3.462  1.00 40.00 ? 7   GLN A CG  1 
ATOM 22   C CD  . GLN A 1 4   ? 6.179  105.979 3.608  1.00 40.00 ? 7   GLN A CD  1 
ATOM 23   O OE1 . GLN A 1 4   ? 6.503  104.823 3.890  1.00 40.00 ? 7   GLN A OE1 1 
ATOM 24   N NE2 . GLN A 1 4   ? 4.899  106.298 3.425  1.00 40.00 ? 7   GLN A NE2 1 
ATOM 25   N N   . LEU A 1 5   ? 9.125  108.516 7.336  1.00 40.00 ? 8   LEU A N   1 
ATOM 26   C CA  . LEU A 1 5   ? 10.058 108.549 8.445  1.00 40.00 ? 8   LEU A CA  1 
ATOM 27   C C   . LEU A 1 5   ? 9.467  109.162 9.688  1.00 40.00 ? 8   LEU A C   1 
ATOM 28   O O   . LEU A 1 5   ? 10.191 109.343 10.688 1.00 40.00 ? 8   LEU A O   1 
ATOM 29   C CB  . LEU A 1 5   ? 11.320 109.276 7.962  1.00 40.00 ? 8   LEU A CB  1 
ATOM 30   C CG  . LEU A 1 5   ? 11.845 108.933 6.580  1.00 40.00 ? 8   LEU A CG  1 
ATOM 31   C CD1 . LEU A 1 5   ? 13.334 109.250 6.477  1.00 40.00 ? 8   LEU A CD1 1 
ATOM 32   C CD2 . LEU A 1 5   ? 11.622 107.478 6.189  1.00 40.00 ? 8   LEU A CD2 1 
ATOM 33   N N   . LEU A 1 6   ? 8.185  109.472 9.749  1.00 40.00 ? 9   LEU A N   1 
ATOM 34   C CA  . LEU A 1 6   ? 7.687  110.113 10.999 1.00 40.00 ? 9   LEU A CA  1 
ATOM 35   C C   . LEU A 1 6   ? 6.648  109.230 11.633 1.00 40.00 ? 9   LEU A C   1 
ATOM 36   O O   . LEU A 1 6   ? 5.602  109.063 10.972 1.00 40.00 ? 9   LEU A O   1 
ATOM 37   C CB  . LEU A 1 6   ? 7.052  111.445 10.617 1.00 40.00 ? 9   LEU A CB  1 
ATOM 38   C CG  . LEU A 1 6   ? 7.300  112.734 11.354 1.00 40.00 ? 9   LEU A CG  1 
ATOM 39   C CD1 . LEU A 1 6   ? 7.054  112.599 12.856 1.00 40.00 ? 9   LEU A CD1 1 
ATOM 40   C CD2 . LEU A 1 6   ? 8.686  113.294 11.054 1.00 40.00 ? 9   LEU A CD2 1 
ATOM 41   N N   . VAL A 1 7   ? 6.864  108.635 12.805 1.00 40.00 ? 10  VAL A N   1 
ATOM 42   C CA  . VAL A 1 7   ? 5.783  107.743 13.269 1.00 40.00 ? 10  VAL A CA  1 
ATOM 43   C C   . VAL A 1 7   ? 5.364  108.021 14.694 1.00 40.00 ? 10  VAL A C   1 
ATOM 44   O O   . VAL A 1 7   ? 6.250  108.220 15.551 1.00 40.00 ? 10  VAL A O   1 
ATOM 45   C CB  . VAL A 1 7   ? 6.171  106.244 13.207 1.00 40.00 ? 10  VAL A CB  1 
ATOM 46   C CG1 . VAL A 1 7   ? 4.978  105.377 13.605 1.00 40.00 ? 10  VAL A CG1 1 
ATOM 47   C CG2 . VAL A 1 7   ? 6.746  105.783 11.890 1.00 40.00 ? 10  VAL A CG2 1 
ATOM 48   N N   . ARG A 1 8   ? 4.059  107.957 14.946 1.00 40.00 ? 11  ARG A N   1 
ATOM 49   C CA  . ARG A 1 8   ? 3.661  108.181 16.350 1.00 40.00 ? 11  ARG A CA  1 
ATOM 50   C C   . ARG A 1 8   ? 3.528  106.787 16.982 1.00 40.00 ? 11  ARG A C   1 
ATOM 51   O O   . ARG A 1 8   ? 2.884  105.901 16.433 1.00 40.00 ? 11  ARG A O   1 
ATOM 52   C CB  . ARG A 1 8   ? 2.450  109.038 16.556 1.00 40.00 ? 11  ARG A CB  1 
ATOM 53   C CG  . ARG A 1 8   ? 1.599  108.762 17.780 1.00 40.00 ? 11  ARG A CG  1 
ATOM 54   C CD  . ARG A 1 8   ? 2.221  109.377 19.020 1.00 40.00 ? 11  ARG A CD  1 
ATOM 55   N NE  . ARG A 1 8   ? 1.740  110.694 19.366 1.00 40.00 ? 11  ARG A NE  1 
ATOM 56   C CZ  . ARG A 1 8   ? 1.613  111.807 18.673 1.00 40.00 ? 11  ARG A CZ  1 
ATOM 57   N NH1 . ARG A 1 8   ? 1.926  111.936 17.386 1.00 40.00 ? 11  ARG A NH1 1 
ATOM 58   N NH2 . ARG A 1 8   ? 1.127  112.893 19.288 1.00 40.00 ? 11  ARG A NH2 1 
ATOM 59   N N   . VAL A 1 9   ? 4.209  106.677 18.120 1.00 40.00 ? 12  VAL A N   1 
ATOM 60   C CA  . VAL A 1 9   ? 4.187  105.406 18.875 1.00 40.00 ? 12  VAL A CA  1 
ATOM 61   C C   . VAL A 1 9   ? 3.348  105.610 20.104 1.00 40.00 ? 12  VAL A C   1 
ATOM 62   O O   . VAL A 1 9   ? 3.087  106.763 20.483 1.00 40.00 ? 12  VAL A O   1 
ATOM 63   C CB  . VAL A 1 9   ? 5.630  104.994 19.154 1.00 40.00 ? 12  VAL A CB  1 
ATOM 64   C CG1 . VAL A 1 9   ? 5.842  104.234 20.440 1.00 40.00 ? 12  VAL A CG1 1 
ATOM 65   C CG2 . VAL A 1 9   ? 6.059  104.167 17.932 1.00 40.00 ? 12  VAL A CG2 1 
ATOM 66   N N   . ARG A 1 10  ? 2.946  104.565 20.789 1.00 40.00 ? 13  ARG A N   1 
ATOM 67   C CA  . ARG A 1 10  ? 2.116  104.637 21.968 1.00 40.00 ? 13  ARG A CA  1 
ATOM 68   C C   . ARG A 1 10  ? 2.614  105.590 23.020 1.00 40.00 ? 13  ARG A C   1 
ATOM 69   O O   . ARG A 1 10  ? 1.828  105.929 23.922 1.00 40.00 ? 13  ARG A O   1 
ATOM 70   C CB  . ARG A 1 10  ? 1.936  103.252 22.596 1.00 40.00 ? 13  ARG A CB  1 
ATOM 71   C CG  . ARG A 1 10  ? 0.752  103.106 23.540 1.00 40.00 ? 13  ARG A CG  1 
ATOM 72   C CD  . ARG A 1 10  ? 0.282  101.649 23.591 1.00 40.00 ? 13  ARG A CD  1 
ATOM 73   N NE  . ARG A 1 10  ? -0.607 101.329 24.680 1.00 40.00 ? 13  ARG A NE  1 
ATOM 74   C CZ  . ARG A 1 10  ? -0.419 101.319 25.992 1.00 40.00 ? 13  ARG A CZ  1 
ATOM 75   N NH1 . ARG A 1 10  ? 0.735  101.649 26.559 1.00 40.00 ? 13  ARG A NH1 1 
ATOM 76   N NH2 . ARG A 1 10  ? -1.437 100.965 26.791 1.00 40.00 ? 13  ARG A NH2 1 
ATOM 77   N N   . GLY A 1 11  ? 3.880  106.023 22.977 1.00 40.00 ? 14  GLY A N   1 
ATOM 78   C CA  . GLY A 1 11  ? 4.437  106.948 23.930 1.00 40.00 ? 14  GLY A CA  1 
ATOM 79   C C   . GLY A 1 11  ? 5.062  108.199 23.336 1.00 40.00 ? 14  GLY A C   1 
ATOM 80   O O   . GLY A 1 11  ? 5.766  108.951 24.071 1.00 40.00 ? 14  GLY A O   1 
ATOM 81   N N   . GLY A 1 12  ? 4.835  108.440 22.026 1.00 40.00 ? 15  GLY A N   1 
ATOM 82   C CA  . GLY A 1 12  ? 5.449  109.658 21.469 1.00 40.00 ? 15  GLY A CA  1 
ATOM 83   C C   . GLY A 1 12  ? 5.812  109.526 20.008 1.00 40.00 ? 15  GLY A C   1 
ATOM 84   O O   . GLY A 1 12  ? 5.584  108.478 19.399 1.00 40.00 ? 15  GLY A O   1 
ATOM 85   N N   . GLN A 1 13  ? 6.360  110.580 19.444 1.00 40.00 ? 16  GLN A N   1 
ATOM 86   C CA  . GLN A 1 13  ? 6.723  110.618 18.044 1.00 40.00 ? 16  GLN A CA  1 
ATOM 87   C C   . GLN A 1 13  ? 8.157  110.216 17.784 1.00 40.00 ? 16  GLN A C   1 
ATOM 88   O O   . GLN A 1 13  ? 9.053  110.391 18.621 1.00 40.00 ? 16  GLN A O   1 
ATOM 89   C CB  . GLN A 1 13  ? 6.486  112.053 17.523 1.00 40.00 ? 16  GLN A CB  1 
ATOM 90   C CG  . GLN A 1 13  ? 5.017  112.364 17.250 1.00 40.00 ? 16  GLN A CG  1 
ATOM 91   C CD  . GLN A 1 13  ? 4.849  113.332 16.089 1.00 40.00 ? 16  GLN A CD  1 
ATOM 92   O OE1 . GLN A 1 13  ? 4.916  114.552 16.308 1.00 40.00 ? 16  GLN A OE1 1 
ATOM 93   N NE2 . GLN A 1 13  ? 4.647  112.824 14.884 1.00 40.00 ? 16  GLN A NE2 1 
ATOM 94   N N   . LEU A 1 14  ? 8.399  109.678 16.600 1.00 40.00 ? 17  LEU A N   1 
ATOM 95   C CA  . LEU A 1 14  ? 9.740  109.240 16.272 1.00 40.00 ? 17  LEU A CA  1 
ATOM 96   C C   . LEU A 1 14  ? 10.142 109.638 14.870 1.00 40.00 ? 17  LEU A C   1 
ATOM 97   O O   . LEU A 1 14  ? 9.282  109.617 13.968 1.00 40.00 ? 17  LEU A O   1 
ATOM 98   C CB  . LEU A 1 14  ? 9.760  107.665 16.270 1.00 40.00 ? 17  LEU A CB  1 
ATOM 99   C CG  . LEU A 1 14  ? 9.354  106.965 17.570 1.00 40.00 ? 17  LEU A CG  1 
ATOM 100  C CD1 . LEU A 1 14  ? 9.006  105.510 17.330 1.00 40.00 ? 17  LEU A CD1 1 
ATOM 101  C CD2 . LEU A 1 14  ? 10.455 107.100 18.633 1.00 40.00 ? 17  LEU A CD2 1 
ATOM 102  N N   . ARG A 1 15  ? 11.427 109.857 14.660 1.00 40.00 ? 18  ARG A N   1 
ATOM 103  C CA  . ARG A 1 15  ? 11.821 110.128 13.273 1.00 40.00 ? 18  ARG A CA  1 
ATOM 104  C C   . ARG A 1 15  ? 12.837 109.070 12.848 1.00 40.00 ? 18  ARG A C   1 
ATOM 105  O O   . ARG A 1 15  ? 13.929 109.020 13.422 1.00 40.00 ? 18  ARG A O   1 
ATOM 106  C CB  . ARG A 1 15  ? 12.345 111.508 13.062 1.00 40.00 ? 18  ARG A CB  1 
ATOM 107  C CG  . ARG A 1 15  ? 13.600 111.658 12.231 1.00 40.00 ? 18  ARG A CG  1 
ATOM 108  C CD  . ARG A 1 15  ? 13.626 112.966 11.486 1.00 40.00 ? 18  ARG A CD  1 
ATOM 109  N NE  . ARG A 1 15  ? 13.661 114.152 12.325 1.00 40.00 ? 18  ARG A NE  1 
ATOM 110  C CZ  . ARG A 1 15  ? 12.644 114.738 12.943 1.00 40.00 ? 18  ARG A CZ  1 
ATOM 111  N NH1 . ARG A 1 15  ? 12.842 115.836 13.674 1.00 40.00 ? 18  ARG A NH1 1 
ATOM 112  N NH2 . ARG A 1 15  ? 11.411 114.252 12.860 1.00 40.00 ? 18  ARG A NH2 1 
ATOM 113  N N   . GLY A 1 16  ? 12.435 108.290 11.846 1.00 40.00 ? 19  GLY A N   1 
ATOM 114  C CA  . GLY A 1 16  ? 13.333 107.260 11.325 1.00 40.00 ? 19  GLY A CA  1 
ATOM 115  C C   . GLY A 1 16  ? 14.346 107.900 10.372 1.00 40.00 ? 19  GLY A C   1 
ATOM 116  O O   . GLY A 1 16  ? 14.515 109.121 10.354 1.00 40.00 ? 19  GLY A O   1 
ATOM 117  N N   . ILE A 1 17  ? 15.029 107.067 9.607  1.00 40.00 ? 20  ILE A N   1 
ATOM 118  C CA  . ILE A 1 17  ? 16.003 107.499 8.613  1.00 40.00 ? 20  ILE A CA  1 
ATOM 119  C C   . ILE A 1 17  ? 15.802 106.535 7.436  1.00 40.00 ? 20  ILE A C   1 
ATOM 120  O O   . ILE A 1 17  ? 15.388 105.400 7.655  1.00 40.00 ? 20  ILE A O   1 
ATOM 121  C CB  . ILE A 1 17  ? 17.451 107.539 9.068  1.00 40.00 ? 20  ILE A CB  1 
ATOM 122  C CG1 . ILE A 1 17  ? 18.450 107.403 7.892  1.00 40.00 ? 20  ILE A CG1 1 
ATOM 123  C CG2 . ILE A 1 17  ? 17.741 106.432 10.066 1.00 40.00 ? 20  ILE A CG2 1 
ATOM 124  C CD1 . ILE A 1 17  ? 19.798 108.043 8.169  1.00 40.00 ? 20  ILE A CD1 1 
ATOM 125  N N   . ARG A 1 18  ? 16.055 107.010 6.235  1.00 40.00 ? 21  ARG A N   1 
ATOM 126  C CA  . ARG A 1 18  ? 15.878 106.226 5.021  1.00 40.00 ? 21  ARG A CA  1 
ATOM 127  C C   . ARG A 1 18  ? 17.195 105.633 4.532  1.00 40.00 ? 21  ARG A C   1 
ATOM 128  O O   . ARG A 1 18  ? 18.098 106.302 4.036  1.00 40.00 ? 21  ARG A O   1 
ATOM 129  C CB  . ARG A 1 18  ? 15.197 107.081 3.967  1.00 40.00 ? 21  ARG A CB  1 
ATOM 130  C CG  . ARG A 1 18  ? 14.511 106.295 2.864  1.00 40.00 ? 21  ARG A CG  1 
ATOM 131  C CD  . ARG A 1 18  ? 14.334 107.174 1.639  1.00 40.00 ? 21  ARG A CD  1 
ATOM 132  N NE  . ARG A 1 18  ? 15.601 107.221 0.875  1.00 40.00 ? 21  ARG A NE  1 
ATOM 133  C CZ  . ARG A 1 18  ? 15.532 107.428 -0.443 1.00 40.00 ? 21  ARG A CZ  1 
ATOM 134  N NH1 . ARG A 1 18  ? 14.329 107.581 -1.010 1.00 40.00 ? 21  ARG A NH1 1 
ATOM 135  N NH2 . ARG A 1 18  ? 16.639 107.472 -1.158 1.00 40.00 ? 21  ARG A NH2 1 
ATOM 136  N N   . LEU A 1 19  ? 17.272 104.316 4.716  1.00 40.00 ? 22  LEU A N   1 
ATOM 137  C CA  . LEU A 1 19  ? 18.440 103.543 4.361  1.00 40.00 ? 22  LEU A CA  1 
ATOM 138  C C   . LEU A 1 19  ? 18.365 103.011 2.940  1.00 40.00 ? 22  LEU A C   1 
ATOM 139  O O   . LEU A 1 19  ? 17.286 102.709 2.426  1.00 40.00 ? 22  LEU A O   1 
ATOM 140  C CB  . LEU A 1 19  ? 18.553 102.356 5.327  1.00 40.00 ? 22  LEU A CB  1 
ATOM 141  C CG  . LEU A 1 19  ? 19.292 102.500 6.636  1.00 40.00 ? 22  LEU A CG  1 
ATOM 142  C CD1 . LEU A 1 19  ? 18.872 103.748 7.410  1.00 40.00 ? 22  LEU A CD1 1 
ATOM 143  C CD2 . LEU A 1 19  ? 19.077 101.265 7.505  1.00 40.00 ? 22  LEU A CD2 1 
ATOM 144  N N   . LYS A 1 20  ? 19.552 102.845 2.344  1.00 40.00 ? 23  LYS A N   1 
ATOM 145  C CA  . LYS A 1 20  ? 19.538 102.317 0.993  1.00 40.00 ? 23  LYS A CA  1 
ATOM 146  C C   . LYS A 1 20  ? 20.122 100.931 0.841  1.00 40.00 ? 23  LYS A C   1 
ATOM 147  O O   . LYS A 1 20  ? 21.325 100.686 0.836  1.00 40.00 ? 23  LYS A O   1 
ATOM 148  C CB  . LYS A 1 20  ? 20.123 103.339 0.022  1.00 40.00 ? 23  LYS A CB  1 
ATOM 149  C CG  . LYS A 1 20  ? 19.023 104.241 -0.558 1.00 40.00 ? 23  LYS A CG  1 
ATOM 150  C CD  . LYS A 1 20  ? 19.620 105.482 -1.199 1.00 40.00 ? 23  LYS A CD  1 
ATOM 151  C CE  . LYS A 1 20  ? 19.774 106.624 -0.203 1.00 40.00 ? 23  LYS A CE  1 
ATOM 152  N NZ  . LYS A 1 20  ? 18.553 106.824 0.623  1.00 40.00 ? 23  LYS A NZ  1 
ATOM 153  N N   . ALA A 1 21  ? 19.211 99.964  0.667  1.00 40.00 ? 24  ALA A N   1 
ATOM 154  C CA  . ALA A 1 21  ? 19.623 98.580  0.410  1.00 40.00 ? 24  ALA A CA  1 
ATOM 155  C C   . ALA A 1 21  ? 19.809 98.430  -1.100 1.00 40.00 ? 24  ALA A C   1 
ATOM 156  O O   . ALA A 1 21  ? 19.158 99.162  -1.860 1.00 40.00 ? 24  ALA A O   1 
ATOM 157  C CB  . ALA A 1 21  ? 18.490 97.645  0.847  1.00 40.00 ? 24  ALA A CB  1 
ATOM 158  N N   . PRO A 1 22  ? 20.612 97.481  -1.549 1.00 40.00 ? 25  PRO A N   1 
ATOM 159  C CA  . PRO A 1 22  ? 20.823 97.218  -2.961 1.00 40.00 ? 25  PRO A CA  1 
ATOM 160  C C   . PRO A 1 22  ? 19.546 97.176  -3.776 1.00 40.00 ? 25  PRO A C   1 
ATOM 161  O O   . PRO A 1 22  ? 19.518 97.764  -4.878 1.00 40.00 ? 25  PRO A O   1 
ATOM 162  C CB  . PRO A 1 22  ? 21.550 95.878  -2.972 1.00 40.00 ? 25  PRO A CB  1 
ATOM 163  C CG  . PRO A 1 22  ? 22.290 95.832  -1.682 1.00 40.00 ? 25  PRO A CG  1 
ATOM 164  C CD  . PRO A 1 22  ? 21.435 96.584  -0.698 1.00 40.00 ? 25  PRO A CD  1 
ATOM 165  N N   . GLY A 1 23  ? 18.469 96.532  -3.311 1.00 40.00 ? 26  GLY A N   1 
ATOM 166  C CA  . GLY A 1 23  ? 17.239 96.495  -4.081 1.00 40.00 ? 26  GLY A CA  1 
ATOM 167  C C   . GLY A 1 23  ? 16.303 97.660  -3.848 1.00 40.00 ? 26  GLY A C   1 
ATOM 168  O O   . GLY A 1 23  ? 15.139 97.613  -4.267 1.00 40.00 ? 26  GLY A O   1 
ATOM 169  N N   . GLY A 1 24  ? 16.728 98.685  -3.118 1.00 40.00 ? 27  GLY A N   1 
ATOM 170  C CA  . GLY A 1 24  ? 15.874 99.810  -2.844 1.00 40.00 ? 27  GLY A CA  1 
ATOM 171  C C   . GLY A 1 24  ? 15.980 100.413 -1.460 1.00 40.00 ? 27  GLY A C   1 
ATOM 172  O O   . GLY A 1 24  ? 16.842 100.137 -0.624 1.00 40.00 ? 27  GLY A O   1 
ATOM 173  N N   . PRO A 1 25  ? 15.042 101.318 -1.199 1.00 40.00 ? 28  PRO A N   1 
ATOM 174  C CA  . PRO A 1 25  ? 14.975 102.047 0.045  1.00 40.00 ? 28  PRO A CA  1 
ATOM 175  C C   . PRO A 1 25  ? 14.273 101.292 1.148  1.00 40.00 ? 28  PRO A C   1 
ATOM 176  O O   . PRO A 1 25  ? 13.384 100.466 0.940  1.00 40.00 ? 28  PRO A O   1 
ATOM 177  C CB  . PRO A 1 25  ? 14.198 103.309 -0.347 1.00 40.00 ? 28  PRO A CB  1 
ATOM 178  C CG  . PRO A 1 25  ? 13.224 102.799 -1.363 1.00 40.00 ? 28  PRO A CG  1 
ATOM 179  C CD  . PRO A 1 25  ? 13.943 101.710 -2.120 1.00 40.00 ? 28  PRO A CD  1 
ATOM 180  N N   . VAL A 1 26  ? 14.723 101.630 2.373  1.00 40.00 ? 29  VAL A N   1 
ATOM 181  C CA  . VAL A 1 26  ? 14.192 101.064 3.576  1.00 40.00 ? 29  VAL A CA  1 
ATOM 182  C C   . VAL A 1 26  ? 13.991 102.125 4.668  1.00 40.00 ? 29  VAL A C   1 
ATOM 183  O O   . VAL A 1 26  ? 14.879 102.949 4.853  1.00 40.00 ? 29  VAL A O   1 
ATOM 184  C CB  . VAL A 1 26  ? 15.116 100.041 4.271  1.00 40.00 ? 29  VAL A CB  1 
ATOM 185  C CG1 . VAL A 1 26  ? 14.209 99.018  4.954  1.00 40.00 ? 29  VAL A CG1 1 
ATOM 186  C CG2 . VAL A 1 26  ? 16.142 99.406  3.367  1.00 40.00 ? 29  VAL A CG2 1 
ATOM 187  N N   . SER A 1 27  ? 12.883 101.995 5.372  1.00 40.00 ? 30  SER A N   1 
ATOM 188  C CA  . SER A 1 27  ? 12.653 102.907 6.520  1.00 40.00 ? 30  SER A CA  1 
ATOM 189  C C   . SER A 1 27  ? 13.368 102.231 7.711  1.00 40.00 ? 30  SER A C   1 
ATOM 190  O O   . SER A 1 27  ? 13.329 100.986 7.779  1.00 40.00 ? 30  SER A O   1 
ATOM 191  C CB  . SER A 1 27  ? 11.157 103.025 6.764  1.00 40.00 ? 30  SER A CB  1 
ATOM 192  O OG  . SER A 1 27  ? 10.537 104.076 6.033  1.00 40.00 ? 30  SER A OG  1 
ATOM 193  N N   . ALA A 1 28  ? 14.015 102.961 8.589  1.00 40.00 ? 31  ALA A N   1 
ATOM 194  C CA  . ALA A 1 28  ? 14.755 102.378 9.705  1.00 40.00 ? 31  ALA A CA  1 
ATOM 195  C C   . ALA A 1 28  ? 14.602 103.236 10.949 1.00 40.00 ? 31  ALA A C   1 
ATOM 196  O O   . ALA A 1 28  ? 14.960 104.414 10.908 1.00 40.00 ? 31  ALA A O   1 
ATOM 197  C CB  . ALA A 1 28  ? 16.236 102.345 9.333  1.00 40.00 ? 31  ALA A CB  1 
ATOM 198  N N   . PHE A 1 29  ? 14.036 102.665 12.011 1.00 40.00 ? 32  PHE A N   1 
ATOM 199  C CA  . PHE A 1 29  ? 13.800 103.441 13.244 1.00 40.00 ? 32  PHE A CA  1 
ATOM 200  C C   . PHE A 1 29  ? 14.650 102.913 14.394 1.00 40.00 ? 32  PHE A C   1 
ATOM 201  O O   . PHE A 1 29  ? 14.177 102.171 15.246 1.00 40.00 ? 32  PHE A O   1 
ATOM 202  C CB  . PHE A 1 29  ? 12.312 103.359 13.631 1.00 40.00 ? 32  PHE A CB  1 
ATOM 203  C CG  . PHE A 1 29  ? 11.439 104.010 12.603 1.00 40.00 ? 32  PHE A CG  1 
ATOM 204  C CD1 . PHE A 1 29  ? 11.232 103.454 11.357 1.00 40.00 ? 32  PHE A CD1 1 
ATOM 205  C CD2 . PHE A 1 29  ? 10.820 105.218 12.890 1.00 40.00 ? 32  PHE A CD2 1 
ATOM 206  C CE1 . PHE A 1 29  ? 10.433 104.075 10.412 1.00 40.00 ? 32  PHE A CE1 1 
ATOM 207  C CE2 . PHE A 1 29  ? 10.009 105.839 11.953 1.00 40.00 ? 32  PHE A CE2 1 
ATOM 208  C CZ  . PHE A 1 29  ? 9.810  105.267 10.707 1.00 40.00 ? 32  PHE A CZ  1 
ATOM 209  N N   . LEU A 1 30  ? 15.893 103.296 14.392 1.00 40.00 ? 33  LEU A N   1 
ATOM 210  C CA  . LEU A 1 30  ? 16.933 102.915 15.317 1.00 40.00 ? 33  LEU A CA  1 
ATOM 211  C C   . LEU A 1 30  ? 16.985 103.617 16.646 1.00 40.00 ? 33  LEU A C   1 
ATOM 212  O O   . LEU A 1 30  ? 17.009 104.868 16.738 1.00 40.00 ? 33  LEU A O   1 
ATOM 213  C CB  . LEU A 1 30  ? 18.219 103.235 14.465 1.00 40.00 ? 33  LEU A CB  1 
ATOM 214  C CG  . LEU A 1 30  ? 18.572 102.144 13.466 1.00 40.00 ? 33  LEU A CG  1 
ATOM 215  C CD1 . LEU A 1 30  ? 17.370 101.509 12.789 1.00 40.00 ? 33  LEU A CD1 1 
ATOM 216  C CD2 . LEU A 1 30  ? 19.581 102.574 12.409 1.00 40.00 ? 33  LEU A CD2 1 
ATOM 217  N N   . GLY A 1 31  ? 17.059 102.931 17.791 1.00 40.00 ? 34  GLY A N   1 
ATOM 218  C CA  . GLY A 1 31  ? 17.182 103.659 19.056 1.00 40.00 ? 34  GLY A CA  1 
ATOM 219  C C   . GLY A 1 31  ? 15.880 103.879 19.785 1.00 40.00 ? 34  GLY A C   1 
ATOM 220  O O   . GLY A 1 31  ? 15.811 104.747 20.667 1.00 40.00 ? 34  GLY A O   1 
ATOM 221  N N   . ILE A 1 32  ? 14.832 103.109 19.499 1.00 40.00 ? 35  ILE A N   1 
ATOM 222  C CA  . ILE A 1 32  ? 13.614 103.400 20.264 1.00 40.00 ? 35  ILE A CA  1 
ATOM 223  C C   . ILE A 1 32  ? 13.625 102.947 21.709 1.00 40.00 ? 35  ILE A C   1 
ATOM 224  O O   . ILE A 1 32  ? 13.585 101.764 22.060 1.00 40.00 ? 35  ILE A O   1 
ATOM 225  C CB  . ILE A 1 32  ? 12.356 102.805 19.593 1.00 40.00 ? 35  ILE A CB  1 
ATOM 226  C CG1 . ILE A 1 32  ? 12.301 103.128 18.109 1.00 40.00 ? 35  ILE A CG1 1 
ATOM 227  C CG2 . ILE A 1 32  ? 11.159 103.359 20.387 1.00 40.00 ? 35  ILE A CG2 1 
ATOM 228  C CD1 . ILE A 1 32  ? 11.558 102.167 17.208 1.00 40.00 ? 35  ILE A CD1 1 
ATOM 229  N N   . PRO A 1 33  ? 13.601 103.886 22.637 1.00 40.00 ? 36  PRO A N   1 
ATOM 230  C CA  . PRO A 1 33  ? 13.557 103.510 24.054 1.00 40.00 ? 36  PRO A CA  1 
ATOM 231  C C   . PRO A 1 33  ? 12.386 102.546 24.238 1.00 40.00 ? 36  PRO A C   1 
ATOM 232  O O   . PRO A 1 33  ? 11.322 102.914 23.699 1.00 40.00 ? 36  PRO A O   1 
ATOM 233  C CB  . PRO A 1 33  ? 13.255 104.807 24.790 1.00 40.00 ? 36  PRO A CB  1 
ATOM 234  C CG  . PRO A 1 33  ? 13.044 105.845 23.774 1.00 40.00 ? 36  PRO A CG  1 
ATOM 235  C CD  . PRO A 1 33  ? 13.611 105.348 22.461 1.00 40.00 ? 36  PRO A CD  1 
ATOM 236  N N   . PHE A 1 34  ? 12.600 101.427 24.902 1.00 40.00 ? 37  PHE A N   1 
ATOM 237  C CA  . PHE A 1 34  ? 11.422 100.559 25.108 1.00 40.00 ? 37  PHE A CA  1 
ATOM 238  C C   . PHE A 1 34  ? 11.186 100.519 26.610 1.00 40.00 ? 37  PHE A C   1 
ATOM 239  O O   . PHE A 1 34  ? 10.113 100.186 27.078 1.00 40.00 ? 37  PHE A O   1 
ATOM 240  C CB  . PHE A 1 34  ? 11.482 99.230  24.502 1.00 40.00 ? 37  PHE A CB  1 
ATOM 241  C CG  . PHE A 1 34  ? 12.499 98.239  24.923 1.00 40.00 ? 37  PHE A CG  1 
ATOM 242  C CD1 . PHE A 1 34  ? 12.243 97.359  25.962 1.00 40.00 ? 37  PHE A CD1 1 
ATOM 243  C CD2 . PHE A 1 34  ? 13.702 98.164  24.219 1.00 40.00 ? 37  PHE A CD2 1 
ATOM 244  C CE1 . PHE A 1 34  ? 13.185 96.400  26.308 1.00 40.00 ? 37  PHE A CE1 1 
ATOM 245  C CE2 . PHE A 1 34  ? 14.653 97.229  24.569 1.00 40.00 ? 37  PHE A CE2 1 
ATOM 246  C CZ  . PHE A 1 34  ? 14.379 96.360  25.613 1.00 40.00 ? 37  PHE A CZ  1 
ATOM 247  N N   . ALA A 1 35  ? 12.221 100.982 27.323 1.00 40.00 ? 38  ALA A N   1 
ATOM 248  C CA  . ALA A 1 35  ? 12.115 101.009 28.778 1.00 40.00 ? 38  ALA A CA  1 
ATOM 249  C C   . ALA A 1 35  ? 12.939 102.124 29.419 1.00 40.00 ? 38  ALA A C   1 
ATOM 250  O O   . ALA A 1 35  ? 13.881 102.648 28.808 1.00 40.00 ? 38  ALA A O   1 
ATOM 251  C CB  . ALA A 1 35  ? 12.714 99.699  29.334 1.00 40.00 ? 38  ALA A CB  1 
ATOM 252  N N   . GLU A 1 36  ? 12.565 102.380 30.672 1.00 40.00 ? 39  GLU A N   1 
ATOM 253  C CA  . GLU A 1 36  ? 13.313 103.346 31.479 1.00 40.00 ? 39  GLU A CA  1 
ATOM 254  C C   . GLU A 1 36  ? 14.688 102.725 31.766 1.00 40.00 ? 39  GLU A C   1 
ATOM 255  O O   . GLU A 1 36  ? 14.792 101.572 32.226 1.00 40.00 ? 39  GLU A O   1 
ATOM 256  C CB  . GLU A 1 36  ? 12.638 103.636 32.815 1.00 40.00 ? 39  GLU A CB  1 
ATOM 257  C CG  . GLU A 1 36  ? 11.410 104.552 32.765 1.00 40.00 ? 39  GLU A CG  1 
ATOM 258  C CD  . GLU A 1 36  ? 11.732 105.971 32.336 1.00 40.00 ? 39  GLU A CD  1 
ATOM 259  O OE1 . GLU A 1 36  ? 11.804 106.827 33.236 1.00 40.00 ? 39  GLU A OE1 1 
ATOM 260  O OE2 . GLU A 1 36  ? 11.922 106.267 31.135 1.00 40.00 ? 39  GLU A OE2 1 
ATOM 261  N N   . PRO A 1 37  ? 15.753 103.460 31.464 1.00 40.00 ? 40  PRO A N   1 
ATOM 262  C CA  . PRO A 1 37  ? 17.127 103.033 31.696 1.00 40.00 ? 40  PRO A CA  1 
ATOM 263  C C   . PRO A 1 37  ? 17.175 102.382 33.077 1.00 40.00 ? 40  PRO A C   1 
ATOM 264  O O   . PRO A 1 37  ? 16.706 102.948 34.073 1.00 40.00 ? 40  PRO A O   1 
ATOM 265  C CB  . PRO A 1 37  ? 17.940 104.322 31.642 1.00 40.00 ? 40  PRO A CB  1 
ATOM 266  C CG  . PRO A 1 37  ? 17.190 105.174 30.706 1.00 40.00 ? 40  PRO A CG  1 
ATOM 267  C CD  . PRO A 1 37  ? 15.736 104.849 30.961 1.00 40.00 ? 40  PRO A CD  1 
ATOM 268  N N   . PRO A 1 38  ? 17.736 101.187 33.130 1.00 40.00 ? 41  PRO A N   1 
ATOM 269  C CA  . PRO A 1 38  ? 17.808 100.382 34.346 1.00 40.00 ? 41  PRO A CA  1 
ATOM 270  C C   . PRO A 1 38  ? 19.060 100.668 35.149 1.00 40.00 ? 41  PRO A C   1 
ATOM 271  O O   . PRO A 1 38  ? 19.757 99.787  35.693 1.00 40.00 ? 41  PRO A O   1 
ATOM 272  C CB  . PRO A 1 38  ? 17.831 98.981  33.745 1.00 40.00 ? 41  PRO A CB  1 
ATOM 273  C CG  . PRO A 1 38  ? 18.728 99.157  32.548 1.00 40.00 ? 41  PRO A CG  1 
ATOM 274  C CD  . PRO A 1 38  ? 18.384 100.493 31.984 1.00 40.00 ? 41  PRO A CD  1 
ATOM 275  N N   . VAL A 1 39  ? 19.321 101.977 35.278 1.00 40.00 ? 42  VAL A N   1 
ATOM 276  C CA  . VAL A 1 39  ? 20.497 102.430 35.982 1.00 40.00 ? 42  VAL A CA  1 
ATOM 277  C C   . VAL A 1 39  ? 20.239 102.791 37.427 1.00 40.00 ? 42  VAL A C   1 
ATOM 278  O O   . VAL A 1 39  ? 19.116 102.844 37.945 1.00 40.00 ? 42  VAL A O   1 
ATOM 279  C CB  . VAL A 1 39  ? 21.075 103.654 35.245 1.00 40.00 ? 42  VAL A CB  1 
ATOM 280  C CG1 . VAL A 1 39  ? 21.335 103.251 33.807 1.00 40.00 ? 42  VAL A CG1 1 
ATOM 281  C CG2 . VAL A 1 39  ? 20.112 104.827 35.379 1.00 40.00 ? 42  VAL A CG2 1 
ATOM 282  N N   . GLY A 1 40  ? 21.394 103.061 38.081 1.00 40.00 ? 43  GLY A N   1 
ATOM 283  C CA  . GLY A 1 40  ? 21.326 103.480 39.453 1.00 40.00 ? 43  GLY A CA  1 
ATOM 284  C C   . GLY A 1 40  ? 20.653 102.496 40.368 1.00 40.00 ? 43  GLY A C   1 
ATOM 285  O O   . GLY A 1 40  ? 21.169 101.383 40.508 1.00 40.00 ? 43  GLY A O   1 
ATOM 286  N N   . SER A 1 41  ? 19.516 102.816 40.962 1.00 40.00 ? 44  SER A N   1 
ATOM 287  C CA  . SER A 1 41  ? 18.865 101.939 41.917 1.00 40.00 ? 44  SER A CA  1 
ATOM 288  C C   . SER A 1 41  ? 17.988 100.923 41.204 1.00 40.00 ? 44  SER A C   1 
ATOM 289  O O   . SER A 1 41  ? 17.239 100.176 41.848 1.00 40.00 ? 44  SER A O   1 
ATOM 290  C CB  . SER A 1 41  ? 17.967 102.752 42.862 1.00 40.00 ? 44  SER A CB  1 
ATOM 291  O OG  . SER A 1 41  ? 16.977 103.432 42.089 1.00 40.00 ? 44  SER A OG  1 
ATOM 292  N N   . ARG A 1 42  ? 18.112 101.005 39.888 1.00 40.00 ? 45  ARG A N   1 
ATOM 293  C CA  . ARG A 1 42  ? 17.379 100.133 39.011 1.00 40.00 ? 45  ARG A CA  1 
ATOM 294  C C   . ARG A 1 42  ? 18.230 98.950  38.605 1.00 40.00 ? 45  ARG A C   1 
ATOM 295  O O   . ARG A 1 42  ? 17.691 97.978  38.076 1.00 40.00 ? 45  ARG A O   1 
ATOM 296  C CB  . ARG A 1 42  ? 16.893 100.911 37.775 1.00 40.00 ? 45  ARG A CB  1 
ATOM 297  C CG  . ARG A 1 42  ? 15.487 101.459 37.873 1.00 40.00 ? 45  ARG A CG  1 
ATOM 298  C CD  . ARG A 1 42  ? 14.871 101.262 39.259 1.00 40.00 ? 45  ARG A CD  1 
ATOM 299  N NE  . ARG A 1 42  ? 14.096 100.028 39.377 1.00 40.00 ? 45  ARG A NE  1 
ATOM 300  C CZ  . ARG A 1 42  ? 13.087 99.718  38.567 1.00 40.00 ? 45  ARG A CZ  1 
ATOM 301  N NH1 . ARG A 1 42  ? 12.719 100.539 37.582 1.00 40.00 ? 45  ARG A NH1 1 
ATOM 302  N NH2 . ARG A 1 42  ? 12.406 98.594  38.718 1.00 40.00 ? 45  ARG A NH2 1 
ATOM 303  N N   . ARG A 1 43  ? 19.537 99.041  38.815 1.00 40.00 ? 46  ARG A N   1 
ATOM 304  C CA  . ARG A 1 43  ? 20.381 97.903  38.412 1.00 40.00 ? 46  ARG A CA  1 
ATOM 305  C C   . ARG A 1 43  ? 19.897 96.593  39.025 1.00 40.00 ? 46  ARG A C   1 
ATOM 306  O O   . ARG A 1 43  ? 19.563 96.581  40.234 1.00 40.00 ? 46  ARG A O   1 
ATOM 307  C CB  . ARG A 1 43  ? 21.802 98.164  38.893 1.00 40.00 ? 46  ARG A CB  1 
ATOM 308  C CG  . ARG A 1 43  ? 22.783 97.166  38.287 1.00 40.00 ? 46  ARG A CG  1 
ATOM 309  C CD  . ARG A 1 43  ? 24.124 97.458  38.859 1.00 40.00 ? 46  ARG A CD  1 
ATOM 310  N NE  . ARG A 1 43  ? 25.049 98.227  38.052 1.00 40.00 ? 46  ARG A NE  1 
ATOM 311  C CZ  . ARG A 1 43  ? 26.184 98.680  38.645 1.00 40.00 ? 46  ARG A CZ  1 
ATOM 312  N NH1 . ARG A 1 43  ? 26.380 98.406  39.951 1.00 40.00 ? 46  ARG A NH1 1 
ATOM 313  N NH2 . ARG A 1 43  ? 27.088 99.352  37.936 1.00 40.00 ? 46  ARG A NH2 1 
ATOM 314  N N   . PHE A 1 44  ? 19.894 95.502  38.247 1.00 40.00 ? 47  PHE A N   1 
ATOM 315  C CA  . PHE A 1 44  ? 19.464 94.203  38.704 1.00 40.00 ? 47  PHE A CA  1 
ATOM 316  C C   . PHE A 1 44  ? 17.943 94.083  38.788 1.00 40.00 ? 47  PHE A C   1 
ATOM 317  O O   . PHE A 1 44  ? 17.413 93.024  39.180 1.00 40.00 ? 47  PHE A O   1 
ATOM 318  C CB  . PHE A 1 44  ? 20.024 93.715  40.067 1.00 40.00 ? 47  PHE A CB  1 
ATOM 319  C CG  . PHE A 1 44  ? 21.520 93.922  40.171 1.00 40.00 ? 47  PHE A CG  1 
ATOM 320  C CD1 . PHE A 1 44  ? 22.335 93.526  39.120 1.00 40.00 ? 47  PHE A CD1 1 
ATOM 321  C CD2 . PHE A 1 44  ? 22.086 94.562  41.247 1.00 40.00 ? 47  PHE A CD2 1 
ATOM 322  C CE1 . PHE A 1 44  ? 23.682 93.743  39.150 1.00 40.00 ? 47  PHE A CE1 1 
ATOM 323  C CE2 . PHE A 1 44  ? 23.434 94.755  41.288 1.00 40.00 ? 47  PHE A CE2 1 
ATOM 324  C CZ  . PHE A 1 44  ? 24.235 94.355  40.244 1.00 40.00 ? 47  PHE A CZ  1 
ATOM 325  N N   . MET A 1 45  ? 17.215 95.122  38.431 1.00 40.00 ? 48  MET A N   1 
ATOM 326  C CA  . MET A 1 45  ? 15.775 95.150  38.513 1.00 40.00 ? 48  MET A CA  1 
ATOM 327  C C   . MET A 1 45  ? 15.081 94.829  37.198 1.00 40.00 ? 48  MET A C   1 
ATOM 328  O O   . MET A 1 45  ? 15.519 95.075  36.075 1.00 40.00 ? 48  MET A O   1 
ATOM 329  C CB  . MET A 1 45  ? 15.295 96.530  38.950 1.00 40.00 ? 48  MET A CB  1 
ATOM 330  C CG  . MET A 1 45  ? 15.466 96.896  40.416 1.00 40.00 ? 48  MET A CG  1 
ATOM 331  S SD  . MET A 1 45  ? 14.711 95.670  41.475 1.00 40.00 ? 48  MET A SD  1 
ATOM 332  C CE  . MET A 1 45  ? 13.523 96.569  42.436 1.00 40.00 ? 48  MET A CE  1 
ATOM 333  N N   . PRO A 1 46  ? 13.890 94.253  37.358 1.00 40.00 ? 49  PRO A N   1 
ATOM 334  C CA  . PRO A 1 46  ? 13.053 93.928  36.178 1.00 40.00 ? 49  PRO A CA  1 
ATOM 335  C C   . PRO A 1 46  ? 12.898 95.241  35.433 1.00 40.00 ? 49  PRO A C   1 
ATOM 336  O O   . PRO A 1 46  ? 12.903 96.281  36.115 1.00 40.00 ? 49  PRO A O   1 
ATOM 337  C CB  . PRO A 1 46  ? 11.807 93.379  36.786 1.00 40.00 ? 49  PRO A CB  1 
ATOM 338  C CG  . PRO A 1 46  ? 11.865 93.536  38.252 1.00 40.00 ? 49  PRO A CG  1 
ATOM 339  C CD  . PRO A 1 46  ? 13.271 93.892  38.647 1.00 40.00 ? 49  PRO A CD  1 
ATOM 340  N N   . PRO A 1 47  ? 12.793 95.271  34.128 1.00 40.00 ? 50  PRO A N   1 
ATOM 341  C CA  . PRO A 1 47  ? 12.713 96.518  33.386 1.00 40.00 ? 50  PRO A CA  1 
ATOM 342  C C   . PRO A 1 47  ? 11.377 97.202  33.565 1.00 40.00 ? 50  PRO A C   1 
ATOM 343  O O   . PRO A 1 47  ? 10.424 96.535  33.937 1.00 40.00 ? 50  PRO A O   1 
ATOM 344  C CB  . PRO A 1 47  ? 12.914 96.119  31.941 1.00 40.00 ? 50  PRO A CB  1 
ATOM 345  C CG  . PRO A 1 47  ? 12.404 94.720  31.897 1.00 40.00 ? 50  PRO A CG  1 
ATOM 346  C CD  . PRO A 1 47  ? 12.705 94.103  33.244 1.00 40.00 ? 50  PRO A CD  1 
ATOM 347  N N   . GLU A 1 48  ? 11.353 98.508  33.322 1.00 40.00 ? 51  GLU A N   1 
ATOM 348  C CA  . GLU A 1 48  ? 10.120 99.294  33.411 1.00 40.00 ? 51  GLU A CA  1 
ATOM 349  C C   . GLU A 1 48  ? 9.881  100.010 32.075 1.00 40.00 ? 51  GLU A C   1 
ATOM 350  O O   . GLU A 1 48  ? 10.776 100.448 31.345 1.00 40.00 ? 51  GLU A O   1 
ATOM 351  C CB  . GLU A 1 48  ? 10.111 100.271 34.551 1.00 40.00 ? 51  GLU A CB  1 
ATOM 352  C CG  . GLU A 1 48  ? 9.268  99.856  35.733 1.00 40.00 ? 51  GLU A CG  1 
ATOM 353  C CD  . GLU A 1 48  ? 9.528  100.650 37.006 1.00 40.00 ? 51  GLU A CD  1 
ATOM 354  O OE1 . GLU A 1 48  ? 8.960  100.184 38.037 1.00 40.00 ? 51  GLU A OE1 1 
ATOM 355  O OE2 . GLU A 1 48  ? 10.240 101.682 37.037 1.00 40.00 ? 51  GLU A OE2 1 
ATOM 356  N N   . PRO A 1 49  ? 8.606  100.096 31.758 1.00 40.00 ? 52  PRO A N   1 
ATOM 357  C CA  . PRO A 1 49  ? 8.176  100.687 30.503 1.00 40.00 ? 52  PRO A CA  1 
ATOM 358  C C   . PRO A 1 49  ? 8.609  102.146 30.397 1.00 40.00 ? 52  PRO A C   1 
ATOM 359  O O   . PRO A 1 49  ? 8.382  102.965 31.301 1.00 40.00 ? 52  PRO A O   1 
ATOM 360  C CB  . PRO A 1 49  ? 6.689  100.500 30.486 1.00 40.00 ? 52  PRO A CB  1 
ATOM 361  C CG  . PRO A 1 49  ? 6.263  99.853  31.738 1.00 40.00 ? 52  PRO A CG  1 
ATOM 362  C CD  . PRO A 1 49  ? 7.485  99.632  32.595 1.00 40.00 ? 52  PRO A CD  1 
ATOM 363  N N   . LYS A 1 50  ? 9.280  102.433 29.282 1.00 40.00 ? 53  LYS A N   1 
ATOM 364  C CA  . LYS A 1 50  ? 9.765  103.782 28.981 1.00 40.00 ? 53  LYS A CA  1 
ATOM 365  C C   . LYS A 1 50  ? 8.620  104.771 29.153 1.00 40.00 ? 53  LYS A C   1 
ATOM 366  O O   . LYS A 1 50  ? 7.517  104.497 28.657 1.00 40.00 ? 53  LYS A O   1 
ATOM 367  C CB  . LYS A 1 50  ? 10.223 103.783 27.516 1.00 40.00 ? 53  LYS A CB  1 
ATOM 368  C CG  . LYS A 1 50  ? 11.045 104.906 26.984 1.00 40.00 ? 53  LYS A CG  1 
ATOM 369  C CD  . LYS A 1 50  ? 11.038 106.150 27.838 1.00 40.00 ? 53  LYS A CD  1 
ATOM 370  C CE  . LYS A 1 50  ? 12.217 107.062 27.614 1.00 40.00 ? 53  LYS A CE  1 
ATOM 371  N NZ  . LYS A 1 50  ? 12.942 107.316 28.893 1.00 40.00 ? 53  LYS A NZ  1 
ATOM 372  N N   . ARG A 1 51  ? 8.856  105.895 29.825 1.00 40.00 ? 54  ARG A N   1 
ATOM 373  C CA  . ARG A 1 51  ? 7.791  106.912 30.007 1.00 40.00 ? 54  ARG A CA  1 
ATOM 374  C C   . ARG A 1 51  ? 7.574  107.590 28.673 1.00 40.00 ? 54  ARG A C   1 
ATOM 375  O O   . ARG A 1 51  ? 8.463  107.537 27.802 1.00 40.00 ? 54  ARG A O   1 
ATOM 376  C CB  . ARG A 1 51  ? 8.186  107.870 31.121 1.00 40.00 ? 54  ARG A CB  1 
ATOM 377  C CG  . ARG A 1 51  ? 7.669  107.408 32.485 1.00 40.00 ? 54  ARG A CG  1 
ATOM 378  C CD  . ARG A 1 51  ? 8.578  107.804 33.642 1.00 40.00 ? 54  ARG A CD  1 
ATOM 379  N NE  . ARG A 1 51  ? 8.603  109.248 33.826 1.00 40.00 ? 54  ARG A NE  1 
ATOM 380  C CZ  . ARG A 1 51  ? 9.621  110.057 33.547 1.00 40.00 ? 54  ARG A CZ  1 
ATOM 381  N NH1 . ARG A 1 51  ? 10.776 109.602 33.065 1.00 40.00 ? 54  ARG A NH1 1 
ATOM 382  N NH2 . ARG A 1 51  ? 9.492  111.374 33.753 1.00 40.00 ? 54  ARG A NH2 1 
ATOM 383  N N   . PRO A 1 52  ? 6.402  108.182 28.452 1.00 40.00 ? 55  PRO A N   1 
ATOM 384  C CA  . PRO A 1 52  ? 6.087  108.833 27.186 1.00 40.00 ? 55  PRO A CA  1 
ATOM 385  C C   . PRO A 1 52  ? 6.864  110.136 27.075 1.00 40.00 ? 55  PRO A C   1 
ATOM 386  O O   . PRO A 1 52  ? 7.045  110.832 28.061 1.00 40.00 ? 55  PRO A O   1 
ATOM 387  C CB  . PRO A 1 52  ? 4.603  109.010 27.236 1.00 40.00 ? 55  PRO A CB  1 
ATOM 388  C CG  . PRO A 1 52  ? 4.116  108.566 28.562 1.00 40.00 ? 55  PRO A CG  1 
ATOM 389  C CD  . PRO A 1 52  ? 5.311  108.341 29.434 1.00 40.00 ? 55  PRO A CD  1 
ATOM 390  N N   . TRP A 1 53  ? 7.342  110.448 25.864 1.00 40.00 ? 56  TRP A N   1 
ATOM 391  C CA  . TRP A 1 53  ? 8.096  111.661 25.673 1.00 40.00 ? 56  TRP A CA  1 
ATOM 392  C C   . TRP A 1 53  ? 7.419  112.733 24.840 1.00 40.00 ? 56  TRP A C   1 
ATOM 393  O O   . TRP A 1 53  ? 6.537  112.544 23.995 1.00 40.00 ? 56  TRP A O   1 
ATOM 394  C CB  . TRP A 1 53  ? 9.410  111.335 24.969 1.00 40.00 ? 56  TRP A CB  1 
ATOM 395  C CG  . TRP A 1 53  ? 9.235  110.644 23.661 1.00 40.00 ? 56  TRP A CG  1 
ATOM 396  C CD1 . TRP A 1 53  ? 9.303  111.211 22.425 1.00 40.00 ? 56  TRP A CD1 1 
ATOM 397  C CD2 . TRP A 1 53  ? 8.989  109.244 23.466 1.00 40.00 ? 56  TRP A CD2 1 
ATOM 398  N NE1 . TRP A 1 53  ? 9.105  110.245 21.456 1.00 40.00 ? 56  TRP A NE1 1 
ATOM 399  C CE2 . TRP A 1 53  ? 8.906  109.031 22.071 1.00 40.00 ? 56  TRP A CE2 1 
ATOM 400  C CE3 . TRP A 1 53  ? 8.823  108.156 24.335 1.00 40.00 ? 56  TRP A CE3 1 
ATOM 401  C CZ2 . TRP A 1 53  ? 8.674  107.770 21.519 1.00 40.00 ? 56  TRP A CZ2 1 
ATOM 402  C CZ3 . TRP A 1 53  ? 8.583  106.908 23.773 1.00 40.00 ? 56  TRP A CZ3 1 
ATOM 403  C CH2 . TRP A 1 53  ? 8.508  106.731 22.385 1.00 40.00 ? 56  TRP A CH2 1 
ATOM 404  N N   . SER A 1 54  ? 7.904  113.960 25.043 1.00 40.00 ? 57  SER A N   1 
ATOM 405  C CA  . SER A 1 54  ? 7.414  115.105 24.293 1.00 40.00 ? 57  SER A CA  1 
ATOM 406  C C   . SER A 1 54  ? 8.179  115.179 22.967 1.00 40.00 ? 57  SER A C   1 
ATOM 407  O O   . SER A 1 54  ? 9.190  114.512 22.750 1.00 40.00 ? 57  SER A O   1 
ATOM 408  C CB  . SER A 1 54  ? 7.731  116.384 25.089 1.00 40.00 ? 57  SER A CB  1 
ATOM 409  O OG  . SER A 1 54  ? 8.939  116.988 24.613 1.00 40.00 ? 57  SER A OG  1 
ATOM 410  N N   . GLY A 1 55  ? 7.711  116.058 22.104 1.00 40.00 ? 58  GLY A N   1 
ATOM 411  C CA  . GLY A 1 55  ? 8.336  116.308 20.829 1.00 40.00 ? 58  GLY A CA  1 
ATOM 412  C C   . GLY A 1 55  ? 8.559  115.052 19.997 1.00 40.00 ? 58  GLY A C   1 
ATOM 413  O O   . GLY A 1 55  ? 7.889  114.018 20.094 1.00 40.00 ? 58  GLY A O   1 
ATOM 414  N N   . VAL A 1 56  ? 9.561  115.215 19.123 1.00 40.00 ? 59  VAL A N   1 
ATOM 415  C CA  . VAL A 1 56  ? 9.869  114.137 18.197 1.00 40.00 ? 59  VAL A CA  1 
ATOM 416  C C   . VAL A 1 56  ? 11.170 113.461 18.565 1.00 40.00 ? 59  VAL A C   1 
ATOM 417  O O   . VAL A 1 56  ? 12.253 114.011 18.360 1.00 40.00 ? 59  VAL A O   1 
ATOM 418  C CB  . VAL A 1 56  ? 9.894  114.688 16.761 1.00 40.00 ? 59  VAL A CB  1 
ATOM 419  C CG1 . VAL A 1 56  ? 10.831 113.930 15.837 1.00 40.00 ? 59  VAL A CG1 1 
ATOM 420  C CG2 . VAL A 1 56  ? 8.451  114.669 16.243 1.00 40.00 ? 59  VAL A CG2 1 
ATOM 421  N N   . LEU A 1 57  ? 11.009 112.242 19.098 1.00 40.00 ? 60  LEU A N   1 
ATOM 422  C CA  . LEU A 1 57  ? 12.186 111.449 19.469 1.00 40.00 ? 60  LEU A CA  1 
ATOM 423  C C   . LEU A 1 57  ? 13.005 111.123 18.222 1.00 40.00 ? 60  LEU A C   1 
ATOM 424  O O   . LEU A 1 57  ? 12.460 110.566 17.257 1.00 40.00 ? 60  LEU A O   1 
ATOM 425  C CB  . LEU A 1 57  ? 11.709 110.159 20.111 1.00 40.00 ? 60  LEU A CB  1 
ATOM 426  C CG  . LEU A 1 57  ? 12.702 109.187 20.738 1.00 40.00 ? 60  LEU A CG  1 
ATOM 427  C CD1 . LEU A 1 57  ? 14.107 109.727 20.812 1.00 40.00 ? 60  LEU A CD1 1 
ATOM 428  C CD2 . LEU A 1 57  ? 12.168 108.830 22.138 1.00 40.00 ? 60  LEU A CD2 1 
ATOM 429  N N   . ASP A 1 58  ? 14.283 111.449 18.242 1.00 40.00 ? 61  ASP A N   1 
ATOM 430  C CA  . ASP A 1 58  ? 15.109 111.127 17.075 1.00 40.00 ? 61  ASP A CA  1 
ATOM 431  C C   . ASP A 1 58  ? 15.351 109.617 17.137 1.00 40.00 ? 61  ASP A C   1 
ATOM 432  O O   . ASP A 1 58  ? 15.592 109.109 18.231 1.00 40.00 ? 61  ASP A O   1 
ATOM 433  C CB  . ASP A 1 58  ? 16.417 111.883 17.076 1.00 40.00 ? 61  ASP A CB  1 
ATOM 434  C CG  . ASP A 1 58  ? 17.394 111.329 16.046 1.00 40.00 ? 61  ASP A CG  1 
ATOM 435  O OD1 . ASP A 1 58  ? 17.768 112.125 15.153 1.00 40.00 ? 61  ASP A OD1 1 
ATOM 436  O OD2 . ASP A 1 58  ? 17.750 110.134 16.130 1.00 40.00 ? 61  ASP A OD2 1 
ATOM 437  N N   . ALA A 1 59  ? 15.303 108.956 16.001 1.00 40.00 ? 62  ALA A N   1 
ATOM 438  C CA  . ALA A 1 59  ? 15.500 107.489 16.032 1.00 40.00 ? 62  ALA A CA  1 
ATOM 439  C C   . ALA A 1 59  ? 16.252 107.108 14.771 1.00 40.00 ? 62  ALA A C   1 
ATOM 440  O O   . ALA A 1 59  ? 16.039 106.057 14.192 1.00 40.00 ? 62  ALA A O   1 
ATOM 441  C CB  . ALA A 1 59  ? 14.125 106.864 16.127 1.00 40.00 ? 62  ALA A CB  1 
ATOM 442  N N   . THR A 1 60  ? 17.157 108.010 14.403 1.00 40.00 ? 63  THR A N   1 
ATOM 443  C CA  . THR A 1 60  ? 17.909 107.841 13.167 1.00 40.00 ? 63  THR A CA  1 
ATOM 444  C C   . THR A 1 60  ? 19.219 107.134 13.359 1.00 40.00 ? 63  THR A C   1 
ATOM 445  O O   . THR A 1 60  ? 20.026 107.015 12.428 1.00 40.00 ? 63  THR A O   1 
ATOM 446  C CB  . THR A 1 60  ? 18.175 109.260 12.604 1.00 40.00 ? 63  THR A CB  1 
ATOM 447  O OG1 . THR A 1 60  ? 19.327 109.864 13.183 1.00 40.00 ? 63  THR A OG1 1 
ATOM 448  C CG2 . THR A 1 60  ? 16.946 110.125 12.896 1.00 40.00 ? 63  THR A CG2 1 
ATOM 449  N N   . THR A 1 61  ? 19.433 106.708 14.619 1.00 40.00 ? 64  THR A N   1 
ATOM 450  C CA  . THR A 1 61  ? 20.707 106.073 14.921 1.00 40.00 ? 64  THR A CA  1 
ATOM 451  C C   . THR A 1 61  ? 20.734 104.999 15.985 1.00 40.00 ? 64  THR A C   1 
ATOM 452  O O   . THR A 1 61  ? 19.857 104.872 16.838 1.00 40.00 ? 64  THR A O   1 
ATOM 453  C CB  . THR A 1 61  ? 21.717 107.172 15.367 1.00 40.00 ? 64  THR A CB  1 
ATOM 454  O OG1 . THR A 1 61  ? 22.989 106.521 15.341 1.00 40.00 ? 64  THR A OG1 1 
ATOM 455  C CG2 . THR A 1 61  ? 21.357 107.648 16.754 1.00 40.00 ? 64  THR A CG2 1 
ATOM 456  N N   . PHE A 1 62  ? 21.807 104.196 15.902 1.00 40.00 ? 65  PHE A N   1 
ATOM 457  C CA  . PHE A 1 62  ? 21.984 103.084 16.827 1.00 40.00 ? 65  PHE A CA  1 
ATOM 458  C C   . PHE A 1 62  ? 22.408 103.520 18.219 1.00 40.00 ? 65  PHE A C   1 
ATOM 459  O O   . PHE A 1 62  ? 23.392 104.238 18.328 1.00 40.00 ? 65  PHE A O   1 
ATOM 460  C CB  . PHE A 1 62  ? 23.054 102.145 16.260 1.00 40.00 ? 65  PHE A CB  1 
ATOM 461  C CG  . PHE A 1 62  ? 22.518 101.002 15.451 1.00 40.00 ? 65  PHE A CG  1 
ATOM 462  C CD1 . PHE A 1 62  ? 21.292 100.412 15.733 1.00 40.00 ? 65  PHE A CD1 1 
ATOM 463  C CD2 . PHE A 1 62  ? 23.267 100.495 14.382 1.00 40.00 ? 65  PHE A CD2 1 
ATOM 464  C CE1 . PHE A 1 62  ? 20.806 99.353  14.993 1.00 40.00 ? 65  PHE A CE1 1 
ATOM 465  C CE2 . PHE A 1 62  ? 22.804 99.436  13.618 1.00 40.00 ? 65  PHE A CE2 1 
ATOM 466  C CZ  . PHE A 1 62  ? 21.583 98.883  13.943 1.00 40.00 ? 65  PHE A CZ  1 
ATOM 467  N N   . GLN A 1 63  ? 21.722 103.060 19.235 1.00 40.00 ? 66  GLN A N   1 
ATOM 468  C CA  . GLN A 1 63  ? 22.040 103.359 20.613 1.00 40.00 ? 66  GLN A CA  1 
ATOM 469  C C   . GLN A 1 63  ? 23.189 102.542 21.193 1.00 40.00 ? 66  GLN A C   1 
ATOM 470  O O   . GLN A 1 63  ? 23.856 101.702 20.565 1.00 40.00 ? 66  GLN A O   1 
ATOM 471  C CB  . GLN A 1 63  ? 20.760 103.122 21.404 1.00 40.00 ? 66  GLN A CB  1 
ATOM 472  C CG  . GLN A 1 63  ? 19.953 104.437 21.413 1.00 40.00 ? 66  GLN A CG  1 
ATOM 473  C CD  . GLN A 1 63  ? 20.727 105.500 22.184 1.00 40.00 ? 66  GLN A CD  1 
ATOM 474  O OE1 . GLN A 1 63  ? 20.870 105.617 23.392 1.00 40.00 ? 66  GLN A OE1 1 
ATOM 475  N NE2 . GLN A 1 63  ? 21.325 106.395 21.387 1.00 40.00 ? 66  GLN A NE2 1 
ATOM 476  N N   . ASN A 1 64  ? 23.469 102.824 22.477 1.00 40.00 ? 67  ASN A N   1 
ATOM 477  C CA  . ASN A 1 64  ? 24.527 102.210 23.231 1.00 40.00 ? 67  ASN A CA  1 
ATOM 478  C C   . ASN A 1 64  ? 24.302 100.722 23.535 1.00 40.00 ? 67  ASN A C   1 
ATOM 479  O O   . ASN A 1 64  ? 23.216 100.314 23.954 1.00 40.00 ? 67  ASN A O   1 
ATOM 480  C CB  . ASN A 1 64  ? 24.720 102.867 24.606 1.00 40.00 ? 67  ASN A CB  1 
ATOM 481  C CG  . ASN A 1 64  ? 25.063 104.333 24.542 1.00 40.00 ? 67  ASN A CG  1 
ATOM 482  O OD1 . ASN A 1 64  ? 25.965 104.752 23.814 1.00 40.00 ? 67  ASN A OD1 1 
ATOM 483  N ND2 . ASN A 1 64  ? 24.313 105.092 25.331 1.00 40.00 ? 67  ASN A ND2 1 
ATOM 484  N N   . VAL A 1 65  ? 25.383 99.993  23.339 1.00 40.00 ? 68  VAL A N   1 
ATOM 485  C CA  . VAL A 1 65  ? 25.452 98.577  23.623 1.00 40.00 ? 68  VAL A CA  1 
ATOM 486  C C   . VAL A 1 65  ? 25.343 98.380  25.133 1.00 40.00 ? 68  VAL A C   1 
ATOM 487  O O   . VAL A 1 65  ? 26.091 99.089  25.864 1.00 40.00 ? 68  VAL A O   1 
ATOM 488  C CB  . VAL A 1 65  ? 26.909 98.154  23.273 1.00 40.00 ? 68  VAL A CB  1 
ATOM 489  C CG1 . VAL A 1 65  ? 27.334 96.868  23.971 1.00 40.00 ? 68  VAL A CG1 1 
ATOM 490  C CG2 . VAL A 1 65  ? 27.171 98.019  21.793 1.00 40.00 ? 68  VAL A CG2 1 
ATOM 491  N N   . CYS A 1 66  ? 24.605 97.426  25.670 1.00 40.00 ? 69  CYS A N   1 
ATOM 492  C CA  . CYS A 1 66  ? 24.633 97.208  27.122 1.00 40.00 ? 69  CYS A CA  1 
ATOM 493  C C   . CYS A 1 66  ? 26.038 96.933  27.684 1.00 40.00 ? 69  CYS A C   1 
ATOM 494  O O   . CYS A 1 66  ? 26.952 96.506  26.966 1.00 40.00 ? 69  CYS A O   1 
ATOM 495  C CB  . CYS A 1 66  ? 23.754 96.014  27.449 1.00 40.00 ? 69  CYS A CB  1 
ATOM 496  S SG  . CYS A 1 66  ? 22.024 96.345  27.205 1.00 40.00 ? 69  CYS A SG  1 
ATOM 497  N N   . TYR A 1 67  ? 26.226 97.138  29.008 1.00 40.00 ? 70  TYR A N   1 
ATOM 498  C CA  . TYR A 1 67  ? 27.520 96.959  29.629 1.00 40.00 ? 70  TYR A CA  1 
ATOM 499  C C   . TYR A 1 67  ? 28.034 95.549  29.559 1.00 40.00 ? 70  TYR A C   1 
ATOM 500  O O   . TYR A 1 67  ? 27.450 94.575  30.047 1.00 40.00 ? 70  TYR A O   1 
ATOM 501  C CB  . TYR A 1 67  ? 27.598 97.576  31.060 1.00 40.00 ? 70  TYR A CB  1 
ATOM 502  C CG  . TYR A 1 67  ? 29.037 98.110  31.209 1.00 40.00 ? 70  TYR A CG  1 
ATOM 503  C CD1 . TYR A 1 67  ? 29.437 99.311  30.644 1.00 40.00 ? 70  TYR A CD1 1 
ATOM 504  C CD2 . TYR A 1 67  ? 29.988 97.362  31.862 1.00 40.00 ? 70  TYR A CD2 1 
ATOM 505  C CE1 . TYR A 1 67  ? 30.732 99.749  30.741 1.00 40.00 ? 70  TYR A CE1 1 
ATOM 506  C CE2 . TYR A 1 67  ? 31.290 97.799  31.974 1.00 40.00 ? 70  TYR A CE2 1 
ATOM 507  C CZ  . TYR A 1 67  ? 31.666 99.000  31.405 1.00 40.00 ? 70  TYR A CZ  1 
ATOM 508  O OH  . TYR A 1 67  ? 32.990 99.381  31.532 1.00 40.00 ? 70  TYR A OH  1 
ATOM 509  N N   . GLN A 1 68  ? 29.202 95.367  28.909 1.00 40.00 ? 71  GLN A N   1 
ATOM 510  C CA  . GLN A 1 68  ? 29.672 93.982  28.769 1.00 40.00 ? 71  GLN A CA  1 
ATOM 511  C C   . GLN A 1 68  ? 31.149 93.777  28.559 1.00 40.00 ? 71  GLN A C   1 
ATOM 512  O O   . GLN A 1 68  ? 31.907 94.601  28.061 1.00 40.00 ? 71  GLN A O   1 
ATOM 513  C CB  . GLN A 1 68  ? 28.899 93.472  27.518 1.00 40.00 ? 71  GLN A CB  1 
ATOM 514  C CG  . GLN A 1 68  ? 29.301 94.210  26.260 1.00 40.00 ? 71  GLN A CG  1 
ATOM 515  C CD  . GLN A 1 68  ? 28.756 93.529  25.015 1.00 40.00 ? 71  GLN A CD  1 
ATOM 516  O OE1 . GLN A 1 68  ? 29.486 92.891  24.238 1.00 40.00 ? 71  GLN A OE1 1 
ATOM 517  N NE2 . GLN A 1 68  ? 27.441 93.702  24.874 1.00 40.00 ? 71  GLN A NE2 1 
ATOM 518  N N   . TYR A 1 69  ? 31.596 92.552  28.903 1.00 40.00 ? 72  TYR A N   1 
ATOM 519  C CA  . TYR A 1 69  ? 33.018 92.231  28.686 1.00 40.00 ? 72  TYR A CA  1 
ATOM 520  C C   . TYR A 1 69  ? 33.319 92.457  27.214 1.00 40.00 ? 72  TYR A C   1 
ATOM 521  O O   . TYR A 1 69  ? 32.454 92.289  26.354 1.00 40.00 ? 72  TYR A O   1 
ATOM 522  C CB  . TYR A 1 69  ? 33.255 90.784  29.110 1.00 40.00 ? 72  TYR A CB  1 
ATOM 523  C CG  . TYR A 1 69  ? 34.562 90.183  28.658 1.00 40.00 ? 72  TYR A CG  1 
ATOM 524  C CD1 . TYR A 1 69  ? 35.590 89.981  29.558 1.00 40.00 ? 72  TYR A CD1 1 
ATOM 525  C CD2 . TYR A 1 69  ? 34.765 89.807  27.341 1.00 40.00 ? 72  TYR A CD2 1 
ATOM 526  C CE1 . TYR A 1 69  ? 36.795 89.441  29.166 1.00 40.00 ? 72  TYR A CE1 1 
ATOM 527  C CE2 . TYR A 1 69  ? 35.966 89.259  26.941 1.00 40.00 ? 72  TYR A CE2 1 
ATOM 528  C CZ  . TYR A 1 69  ? 36.978 89.086  27.854 1.00 40.00 ? 72  TYR A CZ  1 
ATOM 529  O OH  . TYR A 1 69  ? 38.173 88.543  27.448 1.00 40.00 ? 72  TYR A OH  1 
ATOM 530  N N   . VAL A 1 70  ? 34.539 92.803  26.875 1.00 40.00 ? 73  VAL A N   1 
ATOM 531  C CA  . VAL A 1 70  ? 34.917 93.004  25.470 1.00 40.00 ? 73  VAL A CA  1 
ATOM 532  C C   . VAL A 1 70  ? 36.012 92.040  25.071 1.00 40.00 ? 73  VAL A C   1 
ATOM 533  O O   . VAL A 1 70  ? 36.988 91.789  25.803 1.00 40.00 ? 73  VAL A O   1 
ATOM 534  C CB  . VAL A 1 70  ? 35.357 94.447  25.216 1.00 40.00 ? 73  VAL A CB  1 
ATOM 535  C CG1 . VAL A 1 70  ? 36.146 94.587  23.931 1.00 40.00 ? 73  VAL A CG1 1 
ATOM 536  C CG2 . VAL A 1 70  ? 34.145 95.343  25.189 1.00 40.00 ? 73  VAL A CG2 1 
ATOM 537  N N   . ASP A 1 71  ? 35.870 91.408  23.920 1.00 40.00 ? 74  ASP A N   1 
ATOM 538  C CA  . ASP A 1 71  ? 36.884 90.401  23.626 1.00 40.00 ? 74  ASP A CA  1 
ATOM 539  C C   . ASP A 1 71  ? 38.230 90.920  23.203 1.00 40.00 ? 74  ASP A C   1 
ATOM 540  O O   . ASP A 1 71  ? 38.312 91.659  22.230 1.00 40.00 ? 74  ASP A O   1 
ATOM 541  C CB  . ASP A 1 71  ? 36.347 89.377  22.623 1.00 40.00 ? 74  ASP A CB  1 
ATOM 542  C CG  . ASP A 1 71  ? 37.169 88.098  22.691 1.00 40.00 ? 74  ASP A CG  1 
ATOM 543  O OD1 . ASP A 1 71  ? 36.766 87.220  23.477 1.00 40.00 ? 74  ASP A OD1 1 
ATOM 544  O OD2 . ASP A 1 71  ? 38.174 88.033  21.964 1.00 40.00 ? 74  ASP A OD2 1 
ATOM 545  N N   . THR A 1 72  ? 39.246 90.464  23.919 1.00 40.00 ? 75  THR A N   1 
ATOM 546  C CA  . THR A 1 72  ? 40.630 90.795  23.575 1.00 40.00 ? 75  THR A CA  1 
ATOM 547  C C   . THR A 1 72  ? 41.119 89.648  22.688 1.00 40.00 ? 75  THR A C   1 
ATOM 548  O O   . THR A 1 72  ? 40.864 89.661  21.471 1.00 40.00 ? 75  THR A O   1 
ATOM 549  C CB  . THR A 1 72  ? 41.560 90.939  24.772 1.00 40.00 ? 75  THR A CB  1 
ATOM 550  O OG1 . THR A 1 72  ? 40.846 90.876  26.027 1.00 40.00 ? 75  THR A OG1 1 
ATOM 551  C CG2 . THR A 1 72  ? 42.258 92.302  24.730 1.00 40.00 ? 75  THR A CG2 1 
ATOM 552  N N   . LEU A 1 73  ? 41.713 88.626  23.263 1.00 40.00 ? 76  LEU A N   1 
ATOM 553  C CA  . LEU A 1 73  ? 42.204 87.448  22.586 1.00 40.00 ? 76  LEU A CA  1 
ATOM 554  C C   . LEU A 1 73  ? 42.944 87.723  21.291 1.00 40.00 ? 76  LEU A C   1 
ATOM 555  O O   . LEU A 1 73  ? 44.176 87.590  21.249 1.00 40.00 ? 76  LEU A O   1 
ATOM 556  C CB  . LEU A 1 73  ? 41.119 86.391  22.355 1.00 40.00 ? 76  LEU A CB  1 
ATOM 557  C CG  . LEU A 1 73  ? 41.611 85.080  21.703 1.00 40.00 ? 76  LEU A CG  1 
ATOM 558  C CD1 . LEU A 1 73  ? 42.772 84.474  22.466 1.00 40.00 ? 76  LEU A CD1 1 
ATOM 559  C CD2 . LEU A 1 73  ? 40.497 84.059  21.538 1.00 40.00 ? 76  LEU A CD2 1 
ATOM 560  N N   . TYR A 1 74  ? 42.265 88.061  20.221 1.00 40.00 ? 77  TYR A N   1 
ATOM 561  C CA  . TYR A 1 74  ? 42.871 88.352  18.924 1.00 40.00 ? 77  TYR A CA  1 
ATOM 562  C C   . TYR A 1 74  ? 42.462 89.767  18.519 1.00 40.00 ? 77  TYR A C   1 
ATOM 563  O O   . TYR A 1 74  ? 41.482 89.990  17.809 1.00 40.00 ? 77  TYR A O   1 
ATOM 564  C CB  . TYR A 1 74  ? 42.377 87.323  17.910 1.00 40.00 ? 77  TYR A CB  1 
ATOM 565  C CG  . TYR A 1 74  ? 42.848 85.902  18.138 1.00 40.00 ? 77  TYR A CG  1 
ATOM 566  C CD1 . TYR A 1 74  ? 44.207 85.618  18.238 1.00 40.00 ? 77  TYR A CD1 1 
ATOM 567  C CD2 . TYR A 1 74  ? 41.961 84.843  18.252 1.00 40.00 ? 77  TYR A CD2 1 
ATOM 568  C CE1 . TYR A 1 74  ? 44.660 84.335  18.444 1.00 40.00 ? 77  TYR A CE1 1 
ATOM 569  C CE2 . TYR A 1 74  ? 42.404 83.550  18.457 1.00 40.00 ? 77  TYR A CE2 1 
ATOM 570  C CZ  . TYR A 1 74  ? 43.759 83.297  18.549 1.00 40.00 ? 77  TYR A CZ  1 
ATOM 571  O OH  . TYR A 1 74  ? 44.205 82.005  18.753 1.00 40.00 ? 77  TYR A OH  1 
ATOM 572  N N   . PRO A 1 75  ? 43.202 90.750  19.019 1.00 40.00 ? 78  PRO A N   1 
ATOM 573  C CA  . PRO A 1 75  ? 42.928 92.156  18.784 1.00 40.00 ? 78  PRO A CA  1 
ATOM 574  C C   . PRO A 1 75  ? 43.164 92.581  17.356 1.00 40.00 ? 78  PRO A C   1 
ATOM 575  O O   . PRO A 1 75  ? 44.215 92.308  16.774 1.00 40.00 ? 78  PRO A O   1 
ATOM 576  C CB  . PRO A 1 75  ? 43.830 92.880  19.754 1.00 40.00 ? 78  PRO A CB  1 
ATOM 577  C CG  . PRO A 1 75  ? 44.905 91.933  20.131 1.00 40.00 ? 78  PRO A CG  1 
ATOM 578  C CD  . PRO A 1 75  ? 44.414 90.564  19.850 1.00 40.00 ? 78  PRO A CD  1 
ATOM 579  N N   . GLY A 1 76  ? 42.135 93.215  16.785 1.00 40.00 ? 79  GLY A N   1 
ATOM 580  C CA  . GLY A 1 76  ? 42.219 93.644  15.403 1.00 40.00 ? 79  GLY A CA  1 
ATOM 581  C C   . GLY A 1 76  ? 41.797 92.527  14.458 1.00 40.00 ? 79  GLY A C   1 
ATOM 582  O O   . GLY A 1 76  ? 41.742 92.794  13.245 1.00 40.00 ? 79  GLY A O   1 
ATOM 583  N N   . PHE A 1 77  ? 41.487 91.335  14.961 1.00 40.00 ? 80  PHE A N   1 
ATOM 584  C CA  . PHE A 1 77  ? 41.058 90.217  14.117 1.00 40.00 ? 80  PHE A CA  1 
ATOM 585  C C   . PHE A 1 77  ? 39.560 90.285  13.847 1.00 40.00 ? 80  PHE A C   1 
ATOM 586  O O   . PHE A 1 77  ? 38.746 90.232  14.779 1.00 40.00 ? 80  PHE A O   1 
ATOM 587  C CB  . PHE A 1 77  ? 41.404 88.874  14.771 1.00 40.00 ? 80  PHE A CB  1 
ATOM 588  C CG  . PHE A 1 77  ? 40.809 87.669  14.089 1.00 40.00 ? 80  PHE A CG  1 
ATOM 589  C CD1 . PHE A 1 77  ? 41.155 87.356  12.793 1.00 40.00 ? 80  PHE A CD1 1 
ATOM 590  C CD2 . PHE A 1 77  ? 39.909 86.852  14.751 1.00 40.00 ? 80  PHE A CD2 1 
ATOM 591  C CE1 . PHE A 1 77  ? 40.627 86.255  12.154 1.00 40.00 ? 80  PHE A CE1 1 
ATOM 592  C CE2 . PHE A 1 77  ? 39.393 85.738  14.137 1.00 40.00 ? 80  PHE A CE2 1 
ATOM 593  C CZ  . PHE A 1 77  ? 39.745 85.444  12.833 1.00 40.00 ? 80  PHE A CZ  1 
ATOM 594  N N   . GLU A 1 78  ? 39.187 90.352  12.582 1.00 40.00 ? 81  GLU A N   1 
ATOM 595  C CA  . GLU A 1 78  ? 37.775 90.429  12.208 1.00 40.00 ? 81  GLU A CA  1 
ATOM 596  C C   . GLU A 1 78  ? 36.913 89.338  12.814 1.00 40.00 ? 81  GLU A C   1 
ATOM 597  O O   . GLU A 1 78  ? 35.777 89.575  13.258 1.00 40.00 ? 81  GLU A O   1 
ATOM 598  C CB  . GLU A 1 78  ? 37.638 90.396  10.671 1.00 40.00 ? 81  GLU A CB  1 
ATOM 599  C CG  . GLU A 1 78  ? 36.233 90.676  10.181 1.00 40.00 ? 81  GLU A CG  1 
ATOM 600  C CD  . GLU A 1 78  ? 35.932 90.081  8.817  1.00 40.00 ? 81  GLU A CD  1 
ATOM 601  O OE1 . GLU A 1 78  ? 36.101 90.787  7.790  1.00 40.00 ? 81  GLU A OE1 1 
ATOM 602  O OE2 . GLU A 1 78  ? 35.516 88.892  8.721  1.00 40.00 ? 81  GLU A OE2 1 
ATOM 603  N N   . GLY A 1 79  ? 37.420 88.106  12.857 1.00 40.00 ? 82  GLY A N   1 
ATOM 604  C CA  . GLY A 1 79  ? 36.648 86.989  13.375 1.00 40.00 ? 82  GLY A CA  1 
ATOM 605  C C   . GLY A 1 79  ? 36.108 87.186  14.782 1.00 40.00 ? 82  GLY A C   1 
ATOM 606  O O   . GLY A 1 79  ? 35.014 86.691  15.106 1.00 40.00 ? 82  GLY A O   1 
ATOM 607  N N   . THR A 1 80  ? 36.894 87.847  15.628 1.00 40.00 ? 83  THR A N   1 
ATOM 608  C CA  . THR A 1 80  ? 36.434 88.091  16.991 1.00 40.00 ? 83  THR A CA  1 
ATOM 609  C C   . THR A 1 80  ? 35.815 89.490  17.084 1.00 40.00 ? 83  THR A C   1 
ATOM 610  O O   . THR A 1 80  ? 34.739 89.681  17.650 1.00 40.00 ? 83  THR A O   1 
ATOM 611  C CB  . THR A 1 80  ? 37.618 88.055  17.970 1.00 40.00 ? 83  THR A CB  1 
ATOM 612  O OG1 . THR A 1 80  ? 38.765 88.637  17.327 1.00 40.00 ? 83  THR A OG1 1 
ATOM 613  C CG2 . THR A 1 80  ? 37.964 86.640  18.374 1.00 40.00 ? 83  THR A CG2 1 
ATOM 614  N N   . GLU A 1 81  ? 36.525 90.466  16.512 1.00 40.00 ? 84  GLU A N   1 
ATOM 615  C CA  . GLU A 1 81  ? 36.055 91.837  16.586 1.00 40.00 ? 84  GLU A CA  1 
ATOM 616  C C   . GLU A 1 81  ? 34.627 91.974  16.136 1.00 40.00 ? 84  GLU A C   1 
ATOM 617  O O   . GLU A 1 81  ? 33.797 92.539  16.868 1.00 40.00 ? 84  GLU A O   1 
ATOM 618  C CB  . GLU A 1 81  ? 36.949 92.787  15.823 1.00 40.00 ? 84  GLU A CB  1 
ATOM 619  C CG  . GLU A 1 81  ? 38.380 92.933  16.275 1.00 40.00 ? 84  GLU A CG  1 
ATOM 620  C CD  . GLU A 1 81  ? 38.593 93.421  17.682 1.00 40.00 ? 84  GLU A CD  1 
ATOM 621  O OE1 . GLU A 1 81  ? 39.768 93.384  18.145 1.00 40.00 ? 84  GLU A OE1 1 
ATOM 622  O OE2 . GLU A 1 81  ? 37.603 93.840  18.342 1.00 40.00 ? 84  GLU A OE2 1 
ATOM 623  N N   . MET A 1 82  ? 34.256 91.392  15.005 1.00 40.00 ? 85  MET A N   1 
ATOM 624  C CA  . MET A 1 82  ? 32.895 91.464  14.464 1.00 40.00 ? 85  MET A CA  1 
ATOM 625  C C   . MET A 1 82  ? 31.801 91.175  15.473 1.00 40.00 ? 85  MET A C   1 
ATOM 626  O O   . MET A 1 82  ? 30.625 91.471  15.254 1.00 40.00 ? 85  MET A O   1 
ATOM 627  C CB  . MET A 1 82  ? 32.757 90.485  13.291 1.00 40.00 ? 85  MET A CB  1 
ATOM 628  C CG  . MET A 1 82  ? 32.863 89.034  13.758 1.00 40.00 ? 85  MET A CG  1 
ATOM 629  S SD  . MET A 1 82  ? 32.515 87.861  12.441 1.00 40.00 ? 85  MET A SD  1 
ATOM 630  C CE  . MET A 1 82  ? 30.751 88.098  12.250 1.00 40.00 ? 85  MET A CE  1 
ATOM 631  N N   . TRP A 1 83  ? 32.138 90.565  16.599 1.00 40.00 ? 86  TRP A N   1 
ATOM 632  C CA  . TRP A 1 83  ? 31.199 90.235  17.640 1.00 40.00 ? 86  TRP A CA  1 
ATOM 633  C C   . TRP A 1 83  ? 31.133 91.258  18.763 1.00 40.00 ? 86  TRP A C   1 
ATOM 634  O O   . TRP A 1 83  ? 30.138 91.278  19.484 1.00 40.00 ? 86  TRP A O   1 
ATOM 635  C CB  . TRP A 1 83  ? 31.591 88.837  18.195 1.00 40.00 ? 86  TRP A CB  1 
ATOM 636  C CG  . TRP A 1 83  ? 31.472 87.789  17.123 1.00 40.00 ? 86  TRP A CG  1 
ATOM 637  C CD1 . TRP A 1 83  ? 32.488 87.012  16.664 1.00 40.00 ? 86  TRP A CD1 1 
ATOM 638  C CD2 . TRP A 1 83  ? 30.306 87.427  16.379 1.00 40.00 ? 86  TRP A CD2 1 
ATOM 639  N NE1 . TRP A 1 83  ? 32.025 86.177  15.663 1.00 40.00 ? 86  TRP A NE1 1 
ATOM 640  C CE2 . TRP A 1 83  ? 30.697 86.417  15.474 1.00 40.00 ? 86  TRP A CE2 1 
ATOM 641  C CE3 . TRP A 1 83  ? 28.976 87.850  16.381 1.00 40.00 ? 86  TRP A CE3 1 
ATOM 642  C CZ2 . TRP A 1 83  ? 29.805 85.811  14.594 1.00 40.00 ? 86  TRP A CZ2 1 
ATOM 643  C CZ3 . TRP A 1 83  ? 28.082 87.269  15.501 1.00 40.00 ? 86  TRP A CZ3 1 
ATOM 644  C CH2 . TRP A 1 83  ? 28.500 86.255  14.618 1.00 40.00 ? 86  TRP A CH2 1 
ATOM 645  N N   . ASN A 1 84  ? 32.167 92.055  18.873 1.00 40.00 ? 87  ASN A N   1 
ATOM 646  C CA  . ASN A 1 84  ? 32.378 93.106  19.834 1.00 40.00 ? 87  ASN A CA  1 
ATOM 647  C C   . ASN A 1 84  ? 31.442 94.290  19.689 1.00 40.00 ? 87  ASN A C   1 
ATOM 648  O O   . ASN A 1 84  ? 30.808 94.522  18.651 1.00 40.00 ? 87  ASN A O   1 
ATOM 649  C CB  . ASN A 1 84  ? 33.854 93.531  19.705 1.00 40.00 ? 87  ASN A CB  1 
ATOM 650  C CG  . ASN A 1 84  ? 34.705 92.837  20.739 1.00 40.00 ? 87  ASN A CG  1 
ATOM 651  O OD1 . ASN A 1 84  ? 34.129 92.466  21.782 1.00 40.00 ? 87  ASN A OD1 1 
ATOM 652  N ND2 . ASN A 1 84  ? 36.002 92.656  20.516 1.00 40.00 ? 87  ASN A ND2 1 
ATOM 653  N N   . PRO A 1 85  ? 31.310 95.094  20.734 1.00 40.00 ? 88  PRO A N   1 
ATOM 654  C CA  . PRO A 1 85  ? 30.406 96.240  20.735 1.00 40.00 ? 88  PRO A CA  1 
ATOM 655  C C   . PRO A 1 85  ? 30.865 97.225  19.678 1.00 40.00 ? 88  PRO A C   1 
ATOM 656  O O   . PRO A 1 85  ? 32.079 97.320  19.454 1.00 40.00 ? 88  PRO A O   1 
ATOM 657  C CB  . PRO A 1 85  ? 30.377 96.724  22.150 1.00 40.00 ? 88  PRO A CB  1 
ATOM 658  C CG  . PRO A 1 85  ? 31.324 95.903  22.937 1.00 40.00 ? 88  PRO A CG  1 
ATOM 659  C CD  . PRO A 1 85  ? 32.034 94.961  22.020 1.00 40.00 ? 88  PRO A CD  1 
ATOM 660  N N   . ASN A 1 86  ? 29.908 97.868  18.981 1.00 40.00 ? 89  ASN A N   1 
ATOM 661  C CA  . ASN A 1 86  ? 30.313 98.802  17.920 1.00 40.00 ? 89  ASN A CA  1 
ATOM 662  C C   . ASN A 1 86  ? 29.740 100.187 18.235 1.00 40.00 ? 89  ASN A C   1 
ATOM 663  O O   . ASN A 1 86  ? 29.716 101.144 17.460 1.00 40.00 ? 89  ASN A O   1 
ATOM 664  C CB  . ASN A 1 86  ? 29.867 98.358  16.541 1.00 40.00 ? 89  ASN A CB  1 
ATOM 665  C CG  . ASN A 1 86  ? 28.354 98.237  16.428 1.00 40.00 ? 89  ASN A CG  1 
ATOM 666  O OD1 . ASN A 1 86  ? 27.581 98.287  17.394 1.00 40.00 ? 89  ASN A OD1 1 
ATOM 667  N ND2 . ASN A 1 86  ? 27.879 98.034  15.191 1.00 40.00 ? 89  ASN A ND2 1 
ATOM 668  N N   . ARG A 1 87  ? 29.206 100.251 19.443 1.00 40.00 ? 90  ARG A N   1 
ATOM 669  C CA  . ARG A 1 87  ? 28.635 101.459 19.992 1.00 40.00 ? 90  ARG A CA  1 
ATOM 670  C C   . ARG A 1 87  ? 29.225 101.645 21.389 1.00 40.00 ? 90  ARG A C   1 
ATOM 671  O O   . ARG A 1 87  ? 30.030 100.826 21.886 1.00 40.00 ? 90  ARG A O   1 
ATOM 672  C CB  . ARG A 1 87  ? 27.137 101.308 19.973 1.00 40.00 ? 90  ARG A CB  1 
ATOM 673  C CG  . ARG A 1 87  ? 26.390 101.844 18.788 1.00 40.00 ? 90  ARG A CG  1 
ATOM 674  C CD  . ARG A 1 87  ? 27.223 102.628 17.785 1.00 40.00 ? 90  ARG A CD  1 
ATOM 675  N NE  . ARG A 1 87  ? 26.464 102.891 16.582 1.00 40.00 ? 90  ARG A NE  1 
ATOM 676  C CZ  . ARG A 1 87  ? 26.816 102.669 15.319 1.00 40.00 ? 90  ARG A CZ  1 
ATOM 677  N NH1 . ARG A 1 87  ? 27.999 102.153 14.999 1.00 40.00 ? 90  ARG A NH1 1 
ATOM 678  N NH2 . ARG A 1 87  ? 25.927 102.981 14.361 1.00 40.00 ? 90  ARG A NH2 1 
ATOM 679  N N   . GLU A 1 88  ? 28.894 102.744 22.065 1.00 40.00 ? 91  GLU A N   1 
ATOM 680  C CA  . GLU A 1 88  ? 29.473 102.896 23.390 1.00 40.00 ? 91  GLU A CA  1 
ATOM 681  C C   . GLU A 1 88  ? 28.796 101.989 24.395 1.00 40.00 ? 91  GLU A C   1 
ATOM 682  O O   . GLU A 1 88  ? 27.604 101.699 24.292 1.00 40.00 ? 91  GLU A O   1 
ATOM 683  C CB  . GLU A 1 88  ? 29.452 104.369 23.814 1.00 40.00 ? 91  GLU A CB  1 
ATOM 684  C CG  . GLU A 1 88  ? 30.738 105.044 23.291 1.00 40.00 ? 91  GLU A CG  1 
ATOM 685  C CD  . GLU A 1 88  ? 31.005 106.320 24.057 1.00 40.00 ? 91  GLU A CD  1 
ATOM 686  O OE1 . GLU A 1 88  ? 31.456 107.297 23.415 1.00 40.00 ? 91  GLU A OE1 1 
ATOM 687  O OE2 . GLU A 1 88  ? 30.752 106.328 25.286 1.00 40.00 ? 91  GLU A OE2 1 
ATOM 688  N N   . LEU A 1 89  ? 29.641 101.568 25.360 1.00 40.00 ? 92  LEU A N   1 
ATOM 689  C CA  . LEU A 1 89  ? 29.063 100.718 26.401 1.00 40.00 ? 92  LEU A CA  1 
ATOM 690  C C   . LEU A 1 89  ? 28.215 101.562 27.324 1.00 40.00 ? 92  LEU A C   1 
ATOM 691  O O   . LEU A 1 89  ? 28.586 102.715 27.509 1.00 40.00 ? 92  LEU A O   1 
ATOM 692  C CB  . LEU A 1 89  ? 30.228 100.108 27.211 1.00 40.00 ? 92  LEU A CB  1 
ATOM 693  C CG  . LEU A 1 89  ? 30.864 98.969  26.359 1.00 40.00 ? 92  LEU A CG  1 
ATOM 694  C CD1 . LEU A 1 89  ? 32.108 98.447  27.023 1.00 40.00 ? 92  LEU A CD1 1 
ATOM 695  C CD2 . LEU A 1 89  ? 29.799 97.906  26.114 1.00 40.00 ? 92  LEU A CD2 1 
ATOM 696  N N   . SER A 1 90  ? 27.158 101.045 27.907 1.00 40.00 ? 93  SER A N   1 
ATOM 697  C CA  . SER A 1 90  ? 26.462 101.851 28.890 1.00 40.00 ? 93  SER A CA  1 
ATOM 698  C C   . SER A 1 90  ? 25.361 101.072 29.582 1.00 40.00 ? 93  SER A C   1 
ATOM 699  O O   . SER A 1 90  ? 24.644 100.317 28.895 1.00 40.00 ? 93  SER A O   1 
ATOM 700  C CB  . SER A 1 90  ? 25.854 103.107 28.285 1.00 40.00 ? 93  SER A CB  1 
ATOM 701  O OG  . SER A 1 90  ? 24.597 103.322 28.965 1.00 40.00 ? 93  SER A OG  1 
ATOM 702  N N   . GLU A 1 91  ? 25.086 101.334 30.860 1.00 40.00 ? 94  GLU A N   1 
ATOM 703  C CA  . GLU A 1 91  ? 23.955 100.612 31.466 1.00 40.00 ? 94  GLU A CA  1 
ATOM 704  C C   . GLU A 1 91  ? 22.680 101.143 30.833 1.00 40.00 ? 94  GLU A C   1 
ATOM 705  O O   . GLU A 1 91  ? 21.599 100.536 30.923 1.00 40.00 ? 94  GLU A O   1 
ATOM 706  C CB  . GLU A 1 91  ? 23.975 100.741 32.973 1.00 40.00 ? 94  GLU A CB  1 
ATOM 707  C CG  . GLU A 1 91  ? 25.181 100.075 33.656 1.00 40.00 ? 94  GLU A CG  1 
ATOM 708  C CD  . GLU A 1 91  ? 24.901 99.886  35.145 1.00 40.00 ? 94  GLU A CD  1 
ATOM 709  O OE1 . GLU A 1 91  ? 23.933 99.127  35.461 1.00 40.00 ? 94  GLU A OE1 1 
ATOM 710  O OE2 . GLU A 1 91  ? 25.609 100.480 35.986 1.00 40.00 ? 94  GLU A OE2 1 
ATOM 711  N N   . ASP A 1 92  ? 22.721 102.306 30.183 1.00 40.00 ? 95  ASP A N   1 
ATOM 712  C CA  . ASP A 1 92  ? 21.528 102.835 29.532 1.00 40.00 ? 95  ASP A CA  1 
ATOM 713  C C   . ASP A 1 92  ? 21.539 102.366 28.061 1.00 40.00 ? 95  ASP A C   1 
ATOM 714  O O   . ASP A 1 92  ? 22.143 103.072 27.233 1.00 40.00 ? 95  ASP A O   1 
ATOM 715  C CB  . ASP A 1 92  ? 21.473 104.343 29.613 1.00 40.00 ? 95  ASP A CB  1 
ATOM 716  C CG  . ASP A 1 92  ? 20.140 104.837 29.065 1.00 40.00 ? 95  ASP A CG  1 
ATOM 717  O OD1 . ASP A 1 92  ? 19.262 103.947 28.863 1.00 40.00 ? 95  ASP A OD1 1 
ATOM 718  O OD2 . ASP A 1 92  ? 19.972 106.050 28.846 1.00 40.00 ? 95  ASP A OD2 1 
ATOM 719  N N   . CYS A 1 93  ? 20.905 101.195 27.848 1.00 40.00 ? 96  CYS A N   1 
ATOM 720  C CA  . CYS A 1 93  ? 20.929 100.508 26.574 1.00 40.00 ? 96  CYS A CA  1 
ATOM 721  C C   . CYS A 1 93  ? 19.664 99.814  26.140 1.00 40.00 ? 96  CYS A C   1 
ATOM 722  O O   . CYS A 1 93  ? 19.665 99.151  25.087 1.00 40.00 ? 96  CYS A O   1 
ATOM 723  C CB  . CYS A 1 93  ? 22.025 99.381  26.659 1.00 40.00 ? 96  CYS A CB  1 
ATOM 724  S SG  . CYS A 1 93  ? 21.687 98.179  27.963 1.00 40.00 ? 96  CYS A SG  1 
ATOM 725  N N   . LEU A 1 94  ? 18.585 99.924  26.892 1.00 40.00 ? 97  LEU A N   1 
ATOM 726  C CA  . LEU A 1 94  ? 17.323 99.300  26.542 1.00 40.00 ? 97  LEU A CA  1 
ATOM 727  C C   . LEU A 1 94  ? 16.559 99.978  25.444 1.00 40.00 ? 97  LEU A C   1 
ATOM 728  O O   . LEU A 1 94  ? 15.566 100.702 25.644 1.00 40.00 ? 97  LEU A O   1 
ATOM 729  C CB  . LEU A 1 94  ? 16.425 99.175  27.803 1.00 40.00 ? 97  LEU A CB  1 
ATOM 730  C CG  . LEU A 1 94  ? 17.067 98.235  28.824 1.00 40.00 ? 97  LEU A CG  1 
ATOM 731  C CD1 . LEU A 1 94  ? 16.093 97.731  29.877 1.00 40.00 ? 97  LEU A CD1 1 
ATOM 732  C CD2 . LEU A 1 94  ? 17.750 97.084  28.109 1.00 40.00 ? 97  LEU A CD2 1 
ATOM 733  N N   . TYR A 1 95  ? 17.012 99.795  24.210 1.00 40.00 ? 98  TYR A N   1 
ATOM 734  C CA  . TYR A 1 95  ? 16.398 100.334 23.015 1.00 40.00 ? 98  TYR A CA  1 
ATOM 735  C C   . TYR A 1 95  ? 16.167 99.191  22.039 1.00 40.00 ? 98  TYR A C   1 
ATOM 736  O O   . TYR A 1 95  ? 16.702 98.106  22.312 1.00 40.00 ? 98  TYR A O   1 
ATOM 737  C CB  . TYR A 1 95  ? 17.367 101.346 22.366 1.00 40.00 ? 98  TYR A CB  1 
ATOM 738  C CG  . TYR A 1 95  ? 17.695 102.413 23.399 1.00 40.00 ? 98  TYR A CG  1 
ATOM 739  C CD1 . TYR A 1 95  ? 16.686 102.934 24.202 1.00 40.00 ? 98  TYR A CD1 1 
ATOM 740  C CD2 . TYR A 1 95  ? 18.935 102.884 23.643 1.00 40.00 ? 98  TYR A CD2 1 
ATOM 741  C CE1 . TYR A 1 95  ? 16.920 103.871 25.183 1.00 40.00 ? 98  TYR A CE1 1 
ATOM 742  C CE2 . TYR A 1 95  ? 19.216 103.854 24.572 1.00 40.00 ? 98  TYR A CE2 1 
ATOM 743  C CZ  . TYR A 1 95  ? 18.208 104.352 25.353 1.00 40.00 ? 98  TYR A CZ  1 
ATOM 744  O OH  . TYR A 1 95  ? 18.462 105.297 26.306 1.00 40.00 ? 98  TYR A OH  1 
ATOM 745  N N   . LEU A 1 96  ? 15.371 99.419  21.009 1.00 40.00 ? 99  LEU A N   1 
ATOM 746  C CA  . LEU A 1 96  ? 15.195 98.346  20.010 1.00 40.00 ? 99  LEU A CA  1 
ATOM 747  C C   . LEU A 1 96  ? 15.318 98.993  18.655 1.00 40.00 ? 99  LEU A C   1 
ATOM 748  O O   . LEU A 1 96  ? 15.601 100.197 18.530 1.00 40.00 ? 99  LEU A O   1 
ATOM 749  C CB  . LEU A 1 96  ? 13.892 97.640  20.250 1.00 40.00 ? 99  LEU A CB  1 
ATOM 750  C CG  . LEU A 1 96  ? 12.648 98.504  20.176 1.00 40.00 ? 99  LEU A CG  1 
ATOM 751  C CD1 . LEU A 1 96  ? 12.328 98.698  18.685 1.00 40.00 ? 99  LEU A CD1 1 
ATOM 752  C CD2 . LEU A 1 96  ? 11.445 97.857  20.868 1.00 40.00 ? 99  LEU A CD2 1 
ATOM 753  N N   . ASN A 1 97  ? 15.214 98.245  17.584 1.00 40.00 ? 100 ASN A N   1 
ATOM 754  C CA  . ASN A 1 97  ? 15.283 98.837  16.256 1.00 40.00 ? 100 ASN A CA  1 
ATOM 755  C C   . ASN A 1 97  ? 14.125 98.303  15.417 1.00 40.00 ? 100 ASN A C   1 
ATOM 756  O O   . ASN A 1 97  ? 13.509 97.266  15.706 1.00 40.00 ? 100 ASN A O   1 
ATOM 757  C CB  . ASN A 1 97  ? 16.595 98.536  15.526 1.00 40.00 ? 100 ASN A CB  1 
ATOM 758  C CG  . ASN A 1 97  ? 17.749 98.879  16.472 1.00 40.00 ? 100 ASN A CG  1 
ATOM 759  O OD1 . ASN A 1 97  ? 17.943 100.029 16.797 1.00 40.00 ? 100 ASN A OD1 1 
ATOM 760  N ND2 . ASN A 1 97  ? 18.398 97.828  16.913 1.00 40.00 ? 100 ASN A ND2 1 
ATOM 761  N N   . VAL A 1 98  ? 13.810 99.059  14.360 1.00 40.00 ? 101 VAL A N   1 
ATOM 762  C CA  . VAL A 1 98  ? 12.797 98.619  13.423 1.00 40.00 ? 101 VAL A CA  1 
ATOM 763  C C   . VAL A 1 98  ? 13.256 98.940  11.987 1.00 40.00 ? 101 VAL A C   1 
ATOM 764  O O   . VAL A 1 98  ? 13.737 100.056 11.740 1.00 40.00 ? 101 VAL A O   1 
ATOM 765  C CB  . VAL A 1 98  ? 11.410 99.232  13.614 1.00 40.00 ? 101 VAL A CB  1 
ATOM 766  C CG1 . VAL A 1 98  ? 10.496 98.750  12.477 1.00 40.00 ? 101 VAL A CG1 1 
ATOM 767  C CG2 . VAL A 1 98  ? 10.761 98.856  14.949 1.00 40.00 ? 101 VAL A CG2 1 
ATOM 768  N N   . TRP A 1 99  ? 13.093 97.962  11.115 1.00 40.00 ? 102 TRP A N   1 
ATOM 769  C CA  . TRP A 1 99  ? 13.340 98.192  9.702  1.00 40.00 ? 102 TRP A CA  1 
ATOM 770  C C   . TRP A 1 99  ? 11.979 97.831  9.044  1.00 40.00 ? 102 TRP A C   1 
ATOM 771  O O   . TRP A 1 99  ? 11.367 96.847  9.437  1.00 40.00 ? 102 TRP A O   1 
ATOM 772  C CB  . TRP A 1 99  ? 14.456 97.521  9.026  1.00 40.00 ? 102 TRP A CB  1 
ATOM 773  C CG  . TRP A 1 99  ? 15.870 97.592  9.472  1.00 40.00 ? 102 TRP A CG  1 
ATOM 774  C CD1 . TRP A 1 99  ? 16.947 98.046  8.741  1.00 40.00 ? 102 TRP A CD1 1 
ATOM 775  C CD2 . TRP A 1 99  ? 16.431 97.141  10.711 1.00 40.00 ? 102 TRP A CD2 1 
ATOM 776  N NE1 . TRP A 1 99  ? 18.131 97.916  9.448  1.00 40.00 ? 102 TRP A NE1 1 
ATOM 777  C CE2 . TRP A 1 99  ? 17.827 97.353  10.656 1.00 40.00 ? 102 TRP A CE2 1 
ATOM 778  C CE3 . TRP A 1 99  ? 15.875 96.565  11.860 1.00 40.00 ? 102 TRP A CE3 1 
ATOM 779  C CZ2 . TRP A 1 99  ? 18.666 97.042  11.717 1.00 40.00 ? 102 TRP A CZ2 1 
ATOM 780  C CZ3 . TRP A 1 99  ? 16.716 96.256  12.908 1.00 40.00 ? 102 TRP A CZ3 1 
ATOM 781  C CH2 . TRP A 1 99  ? 18.090 96.497  12.825 1.00 40.00 ? 102 TRP A CH2 1 
ATOM 782  N N   . THR A 1 100 ? 11.534 98.674  8.143  1.00 40.00 ? 103 THR A N   1 
ATOM 783  C CA  . THR A 1 100 ? 10.289 98.507  7.384  1.00 40.00 ? 103 THR A CA  1 
ATOM 784  C C   . THR A 1 100 ? 10.705 98.914  5.958  1.00 40.00 ? 103 THR A C   1 
ATOM 785  O O   . THR A 1 100 ? 11.575 99.794  5.842  1.00 40.00 ? 103 THR A O   1 
ATOM 786  C CB  . THR A 1 100 ? 9.169  99.442  7.833  1.00 40.00 ? 103 THR A CB  1 
ATOM 787  O OG1 . THR A 1 100 ? 8.643  99.040  9.109  1.00 40.00 ? 103 THR A OG1 1 
ATOM 788  C CG2 . THR A 1 100 ? 7.969  99.513  6.889  1.00 40.00 ? 103 THR A CG2 1 
ATOM 789  N N   . PRO A 1 101 ? 10.101 98.294  4.968  1.00 40.00 ? 104 PRO A N   1 
ATOM 790  C CA  . PRO A 1 101 ? 10.369 98.635  3.570  1.00 40.00 ? 104 PRO A CA  1 
ATOM 791  C C   . PRO A 1 101 ? 9.869  100.043 3.247  1.00 40.00 ? 104 PRO A C   1 
ATOM 792  O O   . PRO A 1 101 ? 8.845  100.419 3.832  1.00 40.00 ? 104 PRO A O   1 
ATOM 793  C CB  . PRO A 1 101 ? 9.560  97.601  2.810  1.00 40.00 ? 104 PRO A CB  1 
ATOM 794  C CG  . PRO A 1 101 ? 8.436  97.229  3.730  1.00 40.00 ? 104 PRO A CG  1 
ATOM 795  C CD  . PRO A 1 101 ? 9.061  97.252  5.101  1.00 40.00 ? 104 PRO A CD  1 
ATOM 796  N N   . TYR A 1 102 ? 10.562 100.795 2.408  1.00 40.00 ? 105 TYR A N   1 
ATOM 797  C CA  . TYR A 1 102 ? 10.170 102.163 2.016  1.00 40.00 ? 105 TYR A CA  1 
ATOM 798  C C   . TYR A 1 102 ? 9.497  102.035 0.647  1.00 40.00 ? 105 TYR A C   1 
ATOM 799  O O   . TYR A 1 102 ? 10.148 101.651 -0.325 1.00 40.00 ? 105 TYR A O   1 
ATOM 800  C CB  . TYR A 1 102 ? 11.392 103.063 1.879  1.00 40.00 ? 105 TYR A CB  1 
ATOM 801  C CG  . TYR A 1 102 ? 11.104 104.527 1.674  1.00 40.00 ? 105 TYR A CG  1 
ATOM 802  C CD1 . TYR A 1 102 ? 10.490 105.258 2.690  1.00 40.00 ? 105 TYR A CD1 1 
ATOM 803  C CD2 . TYR A 1 102 ? 11.439 105.191 0.496  1.00 40.00 ? 105 TYR A CD2 1 
ATOM 804  C CE1 . TYR A 1 102 ? 10.233 106.602 2.516  1.00 40.00 ? 105 TYR A CE1 1 
ATOM 805  C CE2 . TYR A 1 102 ? 11.175 106.537 0.320  1.00 40.00 ? 105 TYR A CE2 1 
ATOM 806  C CZ  . TYR A 1 102 ? 10.559 107.239 1.341  1.00 40.00 ? 105 TYR A CZ  1 
ATOM 807  O OH  . TYR A 1 102 ? 10.267 108.584 1.220  1.00 40.00 ? 105 TYR A OH  1 
ATOM 808  N N   . PRO A 1 103 ? 8.206  102.294 0.608  1.00 40.00 ? 106 PRO A N   1 
ATOM 809  C CA  . PRO A 1 103 ? 7.422  102.792 1.707  1.00 40.00 ? 106 PRO A CA  1 
ATOM 810  C C   . PRO A 1 103 ? 6.645  101.787 2.517  1.00 40.00 ? 106 PRO A C   1 
ATOM 811  O O   . PRO A 1 103 ? 6.505  100.642 2.071  1.00 40.00 ? 106 PRO A O   1 
ATOM 812  C CB  . PRO A 1 103 ? 6.354  103.613 0.932  1.00 40.00 ? 106 PRO A CB  1 
ATOM 813  C CG  . PRO A 1 103 ? 6.051  102.681 -0.206 1.00 40.00 ? 106 PRO A CG  1 
ATOM 814  C CD  . PRO A 1 103 ? 7.402  102.172 -0.646 1.00 40.00 ? 106 PRO A CD  1 
ATOM 815  N N   . ARG A 1 104 ? 6.240  102.198 3.718  1.00 40.00 ? 107 ARG A N   1 
ATOM 816  C CA  . ARG A 1 104 ? 5.500  101.305 4.607  1.00 40.00 ? 107 ARG A CA  1 
ATOM 817  C C   . ARG A 1 104 ? 4.665  100.335 3.795  1.00 40.00 ? 107 ARG A C   1 
ATOM 818  O O   . ARG A 1 104 ? 4.129  100.675 2.743  1.00 40.00 ? 107 ARG A O   1 
ATOM 819  C CB  . ARG A 1 104 ? 4.639  102.095 5.590  1.00 40.00 ? 107 ARG A CB  1 
ATOM 820  C CG  . ARG A 1 104 ? 5.456  102.505 6.814  1.00 40.00 ? 107 ARG A CG  1 
ATOM 821  C CD  . ARG A 1 104 ? 4.592  102.547 8.068  1.00 40.00 ? 107 ARG A CD  1 
ATOM 822  N NE  . ARG A 1 104 ? 4.026  103.870 8.297  1.00 40.00 ? 107 ARG A NE  1 
ATOM 823  C CZ  . ARG A 1 104 ? 4.744  104.987 8.361  1.00 40.00 ? 107 ARG A CZ  1 
ATOM 824  N NH1 . ARG A 1 104 ? 6.069  104.963 8.216  1.00 40.00 ? 107 ARG A NH1 1 
ATOM 825  N NH2 . ARG A 1 104 ? 4.144  106.151 8.567  1.00 40.00 ? 107 ARG A NH2 1 
ATOM 826  N N   . PRO A 1 105 ? 4.593  99.096  4.262  1.00 40.00 ? 108 PRO A N   1 
ATOM 827  C CA  . PRO A 1 105 ? 3.848  98.066  3.568  1.00 40.00 ? 108 PRO A CA  1 
ATOM 828  C C   . PRO A 1 105 ? 2.413  98.536  3.367  1.00 40.00 ? 108 PRO A C   1 
ATOM 829  O O   . PRO A 1 105 ? 2.014  99.559  3.910  1.00 40.00 ? 108 PRO A O   1 
ATOM 830  C CB  . PRO A 1 105 ? 3.881  96.855  4.472  1.00 40.00 ? 108 PRO A CB  1 
ATOM 831  C CG  . PRO A 1 105 ? 4.418  97.304  5.781  1.00 40.00 ? 108 PRO A CG  1 
ATOM 832  C CD  . PRO A 1 105 ? 5.173  98.582  5.524  1.00 40.00 ? 108 PRO A CD  1 
ATOM 833  N N   . ALA A 1 106 ? 1.679  97.735  2.617  1.00 40.00 ? 109 ALA A N   1 
ATOM 834  C CA  . ALA A 1 106 ? 0.291  98.075  2.317  1.00 40.00 ? 109 ALA A CA  1 
ATOM 835  C C   . ALA A 1 106 ? -0.650 97.646  3.438  1.00 40.00 ? 109 ALA A C   1 
ATOM 836  O O   . ALA A 1 106 ? -1.492 98.353  3.962  1.00 40.00 ? 109 ALA A O   1 
ATOM 837  C CB  . ALA A 1 106 ? -0.093 97.379  1.009  1.00 40.00 ? 109 ALA A CB  1 
ATOM 838  N N   . SER A 1 107 ? -0.461 96.382  3.779  1.00 40.00 ? 110 SER A N   1 
ATOM 839  C CA  . SER A 1 107 ? -1.185 95.599  4.758  1.00 40.00 ? 110 SER A CA  1 
ATOM 840  C C   . SER A 1 107 ? -0.240 95.010  5.802  1.00 40.00 ? 110 SER A C   1 
ATOM 841  O O   . SER A 1 107 ? 0.974  94.918  5.570  1.00 40.00 ? 110 SER A O   1 
ATOM 842  C CB  . SER A 1 107 ? -1.857 94.475  3.942  1.00 40.00 ? 110 SER A CB  1 
ATOM 843  O OG  . SER A 1 107 ? -2.356 93.454  4.761  1.00 40.00 ? 110 SER A OG  1 
ATOM 844  N N   . PRO A 1 108 ? -0.771 94.586  6.945  1.00 40.00 ? 111 PRO A N   1 
ATOM 845  C CA  . PRO A 1 108 ? -0.025 94.009  8.028  1.00 40.00 ? 111 PRO A CA  1 
ATOM 846  C C   . PRO A 1 108 ? 0.982  92.938  7.687  1.00 40.00 ? 111 PRO A C   1 
ATOM 847  O O   . PRO A 1 108 ? 0.606  91.753  7.696  1.00 40.00 ? 111 PRO A O   1 
ATOM 848  C CB  . PRO A 1 108 ? -1.126 93.384  8.916  1.00 40.00 ? 111 PRO A CB  1 
ATOM 849  C CG  . PRO A 1 108 ? -2.271 94.324  8.739  1.00 40.00 ? 111 PRO A CG  1 
ATOM 850  C CD  . PRO A 1 108 ? -2.225 94.675  7.276  1.00 40.00 ? 111 PRO A CD  1 
ATOM 851  N N   . THR A 1 109 ? 2.227  93.323  7.436  1.00 40.00 ? 112 THR A N   1 
ATOM 852  C CA  . THR A 1 109 ? 3.292  92.362  7.129  1.00 40.00 ? 112 THR A CA  1 
ATOM 853  C C   . THR A 1 109 ? 3.647  91.602  8.398  1.00 40.00 ? 112 THR A C   1 
ATOM 854  O O   . THR A 1 109 ? 3.463  92.119  9.500  1.00 40.00 ? 112 THR A O   1 
ATOM 855  C CB  . THR A 1 109 ? 4.528  93.123  6.613  1.00 40.00 ? 112 THR A CB  1 
ATOM 856  O OG1 . THR A 1 109 ? 4.194  93.615  5.301  1.00 40.00 ? 112 THR A OG1 1 
ATOM 857  C CG2 . THR A 1 109 ? 5.814  92.353  6.487  1.00 40.00 ? 112 THR A CG2 1 
ATOM 858  N N   . PRO A 1 110 ? 4.152  90.390  8.231  1.00 40.00 ? 113 PRO A N   1 
ATOM 859  C CA  . PRO A 1 110 ? 4.630  89.578  9.341  1.00 40.00 ? 113 PRO A CA  1 
ATOM 860  C C   . PRO A 1 110 ? 5.929  90.170  9.901  1.00 40.00 ? 113 PRO A C   1 
ATOM 861  O O   . PRO A 1 110 ? 6.782  90.726  9.179  1.00 40.00 ? 113 PRO A O   1 
ATOM 862  C CB  . PRO A 1 110 ? 4.883  88.226  8.676  1.00 40.00 ? 113 PRO A CB  1 
ATOM 863  C CG  . PRO A 1 110 ? 5.326  88.594  7.291  1.00 40.00 ? 113 PRO A CG  1 
ATOM 864  C CD  . PRO A 1 110 ? 4.379  89.707  6.923  1.00 40.00 ? 113 PRO A CD  1 
ATOM 865  N N   . VAL A 1 111 ? 6.097  90.055  11.227 1.00 40.00 ? 114 VAL A N   1 
ATOM 866  C CA  . VAL A 1 111 ? 7.299  90.570  11.863 1.00 40.00 ? 114 VAL A CA  1 
ATOM 867  C C   . VAL A 1 111 ? 8.244  89.484  12.378 1.00 40.00 ? 114 VAL A C   1 
ATOM 868  O O   . VAL A 1 111 ? 7.870  88.499  13.014 1.00 40.00 ? 114 VAL A O   1 
ATOM 869  C CB  . VAL A 1 111 ? 7.013  91.473  13.079 1.00 40.00 ? 114 VAL A CB  1 
ATOM 870  C CG1 . VAL A 1 111 ? 6.421  92.784  12.605 1.00 40.00 ? 114 VAL A CG1 1 
ATOM 871  C CG2 . VAL A 1 111 ? 6.096  90.745  14.056 1.00 40.00 ? 114 VAL A CG2 1 
ATOM 872  N N   . LEU A 1 112 ? 9.508  89.758  12.115 1.00 40.00 ? 115 LEU A N   1 
ATOM 873  C CA  . LEU A 1 112 ? 10.645 88.965  12.537 1.00 40.00 ? 115 LEU A CA  1 
ATOM 874  C C   . LEU A 1 112 ? 11.422 89.692  13.647 1.00 40.00 ? 115 LEU A C   1 
ATOM 875  O O   . LEU A 1 112 ? 12.246 90.559  13.320 1.00 40.00 ? 115 LEU A O   1 
ATOM 876  C CB  . LEU A 1 112 ? 11.606 88.780  11.355 1.00 40.00 ? 115 LEU A CB  1 
ATOM 877  C CG  . LEU A 1 112 ? 11.697 87.385  10.746 1.00 40.00 ? 115 LEU A CG  1 
ATOM 878  C CD1 . LEU A 1 112 ? 10.330 86.713  10.757 1.00 40.00 ? 115 LEU A CD1 1 
ATOM 879  C CD2 . LEU A 1 112 ? 12.293 87.455  9.347  1.00 40.00 ? 115 LEU A CD2 1 
ATOM 880  N N   . ILE A 1 113 ? 11.188 89.374  14.902 1.00 40.00 ? 116 ILE A N   1 
ATOM 881  C CA  . ILE A 1 113 ? 11.891 89.950  16.060 1.00 40.00 ? 116 ILE A CA  1 
ATOM 882  C C   . ILE A 1 113 ? 13.186 89.173  16.299 1.00 40.00 ? 116 ILE A C   1 
ATOM 883  O O   . ILE A 1 113 ? 13.097 87.967  16.614 1.00 40.00 ? 116 ILE A O   1 
ATOM 884  C CB  . ILE A 1 113 ? 10.969 89.777  17.280 1.00 40.00 ? 116 ILE A CB  1 
ATOM 885  C CG1 . ILE A 1 113 ? 9.943  90.916  17.332 1.00 40.00 ? 116 ILE A CG1 1 
ATOM 886  C CG2 . ILE A 1 113 ? 11.658 89.716  18.612 1.00 40.00 ? 116 ILE A CG2 1 
ATOM 887  C CD1 . ILE A 1 113 ? 8.695  90.553  18.141 1.00 40.00 ? 116 ILE A CD1 1 
ATOM 888  N N   . TRP A 1 114 ? 14.351 89.784  16.163 1.00 40.00 ? 117 TRP A N   1 
ATOM 889  C CA  . TRP A 1 114 ? 15.608 89.060  16.353 1.00 40.00 ? 117 TRP A CA  1 
ATOM 890  C C   . TRP A 1 114 ? 16.208 89.186  17.738 1.00 40.00 ? 117 TRP A C   1 
ATOM 891  O O   . TRP A 1 114 ? 16.273 90.271  18.324 1.00 40.00 ? 117 TRP A O   1 
ATOM 892  C CB  . TRP A 1 114 ? 16.629 89.539  15.330 1.00 40.00 ? 117 TRP A CB  1 
ATOM 893  C CG  . TRP A 1 114 ? 18.057 89.252  15.646 1.00 40.00 ? 117 TRP A CG  1 
ATOM 894  C CD1 . TRP A 1 114 ? 18.970 90.059  16.245 1.00 40.00 ? 117 TRP A CD1 1 
ATOM 895  C CD2 . TRP A 1 114 ? 18.743 88.029  15.358 1.00 40.00 ? 117 TRP A CD2 1 
ATOM 896  N NE1 . TRP A 1 114 ? 20.194 89.420  16.334 1.00 40.00 ? 117 TRP A NE1 1 
ATOM 897  C CE2 . TRP A 1 114 ? 20.080 88.173  15.802 1.00 40.00 ? 117 TRP A CE2 1 
ATOM 898  C CE3 . TRP A 1 114 ? 18.358 86.825  14.748 1.00 40.00 ? 117 TRP A CE3 1 
ATOM 899  C CZ2 . TRP A 1 114 ? 21.020 87.163  15.662 1.00 40.00 ? 117 TRP A CZ2 1 
ATOM 900  C CZ3 . TRP A 1 114 ? 19.285 85.831  14.623 1.00 40.00 ? 117 TRP A CZ3 1 
ATOM 901  C CH2 . TRP A 1 114 ? 20.602 85.998  15.065 1.00 40.00 ? 117 TRP A CH2 1 
ATOM 902  N N   . ILE A 1 115 ? 16.728 88.061  18.267 1.00 40.00 ? 118 ILE A N   1 
ATOM 903  C CA  . ILE A 1 115 ? 17.358 88.133  19.594 1.00 40.00 ? 118 ILE A CA  1 
ATOM 904  C C   . ILE A 1 115 ? 18.824 87.776  19.519 1.00 40.00 ? 118 ILE A C   1 
ATOM 905  O O   . ILE A 1 115 ? 19.126 86.614  19.359 1.00 40.00 ? 118 ILE A O   1 
ATOM 906  C CB  . ILE A 1 115 ? 16.635 87.251  20.608 1.00 40.00 ? 118 ILE A CB  1 
ATOM 907  C CG1 . ILE A 1 115 ? 15.145 87.608  20.666 1.00 40.00 ? 118 ILE A CG1 1 
ATOM 908  C CG2 . ILE A 1 115 ? 17.275 87.511  21.954 1.00 40.00 ? 118 ILE A CG2 1 
ATOM 909  C CD1 . ILE A 1 115 ? 14.357 86.924  21.780 1.00 40.00 ? 118 ILE A CD1 1 
ATOM 910  N N   . TYR A 1 116 ? 19.744 88.718  19.611 1.00 40.00 ? 119 TYR A N   1 
ATOM 911  C CA  . TYR A 1 116 ? 21.171 88.439  19.519 1.00 40.00 ? 119 TYR A CA  1 
ATOM 912  C C   . TYR A 1 116 ? 21.655 87.471  20.611 1.00 40.00 ? 119 TYR A C   1 
ATOM 913  O O   . TYR A 1 116 ? 21.027 87.366  21.681 1.00 40.00 ? 119 TYR A O   1 
ATOM 914  C CB  . TYR A 1 116 ? 22.003 89.712  19.586 1.00 40.00 ? 119 TYR A CB  1 
ATOM 915  C CG  . TYR A 1 116 ? 21.984 90.513  20.866 1.00 40.00 ? 119 TYR A CG  1 
ATOM 916  C CD1 . TYR A 1 116 ? 22.613 90.116  22.034 1.00 40.00 ? 119 TYR A CD1 1 
ATOM 917  C CD2 . TYR A 1 116 ? 21.334 91.747  20.896 1.00 40.00 ? 119 TYR A CD2 1 
ATOM 918  C CE1 . TYR A 1 116 ? 22.581 90.892  23.171 1.00 40.00 ? 119 TYR A CE1 1 
ATOM 919  C CE2 . TYR A 1 116 ? 21.289 92.538  22.019 1.00 40.00 ? 119 TYR A CE2 1 
ATOM 920  C CZ  . TYR A 1 116 ? 21.918 92.105  23.172 1.00 40.00 ? 119 TYR A CZ  1 
ATOM 921  O OH  . TYR A 1 116 ? 21.865 92.881  24.316 1.00 40.00 ? 119 TYR A OH  1 
ATOM 922  N N   . GLY A 1 117 ? 22.787 86.805  20.343 1.00 40.00 ? 120 GLY A N   1 
ATOM 923  C CA  . GLY A 1 117 ? 23.309 85.899  21.359 1.00 40.00 ? 120 GLY A CA  1 
ATOM 924  C C   . GLY A 1 117 ? 24.801 86.107  21.603 1.00 40.00 ? 120 GLY A C   1 
ATOM 925  O O   . GLY A 1 117 ? 25.580 86.420  20.696 1.00 40.00 ? 120 GLY A O   1 
ATOM 926  N N   . GLY A 1 118 ? 25.254 85.890  22.846 1.00 40.00 ? 121 GLY A N   1 
ATOM 927  C CA  . GLY A 1 118 ? 26.688 86.024  23.149 1.00 40.00 ? 121 GLY A CA  1 
ATOM 928  C C   . GLY A 1 118 ? 26.954 85.472  24.545 1.00 40.00 ? 121 GLY A C   1 
ATOM 929  O O   . GLY A 1 118 ? 27.437 86.159  25.463 1.00 40.00 ? 121 GLY A O   1 
ATOM 930  N N   . GLY A 1 119 ? 26.550 84.215  24.744 1.00 40.00 ? 122 GLY A N   1 
ATOM 931  C CA  . GLY A 1 119 ? 26.735 83.548  26.026 1.00 40.00 ? 122 GLY A CA  1 
ATOM 932  C C   . GLY A 1 119 ? 25.914 84.143  27.132 1.00 40.00 ? 122 GLY A C   1 
ATOM 933  O O   . GLY A 1 119 ? 26.169 83.842  28.312 1.00 40.00 ? 122 GLY A O   1 
ATOM 934  N N   . PHE A 1 120 ? 24.984 85.034  26.866 1.00 40.00 ? 123 PHE A N   1 
ATOM 935  C CA  . PHE A 1 120 ? 24.231 85.742  27.886 1.00 40.00 ? 123 PHE A CA  1 
ATOM 936  C C   . PHE A 1 120 ? 25.130 86.786  28.557 1.00 40.00 ? 123 PHE A C   1 
ATOM 937  O O   . PHE A 1 120 ? 24.700 87.421  29.520 1.00 40.00 ? 123 PHE A O   1 
ATOM 938  C CB  . PHE A 1 120 ? 23.699 84.785  28.970 1.00 40.00 ? 123 PHE A CB  1 
ATOM 939  C CG  . PHE A 1 120 ? 22.471 84.069  28.530 1.00 40.00 ? 123 PHE A CG  1 
ATOM 940  C CD1 . PHE A 1 120 ? 21.346 84.769  28.131 1.00 40.00 ? 123 PHE A CD1 1 
ATOM 941  C CD2 . PHE A 1 120 ? 22.436 82.685  28.486 1.00 40.00 ? 123 PHE A CD2 1 
ATOM 942  C CE1 . PHE A 1 120 ? 20.208 84.119  27.698 1.00 40.00 ? 123 PHE A CE1 1 
ATOM 943  C CE2 . PHE A 1 120 ? 21.295 82.022  28.057 1.00 40.00 ? 123 PHE A CE2 1 
ATOM 944  C CZ  . PHE A 1 120 ? 20.184 82.750  27.661 1.00 40.00 ? 123 PHE A CZ  1 
ATOM 945  N N   . TYR A 1 121 ? 26.355 86.958  28.106 1.00 40.00 ? 124 TYR A N   1 
ATOM 946  C CA  . TYR A 1 121 ? 27.325 87.843  28.702 1.00 40.00 ? 124 TYR A CA  1 
ATOM 947  C C   . TYR A 1 121 ? 27.754 88.929  27.729 1.00 40.00 ? 124 TYR A C   1 
ATOM 948  O O   . TYR A 1 121 ? 28.522 89.797  28.148 1.00 40.00 ? 124 TYR A O   1 
ATOM 949  C CB  . TYR A 1 121 ? 28.614 87.119  29.174 1.00 40.00 ? 124 TYR A CB  1 
ATOM 950  C CG  . TYR A 1 121 ? 29.555 86.760  28.049 1.00 40.00 ? 124 TYR A CG  1 
ATOM 951  C CD1 . TYR A 1 121 ? 30.430 87.672  27.518 1.00 40.00 ? 124 TYR A CD1 1 
ATOM 952  C CD2 . TYR A 1 121 ? 29.583 85.462  27.496 1.00 40.00 ? 124 TYR A CD2 1 
ATOM 953  C CE1 . TYR A 1 121 ? 31.285 87.351  26.483 1.00 40.00 ? 124 TYR A CE1 1 
ATOM 954  C CE2 . TYR A 1 121 ? 30.431 85.107  26.458 1.00 40.00 ? 124 TYR A CE2 1 
ATOM 955  C CZ  . TYR A 1 121 ? 31.289 86.065  25.952 1.00 40.00 ? 124 TYR A CZ  1 
ATOM 956  O OH  . TYR A 1 121 ? 32.127 85.750  24.910 1.00 40.00 ? 124 TYR A OH  1 
ATOM 957  N N   . SER A 1 122 ? 27.338 88.847  26.472 1.00 40.00 ? 125 SER A N   1 
ATOM 958  C CA  . SER A 1 122 ? 27.807 89.868  25.516 1.00 40.00 ? 125 SER A CA  1 
ATOM 959  C C   . SER A 1 122 ? 26.809 90.016  24.396 1.00 40.00 ? 125 SER A C   1 
ATOM 960  O O   . SER A 1 122 ? 25.798 89.337  24.493 1.00 40.00 ? 125 SER A O   1 
ATOM 961  C CB  . SER A 1 122 ? 29.140 89.392  24.926 1.00 40.00 ? 125 SER A CB  1 
ATOM 962  O OG  . SER A 1 122 ? 28.886 88.493  23.855 1.00 40.00 ? 125 SER A OG  1 
ATOM 963  N N   . GLY A 1 123 ? 27.055 90.851  23.398 1.00 40.00 ? 126 GLY A N   1 
ATOM 964  C CA  . GLY A 1 123 ? 26.094 90.989  22.301 1.00 40.00 ? 126 GLY A CA  1 
ATOM 965  C C   . GLY A 1 123 ? 25.376 92.298  22.114 1.00 40.00 ? 126 GLY A C   1 
ATOM 966  O O   . GLY A 1 123 ? 25.064 93.031  23.060 1.00 40.00 ? 126 GLY A O   1 
ATOM 967  N N   . ALA A 1 124 ? 24.928 92.562  20.871 1.00 40.00 ? 127 ALA A N   1 
ATOM 968  C CA  . ALA A 1 124 ? 24.222 93.776  20.543 1.00 40.00 ? 127 ALA A CA  1 
ATOM 969  C C   . ALA A 1 124 ? 23.532 93.800  19.187 1.00 40.00 ? 127 ALA A C   1 
ATOM 970  O O   . ALA A 1 124 ? 24.141 93.459  18.161 1.00 40.00 ? 127 ALA A O   1 
ATOM 971  C CB  . ALA A 1 124 ? 25.261 94.923  20.490 1.00 40.00 ? 127 ALA A CB  1 
ATOM 972  N N   . ALA A 1 125 ? 22.297 94.304  19.204 1.00 40.00 ? 128 ALA A N   1 
ATOM 973  C CA  . ALA A 1 125 ? 21.559 94.462  17.951 1.00 40.00 ? 128 ALA A CA  1 
ATOM 974  C C   . ALA A 1 125 ? 22.299 95.396  17.019 1.00 40.00 ? 128 ALA A C   1 
ATOM 975  O O   . ALA A 1 125 ? 22.347 95.218  15.788 1.00 40.00 ? 128 ALA A O   1 
ATOM 976  C CB  . ALA A 1 125 ? 20.135 94.884  18.278 1.00 40.00 ? 128 ALA A CB  1 
ATOM 977  N N   . SER A 1 126 ? 23.019 96.388  17.479 1.00 40.00 ? 129 SER A N   1 
ATOM 978  C CA  . SER A 1 126 ? 23.847 97.318  16.739 1.00 40.00 ? 129 SER A CA  1 
ATOM 979  C C   . SER A 1 126 ? 24.819 96.642  15.768 1.00 40.00 ? 129 SER A C   1 
ATOM 980  O O   . SER A 1 126 ? 25.414 97.278  14.883 1.00 40.00 ? 129 SER A O   1 
ATOM 981  C CB  . SER A 1 126 ? 24.744 98.110  17.740 1.00 40.00 ? 129 SER A CB  1 
ATOM 982  O OG  . SER A 1 126 ? 24.175 98.220  19.038 1.00 40.00 ? 129 SER A OG  1 
ATOM 983  N N   . LEU A 1 127 ? 25.071 95.351  15.921 1.00 40.00 ? 130 LEU A N   1 
ATOM 984  C CA  . LEU A 1 127 ? 26.026 94.661  15.084 1.00 40.00 ? 130 LEU A CA  1 
ATOM 985  C C   . LEU A 1 127 ? 25.729 94.622  13.608 1.00 40.00 ? 130 LEU A C   1 
ATOM 986  O O   . LEU A 1 127 ? 24.568 94.611  13.182 1.00 40.00 ? 130 LEU A O   1 
ATOM 987  C CB  . LEU A 1 127 ? 26.252 93.240  15.624 1.00 40.00 ? 130 LEU A CB  1 
ATOM 988  C CG  . LEU A 1 127 ? 27.039 93.241  16.950 1.00 40.00 ? 130 LEU A CG  1 
ATOM 989  C CD1 . LEU A 1 127 ? 27.447 91.836  17.314 1.00 40.00 ? 130 LEU A CD1 1 
ATOM 990  C CD2 . LEU A 1 127 ? 28.293 94.111  16.823 1.00 40.00 ? 130 LEU A CD2 1 
ATOM 991  N N   . ASP A 1 128 ? 26.799 94.573  12.823 1.00 40.00 ? 131 ASP A N   1 
ATOM 992  C CA  . ASP A 1 128 ? 26.690 94.550  11.370 1.00 40.00 ? 131 ASP A CA  1 
ATOM 993  C C   . ASP A 1 128 ? 25.945 93.370  10.810 1.00 40.00 ? 131 ASP A C   1 
ATOM 994  O O   . ASP A 1 128 ? 24.971 93.541  10.059 1.00 40.00 ? 131 ASP A O   1 
ATOM 995  C CB  . ASP A 1 128 ? 28.079 94.623  10.719 1.00 40.00 ? 131 ASP A CB  1 
ATOM 996  C CG  . ASP A 1 128 ? 28.639 96.036  10.697 1.00 40.00 ? 131 ASP A CG  1 
ATOM 997  O OD1 . ASP A 1 128 ? 28.023 96.931  11.339 1.00 40.00 ? 131 ASP A OD1 1 
ATOM 998  O OD2 . ASP A 1 128 ? 29.682 96.238  10.040 1.00 40.00 ? 131 ASP A OD2 1 
ATOM 999  N N   . VAL A 1 129 ? 26.323 92.148  11.180 1.00 40.00 ? 132 VAL A N   1 
ATOM 1000 C CA  . VAL A 1 129 ? 25.606 90.971  10.703 1.00 40.00 ? 132 VAL A CA  1 
ATOM 1001 C C   . VAL A 1 129 ? 24.156 90.955  11.159 1.00 40.00 ? 132 VAL A C   1 
ATOM 1002 O O   . VAL A 1 129 ? 23.447 90.023  10.727 1.00 40.00 ? 132 VAL A O   1 
ATOM 1003 C CB  . VAL A 1 129 ? 26.245 89.640  11.101 1.00 40.00 ? 132 VAL A CB  1 
ATOM 1004 C CG1 . VAL A 1 129 ? 27.713 89.604  10.706 1.00 40.00 ? 132 VAL A CG1 1 
ATOM 1005 C CG2 . VAL A 1 129 ? 26.093 89.416  12.591 1.00 40.00 ? 132 VAL A CG2 1 
ATOM 1006 N N   . TYR A 1 130 ? 23.643 91.856  12.004 1.00 40.00 ? 133 TYR A N   1 
ATOM 1007 C CA  . TYR A 1 130 ? 22.222 91.731  12.339 1.00 40.00 ? 133 TYR A CA  1 
ATOM 1008 C C   . TYR A 1 130 ? 21.456 92.874  11.662 1.00 40.00 ? 133 TYR A C   1 
ATOM 1009 O O   . TYR A 1 130 ? 20.419 93.345  12.143 1.00 40.00 ? 133 TYR A O   1 
ATOM 1010 C CB  . TYR A 1 130 ? 21.879 91.604  13.797 1.00 40.00 ? 133 TYR A CB  1 
ATOM 1011 C CG  . TYR A 1 130 ? 22.677 90.713  14.710 1.00 40.00 ? 133 TYR A CG  1 
ATOM 1012 C CD1 . TYR A 1 130 ? 23.285 89.561  14.235 1.00 40.00 ? 133 TYR A CD1 1 
ATOM 1013 C CD2 . TYR A 1 130 ? 22.849 90.986  16.064 1.00 40.00 ? 133 TYR A CD2 1 
ATOM 1014 C CE1 . TYR A 1 130 ? 24.037 88.728  15.015 1.00 40.00 ? 133 TYR A CE1 1 
ATOM 1015 C CE2 . TYR A 1 130 ? 23.608 90.159  16.875 1.00 40.00 ? 133 TYR A CE2 1 
ATOM 1016 C CZ  . TYR A 1 130 ? 24.202 89.030  16.350 1.00 40.00 ? 133 TYR A CZ  1 
ATOM 1017 O OH  . TYR A 1 130 ? 24.951 88.192  17.141 1.00 40.00 ? 133 TYR A OH  1 
ATOM 1018 N N   . ASP A 1 131 ? 21.999 93.321  10.534 1.00 40.00 ? 134 ASP A N   1 
ATOM 1019 C CA  . ASP A 1 131 ? 21.407 94.394  9.746  1.00 40.00 ? 134 ASP A CA  1 
ATOM 1020 C C   . ASP A 1 131 ? 20.111 93.938  9.102  1.00 40.00 ? 134 ASP A C   1 
ATOM 1021 O O   . ASP A 1 131 ? 20.162 93.313  8.029  1.00 40.00 ? 134 ASP A O   1 
ATOM 1022 C CB  . ASP A 1 131 ? 22.402 94.800  8.649  1.00 40.00 ? 134 ASP A CB  1 
ATOM 1023 C CG  . ASP A 1 131 ? 22.038 96.086  7.942  1.00 40.00 ? 134 ASP A CG  1 
ATOM 1024 O OD1 . ASP A 1 131 ? 22.963 96.647  7.294  1.00 40.00 ? 134 ASP A OD1 1 
ATOM 1025 O OD2 . ASP A 1 131 ? 20.866 96.522  8.042  1.00 40.00 ? 134 ASP A OD2 1 
ATOM 1026 N N   . GLY A 1 132 ? 18.971 94.275  9.703  1.00 40.00 ? 135 GLY A N   1 
ATOM 1027 C CA  . GLY A 1 132 ? 17.691 93.876  9.161  1.00 40.00 ? 135 GLY A CA  1 
ATOM 1028 C C   . GLY A 1 132 ? 17.251 94.567  7.891  1.00 40.00 ? 135 GLY A C   1 
ATOM 1029 O O   . GLY A 1 132 ? 16.072 94.405  7.507  1.00 40.00 ? 135 GLY A O   1 
ATOM 1030 N N   . ARG A 1 133 ? 18.066 95.344  7.187  1.00 40.00 ? 136 ARG A N   1 
ATOM 1031 C CA  . ARG A 1 133 ? 17.627 96.039  5.990  1.00 40.00 ? 136 ARG A CA  1 
ATOM 1032 C C   . ARG A 1 133 ? 17.297 95.115  4.832  1.00 40.00 ? 136 ARG A C   1 
ATOM 1033 O O   . ARG A 1 133 ? 16.198 95.242  4.232  1.00 40.00 ? 136 ARG A O   1 
ATOM 1034 C CB  . ARG A 1 133 ? 18.578 97.164  5.643  1.00 40.00 ? 136 ARG A CB  1 
ATOM 1035 C CG  . ARG A 1 133 ? 19.482 96.975  4.457  1.00 40.00 ? 136 ARG A CG  1 
ATOM 1036 C CD  . ARG A 1 133 ? 20.934 96.925  4.781  1.00 40.00 ? 136 ARG A CD  1 
ATOM 1037 N NE  . ARG A 1 133 ? 21.831 97.952  4.314  1.00 40.00 ? 136 ARG A NE  1 
ATOM 1038 C CZ  . ARG A 1 133 ? 22.102 99.127  4.851  1.00 40.00 ? 136 ARG A CZ  1 
ATOM 1039 N NH1 . ARG A 1 133 ? 21.496 99.531  5.959  1.00 40.00 ? 136 ARG A NH1 1 
ATOM 1040 N NH2 . ARG A 1 133 ? 22.997 99.945  4.287  1.00 40.00 ? 136 ARG A NH2 1 
ATOM 1041 N N   . PHE A 1 134 ? 18.154 94.165  4.492  1.00 40.00 ? 137 PHE A N   1 
ATOM 1042 C CA  . PHE A 1 134 ? 17.882 93.232  3.399  1.00 40.00 ? 137 PHE A CA  1 
ATOM 1043 C C   . PHE A 1 134 ? 16.594 92.456  3.591  1.00 40.00 ? 137 PHE A C   1 
ATOM 1044 O O   . PHE A 1 134 ? 15.686 92.502  2.752  1.00 40.00 ? 137 PHE A O   1 
ATOM 1045 C CB  . PHE A 1 134 ? 19.073 92.281  3.200  1.00 40.00 ? 137 PHE A CB  1 
ATOM 1046 C CG  . PHE A 1 134 ? 20.387 93.015  3.222  1.00 40.00 ? 137 PHE A CG  1 
ATOM 1047 C CD1 . PHE A 1 134 ? 21.154 93.058  4.377  1.00 40.00 ? 137 PHE A CD1 1 
ATOM 1048 C CD2 . PHE A 1 134 ? 20.841 93.695  2.100  1.00 40.00 ? 137 PHE A CD2 1 
ATOM 1049 C CE1 . PHE A 1 134 ? 22.358 93.753  4.385  1.00 40.00 ? 137 PHE A CE1 1 
ATOM 1050 C CE2 . PHE A 1 134 ? 22.041 94.389  2.106  1.00 40.00 ? 137 PHE A CE2 1 
ATOM 1051 C CZ  . PHE A 1 134 ? 22.814 94.412  3.252  1.00 40.00 ? 137 PHE A CZ  1 
ATOM 1052 N N   . LEU A 1 135 ? 16.386 91.779  4.722  1.00 40.00 ? 138 LEU A N   1 
ATOM 1053 C CA  . LEU A 1 135 ? 15.143 91.049  4.958  1.00 40.00 ? 138 LEU A CA  1 
ATOM 1054 C C   . LEU A 1 135 ? 13.913 91.934  4.904  1.00 40.00 ? 138 LEU A C   1 
ATOM 1055 O O   . LEU A 1 135 ? 12.788 91.416  4.722  1.00 40.00 ? 138 LEU A O   1 
ATOM 1056 C CB  . LEU A 1 135 ? 15.187 90.288  6.290  1.00 40.00 ? 138 LEU A CB  1 
ATOM 1057 C CG  . LEU A 1 135 ? 16.170 89.108  6.306  1.00 40.00 ? 138 LEU A CG  1 
ATOM 1058 C CD1 . LEU A 1 135 ? 17.039 89.095  7.540  1.00 40.00 ? 138 LEU A CD1 1 
ATOM 1059 C CD2 . LEU A 1 135 ? 15.396 87.801  6.154  1.00 40.00 ? 138 LEU A CD2 1 
ATOM 1060 N N   . ALA A 1 136 ? 14.043 93.252  5.083  1.00 40.00 ? 139 ALA A N   1 
ATOM 1061 C CA  . ALA A 1 136 ? 12.834 94.079  4.981  1.00 40.00 ? 139 ALA A CA  1 
ATOM 1062 C C   . ALA A 1 136 ? 12.734 94.494  3.506  1.00 40.00 ? 139 ALA A C   1 
ATOM 1063 O O   . ALA A 1 136 ? 11.713 94.402  2.852  1.00 40.00 ? 139 ALA A O   1 
ATOM 1064 C CB  . ALA A 1 136 ? 12.928 95.305  5.848  1.00 40.00 ? 139 ALA A CB  1 
ATOM 1065 N N   . GLN A 1 137 ? 13.908 94.960  3.036  1.00 40.00 ? 140 GLN A N   1 
ATOM 1066 C CA  . GLN A 1 137 ? 13.958 95.449  1.665  1.00 40.00 ? 140 GLN A CA  1 
ATOM 1067 C C   . GLN A 1 137 ? 13.428 94.396  0.700  1.00 40.00 ? 140 GLN A C   1 
ATOM 1068 O O   . GLN A 1 137 ? 12.411 94.564  0.049  1.00 40.00 ? 140 GLN A O   1 
ATOM 1069 C CB  . GLN A 1 137 ? 15.374 95.869  1.283  1.00 40.00 ? 140 GLN A CB  1 
ATOM 1070 C CG  . GLN A 1 137 ? 15.403 96.716  0.010  1.00 40.00 ? 140 GLN A CG  1 
ATOM 1071 C CD  . GLN A 1 137 ? 15.282 95.798  -1.204 1.00 40.00 ? 140 GLN A CD  1 
ATOM 1072 O OE1 . GLN A 1 137 ? 16.208 95.025  -1.459 1.00 40.00 ? 140 GLN A OE1 1 
ATOM 1073 N NE2 . GLN A 1 137 ? 14.156 95.920  -1.890 1.00 40.00 ? 140 GLN A NE2 1 
ATOM 1074 N N   . VAL A 1 138 ? 14.197 93.326  0.601  1.00 40.00 ? 141 VAL A N   1 
ATOM 1075 C CA  . VAL A 1 138 ? 13.938 92.211  -0.260 1.00 40.00 ? 141 VAL A CA  1 
ATOM 1076 C C   . VAL A 1 138 ? 12.704 91.415  0.099  1.00 40.00 ? 141 VAL A C   1 
ATOM 1077 O O   . VAL A 1 138 ? 11.797 91.294  -0.733 1.00 40.00 ? 141 VAL A O   1 
ATOM 1078 C CB  . VAL A 1 138 ? 15.112 91.192  -0.281 1.00 40.00 ? 141 VAL A CB  1 
ATOM 1079 C CG1 . VAL A 1 138 ? 14.694 89.929  -1.011 1.00 40.00 ? 141 VAL A CG1 1 
ATOM 1080 C CG2 . VAL A 1 138 ? 16.367 91.807  -0.860 1.00 40.00 ? 141 VAL A CG2 1 
ATOM 1081 N N   . GLU A 1 139 ? 12.616 90.807  1.272  1.00 40.00 ? 142 GLU A N   1 
ATOM 1082 C CA  . GLU A 1 139 ? 11.415 89.992  1.528  1.00 40.00 ? 142 GLU A CA  1 
ATOM 1083 C C   . GLU A 1 139 ? 10.242 90.776  2.072  1.00 40.00 ? 142 GLU A C   1 
ATOM 1084 O O   . GLU A 1 139 ? 9.215  90.200  2.467  1.00 40.00 ? 142 GLU A O   1 
ATOM 1085 C CB  . GLU A 1 139 ? 11.788 88.778  2.361  1.00 40.00 ? 142 GLU A CB  1 
ATOM 1086 C CG  . GLU A 1 139 ? 12.865 87.902  1.726  1.00 40.00 ? 142 GLU A CG  1 
ATOM 1087 C CD  . GLU A 1 139 ? 12.307 87.136  0.532  1.00 40.00 ? 142 GLU A CD  1 
ATOM 1088 O OE1 . GLU A 1 139 ? 11.106 86.771  0.568  1.00 40.00 ? 142 GLU A OE1 1 
ATOM 1089 O OE2 . GLU A 1 139 ? 13.105 86.921  -0.400 1.00 40.00 ? 142 GLU A OE2 1 
ATOM 1090 N N   . GLY A 1 140 ? 10.355 92.101  2.090  1.00 40.00 ? 143 GLY A N   1 
ATOM 1091 C CA  . GLY A 1 140 ? 9.319  93.012  2.528  1.00 40.00 ? 143 GLY A CA  1 
ATOM 1092 C C   . GLY A 1 140 ? 8.811  92.720  3.925  1.00 40.00 ? 143 GLY A C   1 
ATOM 1093 O O   . GLY A 1 140 ? 7.607  92.752  4.190  1.00 40.00 ? 143 GLY A O   1 
ATOM 1094 N N   . ALA A 1 141 ? 9.763  92.429  4.832  1.00 40.00 ? 144 ALA A N   1 
ATOM 1095 C CA  . ALA A 1 141 ? 9.377  92.064  6.186  1.00 40.00 ? 144 ALA A CA  1 
ATOM 1096 C C   . ALA A 1 141 ? 9.614  93.191  7.174  1.00 40.00 ? 144 ALA A C   1 
ATOM 1097 O O   . ALA A 1 141 ? 10.596 93.905  6.979  1.00 40.00 ? 144 ALA A O   1 
ATOM 1098 C CB  . ALA A 1 141 ? 10.226 90.878  6.658  1.00 40.00 ? 144 ALA A CB  1 
ATOM 1099 N N   . VAL A 1 142 ? 8.749  93.265  8.185  1.00 40.00 ? 145 VAL A N   1 
ATOM 1100 C CA  . VAL A 1 142 ? 9.013  94.243  9.240  1.00 40.00 ? 145 VAL A CA  1 
ATOM 1101 C C   . VAL A 1 142 ? 9.892  93.512  10.294 1.00 40.00 ? 145 VAL A C   1 
ATOM 1102 O O   . VAL A 1 142 ? 9.400  92.620  10.992 1.00 40.00 ? 145 VAL A O   1 
ATOM 1103 C CB  . VAL A 1 142 ? 7.782  94.744  9.981  1.00 40.00 ? 145 VAL A CB  1 
ATOM 1104 C CG1 . VAL A 1 142 ? 8.173  95.693  11.115 1.00 40.00 ? 145 VAL A CG1 1 
ATOM 1105 C CG2 . VAL A 1 142 ? 6.796  95.432  9.048  1.00 40.00 ? 145 VAL A CG2 1 
ATOM 1106 N N   . LEU A 1 143 ? 11.140 93.914  10.370 1.00 40.00 ? 146 LEU A N   1 
ATOM 1107 C CA  . LEU A 1 143 ? 12.123 93.343  11.270 1.00 40.00 ? 146 LEU A CA  1 
ATOM 1108 C C   . LEU A 1 143 ? 12.433 94.188  12.491 1.00 40.00 ? 146 LEU A C   1 
ATOM 1109 O O   . LEU A 1 143 ? 12.618 95.417  12.461 1.00 40.00 ? 146 LEU A O   1 
ATOM 1110 C CB  . LEU A 1 143 ? 13.402 93.158  10.402 1.00 40.00 ? 146 LEU A CB  1 
ATOM 1111 C CG  . LEU A 1 143 ? 14.446 92.246  11.040 1.00 40.00 ? 146 LEU A CG  1 
ATOM 1112 C CD1 . LEU A 1 143 ? 15.324 91.602  9.987  1.00 40.00 ? 146 LEU A CD1 1 
ATOM 1113 C CD2 . LEU A 1 143 ? 15.259 93.034  12.066 1.00 40.00 ? 146 LEU A CD2 1 
ATOM 1114 N N   . VAL A 1 144 ? 12.540 93.562  13.668 1.00 40.00 ? 147 VAL A N   1 
ATOM 1115 C CA  . VAL A 1 144 ? 12.836 94.288  14.901 1.00 40.00 ? 147 VAL A CA  1 
ATOM 1116 C C   . VAL A 1 144 ? 13.977 93.626  15.663 1.00 40.00 ? 147 VAL A C   1 
ATOM 1117 O O   . VAL A 1 144 ? 13.927 92.395  15.834 1.00 40.00 ? 147 VAL A O   1 
ATOM 1118 C CB  . VAL A 1 144 ? 11.607 94.269  15.847 1.00 40.00 ? 147 VAL A CB  1 
ATOM 1119 C CG1 . VAL A 1 144 ? 11.924 95.025  17.126 1.00 40.00 ? 147 VAL A CG1 1 
ATOM 1120 C CG2 . VAL A 1 144 ? 10.343 94.823  15.199 1.00 40.00 ? 147 VAL A CG2 1 
ATOM 1121 N N   . SER A 1 145 ? 14.943 94.392  16.157 1.00 40.00 ? 148 SER A N   1 
ATOM 1122 C CA  . SER A 1 145 ? 16.035 93.783  16.944 1.00 40.00 ? 148 SER A CA  1 
ATOM 1123 C C   . SER A 1 145 ? 16.256 94.637  18.186 1.00 40.00 ? 148 SER A C   1 
ATOM 1124 O O   . SER A 1 145 ? 16.592 95.825  18.025 1.00 40.00 ? 148 SER A O   1 
ATOM 1125 C CB  . SER A 1 145 ? 17.275 93.576  16.103 1.00 40.00 ? 148 SER A CB  1 
ATOM 1126 O OG  . SER A 1 145 ? 18.058 94.718  15.869 1.00 40.00 ? 148 SER A OG  1 
ATOM 1127 N N   . MET A 1 146 ? 16.047 94.093  19.392 1.00 40.00 ? 149 MET A N   1 
ATOM 1128 C CA  . MET A 1 146 ? 16.262 94.851  20.620 1.00 40.00 ? 149 MET A CA  1 
ATOM 1129 C C   . MET A 1 146 ? 17.585 94.528  21.336 1.00 40.00 ? 149 MET A C   1 
ATOM 1130 O O   . MET A 1 146 ? 18.272 93.559  21.023 1.00 40.00 ? 149 MET A O   1 
ATOM 1131 C CB  . MET A 1 146 ? 15.169 94.608  21.667 1.00 40.00 ? 149 MET A CB  1 
ATOM 1132 C CG  . MET A 1 146 ? 15.449 93.404  22.570 1.00 40.00 ? 149 MET A CG  1 
ATOM 1133 S SD  . MET A 1 146 ? 15.313 91.874  21.575 1.00 40.00 ? 149 MET A SD  1 
ATOM 1134 C CE  . MET A 1 146 ? 13.868 91.175  22.396 1.00 40.00 ? 149 MET A CE  1 
ATOM 1135 N N   . ASN A 1 147 ? 17.917 95.335  22.340 1.00 40.00 ? 150 ASN A N   1 
ATOM 1136 C CA  . ASN A 1 147 ? 19.075 95.140  23.188 1.00 40.00 ? 150 ASN A CA  1 
ATOM 1137 C C   . ASN A 1 147 ? 18.501 94.655  24.537 1.00 40.00 ? 150 ASN A C   1 
ATOM 1138 O O   . ASN A 1 147 ? 17.419 95.138  24.919 1.00 40.00 ? 150 ASN A O   1 
ATOM 1139 C CB  . ASN A 1 147 ? 19.864 96.428  23.458 1.00 40.00 ? 150 ASN A CB  1 
ATOM 1140 C CG  . ASN A 1 147 ? 20.793 96.708  22.289 1.00 40.00 ? 150 ASN A CG  1 
ATOM 1141 O OD1 . ASN A 1 147 ? 20.760 95.919  21.331 1.00 40.00 ? 150 ASN A OD1 1 
ATOM 1142 N ND2 . ASN A 1 147 ? 21.592 97.772  22.361 1.00 40.00 ? 150 ASN A ND2 1 
ATOM 1143 N N   . TYR A 1 148 ? 19.157 93.700  25.167 1.00 40.00 ? 151 TYR A N   1 
ATOM 1144 C CA  . TYR A 1 148 ? 18.733 93.200  26.474 1.00 40.00 ? 151 TYR A CA  1 
ATOM 1145 C C   . TYR A 1 148 ? 20.045 93.144  27.297 1.00 40.00 ? 151 TYR A C   1 
ATOM 1146 O O   . TYR A 1 148 ? 21.134 92.922  26.750 1.00 40.00 ? 151 TYR A O   1 
ATOM 1147 C CB  . TYR A 1 148 ? 18.027 91.847  26.488 1.00 40.00 ? 151 TYR A CB  1 
ATOM 1148 C CG  . TYR A 1 148 ? 18.858 90.743  25.872 1.00 40.00 ? 151 TYR A CG  1 
ATOM 1149 C CD1 . TYR A 1 148 ? 19.152 90.774  24.515 1.00 40.00 ? 151 TYR A CD1 1 
ATOM 1150 C CD2 . TYR A 1 148 ? 19.380 89.699  26.623 1.00 40.00 ? 151 TYR A CD2 1 
ATOM 1151 C CE1 . TYR A 1 148 ? 19.901 89.777  23.933 1.00 40.00 ? 151 TYR A CE1 1 
ATOM 1152 C CE2 . TYR A 1 148 ? 20.162 88.699  26.032 1.00 40.00 ? 151 TYR A CE2 1 
ATOM 1153 C CZ  . TYR A 1 148 ? 20.423 88.758  24.688 1.00 40.00 ? 151 TYR A CZ  1 
ATOM 1154 O OH  . TYR A 1 148 ? 21.180 87.827  24.045 1.00 40.00 ? 151 TYR A OH  1 
ATOM 1155 N N   . ARG A 1 149 ? 19.937 93.433  28.585 1.00 40.00 ? 152 ARG A N   1 
ATOM 1156 C CA  . ARG A 1 149 ? 21.041 93.400  29.500 1.00 40.00 ? 152 ARG A CA  1 
ATOM 1157 C C   . ARG A 1 149 ? 21.656 92.002  29.596 1.00 40.00 ? 152 ARG A C   1 
ATOM 1158 O O   . ARG A 1 149 ? 20.968 91.077  30.028 1.00 40.00 ? 152 ARG A O   1 
ATOM 1159 C CB  . ARG A 1 149 ? 20.512 93.741  30.926 1.00 40.00 ? 152 ARG A CB  1 
ATOM 1160 C CG  . ARG A 1 149 ? 20.118 95.182  31.121 1.00 40.00 ? 152 ARG A CG  1 
ATOM 1161 C CD  . ARG A 1 149 ? 19.566 95.544  32.502 1.00 40.00 ? 152 ARG A CD  1 
ATOM 1162 N NE  . ARG A 1 149 ? 18.153 95.197  32.597 1.00 40.00 ? 152 ARG A NE  1 
ATOM 1163 C CZ  . ARG A 1 149 ? 17.393 95.287  33.662 1.00 40.00 ? 152 ARG A CZ  1 
ATOM 1164 N NH1 . ARG A 1 149 ? 17.934 95.761  34.774 1.00 40.00 ? 152 ARG A NH1 1 
ATOM 1165 N NH2 . ARG A 1 149 ? 16.089 94.935  33.675 1.00 40.00 ? 152 ARG A NH2 1 
ATOM 1166 N N   . VAL A 1 150 ? 22.907 91.845  29.277 1.00 40.00 ? 153 VAL A N   1 
ATOM 1167 C CA  . VAL A 1 150 ? 23.697 90.649  29.450 1.00 40.00 ? 153 VAL A CA  1 
ATOM 1168 C C   . VAL A 1 150 ? 24.492 90.735  30.767 1.00 40.00 ? 153 VAL A C   1 
ATOM 1169 O O   . VAL A 1 150 ? 24.410 91.720  31.516 1.00 40.00 ? 153 VAL A O   1 
ATOM 1170 C CB  . VAL A 1 150 ? 24.786 90.583  28.352 1.00 40.00 ? 153 VAL A CB  1 
ATOM 1171 C CG1 . VAL A 1 150 ? 24.172 90.309  26.995 1.00 40.00 ? 153 VAL A CG1 1 
ATOM 1172 C CG2 . VAL A 1 150 ? 25.568 91.891  28.303 1.00 40.00 ? 153 VAL A CG2 1 
ATOM 1173 N N   . GLY A 1 151 ? 25.356 89.749  31.014 1.00 40.00 ? 154 GLY A N   1 
ATOM 1174 C CA  . GLY A 1 151 ? 26.205 89.673  32.197 1.00 40.00 ? 154 GLY A CA  1 
ATOM 1175 C C   . GLY A 1 151 ? 25.483 89.791  33.521 1.00 40.00 ? 154 GLY A C   1 
ATOM 1176 O O   . GLY A 1 151 ? 24.319 89.490  33.766 1.00 40.00 ? 154 GLY A O   1 
ATOM 1177 N N   . THR A 1 152 ? 26.154 90.280  34.545 1.00 40.00 ? 155 THR A N   1 
ATOM 1178 C CA  . THR A 1 152 ? 25.660 90.490  35.890 1.00 40.00 ? 155 THR A CA  1 
ATOM 1179 C C   . THR A 1 152 ? 24.424 91.374  35.858 1.00 40.00 ? 155 THR A C   1 
ATOM 1180 O O   . THR A 1 152 ? 23.456 91.192  36.580 1.00 40.00 ? 155 THR A O   1 
ATOM 1181 C CB  . THR A 1 152 ? 26.725 91.313  36.710 1.00 40.00 ? 155 THR A CB  1 
ATOM 1182 O OG1 . THR A 1 152 ? 27.621 91.913  35.762 1.00 40.00 ? 155 THR A OG1 1 
ATOM 1183 C CG2 . THR A 1 152 ? 27.480 90.322  37.587 1.00 40.00 ? 155 THR A CG2 1 
ATOM 1184 N N   . PHE A 1 153 ? 24.513 92.400  35.005 1.00 40.00 ? 156 PHE A N   1 
ATOM 1185 C CA  . PHE A 1 153 ? 23.406 93.362  34.885 1.00 40.00 ? 156 PHE A CA  1 
ATOM 1186 C C   . PHE A 1 153 ? 22.143 92.643  34.405 1.00 40.00 ? 156 PHE A C   1 
ATOM 1187 O O   . PHE A 1 153 ? 21.047 92.935  34.891 1.00 40.00 ? 156 PHE A O   1 
ATOM 1188 C CB  . PHE A 1 153 ? 23.793 94.491  33.938 1.00 40.00 ? 156 PHE A CB  1 
ATOM 1189 C CG  . PHE A 1 153 ? 25.205 94.968  34.092 1.00 40.00 ? 156 PHE A CG  1 
ATOM 1190 C CD1 . PHE A 1 153 ? 25.521 95.877  35.096 1.00 40.00 ? 156 PHE A CD1 1 
ATOM 1191 C CD2 . PHE A 1 153 ? 26.220 94.526  33.268 1.00 40.00 ? 156 PHE A CD2 1 
ATOM 1192 C CE1 . PHE A 1 153 ? 26.813 96.310  35.271 1.00 40.00 ? 156 PHE A CE1 1 
ATOM 1193 C CE2 . PHE A 1 153 ? 27.517 94.973  33.426 1.00 40.00 ? 156 PHE A CE2 1 
ATOM 1194 C CZ  . PHE A 1 153 ? 27.823 95.859  34.430 1.00 40.00 ? 156 PHE A CZ  1 
ATOM 1195 N N   . GLY A 1 154 ? 22.283 91.703  33.459 1.00 40.00 ? 157 GLY A N   1 
ATOM 1196 C CA  . GLY A 1 154 ? 21.143 90.992  32.992 1.00 40.00 ? 157 GLY A CA  1 
ATOM 1197 C C   . GLY A 1 154 ? 20.692 89.845  33.861 1.00 40.00 ? 157 GLY A C   1 
ATOM 1198 O O   . GLY A 1 154 ? 19.504 89.484  33.943 1.00 40.00 ? 157 GLY A O   1 
ATOM 1199 N N   . PHE A 1 155 ? 21.696 89.114  34.411 1.00 40.00 ? 158 PHE A N   1 
ATOM 1200 C CA  . PHE A 1 155 ? 21.387 87.886  35.147 1.00 40.00 ? 158 PHE A CA  1 
ATOM 1201 C C   . PHE A 1 155 ? 21.910 87.721  36.538 1.00 40.00 ? 158 PHE A C   1 
ATOM 1202 O O   . PHE A 1 155 ? 21.487 86.755  37.216 1.00 40.00 ? 158 PHE A O   1 
ATOM 1203 C CB  . PHE A 1 155 ? 21.805 86.729  34.233 1.00 40.00 ? 158 PHE A CB  1 
ATOM 1204 C CG  . PHE A 1 155 ? 21.082 86.772  32.899 1.00 40.00 ? 158 PHE A CG  1 
ATOM 1205 C CD1 . PHE A 1 155 ? 19.822 86.228  32.756 1.00 40.00 ? 158 PHE A CD1 1 
ATOM 1206 C CD2 . PHE A 1 155 ? 21.659 87.396  31.795 1.00 40.00 ? 158 PHE A CD2 1 
ATOM 1207 C CE1 . PHE A 1 155 ? 19.181 86.281  31.526 1.00 40.00 ? 158 PHE A CE1 1 
ATOM 1208 C CE2 . PHE A 1 155 ? 21.011 87.472  30.573 1.00 40.00 ? 158 PHE A CE2 1 
ATOM 1209 C CZ  . PHE A 1 155 ? 19.781 86.913  30.443 1.00 40.00 ? 158 PHE A CZ  1 
ATOM 1210 N N   . LEU A 1 156 ? 22.725 88.611  37.076 1.00 40.00 ? 159 LEU A N   1 
ATOM 1211 C CA  . LEU A 1 156 ? 23.173 88.387  38.460 1.00 40.00 ? 159 LEU A CA  1 
ATOM 1212 C C   . LEU A 1 156 ? 21.942 88.100  39.298 1.00 40.00 ? 159 LEU A C   1 
ATOM 1213 O O   . LEU A 1 156 ? 21.054 88.939  39.273 1.00 40.00 ? 159 LEU A O   1 
ATOM 1214 C CB  . LEU A 1 156 ? 23.915 89.600  39.052 1.00 40.00 ? 159 LEU A CB  1 
ATOM 1215 C CG  . LEU A 1 156 ? 24.487 89.396  40.465 1.00 40.00 ? 159 LEU A CG  1 
ATOM 1216 C CD1 . LEU A 1 156 ? 25.714 90.234  40.699 1.00 40.00 ? 159 LEU A CD1 1 
ATOM 1217 C CD2 . LEU A 1 156 ? 23.438 89.692  41.527 1.00 40.00 ? 159 LEU A CD2 1 
ATOM 1218 N N   . ALA A 1 157 ? 21.867 87.013  40.042 1.00 40.00 ? 160 ALA A N   1 
ATOM 1219 C CA  . ALA A 1 157 ? 20.600 86.911  40.817 1.00 40.00 ? 160 ALA A CA  1 
ATOM 1220 C C   . ALA A 1 157 ? 20.806 86.404  42.215 1.00 40.00 ? 160 ALA A C   1 
ATOM 1221 O O   . ALA A 1 157 ? 21.655 85.525  42.480 1.00 40.00 ? 160 ALA A O   1 
ATOM 1222 C CB  . ALA A 1 157 ? 19.722 85.906  40.036 1.00 40.00 ? 160 ALA A CB  1 
ATOM 1223 N N   . LEU A 1 158 ? 20.009 86.827  43.159 1.00 40.00 ? 161 LEU A N   1 
ATOM 1224 C CA  . LEU A 1 158 ? 20.028 86.268  44.506 1.00 40.00 ? 161 LEU A CA  1 
ATOM 1225 C C   . LEU A 1 158 ? 18.571 85.781  44.606 1.00 40.00 ? 161 LEU A C   1 
ATOM 1226 O O   . LEU A 1 158 ? 17.690 86.524  44.999 1.00 40.00 ? 161 LEU A O   1 
ATOM 1227 C CB  . LEU A 1 158 ? 20.259 87.261  45.589 1.00 40.00 ? 161 LEU A CB  1 
ATOM 1228 C CG  . LEU A 1 158 ? 21.682 87.467  46.098 1.00 40.00 ? 161 LEU A CG  1 
ATOM 1229 C CD1 . LEU A 1 158 ? 22.417 88.404  45.156 1.00 40.00 ? 161 LEU A CD1 1 
ATOM 1230 C CD2 . LEU A 1 158 ? 21.629 88.084  47.486 1.00 40.00 ? 161 LEU A CD2 1 
ATOM 1231 N N   . PRO A 1 159 ? 18.329 84.606  44.096 1.00 40.00 ? 162 PRO A N   1 
ATOM 1232 C CA  . PRO A 1 159 ? 16.991 84.037  44.059 1.00 40.00 ? 162 PRO A CA  1 
ATOM 1233 C C   . PRO A 1 159 ? 16.223 84.322  45.334 1.00 40.00 ? 162 PRO A C   1 
ATOM 1234 O O   . PRO A 1 159 ? 16.714 84.172  46.436 1.00 40.00 ? 162 PRO A O   1 
ATOM 1235 C CB  . PRO A 1 159 ? 17.195 82.563  43.862 1.00 40.00 ? 162 PRO A CB  1 
ATOM 1236 C CG  . PRO A 1 159 ? 18.658 82.333  43.821 1.00 40.00 ? 162 PRO A CG  1 
ATOM 1237 C CD  . PRO A 1 159 ? 19.308 83.653  43.502 1.00 40.00 ? 162 PRO A CD  1 
ATOM 1238 N N   . GLY A 1 160 ? 14.967 84.745  45.140 1.00 40.00 ? 163 GLY A N   1 
ATOM 1239 C CA  . GLY A 1 160 ? 14.050 85.056  46.215 1.00 40.00 ? 163 GLY A CA  1 
ATOM 1240 C C   . GLY A 1 160 ? 14.060 86.530  46.622 1.00 40.00 ? 163 GLY A C   1 
ATOM 1241 O O   . GLY A 1 160 ? 13.172 87.036  47.310 1.00 40.00 ? 163 GLY A O   1 
ATOM 1242 N N   . SER A 1 161 ? 15.114 87.246  46.257 1.00 40.00 ? 164 SER A N   1 
ATOM 1243 C CA  . SER A 1 161 ? 15.302 88.623  46.541 1.00 40.00 ? 164 SER A CA  1 
ATOM 1244 C C   . SER A 1 161 ? 14.335 89.457  45.679 1.00 40.00 ? 164 SER A C   1 
ATOM 1245 O O   . SER A 1 161 ? 14.029 89.057  44.560 1.00 40.00 ? 164 SER A O   1 
ATOM 1246 C CB  . SER A 1 161 ? 16.722 89.084  46.134 1.00 40.00 ? 164 SER A CB  1 
ATOM 1247 O OG  . SER A 1 161 ? 16.727 89.558  44.795 1.00 40.00 ? 164 SER A OG  1 
ATOM 1248 N N   . ARG A 1 162 ? 14.013 90.611  46.249 1.00 40.00 ? 165 ARG A N   1 
ATOM 1249 C CA  . ARG A 1 162 ? 13.204 91.601  45.603 1.00 40.00 ? 165 ARG A CA  1 
ATOM 1250 C C   . ARG A 1 162 ? 14.038 92.426  44.619 1.00 40.00 ? 165 ARG A C   1 
ATOM 1251 O O   . ARG A 1 162 ? 13.529 92.846  43.586 1.00 40.00 ? 165 ARG A O   1 
ATOM 1252 C CB  . ARG A 1 162 ? 12.711 92.595  46.686 1.00 40.00 ? 165 ARG A CB  1 
ATOM 1253 C CG  . ARG A 1 162 ? 11.294 93.055  46.431 1.00 40.00 ? 165 ARG A CG  1 
ATOM 1254 C CD  . ARG A 1 162 ? 10.959 94.402  47.053 1.00 40.00 ? 165 ARG A CD  1 
ATOM 1255 N NE  . ARG A 1 162 ? 11.545 95.494  46.270 1.00 40.00 ? 165 ARG A NE  1 
ATOM 1256 C CZ  . ARG A 1 162 ? 12.474 96.319  46.741 1.00 40.00 ? 165 ARG A CZ  1 
ATOM 1257 N NH1 . ARG A 1 162 ? 12.935 96.211  47.986 1.00 40.00 ? 165 ARG A NH1 1 
ATOM 1258 N NH2 . ARG A 1 162 ? 12.963 97.278  45.959 1.00 40.00 ? 165 ARG A NH2 1 
ATOM 1259 N N   . GLU A 1 163 ? 15.300 92.668  44.962 1.00 40.00 ? 166 GLU A N   1 
ATOM 1260 C CA  . GLU A 1 163 ? 16.127 93.553  44.167 1.00 40.00 ? 166 GLU A CA  1 
ATOM 1261 C C   . GLU A 1 163 ? 17.116 93.000  43.181 1.00 40.00 ? 166 GLU A C   1 
ATOM 1262 O O   . GLU A 1 163 ? 17.848 93.767  42.513 1.00 40.00 ? 166 GLU A O   1 
ATOM 1263 C CB  . GLU A 1 163 ? 16.923 94.445  45.161 1.00 40.00 ? 166 GLU A CB  1 
ATOM 1264 C CG  . GLU A 1 163 ? 17.168 93.687  46.458 1.00 40.00 ? 166 GLU A CG  1 
ATOM 1265 C CD  . GLU A 1 163 ? 16.199 94.057  47.561 1.00 40.00 ? 166 GLU A CD  1 
ATOM 1266 O OE1 . GLU A 1 163 ? 15.720 95.219  47.580 1.00 40.00 ? 166 GLU A OE1 1 
ATOM 1267 O OE2 . GLU A 1 163 ? 15.900 93.208  48.436 1.00 40.00 ? 166 GLU A OE2 1 
ATOM 1268 N N   . ALA A 1 164 ? 17.199 91.685  43.070 1.00 40.00 ? 167 ALA A N   1 
ATOM 1269 C CA  . ALA A 1 164 ? 18.115 91.063  42.079 1.00 40.00 ? 167 ALA A CA  1 
ATOM 1270 C C   . ALA A 1 164 ? 17.555 89.650  41.961 1.00 40.00 ? 167 ALA A C   1 
ATOM 1271 O O   . ALA A 1 164 ? 18.038 88.669  42.530 1.00 40.00 ? 167 ALA A O   1 
ATOM 1272 C CB  . ALA A 1 164 ? 19.515 91.168  42.525 1.00 40.00 ? 167 ALA A CB  1 
ATOM 1273 N N   . PRO A 1 165 ? 16.372 89.583  41.353 1.00 40.00 ? 168 PRO A N   1 
ATOM 1274 C CA  . PRO A 1 165 ? 15.620 88.335  41.318 1.00 40.00 ? 168 PRO A CA  1 
ATOM 1275 C C   . PRO A 1 165 ? 15.937 87.434  40.170 1.00 40.00 ? 168 PRO A C   1 
ATOM 1276 O O   . PRO A 1 165 ? 15.478 86.267  40.109 1.00 40.00 ? 168 PRO A O   1 
ATOM 1277 C CB  . PRO A 1 165 ? 14.184 88.899  41.382 1.00 40.00 ? 168 PRO A CB  1 
ATOM 1278 C CG  . PRO A 1 165 ? 14.277 90.049  40.436 1.00 40.00 ? 168 PRO A CG  1 
ATOM 1279 C CD  . PRO A 1 165 ? 15.622 90.682  40.689 1.00 40.00 ? 168 PRO A CD  1 
ATOM 1280 N N   . GLY A 1 166 ? 16.735 87.940  39.227 1.00 40.00 ? 169 GLY A N   1 
ATOM 1281 C CA  . GLY A 1 166 ? 17.158 87.194  38.084 1.00 40.00 ? 169 GLY A CA  1 
ATOM 1282 C C   . GLY A 1 166 ? 16.327 87.219  36.839 1.00 40.00 ? 169 GLY A C   1 
ATOM 1283 O O   . GLY A 1 166 ? 15.140 87.554  36.799 1.00 40.00 ? 169 GLY A O   1 
ATOM 1284 N N   . ASN A 1 167 ? 17.004 86.842  35.734 1.00 40.00 ? 170 ASN A N   1 
ATOM 1285 C CA  . ASN A 1 167 ? 16.354 86.748  34.432 1.00 40.00 ? 170 ASN A CA  1 
ATOM 1286 C C   . ASN A 1 167 ? 15.889 88.086  33.920 1.00 40.00 ? 170 ASN A C   1 
ATOM 1287 O O   . ASN A 1 167 ? 15.155 88.209  32.916 1.00 40.00 ? 170 ASN A O   1 
ATOM 1288 C CB  . ASN A 1 167 ? 15.192 85.761  34.597 1.00 40.00 ? 170 ASN A CB  1 
ATOM 1289 C CG  . ASN A 1 167 ? 15.582 84.353  34.954 1.00 40.00 ? 170 ASN A CG  1 
ATOM 1290 O OD1 . ASN A 1 167 ? 16.574 83.805  34.446 1.00 40.00 ? 170 ASN A OD1 1 
ATOM 1291 N ND2 . ASN A 1 167 ? 14.828 83.694  35.838 1.00 40.00 ? 170 ASN A ND2 1 
ATOM 1292 N N   . VAL A 1 168 ? 16.365 89.182  34.544 1.00 40.00 ? 171 VAL A N   1 
ATOM 1293 C CA  . VAL A 1 168 ? 15.903 90.481  34.065 1.00 40.00 ? 171 VAL A CA  1 
ATOM 1294 C C   . VAL A 1 168 ? 16.325 90.734  32.634 1.00 40.00 ? 171 VAL A C   1 
ATOM 1295 O O   . VAL A 1 168 ? 15.640 91.472  31.908 1.00 40.00 ? 171 VAL A O   1 
ATOM 1296 C CB  . VAL A 1 168 ? 16.246 91.651  34.971 1.00 40.00 ? 171 VAL A CB  1 
ATOM 1297 C CG1 . VAL A 1 168 ? 15.715 91.409  36.388 1.00 40.00 ? 171 VAL A CG1 1 
ATOM 1298 C CG2 . VAL A 1 168 ? 17.745 91.948  34.966 1.00 40.00 ? 171 VAL A CG2 1 
ATOM 1299 N N   . GLY A 1 169 ? 17.387 90.119  32.128 1.00 40.00 ? 172 GLY A N   1 
ATOM 1300 C CA  . GLY A 1 169 ? 17.745 90.346  30.716 1.00 40.00 ? 172 GLY A CA  1 
ATOM 1301 C C   . GLY A 1 169 ? 16.635 89.713  29.850 1.00 40.00 ? 172 GLY A C   1 
ATOM 1302 O O   . GLY A 1 169 ? 16.405 90.100  28.681 1.00 40.00 ? 172 GLY A O   1 
ATOM 1303 N N   . LEU A 1 170 ? 15.958 88.688  30.399 1.00 40.00 ? 173 LEU A N   1 
ATOM 1304 C CA  . LEU A 1 170 ? 14.917 88.039  29.598 1.00 40.00 ? 173 LEU A CA  1 
ATOM 1305 C C   . LEU A 1 170 ? 13.678 88.922  29.623 1.00 40.00 ? 173 LEU A C   1 
ATOM 1306 O O   . LEU A 1 170 ? 13.041 89.110  28.592 1.00 40.00 ? 173 LEU A O   1 
ATOM 1307 C CB  . LEU A 1 170 ? 14.560 86.655  30.124 1.00 40.00 ? 173 LEU A CB  1 
ATOM 1308 C CG  . LEU A 1 170 ? 15.599 85.557  29.881 1.00 40.00 ? 173 LEU A CG  1 
ATOM 1309 C CD1 . LEU A 1 170 ? 15.050 84.231  30.362 1.00 40.00 ? 173 LEU A CD1 1 
ATOM 1310 C CD2 . LEU A 1 170 ? 15.977 85.462  28.413 1.00 40.00 ? 173 LEU A CD2 1 
ATOM 1311 N N   . LEU A 1 171 ? 13.425 89.454  30.826 1.00 40.00 ? 174 LEU A N   1 
ATOM 1312 C CA  . LEU A 1 171 ? 12.290 90.385  30.952 1.00 40.00 ? 174 LEU A CA  1 
ATOM 1313 C C   . LEU A 1 171 ? 12.512 91.569  30.031 1.00 40.00 ? 174 LEU A C   1 
ATOM 1314 O O   . LEU A 1 171 ? 11.554 92.144  29.510 1.00 40.00 ? 174 LEU A O   1 
ATOM 1315 C CB  . LEU A 1 171 ? 12.226 90.898  32.388 1.00 40.00 ? 174 LEU A CB  1 
ATOM 1316 C CG  . LEU A 1 171 ? 11.868 89.780  33.358 1.00 40.00 ? 174 LEU A CG  1 
ATOM 1317 C CD1 . LEU A 1 171 ? 11.270 90.375  34.612 1.00 40.00 ? 174 LEU A CD1 1 
ATOM 1318 C CD2 . LEU A 1 171 ? 10.850 88.828  32.762 1.00 40.00 ? 174 LEU A CD2 1 
ATOM 1319 N N   . ASP A 1 172 ? 13.790 91.949  29.860 1.00 40.00 ? 175 ASP A N   1 
ATOM 1320 C CA  . ASP A 1 172 ? 14.043 93.025  28.898 1.00 40.00 ? 175 ASP A CA  1 
ATOM 1321 C C   . ASP A 1 172 ? 13.443 92.574  27.552 1.00 40.00 ? 175 ASP A C   1 
ATOM 1322 O O   . ASP A 1 172 ? 12.577 93.262  27.003 1.00 40.00 ? 175 ASP A O   1 
ATOM 1323 C CB  . ASP A 1 172 ? 15.526 93.331  28.728 1.00 40.00 ? 175 ASP A CB  1 
ATOM 1324 C CG  . ASP A 1 172 ? 16.156 94.016  29.933 1.00 40.00 ? 175 ASP A CG  1 
ATOM 1325 O OD1 . ASP A 1 172 ? 15.435 94.298  30.927 1.00 40.00 ? 175 ASP A OD1 1 
ATOM 1326 O OD2 . ASP A 1 172 ? 17.390 94.258  29.851 1.00 40.00 ? 175 ASP A OD2 1 
ATOM 1327 N N   . GLN A 1 173 ? 13.864 91.420  27.051 1.00 40.00 ? 176 GLN A N   1 
ATOM 1328 C CA  . GLN A 1 173 ? 13.349 90.946  25.767 1.00 40.00 ? 176 GLN A CA  1 
ATOM 1329 C C   . GLN A 1 173 ? 11.825 90.831  25.812 1.00 40.00 ? 176 GLN A C   1 
ATOM 1330 O O   . GLN A 1 173 ? 11.105 91.238  24.872 1.00 40.00 ? 176 GLN A O   1 
ATOM 1331 C CB  . GLN A 1 173 ? 13.980 89.628  25.358 1.00 40.00 ? 176 GLN A CB  1 
ATOM 1332 C CG  . GLN A 1 173 ? 15.463 89.442  25.655 1.00 40.00 ? 176 GLN A CG  1 
ATOM 1333 C CD  . GLN A 1 173 ? 15.864 87.966  25.637 1.00 40.00 ? 176 GLN A CD  1 
ATOM 1334 O OE1 . GLN A 1 173 ? 15.153 87.129  26.208 1.00 40.00 ? 176 GLN A OE1 1 
ATOM 1335 N NE2 . GLN A 1 173 ? 16.983 87.625  25.000 1.00 40.00 ? 176 GLN A NE2 1 
ATOM 1336 N N   . ARG A 1 174 ? 11.266 90.314  26.924 1.00 40.00 ? 177 ARG A N   1 
ATOM 1337 C CA  . ARG A 1 174 ? 9.801  90.186  26.930 1.00 40.00 ? 177 ARG A CA  1 
ATOM 1338 C C   . ARG A 1 174 ? 9.174  91.567  26.761 1.00 40.00 ? 177 ARG A C   1 
ATOM 1339 O O   . ARG A 1 174 ? 8.211  91.788  26.018 1.00 40.00 ? 177 ARG A O   1 
ATOM 1340 C CB  . ARG A 1 174 ? 9.277  89.450  28.115 1.00 40.00 ? 177 ARG A CB  1 
ATOM 1341 C CG  . ARG A 1 174 ? 7.903  89.797  28.648 1.00 40.00 ? 177 ARG A CG  1 
ATOM 1342 C CD  . ARG A 1 174 ? 7.698  89.050  29.997 1.00 40.00 ? 177 ARG A CD  1 
ATOM 1343 N NE  . ARG A 1 174 ? 7.687  87.632  29.753 1.00 40.00 ? 177 ARG A NE  1 
ATOM 1344 C CZ  . ARG A 1 174 ? 7.568  86.634  30.629 1.00 40.00 ? 177 ARG A CZ  1 
ATOM 1345 N NH1 . ARG A 1 174 ? 7.426  86.860  31.936 1.00 40.00 ? 177 ARG A NH1 1 
ATOM 1346 N NH2 . ARG A 1 174 ? 7.560  85.357  30.165 1.00 40.00 ? 177 ARG A NH2 1 
ATOM 1347 N N   . LEU A 1 175 ? 9.760  92.559  27.435 1.00 40.00 ? 178 LEU A N   1 
ATOM 1348 C CA  . LEU A 1 175 ? 9.242  93.921  27.352 1.00 40.00 ? 178 LEU A CA  1 
ATOM 1349 C C   . LEU A 1 175 ? 9.320  94.402  25.912 1.00 40.00 ? 178 LEU A C   1 
ATOM 1350 O O   . LEU A 1 175 ? 8.331  94.938  25.390 1.00 40.00 ? 178 LEU A O   1 
ATOM 1351 C CB  . LEU A 1 175 ? 10.036 94.815  28.284 1.00 40.00 ? 178 LEU A CB  1 
ATOM 1352 C CG  . LEU A 1 175 ? 9.393  96.085  28.848 1.00 40.00 ? 178 LEU A CG  1 
ATOM 1353 C CD1 . LEU A 1 175 ? 10.307 97.270  28.554 1.00 40.00 ? 178 LEU A CD1 1 
ATOM 1354 C CD2 . LEU A 1 175 ? 7.980  96.308  28.368 1.00 40.00 ? 178 LEU A CD2 1 
ATOM 1355 N N   . ALA A 1 176 ? 10.451 94.115  25.245 1.00 40.00 ? 179 ALA A N   1 
ATOM 1356 C CA  . ALA A 1 176 ? 10.533 94.561  23.841 1.00 40.00 ? 179 ALA A CA  1 
ATOM 1357 C C   . ALA A 1 176 ? 9.410  93.900  23.055 1.00 40.00 ? 179 ALA A C   1 
ATOM 1358 O O   . ALA A 1 176 ? 8.805  94.459  22.150 1.00 40.00 ? 179 ALA A O   1 
ATOM 1359 C CB  . ALA A 1 176 ? 11.876 94.212  23.249 1.00 40.00 ? 179 ALA A CB  1 
ATOM 1360 N N   . LEU A 1 177 ? 9.136  92.648  23.434 1.00 40.00 ? 180 LEU A N   1 
ATOM 1361 C CA  . LEU A 1 177 ? 8.058  91.924  22.770 1.00 40.00 ? 180 LEU A CA  1 
ATOM 1362 C C   . LEU A 1 177 ? 6.733  92.623  23.019 1.00 40.00 ? 180 LEU A C   1 
ATOM 1363 O O   . LEU A 1 177 ? 6.011  92.942  22.054 1.00 40.00 ? 180 LEU A O   1 
ATOM 1364 C CB  . LEU A 1 177 ? 8.077  90.506  23.308 1.00 40.00 ? 180 LEU A CB  1 
ATOM 1365 C CG  . LEU A 1 177 ? 8.636  89.380  22.455 1.00 40.00 ? 180 LEU A CG  1 
ATOM 1366 C CD1 . LEU A 1 177 ? 9.764  89.745  21.505 1.00 40.00 ? 180 LEU A CD1 1 
ATOM 1367 C CD2 . LEU A 1 177 ? 9.068  88.273  23.419 1.00 40.00 ? 180 LEU A CD2 1 
ATOM 1368 N N   . GLN A 1 178 ? 6.388  92.963  24.280 1.00 40.00 ? 181 GLN A N   1 
ATOM 1369 C CA  . GLN A 1 178 ? 5.091  93.608  24.512 1.00 40.00 ? 181 GLN A CA  1 
ATOM 1370 C C   . GLN A 1 178 ? 5.017  94.940  23.774 1.00 40.00 ? 181 GLN A C   1 
ATOM 1371 O O   . GLN A 1 178 ? 3.922  95.398  23.451 1.00 40.00 ? 181 GLN A O   1 
ATOM 1372 C CB  . GLN A 1 178 ? 4.743  93.807  25.974 1.00 40.00 ? 181 GLN A CB  1 
ATOM 1373 C CG  . GLN A 1 178 ? 5.185  92.660  26.846 1.00 40.00 ? 181 GLN A CG  1 
ATOM 1374 C CD  . GLN A 1 178 ? 4.974  92.897  28.326 1.00 40.00 ? 181 GLN A CD  1 
ATOM 1375 O OE1 . GLN A 1 178 ? 5.938  93.057  29.101 1.00 40.00 ? 181 GLN A OE1 1 
ATOM 1376 N NE2 . GLN A 1 178 ? 3.700  92.903  28.744 1.00 40.00 ? 181 GLN A NE2 1 
ATOM 1377 N N   . TRP A 1 179 ? 6.199  95.512  23.546 1.00 40.00 ? 182 TRP A N   1 
ATOM 1378 C CA  . TRP A 1 179 ? 6.149  96.786  22.823 1.00 40.00 ? 182 TRP A CA  1 
ATOM 1379 C C   . TRP A 1 179 ? 5.820  96.475  21.369 1.00 40.00 ? 182 TRP A C   1 
ATOM 1380 O O   . TRP A 1 179 ? 4.815  96.995  20.842 1.00 40.00 ? 182 TRP A O   1 
ATOM 1381 C CB  . TRP A 1 179 ? 7.400  97.526  22.995 1.00 40.00 ? 182 TRP A CB  1 
ATOM 1382 C CG  . TRP A 1 179 ? 7.593  98.804  22.296 1.00 40.00 ? 182 TRP A CG  1 
ATOM 1383 C CD1 . TRP A 1 179 ? 7.529  100.019 22.908 1.00 40.00 ? 182 TRP A CD1 1 
ATOM 1384 C CD2 . TRP A 1 179 ? 7.909  99.048  20.924 1.00 40.00 ? 182 TRP A CD2 1 
ATOM 1385 N NE1 . TRP A 1 179 ? 7.791  101.022 21.996 1.00 40.00 ? 182 TRP A NE1 1 
ATOM 1386 C CE2 . TRP A 1 179 ? 8.025  100.446 20.771 1.00 40.00 ? 182 TRP A CE2 1 
ATOM 1387 C CE3 . TRP A 1 179 ? 8.113  98.239  19.808 1.00 40.00 ? 182 TRP A CE3 1 
ATOM 1388 C CZ2 . TRP A 1 179 ? 8.341  101.064 19.564 1.00 40.00 ? 182 TRP A CZ2 1 
ATOM 1389 C CZ3 . TRP A 1 179 ? 8.437  98.860  18.610 1.00 40.00 ? 182 TRP A CZ3 1 
ATOM 1390 C CH2 . TRP A 1 179 ? 8.550  100.258 18.482 1.00 40.00 ? 182 TRP A CH2 1 
ATOM 1391 N N   . VAL A 1 180 ? 6.564  95.558  20.761 1.00 40.00 ? 183 VAL A N   1 
ATOM 1392 C CA  . VAL A 1 180 ? 6.240  95.202  19.364 1.00 40.00 ? 183 VAL A CA  1 
ATOM 1393 C C   . VAL A 1 180 ? 4.739  94.954  19.241 1.00 40.00 ? 183 VAL A C   1 
ATOM 1394 O O   . VAL A 1 180 ? 4.080  95.489  18.344 1.00 40.00 ? 183 VAL A O   1 
ATOM 1395 C CB  . VAL A 1 180 ? 7.109  94.049  18.894 1.00 40.00 ? 183 VAL A CB  1 
ATOM 1396 C CG1 . VAL A 1 180 ? 6.420  92.708  19.097 1.00 40.00 ? 183 VAL A CG1 1 
ATOM 1397 C CG2 . VAL A 1 180 ? 7.527  94.221  17.434 1.00 40.00 ? 183 VAL A CG2 1 
ATOM 1398 N N   . GLN A 1 181 ? 4.169  94.212  20.183 1.00 40.00 ? 184 GLN A N   1 
ATOM 1399 C CA  . GLN A 1 181 ? 2.759  93.959  20.232 1.00 40.00 ? 184 GLN A CA  1 
ATOM 1400 C C   . GLN A 1 181 ? 1.952  95.238  20.067 1.00 40.00 ? 184 GLN A C   1 
ATOM 1401 O O   . GLN A 1 181 ? 1.210  95.433  19.110 1.00 40.00 ? 184 GLN A O   1 
ATOM 1402 C CB  . GLN A 1 181 ? 2.342  93.373  21.588 1.00 40.00 ? 184 GLN A CB  1 
ATOM 1403 C CG  . GLN A 1 181 ? 1.222  92.367  21.555 1.00 40.00 ? 184 GLN A CG  1 
ATOM 1404 C CD  . GLN A 1 181 ? 1.388  91.276  20.519 1.00 40.00 ? 184 GLN A CD  1 
ATOM 1405 O OE1 . GLN A 1 181 ? 2.406  91.144  19.824 1.00 40.00 ? 184 GLN A OE1 1 
ATOM 1406 N NE2 . GLN A 1 181 ? 0.356  90.439  20.376 1.00 40.00 ? 184 GLN A NE2 1 
ATOM 1407 N N   . GLU A 1 182 ? 2.120  96.135  21.051 1.00 40.00 ? 185 GLU A N   1 
ATOM 1408 C CA  . GLU A 1 182 ? 1.302  97.345  21.003 1.00 40.00 ? 185 GLU A CA  1 
ATOM 1409 C C   . GLU A 1 182 ? 1.812  98.466  20.170 1.00 40.00 ? 185 GLU A C   1 
ATOM 1410 O O   . GLU A 1 182 ? 1.390  99.611  20.452 1.00 40.00 ? 185 GLU A O   1 
ATOM 1411 C CB  . GLU A 1 182 ? 0.987  97.777  22.447 1.00 40.00 ? 185 GLU A CB  1 
ATOM 1412 C CG  . GLU A 1 182 ? 2.243  97.892  23.296 1.00 40.00 ? 185 GLU A CG  1 
ATOM 1413 C CD  . GLU A 1 182 ? 1.909  98.423  24.683 1.00 40.00 ? 185 GLU A CD  1 
ATOM 1414 O OE1 . GLU A 1 182 ? 1.018  97.844  25.347 1.00 40.00 ? 185 GLU A OE1 1 
ATOM 1415 O OE2 . GLU A 1 182 ? 2.564  99.431  25.076 1.00 40.00 ? 185 GLU A OE2 1 
ATOM 1416 N N   . ASN A 1 183 ? 2.695  98.309  19.199 1.00 40.00 ? 186 ASN A N   1 
ATOM 1417 C CA  . ASN A 1 183 ? 3.162  99.457  18.436 1.00 40.00 ? 186 ASN A CA  1 
ATOM 1418 C C   . ASN A 1 183 ? 3.716  99.054  17.090 1.00 40.00 ? 186 ASN A C   1 
ATOM 1419 O O   . ASN A 1 183 ? 4.072  99.912  16.278 1.00 40.00 ? 186 ASN A O   1 
ATOM 1420 C CB  . ASN A 1 183 ? 4.400  100.067 19.156 1.00 40.00 ? 186 ASN A CB  1 
ATOM 1421 C CG  . ASN A 1 183 ? 3.995  100.917 20.336 1.00 40.00 ? 186 ASN A CG  1 
ATOM 1422 O OD1 . ASN A 1 183 ? 3.608  102.075 20.102 1.00 40.00 ? 186 ASN A OD1 1 
ATOM 1423 N ND2 . ASN A 1 183 ? 4.029  100.342 21.545 1.00 40.00 ? 186 ASN A ND2 1 
ATOM 1424 N N   . ILE A 1 184 ? 3.899  97.742  16.853 1.00 40.00 ? 187 ILE A N   1 
ATOM 1425 C CA  . ILE A 1 184 ? 4.566  97.440  15.562 1.00 40.00 ? 187 ILE A CA  1 
ATOM 1426 C C   . ILE A 1 184 ? 3.625  97.765  14.422 1.00 40.00 ? 187 ILE A C   1 
ATOM 1427 O O   . ILE A 1 184 ? 3.995  98.057  13.278 1.00 40.00 ? 187 ILE A O   1 
ATOM 1428 C CB  . ILE A 1 184 ? 5.071  96.009  15.576 1.00 40.00 ? 187 ILE A CB  1 
ATOM 1429 C CG1 . ILE A 1 184 ? 6.047  95.717  14.439 1.00 40.00 ? 187 ILE A CG1 1 
ATOM 1430 C CG2 . ILE A 1 184 ? 3.866  95.081  15.505 1.00 40.00 ? 187 ILE A CG2 1 
ATOM 1431 C CD1 . ILE A 1 184 ? 7.216  96.690  14.346 1.00 40.00 ? 187 ILE A CD1 1 
ATOM 1432 N N   . ALA A 1 185 ? 2.332  97.715  14.778 1.00 40.00 ? 188 ALA A N   1 
ATOM 1433 C CA  . ALA A 1 185 ? 1.214  98.024  13.913 1.00 40.00 ? 188 ALA A CA  1 
ATOM 1434 C C   . ALA A 1 185 ? 1.538  99.264  13.092 1.00 40.00 ? 188 ALA A C   1 
ATOM 1435 O O   . ALA A 1 185 ? 1.582  99.241  11.863 1.00 40.00 ? 188 ALA A O   1 
ATOM 1436 C CB  . ALA A 1 185 ? -0.031 98.273  14.757 1.00 40.00 ? 188 ALA A CB  1 
ATOM 1437 N N   . ALA A 1 186 ? 1.903  100.345 13.787 1.00 40.00 ? 189 ALA A N   1 
ATOM 1438 C CA  . ALA A 1 186 ? 2.261  101.623 13.215 1.00 40.00 ? 189 ALA A CA  1 
ATOM 1439 C C   . ALA A 1 186 ? 3.431  101.600 12.257 1.00 40.00 ? 189 ALA A C   1 
ATOM 1440 O O   . ALA A 1 186 ? 3.780  102.623 11.645 1.00 40.00 ? 189 ALA A O   1 
ATOM 1441 C CB  . ALA A 1 186 ? 2.478  102.660 14.319 1.00 40.00 ? 189 ALA A CB  1 
ATOM 1442 N N   . PHE A 1 187 ? 4.105  100.481 12.080 1.00 40.00 ? 190 PHE A N   1 
ATOM 1443 C CA  . PHE A 1 187 ? 5.237  100.424 11.154 1.00 40.00 ? 190 PHE A CA  1 
ATOM 1444 C C   . PHE A 1 187 ? 4.838  99.518  9.980  1.00 40.00 ? 190 PHE A C   1 
ATOM 1445 O O   . PHE A 1 187 ? 5.679  99.192  9.145  1.00 40.00 ? 190 PHE A O   1 
ATOM 1446 C CB  . PHE A 1 187 ? 6.504  99.851  11.815 1.00 40.00 ? 190 PHE A CB  1 
ATOM 1447 C CG  . PHE A 1 187 ? 6.983  100.748 12.926 1.00 40.00 ? 190 PHE A CG  1 
ATOM 1448 C CD1 . PHE A 1 187 ? 6.334  100.740 14.158 1.00 40.00 ? 190 PHE A CD1 1 
ATOM 1449 C CD2 . PHE A 1 187 ? 8.066  101.589 12.712 1.00 40.00 ? 190 PHE A CD2 1 
ATOM 1450 C CE1 . PHE A 1 187 ? 6.779  101.581 15.161 1.00 40.00 ? 190 PHE A CE1 1 
ATOM 1451 C CE2 . PHE A 1 187 ? 8.519  102.432 13.708 1.00 40.00 ? 190 PHE A CE2 1 
ATOM 1452 C CZ  . PHE A 1 187 ? 7.870  102.423 14.938 1.00 40.00 ? 190 PHE A CZ  1 
ATOM 1453 N N   . GLY A 1 188 ? 3.552  99.170  10.015 1.00 40.00 ? 191 GLY A N   1 
ATOM 1454 C CA  . GLY A 1 188 ? 3.011  98.284  8.993  1.00 40.00 ? 191 GLY A CA  1 
ATOM 1455 C C   . GLY A 1 188 ? 3.200  96.825  9.392  1.00 40.00 ? 191 GLY A C   1 
ATOM 1456 O O   . GLY A 1 188 ? 3.060  95.950  8.535  1.00 40.00 ? 191 GLY A O   1 
ATOM 1457 N N   . GLY A 1 189 ? 3.528  96.567  10.664 1.00 40.00 ? 192 GLY A N   1 
ATOM 1458 C CA  . GLY A 1 189 ? 3.734  95.163  11.057 1.00 40.00 ? 192 GLY A CA  1 
ATOM 1459 C C   . GLY A 1 189 ? 2.438  94.575  11.623 1.00 40.00 ? 192 GLY A C   1 
ATOM 1460 O O   . GLY A 1 189 ? 1.602  95.284  12.170 1.00 40.00 ? 192 GLY A O   1 
ATOM 1461 N N   . ASP A 1 190 ? 2.328  93.263  11.479 1.00 40.00 ? 193 ASP A N   1 
ATOM 1462 C CA  . ASP A 1 190 ? 1.183  92.537  11.992 1.00 40.00 ? 193 ASP A CA  1 
ATOM 1463 C C   . ASP A 1 190 ? 1.469  92.012  13.377 1.00 40.00 ? 193 ASP A C   1 
ATOM 1464 O O   . ASP A 1 190 ? 2.178  90.993  13.550 1.00 40.00 ? 193 ASP A O   1 
ATOM 1465 C CB  . ASP A 1 190 ? 0.942  91.322  11.068 1.00 40.00 ? 193 ASP A CB  1 
ATOM 1466 C CG  . ASP A 1 190 ? -0.376 90.636  11.397 1.00 40.00 ? 193 ASP A CG  1 
ATOM 1467 O OD1 . ASP A 1 190 ? -1.118 91.128  12.284 1.00 40.00 ? 193 ASP A OD1 1 
ATOM 1468 O OD2 . ASP A 1 190 ? -0.674 89.591  10.768 1.00 40.00 ? 193 ASP A OD2 1 
ATOM 1469 N N   . PRO A 1 191 ? 0.853  92.574  14.407 1.00 40.00 ? 194 PRO A N   1 
ATOM 1470 C CA  . PRO A 1 191 ? 1.008  92.093  15.774 1.00 40.00 ? 194 PRO A CA  1 
ATOM 1471 C C   . PRO A 1 191 ? 0.502  90.660  15.922 1.00 40.00 ? 194 PRO A C   1 
ATOM 1472 O O   . PRO A 1 191 ? 0.569  90.059  16.997 1.00 40.00 ? 194 PRO A O   1 
ATOM 1473 C CB  . PRO A 1 191 ? 0.090  93.010  16.596 1.00 40.00 ? 194 PRO A CB  1 
ATOM 1474 C CG  . PRO A 1 191 ? -0.907 93.474  15.603 1.00 40.00 ? 194 PRO A CG  1 
ATOM 1475 C CD  . PRO A 1 191 ? -0.075 93.712  14.343 1.00 40.00 ? 194 PRO A CD  1 
ATOM 1476 N N   . MET A 1 192 ? -0.062 90.086  14.888 1.00 40.00 ? 195 MET A N   1 
ATOM 1477 C CA  . MET A 1 192 ? -0.608 88.768  14.848 1.00 40.00 ? 195 MET A CA  1 
ATOM 1478 C C   . MET A 1 192 ? 0.308  87.740  14.204 1.00 40.00 ? 195 MET A C   1 
ATOM 1479 O O   . MET A 1 192 ? 0.021  86.542  14.317 1.00 40.00 ? 195 MET A O   1 
ATOM 1480 C CB  . MET A 1 192 ? -1.963 88.777  14.132 1.00 40.00 ? 195 MET A CB  1 
ATOM 1481 C CG  . MET A 1 192 ? -3.140 88.966  15.074 1.00 40.00 ? 195 MET A CG  1 
ATOM 1482 S SD  . MET A 1 192 ? -2.650 88.806  16.816 1.00 40.00 ? 195 MET A SD  1 
ATOM 1483 C CE  . MET A 1 192 ? -4.223 89.178  17.605 1.00 40.00 ? 195 MET A CE  1 
ATOM 1484 N N   . SER A 1 193 ? 1.416  88.198  13.641 1.00 40.00 ? 196 SER A N   1 
ATOM 1485 C CA  . SER A 1 193 ? 2.377  87.244  13.075 1.00 40.00 ? 196 SER A CA  1 
ATOM 1486 C C   . SER A 1 193 ? 3.796  87.651  13.474 1.00 40.00 ? 196 SER A C   1 
ATOM 1487 O O   . SER A 1 193 ? 4.662  88.143  12.749 1.00 40.00 ? 196 SER A O   1 
ATOM 1488 C CB  . SER A 1 193 ? 2.080  86.953  11.642 1.00 40.00 ? 196 SER A CB  1 
ATOM 1489 O OG  . SER A 1 193 ? 3.099  87.250  10.723 1.00 40.00 ? 196 SER A OG  1 
ATOM 1490 N N   . VAL A 1 194 ? 4.021  87.422  14.786 1.00 40.00 ? 197 VAL A N   1 
ATOM 1491 C CA  . VAL A 1 194 ? 5.299  87.665  15.441 1.00 40.00 ? 197 VAL A CA  1 
ATOM 1492 C C   . VAL A 1 194 ? 6.079  86.339  15.430 1.00 40.00 ? 197 VAL A C   1 
ATOM 1493 O O   . VAL A 1 194 ? 5.654  85.330  15.997 1.00 40.00 ? 197 VAL A O   1 
ATOM 1494 C CB  . VAL A 1 194 ? 5.092  88.106  16.898 1.00 40.00 ? 197 VAL A CB  1 
ATOM 1495 C CG1 . VAL A 1 194 ? 6.329  87.964  17.750 1.00 40.00 ? 197 VAL A CG1 1 
ATOM 1496 C CG2 . VAL A 1 194 ? 4.587  89.551  16.932 1.00 40.00 ? 197 VAL A CG2 1 
ATOM 1497 N N   . THR A 1 195 ? 7.216  86.359  14.759 1.00 40.00 ? 198 THR A N   1 
ATOM 1498 C CA  . THR A 1 195 ? 8.086  85.187  14.692 1.00 40.00 ? 198 THR A CA  1 
ATOM 1499 C C   . THR A 1 195 ? 9.417  85.508  15.363 1.00 40.00 ? 198 THR A C   1 
ATOM 1500 O O   . THR A 1 195 ? 10.225 86.265  14.784 1.00 40.00 ? 198 THR A O   1 
ATOM 1501 C CB  . THR A 1 195 ? 8.276  84.748  13.233 1.00 40.00 ? 198 THR A CB  1 
ATOM 1502 O OG1 . THR A 1 195 ? 7.186  83.872  12.913 1.00 40.00 ? 198 THR A OG1 1 
ATOM 1503 C CG2 . THR A 1 195 ? 9.582  84.023  12.953 1.00 40.00 ? 198 THR A CG2 1 
ATOM 1504 N N   . LEU A 1 196 ? 9.664  84.988  16.568 1.00 40.00 ? 199 LEU A N   1 
ATOM 1505 C CA  . LEU A 1 196 ? 10.950 85.276  17.231 1.00 40.00 ? 199 LEU A CA  1 
ATOM 1506 C C   . LEU A 1 196 ? 12.078 84.526  16.528 1.00 40.00 ? 199 LEU A C   1 
ATOM 1507 O O   . LEU A 1 196 ? 11.855 83.392  16.097 1.00 40.00 ? 199 LEU A O   1 
ATOM 1508 C CB  . LEU A 1 196 ? 10.962 84.802  18.704 1.00 40.00 ? 199 LEU A CB  1 
ATOM 1509 C CG  . LEU A 1 196 ? 9.861  85.347  19.605 1.00 40.00 ? 199 LEU A CG  1 
ATOM 1510 C CD1 . LEU A 1 196 ? 9.856  84.717  20.990 1.00 40.00 ? 199 LEU A CD1 1 
ATOM 1511 C CD2 . LEU A 1 196 ? 9.984  86.874  19.712 1.00 40.00 ? 199 LEU A CD2 1 
ATOM 1512 N N   . PHE A 1 197 ? 13.281 85.073  16.469 1.00 40.00 ? 200 PHE A N   1 
ATOM 1513 C CA  . PHE A 1 197 ? 14.371 84.277  15.897 1.00 40.00 ? 200 PHE A CA  1 
ATOM 1514 C C   . PHE A 1 197 ? 15.739 84.742  16.395 1.00 40.00 ? 200 PHE A C   1 
ATOM 1515 O O   . PHE A 1 197 ? 16.113 85.913  16.273 1.00 40.00 ? 200 PHE A O   1 
ATOM 1516 C CB  . PHE A 1 197 ? 14.309 84.167  14.409 1.00 40.00 ? 200 PHE A CB  1 
ATOM 1517 C CG  . PHE A 1 197 ? 14.900 85.279  13.606 1.00 40.00 ? 200 PHE A CG  1 
ATOM 1518 C CD1 . PHE A 1 197 ? 14.419 86.584  13.739 1.00 40.00 ? 200 PHE A CD1 1 
ATOM 1519 C CD2 . PHE A 1 197 ? 15.932 85.017  12.705 1.00 40.00 ? 200 PHE A CD2 1 
ATOM 1520 C CE1 . PHE A 1 197 ? 14.977 87.604  12.974 1.00 40.00 ? 200 PHE A CE1 1 
ATOM 1521 C CE2 . PHE A 1 197 ? 16.488 86.037  11.939 1.00 40.00 ? 200 PHE A CE2 1 
ATOM 1522 C CZ  . PHE A 1 197 ? 16.019 87.335  12.074 1.00 40.00 ? 200 PHE A CZ  1 
ATOM 1523 N N   . GLY A 1 198 ? 16.507 83.805  16.966 1.00 40.00 ? 201 GLY A N   1 
ATOM 1524 C CA  . GLY A 1 198 ? 17.839 84.129  17.440 1.00 40.00 ? 201 GLY A CA  1 
ATOM 1525 C C   . GLY A 1 198 ? 18.839 82.996  17.385 1.00 40.00 ? 201 GLY A C   1 
ATOM 1526 O O   . GLY A 1 198 ? 18.552 81.806  17.264 1.00 40.00 ? 201 GLY A O   1 
ATOM 1527 N N   . GLU A 1 199 ? 20.098 83.331  17.537 1.00 40.00 ? 202 GLU A N   1 
ATOM 1528 C CA  . GLU A 1 199 ? 21.217 82.399  17.548 1.00 40.00 ? 202 GLU A CA  1 
ATOM 1529 C C   . GLU A 1 199 ? 21.799 82.234  18.942 1.00 40.00 ? 202 GLU A C   1 
ATOM 1530 O O   . GLU A 1 199 ? 21.327 82.862  19.887 1.00 40.00 ? 202 GLU A O   1 
ATOM 1531 C CB  . GLU A 1 199 ? 22.221 82.914  16.521 1.00 40.00 ? 202 GLU A CB  1 
ATOM 1532 C CG  . GLU A 1 199 ? 23.168 81.811  16.077 1.00 40.00 ? 202 GLU A CG  1 
ATOM 1533 C CD  . GLU A 1 199 ? 24.476 82.015  16.839 1.00 40.00 ? 202 GLU A CD  1 
ATOM 1534 O OE1 . GLU A 1 199 ? 24.390 82.791  17.821 1.00 40.00 ? 202 GLU A OE1 1 
ATOM 1535 O OE2 . GLU A 1 199 ? 25.505 81.414  16.463 1.00 40.00 ? 202 GLU A OE2 1 
ATOM 1536 N N   . SER A 1 200 ? 22.757 81.373  19.164 1.00 40.00 ? 203 SER A N   1 
ATOM 1537 C CA  . SER A 1 200 ? 23.375 81.071  20.452 1.00 40.00 ? 203 SER A CA  1 
ATOM 1538 C C   . SER A 1 200 ? 22.433 81.318  21.621 1.00 40.00 ? 203 SER A C   1 
ATOM 1539 O O   . SER A 1 200 ? 21.313 80.757  21.676 1.00 40.00 ? 203 SER A O   1 
ATOM 1540 C CB  . SER A 1 200 ? 24.704 81.784  20.596 1.00 40.00 ? 203 SER A CB  1 
ATOM 1541 O OG  . SER A 1 200 ? 25.632 81.229  21.502 1.00 40.00 ? 203 SER A OG  1 
ATOM 1542 N N   . ALA A 1 201 ? 22.798 82.207  22.574 1.00 40.00 ? 204 ALA A N   1 
ATOM 1543 C CA  . ALA A 1 201 ? 21.873 82.412  23.696 1.00 40.00 ? 204 ALA A CA  1 
ATOM 1544 C C   . ALA A 1 201 ? 20.601 83.124  23.286 1.00 40.00 ? 204 ALA A C   1 
ATOM 1545 O O   . ALA A 1 201 ? 19.556 83.026  23.962 1.00 40.00 ? 204 ALA A O   1 
ATOM 1546 C CB  . ALA A 1 201 ? 22.522 82.945  24.929 1.00 40.00 ? 204 ALA A CB  1 
ATOM 1547 N N   . GLY A 1 202 ? 20.584 83.824  22.154 1.00 40.00 ? 205 GLY A N   1 
ATOM 1548 C CA  . GLY A 1 202 ? 19.304 84.419  21.677 1.00 40.00 ? 205 GLY A CA  1 
ATOM 1549 C C   . GLY A 1 202 ? 18.348 83.245  21.353 1.00 40.00 ? 205 GLY A C   1 
ATOM 1550 O O   . GLY A 1 202 ? 17.192 83.251  21.784 1.00 40.00 ? 205 GLY A O   1 
ATOM 1551 N N   . ALA A 1 203 ? 18.856 82.225  20.662 1.00 40.00 ? 206 ALA A N   1 
ATOM 1552 C CA  . ALA A 1 203 ? 18.075 81.018  20.402 1.00 40.00 ? 206 ALA A CA  1 
ATOM 1553 C C   . ALA A 1 203 ? 17.603 80.431  21.741 1.00 40.00 ? 206 ALA A C   1 
ATOM 1554 O O   . ALA A 1 203 ? 16.406 80.235  21.976 1.00 40.00 ? 206 ALA A O   1 
ATOM 1555 C CB  . ALA A 1 203 ? 18.993 79.996  19.739 1.00 40.00 ? 206 ALA A CB  1 
ATOM 1556 N N   . ALA A 1 204 ? 18.574 80.298  22.673 1.00 40.00 ? 207 ALA A N   1 
ATOM 1557 C CA  . ALA A 1 204 ? 18.269 79.804  23.994 1.00 40.00 ? 207 ALA A CA  1 
ATOM 1558 C C   . ALA A 1 204 ? 17.137 80.610  24.609 1.00 40.00 ? 207 ALA A C   1 
ATOM 1559 O O   . ALA A 1 204 ? 16.300 80.108  25.356 1.00 40.00 ? 207 ALA A O   1 
ATOM 1560 C CB  . ALA A 1 204 ? 19.442 79.944  24.946 1.00 40.00 ? 207 ALA A CB  1 
ATOM 1561 N N   . SER A 1 205 ? 17.195 81.907  24.322 1.00 40.00 ? 208 SER A N   1 
ATOM 1562 C CA  . SER A 1 205 ? 16.216 82.855  24.837 1.00 40.00 ? 208 SER A CA  1 
ATOM 1563 C C   . SER A 1 205 ? 14.853 82.594  24.236 1.00 40.00 ? 208 SER A C   1 
ATOM 1564 O O   . SER A 1 205 ? 13.833 82.354  24.919 1.00 40.00 ? 208 SER A O   1 
ATOM 1565 C CB  . SER A 1 205 ? 16.693 84.268  24.489 1.00 40.00 ? 208 SER A CB  1 
ATOM 1566 O OG  . SER A 1 205 ? 17.873 84.581  25.186 1.00 40.00 ? 208 SER A OG  1 
ATOM 1567 N N   . VAL A 1 206 ? 14.873 82.584  22.879 1.00 40.00 ? 209 VAL A N   1 
ATOM 1568 C CA  . VAL A 1 206 ? 13.613 82.295  22.181 1.00 40.00 ? 209 VAL A CA  1 
ATOM 1569 C C   . VAL A 1 206 ? 13.018 81.044  22.869 1.00 40.00 ? 209 VAL A C   1 
ATOM 1570 O O   . VAL A 1 206 ? 11.807 80.998  23.137 1.00 40.00 ? 209 VAL A O   1 
ATOM 1571 C CB  . VAL A 1 206 ? 13.854 81.868  20.722 1.00 40.00 ? 209 VAL A CB  1 
ATOM 1572 C CG1 . VAL A 1 206 ? 12.563 81.286  20.171 1.00 40.00 ? 209 VAL A CG1 1 
ATOM 1573 C CG2 . VAL A 1 206 ? 14.335 83.001  19.834 1.00 40.00 ? 209 VAL A CG2 1 
ATOM 1574 N N   . GLY A 1 207 ? 13.931 80.062  23.133 1.00 40.00 ? 210 GLY A N   1 
ATOM 1575 C CA  . GLY A 1 207 ? 13.449 78.858  23.780 1.00 40.00 ? 210 GLY A CA  1 
ATOM 1576 C C   . GLY A 1 207 ? 12.716 79.141  25.082 1.00 40.00 ? 210 GLY A C   1 
ATOM 1577 O O   . GLY A 1 207 ? 11.670 78.570  25.441 1.00 40.00 ? 210 GLY A O   1 
ATOM 1578 N N   . MET A 1 208 ? 13.312 80.072  25.850 1.00 40.00 ? 211 MET A N   1 
ATOM 1579 C CA  . MET A 1 208 ? 12.706 80.379  27.165 1.00 40.00 ? 211 MET A CA  1 
ATOM 1580 C C   . MET A 1 208 ? 11.400 81.101  27.038 1.00 40.00 ? 211 MET A C   1 
ATOM 1581 O O   . MET A 1 208 ? 10.416 80.968  27.805 1.00 40.00 ? 211 MET A O   1 
ATOM 1582 C CB  . MET A 1 208 ? 13.766 81.012  28.051 1.00 40.00 ? 211 MET A CB  1 
ATOM 1583 C CG  . MET A 1 208 ? 14.591 79.869  28.650 1.00 40.00 ? 211 MET A CG  1 
ATOM 1584 S SD  . MET A 1 208 ? 15.989 80.382  29.584 1.00 40.00 ? 211 MET A SD  1 
ATOM 1585 C CE  . MET A 1 208 ? 17.326 80.280  28.373 1.00 40.00 ? 211 MET A CE  1 
ATOM 1586 N N   . HIS A 1 209 ? 11.308 81.860  25.912 1.00 40.00 ? 212 HIS A N   1 
ATOM 1587 C CA  . HIS A 1 209 ? 9.980  82.492  25.767 1.00 40.00 ? 212 HIS A CA  1 
ATOM 1588 C C   . HIS A 1 209 ? 8.962  81.393  25.577 1.00 40.00 ? 212 HIS A C   1 
ATOM 1589 O O   . HIS A 1 209 ? 7.963  81.440  26.312 1.00 40.00 ? 212 HIS A O   1 
ATOM 1590 C CB  . HIS A 1 209 ? 9.992  83.601  24.745 1.00 40.00 ? 212 HIS A CB  1 
ATOM 1591 C CG  . HIS A 1 209 ? 10.750 84.800  25.304 1.00 40.00 ? 212 HIS A CG  1 
ATOM 1592 N ND1 . HIS A 1 209 ? 11.736 85.432  24.597 1.00 40.00 ? 212 HIS A ND1 1 
ATOM 1593 C CD2 . HIS A 1 209 ? 10.670 85.406  26.496 1.00 40.00 ? 212 HIS A CD2 1 
ATOM 1594 C CE1 . HIS A 1 209 ? 12.242 86.404  25.331 1.00 40.00 ? 212 HIS A CE1 1 
ATOM 1595 N NE2 . HIS A 1 209 ? 11.602 86.408  26.496 1.00 40.00 ? 212 HIS A NE2 1 
ATOM 1596 N N   . ILE A 1 210 ? 9.227  80.412  24.716 1.00 40.00 ? 213 ILE A N   1 
ATOM 1597 C CA  . ILE A 1 210 ? 8.277  79.312  24.515 1.00 40.00 ? 213 ILE A CA  1 
ATOM 1598 C C   . ILE A 1 210 ? 7.989  78.597  25.837 1.00 40.00 ? 213 ILE A C   1 
ATOM 1599 O O   . ILE A 1 210 ? 6.887  78.137  26.112 1.00 40.00 ? 213 ILE A O   1 
ATOM 1600 C CB  . ILE A 1 210 ? 8.865  78.258  23.577 1.00 40.00 ? 213 ILE A CB  1 
ATOM 1601 C CG1 . ILE A 1 210 ? 8.948  78.726  22.134 1.00 40.00 ? 213 ILE A CG1 1 
ATOM 1602 C CG2 . ILE A 1 210 ? 8.090  76.966  23.669 1.00 40.00 ? 213 ILE A CG2 1 
ATOM 1603 C CD1 . ILE A 1 210 ? 9.779  77.760  21.273 1.00 40.00 ? 213 ILE A CD1 1 
ATOM 1604 N N   . LEU A 1 211 ? 9.011  78.470  26.684 1.00 40.00 ? 214 LEU A N   1 
ATOM 1605 C CA  . LEU A 1 211 ? 8.867  77.761  27.938 1.00 40.00 ? 214 LEU A CA  1 
ATOM 1606 C C   . LEU A 1 211 ? 8.202  78.607  29.008 1.00 40.00 ? 214 LEU A C   1 
ATOM 1607 O O   . LEU A 1 211 ? 7.834  78.104  30.076 1.00 40.00 ? 214 LEU A O   1 
ATOM 1608 C CB  . LEU A 1 211 ? 10.286 77.361  28.376 1.00 40.00 ? 214 LEU A CB  1 
ATOM 1609 C CG  . LEU A 1 211 ? 10.775 75.949  28.120 1.00 40.00 ? 214 LEU A CG  1 
ATOM 1610 C CD1 . LEU A 1 211 ? 9.631  75.020  27.700 1.00 40.00 ? 214 LEU A CD1 1 
ATOM 1611 C CD2 . LEU A 1 211 ? 11.884 75.958  27.066 1.00 40.00 ? 214 LEU A CD2 1 
ATOM 1612 N N   . SER A 1 212 ? 8.117  79.910  28.746 1.00 40.00 ? 215 SER A N   1 
ATOM 1613 C CA  . SER A 1 212 ? 7.545  80.822  29.751 1.00 40.00 ? 215 SER A CA  1 
ATOM 1614 C C   . SER A 1 212 ? 6.135  81.249  29.409 1.00 40.00 ? 215 SER A C   1 
ATOM 1615 O O   . SER A 1 212 ? 5.903  81.808  28.317 1.00 40.00 ? 215 SER A O   1 
ATOM 1616 C CB  . SER A 1 212 ? 8.495  82.020  29.855 1.00 40.00 ? 215 SER A CB  1 
ATOM 1617 O OG  . SER A 1 212 ? 8.352  82.654  31.104 1.00 40.00 ? 215 SER A OG  1 
ATOM 1618 N N   . LEU A 1 213 ? 5.172  81.010  30.317 1.00 40.00 ? 216 LEU A N   1 
ATOM 1619 C CA  . LEU A 1 213 ? 3.808  81.370  29.915 1.00 40.00 ? 216 LEU A CA  1 
ATOM 1620 C C   . LEU A 1 213 ? 3.632  82.758  29.400 1.00 40.00 ? 216 LEU A C   1 
ATOM 1621 O O   . LEU A 1 213 ? 3.422  82.993  28.203 1.00 40.00 ? 216 LEU A O   1 
ATOM 1622 C CB  . LEU A 1 213 ? 2.734  80.951  30.904 1.00 40.00 ? 216 LEU A CB  1 
ATOM 1623 C CG  . LEU A 1 213 ? 2.015  79.655  30.472 1.00 40.00 ? 216 LEU A CG  1 
ATOM 1624 C CD1 . LEU A 1 213 ? 2.783  78.844  29.421 1.00 40.00 ? 216 LEU A CD1 1 
ATOM 1625 C CD2 . LEU A 1 213 ? 1.767  78.754  31.688 1.00 40.00 ? 216 LEU A CD2 1 
ATOM 1626 N N   . PRO A 1 214 ? 3.771  83.745  30.257 1.00 40.00 ? 217 PRO A N   1 
ATOM 1627 C CA  . PRO A 1 214 ? 3.654  85.138  29.856 1.00 40.00 ? 217 PRO A CA  1 
ATOM 1628 C C   . PRO A 1 214 ? 4.343  85.414  28.561 1.00 40.00 ? 217 PRO A C   1 
ATOM 1629 O O   . PRO A 1 214 ? 3.751  86.153  27.726 1.00 40.00 ? 217 PRO A O   1 
ATOM 1630 C CB  . PRO A 1 214 ? 4.195  85.906  31.027 1.00 40.00 ? 217 PRO A CB  1 
ATOM 1631 C CG  . PRO A 1 214 ? 3.902  85.016  32.203 1.00 40.00 ? 217 PRO A CG  1 
ATOM 1632 C CD  . PRO A 1 214 ? 4.036  83.597  31.705 1.00 40.00 ? 217 PRO A CD  1 
ATOM 1633 N N   . SER A 1 215 ? 5.485  84.866  28.174 1.00 40.00 ? 218 SER A N   1 
ATOM 1634 C CA  . SER A 1 215 ? 5.948  85.265  26.819 1.00 40.00 ? 218 SER A CA  1 
ATOM 1635 C C   . SER A 1 215 ? 5.085  84.744  25.697 1.00 40.00 ? 218 SER A C   1 
ATOM 1636 O O   . SER A 1 215 ? 5.183  85.169  24.528 1.00 40.00 ? 218 SER A O   1 
ATOM 1637 C CB  . SER A 1 215 ? 7.426  84.864  26.677 1.00 40.00 ? 218 SER A CB  1 
ATOM 1638 O OG  . SER A 1 215 ? 8.179  85.685  27.613 1.00 40.00 ? 218 SER A OG  1 
ATOM 1639 N N   . ARG A 1 216 ? 4.209  83.781  25.933 1.00 40.00 ? 219 ARG A N   1 
ATOM 1640 C CA  . ARG A 1 216 ? 3.426  83.109  24.925 1.00 40.00 ? 219 ARG A CA  1 
ATOM 1641 C C   . ARG A 1 216 ? 2.587  83.957  24.013 1.00 40.00 ? 219 ARG A C   1 
ATOM 1642 O O   . ARG A 1 216 ? 2.671  83.908  22.770 1.00 40.00 ? 219 ARG A O   1 
ATOM 1643 C CB  . ARG A 1 216 ? 2.536  82.043  25.595 1.00 40.00 ? 219 ARG A CB  1 
ATOM 1644 C CG  . ARG A 1 216 ? 3.337  80.887  26.179 1.00 40.00 ? 219 ARG A CG  1 
ATOM 1645 C CD  . ARG A 1 216 ? 4.195  80.183  25.144 1.00 40.00 ? 219 ARG A CD  1 
ATOM 1646 N NE  . ARG A 1 216 ? 3.390  79.382  24.220 1.00 40.00 ? 219 ARG A NE  1 
ATOM 1647 C CZ  . ARG A 1 216 ? 3.895  78.462  23.408 1.00 40.00 ? 219 ARG A CZ  1 
ATOM 1648 N NH1 . ARG A 1 216 ? 5.204  78.247  23.436 1.00 40.00 ? 219 ARG A NH1 1 
ATOM 1649 N NH2 . ARG A 1 216 ? 3.149  77.747  22.572 1.00 40.00 ? 219 ARG A NH2 1 
ATOM 1650 N N   . SER A 1 217 ? 1.743  84.801  24.629 1.00 40.00 ? 220 SER A N   1 
ATOM 1651 C CA  . SER A 1 217 ? 0.884  85.677  23.860 1.00 40.00 ? 220 SER A CA  1 
ATOM 1652 C C   . SER A 1 217 ? 1.644  86.681  23.030 1.00 40.00 ? 220 SER A C   1 
ATOM 1653 O O   . SER A 1 217 ? 0.948  87.502  22.417 1.00 40.00 ? 220 SER A O   1 
ATOM 1654 C CB  . SER A 1 217 ? -0.017 86.508  24.787 1.00 40.00 ? 220 SER A CB  1 
ATOM 1655 O OG  . SER A 1 217 ? 0.540  86.509  26.079 1.00 40.00 ? 220 SER A OG  1 
ATOM 1656 N N   . LEU A 1 218 ? 2.952  86.743  23.024 1.00 40.00 ? 221 LEU A N   1 
ATOM 1657 C CA  . LEU A 1 218 ? 3.573  87.828  22.287 1.00 40.00 ? 221 LEU A CA  1 
ATOM 1658 C C   . LEU A 1 218 ? 4.246  87.374  21.029 1.00 40.00 ? 221 LEU A C   1 
ATOM 1659 O O   . LEU A 1 218 ? 4.903  88.182  20.351 1.00 40.00 ? 221 LEU A O   1 
ATOM 1660 C CB  . LEU A 1 218 ? 4.495  88.599  23.225 1.00 40.00 ? 221 LEU A CB  1 
ATOM 1661 C CG  . LEU A 1 218 ? 4.326  88.496  24.745 1.00 40.00 ? 221 LEU A CG  1 
ATOM 1662 C CD1 . LEU A 1 218 ? 5.445  89.347  25.341 1.00 40.00 ? 221 LEU A CD1 1 
ATOM 1663 C CD2 . LEU A 1 218 ? 2.991  89.022  25.235 1.00 40.00 ? 221 LEU A CD2 1 
ATOM 1664 N N   . PHE A 1 219 ? 4.110  86.099  20.721 1.00 40.00 ? 222 PHE A N   1 
ATOM 1665 C CA  . PHE A 1 219 ? 4.741  85.612  19.481 1.00 40.00 ? 222 PHE A CA  1 
ATOM 1666 C C   . PHE A 1 219 ? 3.982  84.379  19.024 1.00 40.00 ? 222 PHE A C   1 
ATOM 1667 O O   . PHE A 1 219 ? 3.201  83.807  19.797 1.00 40.00 ? 222 PHE A O   1 
ATOM 1668 C CB  . PHE A 1 219 ? 6.207  85.305  19.681 1.00 40.00 ? 222 PHE A CB  1 
ATOM 1669 C CG  . PHE A 1 219 ? 6.421  84.097  20.561 1.00 40.00 ? 222 PHE A CG  1 
ATOM 1670 C CD1 . PHE A 1 219 ? 6.153  84.200  21.921 1.00 40.00 ? 222 PHE A CD1 1 
ATOM 1671 C CD2 . PHE A 1 219 ? 6.874  82.903  20.000 1.00 40.00 ? 222 PHE A CD2 1 
ATOM 1672 C CE1 . PHE A 1 219 ? 6.357  83.102  22.733 1.00 40.00 ? 222 PHE A CE1 1 
ATOM 1673 C CE2 . PHE A 1 219 ? 7.080  81.813  20.816 1.00 40.00 ? 222 PHE A CE2 1 
ATOM 1674 C CZ  . PHE A 1 219 ? 6.819  81.916  22.177 1.00 40.00 ? 222 PHE A CZ  1 
ATOM 1675 N N   . HIS A 1 220 ? 4.145  84.028  17.754 1.00 40.00 ? 223 HIS A N   1 
ATOM 1676 C CA  . HIS A 1 220 ? 3.361  82.890  17.235 1.00 40.00 ? 223 HIS A CA  1 
ATOM 1677 C C   . HIS A 1 220 ? 4.228  81.797  16.654 1.00 40.00 ? 223 HIS A C   1 
ATOM 1678 O O   . HIS A 1 220 ? 3.935  80.604  16.798 1.00 40.00 ? 223 HIS A O   1 
ATOM 1679 C CB  . HIS A 1 220 ? 2.336  83.473  16.249 1.00 40.00 ? 223 HIS A CB  1 
ATOM 1680 C CG  . HIS A 1 220 ? 1.592  84.678  16.773 1.00 40.00 ? 223 HIS A CG  1 
ATOM 1681 N ND1 . HIS A 1 220 ? 2.001  85.982  16.573 1.00 40.00 ? 223 HIS A ND1 1 
ATOM 1682 C CD2 . HIS A 1 220 ? 0.476  84.731  17.548 1.00 40.00 ? 223 HIS A CD2 1 
ATOM 1683 C CE1 . HIS A 1 220 ? 1.154  86.777  17.200 1.00 40.00 ? 223 HIS A CE1 1 
ATOM 1684 N NE2 . HIS A 1 220 ? 0.207  86.060  17.781 1.00 40.00 ? 223 HIS A NE2 1 
ATOM 1685 N N   . ARG A 1 221 ? 5.323  82.150  15.997 1.00 40.00 ? 224 ARG A N   1 
ATOM 1686 C CA  . ARG A 1 221 ? 6.278  81.200  15.439 1.00 40.00 ? 224 ARG A CA  1 
ATOM 1687 C C   . ARG A 1 221 ? 7.646  81.426  16.071 1.00 40.00 ? 224 ARG A C   1 
ATOM 1688 O O   . ARG A 1 221 ? 7.854  82.486  16.689 1.00 40.00 ? 224 ARG A O   1 
ATOM 1689 C CB  . ARG A 1 221 ? 6.239  81.278  13.917 1.00 40.00 ? 224 ARG A CB  1 
ATOM 1690 C CG  . ARG A 1 221 ? 5.170  80.375  13.326 1.00 40.00 ? 224 ARG A CG  1 
ATOM 1691 C CD  . ARG A 1 221 ? 4.990  80.488  11.819 1.00 40.00 ? 224 ARG A CD  1 
ATOM 1692 N NE  . ARG A 1 221 ? 4.609  81.816  11.398 1.00 40.00 ? 224 ARG A NE  1 
ATOM 1693 C CZ  . ARG A 1 221 ? 3.477  82.447  11.689 1.00 40.00 ? 224 ARG A CZ  1 
ATOM 1694 N NH1 . ARG A 1 221 ? 2.504  81.889  12.409 1.00 40.00 ? 224 ARG A NH1 1 
ATOM 1695 N NH2 . ARG A 1 221 ? 3.346  83.695  11.233 1.00 40.00 ? 224 ARG A NH2 1 
ATOM 1696 N N   . ALA A 1 222 ? 8.582  80.495  16.000 1.00 40.00 ? 225 ALA A N   1 
ATOM 1697 C CA  . ALA A 1 222 ? 9.899  80.613  16.622 1.00 40.00 ? 225 ALA A CA  1 
ATOM 1698 C C   . ALA A 1 222 ? 11.022 79.916  15.856 1.00 40.00 ? 225 ALA A C   1 
ATOM 1699 O O   . ALA A 1 222 ? 10.796 78.820  15.321 1.00 40.00 ? 225 ALA A O   1 
ATOM 1700 C CB  . ALA A 1 222 ? 9.862  79.936  18.009 1.00 40.00 ? 225 ALA A CB  1 
ATOM 1701 N N   . VAL A 1 223 ? 12.201 80.495  15.808 1.00 40.00 ? 226 VAL A N   1 
ATOM 1702 C CA  . VAL A 1 223 ? 13.339 79.877  15.146 1.00 40.00 ? 226 VAL A CA  1 
ATOM 1703 C C   . VAL A 1 223 ? 14.440 79.818  16.213 1.00 40.00 ? 226 VAL A C   1 
ATOM 1704 O O   . VAL A 1 223 ? 14.474 80.708  17.104 1.00 40.00 ? 226 VAL A O   1 
ATOM 1705 C CB  . VAL A 1 223 ? 13.884 80.728  14.005 1.00 40.00 ? 226 VAL A CB  1 
ATOM 1706 C CG1 . VAL A 1 223 ? 15.049 80.083  13.271 1.00 40.00 ? 226 VAL A CG1 1 
ATOM 1707 C CG2 . VAL A 1 223 ? 12.779 81.116  13.052 1.00 40.00 ? 226 VAL A CG2 1 
ATOM 1708 N N   . LEU A 1 224 ? 15.273 78.787  16.242 1.00 40.00 ? 227 LEU A N   1 
ATOM 1709 C CA  . LEU A 1 224 ? 16.323 78.710  17.271 1.00 40.00 ? 227 LEU A CA  1 
ATOM 1710 C C   . LEU A 1 224 ? 17.581 78.258  16.547 1.00 40.00 ? 227 LEU A C   1 
ATOM 1711 O O   . LEU A 1 224 ? 17.611 77.073  16.205 1.00 40.00 ? 227 LEU A O   1 
ATOM 1712 C CB  . LEU A 1 224 ? 15.930 77.671  18.311 1.00 40.00 ? 227 LEU A CB  1 
ATOM 1713 C CG  . LEU A 1 224 ? 14.711 77.938  19.172 1.00 40.00 ? 227 LEU A CG  1 
ATOM 1714 C CD1 . LEU A 1 224 ? 13.398 77.577  18.518 1.00 40.00 ? 227 LEU A CD1 1 
ATOM 1715 C CD2 . LEU A 1 224 ? 14.741 77.124  20.475 1.00 40.00 ? 227 LEU A CD2 1 
ATOM 1716 N N   . GLN A 1 225 ? 18.509 79.116  16.260 1.00 40.00 ? 228 GLN A N   1 
ATOM 1717 C CA  . GLN A 1 225 ? 19.716 78.734  15.549 1.00 40.00 ? 228 GLN A CA  1 
ATOM 1718 C C   . GLN A 1 225 ? 20.887 78.482  16.489 1.00 40.00 ? 228 GLN A C   1 
ATOM 1719 O O   . GLN A 1 225 ? 21.284 79.286  17.339 1.00 40.00 ? 228 GLN A O   1 
ATOM 1720 C CB  . GLN A 1 225 ? 20.086 79.839  14.545 1.00 40.00 ? 228 GLN A CB  1 
ATOM 1721 C CG  . GLN A 1 225 ? 18.867 80.461  13.872 1.00 40.00 ? 228 GLN A CG  1 
ATOM 1722 C CD  . GLN A 1 225 ? 19.240 81.614  12.955 1.00 40.00 ? 228 GLN A CD  1 
ATOM 1723 O OE1 . GLN A 1 225 ? 18.390 82.440  12.622 1.00 40.00 ? 228 GLN A OE1 1 
ATOM 1724 N NE2 . GLN A 1 225 ? 20.502 81.650  12.540 1.00 40.00 ? 228 GLN A NE2 1 
ATOM 1725 N N   . SER A 1 226 ? 21.509 77.300  16.345 1.00 40.00 ? 229 SER A N   1 
ATOM 1726 C CA  . SER A 1 226 ? 22.666 76.924  17.133 1.00 40.00 ? 229 SER A CA  1 
ATOM 1727 C C   . SER A 1 226 ? 22.438 77.126  18.624 1.00 40.00 ? 229 SER A C   1 
ATOM 1728 O O   . SER A 1 226 ? 23.447 77.471  19.285 1.00 40.00 ? 229 SER A O   1 
ATOM 1729 C CB  . SER A 1 226 ? 23.871 77.790  16.730 1.00 40.00 ? 229 SER A CB  1 
ATOM 1730 O OG  . SER A 1 226 ? 24.491 77.427  15.539 1.00 40.00 ? 229 SER A OG  1 
ATOM 1731 N N   . GLY A 1 227 ? 21.262 76.901  19.207 1.00 40.00 ? 230 GLY A N   1 
ATOM 1732 C CA  . GLY A 1 227 ? 21.223 77.089  20.658 1.00 40.00 ? 230 GLY A CA  1 
ATOM 1733 C C   . GLY A 1 227 ? 19.934 76.708  21.254 1.00 40.00 ? 230 GLY A C   1 
ATOM 1734 O O   . GLY A 1 227 ? 18.955 76.809  20.505 1.00 40.00 ? 230 GLY A O   1 
ATOM 1735 N N   . THR A 1 228 ? 19.763 76.251  22.481 1.00 40.00 ? 231 THR A N   1 
ATOM 1736 C CA  . THR A 1 228 ? 18.401 75.881  22.983 1.00 40.00 ? 231 THR A CA  1 
ATOM 1737 C C   . THR A 1 228 ? 18.261 76.248  24.444 1.00 40.00 ? 231 THR A C   1 
ATOM 1738 O O   . THR A 1 228 ? 19.252 76.549  25.127 1.00 40.00 ? 231 THR A O   1 
ATOM 1739 C CB  . THR A 1 228 ? 18.271 74.359  23.031 1.00 40.00 ? 231 THR A CB  1 
ATOM 1740 O OG1 . THR A 1 228 ? 19.319 73.913  23.960 1.00 40.00 ? 231 THR A OG1 1 
ATOM 1741 C CG2 . THR A 1 228 ? 18.447 73.711  21.679 1.00 40.00 ? 231 THR A CG2 1 
ATOM 1742 N N   . PRO A 1 229 ? 17.095 76.141  25.021 1.00 40.00 ? 232 PRO A N   1 
ATOM 1743 C CA  . PRO A 1 229 ? 16.991 76.495  26.439 1.00 40.00 ? 232 PRO A CA  1 
ATOM 1744 C C   . PRO A 1 229 ? 17.399 75.329  27.311 1.00 40.00 ? 232 PRO A C   1 
ATOM 1745 O O   . PRO A 1 229 ? 17.514 75.464  28.520 1.00 40.00 ? 232 PRO A O   1 
ATOM 1746 C CB  . PRO A 1 229 ? 15.491 76.733  26.621 1.00 40.00 ? 232 PRO A CB  1 
ATOM 1747 C CG  . PRO A 1 229 ? 14.882 75.768  25.650 1.00 40.00 ? 232 PRO A CG  1 
ATOM 1748 C CD  . PRO A 1 229 ? 15.813 75.762  24.440 1.00 40.00 ? 232 PRO A CD  1 
ATOM 1749 N N   . ASN A 1 230 ? 17.522 74.144  26.720 1.00 40.00 ? 233 ASN A N   1 
ATOM 1750 C CA  . ASN A 1 230 ? 17.707 72.958  27.536 1.00 40.00 ? 233 ASN A CA  1 
ATOM 1751 C C   . ASN A 1 230 ? 19.074 72.431  27.750 1.00 40.00 ? 233 ASN A C   1 
ATOM 1752 O O   . ASN A 1 230 ? 19.273 71.639  28.731 1.00 40.00 ? 233 ASN A O   1 
ATOM 1753 C CB  . ASN A 1 230 ? 16.678 71.920  26.992 1.00 40.00 ? 233 ASN A CB  1 
ATOM 1754 C CG  . ASN A 1 230 ? 17.024 71.573  25.542 1.00 40.00 ? 233 ASN A CG  1 
ATOM 1755 O OD1 . ASN A 1 230 ? 16.800 72.378  24.648 1.00 40.00 ? 233 ASN A OD1 1 
ATOM 1756 N ND2 . ASN A 1 230 ? 17.579 70.395  25.314 1.00 40.00 ? 233 ASN A ND2 1 
ATOM 1757 N N   . GLY A 1 231 ? 20.131 72.779  27.037 1.00 40.00 ? 234 GLY A N   1 
ATOM 1758 C CA  . GLY A 1 231 ? 21.449 72.194  27.330 1.00 40.00 ? 234 GLY A CA  1 
ATOM 1759 C C   . GLY A 1 231 ? 22.133 72.347  28.654 1.00 40.00 ? 234 GLY A C   1 
ATOM 1760 O O   . GLY A 1 231 ? 21.607 72.646  29.742 1.00 40.00 ? 234 GLY A O   1 
ATOM 1761 N N   . PRO A 1 232 ? 23.469 72.141  28.668 1.00 40.00 ? 235 PRO A N   1 
ATOM 1762 C CA  . PRO A 1 232 ? 24.279 72.291  29.863 1.00 40.00 ? 235 PRO A CA  1 
ATOM 1763 C C   . PRO A 1 232 ? 24.671 73.720  30.213 1.00 40.00 ? 235 PRO A C   1 
ATOM 1764 O O   . PRO A 1 232 ? 25.120 74.006  31.341 1.00 40.00 ? 235 PRO A O   1 
ATOM 1765 C CB  . PRO A 1 232 ? 25.547 71.521  29.509 1.00 40.00 ? 235 PRO A CB  1 
ATOM 1766 C CG  . PRO A 1 232 ? 25.666 71.621  28.039 1.00 40.00 ? 235 PRO A CG  1 
ATOM 1767 C CD  . PRO A 1 232 ? 24.294 71.771  27.492 1.00 40.00 ? 235 PRO A CD  1 
ATOM 1768 N N   . TRP A 1 233 ? 24.568 74.703  29.328 1.00 40.00 ? 236 TRP A N   1 
ATOM 1769 C CA  . TRP A 1 233 ? 25.046 76.020  29.655 1.00 40.00 ? 236 TRP A CA  1 
ATOM 1770 C C   . TRP A 1 233 ? 24.100 77.196  29.717 1.00 40.00 ? 236 TRP A C   1 
ATOM 1771 O O   . TRP A 1 233 ? 24.515 78.298  30.130 1.00 40.00 ? 236 TRP A O   1 
ATOM 1772 C CB  . TRP A 1 233 ? 26.080 76.395  28.561 1.00 40.00 ? 236 TRP A CB  1 
ATOM 1773 C CG  . TRP A 1 233 ? 25.482 76.372  27.185 1.00 40.00 ? 236 TRP A CG  1 
ATOM 1774 C CD1 . TRP A 1 233 ? 25.537 75.326  26.310 1.00 40.00 ? 236 TRP A CD1 1 
ATOM 1775 C CD2 . TRP A 1 233 ? 24.729 77.390  26.519 1.00 40.00 ? 236 TRP A CD2 1 
ATOM 1776 N NE1 . TRP A 1 233 ? 24.894 75.632  25.144 1.00 40.00 ? 236 TRP A NE1 1 
ATOM 1777 C CE2 . TRP A 1 233 ? 24.381 76.903  25.247 1.00 40.00 ? 236 TRP A CE2 1 
ATOM 1778 C CE3 . TRP A 1 233 ? 24.313 78.678  26.871 1.00 40.00 ? 236 TRP A CE3 1 
ATOM 1779 C CZ2 . TRP A 1 233 ? 23.657 77.647  24.316 1.00 40.00 ? 236 TRP A CZ2 1 
ATOM 1780 C CZ3 . TRP A 1 233 ? 23.586 79.415  25.957 1.00 40.00 ? 236 TRP A CZ3 1 
ATOM 1781 C CH2 . TRP A 1 233 ? 23.261 78.890  24.693 1.00 40.00 ? 236 TRP A CH2 1 
ATOM 1782 N N   . ALA A 1 234 ? 22.865 77.058  29.272 1.00 40.00 ? 237 ALA A N   1 
ATOM 1783 C CA  . ALA A 1 234 ? 21.961 78.189  29.246 1.00 40.00 ? 237 ALA A CA  1 
ATOM 1784 C C   . ALA A 1 234 ? 21.163 78.333  30.501 1.00 40.00 ? 237 ALA A C   1 
ATOM 1785 O O   . ALA A 1 234 ? 20.315 79.255  30.538 1.00 40.00 ? 237 ALA A O   1 
ATOM 1786 C CB  . ALA A 1 234 ? 21.171 78.200  27.964 1.00 40.00 ? 237 ALA A CB  1 
ATOM 1787 N N   . THR A 1 235 ? 21.345 77.546  31.558 1.00 40.00 ? 238 THR A N   1 
ATOM 1788 C CA  . THR A 1 235 ? 20.585 77.897  32.771 1.00 40.00 ? 238 THR A CA  1 
ATOM 1789 C C   . THR A 1 235 ? 21.421 77.413  33.964 1.00 40.00 ? 238 THR A C   1 
ATOM 1790 O O   . THR A 1 235 ? 22.264 76.555  33.765 1.00 40.00 ? 238 THR A O   1 
ATOM 1791 C CB  . THR A 1 235 ? 19.202 77.359  33.006 1.00 40.00 ? 238 THR A CB  1 
ATOM 1792 O OG1 . THR A 1 235 ? 19.231 75.899  32.977 1.00 40.00 ? 238 THR A OG1 1 
ATOM 1793 C CG2 . THR A 1 235 ? 18.154 77.873  32.055 1.00 40.00 ? 238 THR A CG2 1 
ATOM 1794 N N   . VAL A 1 236 ? 21.212 77.938  35.142 1.00 40.00 ? 239 VAL A N   1 
ATOM 1795 C CA  . VAL A 1 236 ? 21.908 77.513  36.347 1.00 40.00 ? 239 VAL A CA  1 
ATOM 1796 C C   . VAL A 1 236 ? 20.833 77.338  37.438 1.00 40.00 ? 239 VAL A C   1 
ATOM 1797 O O   . VAL A 1 236 ? 19.732 77.890  37.272 1.00 40.00 ? 239 VAL A O   1 
ATOM 1798 C CB  . VAL A 1 236 ? 22.853 78.616  36.860 1.00 40.00 ? 239 VAL A CB  1 
ATOM 1799 C CG1 . VAL A 1 236 ? 23.844 79.009  35.785 1.00 40.00 ? 239 VAL A CG1 1 
ATOM 1800 C CG2 . VAL A 1 236 ? 21.999 79.821  37.245 1.00 40.00 ? 239 VAL A CG2 1 
ATOM 1801 N N   . SER A 1 237 ? 21.111 76.668  38.521 1.00 40.00 ? 240 SER A N   1 
ATOM 1802 C CA  . SER A 1 237 ? 20.060 76.584  39.533 1.00 40.00 ? 240 SER A CA  1 
ATOM 1803 C C   . SER A 1 237 ? 20.156 77.844  40.391 1.00 40.00 ? 240 SER A C   1 
ATOM 1804 O O   . SER A 1 237 ? 21.099 78.595  40.277 1.00 40.00 ? 240 SER A O   1 
ATOM 1805 C CB  . SER A 1 237 ? 20.305 75.418  40.499 1.00 40.00 ? 240 SER A CB  1 
ATOM 1806 O OG  . SER A 1 237 ? 21.630 75.416  40.984 1.00 40.00 ? 240 SER A OG  1 
ATOM 1807 N N   . ALA A 1 238 ? 19.209 77.978  41.288 1.00 40.00 ? 241 ALA A N   1 
ATOM 1808 C CA  . ALA A 1 238 ? 19.155 79.072  42.241 1.00 40.00 ? 241 ALA A CA  1 
ATOM 1809 C C   . ALA A 1 238 ? 20.439 79.011  43.065 1.00 40.00 ? 241 ALA A C   1 
ATOM 1810 O O   . ALA A 1 238 ? 21.234 79.951  43.075 1.00 40.00 ? 241 ALA A O   1 
ATOM 1811 C CB  . ALA A 1 238 ? 17.969 78.886  43.168 1.00 40.00 ? 241 ALA A CB  1 
ATOM 1812 N N   . GLY A 1 239 ? 20.654 77.868  43.706 1.00 40.00 ? 242 GLY A N   1 
ATOM 1813 C CA  . GLY A 1 239 ? 21.844 77.672  44.527 1.00 40.00 ? 242 GLY A CA  1 
ATOM 1814 C C   . GLY A 1 239 ? 23.110 78.141  43.843 1.00 40.00 ? 242 GLY A C   1 
ATOM 1815 O O   . GLY A 1 239 ? 23.881 78.891  44.480 1.00 40.00 ? 242 GLY A O   1 
ATOM 1816 N N   . GLU A 1 240 ? 23.341 77.773  42.579 1.00 40.00 ? 243 GLU A N   1 
ATOM 1817 C CA  . GLU A 1 240 ? 24.592 78.211  41.968 1.00 40.00 ? 243 GLU A CA  1 
ATOM 1818 C C   . GLU A 1 240 ? 24.587 79.708  41.670 1.00 40.00 ? 243 GLU A C   1 
ATOM 1819 O O   . GLU A 1 240 ? 25.648 80.311  41.682 1.00 40.00 ? 243 GLU A O   1 
ATOM 1820 C CB  . GLU A 1 240 ? 24.830 77.561  40.608 1.00 40.00 ? 243 GLU A CB  1 
ATOM 1821 C CG  . GLU A 1 240 ? 25.955 76.602  40.644 1.00 40.00 ? 243 GLU A CG  1 
ATOM 1822 C CD  . GLU A 1 240 ? 27.327 77.189  40.652 1.00 40.00 ? 243 GLU A CD  1 
ATOM 1823 O OE1 . GLU A 1 240 ? 27.740 77.630  39.558 1.00 40.00 ? 243 GLU A OE1 1 
ATOM 1824 O OE2 . GLU A 1 240 ? 27.966 77.169  41.735 1.00 40.00 ? 243 GLU A OE2 1 
ATOM 1825 N N   . ALA A 1 241 ? 23.381 80.160  41.333 1.00 40.00 ? 244 ALA A N   1 
ATOM 1826 C CA  . ALA A 1 241 ? 23.209 81.566  41.015 1.00 40.00 ? 244 ALA A CA  1 
ATOM 1827 C C   . ALA A 1 241 ? 23.688 82.345  42.249 1.00 40.00 ? 244 ALA A C   1 
ATOM 1828 O O   . ALA A 1 241 ? 24.599 83.174  42.290 1.00 40.00 ? 244 ALA A O   1 
ATOM 1829 C CB  . ALA A 1 241 ? 21.730 81.812  40.772 1.00 40.00 ? 244 ALA A CB  1 
ATOM 1830 N N   . ARG A 1 242 ? 23.031 81.969  43.362 1.00 40.00 ? 245 ARG A N   1 
ATOM 1831 C CA  . ARG A 1 242 ? 23.415 82.641  44.594 1.00 40.00 ? 245 ARG A CA  1 
ATOM 1832 C C   . ARG A 1 242 ? 24.921 82.552  44.796 1.00 40.00 ? 245 ARG A C   1 
ATOM 1833 O O   . ARG A 1 242 ? 25.662 83.522  45.004 1.00 40.00 ? 245 ARG A O   1 
ATOM 1834 C CB  . ARG A 1 242 ? 22.679 81.977  45.735 1.00 40.00 ? 245 ARG A CB  1 
ATOM 1835 C CG  . ARG A 1 242 ? 23.084 82.460  47.107 1.00 40.00 ? 245 ARG A CG  1 
ATOM 1836 C CD  . ARG A 1 242 ? 21.905 82.272  48.058 1.00 40.00 ? 245 ARG A CD  1 
ATOM 1837 N NE  . ARG A 1 242 ? 22.130 82.915  49.354 1.00 40.00 ? 245 ARG A NE  1 
ATOM 1838 C CZ  . ARG A 1 242 ? 22.258 84.232  49.515 1.00 40.00 ? 245 ARG A CZ  1 
ATOM 1839 N NH1 . ARG A 1 242 ? 22.191 85.111  48.517 1.00 40.00 ? 245 ARG A NH1 1 
ATOM 1840 N NH2 . ARG A 1 242 ? 22.463 84.690  50.750 1.00 40.00 ? 245 ARG A NH2 1 
ATOM 1841 N N   . ARG A 1 243 ? 25.417 81.305  44.729 1.00 40.00 ? 246 ARG A N   1 
ATOM 1842 C CA  . ARG A 1 243 ? 26.845 81.093  44.952 1.00 40.00 ? 246 ARG A CA  1 
ATOM 1843 C C   . ARG A 1 243 ? 27.648 82.022  44.065 1.00 40.00 ? 246 ARG A C   1 
ATOM 1844 O O   . ARG A 1 243 ? 28.641 82.579  44.554 1.00 40.00 ? 246 ARG A O   1 
ATOM 1845 C CB  . ARG A 1 243 ? 27.192 79.638  44.769 1.00 40.00 ? 246 ARG A CB  1 
ATOM 1846 C CG  . ARG A 1 243 ? 28.583 79.161  45.042 1.00 40.00 ? 246 ARG A CG  1 
ATOM 1847 C CD  . ARG A 1 243 ? 29.184 78.278  43.933 1.00 40.00 ? 246 ARG A CD  1 
ATOM 1848 N NE  . ARG A 1 243 ? 30.468 78.858  43.575 1.00 40.00 ? 246 ARG A NE  1 
ATOM 1849 C CZ  . ARG A 1 243 ? 30.927 78.975  42.336 1.00 40.00 ? 246 ARG A CZ  1 
ATOM 1850 N NH1 . ARG A 1 243 ? 30.204 78.516  41.318 1.00 40.00 ? 246 ARG A NH1 1 
ATOM 1851 N NH2 . ARG A 1 243 ? 32.137 79.545  42.228 1.00 40.00 ? 246 ARG A NH2 1 
ATOM 1852 N N   . ARG A 1 244 ? 27.225 82.251  42.799 1.00 40.00 ? 247 ARG A N   1 
ATOM 1853 C CA  . ARG A 1 244 ? 28.092 83.141  42.023 1.00 40.00 ? 247 ARG A CA  1 
ATOM 1854 C C   . ARG A 1 244 ? 27.789 84.600  42.246 1.00 40.00 ? 247 ARG A C   1 
ATOM 1855 O O   . ARG A 1 244 ? 28.634 85.458  41.939 1.00 40.00 ? 247 ARG A O   1 
ATOM 1856 C CB  . ARG A 1 244 ? 28.238 82.817  40.568 1.00 40.00 ? 247 ARG A CB  1 
ATOM 1857 C CG  . ARG A 1 244 ? 28.244 81.329  40.225 1.00 40.00 ? 247 ARG A CG  1 
ATOM 1858 C CD  . ARG A 1 244 ? 27.378 81.093  38.981 1.00 40.00 ? 247 ARG A CD  1 
ATOM 1859 N NE  . ARG A 1 244 ? 27.691 79.850  38.397 1.00 40.00 ? 247 ARG A NE  1 
ATOM 1860 C CZ  . ARG A 1 244 ? 27.801 79.374  37.190 1.00 40.00 ? 247 ARG A CZ  1 
ATOM 1861 N NH1 . ARG A 1 244 ? 27.604 80.047  36.073 1.00 40.00 ? 247 ARG A NH1 1 
ATOM 1862 N NH2 . ARG A 1 244 ? 28.133 78.069  37.150 1.00 40.00 ? 247 ARG A NH2 1 
ATOM 1863 N N   . ALA A 1 245 ? 26.618 84.909  42.778 1.00 40.00 ? 248 ALA A N   1 
ATOM 1864 C CA  . ALA A 1 245 ? 26.296 86.334  43.015 1.00 40.00 ? 248 ALA A CA  1 
ATOM 1865 C C   . ALA A 1 245 ? 27.157 86.815  44.180 1.00 40.00 ? 248 ALA A C   1 
ATOM 1866 O O   . ALA A 1 245 ? 28.073 87.632  44.087 1.00 40.00 ? 248 ALA A O   1 
ATOM 1867 C CB  . ALA A 1 245 ? 24.819 86.438  43.355 1.00 40.00 ? 248 ALA A CB  1 
ATOM 1868 N N   . THR A 1 246 ? 26.873 86.224  45.345 1.00 40.00 ? 249 THR A N   1 
ATOM 1869 C CA  . THR A 1 246 ? 27.650 86.594  46.497 1.00 40.00 ? 249 THR A CA  1 
ATOM 1870 C C   . THR A 1 246 ? 29.146 86.459  46.198 1.00 40.00 ? 249 THR A C   1 
ATOM 1871 O O   . THR A 1 246 ? 29.987 87.330  46.527 1.00 40.00 ? 249 THR A O   1 
ATOM 1872 C CB  . THR A 1 246 ? 27.353 85.618  47.649 1.00 40.00 ? 249 THR A CB  1 
ATOM 1873 O OG1 . THR A 1 246 ? 28.037 84.448  47.221 1.00 40.00 ? 249 THR A OG1 1 
ATOM 1874 C CG2 . THR A 1 246 ? 25.918 85.320  47.913 1.00 40.00 ? 249 THR A CG2 1 
ATOM 1875 N N   . LEU A 1 247 ? 29.606 85.362  45.566 1.00 40.00 ? 250 LEU A N   1 
ATOM 1876 C CA  . LEU A 1 247 ? 31.070 85.333  45.359 1.00 40.00 ? 250 LEU A CA  1 
ATOM 1877 C C   . LEU A 1 247 ? 31.517 86.541  44.556 1.00 40.00 ? 250 LEU A C   1 
ATOM 1878 O O   . LEU A 1 247 ? 32.456 87.275  44.930 1.00 40.00 ? 250 LEU A O   1 
ATOM 1879 C CB  . LEU A 1 247 ? 31.544 84.004  44.816 1.00 40.00 ? 250 LEU A CB  1 
ATOM 1880 C CG  . LEU A 1 247 ? 32.935 84.044  44.164 1.00 40.00 ? 250 LEU A CG  1 
ATOM 1881 C CD1 . LEU A 1 247 ? 33.932 84.464  45.209 1.00 40.00 ? 250 LEU A CD1 1 
ATOM 1882 C CD2 . LEU A 1 247 ? 33.320 82.782  43.473 1.00 40.00 ? 250 LEU A CD2 1 
ATOM 1883 N N   . LEU A 1 248 ? 30.811 86.835  43.450 1.00 40.00 ? 251 LEU A N   1 
ATOM 1884 C CA  . LEU A 1 248 ? 31.162 88.034  42.709 1.00 40.00 ? 251 LEU A CA  1 
ATOM 1885 C C   . LEU A 1 248 ? 31.109 89.287  43.606 1.00 40.00 ? 251 LEU A C   1 
ATOM 1886 O O   . LEU A 1 248 ? 32.009 90.129  43.617 1.00 40.00 ? 251 LEU A O   1 
ATOM 1887 C CB  . LEU A 1 248 ? 30.224 88.309  41.519 1.00 40.00 ? 251 LEU A CB  1 
ATOM 1888 C CG  . LEU A 1 248 ? 30.798 89.621  40.864 1.00 40.00 ? 251 LEU A CG  1 
ATOM 1889 C CD1 . LEU A 1 248 ? 31.470 89.274  39.566 1.00 40.00 ? 251 LEU A CD1 1 
ATOM 1890 C CD2 . LEU A 1 248 ? 29.655 90.601  40.845 1.00 40.00 ? 251 LEU A CD2 1 
ATOM 1891 N N   . ALA A 1 249 ? 29.997 89.406  44.340 1.00 40.00 ? 252 ALA A N   1 
ATOM 1892 C CA  . ALA A 1 249 ? 29.889 90.559  45.236 1.00 40.00 ? 252 ALA A CA  1 
ATOM 1893 C C   . ALA A 1 249 ? 31.154 90.659  46.085 1.00 40.00 ? 252 ALA A C   1 
ATOM 1894 O O   . ALA A 1 249 ? 31.834 91.679  46.123 1.00 40.00 ? 252 ALA A O   1 
ATOM 1895 C CB  . ALA A 1 249 ? 28.676 90.445  46.130 1.00 40.00 ? 252 ALA A CB  1 
ATOM 1896 N N   . ARG A 1 250 ? 31.428 89.599  46.849 1.00 40.00 ? 253 ARG A N   1 
ATOM 1897 C CA  . ARG A 1 250 ? 32.587 89.539  47.744 1.00 40.00 ? 253 ARG A CA  1 
ATOM 1898 C C   . ARG A 1 250 ? 33.851 89.992  47.034 1.00 40.00 ? 253 ARG A C   1 
ATOM 1899 O O   . ARG A 1 250 ? 34.556 90.832  47.573 1.00 40.00 ? 253 ARG A O   1 
ATOM 1900 C CB  . ARG A 1 250 ? 32.832 88.130  48.222 1.00 40.00 ? 253 ARG A CB  1 
ATOM 1901 C CG  . ARG A 1 250 ? 33.273 87.811  49.604 1.00 40.00 ? 253 ARG A CG  1 
ATOM 1902 C CD  . ARG A 1 250 ? 33.445 86.321  49.804 1.00 40.00 ? 253 ARG A CD  1 
ATOM 1903 N NE  . ARG A 1 250 ? 32.216 85.585  50.068 1.00 40.00 ? 253 ARG A NE  1 
ATOM 1904 C CZ  . ARG A 1 250 ? 31.871 84.517  49.334 1.00 40.00 ? 253 ARG A CZ  1 
ATOM 1905 N NH1 . ARG A 1 250 ? 32.649 84.114  48.327 1.00 40.00 ? 253 ARG A NH1 1 
ATOM 1906 N NH2 . ARG A 1 250 ? 30.732 83.902  49.621 1.00 40.00 ? 253 ARG A NH2 1 
ATOM 1907 N N   . LEU A 1 251 ? 34.159 89.505  45.828 1.00 40.00 ? 254 LEU A N   1 
ATOM 1908 C CA  . LEU A 1 251 ? 35.369 89.999  45.176 1.00 40.00 ? 254 LEU A CA  1 
ATOM 1909 C C   . LEU A 1 251 ? 35.387 91.494  44.906 1.00 40.00 ? 254 LEU A C   1 
ATOM 1910 O O   . LEU A 1 251 ? 36.413 92.120  44.573 1.00 40.00 ? 254 LEU A O   1 
ATOM 1911 C CB  . LEU A 1 251 ? 35.519 89.338  43.778 1.00 40.00 ? 254 LEU A CB  1 
ATOM 1912 C CG  . LEU A 1 251 ? 35.816 87.843  43.934 1.00 40.00 ? 254 LEU A CG  1 
ATOM 1913 C CD1 . LEU A 1 251 ? 35.912 87.118  42.642 1.00 40.00 ? 254 LEU A CD1 1 
ATOM 1914 C CD2 . LEU A 1 251 ? 37.137 87.764  44.704 1.00 40.00 ? 254 LEU A CD2 1 
ATOM 1915 N N   . VAL A 1 252 ? 34.243 92.135  44.964 1.00 40.00 ? 255 VAL A N   1 
ATOM 1916 C CA  . VAL A 1 252 ? 34.101 93.541  44.622 1.00 40.00 ? 255 VAL A CA  1 
ATOM 1917 C C   . VAL A 1 252 ? 33.946 94.334  45.884 1.00 40.00 ? 255 VAL A C   1 
ATOM 1918 O O   . VAL A 1 252 ? 33.769 95.550  45.908 1.00 40.00 ? 255 VAL A O   1 
ATOM 1919 C CB  . VAL A 1 252 ? 32.930 93.598  43.624 1.00 40.00 ? 255 VAL A CB  1 
ATOM 1920 C CG1 . VAL A 1 252 ? 31.667 94.194  44.176 1.00 40.00 ? 255 VAL A CG1 1 
ATOM 1921 C CG2 . VAL A 1 252 ? 33.439 94.201  42.329 1.00 40.00 ? 255 VAL A CG2 1 
ATOM 1922 N N   . GLY A 1 253 ? 34.055 93.617  47.007 1.00 40.00 ? 256 GLY A N   1 
ATOM 1923 C CA  . GLY A 1 253 ? 34.008 94.285  48.298 1.00 40.00 ? 256 GLY A CA  1 
ATOM 1924 C C   . GLY A 1 253 ? 32.606 94.414  48.796 1.00 40.00 ? 256 GLY A C   1 
ATOM 1925 O O   . GLY A 1 253 ? 32.363 95.151  49.738 1.00 40.00 ? 256 GLY A O   1 
ATOM 1926 N N   . CYS A 1 254 ? 31.684 93.689  48.158 1.00 40.00 ? 257 CYS A N   1 
ATOM 1927 C CA  . CYS A 1 254 ? 30.313 93.736  48.643 1.00 40.00 ? 257 CYS A CA  1 
ATOM 1928 C C   . CYS A 1 254 ? 29.917 92.505  49.375 1.00 40.00 ? 257 CYS A C   1 
ATOM 1929 O O   . CYS A 1 254 ? 29.958 91.505  48.689 1.00 40.00 ? 257 CYS A O   1 
ATOM 1930 C CB  . CYS A 1 254 ? 29.361 94.092  47.507 1.00 40.00 ? 257 CYS A CB  1 
ATOM 1931 S SG  . CYS A 1 254 ? 29.517 95.870  47.144 1.00 40.00 ? 257 CYS A SG  1 
ATOM 1932 N N   . PRO A 1 255 ? 29.544 92.576  50.621 1.00 40.00 ? 258 PRO A N   1 
ATOM 1933 C CA  . PRO A 1 255 ? 29.613 93.682  51.543 1.00 40.00 ? 258 PRO A CA  1 
ATOM 1934 C C   . PRO A 1 255 ? 31.061 93.704  52.083 1.00 40.00 ? 258 PRO A C   1 
ATOM 1935 O O   . PRO A 1 255 ? 31.783 92.720  51.886 1.00 40.00 ? 258 PRO A O   1 
ATOM 1936 C CB  . PRO A 1 255 ? 28.674 93.340  52.687 1.00 40.00 ? 258 PRO A CB  1 
ATOM 1937 C CG  . PRO A 1 255 ? 28.975 91.874  52.842 1.00 40.00 ? 258 PRO A CG  1 
ATOM 1938 C CD  . PRO A 1 255 ? 29.118 91.415  51.422 1.00 40.00 ? 258 PRO A CD  1 
ATOM 1939 N N   . PRO A 1 256 ? 31.490 94.820  52.627 1.00 40.00 ? 259 PRO A N   1 
ATOM 1940 C CA  . PRO A 1 256 ? 32.861 94.983  53.150 1.00 40.00 ? 259 PRO A CA  1 
ATOM 1941 C C   . PRO A 1 256 ? 32.946 94.431  54.567 1.00 40.00 ? 259 PRO A C   1 
ATOM 1942 O O   . PRO A 1 256 ? 31.952 94.513  55.329 1.00 40.00 ? 259 PRO A O   1 
ATOM 1943 C CB  . PRO A 1 256 ? 33.067 96.486  53.096 1.00 40.00 ? 259 PRO A CB  1 
ATOM 1944 C CG  . PRO A 1 256 ? 31.712 97.033  53.386 1.00 40.00 ? 259 PRO A CG  1 
ATOM 1945 C CD  . PRO A 1 256 ? 30.703 96.054  52.840 1.00 40.00 ? 259 PRO A CD  1 
ATOM 1946 N N   . GLY A 1 257 ? 34.071 93.815  54.916 1.00 40.00 ? 260 GLY A N   1 
ATOM 1947 C CA  . GLY A 1 257 ? 34.155 93.245  56.254 1.00 40.00 ? 260 GLY A CA  1 
ATOM 1948 C C   . GLY A 1 257 ? 33.506 91.877  56.359 1.00 40.00 ? 260 GLY A C   1 
ATOM 1949 O O   . GLY A 1 257 ? 33.218 91.220  55.365 1.00 40.00 ? 260 GLY A O   1 
ATOM 1950 N N   . GLY A 1 258 ? 33.297 91.422  57.598 1.00 40.00 ? 261 GLY A N   1 
ATOM 1951 C CA  . GLY A 1 258 ? 32.701 90.137  57.919 1.00 40.00 ? 261 GLY A CA  1 
ATOM 1952 C C   . GLY A 1 258 ? 31.214 90.242  58.273 1.00 40.00 ? 261 GLY A C   1 
ATOM 1953 O O   . GLY A 1 258 ? 30.721 89.627  59.223 1.00 40.00 ? 261 GLY A O   1 
ATOM 1954 N N   . ALA A 1 259 ? 30.500 91.007  57.476 1.00 40.00 ? 262 ALA A N   1 
ATOM 1955 C CA  . ALA A 1 259 ? 29.115 91.383  57.521 1.00 40.00 ? 262 ALA A CA  1 
ATOM 1956 C C   . ALA A 1 259 ? 28.158 90.333  57.013 1.00 40.00 ? 262 ALA A C   1 
ATOM 1957 O O   . ALA A 1 259 ? 28.585 89.172  57.032 1.00 40.00 ? 262 ALA A O   1 
ATOM 1958 C CB  . ALA A 1 259 ? 28.971 92.654  56.652 1.00 40.00 ? 262 ALA A CB  1 
ATOM 1959 N N   . GLY A 1 260 ? 26.938 90.653  56.588 1.00 40.00 ? 263 GLY A N   1 
ATOM 1960 C CA  . GLY A 1 260 ? 26.170 89.549  56.084 1.00 40.00 ? 263 GLY A CA  1 
ATOM 1961 C C   . GLY A 1 260 ? 24.763 89.344  56.482 1.00 40.00 ? 263 GLY A C   1 
ATOM 1962 O O   . GLY A 1 260 ? 24.162 90.042  57.281 1.00 40.00 ? 263 GLY A O   1 
ATOM 1963 N N   . GLY A 1 261 ? 24.232 88.329  55.782 1.00 40.00 ? 264 GLY A N   1 
ATOM 1964 C CA  . GLY A 1 261 ? 22.855 87.956  55.973 1.00 40.00 ? 264 GLY A CA  1 
ATOM 1965 C C   . GLY A 1 261 ? 21.946 89.110  55.603 1.00 40.00 ? 264 GLY A C   1 
ATOM 1966 O O   . GLY A 1 261 ? 20.870 89.143  56.238 1.00 40.00 ? 264 GLY A O   1 
ATOM 1967 N N   . ASN A 1 262 ? 22.282 90.027  54.705 1.00 40.00 ? 265 ASN A N   1 
ATOM 1968 C CA  . ASN A 1 262 ? 21.276 91.028  54.319 1.00 40.00 ? 265 ASN A CA  1 
ATOM 1969 C C   . ASN A 1 262 ? 21.433 91.115  52.799 1.00 40.00 ? 265 ASN A C   1 
ATOM 1970 O O   . ASN A 1 262 ? 22.354 91.706  52.255 1.00 40.00 ? 265 ASN A O   1 
ATOM 1971 C CB  . ASN A 1 262 ? 21.092 92.295  55.058 1.00 40.00 ? 265 ASN A CB  1 
ATOM 1972 C CG  . ASN A 1 262 ? 19.739 92.963  54.830 1.00 40.00 ? 265 ASN A CG  1 
ATOM 1973 O OD1 . ASN A 1 262 ? 19.397 93.298  53.683 1.00 40.00 ? 265 ASN A OD1 1 
ATOM 1974 N ND2 . ASN A 1 262 ? 18.951 93.177  55.881 1.00 40.00 ? 265 ASN A ND2 1 
ATOM 1975 N N   . ASP A 1 263 ? 20.505 90.402  52.114 1.00 40.00 ? 266 ASP A N   1 
ATOM 1976 C CA  . ASP A 1 263 ? 20.682 90.374  50.642 1.00 40.00 ? 266 ASP A CA  1 
ATOM 1977 C C   . ASP A 1 263 ? 20.543 91.779  50.110 1.00 40.00 ? 266 ASP A C   1 
ATOM 1978 O O   . ASP A 1 263 ? 21.311 92.294  49.286 1.00 40.00 ? 266 ASP A O   1 
ATOM 1979 C CB  . ASP A 1 263 ? 19.891 89.264  50.016 1.00 40.00 ? 266 ASP A CB  1 
ATOM 1980 C CG  . ASP A 1 263 ? 20.302 87.849  50.428 1.00 40.00 ? 266 ASP A CG  1 
ATOM 1981 O OD1 . ASP A 1 263 ? 21.490 87.627  50.800 1.00 40.00 ? 266 ASP A OD1 1 
ATOM 1982 O OD2 . ASP A 1 263 ? 19.461 86.891  50.401 1.00 40.00 ? 266 ASP A OD2 1 
ATOM 1983 N N   . THR A 1 264 ? 19.591 92.505  50.704 1.00 40.00 ? 267 THR A N   1 
ATOM 1984 C CA  . THR A 1 264 ? 19.356 93.890  50.344 1.00 40.00 ? 267 THR A CA  1 
ATOM 1985 C C   . THR A 1 264 ? 20.580 94.787  50.476 1.00 40.00 ? 267 THR A C   1 
ATOM 1986 O O   . THR A 1 264 ? 20.915 95.533  49.561 1.00 40.00 ? 267 THR A O   1 
ATOM 1987 C CB  . THR A 1 264 ? 18.208 94.578  51.110 1.00 40.00 ? 267 THR A CB  1 
ATOM 1988 O OG1 . THR A 1 264 ? 17.166 93.636  51.399 1.00 40.00 ? 267 THR A OG1 1 
ATOM 1989 C CG2 . THR A 1 264 ? 17.672 95.688  50.204 1.00 40.00 ? 267 THR A CG2 1 
ATOM 1990 N N   . GLU A 1 265 ? 21.243 94.676  51.616 1.00 40.00 ? 268 GLU A N   1 
ATOM 1991 C CA  . GLU A 1 265 ? 22.470 95.482  51.789 1.00 40.00 ? 268 GLU A CA  1 
ATOM 1992 C C   . GLU A 1 265 ? 23.475 95.084  50.718 1.00 40.00 ? 268 GLU A C   1 
ATOM 1993 O O   . GLU A 1 265 ? 24.118 95.917  50.119 1.00 40.00 ? 268 GLU A O   1 
ATOM 1994 C CB  . GLU A 1 265 ? 23.036 95.241  53.175 1.00 40.00 ? 268 GLU A CB  1 
ATOM 1995 C CG  . GLU A 1 265 ? 22.013 95.619  54.261 1.00 40.00 ? 268 GLU A CG  1 
ATOM 1996 C CD  . GLU A 1 265 ? 22.674 95.591  55.629 1.00 40.00 ? 268 GLU A CD  1 
ATOM 1997 O OE1 . GLU A 1 265 ? 22.014 95.236  56.633 1.00 40.00 ? 268 GLU A OE1 1 
ATOM 1998 O OE2 . GLU A 1 265 ? 23.882 95.930  55.689 1.00 40.00 ? 268 GLU A OE2 1 
ATOM 1999 N N   . LEU A 1 266 ? 23.519 93.769  50.465 1.00 40.00 ? 269 LEU A N   1 
ATOM 2000 C CA  . LEU A 1 266 ? 24.432 93.190  49.490 1.00 40.00 ? 269 LEU A CA  1 
ATOM 2001 C C   . LEU A 1 266 ? 24.195 93.782  48.116 1.00 40.00 ? 269 LEU A C   1 
ATOM 2002 O O   . LEU A 1 266 ? 25.108 94.285  47.449 1.00 40.00 ? 269 LEU A O   1 
ATOM 2003 C CB  . LEU A 1 266 ? 24.285 91.684  49.486 1.00 40.00 ? 269 LEU A CB  1 
ATOM 2004 C CG  . LEU A 1 266 ? 25.427 90.782  49.019 1.00 40.00 ? 269 LEU A CG  1 
ATOM 2005 C CD1 . LEU A 1 266 ? 24.962 89.314  49.117 1.00 40.00 ? 269 LEU A CD1 1 
ATOM 2006 C CD2 . LEU A 1 266 ? 25.840 91.052  47.580 1.00 40.00 ? 269 LEU A CD2 1 
ATOM 2007 N N   . ILE A 1 267 ? 22.912 93.718  47.720 1.00 40.00 ? 270 ILE A N   1 
ATOM 2008 C CA  . ILE A 1 267 ? 22.618 94.302  46.398 1.00 40.00 ? 270 ILE A CA  1 
ATOM 2009 C C   . ILE A 1 267 ? 22.834 95.831  46.421 1.00 40.00 ? 270 ILE A C   1 
ATOM 2010 O O   . ILE A 1 267 ? 23.366 96.480  45.497 1.00 40.00 ? 270 ILE A O   1 
ATOM 2011 C CB  . ILE A 1 267 ? 21.208 93.972  45.911 1.00 40.00 ? 270 ILE A CB  1 
ATOM 2012 C CG1 . ILE A 1 267 ? 20.666 92.635  46.385 1.00 40.00 ? 270 ILE A CG1 1 
ATOM 2013 C CG2 . ILE A 1 267 ? 21.175 94.127  44.391 1.00 40.00 ? 270 ILE A CG2 1 
ATOM 2014 C CD1 . ILE A 1 267 ? 20.854 91.435  45.489 1.00 40.00 ? 270 ILE A CD1 1 
ATOM 2015 N N   . ALA A 1 268 ? 22.449 96.452  47.555 1.00 40.00 ? 271 ALA A N   1 
ATOM 2016 C CA  . ALA A 1 268 ? 22.593 97.909  47.663 1.00 40.00 ? 271 ALA A CA  1 
ATOM 2017 C C   . ALA A 1 268 ? 24.045 98.279  47.409 1.00 40.00 ? 271 ALA A C   1 
ATOM 2018 O O   . ALA A 1 268 ? 24.385 99.142  46.613 1.00 40.00 ? 271 ALA A O   1 
ATOM 2019 C CB  . ALA A 1 268 ? 22.125 98.430  48.993 1.00 40.00 ? 271 ALA A CB  1 
ATOM 2020 N N   . CYS A 1 269 ? 24.897 97.539  48.121 1.00 40.00 ? 272 CYS A N   1 
ATOM 2021 C CA  . CYS A 1 269 ? 26.338 97.712  47.975 1.00 40.00 ? 272 CYS A CA  1 
ATOM 2022 C C   . CYS A 1 269 ? 26.740 97.501  46.520 1.00 40.00 ? 272 CYS A C   1 
ATOM 2023 O O   . CYS A 1 269 ? 27.496 98.294  45.958 1.00 40.00 ? 272 CYS A O   1 
ATOM 2024 C CB  . CYS A 1 269 ? 27.029 96.679  48.855 1.00 40.00 ? 272 CYS A CB  1 
ATOM 2025 S SG  . CYS A 1 269 ? 28.771 96.697  48.818 1.00 40.00 ? 272 CYS A SG  1 
ATOM 2026 N N   . LEU A 1 270 ? 26.272 96.395  45.904 1.00 40.00 ? 273 LEU A N   1 
ATOM 2027 C CA  . LEU A 1 270 ? 26.635 96.080  44.525 1.00 40.00 ? 273 LEU A CA  1 
ATOM 2028 C C   . LEU A 1 270 ? 26.216 97.172  43.548 1.00 40.00 ? 273 LEU A C   1 
ATOM 2029 O O   . LEU A 1 270 ? 26.856 97.502  42.540 1.00 40.00 ? 273 LEU A O   1 
ATOM 2030 C CB  . LEU A 1 270 ? 25.950 94.778  44.103 1.00 40.00 ? 273 LEU A CB  1 
ATOM 2031 C CG  . LEU A 1 270 ? 26.821 93.519  44.205 1.00 40.00 ? 273 LEU A CG  1 
ATOM 2032 C CD1 . LEU A 1 270 ? 25.924 92.290  44.201 1.00 40.00 ? 273 LEU A CD1 1 
ATOM 2033 C CD2 . LEU A 1 270 ? 27.865 93.443  43.109 1.00 40.00 ? 273 LEU A CD2 1 
ATOM 2034 N N   . ARG A 1 271 ? 25.073 97.771  43.903 1.00 40.00 ? 274 ARG A N   1 
ATOM 2035 C CA  . ARG A 1 271 ? 24.497 98.825  43.089 1.00 40.00 ? 274 ARG A CA  1 
ATOM 2036 C C   . ARG A 1 271 ? 25.355 100.075 43.051 1.00 40.00 ? 274 ARG A C   1 
ATOM 2037 O O   . ARG A 1 271 ? 25.105 100.942 42.209 1.00 40.00 ? 274 ARG A O   1 
ATOM 2038 C CB  . ARG A 1 271 ? 23.067 99.103  43.541 1.00 40.00 ? 274 ARG A CB  1 
ATOM 2039 C CG  . ARG A 1 271 ? 22.098 99.093  42.394 1.00 40.00 ? 274 ARG A CG  1 
ATOM 2040 C CD  . ARG A 1 271 ? 20.662 99.235  42.716 1.00 40.00 ? 274 ARG A CD  1 
ATOM 2041 N NE  . ARG A 1 271 ? 20.111 98.767  43.939 1.00 40.00 ? 274 ARG A NE  1 
ATOM 2042 C CZ  . ARG A 1 271 ? 19.275 97.721  44.014 1.00 40.00 ? 274 ARG A CZ  1 
ATOM 2043 N NH1 . ARG A 1 271 ? 18.892 97.002  42.965 1.00 40.00 ? 274 ARG A NH1 1 
ATOM 2044 N NH2 . ARG A 1 271 ? 18.849 97.441  45.254 1.00 40.00 ? 274 ARG A NH2 1 
ATOM 2045 N N   . THR A 1 272 ? 26.389 100.211 43.872 1.00 40.00 ? 275 THR A N   1 
ATOM 2046 C CA  . THR A 1 272 ? 27.240 101.377 43.846 1.00 40.00 ? 275 THR A CA  1 
ATOM 2047 C C   . THR A 1 272 ? 28.534 101.169 43.065 1.00 40.00 ? 275 THR A C   1 
ATOM 2048 O O   . THR A 1 272 ? 29.303 102.100 42.804 1.00 40.00 ? 275 THR A O   1 
ATOM 2049 C CB  . THR A 1 272 ? 27.719 101.792 45.266 1.00 40.00 ? 275 THR A CB  1 
ATOM 2050 O OG1 . THR A 1 272 ? 28.954 101.073 45.446 1.00 40.00 ? 275 THR A OG1 1 
ATOM 2051 C CG2 . THR A 1 272 ? 26.776 101.454 46.386 1.00 40.00 ? 275 THR A CG2 1 
ATOM 2052 N N   . ARG A 1 273 ? 28.879 99.923  42.767 1.00 40.00 ? 276 ARG A N   1 
ATOM 2053 C CA  . ARG A 1 273 ? 30.153 99.679  42.077 1.00 40.00 ? 276 ARG A CA  1 
ATOM 2054 C C   . ARG A 1 273 ? 30.088 100.042 40.613 1.00 40.00 ? 276 ARG A C   1 
ATOM 2055 O O   . ARG A 1 273 ? 29.126 99.746  39.874 1.00 40.00 ? 276 ARG A O   1 
ATOM 2056 C CB  . ARG A 1 273 ? 30.524 98.194  42.213 1.00 40.00 ? 276 ARG A CB  1 
ATOM 2057 C CG  . ARG A 1 273 ? 30.322 97.719  43.668 1.00 40.00 ? 276 ARG A CG  1 
ATOM 2058 C CD  . ARG A 1 273 ? 31.707 97.691  44.318 1.00 40.00 ? 276 ARG A CD  1 
ATOM 2059 N NE  . ARG A 1 273 ? 31.730 97.530  45.755 1.00 40.00 ? 276 ARG A NE  1 
ATOM 2060 C CZ  . ARG A 1 273 ? 31.898 98.521  46.622 1.00 40.00 ? 276 ARG A CZ  1 
ATOM 2061 N NH1 . ARG A 1 273 ? 32.037 99.762  46.153 1.00 40.00 ? 276 ARG A NH1 1 
ATOM 2062 N NH2 . ARG A 1 273 ? 31.911 98.285  47.926 1.00 40.00 ? 276 ARG A NH2 1 
ATOM 2063 N N   . PRO A 1 274 ? 31.150 100.693 40.161 1.00 40.00 ? 277 PRO A N   1 
ATOM 2064 C CA  . PRO A 1 274 ? 31.255 101.052 38.743 1.00 40.00 ? 277 PRO A CA  1 
ATOM 2065 C C   . PRO A 1 274 ? 30.933 99.821  37.899 1.00 40.00 ? 277 PRO A C   1 
ATOM 2066 O O   . PRO A 1 274 ? 31.448 98.723  38.192 1.00 40.00 ? 277 PRO A O   1 
ATOM 2067 C CB  . PRO A 1 274 ? 32.759 101.374 38.587 1.00 40.00 ? 277 PRO A CB  1 
ATOM 2068 C CG  . PRO A 1 274 ? 33.419 101.321 39.906 1.00 40.00 ? 277 PRO A CG  1 
ATOM 2069 C CD  . PRO A 1 274 ? 32.360 101.037 40.927 1.00 40.00 ? 277 PRO A CD  1 
ATOM 2070 N N   . ALA A 1 275 ? 30.170 99.952  36.824 1.00 40.00 ? 278 ALA A N   1 
ATOM 2071 C CA  . ALA A 1 275 ? 29.861 98.811  35.968 1.00 40.00 ? 278 ALA A CA  1 
ATOM 2072 C C   . ALA A 1 275 ? 31.089 97.958  35.693 1.00 40.00 ? 278 ALA A C   1 
ATOM 2073 O O   . ALA A 1 275 ? 31.051 96.731  35.918 1.00 40.00 ? 278 ALA A O   1 
ATOM 2074 C CB  . ALA A 1 275 ? 29.249 99.252  34.650 1.00 40.00 ? 278 ALA A CB  1 
ATOM 2075 N N   . GLN A 1 276 ? 32.189 98.541  35.229 1.00 40.00 ? 279 GLN A N   1 
ATOM 2076 C CA  . GLN A 1 276 ? 33.360 97.734  34.912 1.00 40.00 ? 279 GLN A CA  1 
ATOM 2077 C C   . GLN A 1 276 ? 33.953 96.938  36.057 1.00 40.00 ? 279 GLN A C   1 
ATOM 2078 O O   . GLN A 1 276 ? 34.720 95.979  35.860 1.00 40.00 ? 279 GLN A O   1 
ATOM 2079 C CB  . GLN A 1 276 ? 34.461 98.641  34.359 1.00 40.00 ? 279 GLN A CB  1 
ATOM 2080 C CG  . GLN A 1 276 ? 35.722 97.885  33.982 1.00 40.00 ? 279 GLN A CG  1 
ATOM 2081 C CD  . GLN A 1 276 ? 35.431 96.982  32.797 1.00 40.00 ? 279 GLN A CD  1 
ATOM 2082 O OE1 . GLN A 1 276 ? 34.546 97.297  31.985 1.00 40.00 ? 279 GLN A OE1 1 
ATOM 2083 N NE2 . GLN A 1 276 ? 36.170 95.883  32.794 1.00 40.00 ? 279 GLN A NE2 1 
ATOM 2084 N N   . ASP A 1 277 ? 33.646 97.344  37.297 1.00 40.00 ? 280 ASP A N   1 
ATOM 2085 C CA  . ASP A 1 277 ? 34.181 96.589  38.448 1.00 40.00 ? 280 ASP A CA  1 
ATOM 2086 C C   . ASP A 1 277 ? 33.535 95.187  38.375 1.00 40.00 ? 280 ASP A C   1 
ATOM 2087 O O   . ASP A 1 277 ? 34.220 94.209  38.617 1.00 40.00 ? 280 ASP A O   1 
ATOM 2088 C CB  . ASP A 1 277 ? 33.768 97.126  39.801 1.00 40.00 ? 280 ASP A CB  1 
ATOM 2089 C CG  . ASP A 1 277 ? 34.688 98.217  40.288 1.00 40.00 ? 280 ASP A CG  1 
ATOM 2090 O OD1 . ASP A 1 277 ? 35.244 98.908  39.399 1.00 40.00 ? 280 ASP A OD1 1 
ATOM 2091 O OD2 . ASP A 1 277 ? 34.784 98.315  41.542 1.00 40.00 ? 280 ASP A OD2 1 
ATOM 2092 N N   . LEU A 1 278 ? 32.232 95.155  38.084 1.00 40.00 ? 281 LEU A N   1 
ATOM 2093 C CA  . LEU A 1 278 ? 31.556 93.855  37.988 1.00 40.00 ? 281 LEU A CA  1 
ATOM 2094 C C   . LEU A 1 278 ? 32.088 93.029  36.843 1.00 40.00 ? 281 LEU A C   1 
ATOM 2095 O O   . LEU A 1 278 ? 32.511 91.886  36.975 1.00 40.00 ? 281 LEU A O   1 
ATOM 2096 C CB  . LEU A 1 278 ? 30.059 93.970  37.760 1.00 40.00 ? 281 LEU A CB  1 
ATOM 2097 C CG  . LEU A 1 278 ? 29.195 94.317  38.979 1.00 40.00 ? 281 LEU A CG  1 
ATOM 2098 C CD1 . LEU A 1 278 ? 29.943 94.159  40.282 1.00 40.00 ? 281 LEU A CD1 1 
ATOM 2099 C CD2 . LEU A 1 278 ? 28.594 95.687  38.801 1.00 40.00 ? 281 LEU A CD2 1 
ATOM 2100 N N   . VAL A 1 279 ? 32.125 93.639  35.673 1.00 40.00 ? 282 VAL A N   1 
ATOM 2101 C CA  . VAL A 1 279 ? 32.644 92.926  34.486 1.00 40.00 ? 282 VAL A CA  1 
ATOM 2102 C C   . VAL A 1 279 ? 34.029 92.386  34.806 1.00 40.00 ? 282 VAL A C   1 
ATOM 2103 O O   . VAL A 1 279 ? 34.415 91.334  34.314 1.00 40.00 ? 282 VAL A O   1 
ATOM 2104 C CB  . VAL A 1 279 ? 32.790 93.916  33.312 1.00 40.00 ? 282 VAL A CB  1 
ATOM 2105 C CG1 . VAL A 1 279 ? 33.511 93.273  32.165 1.00 40.00 ? 282 VAL A CG1 1 
ATOM 2106 C CG2 . VAL A 1 279 ? 31.441 94.503  32.938 1.00 40.00 ? 282 VAL A CG2 1 
ATOM 2107 N N   . ASP A 1 280 ? 34.792 93.134  35.619 1.00 40.00 ? 283 ASP A N   1 
ATOM 2108 C CA  . ASP A 1 280 ? 36.128 92.662  35.943 1.00 40.00 ? 283 ASP A CA  1 
ATOM 2109 C C   . ASP A 1 280 ? 36.104 91.317  36.628 1.00 40.00 ? 283 ASP A C   1 
ATOM 2110 O O   . ASP A 1 280 ? 37.031 90.521  36.399 1.00 40.00 ? 283 ASP A O   1 
ATOM 2111 C CB  . ASP A 1 280 ? 36.866 93.698  36.764 1.00 40.00 ? 283 ASP A CB  1 
ATOM 2112 C CG  . ASP A 1 280 ? 37.515 94.759  35.901 1.00 40.00 ? 283 ASP A CG  1 
ATOM 2113 O OD1 . ASP A 1 280 ? 37.938 94.437  34.785 1.00 40.00 ? 283 ASP A OD1 1 
ATOM 2114 O OD2 . ASP A 1 280 ? 37.624 95.921  36.350 1.00 40.00 ? 283 ASP A OD2 1 
ATOM 2115 N N   . HIS A 1 281 ? 35.105 91.013  37.464 1.00 40.00 ? 284 HIS A N   1 
ATOM 2116 C CA  . HIS A 1 281 ? 35.191 89.708  38.133 1.00 40.00 ? 284 HIS A CA  1 
ATOM 2117 C C   . HIS A 1 281 ? 34.271 88.671  37.582 1.00 40.00 ? 284 HIS A C   1 
ATOM 2118 O O   . HIS A 1 281 ? 34.210 87.578  38.151 1.00 40.00 ? 284 HIS A O   1 
ATOM 2119 C CB  . HIS A 1 281 ? 34.926 89.933  39.631 1.00 40.00 ? 284 HIS A CB  1 
ATOM 2120 C CG  . HIS A 1 281 ? 36.182 90.509  40.252 1.00 40.00 ? 284 HIS A CG  1 
ATOM 2121 N ND1 . HIS A 1 281 ? 37.319 89.746  40.412 1.00 40.00 ? 284 HIS A ND1 1 
ATOM 2122 C CD2 . HIS A 1 281 ? 36.474 91.738  40.707 1.00 40.00 ? 284 HIS A CD2 1 
ATOM 2123 C CE1 . HIS A 1 281 ? 38.255 90.484  40.965 1.00 40.00 ? 284 HIS A CE1 1 
ATOM 2124 N NE2 . HIS A 1 281 ? 37.770 91.688  41.157 1.00 40.00 ? 284 HIS A NE2 1 
ATOM 2125 N N   . GLU A 1 282 ? 33.526 89.029  36.533 1.00 40.00 ? 285 GLU A N   1 
ATOM 2126 C CA  . GLU A 1 282 ? 32.582 88.161  35.869 1.00 40.00 ? 285 GLU A CA  1 
ATOM 2127 C C   . GLU A 1 282 ? 33.060 86.721  35.721 1.00 40.00 ? 285 GLU A C   1 
ATOM 2128 O O   . GLU A 1 282 ? 32.405 85.784  36.140 1.00 40.00 ? 285 GLU A O   1 
ATOM 2129 C CB  . GLU A 1 282 ? 32.327 88.643  34.412 1.00 40.00 ? 285 GLU A CB  1 
ATOM 2130 C CG  . GLU A 1 282 ? 30.851 88.592  34.100 1.00 40.00 ? 285 GLU A CG  1 
ATOM 2131 C CD  . GLU A 1 282 ? 30.518 88.818  32.655 1.00 40.00 ? 285 GLU A CD  1 
ATOM 2132 O OE1 . GLU A 1 282 ? 29.542 88.123  32.255 1.00 40.00 ? 285 GLU A OE1 1 
ATOM 2133 O OE2 . GLU A 1 282 ? 31.170 89.623  31.968 1.00 40.00 ? 285 GLU A OE2 1 
ATOM 2134 N N   . TRP A 1 283 ? 34.220 86.595  35.079 1.00 40.00 ? 286 TRP A N   1 
ATOM 2135 C CA  . TRP A 1 283 ? 34.792 85.296  34.820 1.00 40.00 ? 286 TRP A CA  1 
ATOM 2136 C C   . TRP A 1 283 ? 35.421 84.596  35.992 1.00 40.00 ? 286 TRP A C   1 
ATOM 2137 O O   . TRP A 1 283 ? 35.903 83.471  35.769 1.00 40.00 ? 286 TRP A O   1 
ATOM 2138 C CB  . TRP A 1 283 ? 35.791 85.368  33.653 1.00 40.00 ? 286 TRP A CB  1 
ATOM 2139 C CG  . TRP A 1 283 ? 35.054 85.859  32.444 1.00 40.00 ? 286 TRP A CG  1 
ATOM 2140 C CD1 . TRP A 1 283 ? 35.231 87.028  31.783 1.00 40.00 ? 286 TRP A CD1 1 
ATOM 2141 C CD2 . TRP A 1 283 ? 33.982 85.177  31.779 1.00 40.00 ? 286 TRP A CD2 1 
ATOM 2142 N NE1 . TRP A 1 283 ? 34.352 87.128  30.732 1.00 40.00 ? 286 TRP A NE1 1 
ATOM 2143 C CE2 . TRP A 1 283 ? 33.568 86.003  30.714 1.00 40.00 ? 286 TRP A CE2 1 
ATOM 2144 C CE3 . TRP A 1 283 ? 33.341 83.961  31.989 1.00 40.00 ? 286 TRP A CE3 1 
ATOM 2145 C CZ2 . TRP A 1 283 ? 32.545 85.648  29.846 1.00 40.00 ? 286 TRP A CZ2 1 
ATOM 2146 C CZ3 . TRP A 1 283 ? 32.320 83.610  31.130 1.00 40.00 ? 286 TRP A CZ3 1 
ATOM 2147 C CH2 . TRP A 1 283 ? 31.932 84.448  30.073 1.00 40.00 ? 286 TRP A CH2 1 
ATOM 2148 N N   . HIS A 1 284 ? 35.441 85.118  37.197 1.00 40.00 ? 287 HIS A N   1 
ATOM 2149 C CA  . HIS A 1 284 ? 36.028 84.398  38.312 1.00 40.00 ? 287 HIS A CA  1 
ATOM 2150 C C   . HIS A 1 284 ? 35.002 83.656  39.123 1.00 40.00 ? 287 HIS A C   1 
ATOM 2151 O O   . HIS A 1 284 ? 35.287 83.267  40.272 1.00 40.00 ? 287 HIS A O   1 
ATOM 2152 C CB  . HIS A 1 284 ? 36.741 85.423  39.212 1.00 40.00 ? 287 HIS A CB  1 
ATOM 2153 C CG  . HIS A 1 284 ? 37.811 86.158  38.456 1.00 40.00 ? 287 HIS A CG  1 
ATOM 2154 N ND1 . HIS A 1 284 ? 38.453 87.246  39.003 1.00 40.00 ? 287 HIS A ND1 1 
ATOM 2155 C CD2 . HIS A 1 284 ? 38.337 85.961  37.224 1.00 40.00 ? 287 HIS A CD2 1 
ATOM 2156 C CE1 . HIS A 1 284 ? 39.327 87.691  38.110 1.00 40.00 ? 287 HIS A CE1 1 
ATOM 2157 N NE2 . HIS A 1 284 ? 39.280 86.922  37.019 1.00 40.00 ? 287 HIS A NE2 1 
ATOM 2158 N N   . VAL A 1 285 ? 33.770 83.459  38.660 1.00 40.00 ? 288 VAL A N   1 
ATOM 2159 C CA  . VAL A 1 285 ? 32.867 82.760  39.596 1.00 40.00 ? 288 VAL A CA  1 
ATOM 2160 C C   . VAL A 1 285 ? 32.505 81.396  39.063 1.00 40.00 ? 288 VAL A C   1 
ATOM 2161 O O   . VAL A 1 285 ? 31.763 80.650  39.705 1.00 40.00 ? 288 VAL A O   1 
ATOM 2162 C CB  . VAL A 1 285 ? 31.670 83.613  39.986 1.00 40.00 ? 288 VAL A CB  1 
ATOM 2163 C CG1 . VAL A 1 285 ? 32.128 84.815  40.790 1.00 40.00 ? 288 VAL A CG1 1 
ATOM 2164 C CG2 . VAL A 1 285 ? 30.839 84.064  38.800 1.00 40.00 ? 288 VAL A CG2 1 
ATOM 2165 N N   . LEU A 1 286 ? 33.051 81.070  37.878 1.00 40.00 ? 289 LEU A N   1 
ATOM 2166 C CA  . LEU A 1 286 ? 32.747 79.717  37.331 1.00 40.00 ? 289 LEU A CA  1 
ATOM 2167 C C   . LEU A 1 286 ? 33.350 78.715  38.285 1.00 40.00 ? 289 LEU A C   1 
ATOM 2168 O O   . LEU A 1 286 ? 34.364 79.055  38.898 1.00 40.00 ? 289 LEU A O   1 
ATOM 2169 C CB  . LEU A 1 286 ? 33.231 79.572  35.902 1.00 40.00 ? 289 LEU A CB  1 
ATOM 2170 C CG  . LEU A 1 286 ? 32.330 80.315  34.881 1.00 40.00 ? 289 LEU A CG  1 
ATOM 2171 C CD1 . LEU A 1 286 ? 32.861 80.147  33.467 1.00 40.00 ? 289 LEU A CD1 1 
ATOM 2172 C CD2 . LEU A 1 286 ? 30.883 79.856  35.002 1.00 40.00 ? 289 LEU A CD2 1 
ATOM 2173 N N   . PRO A 1 287 ? 32.767 77.560  38.479 1.00 40.00 ? 290 PRO A N   1 
ATOM 2174 C CA  . PRO A 1 287 ? 33.271 76.607  39.451 1.00 40.00 ? 290 PRO A CA  1 
ATOM 2175 C C   . PRO A 1 287 ? 34.376 75.715  38.982 1.00 40.00 ? 290 PRO A C   1 
ATOM 2176 O O   . PRO A 1 287 ? 34.963 75.044  39.841 1.00 40.00 ? 290 PRO A O   1 
ATOM 2177 C CB  . PRO A 1 287 ? 32.021 75.855  39.877 1.00 40.00 ? 290 PRO A CB  1 
ATOM 2178 C CG  . PRO A 1 287 ? 31.065 75.976  38.751 1.00 40.00 ? 290 PRO A CG  1 
ATOM 2179 C CD  . PRO A 1 287 ? 31.549 77.060  37.830 1.00 40.00 ? 290 PRO A CD  1 
ATOM 2180 N N   . GLN A 1 288 ? 34.683 75.637  37.700 1.00 40.00 ? 291 GLN A N   1 
ATOM 2181 C CA  . GLN A 1 288 ? 35.739 74.810  37.165 1.00 40.00 ? 291 GLN A CA  1 
ATOM 2182 C C   . GLN A 1 288 ? 36.371 75.449  35.932 1.00 40.00 ? 291 GLN A C   1 
ATOM 2183 O O   . GLN A 1 288 ? 35.762 76.326  35.308 1.00 40.00 ? 291 GLN A O   1 
ATOM 2184 C CB  . GLN A 1 288 ? 35.186 73.481  36.624 1.00 40.00 ? 291 GLN A CB  1 
ATOM 2185 C CG  . GLN A 1 288 ? 34.335 72.658  37.543 1.00 40.00 ? 291 GLN A CG  1 
ATOM 2186 C CD  . GLN A 1 288 ? 32.860 72.861  37.314 1.00 40.00 ? 291 GLN A CD  1 
ATOM 2187 O OE1 . GLN A 1 288 ? 32.044 72.330  38.069 1.00 40.00 ? 291 GLN A OE1 1 
ATOM 2188 N NE2 . GLN A 1 288 ? 32.490 73.629  36.290 1.00 40.00 ? 291 GLN A NE2 1 
ATOM 2189 N N   . GLU A 1 289 ? 37.537 74.945  35.545 1.00 40.00 ? 292 GLU A N   1 
ATOM 2190 C CA  . GLU A 1 289 ? 38.123 75.484  34.300 1.00 40.00 ? 292 GLU A CA  1 
ATOM 2191 C C   . GLU A 1 289 ? 37.224 74.986  33.161 1.00 40.00 ? 292 GLU A C   1 
ATOM 2192 O O   . GLU A 1 289 ? 36.762 73.853  33.307 1.00 40.00 ? 292 GLU A O   1 
ATOM 2193 C CB  . GLU A 1 289 ? 39.557 75.109  34.135 1.00 40.00 ? 292 GLU A CB  1 
ATOM 2194 C CG  . GLU A 1 289 ? 40.172 75.724  32.908 1.00 40.00 ? 292 GLU A CG  1 
ATOM 2195 C CD  . GLU A 1 289 ? 41.489 75.130  32.487 1.00 40.00 ? 292 GLU A CD  1 
ATOM 2196 O OE1 . GLU A 1 289 ? 42.046 74.281  33.224 1.00 40.00 ? 292 GLU A OE1 1 
ATOM 2197 O OE2 . GLU A 1 289 ? 41.949 75.541  31.382 1.00 40.00 ? 292 GLU A OE2 1 
ATOM 2198 N N   . SER A 1 290 ? 36.902 75.783  32.145 1.00 40.00 ? 293 SER A N   1 
ATOM 2199 C CA  . SER A 1 290 ? 35.961 75.271  31.162 1.00 40.00 ? 293 SER A CA  1 
ATOM 2200 C C   . SER A 1 290 ? 35.799 76.134  29.930 1.00 40.00 ? 293 SER A C   1 
ATOM 2201 O O   . SER A 1 290 ? 36.444 77.154  29.785 1.00 40.00 ? 293 SER A O   1 
ATOM 2202 C CB  . SER A 1 290 ? 34.585 75.196  31.887 1.00 40.00 ? 293 SER A CB  1 
ATOM 2203 O OG  . SER A 1 290 ? 34.331 76.447  32.493 1.00 40.00 ? 293 SER A OG  1 
ATOM 2204 N N   . ILE A 1 291 ? 34.960 75.686  29.009 1.00 40.00 ? 294 ILE A N   1 
ATOM 2205 C CA  . ILE A 1 291 ? 34.619 76.387  27.791 1.00 40.00 ? 294 ILE A CA  1 
ATOM 2206 C C   . ILE A 1 291 ? 33.126 76.199  27.552 1.00 40.00 ? 294 ILE A C   1 
ATOM 2207 O O   . ILE A 1 291 ? 32.511 75.282  28.097 1.00 40.00 ? 294 ILE A O   1 
ATOM 2208 C CB  . ILE A 1 291 ? 35.415 75.984  26.572 1.00 40.00 ? 294 ILE A CB  1 
ATOM 2209 C CG1 . ILE A 1 291 ? 35.718 74.480  26.565 1.00 40.00 ? 294 ILE A CG1 1 
ATOM 2210 C CG2 . ILE A 1 291 ? 36.728 76.774  26.522 1.00 40.00 ? 294 ILE A CG2 1 
ATOM 2211 C CD1 . ILE A 1 291 ? 36.178 74.056  25.173 1.00 40.00 ? 294 ILE A CD1 1 
ATOM 2212 N N   . PHE A 1 292 ? 32.497 77.114  26.841 1.00 40.00 ? 295 PHE A N   1 
ATOM 2213 C CA  . PHE A 1 292 ? 31.059 76.947  26.620 1.00 40.00 ? 295 PHE A CA  1 
ATOM 2214 C C   . PHE A 1 292 ? 30.309 76.776  27.936 1.00 40.00 ? 295 PHE A C   1 
ATOM 2215 O O   . PHE A 1 292 ? 29.410 75.954  28.119 1.00 40.00 ? 295 PHE A O   1 
ATOM 2216 C CB  . PHE A 1 292 ? 30.775 75.792  25.658 1.00 40.00 ? 295 PHE A CB  1 
ATOM 2217 C CG  . PHE A 1 292 ? 29.672 76.132  24.702 1.00 40.00 ? 295 PHE A CG  1 
ATOM 2218 C CD1 . PHE A 1 292 ? 28.464 76.657  25.176 1.00 40.00 ? 295 PHE A CD1 1 
ATOM 2219 C CD2 . PHE A 1 292 ? 29.835 75.950  23.348 1.00 40.00 ? 295 PHE A CD2 1 
ATOM 2220 C CE1 . PHE A 1 292 ? 27.446 77.019  24.335 1.00 40.00 ? 295 PHE A CE1 1 
ATOM 2221 C CE2 . PHE A 1 292 ? 28.798 76.282  22.484 1.00 40.00 ? 295 PHE A CE2 1 
ATOM 2222 C CZ  . PHE A 1 292 ? 27.620 76.821  22.972 1.00 40.00 ? 295 PHE A CZ  1 
ATOM 2223 N N   . ARG A 1 293 ? 30.683 77.651  28.851 1.00 40.00 ? 296 ARG A N   1 
ATOM 2224 C CA  . ARG A 1 293 ? 30.095 77.742  30.190 1.00 40.00 ? 296 ARG A CA  1 
ATOM 2225 C C   . ARG A 1 293 ? 30.112 79.211  30.547 1.00 40.00 ? 296 ARG A C   1 
ATOM 2226 O O   . ARG A 1 293 ? 31.101 79.881  30.170 1.00 40.00 ? 296 ARG A O   1 
ATOM 2227 C CB  . ARG A 1 293 ? 30.891 76.854  31.115 1.00 40.00 ? 296 ARG A CB  1 
ATOM 2228 C CG  . ARG A 1 293 ? 29.969 76.260  32.166 1.00 40.00 ? 296 ARG A CG  1 
ATOM 2229 C CD  . ARG A 1 293 ? 29.505 74.852  31.902 1.00 40.00 ? 296 ARG A CD  1 
ATOM 2230 N NE  . ARG A 1 293 ? 29.650 74.446  30.526 1.00 40.00 ? 296 ARG A NE  1 
ATOM 2231 C CZ  . ARG A 1 293 ? 29.297 73.197  30.172 1.00 40.00 ? 296 ARG A CZ  1 
ATOM 2232 N NH1 . ARG A 1 293 ? 28.844 72.392  31.134 1.00 40.00 ? 296 ARG A NH1 1 
ATOM 2233 N NH2 . ARG A 1 293 ? 29.405 72.796  28.918 1.00 40.00 ? 296 ARG A NH2 1 
ATOM 2234 N N   . PHE A 1 294 ? 29.011 79.796  31.018 1.00 40.00 ? 297 PHE A N   1 
ATOM 2235 C CA  . PHE A 1 294 ? 29.009 81.244  31.263 1.00 40.00 ? 297 PHE A CA  1 
ATOM 2236 C C   . PHE A 1 294 ? 28.568 81.585  32.669 1.00 40.00 ? 297 PHE A C   1 
ATOM 2237 O O   . PHE A 1 294 ? 27.691 80.911  33.220 1.00 40.00 ? 297 PHE A O   1 
ATOM 2238 C CB  . PHE A 1 294 ? 28.153 81.972  30.233 1.00 40.00 ? 297 PHE A CB  1 
ATOM 2239 C CG  . PHE A 1 294 ? 28.444 81.475  28.844 1.00 40.00 ? 297 PHE A CG  1 
ATOM 2240 C CD1 . PHE A 1 294 ? 29.660 81.802  28.258 1.00 40.00 ? 297 PHE A CD1 1 
ATOM 2241 C CD2 . PHE A 1 294 ? 27.559 80.650  28.178 1.00 40.00 ? 297 PHE A CD2 1 
ATOM 2242 C CE1 . PHE A 1 294 ? 29.970 81.321  26.990 1.00 40.00 ? 297 PHE A CE1 1 
ATOM 2243 C CE2 . PHE A 1 294 ? 27.878 80.188  26.923 1.00 40.00 ? 297 PHE A CE2 1 
ATOM 2244 C CZ  . PHE A 1 294 ? 29.081 80.513  26.333 1.00 40.00 ? 297 PHE A CZ  1 
ATOM 2245 N N   . SER A 1 295 ? 29.153 82.639  33.256 1.00 40.00 ? 298 SER A N   1 
ATOM 2246 C CA  . SER A 1 295 ? 28.866 82.948  34.645 1.00 40.00 ? 298 SER A CA  1 
ATOM 2247 C C   . SER A 1 295 ? 27.495 83.405  35.031 1.00 40.00 ? 298 SER A C   1 
ATOM 2248 O O   . SER A 1 295 ? 26.966 83.007  36.083 1.00 40.00 ? 298 SER A O   1 
ATOM 2249 C CB  . SER A 1 295 ? 29.913 83.923  35.199 1.00 40.00 ? 298 SER A CB  1 
ATOM 2250 O OG  . SER A 1 295 ? 31.220 83.474  34.850 1.00 40.00 ? 298 SER A OG  1 
ATOM 2251 N N   . PHE A 1 296 ? 26.988 84.353  34.240 1.00 40.00 ? 299 PHE A N   1 
ATOM 2252 C CA  . PHE A 1 296 ? 25.658 84.931  34.517 1.00 40.00 ? 299 PHE A CA  1 
ATOM 2253 C C   . PHE A 1 296 ? 24.754 84.697  33.328 1.00 40.00 ? 299 PHE A C   1 
ATOM 2254 O O   . PHE A 1 296 ? 25.047 85.089  32.191 1.00 40.00 ? 299 PHE A O   1 
ATOM 2255 C CB  . PHE A 1 296 ? 25.812 86.398  34.948 1.00 40.00 ? 299 PHE A CB  1 
ATOM 2256 C CG  . PHE A 1 296 ? 26.517 86.446  36.294 1.00 40.00 ? 299 PHE A CG  1 
ATOM 2257 C CD1 . PHE A 1 296 ? 25.809 86.205  37.450 1.00 40.00 ? 299 PHE A CD1 1 
ATOM 2258 C CD2 . PHE A 1 296 ? 27.879 86.649  36.364 1.00 40.00 ? 299 PHE A CD2 1 
ATOM 2259 C CE1 . PHE A 1 296 ? 26.421 86.194  38.679 1.00 40.00 ? 299 PHE A CE1 1 
ATOM 2260 C CE2 . PHE A 1 296 ? 28.499 86.634  37.586 1.00 40.00 ? 299 PHE A CE2 1 
ATOM 2261 C CZ  . PHE A 1 296 ? 27.775 86.406  38.732 1.00 40.00 ? 299 PHE A CZ  1 
ATOM 2262 N N   . VAL A 1 297 ? 23.702 83.918  33.562 1.00 40.00 ? 300 VAL A N   1 
ATOM 2263 C CA  . VAL A 1 297 ? 22.736 83.437  32.605 1.00 40.00 ? 300 VAL A CA  1 
ATOM 2264 C C   . VAL A 1 297 ? 21.419 83.121  33.322 1.00 40.00 ? 300 VAL A C   1 
ATOM 2265 O O   . VAL A 1 297 ? 21.385 83.067  34.538 1.00 40.00 ? 300 VAL A O   1 
ATOM 2266 C CB  . VAL A 1 297 ? 23.163 82.076  31.987 1.00 40.00 ? 300 VAL A CB  1 
ATOM 2267 C CG1 . VAL A 1 297 ? 24.428 82.132  31.156 1.00 40.00 ? 300 VAL A CG1 1 
ATOM 2268 C CG2 . VAL A 1 297 ? 23.256 81.060  33.130 1.00 40.00 ? 300 VAL A CG2 1 
ATOM 2269 N N   . PRO A 1 298 ? 20.351 82.893  32.586 1.00 40.00 ? 301 PRO A N   1 
ATOM 2270 C CA  . PRO A 1 298 ? 19.049 82.628  33.161 1.00 40.00 ? 301 PRO A CA  1 
ATOM 2271 C C   . PRO A 1 298 ? 19.127 81.632  34.283 1.00 40.00 ? 301 PRO A C   1 
ATOM 2272 O O   . PRO A 1 298 ? 19.891 80.671  34.185 1.00 40.00 ? 301 PRO A O   1 
ATOM 2273 C CB  . PRO A 1 298 ? 18.208 82.074  32.043 1.00 40.00 ? 301 PRO A CB  1 
ATOM 2274 C CG  . PRO A 1 298 ? 18.853 82.573  30.796 1.00 40.00 ? 301 PRO A CG  1 
ATOM 2275 C CD  . PRO A 1 298 ? 20.279 82.933  31.106 1.00 40.00 ? 301 PRO A CD  1 
ATOM 2276 N N   . VAL A 1 299 ? 18.337 81.884  35.296 1.00 40.00 ? 302 VAL A N   1 
ATOM 2277 C CA  . VAL A 1 299 ? 18.305 80.991  36.462 1.00 40.00 ? 302 VAL A CA  1 
ATOM 2278 C C   . VAL A 1 299 ? 16.928 80.349  36.584 1.00 40.00 ? 302 VAL A C   1 
ATOM 2279 O O   . VAL A 1 299 ? 15.923 81.035  36.306 1.00 40.00 ? 302 VAL A O   1 
ATOM 2280 C CB  . VAL A 1 299 ? 18.538 81.828  37.747 1.00 40.00 ? 302 VAL A CB  1 
ATOM 2281 C CG1 . VAL A 1 299 ? 17.505 82.927  37.839 1.00 40.00 ? 302 VAL A CG1 1 
ATOM 2282 C CG2 . VAL A 1 299 ? 18.472 80.944  38.980 1.00 40.00 ? 302 VAL A CG2 1 
ATOM 2283 N N   . VAL A 1 300 ? 16.931 79.111  37.043 1.00 40.00 ? 303 VAL A N   1 
ATOM 2284 C CA  . VAL A 1 300 ? 15.630 78.409  37.223 1.00 40.00 ? 303 VAL A CA  1 
ATOM 2285 C C   . VAL A 1 300 ? 15.071 78.893  38.542 1.00 40.00 ? 303 VAL A C   1 
ATOM 2286 O O   . VAL A 1 300 ? 15.389 78.344  39.577 1.00 40.00 ? 303 VAL A O   1 
ATOM 2287 C CB  . VAL A 1 300 ? 15.885 76.895  37.201 1.00 40.00 ? 303 VAL A CB  1 
ATOM 2288 C CG1 . VAL A 1 300 ? 14.675 76.094  37.641 1.00 40.00 ? 303 VAL A CG1 1 
ATOM 2289 C CG2 . VAL A 1 300 ? 16.383 76.497  35.816 1.00 40.00 ? 303 VAL A CG2 1 
ATOM 2290 N N   . ASP A 1 301 ? 14.317 79.970  38.524 1.00 40.00 ? 304 ASP A N   1 
ATOM 2291 C CA  . ASP A 1 301 ? 13.763 80.622  39.702 1.00 40.00 ? 304 ASP A CA  1 
ATOM 2292 C C   . ASP A 1 301 ? 12.444 80.014  40.148 1.00 40.00 ? 304 ASP A C   1 
ATOM 2293 O O   . ASP A 1 301 ? 12.035 80.131  41.289 1.00 40.00 ? 304 ASP A O   1 
ATOM 2294 C CB  . ASP A 1 301 ? 13.413 82.094  39.403 1.00 40.00 ? 304 ASP A CB  1 
ATOM 2295 C CG  . ASP A 1 301 ? 12.905 82.314  37.992 1.00 40.00 ? 304 ASP A CG  1 
ATOM 2296 O OD1 . ASP A 1 301 ? 12.454 81.373  37.299 1.00 40.00 ? 304 ASP A OD1 1 
ATOM 2297 O OD2 . ASP A 1 301 ? 12.981 83.499  37.548 1.00 40.00 ? 304 ASP A OD2 1 
ATOM 2298 N N   . GLY A 1 302 ? 11.734 79.422  39.185 1.00 40.00 ? 305 GLY A N   1 
ATOM 2299 C CA  . GLY A 1 302 ? 10.403 78.871  39.530 1.00 40.00 ? 305 GLY A CA  1 
ATOM 2300 C C   . GLY A 1 302 ? 9.403  80.030  39.356 1.00 40.00 ? 305 GLY A C   1 
ATOM 2301 O O   . GLY A 1 302 ? 8.401  80.159  40.048 1.00 40.00 ? 305 GLY A O   1 
ATOM 2302 N N   . ASP A 1 303 ? 9.740  80.907  38.429 1.00 40.00 ? 306 ASP A N   1 
ATOM 2303 C CA  . ASP A 1 303 ? 8.934  82.050  38.084 1.00 40.00 ? 306 ASP A CA  1 
ATOM 2304 C C   . ASP A 1 303 ? 9.043  82.127  36.562 1.00 40.00 ? 306 ASP A C   1 
ATOM 2305 O O   . ASP A 1 303 ? 8.321  81.479  35.813 1.00 40.00 ? 306 ASP A O   1 
ATOM 2306 C CB  . ASP A 1 303 ? 9.427  83.366  38.639 1.00 40.00 ? 306 ASP A CB  1 
ATOM 2307 C CG  . ASP A 1 303 ? 8.524  84.543  38.311 1.00 40.00 ? 306 ASP A CG  1 
ATOM 2308 O OD1 . ASP A 1 303 ? 7.441  84.630  38.951 1.00 40.00 ? 306 ASP A OD1 1 
ATOM 2309 O OD2 . ASP A 1 303 ? 8.822  85.408  37.454 1.00 40.00 ? 306 ASP A OD2 1 
ATOM 2310 N N   . PHE A 1 304 ? 10.081 82.860  36.133 1.00 40.00 ? 307 PHE A N   1 
ATOM 2311 C CA  . PHE A 1 304 ? 10.168 82.952  34.668 1.00 40.00 ? 307 PHE A CA  1 
ATOM 2312 C C   . PHE A 1 304 ? 10.217 81.560  34.075 1.00 40.00 ? 307 PHE A C   1 
ATOM 2313 O O   . PHE A 1 304 ? 9.601  81.425  33.020 1.00 40.00 ? 307 PHE A O   1 
ATOM 2314 C CB  . PHE A 1 304 ? 11.206 83.874  34.200 1.00 40.00 ? 307 PHE A CB  1 
ATOM 2315 C CG  . PHE A 1 304 ? 11.198 84.233  32.741 1.00 40.00 ? 307 PHE A CG  1 
ATOM 2316 C CD1 . PHE A 1 304 ? 11.580 83.358  31.760 1.00 40.00 ? 307 PHE A CD1 1 
ATOM 2317 C CD2 . PHE A 1 304 ? 10.837 85.515  32.375 1.00 40.00 ? 307 PHE A CD2 1 
ATOM 2318 C CE1 . PHE A 1 304 ? 11.618 83.736  30.440 1.00 40.00 ? 307 PHE A CE1 1 
ATOM 2319 C CE2 . PHE A 1 304 ? 10.857 85.917  31.059 1.00 40.00 ? 307 PHE A CE2 1 
ATOM 2320 C CZ  . PHE A 1 304 ? 11.245 85.021  30.083 1.00 40.00 ? 307 PHE A CZ  1 
ATOM 2321 N N   . LEU A 1 305 ? 10.908 80.630  34.674 1.00 40.00 ? 308 LEU A N   1 
ATOM 2322 C CA  . LEU A 1 305 ? 10.926 79.220  34.293 1.00 40.00 ? 308 LEU A CA  1 
ATOM 2323 C C   . LEU A 1 305 ? 10.324 78.495  35.520 1.00 40.00 ? 308 LEU A C   1 
ATOM 2324 O O   . LEU A 1 305 ? 10.786 78.615  36.665 1.00 40.00 ? 308 LEU A O   1 
ATOM 2325 C CB  . LEU A 1 305 ? 12.292 78.729  33.926 1.00 40.00 ? 308 LEU A CB  1 
ATOM 2326 C CG  . LEU A 1 305 ? 13.124 79.488  32.902 1.00 40.00 ? 308 LEU A CG  1 
ATOM 2327 C CD1 . LEU A 1 305 ? 14.540 78.924  32.838 1.00 40.00 ? 308 LEU A CD1 1 
ATOM 2328 C CD2 . LEU A 1 305 ? 12.562 79.397  31.490 1.00 40.00 ? 308 LEU A CD2 1 
ATOM 2329 N N   . SER A 1 306 ? 9.208  77.769  35.356 1.00 40.00 ? 309 SER A N   1 
ATOM 2330 C CA  . SER A 1 306 ? 8.543  77.132  36.506 1.00 40.00 ? 309 SER A CA  1 
ATOM 2331 C C   . SER A 1 306 ? 9.315  75.938  37.028 1.00 40.00 ? 309 SER A C   1 
ATOM 2332 O O   . SER A 1 306 ? 9.128  75.483  38.152 1.00 40.00 ? 309 SER A O   1 
ATOM 2333 C CB  . SER A 1 306 ? 7.140  76.649  36.113 1.00 40.00 ? 309 SER A CB  1 
ATOM 2334 O OG  . SER A 1 306 ? 7.106  76.589  34.681 1.00 40.00 ? 309 SER A OG  1 
ATOM 2335 N N   . ASP A 1 307 ? 10.157 75.448  36.142 1.00 40.00 ? 310 ASP A N   1 
ATOM 2336 C CA  . ASP A 1 307 ? 10.980 74.275  36.425 1.00 40.00 ? 310 ASP A CA  1 
ATOM 2337 C C   . ASP A 1 307 ? 12.080 74.299  35.367 1.00 40.00 ? 310 ASP A C   1 
ATOM 2338 O O   . ASP A 1 307 ? 11.994 75.169  34.471 1.00 40.00 ? 310 ASP A O   1 
ATOM 2339 C CB  . ASP A 1 307 ? 10.089 73.048  36.146 1.00 40.00 ? 310 ASP A CB  1 
ATOM 2340 C CG  . ASP A 1 307 ? 10.592 71.823  36.868 1.00 40.00 ? 310 ASP A CG  1 
ATOM 2341 O OD1 . ASP A 1 307 ? 11.830 71.669  36.824 1.00 40.00 ? 310 ASP A OD1 1 
ATOM 2342 O OD2 . ASP A 1 307 ? 9.785  71.066  37.456 1.00 40.00 ? 310 ASP A OD2 1 
ATOM 2343 N N   . THR A 1 308 ? 13.029 73.405  35.435 1.00 40.00 ? 311 THR A N   1 
ATOM 2344 C CA  . THR A 1 308 ? 14.047 73.371  34.413 1.00 40.00 ? 311 THR A CA  1 
ATOM 2345 C C   . THR A 1 308 ? 13.487 73.256  33.008 1.00 40.00 ? 311 THR A C   1 
ATOM 2346 O O   . THR A 1 308 ? 12.551 72.471  32.780 1.00 40.00 ? 311 THR A O   1 
ATOM 2347 C CB  . THR A 1 308 ? 14.758 71.977  34.529 1.00 40.00 ? 311 THR A CB  1 
ATOM 2348 O OG1 . THR A 1 308 ? 14.436 71.445  35.805 1.00 40.00 ? 311 THR A OG1 1 
ATOM 2349 C CG2 . THR A 1 308 ? 16.235 72.247  34.389 1.00 40.00 ? 311 THR A CG2 1 
ATOM 2350 N N   . PRO A 1 309 ? 14.189 73.868  32.070 1.00 40.00 ? 312 PRO A N   1 
ATOM 2351 C CA  . PRO A 1 309 ? 13.861 73.700  30.661 1.00 40.00 ? 312 PRO A CA  1 
ATOM 2352 C C   . PRO A 1 309 ? 13.755 72.200  30.370 1.00 40.00 ? 312 PRO A C   1 
ATOM 2353 O O   . PRO A 1 309 ? 12.805 71.794  29.683 1.00 40.00 ? 312 PRO A O   1 
ATOM 2354 C CB  . PRO A 1 309 ? 15.006 74.324  29.899 1.00 40.00 ? 312 PRO A CB  1 
ATOM 2355 C CG  . PRO A 1 309 ? 15.849 74.992  30.884 1.00 40.00 ? 312 PRO A CG  1 
ATOM 2356 C CD  . PRO A 1 309 ? 15.349 74.729  32.273 1.00 40.00 ? 312 PRO A CD  1 
ATOM 2357 N N   . GLU A 1 310 ? 14.672 71.354  30.875 1.00 40.00 ? 313 GLU A N   1 
ATOM 2358 C CA  . GLU A 1 310 ? 14.529 69.910  30.596 1.00 40.00 ? 313 GLU A CA  1 
ATOM 2359 C C   . GLU A 1 310 ? 13.125 69.458  30.959 1.00 40.00 ? 313 GLU A C   1 
ATOM 2360 O O   . GLU A 1 310 ? 12.353 69.121  30.073 1.00 40.00 ? 313 GLU A O   1 
ATOM 2361 C CB  . GLU A 1 310 ? 15.475 69.017  31.359 1.00 40.00 ? 313 GLU A CB  1 
ATOM 2362 C CG  . GLU A 1 310 ? 15.896 67.751  30.632 1.00 40.00 ? 313 GLU A CG  1 
ATOM 2363 C CD  . GLU A 1 310 ? 16.954 68.051  29.580 1.00 40.00 ? 313 GLU A CD  1 
ATOM 2364 O OE1 . GLU A 1 310 ? 17.685 69.068  29.684 1.00 40.00 ? 313 GLU A OE1 1 
ATOM 2365 O OE2 . GLU A 1 310 ? 17.063 67.248  28.626 1.00 40.00 ? 313 GLU A OE2 1 
ATOM 2366 N N   . ALA A 1 311 ? 12.781 69.534  32.243 1.00 40.00 ? 314 ALA A N   1 
ATOM 2367 C CA  . ALA A 1 311 ? 11.426 69.154  32.646 1.00 40.00 ? 314 ALA A CA  1 
ATOM 2368 C C   . ALA A 1 311 ? 10.390 69.833  31.768 1.00 40.00 ? 314 ALA A C   1 
ATOM 2369 O O   . ALA A 1 311 ? 9.363  69.237  31.458 1.00 40.00 ? 314 ALA A O   1 
ATOM 2370 C CB  . ALA A 1 311 ? 11.152 69.606  34.087 1.00 40.00 ? 314 ALA A CB  1 
ATOM 2371 N N   . LEU A 1 312 ? 10.584 71.101  31.410 1.00 40.00 ? 315 LEU A N   1 
ATOM 2372 C CA  . LEU A 1 312 ? 9.552  71.783  30.632 1.00 40.00 ? 315 LEU A CA  1 
ATOM 2373 C C   . LEU A 1 312 ? 9.390  71.235  29.239 1.00 40.00 ? 315 LEU A C   1 
ATOM 2374 O O   . LEU A 1 312 ? 8.274  70.828  28.914 1.00 40.00 ? 315 LEU A O   1 
ATOM 2375 C CB  . LEU A 1 312 ? 9.718  73.294  30.587 1.00 40.00 ? 315 LEU A CB  1 
ATOM 2376 C CG  . LEU A 1 312 ? 9.570  74.052  31.901 1.00 40.00 ? 315 LEU A CG  1 
ATOM 2377 C CD1 . LEU A 1 312 ? 9.509  75.545  31.603 1.00 40.00 ? 315 LEU A CD1 1 
ATOM 2378 C CD2 . LEU A 1 312 ? 8.357  73.589  32.703 1.00 40.00 ? 315 LEU A CD2 1 
ATOM 2379 N N   . ILE A 1 313 ? 10.439 71.116  28.435 1.00 40.00 ? 316 ILE A N   1 
ATOM 2380 C CA  . ILE A 1 313 ? 10.253 70.587  27.092 1.00 40.00 ? 316 ILE A CA  1 
ATOM 2381 C C   . ILE A 1 313 ? 9.853  69.112  27.189 1.00 40.00 ? 316 ILE A C   1 
ATOM 2382 O O   . ILE A 1 313 ? 9.473  68.444  26.230 1.00 40.00 ? 316 ILE A O   1 
ATOM 2383 C CB  . ILE A 1 313 ? 11.535 70.583  26.243 1.00 40.00 ? 316 ILE A CB  1 
ATOM 2384 C CG1 . ILE A 1 313 ? 12.572 69.691  26.936 1.00 40.00 ? 316 ILE A CG1 1 
ATOM 2385 C CG2 . ILE A 1 313 ? 12.062 71.968  25.969 1.00 40.00 ? 316 ILE A CG2 1 
ATOM 2386 C CD1 . ILE A 1 313 ? 13.673 69.178  26.020 1.00 40.00 ? 316 ILE A CD1 1 
ATOM 2387 N N   . ASN A 1 314 ? 10.065 68.565  28.376 1.00 40.00 ? 317 ASN A N   1 
ATOM 2388 C CA  . ASN A 1 314 ? 9.718  67.164  28.562 1.00 40.00 ? 317 ASN A CA  1 
ATOM 2389 C C   . ASN A 1 314 ? 8.232  67.052  28.764 1.00 40.00 ? 317 ASN A C   1 
ATOM 2390 O O   . ASN A 1 314 ? 7.686  66.076  28.237 1.00 40.00 ? 317 ASN A O   1 
ATOM 2391 C CB  . ASN A 1 314 ? 10.580 66.576  29.659 1.00 40.00 ? 317 ASN A CB  1 
ATOM 2392 C CG  . ASN A 1 314 ? 9.853  65.595  30.547 1.00 40.00 ? 317 ASN A CG  1 
ATOM 2393 O OD1 . ASN A 1 314 ? 9.856  65.740  31.782 1.00 40.00 ? 317 ASN A OD1 1 
ATOM 2394 N ND2 . ASN A 1 314 ? 9.224  64.599  29.920 1.00 40.00 ? 317 ASN A ND2 1 
ATOM 2395 N N   . THR A 1 315 ? 7.540  67.930  29.469 1.00 40.00 ? 318 THR A N   1 
ATOM 2396 C CA  . THR A 1 315 ? 6.101  67.744  29.656 1.00 40.00 ? 318 THR A CA  1 
ATOM 2397 C C   . THR A 1 315 ? 5.234  68.896  29.190 1.00 40.00 ? 318 THR A C   1 
ATOM 2398 O O   . THR A 1 315 ? 4.035  68.936  29.482 1.00 40.00 ? 318 THR A O   1 
ATOM 2399 C CB  . THR A 1 315 ? 5.750  67.474  31.134 1.00 40.00 ? 318 THR A CB  1 
ATOM 2400 O OG1 . THR A 1 315 ? 5.949  68.669  31.907 1.00 40.00 ? 318 THR A OG1 1 
ATOM 2401 C CG2 . THR A 1 315 ? 6.567  66.324  31.692 1.00 40.00 ? 318 THR A CG2 1 
ATOM 2402 N N   . GLY A 1 316 ? 5.812  69.850  28.477 1.00 40.00 ? 319 GLY A N   1 
ATOM 2403 C CA  . GLY A 1 316 ? 5.047  71.006  28.015 1.00 40.00 ? 319 GLY A CA  1 
ATOM 2404 C C   . GLY A 1 316 ? 4.097  70.584  26.902 1.00 40.00 ? 319 GLY A C   1 
ATOM 2405 O O   . GLY A 1 316 ? 4.323  69.558  26.280 1.00 40.00 ? 319 GLY A O   1 
ATOM 2406 N N   . ASP A 1 317 ? 3.052  71.368  26.669 1.00 40.00 ? 320 ASP A N   1 
ATOM 2407 C CA  . ASP A 1 317 ? 2.127  71.083  25.565 1.00 40.00 ? 320 ASP A CA  1 
ATOM 2408 C C   . ASP A 1 317 ? 2.519  72.052  24.439 1.00 40.00 ? 320 ASP A C   1 
ATOM 2409 O O   . ASP A 1 317 ? 2.238  73.247  24.566 1.00 40.00 ? 320 ASP A O   1 
ATOM 2410 C CB  . ASP A 1 317 ? 0.676  71.313  25.948 1.00 40.00 ? 320 ASP A CB  1 
ATOM 2411 C CG  . ASP A 1 317 ? -0.305 70.872  24.869 1.00 40.00 ? 320 ASP A CG  1 
ATOM 2412 O OD1 . ASP A 1 317 ? -0.202 71.357  23.718 1.00 40.00 ? 320 ASP A OD1 1 
ATOM 2413 O OD2 . ASP A 1 317 ? -1.185 70.031  25.176 1.00 40.00 ? 320 ASP A OD2 1 
ATOM 2414 N N   . PHE A 1 318 ? 3.196  71.556  23.414 1.00 40.00 ? 321 PHE A N   1 
ATOM 2415 C CA  . PHE A 1 318 ? 3.618  72.450  22.323 1.00 40.00 ? 321 PHE A CA  1 
ATOM 2416 C C   . PHE A 1 318 ? 2.855  72.082  21.062 1.00 40.00 ? 321 PHE A C   1 
ATOM 2417 O O   . PHE A 1 318 ? 3.363  72.208  19.946 1.00 40.00 ? 321 PHE A O   1 
ATOM 2418 C CB  . PHE A 1 318 ? 5.131  72.300  22.079 1.00 40.00 ? 321 PHE A CB  1 
ATOM 2419 C CG  . PHE A 1 318 ? 5.896  72.311  23.378 1.00 40.00 ? 321 PHE A CG  1 
ATOM 2420 C CD1 . PHE A 1 318 ? 5.999  73.495  24.087 1.00 40.00 ? 321 PHE A CD1 1 
ATOM 2421 C CD2 . PHE A 1 318 ? 6.459  71.167  23.897 1.00 40.00 ? 321 PHE A CD2 1 
ATOM 2422 C CE1 . PHE A 1 318 ? 6.671  73.532  25.290 1.00 40.00 ? 321 PHE A CE1 1 
ATOM 2423 C CE2 . PHE A 1 318 ? 7.141  71.201  25.097 1.00 40.00 ? 321 PHE A CE2 1 
ATOM 2424 C CZ  . PHE A 1 318 ? 7.251  72.380  25.802 1.00 40.00 ? 321 PHE A CZ  1 
ATOM 2425 N N   . GLN A 1 319 ? 1.632  71.616  21.278 1.00 40.00 ? 322 GLN A N   1 
ATOM 2426 C CA  . GLN A 1 319 ? 0.769  71.130  20.222 1.00 40.00 ? 322 GLN A CA  1 
ATOM 2427 C C   . GLN A 1 319 ? 0.139  72.154  19.323 1.00 40.00 ? 322 GLN A C   1 
ATOM 2428 O O   . GLN A 1 319 ? -1.067 72.363  19.406 1.00 40.00 ? 322 GLN A O   1 
ATOM 2429 C CB  . GLN A 1 319 ? -0.339 70.274  20.866 1.00 40.00 ? 322 GLN A CB  1 
ATOM 2430 C CG  . GLN A 1 319 ? -1.088 69.401  19.868 1.00 40.00 ? 322 GLN A CG  1 
ATOM 2431 C CD  . GLN A 1 319 ? -2.528 69.224  20.323 1.00 40.00 ? 322 GLN A CD  1 
ATOM 2432 O OE1 . GLN A 1 319 ? -2.801 69.209  21.528 1.00 40.00 ? 322 GLN A OE1 1 
ATOM 2433 N NE2 . GLN A 1 319 ? -3.444 69.100  19.366 1.00 40.00 ? 322 GLN A NE2 1 
ATOM 2434 N N   . ASP A 1 320 ? 0.906  72.823  18.485 1.00 40.00 ? 323 ASP A N   1 
ATOM 2435 C CA  . ASP A 1 320 ? 0.453  73.860  17.579 1.00 40.00 ? 323 ASP A CA  1 
ATOM 2436 C C   . ASP A 1 320 ? 1.639  74.753  17.170 1.00 40.00 ? 323 ASP A C   1 
ATOM 2437 O O   . ASP A 1 320 ? 1.671  75.298  16.063 1.00 40.00 ? 323 ASP A O   1 
ATOM 2438 C CB  . ASP A 1 320 ? -0.613 74.735  18.247 1.00 40.00 ? 323 ASP A CB  1 
ATOM 2439 C CG  . ASP A 1 320 ? -0.010 75.584  19.362 1.00 40.00 ? 323 ASP A CG  1 
ATOM 2440 O OD1 . ASP A 1 320 ? 0.295  75.038  20.442 1.00 40.00 ? 323 ASP A OD1 1 
ATOM 2441 O OD2 . ASP A 1 320 ? 0.156  76.784  19.078 1.00 40.00 ? 323 ASP A OD2 1 
ATOM 2442 N N   . LEU A 1 321 ? 2.592  74.885  18.094 1.00 40.00 ? 324 LEU A N   1 
ATOM 2443 C CA  . LEU A 1 321 ? 3.769  75.690  17.867 1.00 40.00 ? 324 LEU A CA  1 
ATOM 2444 C C   . LEU A 1 321 ? 4.523  75.333  16.598 1.00 40.00 ? 324 LEU A C   1 
ATOM 2445 O O   . LEU A 1 321 ? 4.839  74.166  16.374 1.00 40.00 ? 324 LEU A O   1 
ATOM 2446 C CB  . LEU A 1 321 ? 4.696  75.443  19.055 1.00 40.00 ? 324 LEU A CB  1 
ATOM 2447 C CG  . LEU A 1 321 ? 5.502  76.547  19.718 1.00 40.00 ? 324 LEU A CG  1 
ATOM 2448 C CD1 . LEU A 1 321 ? 6.475  75.877  20.701 1.00 40.00 ? 324 LEU A CD1 1 
ATOM 2449 C CD2 . LEU A 1 321 ? 6.254  77.430  18.737 1.00 40.00 ? 324 LEU A CD2 1 
ATOM 2450 N N   . GLN A 1 322 ? 4.845  76.303  15.761 1.00 40.00 ? 325 GLN A N   1 
ATOM 2451 C CA  . GLN A 1 322 ? 5.658  75.971  14.584 1.00 40.00 ? 325 GLN A CA  1 
ATOM 2452 C C   . GLN A 1 322 ? 7.067  76.398  15.028 1.00 40.00 ? 325 GLN A C   1 
ATOM 2453 O O   . GLN A 1 322 ? 7.174  77.478  15.614 1.00 40.00 ? 325 GLN A O   1 
ATOM 2454 C CB  . GLN A 1 322 ? 5.333  76.716  13.325 1.00 40.00 ? 325 GLN A CB  1 
ATOM 2455 C CG  . GLN A 1 322 ? 4.218  76.138  12.459 1.00 40.00 ? 325 GLN A CG  1 
ATOM 2456 C CD  . GLN A 1 322 ? 3.005  77.066  12.552 1.00 40.00 ? 325 GLN A CD  1 
ATOM 2457 O OE1 . GLN A 1 322 ? 3.004  78.050  11.810 1.00 40.00 ? 325 GLN A OE1 1 
ATOM 2458 N NE2 . GLN A 1 322 ? 2.082  76.727  13.446 1.00 40.00 ? 325 GLN A NE2 1 
ATOM 2459 N N   . VAL A 1 323 ? 8.072  75.579  14.775 1.00 40.00 ? 326 VAL A N   1 
ATOM 2460 C CA  . VAL A 1 323 ? 9.403  75.951  15.217 1.00 40.00 ? 326 VAL A CA  1 
ATOM 2461 C C   . VAL A 1 323 ? 10.436 75.492  14.194 1.00 40.00 ? 326 VAL A C   1 
ATOM 2462 O O   . VAL A 1 323 ? 10.485 74.304  13.871 1.00 40.00 ? 326 VAL A O   1 
ATOM 2463 C CB  . VAL A 1 323 ? 9.774  75.148  16.488 1.00 40.00 ? 326 VAL A CB  1 
ATOM 2464 C CG1 . VAL A 1 323 ? 11.237 75.475  16.787 1.00 40.00 ? 326 VAL A CG1 1 
ATOM 2465 C CG2 . VAL A 1 323 ? 8.863  75.332  17.671 1.00 40.00 ? 326 VAL A CG2 1 
ATOM 2466 N N   . LEU A 1 324 ? 11.264 76.389  13.752 1.00 40.00 ? 327 LEU A N   1 
ATOM 2467 C CA  . LEU A 1 324 ? 12.359 75.998  12.847 1.00 40.00 ? 327 LEU A CA  1 
ATOM 2468 C C   . LEU A 1 324 ? 13.569 75.871  13.776 1.00 40.00 ? 327 LEU A C   1 
ATOM 2469 O O   . LEU A 1 324 ? 13.700 76.670  14.737 1.00 40.00 ? 327 LEU A O   1 
ATOM 2470 C CB  . LEU A 1 324 ? 12.548 77.079  11.796 1.00 40.00 ? 327 LEU A CB  1 
ATOM 2471 C CG  . LEU A 1 324 ? 13.504 76.822  10.636 1.00 40.00 ? 327 LEU A CG  1 
ATOM 2472 C CD1 . LEU A 1 324 ? 13.811 78.109  9.862  1.00 40.00 ? 327 LEU A CD1 1 
ATOM 2473 C CD2 . LEU A 1 324 ? 14.849 76.250  11.048 1.00 40.00 ? 327 LEU A CD2 1 
ATOM 2474 N N   . VAL A 1 325 ? 14.445 74.912  13.603 1.00 40.00 ? 328 VAL A N   1 
ATOM 2475 C CA  . VAL A 1 325 ? 15.596 74.706  14.468 1.00 40.00 ? 328 VAL A CA  1 
ATOM 2476 C C   . VAL A 1 325 ? 16.767 74.244  13.623 1.00 40.00 ? 328 VAL A C   1 
ATOM 2477 O O   . VAL A 1 325 ? 16.445 73.628  12.593 1.00 40.00 ? 328 VAL A O   1 
ATOM 2478 C CB  . VAL A 1 325 ? 15.334 73.487  15.379 1.00 40.00 ? 328 VAL A CB  1 
ATOM 2479 C CG1 . VAL A 1 325 ? 16.615 73.176  16.146 1.00 40.00 ? 328 VAL A CG1 1 
ATOM 2480 C CG2 . VAL A 1 325 ? 14.191 73.715  16.343 1.00 40.00 ? 328 VAL A CG2 1 
ATOM 2481 N N   . GLY A 1 326 ? 18.014 74.465  13.997 1.00 40.00 ? 329 GLY A N   1 
ATOM 2482 C CA  . GLY A 1 326 ? 19.065 73.940  13.120 1.00 40.00 ? 329 GLY A CA  1 
ATOM 2483 C C   . GLY A 1 326 ? 20.397 74.071  13.818 1.00 40.00 ? 329 GLY A C   1 
ATOM 2484 O O   . GLY A 1 326 ? 20.419 74.334  15.025 1.00 40.00 ? 329 GLY A O   1 
ATOM 2485 N N   . VAL A 1 327 ? 21.474 73.889  13.073 1.00 40.00 ? 330 VAL A N   1 
ATOM 2486 C CA  . VAL A 1 327 ? 22.818 73.856  13.669 1.00 40.00 ? 330 VAL A CA  1 
ATOM 2487 C C   . VAL A 1 327 ? 23.848 74.030  12.562 1.00 40.00 ? 330 VAL A C   1 
ATOM 2488 O O   . VAL A 1 327 ? 23.484 73.852  11.384 1.00 40.00 ? 330 VAL A O   1 
ATOM 2489 C CB  . VAL A 1 327 ? 22.919 72.395  14.201 1.00 40.00 ? 330 VAL A CB  1 
ATOM 2490 C CG1 . VAL A 1 327 ? 24.269 71.761  13.953 1.00 40.00 ? 330 VAL A CG1 1 
ATOM 2491 C CG2 . VAL A 1 327 ? 22.513 72.264  15.651 1.00 40.00 ? 330 VAL A CG2 1 
ATOM 2492 N N   . VAL A 1 328 ? 25.089 74.342  12.868 1.00 40.00 ? 331 VAL A N   1 
ATOM 2493 C CA  . VAL A 1 328 ? 26.071 74.493  11.805 1.00 40.00 ? 331 VAL A CA  1 
ATOM 2494 C C   . VAL A 1 328 ? 27.009 73.309  11.763 1.00 40.00 ? 331 VAL A C   1 
ATOM 2495 O O   . VAL A 1 328 ? 27.008 72.431  12.639 1.00 40.00 ? 331 VAL A O   1 
ATOM 2496 C CB  . VAL A 1 328 ? 26.847 75.809  11.946 1.00 40.00 ? 331 VAL A CB  1 
ATOM 2497 C CG1 . VAL A 1 328 ? 25.948 76.977  11.492 1.00 40.00 ? 331 VAL A CG1 1 
ATOM 2498 C CG2 . VAL A 1 328 ? 27.276 76.049  13.376 1.00 40.00 ? 331 VAL A CG2 1 
ATOM 2499 N N   . LYS A 1 329 ? 27.833 73.248  10.712 1.00 40.00 ? 332 LYS A N   1 
ATOM 2500 C CA  . LYS A 1 329 ? 28.744 72.121  10.572 1.00 40.00 ? 332 LYS A CA  1 
ATOM 2501 C C   . LYS A 1 329 ? 29.606 71.925  11.814 1.00 40.00 ? 332 LYS A C   1 
ATOM 2502 O O   . LYS A 1 329 ? 29.576 70.830  12.390 1.00 40.00 ? 332 LYS A O   1 
ATOM 2503 C CB  . LYS A 1 329 ? 29.572 72.207  9.291  1.00 40.00 ? 332 LYS A CB  1 
ATOM 2504 C CG  . LYS A 1 329 ? 29.714 70.868  8.598  1.00 40.00 ? 332 LYS A CG  1 
ATOM 2505 C CD  . LYS A 1 329 ? 30.821 70.674  7.630  1.00 40.00 ? 332 LYS A CD  1 
ATOM 2506 C CE  . LYS A 1 329 ? 32.145 71.332  7.915  1.00 40.00 ? 332 LYS A CE  1 
ATOM 2507 N NZ  . LYS A 1 329 ? 32.270 72.660  7.224  1.00 40.00 ? 332 LYS A NZ  1 
ATOM 2508 N N   . ASP A 1 330 ? 30.369 72.923  12.249 1.00 40.00 ? 333 ASP A N   1 
ATOM 2509 C CA  . ASP A 1 330 ? 31.215 72.737  13.410 1.00 40.00 ? 333 ASP A CA  1 
ATOM 2510 C C   . ASP A 1 330 ? 30.989 73.656  14.597 1.00 40.00 ? 333 ASP A C   1 
ATOM 2511 O O   . ASP A 1 330 ? 31.906 74.421  14.903 1.00 40.00 ? 333 ASP A O   1 
ATOM 2512 C CB  . ASP A 1 330 ? 32.704 72.777  13.021 1.00 40.00 ? 333 ASP A CB  1 
ATOM 2513 C CG  . ASP A 1 330 ? 32.994 72.292  11.617 1.00 40.00 ? 333 ASP A CG  1 
ATOM 2514 O OD1 . ASP A 1 330 ? 32.407 72.885  10.685 1.00 40.00 ? 333 ASP A OD1 1 
ATOM 2515 O OD2 . ASP A 1 330 ? 33.791 71.340  11.444 1.00 40.00 ? 333 ASP A OD2 1 
ATOM 2516 N N   . GLU A 1 331 ? 29.885 73.569  15.331 1.00 40.00 ? 334 GLU A N   1 
ATOM 2517 C CA  . GLU A 1 331 ? 29.652 74.394  16.499 1.00 40.00 ? 334 GLU A CA  1 
ATOM 2518 C C   . GLU A 1 331 ? 30.887 74.550  17.390 1.00 40.00 ? 334 GLU A C   1 
ATOM 2519 O O   . GLU A 1 331 ? 31.419 75.662  17.552 1.00 40.00 ? 334 GLU A O   1 
ATOM 2520 C CB  . GLU A 1 331 ? 28.516 73.896  17.393 1.00 40.00 ? 334 GLU A CB  1 
ATOM 2521 C CG  . GLU A 1 331 ? 27.217 73.588  16.693 1.00 40.00 ? 334 GLU A CG  1 
ATOM 2522 C CD  . GLU A 1 331 ? 26.422 74.801  16.284 1.00 40.00 ? 334 GLU A CD  1 
ATOM 2523 O OE1 . GLU A 1 331 ? 26.948 75.937  16.367 1.00 40.00 ? 334 GLU A OE1 1 
ATOM 2524 O OE2 . GLU A 1 331 ? 25.260 74.667  15.863 1.00 40.00 ? 334 GLU A OE2 1 
ATOM 2525 N N   . GLY A 1 332 ? 31.404 73.468  17.957 1.00 40.00 ? 335 GLY A N   1 
ATOM 2526 C CA  . GLY A 1 332 ? 32.513 73.505  18.834 1.00 40.00 ? 335 GLY A CA  1 
ATOM 2527 C C   . GLY A 1 332 ? 33.797 74.144  18.451 1.00 40.00 ? 335 GLY A C   1 
ATOM 2528 O O   . GLY A 1 332 ? 34.555 74.525  19.380 1.00 40.00 ? 335 GLY A O   1 
ATOM 2529 N N   . SER A 1 333 ? 34.177 74.277  17.196 1.00 40.00 ? 336 SER A N   1 
ATOM 2530 C CA  . SER A 1 333 ? 35.486 74.819  16.815 1.00 40.00 ? 336 SER A CA  1 
ATOM 2531 C C   . SER A 1 333 ? 35.892 76.127  17.464 1.00 40.00 ? 336 SER A C   1 
ATOM 2532 O O   . SER A 1 333 ? 36.910 76.233  18.154 1.00 40.00 ? 336 SER A O   1 
ATOM 2533 C CB  . SER A 1 333 ? 35.513 75.014  15.286 1.00 40.00 ? 336 SER A CB  1 
ATOM 2534 O OG  . SER A 1 333 ? 34.207 75.460  14.910 1.00 40.00 ? 336 SER A OG  1 
ATOM 2535 N N   . TYR A 1 334 ? 35.104 77.178  17.238 1.00 40.00 ? 337 TYR A N   1 
ATOM 2536 C CA  . TYR A 1 334 ? 35.339 78.524  17.793 1.00 40.00 ? 337 TYR A CA  1 
ATOM 2537 C C   . TYR A 1 334 ? 35.759 78.435  19.242 1.00 40.00 ? 337 TYR A C   1 
ATOM 2538 O O   . TYR A 1 334 ? 36.855 78.873  19.595 1.00 40.00 ? 337 TYR A O   1 
ATOM 2539 C CB  . TYR A 1 334 ? 34.069 79.335  17.640 1.00 40.00 ? 337 TYR A CB  1 
ATOM 2540 C CG  . TYR A 1 334 ? 33.933 80.729  18.134 1.00 40.00 ? 337 TYR A CG  1 
ATOM 2541 C CD1 . TYR A 1 334 ? 34.345 81.788  17.333 1.00 40.00 ? 337 TYR A CD1 1 
ATOM 2542 C CD2 . TYR A 1 334 ? 33.365 81.041  19.366 1.00 40.00 ? 337 TYR A CD2 1 
ATOM 2543 C CE1 . TYR A 1 334 ? 34.234 83.112  17.745 1.00 40.00 ? 337 TYR A CE1 1 
ATOM 2544 C CE2 . TYR A 1 334 ? 33.243 82.351  19.785 1.00 40.00 ? 337 TYR A CE2 1 
ATOM 2545 C CZ  . TYR A 1 334 ? 33.679 83.388  18.976 1.00 40.00 ? 337 TYR A CZ  1 
ATOM 2546 O OH  . TYR A 1 334 ? 33.546 84.695  19.415 1.00 40.00 ? 337 TYR A OH  1 
ATOM 2547 N N   . PHE A 1 335 ? 34.961 77.802  20.110 1.00 40.00 ? 338 PHE A N   1 
ATOM 2548 C CA  . PHE A 1 335 ? 35.282 77.729  21.518 1.00 40.00 ? 338 PHE A CA  1 
ATOM 2549 C C   . PHE A 1 335 ? 36.589 77.097  21.876 1.00 40.00 ? 338 PHE A C   1 
ATOM 2550 O O   . PHE A 1 335 ? 36.977 77.210  23.045 1.00 40.00 ? 338 PHE A O   1 
ATOM 2551 C CB  . PHE A 1 335 ? 34.207 76.889  22.274 1.00 40.00 ? 338 PHE A CB  1 
ATOM 2552 C CG  . PHE A 1 335 ? 32.866 77.515  22.021 1.00 40.00 ? 338 PHE A CG  1 
ATOM 2553 C CD1 . PHE A 1 335 ? 32.221 77.282  20.825 1.00 40.00 ? 338 PHE A CD1 1 
ATOM 2554 C CD2 . PHE A 1 335 ? 32.280 78.352  22.944 1.00 40.00 ? 338 PHE A CD2 1 
ATOM 2555 C CE1 . PHE A 1 335 ? 30.993 77.847  20.539 1.00 40.00 ? 338 PHE A CE1 1 
ATOM 2556 C CE2 . PHE A 1 335 ? 31.051 78.929  22.668 1.00 40.00 ? 338 PHE A CE2 1 
ATOM 2557 C CZ  . PHE A 1 335 ? 30.417 78.680  21.461 1.00 40.00 ? 338 PHE A CZ  1 
ATOM 2558 N N   . LEU A 1 336 ? 37.229 76.365  20.976 1.00 40.00 ? 339 LEU A N   1 
ATOM 2559 C CA  . LEU A 1 336 ? 38.448 75.679  21.407 1.00 40.00 ? 339 LEU A CA  1 
ATOM 2560 C C   . LEU A 1 336 ? 39.601 76.630  21.613 1.00 40.00 ? 339 LEU A C   1 
ATOM 2561 O O   . LEU A 1 336 ? 40.397 76.465  22.541 1.00 40.00 ? 339 LEU A O   1 
ATOM 2562 C CB  . LEU A 1 336 ? 38.769 74.523  20.489 1.00 40.00 ? 339 LEU A CB  1 
ATOM 2563 C CG  . LEU A 1 336 ? 37.688 73.439  20.355 1.00 40.00 ? 339 LEU A CG  1 
ATOM 2564 C CD1 . LEU A 1 336 ? 38.151 72.394  19.351 1.00 40.00 ? 339 LEU A CD1 1 
ATOM 2565 C CD2 . LEU A 1 336 ? 37.441 72.784  21.705 1.00 40.00 ? 339 LEU A CD2 1 
ATOM 2566 N N   . VAL A 1 337 ? 39.688 77.680  20.803 1.00 40.00 ? 340 VAL A N   1 
ATOM 2567 C CA  . VAL A 1 337 ? 40.748 78.665  20.860 1.00 40.00 ? 340 VAL A CA  1 
ATOM 2568 C C   . VAL A 1 337 ? 40.770 79.381  22.204 1.00 40.00 ? 340 VAL A C   1 
ATOM 2569 O O   . VAL A 1 337 ? 41.795 79.823  22.730 1.00 40.00 ? 340 VAL A O   1 
ATOM 2570 C CB  . VAL A 1 337 ? 40.594 79.758  19.787 1.00 40.00 ? 340 VAL A CB  1 
ATOM 2571 C CG1 . VAL A 1 337 ? 40.668 79.159  18.399 1.00 40.00 ? 340 VAL A CG1 1 
ATOM 2572 C CG2 . VAL A 1 337 ? 39.319 80.542  19.960 1.00 40.00 ? 340 VAL A CG2 1 
ATOM 2573 N N   . TYR A 1 338 ? 39.589 79.518  22.795 1.00 40.00 ? 341 TYR A N   1 
ATOM 2574 C CA  . TYR A 1 338 ? 39.424 80.193  24.064 1.00 40.00 ? 341 TYR A CA  1 
ATOM 2575 C C   . TYR A 1 338 ? 39.762 79.345  25.262 1.00 40.00 ? 341 TYR A C   1 
ATOM 2576 O O   . TYR A 1 338 ? 39.031 79.418  26.278 1.00 40.00 ? 341 TYR A O   1 
ATOM 2577 C CB  . TYR A 1 338 ? 37.960 80.690  24.175 1.00 40.00 ? 341 TYR A CB  1 
ATOM 2578 C CG  . TYR A 1 338 ? 37.668 81.890  23.311 1.00 40.00 ? 341 TYR A CG  1 
ATOM 2579 C CD1 . TYR A 1 338 ? 37.416 81.798  21.958 1.00 40.00 ? 341 TYR A CD1 1 
ATOM 2580 C CD2 . TYR A 1 338 ? 37.645 83.157  23.866 1.00 40.00 ? 341 TYR A CD2 1 
ATOM 2581 C CE1 . TYR A 1 338 ? 37.173 82.905  21.173 1.00 40.00 ? 341 TYR A CE1 1 
ATOM 2582 C CE2 . TYR A 1 338 ? 37.395 84.279  23.113 1.00 40.00 ? 341 TYR A CE2 1 
ATOM 2583 C CZ  . TYR A 1 338 ? 37.158 84.153  21.762 1.00 40.00 ? 341 TYR A CZ  1 
ATOM 2584 O OH  . TYR A 1 338 ? 36.897 85.292  21.037 1.00 40.00 ? 341 TYR A OH  1 
ATOM 2585 N N   . GLY A 1 339 ? 40.801 78.523  25.313 1.00 40.00 ? 342 GLY A N   1 
ATOM 2586 C CA  . GLY A 1 339 ? 41.032 77.777  26.544 1.00 40.00 ? 342 GLY A CA  1 
ATOM 2587 C C   . GLY A 1 339 ? 41.414 76.324  26.447 1.00 40.00 ? 342 GLY A C   1 
ATOM 2588 O O   . GLY A 1 339 ? 41.589 75.678  27.507 1.00 40.00 ? 342 GLY A O   1 
ATOM 2589 N N   . VAL A 1 340 ? 41.556 75.729  25.261 1.00 40.00 ? 343 VAL A N   1 
ATOM 2590 C CA  . VAL A 1 340 ? 41.947 74.320  25.218 1.00 40.00 ? 343 VAL A CA  1 
ATOM 2591 C C   . VAL A 1 340 ? 43.378 74.239  24.688 1.00 40.00 ? 343 VAL A C   1 
ATOM 2592 O O   . VAL A 1 340 ? 43.656 74.464  23.510 1.00 40.00 ? 343 VAL A O   1 
ATOM 2593 C CB  . VAL A 1 340 ? 40.989 73.450  24.424 1.00 40.00 ? 343 VAL A CB  1 
ATOM 2594 C CG1 . VAL A 1 340 ? 41.472 72.004  24.415 1.00 40.00 ? 343 VAL A CG1 1 
ATOM 2595 C CG2 . VAL A 1 340 ? 39.587 73.495  25.024 1.00 40.00 ? 343 VAL A CG2 1 
ATOM 2596 N N   . PRO A 1 341 ? 44.301 73.936  25.601 1.00 40.00 ? 344 PRO A N   1 
ATOM 2597 C CA  . PRO A 1 341 ? 45.716 73.884  25.270 1.00 40.00 ? 344 PRO A CA  1 
ATOM 2598 C C   . PRO A 1 341 ? 45.939 73.079  24.005 1.00 40.00 ? 344 PRO A C   1 
ATOM 2599 O O   . PRO A 1 341 ? 45.404 71.989  23.871 1.00 40.00 ? 344 PRO A O   1 
ATOM 2600 C CB  . PRO A 1 341 ? 46.392 73.376  26.493 1.00 40.00 ? 344 PRO A CB  1 
ATOM 2601 C CG  . PRO A 1 341 ? 45.389 73.322  27.572 1.00 40.00 ? 344 PRO A CG  1 
ATOM 2602 C CD  . PRO A 1 341 ? 44.047 73.662  27.021 1.00 40.00 ? 344 PRO A CD  1 
ATOM 2603 N N   . GLY A 1 342 ? 46.692 73.654  23.077 1.00 40.00 ? 345 GLY A N   1 
ATOM 2604 C CA  . GLY A 1 342 ? 46.997 73.061  21.793 1.00 40.00 ? 345 GLY A CA  1 
ATOM 2605 C C   . GLY A 1 342 ? 46.229 73.771  20.689 1.00 40.00 ? 345 GLY A C   1 
ATOM 2606 O O   . GLY A 1 342 ? 46.608 73.688  19.510 1.00 40.00 ? 345 GLY A O   1 
ATOM 2607 N N   . PHE A 1 343 ? 45.133 74.458  21.024 1.00 40.00 ? 346 PHE A N   1 
ATOM 2608 C CA  . PHE A 1 343 ? 44.416 75.083  19.908 1.00 40.00 ? 346 PHE A CA  1 
ATOM 2609 C C   . PHE A 1 343 ? 44.745 76.551  19.735 1.00 40.00 ? 346 PHE A C   1 
ATOM 2610 O O   . PHE A 1 343 ? 44.936 77.295  20.701 1.00 40.00 ? 346 PHE A O   1 
ATOM 2611 C CB  . PHE A 1 343 ? 42.917 74.863  20.110 1.00 40.00 ? 346 PHE A CB  1 
ATOM 2612 C CG  . PHE A 1 343 ? 42.524 73.412  20.117 1.00 40.00 ? 346 PHE A CG  1 
ATOM 2613 C CD1 . PHE A 1 343 ? 42.014 72.834  18.973 1.00 40.00 ? 346 PHE A CD1 1 
ATOM 2614 C CD2 . PHE A 1 343 ? 42.648 72.630  21.258 1.00 40.00 ? 346 PHE A CD2 1 
ATOM 2615 C CE1 . PHE A 1 343 ? 41.639 71.504  18.973 1.00 40.00 ? 346 PHE A CE1 1 
ATOM 2616 C CE2 . PHE A 1 343 ? 42.280 71.296  21.258 1.00 40.00 ? 346 PHE A CE2 1 
ATOM 2617 C CZ  . PHE A 1 343 ? 41.781 70.736  20.112 1.00 40.00 ? 346 PHE A CZ  1 
ATOM 2618 N N   . SER A 1 344 ? 44.778 76.971  18.474 1.00 40.00 ? 347 SER A N   1 
ATOM 2619 C CA  . SER A 1 344 ? 44.990 78.364  18.129 1.00 40.00 ? 347 SER A CA  1 
ATOM 2620 C C   . SER A 1 344 ? 44.389 78.626  16.747 1.00 40.00 ? 347 SER A C   1 
ATOM 2621 O O   . SER A 1 344 ? 44.289 77.714  15.922 1.00 40.00 ? 347 SER A O   1 
ATOM 2622 C CB  . SER A 1 344 ? 46.483 78.704  18.081 1.00 40.00 ? 347 SER A CB  1 
ATOM 2623 O OG  . SER A 1 344 ? 46.729 79.326  16.806 1.00 40.00 ? 347 SER A OG  1 
ATOM 2624 N N   . LYS A 1 345 ? 44.089 79.881  16.451 1.00 40.00 ? 348 LYS A N   1 
ATOM 2625 C CA  . LYS A 1 345 ? 43.563 80.184  15.111 1.00 40.00 ? 348 LYS A CA  1 
ATOM 2626 C C   . LYS A 1 345 ? 44.754 80.301  14.155 1.00 40.00 ? 348 LYS A C   1 
ATOM 2627 O O   . LYS A 1 345 ? 44.609 80.324  12.929 1.00 40.00 ? 348 LYS A O   1 
ATOM 2628 C CB  . LYS A 1 345 ? 42.776 81.498  15.163 1.00 40.00 ? 348 LYS A CB  1 
ATOM 2629 C CG  . LYS A 1 345 ? 43.598 82.786  15.105 1.00 40.00 ? 348 LYS A CG  1 
ATOM 2630 C CD  . LYS A 1 345 ? 42.647 83.977  14.968 1.00 40.00 ? 348 LYS A CD  1 
ATOM 2631 C CE  . LYS A 1 345 ? 43.275 85.150  14.246 1.00 40.00 ? 348 LYS A CE  1 
ATOM 2632 N NZ  . LYS A 1 345 ? 43.119 85.012  12.769 1.00 40.00 ? 348 LYS A NZ  1 
ATOM 2633 N N   . ASP A 1 346 ? 45.944 80.402  14.738 1.00 40.00 ? 349 ASP A N   1 
ATOM 2634 C CA  . ASP A 1 346 ? 47.134 80.618  13.947 1.00 40.00 ? 349 ASP A CA  1 
ATOM 2635 C C   . ASP A 1 346 ? 47.851 79.424  13.406 1.00 40.00 ? 349 ASP A C   1 
ATOM 2636 O O   . ASP A 1 346 ? 48.606 79.614  12.423 1.00 40.00 ? 349 ASP A O   1 
ATOM 2637 C CB  . ASP A 1 346 ? 48.036 81.633  14.669 1.00 40.00 ? 349 ASP A CB  1 
ATOM 2638 C CG  . ASP A 1 346 ? 47.319 82.989  14.758 1.00 40.00 ? 349 ASP A CG  1 
ATOM 2639 O OD1 . ASP A 1 346 ? 46.618 83.408  13.806 1.00 40.00 ? 349 ASP A OD1 1 
ATOM 2640 O OD2 . ASP A 1 346 ? 47.462 83.632  15.824 1.00 40.00 ? 349 ASP A OD2 1 
ATOM 2641 N N   . ASN A 1 347 ? 47.629 78.223  13.934 1.00 40.00 ? 350 ASN A N   1 
ATOM 2642 C CA  . ASN A 1 347 ? 48.224 77.002  13.377 1.00 40.00 ? 350 ASN A CA  1 
ATOM 2643 C C   . ASN A 1 347 ? 47.084 76.006  13.163 1.00 40.00 ? 350 ASN A C   1 
ATOM 2644 O O   . ASN A 1 347 ? 45.930 76.289  13.510 1.00 40.00 ? 350 ASN A O   1 
ATOM 2645 C CB  . ASN A 1 347 ? 49.285 76.402  14.258 1.00 40.00 ? 350 ASN A CB  1 
ATOM 2646 C CG  . ASN A 1 347 ? 48.785 76.249  15.689 1.00 40.00 ? 350 ASN A CG  1 
ATOM 2647 O OD1 . ASN A 1 347 ? 47.571 76.260  15.904 1.00 40.00 ? 350 ASN A OD1 1 
ATOM 2648 N ND2 . ASN A 1 347 ? 49.746 76.120  16.573 1.00 40.00 ? 350 ASN A ND2 1 
ATOM 2649 N N   . GLU A 1 348 ? 47.384 74.824  12.662 1.00 40.00 ? 351 GLU A N   1 
ATOM 2650 C CA  . GLU A 1 348 ? 46.401 73.791  12.363 1.00 40.00 ? 351 GLU A CA  1 
ATOM 2651 C C   . GLU A 1 348 ? 45.908 73.059  13.594 1.00 40.00 ? 351 GLU A C   1 
ATOM 2652 O O   . GLU A 1 348 ? 45.040 72.173  13.532 1.00 40.00 ? 351 GLU A O   1 
ATOM 2653 C CB  . GLU A 1 348 ? 47.037 72.798  11.382 1.00 40.00 ? 351 GLU A CB  1 
ATOM 2654 C CG  . GLU A 1 348 ? 47.215 73.350  9.974  1.00 40.00 ? 351 GLU A CG  1 
ATOM 2655 C CD  . GLU A 1 348 ? 47.147 72.215  8.953  1.00 40.00 ? 351 GLU A CD  1 
ATOM 2656 O OE1 . GLU A 1 348 ? 46.035 71.930  8.430  1.00 40.00 ? 351 GLU A OE1 1 
ATOM 2657 O OE2 . GLU A 1 348 ? 48.219 71.619  8.705  1.00 40.00 ? 351 GLU A OE2 1 
ATOM 2658 N N   . SER A 1 349 ? 46.471 73.428  14.746 1.00 40.00 ? 352 SER A N   1 
ATOM 2659 C CA  . SER A 1 349 ? 46.069 72.848  16.014 1.00 40.00 ? 352 SER A CA  1 
ATOM 2660 C C   . SER A 1 349 ? 45.973 71.329  15.932 1.00 40.00 ? 352 SER A C   1 
ATOM 2661 O O   . SER A 1 349 ? 44.961 70.711  16.287 1.00 40.00 ? 352 SER A O   1 
ATOM 2662 C CB  . SER A 1 349 ? 44.767 73.470  16.515 1.00 40.00 ? 352 SER A CB  1 
ATOM 2663 O OG  . SER A 1 349 ? 44.441 74.704  15.914 1.00 40.00 ? 352 SER A OG  1 
ATOM 2664 N N   . LEU A 1 350 ? 47.046 70.702  15.435 1.00 40.00 ? 353 LEU A N   1 
ATOM 2665 C CA  . LEU A 1 350 ? 47.087 69.239  15.395 1.00 40.00 ? 353 LEU A CA  1 
ATOM 2666 C C   . LEU A 1 350 ? 47.542 68.827  16.804 1.00 40.00 ? 353 LEU A C   1 
ATOM 2667 O O   . LEU A 1 350 ? 48.734 68.743  17.089 1.00 40.00 ? 353 LEU A O   1 
ATOM 2668 C CB  . LEU A 1 350 ? 48.005 68.705  14.338 1.00 40.00 ? 353 LEU A CB  1 
ATOM 2669 C CG  . LEU A 1 350 ? 47.572 68.560  12.890 1.00 40.00 ? 353 LEU A CG  1 
ATOM 2670 C CD1 . LEU A 1 350 ? 46.104 68.868  12.626 1.00 40.00 ? 353 LEU A CD1 1 
ATOM 2671 C CD2 . LEU A 1 350 ? 48.455 69.425  11.978 1.00 40.00 ? 353 LEU A CD2 1 
ATOM 2672 N N   . ILE A 1 351 ? 46.596 68.613  17.693 1.00 40.00 ? 354 ILE A N   1 
ATOM 2673 C CA  . ILE A 1 351 ? 46.888 68.260  19.070 1.00 40.00 ? 354 ILE A CA  1 
ATOM 2674 C C   . ILE A 1 351 ? 47.341 66.830  19.320 1.00 40.00 ? 354 ILE A C   1 
ATOM 2675 O O   . ILE A 1 351 ? 47.152 65.885  18.559 1.00 40.00 ? 354 ILE A O   1 
ATOM 2676 C CB  . ILE A 1 351 ? 45.619 68.555  19.911 1.00 40.00 ? 354 ILE A CB  1 
ATOM 2677 C CG1 . ILE A 1 351 ? 44.540 67.518  19.573 1.00 40.00 ? 354 ILE A CG1 1 
ATOM 2678 C CG2 . ILE A 1 351 ? 45.095 69.944  19.541 1.00 40.00 ? 354 ILE A CG2 1 
ATOM 2679 C CD1 . ILE A 1 351 ? 43.580 67.212  20.700 1.00 40.00 ? 354 ILE A CD1 1 
ATOM 2680 N N   . SER A 1 352 ? 47.982 66.646  20.461 1.00 40.00 ? 355 SER A N   1 
ATOM 2681 C CA  . SER A 1 352 ? 48.482 65.411  21.009 1.00 40.00 ? 355 SER A CA  1 
ATOM 2682 C C   . SER A 1 352 ? 47.318 64.634  21.625 1.00 40.00 ? 355 SER A C   1 
ATOM 2683 O O   . SER A 1 352 ? 46.274 65.257  21.809 1.00 40.00 ? 355 SER A O   1 
ATOM 2684 C CB  . SER A 1 352 ? 49.401 65.724  22.216 1.00 40.00 ? 355 SER A CB  1 
ATOM 2685 O OG  . SER A 1 352 ? 48.774 65.309  23.434 1.00 40.00 ? 355 SER A OG  1 
ATOM 2686 N N   . ARG A 1 353 ? 47.530 63.385  22.023 1.00 40.00 ? 356 ARG A N   1 
ATOM 2687 C CA  . ARG A 1 353 ? 46.428 62.675  22.667 1.00 40.00 ? 356 ARG A CA  1 
ATOM 2688 C C   . ARG A 1 353 ? 46.168 63.256  24.049 1.00 40.00 ? 356 ARG A C   1 
ATOM 2689 O O   . ARG A 1 353 ? 45.062 63.674  24.409 1.00 40.00 ? 356 ARG A O   1 
ATOM 2690 C CB  . ARG A 1 353 ? 46.664 61.179  22.788 1.00 40.00 ? 356 ARG A CB  1 
ATOM 2691 C CG  . ARG A 1 353 ? 45.357 60.396  22.547 1.00 40.00 ? 356 ARG A CG  1 
ATOM 2692 C CD  . ARG A 1 353 ? 45.467 58.988  23.085 1.00 40.00 ? 356 ARG A CD  1 
ATOM 2693 N NE  . ARG A 1 353 ? 44.273 58.509  23.763 1.00 40.00 ? 356 ARG A NE  1 
ATOM 2694 C CZ  . ARG A 1 353 ? 43.108 58.347  23.124 1.00 40.00 ? 356 ARG A CZ  1 
ATOM 2695 N NH1 . ARG A 1 353 ? 43.031 58.641  21.835 1.00 40.00 ? 356 ARG A NH1 1 
ATOM 2696 N NH2 . ARG A 1 353 ? 42.051 57.908  23.795 1.00 40.00 ? 356 ARG A NH2 1 
ATOM 2697 N N   . ALA A 1 354 ? 47.222 63.345  24.852 1.00 40.00 ? 357 ALA A N   1 
ATOM 2698 C CA  . ALA A 1 354 ? 47.127 63.896  26.202 1.00 40.00 ? 357 ALA A CA  1 
ATOM 2699 C C   . ALA A 1 354 ? 46.411 65.245  26.206 1.00 40.00 ? 357 ALA A C   1 
ATOM 2700 O O   . ALA A 1 354 ? 45.638 65.568  27.117 1.00 40.00 ? 357 ALA A O   1 
ATOM 2701 C CB  . ALA A 1 354 ? 48.491 64.032  26.836 1.00 40.00 ? 357 ALA A CB  1 
ATOM 2702 N N   . GLN A 1 355 ? 46.681 66.055  25.185 1.00 40.00 ? 358 GLN A N   1 
ATOM 2703 C CA  . GLN A 1 355 ? 45.995 67.338  25.073 1.00 40.00 ? 358 GLN A CA  1 
ATOM 2704 C C   . GLN A 1 355 ? 44.497 67.023  24.951 1.00 40.00 ? 358 GLN A C   1 
ATOM 2705 O O   . GLN A 1 355 ? 43.656 67.439  25.753 1.00 40.00 ? 358 GLN A O   1 
ATOM 2706 C CB  . GLN A 1 355 ? 46.492 68.135  23.865 1.00 40.00 ? 358 GLN A CB  1 
ATOM 2707 C CG  . GLN A 1 355 ? 47.889 68.692  24.073 1.00 40.00 ? 358 GLN A CG  1 
ATOM 2708 C CD  . GLN A 1 355 ? 48.454 69.460  22.901 1.00 40.00 ? 358 GLN A CD  1 
ATOM 2709 O OE1 . GLN A 1 355 ? 48.292 69.161  21.713 1.00 40.00 ? 358 GLN A OE1 1 
ATOM 2710 N NE2 . GLN A 1 355 ? 49.183 70.531  23.245 1.00 40.00 ? 358 GLN A NE2 1 
ATOM 2711 N N   . PHE A 1 356 ? 44.164 66.202  23.949 1.00 40.00 ? 359 PHE A N   1 
ATOM 2712 C CA  . PHE A 1 356 ? 42.772 65.789  23.779 1.00 40.00 ? 359 PHE A CA  1 
ATOM 2713 C C   . PHE A 1 356 ? 42.180 65.230  25.076 1.00 40.00 ? 359 PHE A C   1 
ATOM 2714 O O   . PHE A 1 356 ? 41.032 65.541  25.427 1.00 40.00 ? 359 PHE A O   1 
ATOM 2715 C CB  . PHE A 1 356 ? 42.652 64.766  22.650 1.00 40.00 ? 359 PHE A CB  1 
ATOM 2716 C CG  . PHE A 1 356 ? 41.294 64.122  22.572 1.00 40.00 ? 359 PHE A CG  1 
ATOM 2717 C CD1 . PHE A 1 356 ? 40.994 63.018  23.355 1.00 40.00 ? 359 PHE A CD1 1 
ATOM 2718 C CD2 . PHE A 1 356 ? 40.329 64.626  21.725 1.00 40.00 ? 359 PHE A CD2 1 
ATOM 2719 C CE1 . PHE A 1 356 ? 39.748 62.413  23.303 1.00 40.00 ? 359 PHE A CE1 1 
ATOM 2720 C CE2 . PHE A 1 356 ? 39.087 64.030  21.681 1.00 40.00 ? 359 PHE A CE2 1 
ATOM 2721 C CZ  . PHE A 1 356 ? 38.792 62.929  22.465 1.00 40.00 ? 359 PHE A CZ  1 
ATOM 2722 N N   . LEU A 1 357 ? 42.926 64.385  25.815 1.00 40.00 ? 360 LEU A N   1 
ATOM 2723 C CA  . LEU A 1 357 ? 42.375 63.891  27.073 1.00 40.00 ? 360 LEU A CA  1 
ATOM 2724 C C   . LEU A 1 357 ? 42.017 65.045  28.008 1.00 40.00 ? 360 LEU A C   1 
ATOM 2725 O O   . LEU A 1 357 ? 41.017 64.979  28.723 1.00 40.00 ? 360 LEU A O   1 
ATOM 2726 C CB  . LEU A 1 357 ? 43.330 62.980  27.809 1.00 40.00 ? 360 LEU A CB  1 
ATOM 2727 C CG  . LEU A 1 357 ? 43.418 61.505  27.437 1.00 40.00 ? 360 LEU A CG  1 
ATOM 2728 C CD1 . LEU A 1 357 ? 42.184 61.032  26.671 1.00 40.00 ? 360 LEU A CD1 1 
ATOM 2729 C CD2 . LEU A 1 357 ? 44.663 61.272  26.577 1.00 40.00 ? 360 LEU A CD2 1 
ATOM 2730 N N   . ALA A 1 358 ? 42.856 66.073  28.037 1.00 40.00 ? 361 ALA A N   1 
ATOM 2731 C CA  . ALA A 1 358 ? 42.611 67.220  28.921 1.00 40.00 ? 361 ALA A CA  1 
ATOM 2732 C C   . ALA A 1 358 ? 41.444 68.065  28.415 1.00 40.00 ? 361 ALA A C   1 
ATOM 2733 O O   . ALA A 1 358 ? 40.597 68.550  29.157 1.00 40.00 ? 361 ALA A O   1 
ATOM 2734 C CB  . ALA A 1 358 ? 43.854 68.068  28.951 1.00 40.00 ? 361 ALA A CB  1 
ATOM 2735 N N   . GLY A 1 359 ? 41.435 68.193  27.079 1.00 40.00 ? 362 GLY A N   1 
ATOM 2736 C CA  . GLY A 1 359 ? 40.390 68.984  26.434 1.00 40.00 ? 362 GLY A CA  1 
ATOM 2737 C C   . GLY A 1 359 ? 39.063 68.474  26.974 1.00 40.00 ? 362 GLY A C   1 
ATOM 2738 O O   . GLY A 1 359 ? 38.219 69.189  27.510 1.00 40.00 ? 362 GLY A O   1 
ATOM 2739 N N   . VAL A 1 360 ? 38.900 67.154  26.866 1.00 40.00 ? 363 VAL A N   1 
ATOM 2740 C CA  . VAL A 1 360 ? 37.662 66.531  27.319 1.00 40.00 ? 363 VAL A CA  1 
ATOM 2741 C C   . VAL A 1 360 ? 37.279 67.004  28.699 1.00 40.00 ? 363 VAL A C   1 
ATOM 2742 O O   . VAL A 1 360 ? 36.075 67.245  28.952 1.00 40.00 ? 363 VAL A O   1 
ATOM 2743 C CB  . VAL A 1 360 ? 37.689 65.007  27.196 1.00 40.00 ? 363 VAL A CB  1 
ATOM 2744 C CG1 . VAL A 1 360 ? 36.519 64.385  27.939 1.00 40.00 ? 363 VAL A CG1 1 
ATOM 2745 C CG2 . VAL A 1 360 ? 37.633 64.602  25.717 1.00 40.00 ? 363 VAL A CG2 1 
ATOM 2746 N N   . ARG A 1 361 ? 38.216 67.200  29.624 1.00 40.00 ? 364 ARG A N   1 
ATOM 2747 C CA  . ARG A 1 361 ? 37.789 67.664  30.955 1.00 40.00 ? 364 ARG A CA  1 
ATOM 2748 C C   . ARG A 1 361 ? 37.436 69.133  30.976 1.00 40.00 ? 364 ARG A C   1 
ATOM 2749 O O   . ARG A 1 361 ? 36.603 69.587  31.794 1.00 40.00 ? 364 ARG A O   1 
ATOM 2750 C CB  . ARG A 1 361 ? 38.819 67.250  31.983 1.00 40.00 ? 364 ARG A CB  1 
ATOM 2751 C CG  . ARG A 1 361 ? 39.500 65.933  31.625 1.00 40.00 ? 364 ARG A CG  1 
ATOM 2752 C CD  . ARG A 1 361 ? 38.654 64.745  31.962 1.00 40.00 ? 364 ARG A CD  1 
ATOM 2753 N NE  . ARG A 1 361 ? 37.685 64.900  33.047 1.00 40.00 ? 364 ARG A NE  1 
ATOM 2754 C CZ  . ARG A 1 361 ? 37.823 64.236  34.207 1.00 40.00 ? 364 ARG A CZ  1 
ATOM 2755 N NH1 . ARG A 1 361 ? 38.881 63.446  34.370 1.00 40.00 ? 364 ARG A NH1 1 
ATOM 2756 N NH2 . ARG A 1 361 ? 36.925 64.379  35.169 1.00 40.00 ? 364 ARG A NH2 1 
ATOM 2757 N N   . ILE A 1 362 ? 38.003 69.939  30.094 1.00 40.00 ? 365 ILE A N   1 
ATOM 2758 C CA  . ILE A 1 362 ? 37.648 71.371  30.082 1.00 40.00 ? 365 ILE A CA  1 
ATOM 2759 C C   . ILE A 1 362 ? 36.275 71.522  29.423 1.00 40.00 ? 365 ILE A C   1 
ATOM 2760 O O   . ILE A 1 362 ? 35.358 72.179  29.904 1.00 40.00 ? 365 ILE A O   1 
ATOM 2761 C CB  . ILE A 1 362 ? 38.682 72.104  29.231 1.00 40.00 ? 365 ILE A CB  1 
ATOM 2762 C CG1 . ILE A 1 362 ? 39.963 72.362  30.044 1.00 40.00 ? 365 ILE A CG1 1 
ATOM 2763 C CG2 . ILE A 1 362 ? 38.156 73.403  28.650 1.00 40.00 ? 365 ILE A CG2 1 
ATOM 2764 C CD1 . ILE A 1 362 ? 41.066 72.811  29.118 1.00 40.00 ? 365 ILE A CD1 1 
ATOM 2765 N N   . GLY A 1 363 ? 36.181 70.862  28.268 1.00 40.00 ? 366 GLY A N   1 
ATOM 2766 C CA  . GLY A 1 363 ? 34.975 70.842  27.464 1.00 40.00 ? 366 GLY A CA  1 
ATOM 2767 C C   . GLY A 1 363 ? 33.787 70.182  28.127 1.00 40.00 ? 366 GLY A C   1 
ATOM 2768 O O   . GLY A 1 363 ? 32.668 70.530  27.754 1.00 40.00 ? 366 GLY A O   1 
ATOM 2769 N N   . VAL A 1 364 ? 33.932 69.321  29.125 1.00 40.00 ? 367 VAL A N   1 
ATOM 2770 C CA  . VAL A 1 364 ? 32.832 68.644  29.814 1.00 40.00 ? 367 VAL A CA  1 
ATOM 2771 C C   . VAL A 1 364 ? 33.171 68.696  31.295 1.00 40.00 ? 367 VAL A C   1 
ATOM 2772 O O   . VAL A 1 364 ? 33.441 67.716  32.010 1.00 40.00 ? 367 VAL A O   1 
ATOM 2773 C CB  . VAL A 1 364 ? 32.829 67.152  29.400 1.00 40.00 ? 367 VAL A CB  1 
ATOM 2774 C CG1 . VAL A 1 364 ? 31.523 66.507  29.834 1.00 40.00 ? 367 VAL A CG1 1 
ATOM 2775 C CG2 . VAL A 1 364 ? 33.096 66.964  27.921 1.00 40.00 ? 367 VAL A CG2 1 
ATOM 2776 N N   . PRO A 1 365 ? 33.211 69.932  31.792 1.00 40.00 ? 368 PRO A N   1 
ATOM 2777 C CA  . PRO A 1 365 ? 33.618 70.219  33.159 1.00 40.00 ? 368 PRO A CA  1 
ATOM 2778 C C   . PRO A 1 365 ? 32.811 69.532  34.218 1.00 40.00 ? 368 PRO A C   1 
ATOM 2779 O O   . PRO A 1 365 ? 33.285 69.352  35.349 1.00 40.00 ? 368 PRO A O   1 
ATOM 2780 C CB  . PRO A 1 365 ? 33.389 71.730  33.304 1.00 40.00 ? 368 PRO A CB  1 
ATOM 2781 C CG  . PRO A 1 365 ? 32.355 72.013  32.269 1.00 40.00 ? 368 PRO A CG  1 
ATOM 2782 C CD  . PRO A 1 365 ? 32.894 71.197  31.096 1.00 40.00 ? 368 PRO A CD  1 
ATOM 2783 N N   . GLN A 1 366 ? 31.569 69.202  33.912 1.00 40.00 ? 369 GLN A N   1 
ATOM 2784 C CA  . GLN A 1 366 ? 30.725 68.582  34.928 1.00 40.00 ? 369 GLN A CA  1 
ATOM 2785 C C   . GLN A 1 366 ? 30.979 67.084  34.986 1.00 40.00 ? 369 GLN A C   1 
ATOM 2786 O O   . GLN A 1 366 ? 30.443 66.409  35.875 1.00 40.00 ? 369 GLN A O   1 
ATOM 2787 C CB  . GLN A 1 366 ? 29.242 68.791  34.592 1.00 40.00 ? 369 GLN A CB  1 
ATOM 2788 C CG  . GLN A 1 366 ? 28.808 67.962  33.386 1.00 40.00 ? 369 GLN A CG  1 
ATOM 2789 C CD  . GLN A 1 366 ? 29.017 68.650  32.065 1.00 40.00 ? 369 GLN A CD  1 
ATOM 2790 O OE1 . GLN A 1 366 ? 30.092 69.154  31.749 1.00 40.00 ? 369 GLN A OE1 1 
ATOM 2791 N NE2 . GLN A 1 366 ? 27.961 68.685  31.239 1.00 40.00 ? 369 GLN A NE2 1 
ATOM 2792 N N   . ALA A 1 367 ? 31.750 66.581  34.012 1.00 40.00 ? 370 ALA A N   1 
ATOM 2793 C CA  . ALA A 1 367 ? 31.947 65.157  33.984 1.00 40.00 ? 370 ALA A CA  1 
ATOM 2794 C C   . ALA A 1 367 ? 32.843 64.612  35.060 1.00 40.00 ? 370 ALA A C   1 
ATOM 2795 O O   . ALA A 1 367 ? 33.969 65.040  35.281 1.00 40.00 ? 370 ALA A O   1 
ATOM 2796 C CB  . ALA A 1 367 ? 32.469 64.702  32.619 1.00 40.00 ? 370 ALA A CB  1 
ATOM 2797 N N   . SER A 1 368 ? 32.345 63.540  35.670 1.00 40.00 ? 371 SER A N   1 
ATOM 2798 C CA  . SER A 1 368 ? 33.196 62.769  36.600 1.00 40.00 ? 371 SER A CA  1 
ATOM 2799 C C   . SER A 1 368 ? 34.265 62.073  35.751 1.00 40.00 ? 371 SER A C   1 
ATOM 2800 O O   . SER A 1 368 ? 34.272 62.178  34.515 1.00 40.00 ? 371 SER A O   1 
ATOM 2801 C CB  . SER A 1 368 ? 32.337 61.713  37.294 1.00 40.00 ? 371 SER A CB  1 
ATOM 2802 O OG  . SER A 1 368 ? 32.054 60.591  36.468 1.00 40.00 ? 371 SER A OG  1 
ATOM 2803 N N   . ASP A 1 369 ? 35.151 61.298  36.381 1.00 40.00 ? 372 ASP A N   1 
ATOM 2804 C CA  . ASP A 1 369 ? 36.180 60.598  35.595 1.00 40.00 ? 372 ASP A CA  1 
ATOM 2805 C C   . ASP A 1 369 ? 35.555 59.556  34.676 1.00 40.00 ? 372 ASP A C   1 
ATOM 2806 O O   . ASP A 1 369 ? 35.755 59.569  33.464 1.00 40.00 ? 372 ASP A O   1 
ATOM 2807 C CB  . ASP A 1 369 ? 37.216 59.898  36.451 1.00 40.00 ? 372 ASP A CB  1 
ATOM 2808 C CG  . ASP A 1 369 ? 38.032 60.857  37.281 1.00 40.00 ? 372 ASP A CG  1 
ATOM 2809 O OD1 . ASP A 1 369 ? 38.672 61.732  36.671 1.00 40.00 ? 372 ASP A OD1 1 
ATOM 2810 O OD2 . ASP A 1 369 ? 37.992 60.710  38.517 1.00 40.00 ? 372 ASP A OD2 1 
ATOM 2811 N N   . LEU A 1 370 ? 34.778 58.655  35.285 1.00 40.00 ? 373 LEU A N   1 
ATOM 2812 C CA  . LEU A 1 370 ? 34.126 57.626  34.490 1.00 40.00 ? 373 LEU A CA  1 
ATOM 2813 C C   . LEU A 1 370 ? 33.416 58.257  33.300 1.00 40.00 ? 373 LEU A C   1 
ATOM 2814 O O   . LEU A 1 370 ? 33.598 57.812  32.156 1.00 40.00 ? 373 LEU A O   1 
ATOM 2815 C CB  . LEU A 1 370 ? 33.143 56.878  35.362 1.00 40.00 ? 373 LEU A CB  1 
ATOM 2816 C CG  . LEU A 1 370 ? 32.746 55.474  34.919 1.00 40.00 ? 373 LEU A CG  1 
ATOM 2817 C CD1 . LEU A 1 370 ? 33.925 54.677  34.417 1.00 40.00 ? 373 LEU A CD1 1 
ATOM 2818 C CD2 . LEU A 1 370 ? 32.074 54.772  36.105 1.00 40.00 ? 373 LEU A CD2 1 
ATOM 2819 N N   . ALA A 1 371 ? 32.620 59.318  33.567 1.00 40.00 ? 374 ALA A N   1 
ATOM 2820 C CA  . ALA A 1 371 ? 31.907 59.944  32.443 1.00 40.00 ? 374 ALA A CA  1 
ATOM 2821 C C   . ALA A 1 371 ? 32.890 60.478  31.420 1.00 40.00 ? 374 ALA A C   1 
ATOM 2822 O O   . ALA A 1 371 ? 32.720 60.313  30.210 1.00 40.00 ? 374 ALA A O   1 
ATOM 2823 C CB  . ALA A 1 371 ? 30.957 60.998  32.929 1.00 40.00 ? 374 ALA A CB  1 
ATOM 2824 N N   . ALA A 1 372 ? 33.966 61.086  31.886 1.00 40.00 ? 375 ALA A N   1 
ATOM 2825 C CA  . ALA A 1 372 ? 34.977 61.553  30.926 1.00 40.00 ? 375 ALA A CA  1 
ATOM 2826 C C   . ALA A 1 372 ? 35.463 60.361  30.102 1.00 40.00 ? 375 ALA A C   1 
ATOM 2827 O O   . ALA A 1 372 ? 35.576 60.421  28.882 1.00 40.00 ? 375 ALA A O   1 
ATOM 2828 C CB  . ALA A 1 372 ? 36.156 62.148  31.680 1.00 40.00 ? 375 ALA A CB  1 
ATOM 2829 N N   . GLU A 1 373 ? 35.752 59.253  30.792 1.00 40.00 ? 376 GLU A N   1 
ATOM 2830 C CA  . GLU A 1 373 ? 36.202 58.039  30.120 1.00 40.00 ? 376 GLU A CA  1 
ATOM 2831 C C   . GLU A 1 373 ? 35.211 57.706  29.009 1.00 40.00 ? 376 GLU A C   1 
ATOM 2832 O O   . GLU A 1 373 ? 35.548 57.547  27.827 1.00 40.00 ? 376 GLU A O   1 
ATOM 2833 C CB  . GLU A 1 373 ? 36.319 56.905  31.125 1.00 40.00 ? 376 GLU A CB  1 
ATOM 2834 C CG  . GLU A 1 373 ? 37.603 56.065  30.996 1.00 40.00 ? 376 GLU A CG  1 
ATOM 2835 C CD  . GLU A 1 373 ? 38.510 56.333  32.181 1.00 40.00 ? 376 GLU A CD  1 
ATOM 2836 O OE1 . GLU A 1 373 ? 38.088 55.956  33.307 1.00 40.00 ? 376 GLU A OE1 1 
ATOM 2837 O OE2 . GLU A 1 373 ? 39.603 56.927  32.014 1.00 40.00 ? 376 GLU A OE2 1 
ATOM 2838 N N   . ALA A 1 374 ? 33.931 57.638  29.384 1.00 40.00 ? 377 ALA A N   1 
ATOM 2839 C CA  . ALA A 1 374 ? 32.870 57.374  28.409 1.00 40.00 ? 377 ALA A CA  1 
ATOM 2840 C C   . ALA A 1 374 ? 33.030 58.279  27.181 1.00 40.00 ? 377 ALA A C   1 
ATOM 2841 O O   . ALA A 1 374 ? 33.084 57.791  26.038 1.00 40.00 ? 377 ALA A O   1 
ATOM 2842 C CB  . ALA A 1 374 ? 31.490 57.583  28.994 1.00 40.00 ? 377 ALA A CB  1 
ATOM 2843 N N   . VAL A 1 375 ? 33.146 59.597  27.431 1.00 40.00 ? 378 VAL A N   1 
ATOM 2844 C CA  . VAL A 1 375 ? 33.324 60.497  26.295 1.00 40.00 ? 378 VAL A CA  1 
ATOM 2845 C C   . VAL A 1 375 ? 34.571 60.172  25.492 1.00 40.00 ? 378 VAL A C   1 
ATOM 2846 O O   . VAL A 1 375 ? 34.573 60.184  24.242 1.00 40.00 ? 378 VAL A O   1 
ATOM 2847 C CB  . VAL A 1 375 ? 33.391 61.952  26.788 1.00 40.00 ? 378 VAL A CB  1 
ATOM 2848 C CG1 . VAL A 1 375 ? 33.455 62.896  25.592 1.00 40.00 ? 378 VAL A CG1 1 
ATOM 2849 C CG2 . VAL A 1 375 ? 32.177 62.218  27.666 1.00 40.00 ? 378 VAL A CG2 1 
ATOM 2850 N N   . VAL A 1 376 ? 35.679 59.861  26.173 1.00 40.00 ? 379 VAL A N   1 
ATOM 2851 C CA  . VAL A 1 376 ? 36.876 59.572  25.391 1.00 40.00 ? 379 VAL A CA  1 
ATOM 2852 C C   . VAL A 1 376 ? 36.703 58.331  24.530 1.00 40.00 ? 379 VAL A C   1 
ATOM 2853 O O   . VAL A 1 376 ? 37.159 58.267  23.389 1.00 40.00 ? 379 VAL A O   1 
ATOM 2854 C CB  . VAL A 1 376 ? 38.139 59.420  26.242 1.00 40.00 ? 379 VAL A CB  1 
ATOM 2855 C CG1 . VAL A 1 376 ? 39.305 59.155  25.302 1.00 40.00 ? 379 VAL A CG1 1 
ATOM 2856 C CG2 . VAL A 1 376 ? 38.368 60.686  27.050 1.00 40.00 ? 379 VAL A CG2 1 
ATOM 2857 N N   . LEU A 1 377 ? 36.024 57.349  25.142 1.00 40.00 ? 380 LEU A N   1 
ATOM 2858 C CA  . LEU A 1 377 ? 35.762 56.084  24.445 1.00 40.00 ? 380 LEU A CA  1 
ATOM 2859 C C   . LEU A 1 377 ? 35.030 56.424  23.143 1.00 40.00 ? 380 LEU A C   1 
ATOM 2860 O O   . LEU A 1 377 ? 35.386 56.047  22.054 1.00 40.00 ? 380 LEU A O   1 
ATOM 2861 C CB  . LEU A 1 377 ? 34.777 55.236  25.232 1.00 40.00 ? 380 LEU A CB  1 
ATOM 2862 C CG  . LEU A 1 377 ? 34.565 53.787  24.863 1.00 40.00 ? 380 LEU A CG  1 
ATOM 2863 C CD1 . LEU A 1 377 ? 33.099 53.400  24.999 1.00 40.00 ? 380 LEU A CD1 1 
ATOM 2864 C CD2 . LEU A 1 377 ? 35.106 53.396  23.510 1.00 40.00 ? 380 LEU A CD2 1 
ATOM 2865 N N   . HIS A 1 378 ? 33.951 57.185  23.381 1.00 40.00 ? 381 HIS A N   1 
ATOM 2866 C CA  . HIS A 1 378 ? 33.127 57.538  22.242 1.00 40.00 ? 381 HIS A CA  1 
ATOM 2867 C C   . HIS A 1 378 ? 33.819 58.332  21.158 1.00 40.00 ? 381 HIS A C   1 
ATOM 2868 O O   . HIS A 1 378 ? 33.508 58.054  19.986 1.00 40.00 ? 381 HIS A O   1 
ATOM 2869 C CB  . HIS A 1 378 ? 31.863 58.271  22.670 1.00 40.00 ? 381 HIS A CB  1 
ATOM 2870 C CG  . HIS A 1 378 ? 30.858 58.352  21.566 1.00 40.00 ? 381 HIS A CG  1 
ATOM 2871 N ND1 . HIS A 1 378 ? 29.861 57.424  21.382 1.00 40.00 ? 381 HIS A ND1 1 
ATOM 2872 C CD2 . HIS A 1 378 ? 30.716 59.270  20.586 1.00 40.00 ? 381 HIS A CD2 1 
ATOM 2873 C CE1 . HIS A 1 378 ? 29.127 57.785  20.330 1.00 40.00 ? 381 HIS A CE1 1 
ATOM 2874 N NE2 . HIS A 1 378 ? 29.623 58.899  19.820 1.00 40.00 ? 381 HIS A NE2 1 
ATOM 2875 N N   . TYR A 1 379 ? 34.678 59.306  21.502 1.00 40.00 ? 382 TYR A N   1 
ATOM 2876 C CA  . TYR A 1 379 ? 35.254 60.084  20.394 1.00 40.00 ? 382 TYR A CA  1 
ATOM 2877 C C   . TYR A 1 379 ? 36.614 59.632  19.934 1.00 40.00 ? 382 TYR A C   1 
ATOM 2878 O O   . TYR A 1 379 ? 37.104 60.115  18.879 1.00 40.00 ? 382 TYR A O   1 
ATOM 2879 C CB  . TYR A 1 379 ? 35.191 61.548  20.764 1.00 40.00 ? 382 TYR A CB  1 
ATOM 2880 C CG  . TYR A 1 379 ? 33.811 62.157  20.811 1.00 40.00 ? 382 TYR A CG  1 
ATOM 2881 C CD1 . TYR A 1 379 ? 33.332 62.923  19.739 1.00 40.00 ? 382 TYR A CD1 1 
ATOM 2882 C CD2 . TYR A 1 379 ? 32.988 61.996  21.918 1.00 40.00 ? 382 TYR A CD2 1 
ATOM 2883 C CE1 . TYR A 1 379 ? 32.101 63.510  19.760 1.00 40.00 ? 382 TYR A CE1 1 
ATOM 2884 C CE2 . TYR A 1 379 ? 31.728 62.578  21.939 1.00 40.00 ? 382 TYR A CE2 1 
ATOM 2885 C CZ  . TYR A 1 379 ? 31.312 63.326  20.862 1.00 40.00 ? 382 TYR A CZ  1 
ATOM 2886 O OH  . TYR A 1 379 ? 30.037 63.888  20.902 1.00 40.00 ? 382 TYR A OH  1 
ATOM 2887 N N   . THR A 1 380 ? 37.273 58.716  20.647 1.00 40.00 ? 383 THR A N   1 
ATOM 2888 C CA  . THR A 1 380 ? 38.583 58.240  20.186 1.00 40.00 ? 383 THR A CA  1 
ATOM 2889 C C   . THR A 1 380 ? 38.445 57.359  18.936 1.00 40.00 ? 383 THR A C   1 
ATOM 2890 O O   . THR A 1 380 ? 37.493 56.572  18.889 1.00 40.00 ? 383 THR A O   1 
ATOM 2891 C CB  . THR A 1 380 ? 39.223 57.310  21.244 1.00 40.00 ? 383 THR A CB  1 
ATOM 2892 O OG1 . THR A 1 380 ? 39.542 58.009  22.449 1.00 40.00 ? 383 THR A OG1 1 
ATOM 2893 C CG2 . THR A 1 380 ? 40.460 56.646  20.659 1.00 40.00 ? 383 THR A CG2 1 
ATOM 2894 N N   . ASP A 1 381 ? 39.355 57.437  17.966 1.00 40.00 ? 384 ASP A N   1 
ATOM 2895 C CA  . ASP A 1 381 ? 39.242 56.483  16.847 1.00 40.00 ? 384 ASP A CA  1 
ATOM 2896 C C   . ASP A 1 381 ? 40.263 55.372  17.185 1.00 40.00 ? 384 ASP A C   1 
ATOM 2897 O O   . ASP A 1 381 ? 41.450 55.522  16.911 1.00 40.00 ? 384 ASP A O   1 
ATOM 2898 C CB  . ASP A 1 381 ? 39.550 57.042  15.484 1.00 40.00 ? 384 ASP A CB  1 
ATOM 2899 C CG  . ASP A 1 381 ? 39.871 55.931  14.488 1.00 40.00 ? 384 ASP A CG  1 
ATOM 2900 O OD1 . ASP A 1 381 ? 39.388 54.793  14.703 1.00 40.00 ? 384 ASP A OD1 1 
ATOM 2901 O OD2 . ASP A 1 381 ? 40.611 56.238  13.542 1.00 40.00 ? 384 ASP A OD2 1 
ATOM 2902 N N   . TRP A 1 382 ? 39.813 54.243  17.721 1.00 40.00 ? 385 TRP A N   1 
ATOM 2903 C CA  . TRP A 1 382 ? 40.693 53.172  18.140 1.00 40.00 ? 385 TRP A CA  1 
ATOM 2904 C C   . TRP A 1 382 ? 41.565 52.531  17.101 1.00 40.00 ? 385 TRP A C   1 
ATOM 2905 O O   . TRP A 1 382 ? 42.490 51.732  17.419 1.00 40.00 ? 385 TRP A O   1 
ATOM 2906 C CB  . TRP A 1 382 ? 39.919 52.171  18.986 1.00 40.00 ? 385 TRP A CB  1 
ATOM 2907 C CG  . TRP A 1 382 ? 39.227 52.863  20.119 1.00 40.00 ? 385 TRP A CG  1 
ATOM 2908 C CD1 . TRP A 1 382 ? 37.915 53.263  20.156 1.00 40.00 ? 385 TRP A CD1 1 
ATOM 2909 C CD2 . TRP A 1 382 ? 39.798 53.259  21.362 1.00 40.00 ? 385 TRP A CD2 1 
ATOM 2910 N NE1 . TRP A 1 382 ? 37.628 53.876  21.348 1.00 40.00 ? 385 TRP A NE1 1 
ATOM 2911 C CE2 . TRP A 1 382 ? 38.770 53.886  22.107 1.00 40.00 ? 385 TRP A CE2 1 
ATOM 2912 C CE3 . TRP A 1 382 ? 41.074 53.159  21.921 1.00 40.00 ? 385 TRP A CE3 1 
ATOM 2913 C CZ2 . TRP A 1 382 ? 38.985 54.398  23.383 1.00 40.00 ? 385 TRP A CZ2 1 
ATOM 2914 C CZ3 . TRP A 1 382 ? 41.281 53.668  23.190 1.00 40.00 ? 385 TRP A CZ3 1 
ATOM 2915 C CH2 . TRP A 1 382 ? 40.243 54.279  23.906 1.00 40.00 ? 385 TRP A CH2 1 
ATOM 2916 N N   . LEU A 1 383 ? 41.388 52.869  15.819 1.00 40.00 ? 386 LEU A N   1 
ATOM 2917 C CA  . LEU A 1 383 ? 42.334 52.350  14.837 1.00 40.00 ? 386 LEU A CA  1 
ATOM 2918 C C   . LEU A 1 383 ? 43.469 53.366  14.786 1.00 40.00 ? 386 LEU A C   1 
ATOM 2919 O O   . LEU A 1 383 ? 44.565 53.012  14.360 1.00 40.00 ? 386 LEU A O   1 
ATOM 2920 C CB  . LEU A 1 383 ? 41.722 52.073  13.513 1.00 40.00 ? 386 LEU A CB  1 
ATOM 2921 C CG  . LEU A 1 383 ? 42.222 50.944  12.631 1.00 40.00 ? 386 LEU A CG  1 
ATOM 2922 C CD1 . LEU A 1 383 ? 42.939 51.510  11.400 1.00 40.00 ? 386 LEU A CD1 1 
ATOM 2923 C CD2 . LEU A 1 383 ? 43.184 49.989  13.339 1.00 40.00 ? 386 LEU A CD2 1 
ATOM 2924 N N   . HIS A 1 384 ? 43.259 54.611  15.202 1.00 40.00 ? 387 HIS A N   1 
ATOM 2925 C CA  . HIS A 1 384 ? 44.331 55.637  15.204 1.00 40.00 ? 387 HIS A CA  1 
ATOM 2926 C C   . HIS A 1 384 ? 44.192 56.577  16.397 1.00 40.00 ? 387 HIS A C   1 
ATOM 2927 O O   . HIS A 1 384 ? 43.851 57.769  16.267 1.00 40.00 ? 387 HIS A O   1 
ATOM 2928 C CB  . HIS A 1 384 ? 44.177 56.468  13.925 1.00 40.00 ? 387 HIS A CB  1 
ATOM 2929 C CG  . HIS A 1 384 ? 44.132 55.727  12.636 1.00 40.00 ? 387 HIS A CG  1 
ATOM 2930 N ND1 . HIS A 1 384 ? 42.963 55.437  11.964 1.00 40.00 ? 387 HIS A ND1 1 
ATOM 2931 C CD2 . HIS A 1 384 ? 45.126 55.177  11.899 1.00 40.00 ? 387 HIS A CD2 1 
ATOM 2932 C CE1 . HIS A 1 384 ? 43.238 54.775  10.862 1.00 40.00 ? 387 HIS A CE1 1 
ATOM 2933 N NE2 . HIS A 1 384 ? 44.541 54.598  10.795 1.00 40.00 ? 387 HIS A NE2 1 
ATOM 2934 N N   . PRO A 1 385 ? 44.375 56.089  17.615 1.00 40.00 ? 388 PRO A N   1 
ATOM 2935 C CA  . PRO A 1 385 ? 44.138 56.844  18.819 1.00 40.00 ? 388 PRO A CA  1 
ATOM 2936 C C   . PRO A 1 385 ? 45.072 57.981  19.084 1.00 40.00 ? 388 PRO A C   1 
ATOM 2937 O O   . PRO A 1 385 ? 45.058 58.569  20.191 1.00 40.00 ? 388 PRO A O   1 
ATOM 2938 C CB  . PRO A 1 385 ? 44.261 55.795  19.931 1.00 40.00 ? 388 PRO A CB  1 
ATOM 2939 C CG  . PRO A 1 385 ? 45.260 54.835  19.367 1.00 40.00 ? 388 PRO A CG  1 
ATOM 2940 C CD  . PRO A 1 385 ? 44.770 54.693  17.924 1.00 40.00 ? 388 PRO A CD  1 
ATOM 2941 N N   . GLU A 1 386 ? 45.958 58.296  18.149 1.00 40.00 ? 389 GLU A N   1 
ATOM 2942 C CA  . GLU A 1 386 ? 46.916 59.360  18.299 1.00 40.00 ? 389 GLU A CA  1 
ATOM 2943 C C   . GLU A 1 386 ? 46.938 60.239  17.050 1.00 40.00 ? 389 GLU A C   1 
ATOM 2944 O O   . GLU A 1 386 ? 47.704 61.210  17.034 1.00 40.00 ? 389 GLU A O   1 
ATOM 2945 C CB  . GLU A 1 386 ? 48.333 58.896  18.552 1.00 40.00 ? 389 GLU A CB  1 
ATOM 2946 C CG  . GLU A 1 386 ? 48.505 57.549  19.191 1.00 40.00 ? 389 GLU A CG  1 
ATOM 2947 C CD  . GLU A 1 386 ? 48.908 57.635  20.646 1.00 40.00 ? 389 GLU A CD  1 
ATOM 2948 O OE1 . GLU A 1 386 ? 49.549 58.634  21.034 1.00 40.00 ? 389 GLU A OE1 1 
ATOM 2949 O OE2 . GLU A 1 386 ? 48.576 56.688  21.393 1.00 40.00 ? 389 GLU A OE2 1 
ATOM 2950 N N   . ASP A 1 387 ? 46.137 59.897  16.053 1.00 40.00 ? 390 ASP A N   1 
ATOM 2951 C CA  . ASP A 1 387 ? 46.167 60.783  14.855 1.00 40.00 ? 390 ASP A CA  1 
ATOM 2952 C C   . ASP A 1 387 ? 45.746 62.161  15.350 1.00 40.00 ? 390 ASP A C   1 
ATOM 2953 O O   . ASP A 1 387 ? 44.641 62.381  15.884 1.00 40.00 ? 390 ASP A O   1 
ATOM 2954 C CB  . ASP A 1 387 ? 45.270 60.154  13.826 1.00 40.00 ? 390 ASP A CB  1 
ATOM 2955 C CG  . ASP A 1 387 ? 44.891 61.114  12.724 1.00 40.00 ? 390 ASP A CG  1 
ATOM 2956 O OD1 . ASP A 1 387 ? 45.804 61.809  12.219 1.00 40.00 ? 390 ASP A OD1 1 
ATOM 2957 O OD2 . ASP A 1 387 ? 43.686 61.171  12.388 1.00 40.00 ? 390 ASP A OD2 1 
ATOM 2958 N N   . PRO A 1 388 ? 46.651 63.129  15.266 1.00 40.00 ? 391 PRO A N   1 
ATOM 2959 C CA  . PRO A 1 388 ? 46.399 64.491  15.734 1.00 40.00 ? 391 PRO A CA  1 
ATOM 2960 C C   . PRO A 1 388 ? 45.211 65.079  15.005 1.00 40.00 ? 391 PRO A C   1 
ATOM 2961 O O   . PRO A 1 388 ? 44.238 65.558  15.620 1.00 40.00 ? 391 PRO A O   1 
ATOM 2962 C CB  . PRO A 1 388 ? 47.699 65.216  15.473 1.00 40.00 ? 391 PRO A CB  1 
ATOM 2963 C CG  . PRO A 1 388 ? 48.305 64.454  14.326 1.00 40.00 ? 391 PRO A CG  1 
ATOM 2964 C CD  . PRO A 1 388 ? 47.980 63.010  14.634 1.00 40.00 ? 391 PRO A CD  1 
ATOM 2965 N N   . THR A 1 389 ? 45.192 65.001  13.679 1.00 40.00 ? 392 THR A N   1 
ATOM 2966 C CA  . THR A 1 389 ? 44.048 65.511  12.943 1.00 40.00 ? 392 THR A CA  1 
ATOM 2967 C C   . THR A 1 389 ? 42.714 64.980  13.462 1.00 40.00 ? 392 THR A C   1 
ATOM 2968 O O   . THR A 1 389 ? 41.707 65.708  13.479 1.00 40.00 ? 392 THR A O   1 
ATOM 2969 C CB  . THR A 1 389 ? 44.108 65.112  11.448 1.00 40.00 ? 392 THR A CB  1 
ATOM 2970 O OG1 . THR A 1 389 ? 45.200 65.787  10.815 1.00 40.00 ? 392 THR A OG1 1 
ATOM 2971 C CG2 . THR A 1 389 ? 42.804 65.502  10.760 1.00 40.00 ? 392 THR A CG2 1 
ATOM 2972 N N   . HIS A 1 390 ? 42.676 63.676  13.795 1.00 40.00 ? 393 HIS A N   1 
ATOM 2973 C CA  . HIS A 1 390 ? 41.402 63.133  14.265 1.00 40.00 ? 393 HIS A CA  1 
ATOM 2974 C C   . HIS A 1 390 ? 41.058 63.719  15.636 1.00 40.00 ? 393 HIS A C   1 
ATOM 2975 O O   . HIS A 1 390 ? 39.987 64.263  15.843 1.00 40.00 ? 393 HIS A O   1 
ATOM 2976 C CB  . HIS A 1 390 ? 41.359 61.613  14.313 1.00 40.00 ? 393 HIS A CB  1 
ATOM 2977 C CG  . HIS A 1 390 ? 39.983 61.160  14.718 1.00 40.00 ? 393 HIS A CG  1 
ATOM 2978 N ND1 . HIS A 1 390 ? 38.981 60.950  13.799 1.00 40.00 ? 393 HIS A ND1 1 
ATOM 2979 C CD2 . HIS A 1 390 ? 39.436 60.910  15.933 1.00 40.00 ? 393 HIS A CD2 1 
ATOM 2980 C CE1 . HIS A 1 390 ? 37.877 60.577  14.431 1.00 40.00 ? 393 HIS A CE1 1 
ATOM 2981 N NE2 . HIS A 1 390 ? 38.129 60.540  15.732 1.00 40.00 ? 393 HIS A NE2 1 
ATOM 2982 N N   . LEU A 1 391 ? 42.022 63.613  16.539 1.00 40.00 ? 394 LEU A N   1 
ATOM 2983 C CA  . LEU A 1 391 ? 41.912 64.165  17.883 1.00 40.00 ? 394 LEU A CA  1 
ATOM 2984 C C   . LEU A 1 391 ? 41.354 65.585  17.809 1.00 40.00 ? 394 LEU A C   1 
ATOM 2985 O O   . LEU A 1 391 ? 40.345 65.934  18.431 1.00 40.00 ? 394 LEU A O   1 
ATOM 2986 C CB  . LEU A 1 391 ? 43.353 64.202  18.429 1.00 40.00 ? 394 LEU A CB  1 
ATOM 2987 C CG  . LEU A 1 391 ? 43.856 62.812  18.846 1.00 40.00 ? 394 LEU A CG  1 
ATOM 2988 C CD1 . LEU A 1 391 ? 45.341 62.829  19.099 1.00 40.00 ? 394 LEU A CD1 1 
ATOM 2989 C CD2 . LEU A 1 391 ? 43.071 62.360  20.076 1.00 40.00 ? 394 LEU A CD2 1 
ATOM 2990 N N   . ARG A 1 392 ? 42.011 66.399  16.983 1.00 40.00 ? 395 ARG A N   1 
ATOM 2991 C CA  . ARG A 1 392 ? 41.595 67.773  16.777 1.00 40.00 ? 395 ARG A CA  1 
ATOM 2992 C C   . ARG A 1 392 ? 40.110 67.885  16.492 1.00 40.00 ? 395 ARG A C   1 
ATOM 2993 O O   . ARG A 1 392 ? 39.317 68.429  17.259 1.00 40.00 ? 395 ARG A O   1 
ATOM 2994 C CB  . ARG A 1 392 ? 42.329 68.420  15.590 1.00 40.00 ? 395 ARG A CB  1 
ATOM 2995 C CG  . ARG A 1 392 ? 41.992 69.922  15.486 1.00 40.00 ? 395 ARG A CG  1 
ATOM 2996 C CD  . ARG A 1 392 ? 41.462 70.142  14.074 1.00 40.00 ? 395 ARG A CD  1 
ATOM 2997 N NE  . ARG A 1 392 ? 42.552 70.395  13.142 1.00 40.00 ? 395 ARG A NE  1 
ATOM 2998 C CZ  . ARG A 1 392 ? 42.538 70.083  11.857 1.00 40.00 ? 395 ARG A CZ  1 
ATOM 2999 N NH1 . ARG A 1 392 ? 41.511 69.479  11.278 1.00 40.00 ? 395 ARG A NH1 1 
ATOM 3000 N NH2 . ARG A 1 392 ? 43.618 70.391  11.126 1.00 40.00 ? 395 ARG A NH2 1 
ATOM 3001 N N   . ASP A 1 393 ? 39.721 67.298  15.368 1.00 40.00 ? 396 ASP A N   1 
ATOM 3002 C CA  . ASP A 1 393 ? 38.289 67.333  15.044 1.00 40.00 ? 396 ASP A CA  1 
ATOM 3003 C C   . ASP A 1 393 ? 37.435 66.714  16.126 1.00 40.00 ? 396 ASP A C   1 
ATOM 3004 O O   . ASP A 1 393 ? 36.265 67.113  16.300 1.00 40.00 ? 396 ASP A O   1 
ATOM 3005 C CB  . ASP A 1 393 ? 38.056 66.691  13.680 1.00 40.00 ? 396 ASP A CB  1 
ATOM 3006 C CG  . ASP A 1 393 ? 38.882 67.418  12.621 1.00 40.00 ? 396 ASP A CG  1 
ATOM 3007 O OD1 . ASP A 1 393 ? 39.356 68.538  12.909 1.00 40.00 ? 396 ASP A OD1 1 
ATOM 3008 O OD2 . ASP A 1 393 ? 39.063 66.882  11.510 1.00 40.00 ? 396 ASP A OD2 1 
ATOM 3009 N N   . ALA A 1 394 ? 37.970 65.751  16.872 1.00 40.00 ? 397 ALA A N   1 
ATOM 3010 C CA  . ALA A 1 394 ? 37.170 65.082  17.899 1.00 40.00 ? 397 ALA A CA  1 
ATOM 3011 C C   . ALA A 1 394 ? 36.777 66.057  18.997 1.00 40.00 ? 397 ALA A C   1 
ATOM 3012 O O   . ALA A 1 394 ? 35.601 66.128  19.401 1.00 40.00 ? 397 ALA A O   1 
ATOM 3013 C CB  . ALA A 1 394 ? 37.917 63.886  18.435 1.00 40.00 ? 397 ALA A CB  1 
ATOM 3014 N N   . MET A 1 395 ? 37.812 66.790  19.439 1.00 40.00 ? 398 MET A N   1 
ATOM 3015 C CA  . MET A 1 395 ? 37.652 67.819  20.471 1.00 40.00 ? 398 MET A CA  1 
ATOM 3016 C C   . MET A 1 395 ? 36.528 68.755  20.031 1.00 40.00 ? 398 MET A C   1 
ATOM 3017 O O   . MET A 1 395 ? 35.540 68.930  20.739 1.00 40.00 ? 398 MET A O   1 
ATOM 3018 C CB  . MET A 1 395 ? 38.915 68.649  20.579 1.00 40.00 ? 398 MET A CB  1 
ATOM 3019 C CG  . MET A 1 395 ? 39.559 68.894  21.907 1.00 40.00 ? 398 MET A CG  1 
ATOM 3020 S SD  . MET A 1 395 ? 38.477 68.675  23.338 1.00 40.00 ? 398 MET A SD  1 
ATOM 3021 C CE  . MET A 1 395 ? 39.136 67.104  23.885 1.00 40.00 ? 398 MET A CE  1 
ATOM 3022 N N   . SER A 1 396 ? 36.648 69.286  18.809 1.00 40.00 ? 399 SER A N   1 
ATOM 3023 C CA  . SER A 1 396 ? 35.595 70.175  18.331 1.00 40.00 ? 399 SER A CA  1 
ATOM 3024 C C   . SER A 1 396 ? 34.231 69.504  18.385 1.00 40.00 ? 399 SER A C   1 
ATOM 3025 O O   . SER A 1 396 ? 33.222 70.143  18.720 1.00 40.00 ? 399 SER A O   1 
ATOM 3026 C CB  . SER A 1 396 ? 35.949 70.692  16.935 1.00 40.00 ? 399 SER A CB  1 
ATOM 3027 O OG  . SER A 1 396 ? 34.744 71.181  16.354 1.00 40.00 ? 399 SER A OG  1 
ATOM 3028 N N   . ALA A 1 397 ? 34.147 68.201  18.077 1.00 40.00 ? 400 ALA A N   1 
ATOM 3029 C CA  . ALA A 1 397 ? 32.846 67.539  18.132 1.00 40.00 ? 400 ALA A CA  1 
ATOM 3030 C C   . ALA A 1 397 ? 32.376 67.391  19.575 1.00 40.00 ? 400 ALA A C   1 
ATOM 3031 O O   . ALA A 1 397 ? 31.167 67.603  19.785 1.00 40.00 ? 400 ALA A O   1 
ATOM 3032 C CB  . ALA A 1 397 ? 32.817 66.173  17.469 1.00 40.00 ? 400 ALA A CB  1 
ATOM 3033 N N   . VAL A 1 398 ? 33.272 67.022  20.500 1.00 40.00 ? 401 VAL A N   1 
ATOM 3034 C CA  . VAL A 1 398 ? 32.774 66.853  21.877 1.00 40.00 ? 401 VAL A CA  1 
ATOM 3035 C C   . VAL A 1 398 ? 32.066 68.135  22.316 1.00 40.00 ? 401 VAL A C   1 
ATOM 3036 O O   . VAL A 1 398 ? 30.955 68.130  22.850 1.00 40.00 ? 401 VAL A O   1 
ATOM 3037 C CB  . VAL A 1 398 ? 33.908 66.541  22.870 1.00 40.00 ? 401 VAL A CB  1 
ATOM 3038 C CG1 . VAL A 1 398 ? 33.433 66.441  24.297 1.00 40.00 ? 401 VAL A CG1 1 
ATOM 3039 C CG2 . VAL A 1 398 ? 34.600 65.253  22.418 1.00 40.00 ? 401 VAL A CG2 1 
ATOM 3040 N N   . VAL A 1 399 ? 32.783 69.246  22.069 1.00 40.00 ? 402 VAL A N   1 
ATOM 3041 C CA  . VAL A 1 399 ? 32.209 70.512  22.453 1.00 40.00 ? 402 VAL A CA  1 
ATOM 3042 C C   . VAL A 1 399 ? 30.928 70.840  21.701 1.00 40.00 ? 402 VAL A C   1 
ATOM 3043 O O   . VAL A 1 399 ? 29.921 71.160  22.321 1.00 40.00 ? 402 VAL A O   1 
ATOM 3044 C CB  . VAL A 1 399 ? 33.172 71.692  22.276 1.00 40.00 ? 402 VAL A CB  1 
ATOM 3045 C CG1 . VAL A 1 399 ? 32.433 72.966  22.708 1.00 40.00 ? 402 VAL A CG1 1 
ATOM 3046 C CG2 . VAL A 1 399 ? 34.416 71.445  23.109 1.00 40.00 ? 402 VAL A CG2 1 
ATOM 3047 N N   . GLY A 1 400 ? 30.983 70.797  20.383 1.00 40.00 ? 403 GLY A N   1 
ATOM 3048 C CA  . GLY A 1 400 ? 29.822 71.118  19.578 1.00 40.00 ? 403 GLY A CA  1 
ATOM 3049 C C   . GLY A 1 400 ? 28.654 70.181  19.811 1.00 40.00 ? 403 GLY A C   1 
ATOM 3050 O O   . GLY A 1 400 ? 27.476 70.623  19.791 1.00 40.00 ? 403 GLY A O   1 
ATOM 3051 N N   . ASP A 1 401 ? 28.926 68.869  20.006 1.00 40.00 ? 404 ASP A N   1 
ATOM 3052 C CA  . ASP A 1 401 ? 27.779 67.994  20.192 1.00 40.00 ? 404 ASP A CA  1 
ATOM 3053 C C   . ASP A 1 401 ? 27.177 68.203  21.577 1.00 40.00 ? 404 ASP A C   1 
ATOM 3054 O O   . ASP A 1 401 ? 25.964 68.195  21.695 1.00 40.00 ? 404 ASP A O   1 
ATOM 3055 C CB  . ASP A 1 401 ? 28.116 66.514  20.084 1.00 40.00 ? 404 ASP A CB  1 
ATOM 3056 C CG  . ASP A 1 401 ? 28.696 66.155  18.727 1.00 40.00 ? 404 ASP A CG  1 
ATOM 3057 O OD1 . ASP A 1 401 ? 28.441 66.925  17.761 1.00 40.00 ? 404 ASP A OD1 1 
ATOM 3058 O OD2 . ASP A 1 401 ? 29.380 65.107  18.697 1.00 40.00 ? 404 ASP A OD2 1 
ATOM 3059 N N   . HIS A 1 402 ? 28.046 68.351  22.554 1.00 40.00 ? 405 HIS A N   1 
ATOM 3060 C CA  . HIS A 1 402 ? 27.613 68.426  23.919 1.00 40.00 ? 405 HIS A CA  1 
ATOM 3061 C C   . HIS A 1 402 ? 26.760 69.623  24.234 1.00 40.00 ? 405 HIS A C   1 
ATOM 3062 O O   . HIS A 1 402 ? 25.811 69.455  24.989 1.00 40.00 ? 405 HIS A O   1 
ATOM 3063 C CB  . HIS A 1 402 ? 28.832 68.409  24.843 1.00 40.00 ? 405 HIS A CB  1 
ATOM 3064 C CG  . HIS A 1 402 ? 28.479 68.550  26.295 1.00 40.00 ? 405 HIS A CG  1 
ATOM 3065 N ND1 . HIS A 1 402 ? 27.406 67.880  26.847 1.00 40.00 ? 405 HIS A ND1 1 
ATOM 3066 C CD2 . HIS A 1 402 ? 29.060 69.260  27.291 1.00 40.00 ? 405 HIS A CD2 1 
ATOM 3067 C CE1 . HIS A 1 402 ? 27.337 68.168  28.136 1.00 40.00 ? 405 HIS A CE1 1 
ATOM 3068 N NE2 . HIS A 1 402 ? 28.333 68.999  28.427 1.00 40.00 ? 405 HIS A NE2 1 
ATOM 3069 N N   . ASN A 1 403 ? 27.133 70.771  23.692 1.00 40.00 ? 406 ASN A N   1 
ATOM 3070 C CA  . ASN A 1 403 ? 26.487 72.025  23.962 1.00 40.00 ? 406 ASN A CA  1 
ATOM 3071 C C   . ASN A 1 403 ? 25.429 72.428  22.959 1.00 40.00 ? 406 ASN A C   1 
ATOM 3072 O O   . ASN A 1 403 ? 24.433 73.070  23.319 1.00 40.00 ? 406 ASN A O   1 
ATOM 3073 C CB  . ASN A 1 403 ? 27.549 73.160  23.941 1.00 40.00 ? 406 ASN A CB  1 
ATOM 3074 C CG  . ASN A 1 403 ? 28.531 73.070  25.068 1.00 40.00 ? 406 ASN A CG  1 
ATOM 3075 O OD1 . ASN A 1 403 ? 28.185 73.201  26.242 1.00 40.00 ? 406 ASN A OD1 1 
ATOM 3076 N ND2 . ASN A 1 403 ? 29.799 72.852  24.681 1.00 40.00 ? 406 ASN A ND2 1 
ATOM 3077 N N   . VAL A 1 404 ? 25.658 72.133  21.672 1.00 40.00 ? 407 VAL A N   1 
ATOM 3078 C CA  . VAL A 1 404 ? 24.679 72.621  20.698 1.00 40.00 ? 407 VAL A CA  1 
ATOM 3079 C C   . VAL A 1 404 ? 23.892 71.556  20.005 1.00 40.00 ? 407 VAL A C   1 
ATOM 3080 O O   . VAL A 1 404 ? 22.665 71.440  20.202 1.00 40.00 ? 407 VAL A O   1 
ATOM 3081 C CB  . VAL A 1 404 ? 25.376 73.569  19.705 1.00 40.00 ? 407 VAL A CB  1 
ATOM 3082 C CG1 . VAL A 1 404 ? 24.311 74.314  18.910 1.00 40.00 ? 407 VAL A CG1 1 
ATOM 3083 C CG2 . VAL A 1 404 ? 26.278 74.584  20.409 1.00 40.00 ? 407 VAL A CG2 1 
ATOM 3084 N N   . VAL A 1 405 ? 24.572 70.695  19.233 1.00 40.00 ? 408 VAL A N   1 
ATOM 3085 C CA  . VAL A 1 405 ? 23.853 69.678  18.481 1.00 40.00 ? 408 VAL A CA  1 
ATOM 3086 C C   . VAL A 1 405 ? 22.932 68.753  19.222 1.00 40.00 ? 408 VAL A C   1 
ATOM 3087 O O   . VAL A 1 405 ? 21.714 68.817  19.031 1.00 40.00 ? 408 VAL A O   1 
ATOM 3088 C CB  . VAL A 1 405 ? 24.761 68.857  17.558 1.00 40.00 ? 408 VAL A CB  1 
ATOM 3089 C CG1 . VAL A 1 405 ? 23.864 68.081  16.605 1.00 40.00 ? 408 VAL A CG1 1 
ATOM 3090 C CG2 . VAL A 1 405 ? 25.664 69.780  16.771 1.00 40.00 ? 408 VAL A CG2 1 
ATOM 3091 N N   . CYS A 1 406 ? 23.466 67.949  20.147 1.00 40.00 ? 409 CYS A N   1 
ATOM 3092 C CA  . CYS A 1 406 ? 22.559 67.021  20.849 1.00 40.00 ? 409 CYS A CA  1 
ATOM 3093 C C   . CYS A 1 406 ? 21.429 67.724  21.553 1.00 40.00 ? 409 CYS A C   1 
ATOM 3094 O O   . CYS A 1 406 ? 20.254 67.305  21.471 1.00 40.00 ? 409 CYS A O   1 
ATOM 3095 C CB  . CYS A 1 406 ? 23.291 65.986  21.678 1.00 40.00 ? 409 CYS A CB  1 
ATOM 3096 S SG  . CYS A 1 406 ? 24.530 65.113  20.631 1.00 40.00 ? 409 CYS A SG  1 
ATOM 3097 N N   . PRO A 1 407 ? 21.674 68.852  22.198 1.00 40.00 ? 410 PRO A N   1 
ATOM 3098 C CA  . PRO A 1 407 ? 20.613 69.606  22.846 1.00 40.00 ? 410 PRO A CA  1 
ATOM 3099 C C   . PRO A 1 407 ? 19.564 70.044  21.825 1.00 40.00 ? 410 PRO A C   1 
ATOM 3100 O O   . PRO A 1 407 ? 18.339 69.979  22.105 1.00 40.00 ? 410 PRO A O   1 
ATOM 3101 C CB  . PRO A 1 407 ? 21.331 70.755  23.491 1.00 40.00 ? 410 PRO A CB  1 
ATOM 3102 C CG  . PRO A 1 407 ? 22.774 70.377  23.564 1.00 40.00 ? 410 PRO A CG  1 
ATOM 3103 C CD  . PRO A 1 407 ? 23.011 69.443  22.407 1.00 40.00 ? 410 PRO A CD  1 
ATOM 3104 N N   . VAL A 1 408 ? 20.011 70.444  20.623 1.00 40.00 ? 411 VAL A N   1 
ATOM 3105 C CA  . VAL A 1 408 ? 19.055 70.823  19.569 1.00 40.00 ? 411 VAL A CA  1 
ATOM 3106 C C   . VAL A 1 408 ? 18.164 69.622  19.249 1.00 40.00 ? 411 VAL A C   1 
ATOM 3107 O O   . VAL A 1 408 ? 16.949 69.585  19.179 1.00 40.00 ? 411 VAL A O   1 
ATOM 3108 C CB  . VAL A 1 408 ? 19.838 71.086  18.257 1.00 40.00 ? 411 VAL A CB  1 
ATOM 3109 C CG1 . VAL A 1 408 ? 18.940 71.143  17.042 1.00 40.00 ? 411 VAL A CG1 1 
ATOM 3110 C CG2 . VAL A 1 408 ? 20.641 72.370  18.390 1.00 40.00 ? 411 VAL A CG2 1 
ATOM 3111 N N   . ALA A 1 409 ? 18.894 68.516  19.026 1.00 40.00 ? 412 ALA A N   1 
ATOM 3112 C CA  . ALA A 1 409 ? 18.168 67.269  18.706 1.00 40.00 ? 412 ALA A CA  1 
ATOM 3113 C C   . ALA A 1 409 ? 17.283 66.852  19.859 1.00 40.00 ? 412 ALA A C   1 
ATOM 3114 O O   . ALA A 1 409 ? 16.135 66.446  19.657 1.00 40.00 ? 412 ALA A O   1 
ATOM 3115 C CB  . ALA A 1 409 ? 19.081 66.184  18.258 1.00 40.00 ? 412 ALA A CB  1 
ATOM 3116 N N   . GLN A 1 410 ? 17.737 67.001  21.101 1.00 40.00 ? 413 GLN A N   1 
ATOM 3117 C CA  . GLN A 1 410 ? 16.864 66.627  22.219 1.00 40.00 ? 413 GLN A CA  1 
ATOM 3118 C C   . GLN A 1 410 ? 15.609 67.493  22.215 1.00 40.00 ? 413 GLN A C   1 
ATOM 3119 O O   . GLN A 1 410 ? 14.502 67.025  22.552 1.00 40.00 ? 413 GLN A O   1 
ATOM 3120 C CB  . GLN A 1 410 ? 17.567 66.723  23.559 1.00 40.00 ? 413 GLN A CB  1 
ATOM 3121 C CG  . GLN A 1 410 ? 16.643 66.642  24.758 1.00 40.00 ? 413 GLN A CG  1 
ATOM 3122 C CD  . GLN A 1 410 ? 16.058 65.283  25.012 1.00 40.00 ? 413 GLN A CD  1 
ATOM 3123 O OE1 . GLN A 1 410 ? 16.266 64.320  24.242 1.00 40.00 ? 413 GLN A OE1 1 
ATOM 3124 N NE2 . GLN A 1 410 ? 15.304 65.154  26.103 1.00 40.00 ? 413 GLN A NE2 1 
ATOM 3125 N N   . LEU A 1 411 ? 15.796 68.759  21.829 1.00 40.00 ? 414 LEU A N   1 
ATOM 3126 C CA  . LEU A 1 411 ? 14.624 69.646  21.802 1.00 40.00 ? 414 LEU A CA  1 
ATOM 3127 C C   . LEU A 1 411 ? 13.746 69.336  20.605 1.00 40.00 ? 414 LEU A C   1 
ATOM 3128 O O   . LEU A 1 411 ? 12.510 69.244  20.770 1.00 40.00 ? 414 LEU A O   1 
ATOM 3129 C CB  . LEU A 1 411 ? 15.039 71.111  21.823 1.00 40.00 ? 414 LEU A CB  1 
ATOM 3130 C CG  . LEU A 1 411 ? 13.988 72.197  21.749 1.00 40.00 ? 414 LEU A CG  1 
ATOM 3131 C CD1 . LEU A 1 411 ? 13.264 72.421  23.062 1.00 40.00 ? 414 LEU A CD1 1 
ATOM 3132 C CD2 . LEU A 1 411 ? 14.571 73.497  21.218 1.00 40.00 ? 414 LEU A CD2 1 
ATOM 3133 N N   . ALA A 1 412 ? 14.352 69.173  19.422 1.00 40.00 ? 415 ALA A N   1 
ATOM 3134 C CA  . ALA A 1 412 ? 13.552 68.897  18.215 1.00 40.00 ? 415 ALA A CA  1 
ATOM 3135 C C   . ALA A 1 412 ? 12.555 67.774  18.488 1.00 40.00 ? 415 ALA A C   1 
ATOM 3136 O O   . ALA A 1 412 ? 11.337 67.902  18.431 1.00 40.00 ? 415 ALA A O   1 
ATOM 3137 C CB  . ALA A 1 412 ? 14.418 68.499  17.041 1.00 40.00 ? 415 ALA A CB  1 
ATOM 3138 N N   . GLY A 1 413 ? 13.142 66.636  18.856 1.00 40.00 ? 416 GLY A N   1 
ATOM 3139 C CA  . GLY A 1 413 ? 12.373 65.452  19.168 1.00 40.00 ? 416 GLY A CA  1 
ATOM 3140 C C   . GLY A 1 413 ? 11.363 65.660  20.262 1.00 40.00 ? 416 GLY A C   1 
ATOM 3141 O O   . GLY A 1 413 ? 10.195 65.317  20.150 1.00 40.00 ? 416 GLY A O   1 
ATOM 3142 N N   . ARG A 1 414 ? 11.750 66.272  21.378 1.00 40.00 ? 417 ARG A N   1 
ATOM 3143 C CA  . ARG A 1 414 ? 10.788 66.487  22.461 1.00 40.00 ? 417 ARG A CA  1 
ATOM 3144 C C   . ARG A 1 414 ? 9.623  67.344  22.005 1.00 40.00 ? 417 ARG A C   1 
ATOM 3145 O O   . ARG A 1 414 ? 8.469  67.143  22.388 1.00 40.00 ? 417 ARG A O   1 
ATOM 3146 C CB  . ARG A 1 414 ? 11.484 67.103  23.689 1.00 40.00 ? 417 ARG A CB  1 
ATOM 3147 C CG  . ARG A 1 414 ? 11.657 66.023  24.784 1.00 40.00 ? 417 ARG A CG  1 
ATOM 3148 C CD  . ARG A 1 414 ? 10.265 65.536  25.192 1.00 40.00 ? 417 ARG A CD  1 
ATOM 3149 N NE  . ARG A 1 414 ? 10.259 64.126  25.562 1.00 40.00 ? 417 ARG A NE  1 
ATOM 3150 C CZ  . ARG A 1 414 ? 10.679 63.744  26.773 1.00 40.00 ? 417 ARG A CZ  1 
ATOM 3151 N NH1 . ARG A 1 414 ? 11.107 64.656  27.638 1.00 40.00 ? 417 ARG A NH1 1 
ATOM 3152 N NH2 . ARG A 1 414 ? 10.682 62.460  27.110 1.00 40.00 ? 417 ARG A NH2 1 
ATOM 3153 N N   . LEU A 1 415 ? 9.977  68.313  21.159 1.00 40.00 ? 418 LEU A N   1 
ATOM 3154 C CA  . LEU A 1 415 ? 8.927  69.206  20.660 1.00 40.00 ? 418 LEU A CA  1 
ATOM 3155 C C   . LEU A 1 415 ? 7.949  68.441  19.780 1.00 40.00 ? 418 LEU A C   1 
ATOM 3156 O O   . LEU A 1 415 ? 6.738  68.384  19.995 1.00 40.00 ? 418 LEU A O   1 
ATOM 3157 C CB  . LEU A 1 415 ? 9.588  70.375  19.956 1.00 40.00 ? 418 LEU A CB  1 
ATOM 3158 C CG  . LEU A 1 415 ? 9.362  71.777  20.506 1.00 40.00 ? 418 LEU A CG  1 
ATOM 3159 C CD1 . LEU A 1 415 ? 9.022  71.810  21.988 1.00 40.00 ? 418 LEU A CD1 1 
ATOM 3160 C CD2 . LEU A 1 415 ? 10.584 72.627  20.156 1.00 40.00 ? 418 LEU A CD2 1 
ATOM 3161 N N   . ALA A 1 416 ? 8.535  67.822  18.752 1.00 40.00 ? 419 ALA A N   1 
ATOM 3162 C CA  . ALA A 1 416 ? 7.741  67.055  17.791 1.00 40.00 ? 419 ALA A CA  1 
ATOM 3163 C C   . ALA A 1 416 ? 6.830  66.106  18.541 1.00 40.00 ? 419 ALA A C   1 
ATOM 3164 O O   . ALA A 1 416 ? 5.601  66.166  18.447 1.00 40.00 ? 419 ALA A O   1 
ATOM 3165 C CB  . ALA A 1 416 ? 8.614  66.347  16.776 1.00 40.00 ? 419 ALA A CB  1 
ATOM 3166 N N   . ALA A 1 417 ? 7.400  65.266  19.381 1.00 40.00 ? 420 ALA A N   1 
ATOM 3167 C CA  . ALA A 1 417 ? 6.644  64.333  20.186 1.00 40.00 ? 420 ALA A CA  1 
ATOM 3168 C C   . ALA A 1 417 ? 5.527  64.997  20.977 1.00 40.00 ? 420 ALA A C   1 
ATOM 3169 O O   . ALA A 1 417 ? 4.535  64.328  21.279 1.00 40.00 ? 420 ALA A O   1 
ATOM 3170 C CB  . ALA A 1 417 ? 7.566  63.609  21.153 1.00 40.00 ? 420 ALA A CB  1 
ATOM 3171 N N   . GLN A 1 418 ? 5.669  66.260  21.356 1.00 40.00 ? 421 GLN A N   1 
ATOM 3172 C CA  . GLN A 1 418 ? 4.610  66.903  22.099 1.00 40.00 ? 421 GLN A CA  1 
ATOM 3173 C C   . GLN A 1 418 ? 3.585  67.645  21.271 1.00 40.00 ? 421 GLN A C   1 
ATOM 3174 O O   . GLN A 1 418 ? 2.653  68.200  21.870 1.00 40.00 ? 421 GLN A O   1 
ATOM 3175 C CB  . GLN A 1 418 ? 5.216  67.850  23.138 1.00 40.00 ? 421 GLN A CB  1 
ATOM 3176 C CG  . GLN A 1 418 ? 4.756  67.425  24.539 1.00 40.00 ? 421 GLN A CG  1 
ATOM 3177 C CD  . GLN A 1 418 ? 5.729  66.416  25.116 1.00 40.00 ? 421 GLN A CD  1 
ATOM 3178 O OE1 . GLN A 1 418 ? 5.425  65.753  26.121 1.00 40.00 ? 421 GLN A OE1 1 
ATOM 3179 N NE2 . GLN A 1 418 ? 6.882  66.314  24.455 1.00 40.00 ? 421 GLN A NE2 1 
ATOM 3180 N N   . GLY A 1 419 ? 3.699  67.711  19.954 1.00 40.00 ? 422 GLY A N   1 
ATOM 3181 C CA  . GLY A 1 419 ? 2.668  68.408  19.179 1.00 40.00 ? 422 GLY A CA  1 
ATOM 3182 C C   . GLY A 1 419 ? 3.259  69.384  18.192 1.00 40.00 ? 422 GLY A C   1 
ATOM 3183 O O   . GLY A 1 419 ? 2.693  69.717  17.153 1.00 40.00 ? 422 GLY A O   1 
ATOM 3184 N N   . ALA A 1 420 ? 4.431  69.915  18.526 1.00 40.00 ? 423 ALA A N   1 
ATOM 3185 C CA  . ALA A 1 420 ? 5.040  70.917  17.668 1.00 40.00 ? 423 ALA A CA  1 
ATOM 3186 C C   . ALA A 1 420 ? 5.157  70.449  16.221 1.00 40.00 ? 423 ALA A C   1 
ATOM 3187 O O   . ALA A 1 420 ? 5.256  69.262  15.983 1.00 40.00 ? 423 ALA A O   1 
ATOM 3188 C CB  . ALA A 1 420 ? 6.480  71.215  18.140 1.00 40.00 ? 423 ALA A CB  1 
ATOM 3189 N N   . ARG A 1 421 ? 5.194  71.418  15.333 1.00 40.00 ? 424 ARG A N   1 
ATOM 3190 C CA  . ARG A 1 421 ? 5.502  71.102  13.940 1.00 40.00 ? 424 ARG A CA  1 
ATOM 3191 C C   . ARG A 1 421 ? 6.969  71.603  13.922 1.00 40.00 ? 424 ARG A C   1 
ATOM 3192 O O   . ARG A 1 421 ? 7.158  72.802  14.177 1.00 40.00 ? 424 ARG A O   1 
ATOM 3193 C CB  . ARG A 1 421 ? 4.680  71.798  12.903 1.00 40.00 ? 424 ARG A CB  1 
ATOM 3194 C CG  . ARG A 1 421 ? 5.361  72.001  11.552 1.00 40.00 ? 424 ARG A CG  1 
ATOM 3195 C CD  . ARG A 1 421 ? 4.481  72.812  10.625 1.00 40.00 ? 424 ARG A CD  1 
ATOM 3196 N NE  . ARG A 1 421 ? 4.000  72.082  9.481  1.00 40.00 ? 424 ARG A NE  1 
ATOM 3197 C CZ  . ARG A 1 421 ? 3.291  70.974  9.374  1.00 40.00 ? 424 ARG A CZ  1 
ATOM 3198 N NH1 . ARG A 1 421 ? 2.870  70.274  10.424 1.00 40.00 ? 424 ARG A NH1 1 
ATOM 3199 N NH2 . ARG A 1 421 ? 2.984  70.536  8.144  1.00 40.00 ? 424 ARG A NH2 1 
ATOM 3200 N N   . VAL A 1 422 ? 7.917  70.718  13.779 1.00 40.00 ? 425 VAL A N   1 
ATOM 3201 C CA  . VAL A 1 422 ? 9.315  71.173  13.853 1.00 40.00 ? 425 VAL A CA  1 
ATOM 3202 C C   . VAL A 1 422 ? 9.985  71.051  12.515 1.00 40.00 ? 425 VAL A C   1 
ATOM 3203 O O   . VAL A 1 422 ? 9.547  70.209  11.728 1.00 40.00 ? 425 VAL A O   1 
ATOM 3204 C CB  . VAL A 1 422 ? 10.038 70.192  14.832 1.00 40.00 ? 425 VAL A CB  1 
ATOM 3205 C CG1 . VAL A 1 422 ? 11.509 70.525  14.923 1.00 40.00 ? 425 VAL A CG1 1 
ATOM 3206 C CG2 . VAL A 1 422 ? 9.309  70.152  16.173 1.00 40.00 ? 425 VAL A CG2 1 
ATOM 3207 N N   . TYR A 1 423 ? 10.982 71.823  12.161 1.00 40.00 ? 426 TYR A N   1 
ATOM 3208 C CA  . TYR A 1 423 ? 11.711 71.672  10.896 1.00 40.00 ? 426 TYR A CA  1 
ATOM 3209 C C   . TYR A 1 423 ? 13.173 71.717  11.360 1.00 40.00 ? 426 TYR A C   1 
ATOM 3210 O O   . TYR A 1 423 ? 13.343 72.380  12.376 1.00 40.00 ? 426 TYR A O   1 
ATOM 3211 C CB  . TYR A 1 423 ? 11.507 72.781  9.876  1.00 40.00 ? 426 TYR A CB  1 
ATOM 3212 C CG  . TYR A 1 423 ? 10.126 72.722  9.257  1.00 40.00 ? 426 TYR A CG  1 
ATOM 3213 C CD1 . TYR A 1 423 ? 9.016  73.032  10.046 1.00 40.00 ? 426 TYR A CD1 1 
ATOM 3214 C CD2 . TYR A 1 423 ? 9.909  72.362  7.940  1.00 40.00 ? 426 TYR A CD2 1 
ATOM 3215 C CE1 . TYR A 1 423 ? 7.729  72.971  9.554  1.00 40.00 ? 426 TYR A CE1 1 
ATOM 3216 C CE2 . TYR A 1 423 ? 8.620  72.305  7.427  1.00 40.00 ? 426 TYR A CE2 1 
ATOM 3217 C CZ  . TYR A 1 423 ? 7.540  72.612  8.237  1.00 40.00 ? 426 TYR A CZ  1 
ATOM 3218 O OH  . TYR A 1 423 ? 6.261  72.562  7.763  1.00 40.00 ? 426 TYR A OH  1 
ATOM 3219 N N   . ALA A 1 424 ? 14.115 71.090  10.712 1.00 40.00 ? 427 ALA A N   1 
ATOM 3220 C CA  . ALA A 1 424 ? 15.495 71.122  11.199 1.00 40.00 ? 427 ALA A CA  1 
ATOM 3221 C C   . ALA A 1 424 ? 16.483 71.274  10.069 1.00 40.00 ? 427 ALA A C   1 
ATOM 3222 O O   . ALA A 1 424 ? 16.118 71.028  8.909  1.00 40.00 ? 427 ALA A O   1 
ATOM 3223 C CB  . ALA A 1 424 ? 15.751 69.836  11.971 1.00 40.00 ? 427 ALA A CB  1 
ATOM 3224 N N   . TYR A 1 425 ? 17.731 71.643  10.363 1.00 40.00 ? 428 TYR A N   1 
ATOM 3225 C CA  . TYR A 1 425 ? 18.659 71.845  9.235  1.00 40.00 ? 428 TYR A CA  1 
ATOM 3226 C C   . TYR A 1 425 ? 20.102 71.755  9.639  1.00 40.00 ? 428 TYR A C   1 
ATOM 3227 O O   . TYR A 1 425 ? 20.414 71.746  10.851 1.00 40.00 ? 428 TYR A O   1 
ATOM 3228 C CB  . TYR A 1 425 ? 18.377 73.287  8.739  1.00 40.00 ? 428 TYR A CB  1 
ATOM 3229 C CG  . TYR A 1 425 ? 18.799 74.412  9.639  1.00 40.00 ? 428 TYR A CG  1 
ATOM 3230 C CD1 . TYR A 1 425 ? 17.876 75.148  10.356 1.00 40.00 ? 428 TYR A CD1 1 
ATOM 3231 C CD2 . TYR A 1 425 ? 20.152 74.771  9.751  1.00 40.00 ? 428 TYR A CD2 1 
ATOM 3232 C CE1 . TYR A 1 425 ? 18.242 76.207  11.174 1.00 40.00 ? 428 TYR A CE1 1 
ATOM 3233 C CE2 . TYR A 1 425 ? 20.548 75.813  10.568 1.00 40.00 ? 428 TYR A CE2 1 
ATOM 3234 C CZ  . TYR A 1 425 ? 19.576 76.523  11.270 1.00 40.00 ? 428 TYR A CZ  1 
ATOM 3235 O OH  . TYR A 1 425 ? 19.981 77.549  12.090 1.00 40.00 ? 428 TYR A OH  1 
ATOM 3236 N N   . ILE A 1 426 ? 21.035 71.740  8.691  1.00 40.00 ? 429 ILE A N   1 
ATOM 3237 C CA  . ILE A 1 426 ? 22.441 71.714  9.110  1.00 40.00 ? 429 ILE A CA  1 
ATOM 3238 C C   . ILE A 1 426 ? 23.161 72.713  8.218  1.00 40.00 ? 429 ILE A C   1 
ATOM 3239 O O   . ILE A 1 426 ? 23.401 72.392  7.056  1.00 40.00 ? 429 ILE A O   1 
ATOM 3240 C CB  . ILE A 1 426 ? 23.109 70.353  8.948  1.00 40.00 ? 429 ILE A CB  1 
ATOM 3241 C CG1 . ILE A 1 426 ? 22.475 69.305  9.862  1.00 40.00 ? 429 ILE A CG1 1 
ATOM 3242 C CG2 . ILE A 1 426 ? 24.615 70.389  9.229  1.00 40.00 ? 429 ILE A CG2 1 
ATOM 3243 C CD1 . ILE A 1 426 ? 22.589 69.650  11.334 1.00 40.00 ? 429 ILE A CD1 1 
ATOM 3244 N N   . PHE A 1 427 ? 23.472 73.897  8.722  1.00 40.00 ? 430 PHE A N   1 
ATOM 3245 C CA  . PHE A 1 427 ? 24.145 74.859  7.797  1.00 40.00 ? 430 PHE A CA  1 
ATOM 3246 C C   . PHE A 1 427 ? 25.512 74.303  7.486  1.00 40.00 ? 430 PHE A C   1 
ATOM 3247 O O   . PHE A 1 427 ? 26.246 74.040  8.451  1.00 40.00 ? 430 PHE A O   1 
ATOM 3248 C CB  . PHE A 1 427 ? 24.170 76.211  8.447  1.00 40.00 ? 430 PHE A CB  1 
ATOM 3249 C CG  . PHE A 1 427 ? 24.578 77.359  7.580  1.00 40.00 ? 430 PHE A CG  1 
ATOM 3250 C CD1 . PHE A 1 427 ? 23.635 78.167  6.960  1.00 40.00 ? 430 PHE A CD1 1 
ATOM 3251 C CD2 . PHE A 1 427 ? 25.930 77.645  7.400  1.00 40.00 ? 430 PHE A CD2 1 
ATOM 3252 C CE1 . PHE A 1 427 ? 24.027 79.233  6.177  1.00 40.00 ? 430 PHE A CE1 1 
ATOM 3253 C CE2 . PHE A 1 427 ? 26.324 78.712  6.618  1.00 40.00 ? 430 PHE A CE2 1 
ATOM 3254 C CZ  . PHE A 1 427 ? 25.380 79.505  6.013  1.00 40.00 ? 430 PHE A CZ  1 
ATOM 3255 N N   . GLU A 1 428 ? 25.866 74.077  6.229  1.00 40.00 ? 431 GLU A N   1 
ATOM 3256 C CA  . GLU A 1 428 ? 27.186 73.505  5.961  1.00 40.00 ? 431 GLU A CA  1 
ATOM 3257 C C   . GLU A 1 428 ? 28.063 74.352  5.070  1.00 40.00 ? 431 GLU A C   1 
ATOM 3258 O O   . GLU A 1 428 ? 29.185 73.935  4.750  1.00 40.00 ? 431 GLU A O   1 
ATOM 3259 C CB  . GLU A 1 428 ? 27.072 72.096  5.401  1.00 40.00 ? 431 GLU A CB  1 
ATOM 3260 C CG  . GLU A 1 428 ? 26.157 71.143  6.143  1.00 40.00 ? 431 GLU A CG  1 
ATOM 3261 C CD  . GLU A 1 428 ? 26.056 69.774  5.491  1.00 40.00 ? 431 GLU A CD  1 
ATOM 3262 O OE1 . GLU A 1 428 ? 26.373 68.754  6.146  1.00 40.00 ? 431 GLU A OE1 1 
ATOM 3263 O OE2 . GLU A 1 428 ? 25.669 69.667  4.306  1.00 40.00 ? 431 GLU A OE2 1 
ATOM 3264 N N   . HIS A 1 429 ? 27.605 75.536  4.667  1.00 40.00 ? 432 HIS A N   1 
ATOM 3265 C CA  . HIS A 1 429 ? 28.416 76.380  3.790  1.00 40.00 ? 432 HIS A CA  1 
ATOM 3266 C C   . HIS A 1 429 ? 29.324 77.343  4.534  1.00 40.00 ? 432 HIS A C   1 
ATOM 3267 O O   . HIS A 1 429 ? 28.956 78.208  5.330  1.00 40.00 ? 432 HIS A O   1 
ATOM 3268 C CB  . HIS A 1 429 ? 27.551 77.131  2.773  1.00 40.00 ? 432 HIS A CB  1 
ATOM 3269 C CG  . HIS A 1 429 ? 28.335 78.159  2.012  1.00 40.00 ? 432 HIS A CG  1 
ATOM 3270 N ND1 . HIS A 1 429 ? 29.518 77.833  1.388  1.00 40.00 ? 432 HIS A ND1 1 
ATOM 3271 C CD2 . HIS A 1 429 ? 28.151 79.482  1.806  1.00 40.00 ? 432 HIS A CD2 1 
ATOM 3272 C CE1 . HIS A 1 429 ? 30.029 78.915  0.808  1.00 40.00 ? 432 HIS A CE1 1 
ATOM 3273 N NE2 . HIS A 1 429 ? 29.221 79.926  1.054  1.00 40.00 ? 432 HIS A NE2 1 
ATOM 3274 N N   . ARG A 1 430 ? 30.620 77.182  4.267  1.00 40.00 ? 433 ARG A N   1 
ATOM 3275 C CA  . ARG A 1 430 ? 31.639 78.032  4.907  1.00 40.00 ? 433 ARG A CA  1 
ATOM 3276 C C   . ARG A 1 430 ? 31.767 79.297  4.080  1.00 40.00 ? 433 ARG A C   1 
ATOM 3277 O O   . ARG A 1 430 ? 32.089 79.184  2.892  1.00 40.00 ? 433 ARG A O   1 
ATOM 3278 C CB  . ARG A 1 430 ? 32.943 77.271  4.993  1.00 40.00 ? 433 ARG A CB  1 
ATOM 3279 C CG  . ARG A 1 430 ? 34.167 78.116  5.240  1.00 40.00 ? 433 ARG A CG  1 
ATOM 3280 C CD  . ARG A 1 430 ? 35.431 77.288  5.340  1.00 40.00 ? 433 ARG A CD  1 
ATOM 3281 N NE  . ARG A 1 430 ? 36.187 77.481  6.550  1.00 40.00 ? 433 ARG A NE  1 
ATOM 3282 C CZ  . ARG A 1 430 ? 37.238 78.294  6.667  1.00 40.00 ? 433 ARG A CZ  1 
ATOM 3283 N NH1 . ARG A 1 430 ? 37.633 78.986  5.603  1.00 40.00 ? 433 ARG A NH1 1 
ATOM 3284 N NH2 . ARG A 1 430 ? 37.878 78.416  7.815  1.00 40.00 ? 433 ARG A NH2 1 
ATOM 3285 N N   . ALA A 1 431 ? 31.470 80.455  4.674  1.00 40.00 ? 434 ALA A N   1 
ATOM 3286 C CA  . ALA A 1 431 ? 31.542 81.697  3.881  1.00 40.00 ? 434 ALA A CA  1 
ATOM 3287 C C   . ALA A 1 431 ? 32.936 81.841  3.290  1.00 40.00 ? 434 ALA A C   1 
ATOM 3288 O O   . ALA A 1 431 ? 33.909 81.436  3.919  1.00 40.00 ? 434 ALA A O   1 
ATOM 3289 C CB  . ALA A 1 431 ? 31.116 82.882  4.693  1.00 40.00 ? 434 ALA A CB  1 
ATOM 3290 N N   . SER A 1 432 ? 33.003 82.381  2.066  1.00 40.00 ? 435 SER A N   1 
ATOM 3291 C CA  . SER A 1 432 ? 34.280 82.513  1.363  1.00 40.00 ? 435 SER A CA  1 
ATOM 3292 C C   . SER A 1 432 ? 35.193 83.520  2.053  1.00 40.00 ? 435 SER A C   1 
ATOM 3293 O O   . SER A 1 432 ? 36.414 83.400  2.099  1.00 40.00 ? 435 SER A O   1 
ATOM 3294 C CB  . SER A 1 432 ? 34.095 82.905  -0.094 1.00 40.00 ? 435 SER A CB  1 
ATOM 3295 O OG  . SER A 1 432 ? 33.397 84.134  -0.221 1.00 40.00 ? 435 SER A OG  1 
ATOM 3296 N N   . THR A 1 433 ? 34.531 84.507  2.615  1.00 40.00 ? 436 THR A N   1 
ATOM 3297 C CA  . THR A 1 433 ? 35.071 85.607  3.372  1.00 40.00 ? 436 THR A CA  1 
ATOM 3298 C C   . THR A 1 433 ? 35.559 85.243  4.772  1.00 40.00 ? 436 THR A C   1 
ATOM 3299 O O   . THR A 1 433 ? 36.335 86.002  5.374  1.00 40.00 ? 436 THR A O   1 
ATOM 3300 C CB  . THR A 1 433 ? 33.889 86.615  3.529  1.00 40.00 ? 436 THR A CB  1 
ATOM 3301 O OG1 . THR A 1 433 ? 32.861 85.952  4.296  1.00 40.00 ? 436 THR A OG1 1 
ATOM 3302 C CG2 . THR A 1 433 ? 33.315 86.981  2.171  1.00 40.00 ? 436 THR A CG2 1 
ATOM 3303 N N   . LEU A 1 434 ? 35.116 84.128  5.337  1.00 40.00 ? 437 LEU A N   1 
ATOM 3304 C CA  . LEU A 1 434 ? 35.493 83.674  6.680  1.00 40.00 ? 437 LEU A CA  1 
ATOM 3305 C C   . LEU A 1 434 ? 36.967 83.897  6.975  1.00 40.00 ? 437 LEU A C   1 
ATOM 3306 O O   . LEU A 1 434 ? 37.852 83.465  6.242  1.00 40.00 ? 437 LEU A O   1 
ATOM 3307 C CB  . LEU A 1 434 ? 35.092 82.216  6.825  1.00 40.00 ? 437 LEU A CB  1 
ATOM 3308 C CG  . LEU A 1 434 ? 34.729 81.593  8.153  1.00 40.00 ? 437 LEU A CG  1 
ATOM 3309 C CD1 . LEU A 1 434 ? 35.776 81.921  9.215  1.00 40.00 ? 437 LEU A CD1 1 
ATOM 3310 C CD2 . LEU A 1 434 ? 33.350 82.008  8.638  1.00 40.00 ? 437 LEU A CD2 1 
ATOM 3311 N N   . THR A 1 435 ? 37.284 84.578  8.067  1.00 40.00 ? 438 THR A N   1 
ATOM 3312 C CA  . THR A 1 435 ? 38.650 84.895  8.453  1.00 40.00 ? 438 THR A CA  1 
ATOM 3313 C C   . THR A 1 435 ? 39.296 83.926  9.432  1.00 40.00 ? 438 THR A C   1 
ATOM 3314 O O   . THR A 1 435 ? 40.484 84.080  9.784  1.00 40.00 ? 438 THR A O   1 
ATOM 3315 C CB  . THR A 1 435 ? 38.729 86.317  9.075  1.00 40.00 ? 438 THR A CB  1 
ATOM 3316 O OG1 . THR A 1 435 ? 37.489 86.635  9.719  1.00 40.00 ? 438 THR A OG1 1 
ATOM 3317 C CG2 . THR A 1 435 ? 38.993 87.315  7.966  1.00 40.00 ? 438 THR A CG2 1 
ATOM 3318 N N   . TRP A 1 436 ? 38.511 82.957  9.897  1.00 40.00 ? 439 TRP A N   1 
ATOM 3319 C CA  . TRP A 1 436 ? 39.048 81.936  10.820 1.00 40.00 ? 439 TRP A CA  1 
ATOM 3320 C C   . TRP A 1 436 ? 39.771 80.908  9.952  1.00 40.00 ? 439 TRP A C   1 
ATOM 3321 O O   . TRP A 1 436 ? 39.575 80.919  8.725  1.00 40.00 ? 439 TRP A O   1 
ATOM 3322 C CB  . TRP A 1 436 ? 37.955 81.338  11.653 1.00 40.00 ? 439 TRP A CB  1 
ATOM 3323 C CG  . TRP A 1 436 ? 37.264 82.188  12.674 1.00 40.00 ? 439 TRP A CG  1 
ATOM 3324 C CD1 . TRP A 1 436 ? 36.074 82.842  12.515 1.00 40.00 ? 439 TRP A CD1 1 
ATOM 3325 C CD2 . TRP A 1 436 ? 37.681 82.469  14.016 1.00 40.00 ? 439 TRP A CD2 1 
ATOM 3326 N NE1 . TRP A 1 436 ? 35.732 83.506  13.672 1.00 40.00 ? 439 TRP A NE1 1 
ATOM 3327 C CE2 . TRP A 1 436 ? 36.701 83.297  14.600 1.00 40.00 ? 439 TRP A CE2 1 
ATOM 3328 C CE3 . TRP A 1 436 ? 38.790 82.097  14.777 1.00 40.00 ? 439 TRP A CE3 1 
ATOM 3329 C CZ2 . TRP A 1 436 ? 36.787 83.761  15.907 1.00 40.00 ? 439 TRP A CZ2 1 
ATOM 3330 C CZ3 . TRP A 1 436 ? 38.876 82.568  16.089 1.00 40.00 ? 439 TRP A CZ3 1 
ATOM 3331 C CH2 . TRP A 1 436 ? 37.885 83.381  16.636 1.00 40.00 ? 439 TRP A CH2 1 
ATOM 3332 N N   . PRO A 1 437 ? 40.603 80.073  10.535 1.00 40.00 ? 440 PRO A N   1 
ATOM 3333 C CA  . PRO A 1 437 ? 41.367 79.085  9.786  1.00 40.00 ? 440 PRO A CA  1 
ATOM 3334 C C   . PRO A 1 437 ? 40.454 78.009  9.250  1.00 40.00 ? 440 PRO A C   1 
ATOM 3335 O O   . PRO A 1 437 ? 39.336 77.799  9.765  1.00 40.00 ? 440 PRO A O   1 
ATOM 3336 C CB  . PRO A 1 437 ? 42.384 78.542  10.750 1.00 40.00 ? 440 PRO A CB  1 
ATOM 3337 C CG  . PRO A 1 437 ? 41.984 78.986  12.100 1.00 40.00 ? 440 PRO A CG  1 
ATOM 3338 C CD  . PRO A 1 437 ? 40.886 79.996  11.970 1.00 40.00 ? 440 PRO A CD  1 
ATOM 3339 N N   . LEU A 1 438 ? 40.865 77.361  8.166  1.00 40.00 ? 441 LEU A N   1 
ATOM 3340 C CA  . LEU A 1 438 ? 40.083 76.304  7.544  1.00 40.00 ? 441 LEU A CA  1 
ATOM 3341 C C   . LEU A 1 438 ? 39.655 75.244  8.547  1.00 40.00 ? 441 LEU A C   1 
ATOM 3342 O O   . LEU A 1 438 ? 38.495 74.807  8.574  1.00 40.00 ? 441 LEU A O   1 
ATOM 3343 C CB  . LEU A 1 438 ? 40.941 75.627  6.467  1.00 40.00 ? 441 LEU A CB  1 
ATOM 3344 C CG  . LEU A 1 438 ? 40.219 75.143  5.208  1.00 40.00 ? 441 LEU A CG  1 
ATOM 3345 C CD1 . LEU A 1 438 ? 39.193 74.068  5.539  1.00 40.00 ? 441 LEU A CD1 1 
ATOM 3346 C CD2 . LEU A 1 438 ? 39.570 76.307  4.466  1.00 40.00 ? 441 LEU A CD2 1 
ATOM 3347 N N   . TRP A 1 439 ? 40.585 74.835  9.426  1.00 40.00 ? 442 TRP A N   1 
ATOM 3348 C CA  . TRP A 1 439 ? 40.263 73.831  10.419 1.00 40.00 ? 442 TRP A CA  1 
ATOM 3349 C C   . TRP A 1 439 ? 39.009 74.067  11.220 1.00 40.00 ? 442 TRP A C   1 
ATOM 3350 O O   . TRP A 1 439 ? 38.462 73.070  11.738 1.00 40.00 ? 442 TRP A O   1 
ATOM 3351 C CB  . TRP A 1 439 ? 41.449 73.534  11.273 1.00 40.00 ? 442 TRP A CB  1 
ATOM 3352 C CG  . TRP A 1 439 ? 41.834 74.376  12.422 1.00 40.00 ? 442 TRP A CG  1 
ATOM 3353 C CD1 . TRP A 1 439 ? 42.956 75.168  12.510 1.00 40.00 ? 442 TRP A CD1 1 
ATOM 3354 C CD2 . TRP A 1 439 ? 41.180 74.494  13.688 1.00 40.00 ? 442 TRP A CD2 1 
ATOM 3355 N NE1 . TRP A 1 439 ? 43.031 75.768  13.734 1.00 40.00 ? 442 TRP A NE1 1 
ATOM 3356 C CE2 . TRP A 1 439 ? 41.942 75.368  14.473 1.00 40.00 ? 442 TRP A CE2 1 
ATOM 3357 C CE3 . TRP A 1 439 ? 40.026 73.929  14.227 1.00 40.00 ? 442 TRP A CE3 1 
ATOM 3358 C CZ2 . TRP A 1 439 ? 41.579 75.712  15.775 1.00 40.00 ? 442 TRP A CZ2 1 
ATOM 3359 C CZ3 . TRP A 1 439 ? 39.659 74.271  15.509 1.00 40.00 ? 442 TRP A CZ3 1 
ATOM 3360 C CH2 . TRP A 1 439 ? 40.434 75.161  16.271 1.00 40.00 ? 442 TRP A CH2 1 
ATOM 3361 N N   . MET A 1 440 ? 38.460 75.239  11.387 1.00 40.00 ? 443 MET A N   1 
ATOM 3362 C CA  . MET A 1 440 ? 37.239 75.457  12.167 1.00 40.00 ? 443 MET A CA  1 
ATOM 3363 C C   . MET A 1 440 ? 36.012 75.269  11.298 1.00 40.00 ? 443 MET A C   1 
ATOM 3364 O O   . MET A 1 440 ? 34.834 75.267  11.737 1.00 40.00 ? 443 MET A O   1 
ATOM 3365 C CB  . MET A 1 440 ? 37.350 76.855  12.794 1.00 40.00 ? 443 MET A CB  1 
ATOM 3366 C CG  . MET A 1 440 ? 38.728 77.066  13.453 1.00 40.00 ? 443 MET A CG  1 
ATOM 3367 S SD  . MET A 1 440 ? 38.938 78.665  14.227 1.00 40.00 ? 443 MET A SD  1 
ATOM 3368 C CE  . MET A 1 440 ? 38.420 78.379  15.903 1.00 40.00 ? 443 MET A CE  1 
ATOM 3369 N N   . GLY A 1 441 ? 36.262 75.080  9.979  1.00 40.00 ? 444 GLY A N   1 
ATOM 3370 C CA  . GLY A 1 441 ? 35.175 74.844  9.051  1.00 40.00 ? 444 GLY A CA  1 
ATOM 3371 C C   . GLY A 1 441 ? 34.059 75.846  9.172  1.00 40.00 ? 444 GLY A C   1 
ATOM 3372 O O   . GLY A 1 441 ? 34.313 77.028  8.878  1.00 40.00 ? 444 GLY A O   1 
ATOM 3373 N N   . VAL A 1 442 ? 32.880 75.429  9.594  1.00 40.00 ? 445 VAL A N   1 
ATOM 3374 C CA  . VAL A 1 442 ? 31.754 76.377  9.733  1.00 40.00 ? 445 VAL A CA  1 
ATOM 3375 C C   . VAL A 1 442 ? 31.462 76.550  11.215 1.00 40.00 ? 445 VAL A C   1 
ATOM 3376 O O   . VAL A 1 442 ? 30.737 75.782  11.813 1.00 40.00 ? 445 VAL A O   1 
ATOM 3377 C CB  . VAL A 1 442 ? 30.543 75.856  8.987  1.00 40.00 ? 445 VAL A CB  1 
ATOM 3378 C CG1 . VAL A 1 442 ? 29.233 76.412  9.522  1.00 40.00 ? 445 VAL A CG1 1 
ATOM 3379 C CG2 . VAL A 1 442 ? 30.719 76.195  7.517  1.00 40.00 ? 445 VAL A CG2 1 
ATOM 3380 N N   . PRO A 1 443 ? 32.095 77.550  11.815 1.00 40.00 ? 446 PRO A N   1 
ATOM 3381 C CA  . PRO A 1 443 ? 32.028 77.838  13.219 1.00 40.00 ? 446 PRO A CA  1 
ATOM 3382 C C   . PRO A 1 443 ? 30.703 78.342  13.726 1.00 40.00 ? 446 PRO A C   1 
ATOM 3383 O O   . PRO A 1 443 ? 29.883 78.860  12.986 1.00 40.00 ? 446 PRO A O   1 
ATOM 3384 C CB  . PRO A 1 443 ? 33.070 78.948  13.419 1.00 40.00 ? 446 PRO A CB  1 
ATOM 3385 C CG  . PRO A 1 443 ? 33.988 78.781  12.252 1.00 40.00 ? 446 PRO A CG  1 
ATOM 3386 C CD  . PRO A 1 443 ? 33.018 78.518  11.130 1.00 40.00 ? 446 PRO A CD  1 
ATOM 3387 N N   . HIS A 1 444 ? 30.530 78.200  15.029 1.00 40.00 ? 447 HIS A N   1 
ATOM 3388 C CA  . HIS A 1 444 ? 29.305 78.690  15.679 1.00 40.00 ? 447 HIS A CA  1 
ATOM 3389 C C   . HIS A 1 444 ? 29.076 80.131  15.235 1.00 40.00 ? 447 HIS A C   1 
ATOM 3390 O O   . HIS A 1 444 ? 30.000 80.933  15.270 1.00 40.00 ? 447 HIS A O   1 
ATOM 3391 C CB  . HIS A 1 444 ? 29.520 78.576  17.181 1.00 40.00 ? 447 HIS A CB  1 
ATOM 3392 C CG  . HIS A 1 444 ? 28.384 78.931  18.055 1.00 40.00 ? 447 HIS A CG  1 
ATOM 3393 N ND1 . HIS A 1 444 ? 27.242 78.146  18.154 1.00 40.00 ? 447 HIS A ND1 1 
ATOM 3394 C CD2 . HIS A 1 444 ? 28.191 79.986  18.884 1.00 40.00 ? 447 HIS A CD2 1 
ATOM 3395 C CE1 . HIS A 1 444 ? 26.400 78.719  19.003 1.00 40.00 ? 447 HIS A CE1 1 
ATOM 3396 N NE2 . HIS A 1 444 ? 26.948 79.841  19.463 1.00 40.00 ? 447 HIS A NE2 1 
ATOM 3397 N N   . GLY A 1 445 ? 27.872 80.458  14.766 1.00 40.00 ? 448 GLY A N   1 
ATOM 3398 C CA  . GLY A 1 445 ? 27.569 81.804  14.350 1.00 40.00 ? 448 GLY A CA  1 
ATOM 3399 C C   . GLY A 1 445 ? 27.829 82.201  12.935 1.00 40.00 ? 448 GLY A C   1 
ATOM 3400 O O   . GLY A 1 445 ? 27.478 83.322  12.502 1.00 40.00 ? 448 GLY A O   1 
ATOM 3401 N N   . TYR A 1 446 ? 28.403 81.331  12.097 1.00 40.00 ? 449 TYR A N   1 
ATOM 3402 C CA  . TYR A 1 446 ? 28.636 81.772  10.713 1.00 40.00 ? 449 TYR A CA  1 
ATOM 3403 C C   . TYR A 1 446 ? 27.533 81.514  9.737  1.00 40.00 ? 449 TYR A C   1 
ATOM 3404 O O   . TYR A 1 446 ? 27.768 81.461  8.510  1.00 40.00 ? 449 TYR A O   1 
ATOM 3405 C CB  . TYR A 1 446 ? 30.061 81.357  10.367 1.00 40.00 ? 449 TYR A CB  1 
ATOM 3406 C CG  . TYR A 1 446 ? 30.943 82.211  11.286 1.00 40.00 ? 449 TYR A CG  1 
ATOM 3407 C CD1 . TYR A 1 446 ? 31.234 81.835  12.586 1.00 40.00 ? 449 TYR A CD1 1 
ATOM 3408 C CD2 . TYR A 1 446 ? 31.418 83.423  10.813 1.00 40.00 ? 449 TYR A CD2 1 
ATOM 3409 C CE1 . TYR A 1 446 ? 32.013 82.641  13.398 1.00 40.00 ? 449 TYR A CE1 1 
ATOM 3410 C CE2 . TYR A 1 446 ? 32.223 84.227  11.613 1.00 40.00 ? 449 TYR A CE2 1 
ATOM 3411 C CZ  . TYR A 1 446 ? 32.513 83.828  12.908 1.00 40.00 ? 449 TYR A CZ  1 
ATOM 3412 O OH  . TYR A 1 446 ? 33.293 84.668  13.677 1.00 40.00 ? 449 TYR A OH  1 
ATOM 3413 N N   . GLU A 1 447 ? 26.275 81.428  10.191 1.00 40.00 ? 450 GLU A N   1 
ATOM 3414 C CA  . GLU A 1 447 ? 25.147 81.288  9.282  1.00 40.00 ? 450 GLU A CA  1 
ATOM 3415 C C   . GLU A 1 447 ? 24.467 82.673  9.209  1.00 40.00 ? 450 GLU A C   1 
ATOM 3416 O O   . GLU A 1 447 ? 23.745 83.005  8.266  1.00 40.00 ? 450 GLU A O   1 
ATOM 3417 C CB  . GLU A 1 447 ? 24.083 80.319  9.807  1.00 40.00 ? 450 GLU A CB  1 
ATOM 3418 C CG  . GLU A 1 447 ? 23.212 80.913  10.929 1.00 40.00 ? 450 GLU A CG  1 
ATOM 3419 C CD  . GLU A 1 447 ? 23.655 80.443  12.308 1.00 40.00 ? 450 GLU A CD  1 
ATOM 3420 O OE1 . GLU A 1 447 ? 24.890 80.367  12.517 1.00 40.00 ? 450 GLU A OE1 1 
ATOM 3421 O OE2 . GLU A 1 447 ? 22.729 80.147  13.103 1.00 40.00 ? 450 GLU A OE2 1 
ATOM 3422 N N   . ILE A 1 448 ? 24.654 83.471  10.287 1.00 40.00 ? 451 ILE A N   1 
ATOM 3423 C CA  . ILE A 1 448 ? 24.000 84.760  10.427 1.00 40.00 ? 451 ILE A CA  1 
ATOM 3424 C C   . ILE A 1 448 ? 24.165 85.675  9.228  1.00 40.00 ? 451 ILE A C   1 
ATOM 3425 O O   . ILE A 1 448 ? 23.151 86.151  8.670  1.00 40.00 ? 451 ILE A O   1 
ATOM 3426 C CB  . ILE A 1 448 ? 24.367 85.563  11.682 1.00 40.00 ? 451 ILE A CB  1 
ATOM 3427 C CG1 . ILE A 1 448 ? 25.060 84.748  12.751 1.00 40.00 ? 451 ILE A CG1 1 
ATOM 3428 C CG2 . ILE A 1 448 ? 23.090 86.250  12.212 1.00 40.00 ? 451 ILE A CG2 1 
ATOM 3429 C CD1 . ILE A 1 448 ? 24.326 84.442  14.035 1.00 40.00 ? 451 ILE A CD1 1 
ATOM 3430 N N   . GLU A 1 449 ? 25.426 85.863  8.822  1.00 40.00 ? 452 GLU A N   1 
ATOM 3431 C CA  . GLU A 1 449 ? 25.706 86.642  7.607  1.00 40.00 ? 452 GLU A CA  1 
ATOM 3432 C C   . GLU A 1 449 ? 24.680 86.241  6.537  1.00 40.00 ? 452 GLU A C   1 
ATOM 3433 O O   . GLU A 1 449 ? 23.970 87.087  5.953  1.00 40.00 ? 452 GLU A O   1 
ATOM 3434 C CB  . GLU A 1 449 ? 27.115 86.380  7.139  1.00 40.00 ? 452 GLU A CB  1 
ATOM 3435 C CG  . GLU A 1 449 ? 28.121 85.875  8.167  1.00 40.00 ? 452 GLU A CG  1 
ATOM 3436 C CD  . GLU A 1 449 ? 29.528 85.947  7.584  1.00 40.00 ? 452 GLU A CD  1 
ATOM 3437 O OE1 . GLU A 1 449 ? 29.575 86.160  6.346  1.00 40.00 ? 452 GLU A OE1 1 
ATOM 3438 O OE2 . GLU A 1 449 ? 30.610 85.822  8.215  1.00 40.00 ? 452 GLU A OE2 1 
ATOM 3439 N N   . PHE A 1 450 ? 24.497 84.948  6.271  1.00 40.00 ? 453 PHE A N   1 
ATOM 3440 C CA  . PHE A 1 450 ? 23.529 84.519  5.265  1.00 40.00 ? 453 PHE A CA  1 
ATOM 3441 C C   . PHE A 1 450 ? 22.096 84.780  5.606  1.00 40.00 ? 453 PHE A C   1 
ATOM 3442 O O   . PHE A 1 450 ? 21.414 85.510  4.845  1.00 40.00 ? 453 PHE A O   1 
ATOM 3443 C CB  . PHE A 1 450 ? 23.812 83.054  4.868  1.00 40.00 ? 453 PHE A CB  1 
ATOM 3444 C CG  . PHE A 1 450 ? 25.252 82.955  4.390  1.00 40.00 ? 453 PHE A CG  1 
ATOM 3445 C CD1 . PHE A 1 450 ? 26.269 82.659  5.267  1.00 40.00 ? 453 PHE A CD1 1 
ATOM 3446 C CD2 . PHE A 1 450 ? 25.573 83.195  3.073  1.00 40.00 ? 453 PHE A CD2 1 
ATOM 3447 C CE1 . PHE A 1 450 ? 27.582 82.594  4.818  1.00 40.00 ? 453 PHE A CE1 1 
ATOM 3448 C CE2 . PHE A 1 450 ? 26.881 83.129  2.621  1.00 40.00 ? 453 PHE A CE2 1 
ATOM 3449 C CZ  . PHE A 1 450 ? 27.906 82.827  3.490  1.00 40.00 ? 453 PHE A CZ  1 
ATOM 3450 N N   . ILE A 1 451 ? 21.571 84.267  6.715  1.00 40.00 ? 454 ILE A N   1 
ATOM 3451 C CA  . ILE A 1 451 ? 20.144 84.551  7.017  1.00 40.00 ? 454 ILE A CA  1 
ATOM 3452 C C   . ILE A 1 451 ? 19.845 86.028  6.875  1.00 40.00 ? 454 ILE A C   1 
ATOM 3453 O O   . ILE A 1 451 ? 18.866 86.420  6.255  1.00 40.00 ? 454 ILE A O   1 
ATOM 3454 C CB  . ILE A 1 451 ? 19.796 84.099  8.443  1.00 40.00 ? 454 ILE A CB  1 
ATOM 3455 C CG1 . ILE A 1 451 ? 20.294 82.665  8.669  1.00 40.00 ? 454 ILE A CG1 1 
ATOM 3456 C CG2 . ILE A 1 451 ? 18.314 84.188  8.750  1.00 40.00 ? 454 ILE A CG2 1 
ATOM 3457 C CD1 . ILE A 1 451 ? 19.445 81.636  7.960  1.00 40.00 ? 454 ILE A CD1 1 
ATOM 3458 N N   . PHE A 1 452 ? 20.689 86.912  7.431  1.00 40.00 ? 455 PHE A N   1 
ATOM 3459 C CA  . PHE A 1 452 ? 20.433 88.350  7.327  1.00 40.00 ? 455 PHE A CA  1 
ATOM 3460 C C   . PHE A 1 452 ? 20.544 88.882  5.917  1.00 40.00 ? 455 PHE A C   1 
ATOM 3461 O O   . PHE A 1 452 ? 19.905 89.895  5.600  1.00 40.00 ? 455 PHE A O   1 
ATOM 3462 C CB  . PHE A 1 452 ? 21.233 89.162  8.378  1.00 40.00 ? 455 PHE A CB  1 
ATOM 3463 C CG  . PHE A 1 452 ? 20.444 89.183  9.682  1.00 40.00 ? 455 PHE A CG  1 
ATOM 3464 C CD1 . PHE A 1 452 ? 20.649 88.186  10.630 1.00 40.00 ? 455 PHE A CD1 1 
ATOM 3465 C CD2 . PHE A 1 452 ? 19.489 90.151  9.919  1.00 40.00 ? 455 PHE A CD2 1 
ATOM 3466 C CE1 . PHE A 1 452 ? 19.904 88.178  11.799 1.00 40.00 ? 455 PHE A CE1 1 
ATOM 3467 C CE2 . PHE A 1 452 ? 18.750 90.144  11.093 1.00 40.00 ? 455 PHE A CE2 1 
ATOM 3468 C CZ  . PHE A 1 452 ? 18.955 89.165  12.040 1.00 40.00 ? 455 PHE A CZ  1 
ATOM 3469 N N   . GLY A 1 453 ? 21.267 88.218  5.028  1.00 40.00 ? 456 GLY A N   1 
ATOM 3470 C CA  . GLY A 1 453 ? 21.323 88.634  3.641  1.00 40.00 ? 456 GLY A CA  1 
ATOM 3471 C C   . GLY A 1 453 ? 22.485 89.531  3.346  1.00 40.00 ? 456 GLY A C   1 
ATOM 3472 O O   . GLY A 1 453 ? 22.540 90.198  2.308  1.00 40.00 ? 456 GLY A O   1 
ATOM 3473 N N   . LEU A 1 454 ? 23.570 89.429  4.121  1.00 40.00 ? 457 LEU A N   1 
ATOM 3474 C CA  . LEU A 1 454 ? 24.749 90.247  3.857  1.00 40.00 ? 457 LEU A CA  1 
ATOM 3475 C C   . LEU A 1 454 ? 25.380 90.062  2.514  1.00 40.00 ? 457 LEU A C   1 
ATOM 3476 O O   . LEU A 1 454 ? 25.941 91.001  1.933  1.00 40.00 ? 457 LEU A O   1 
ATOM 3477 C CB  . LEU A 1 454 ? 25.755 90.180  5.013  1.00 40.00 ? 457 LEU A CB  1 
ATOM 3478 C CG  . LEU A 1 454 ? 25.454 91.258  6.082  1.00 40.00 ? 457 LEU A CG  1 
ATOM 3479 C CD1 . LEU A 1 454 ? 24.047 91.073  6.639  1.00 40.00 ? 457 LEU A CD1 1 
ATOM 3480 C CD2 . LEU A 1 454 ? 26.497 91.266  7.184  1.00 40.00 ? 457 LEU A CD2 1 
ATOM 3481 N N   . PRO A 1 455 ? 25.294 88.898  1.905  1.00 40.00 ? 458 PRO A N   1 
ATOM 3482 C CA  . PRO A 1 455 ? 25.897 88.720  0.571  1.00 40.00 ? 458 PRO A CA  1 
ATOM 3483 C C   . PRO A 1 455 ? 25.195 89.543  -0.476 1.00 40.00 ? 458 PRO A C   1 
ATOM 3484 O O   . PRO A 1 455 ? 25.856 89.949  -1.462 1.00 40.00 ? 458 PRO A O   1 
ATOM 3485 C CB  . PRO A 1 455 ? 25.967 87.225  0.399  1.00 40.00 ? 458 PRO A CB  1 
ATOM 3486 C CG  . PRO A 1 455 ? 25.788 86.657  1.779  1.00 40.00 ? 458 PRO A CG  1 
ATOM 3487 C CD  . PRO A 1 455 ? 24.749 87.605  2.382  1.00 40.00 ? 458 PRO A CD  1 
ATOM 3488 N N   . LEU A 1 456 ? 23.931 89.930  -0.309 1.00 40.00 ? 459 LEU A N   1 
ATOM 3489 C CA  . LEU A 1 456 ? 23.233 90.802  -1.257 1.00 40.00 ? 459 LEU A CA  1 
ATOM 3490 C C   . LEU A 1 456 ? 23.965 92.138  -1.417 1.00 40.00 ? 459 LEU A C   1 
ATOM 3491 O O   . LEU A 1 456 ? 23.864 92.803  -2.462 1.00 40.00 ? 459 LEU A O   1 
ATOM 3492 C CB  . LEU A 1 456 ? 21.756 90.994  -0.883 1.00 40.00 ? 459 LEU A CB  1 
ATOM 3493 C CG  . LEU A 1 456 ? 20.810 89.806  -1.071 1.00 40.00 ? 459 LEU A CG  1 
ATOM 3494 C CD1 . LEU A 1 456 ? 20.668 88.913  0.149  1.00 40.00 ? 459 LEU A CD1 1 
ATOM 3495 C CD2 . LEU A 1 456 ? 19.407 90.252  -1.471 1.00 40.00 ? 459 LEU A CD2 1 
ATOM 3496 N N   . ASP A 1 457 ? 24.745 92.591  -0.441 1.00 40.00 ? 460 ASP A N   1 
ATOM 3497 C CA  . ASP A 1 457 ? 25.522 93.817  -0.575 1.00 40.00 ? 460 ASP A CA  1 
ATOM 3498 C C   . ASP A 1 457 ? 26.776 93.514  -1.411 1.00 40.00 ? 460 ASP A C   1 
ATOM 3499 O O   . ASP A 1 457 ? 27.666 92.750  -1.028 1.00 40.00 ? 460 ASP A O   1 
ATOM 3500 C CB  . ASP A 1 457 ? 25.908 94.401  0.774  1.00 40.00 ? 460 ASP A CB  1 
ATOM 3501 C CG  . ASP A 1 457 ? 26.731 95.668  0.725  1.00 40.00 ? 460 ASP A CG  1 
ATOM 3502 O OD1 . ASP A 1 457 ? 27.304 96.034  -0.327 1.00 40.00 ? 460 ASP A OD1 1 
ATOM 3503 O OD2 . ASP A 1 457 ? 26.827 96.351  1.780  1.00 40.00 ? 460 ASP A OD2 1 
ATOM 3504 N N   . PRO A 1 458 ? 26.858 94.157  -2.565 1.00 40.00 ? 461 PRO A N   1 
ATOM 3505 C CA  . PRO A 1 458 ? 27.935 93.985  -3.513 1.00 40.00 ? 461 PRO A CA  1 
ATOM 3506 C C   . PRO A 1 458 ? 29.295 94.420  -3.031 1.00 40.00 ? 461 PRO A C   1 
ATOM 3507 O O   . PRO A 1 458 ? 30.325 93.851  -3.430 1.00 40.00 ? 461 PRO A O   1 
ATOM 3508 C CB  . PRO A 1 458 ? 27.508 94.812  -4.724 1.00 40.00 ? 461 PRO A CB  1 
ATOM 3509 C CG  . PRO A 1 458 ? 26.012 94.903  -4.586 1.00 40.00 ? 461 PRO A CG  1 
ATOM 3510 C CD  . PRO A 1 458 ? 25.812 95.083  -3.088 1.00 40.00 ? 461 PRO A CD  1 
ATOM 3511 N N   . SER A 1 459 ? 29.328 95.440  -2.178 1.00 40.00 ? 462 SER A N   1 
ATOM 3512 C CA  . SER A 1 459 ? 30.617 95.924  -1.667 1.00 40.00 ? 462 SER A CA  1 
ATOM 3513 C C   . SER A 1 459 ? 31.308 94.824  -0.867 1.00 40.00 ? 462 SER A C   1 
ATOM 3514 O O   . SER A 1 459 ? 32.484 94.523  -1.041 1.00 40.00 ? 462 SER A O   1 
ATOM 3515 C CB  . SER A 1 459 ? 30.372 97.135  -0.768 1.00 40.00 ? 462 SER A CB  1 
ATOM 3516 O OG  . SER A 1 459 ? 29.885 96.687  0.490  1.00 40.00 ? 462 SER A OG  1 
ATOM 3517 N N   . LEU A 1 460 ? 30.529 94.199  0.005  1.00 40.00 ? 463 LEU A N   1 
ATOM 3518 C CA  . LEU A 1 460 ? 30.909 93.128  0.889  1.00 40.00 ? 463 LEU A CA  1 
ATOM 3519 C C   . LEU A 1 460 ? 31.606 91.973  0.219  1.00 40.00 ? 463 LEU A C   1 
ATOM 3520 O O   . LEU A 1 460 ? 32.455 91.299  0.806  1.00 40.00 ? 463 LEU A O   1 
ATOM 3521 C CB  . LEU A 1 460 ? 29.629 92.580  1.558  1.00 40.00 ? 463 LEU A CB  1 
ATOM 3522 C CG  . LEU A 1 460 ? 29.243 93.392  2.797  1.00 40.00 ? 463 LEU A CG  1 
ATOM 3523 C CD1 . LEU A 1 460 ? 27.900 92.965  3.341  1.00 40.00 ? 463 LEU A CD1 1 
ATOM 3524 C CD2 . LEU A 1 460 ? 30.345 93.255  3.842  1.00 40.00 ? 463 LEU A CD2 1 
ATOM 3525 N N   . ASN A 1 461 ? 31.313 91.739  -1.038 1.00 40.00 ? 464 ASN A N   1 
ATOM 3526 C CA  . ASN A 1 461 ? 31.870 90.777  -1.915 1.00 40.00 ? 464 ASN A CA  1 
ATOM 3527 C C   . ASN A 1 461 ? 31.939 89.333  -1.486 1.00 40.00 ? 464 ASN A C   1 
ATOM 3528 O O   . ASN A 1 461 ? 32.953 88.746  -1.113 1.00 40.00 ? 464 ASN A O   1 
ATOM 3529 C CB  . ASN A 1 461 ? 33.211 91.273  -2.475 1.00 40.00 ? 464 ASN A CB  1 
ATOM 3530 C CG  . ASN A 1 461 ? 34.397 91.213  -1.565 1.00 40.00 ? 464 ASN A CG  1 
ATOM 3531 O OD1 . ASN A 1 461 ? 35.251 90.327  -1.662 1.00 40.00 ? 464 ASN A OD1 1 
ATOM 3532 N ND2 . ASN A 1 461 ? 34.546 92.138  -0.627 1.00 40.00 ? 464 ASN A ND2 1 
ATOM 3533 N N   . TYR A 1 462 ? 30.779 88.680  -1.610 1.00 40.00 ? 465 TYR A N   1 
ATOM 3534 C CA  . TYR A 1 462 ? 30.709 87.232  -1.384 1.00 40.00 ? 465 TYR A CA  1 
ATOM 3535 C C   . TYR A 1 462 ? 30.723 86.690  -2.834 1.00 40.00 ? 465 TYR A C   1 
ATOM 3536 O O   . TYR A 1 462 ? 31.130 87.427  -3.740 1.00 40.00 ? 465 TYR A O   1 
ATOM 3537 C CB  . TYR A 1 462 ? 29.423 86.810  -0.733 1.00 40.00 ? 465 TYR A CB  1 
ATOM 3538 C CG  . TYR A 1 462 ? 29.250 87.165  0.713  1.00 40.00 ? 465 TYR A CG  1 
ATOM 3539 C CD1 . TYR A 1 462 ? 29.462 86.196  1.690  1.00 40.00 ? 465 TYR A CD1 1 
ATOM 3540 C CD2 . TYR A 1 462 ? 28.885 88.437  1.120  1.00 40.00 ? 465 TYR A CD2 1 
ATOM 3541 C CE1 . TYR A 1 462 ? 29.305 86.501  3.030  1.00 40.00 ? 465 TYR A CE1 1 
ATOM 3542 C CE2 . TYR A 1 462 ? 28.712 88.744  2.458  1.00 40.00 ? 465 TYR A CE2 1 
ATOM 3543 C CZ  . TYR A 1 462 ? 28.926 87.772  3.407  1.00 40.00 ? 465 TYR A CZ  1 
ATOM 3544 O OH  . TYR A 1 462 ? 28.767 88.050  4.740  1.00 40.00 ? 465 TYR A OH  1 
ATOM 3545 N N   . THR A 1 463 ? 30.249 85.484  -3.039 1.00 40.00 ? 466 THR A N   1 
ATOM 3546 C CA  . THR A 1 463 ? 30.183 84.965  -4.403 1.00 40.00 ? 466 THR A CA  1 
ATOM 3547 C C   . THR A 1 463 ? 28.711 85.035  -4.809 1.00 40.00 ? 466 THR A C   1 
ATOM 3548 O O   . THR A 1 463 ? 27.818 85.014  -3.957 1.00 40.00 ? 466 THR A O   1 
ATOM 3549 C CB  . THR A 1 463 ? 30.709 83.542  -4.565 1.00 40.00 ? 466 THR A CB  1 
ATOM 3550 O OG1 . THR A 1 463 ? 29.757 82.579  -4.081 1.00 40.00 ? 466 THR A OG1 1 
ATOM 3551 C CG2 . THR A 1 463 ? 32.038 83.374  -3.851 1.00 40.00 ? 466 THR A CG2 1 
ATOM 3552 N N   . THR A 1 464 ? 28.487 85.063  -6.115 1.00 40.00 ? 467 THR A N   1 
ATOM 3553 C CA  . THR A 1 464 ? 27.116 85.102  -6.632 1.00 40.00 ? 467 THR A CA  1 
ATOM 3554 C C   . THR A 1 464 ? 26.324 83.937  -6.057 1.00 40.00 ? 467 THR A C   1 
ATOM 3555 O O   . THR A 1 464 ? 25.168 84.083  -5.662 1.00 40.00 ? 467 THR A O   1 
ATOM 3556 C CB  . THR A 1 464 ? 27.157 85.077  -8.163 1.00 40.00 ? 467 THR A CB  1 
ATOM 3557 O OG1 . THR A 1 464 ? 28.392 85.676  -8.590 1.00 40.00 ? 467 THR A OG1 1 
ATOM 3558 C CG2 . THR A 1 464 ? 25.973 85.831  -8.739 1.00 40.00 ? 467 THR A CG2 1 
ATOM 3559 N N   . GLU A 1 465 ? 26.976 82.772  -5.970 1.00 40.00 ? 468 GLU A N   1 
ATOM 3560 C CA  . GLU A 1 465 ? 26.328 81.594  -5.390 1.00 40.00 ? 468 GLU A CA  1 
ATOM 3561 C C   . GLU A 1 465 ? 25.887 81.942  -3.968 1.00 40.00 ? 468 GLU A C   1 
ATOM 3562 O O   . GLU A 1 465 ? 24.723 81.806  -3.597 1.00 40.00 ? 468 GLU A O   1 
ATOM 3563 C CB  . GLU A 1 465 ? 27.282 80.405  -5.409 1.00 40.00 ? 468 GLU A CB  1 
ATOM 3564 C CG  . GLU A 1 465 ? 27.888 80.130  -6.786 1.00 40.00 ? 468 GLU A CG  1 
ATOM 3565 C CD  . GLU A 1 465 ? 29.221 80.848  -6.972 1.00 40.00 ? 468 GLU A CD  1 
ATOM 3566 O OE1 . GLU A 1 465 ? 30.246 80.346  -6.442 1.00 40.00 ? 468 GLU A OE1 1 
ATOM 3567 O OE2 . GLU A 1 465 ? 29.255 81.904  -7.641 1.00 40.00 ? 468 GLU A OE2 1 
ATOM 3568 N N   . GLU A 1 466 ? 26.854 82.487  -3.212 1.00 40.00 ? 469 GLU A N   1 
ATOM 3569 C CA  . GLU A 1 466 ? 26.599 82.918  -1.835 1.00 40.00 ? 469 GLU A CA  1 
ATOM 3570 C C   . GLU A 1 466 ? 25.402 83.862  -1.799 1.00 40.00 ? 469 GLU A C   1 
ATOM 3571 O O   . GLU A 1 466 ? 24.509 83.739  -0.952 1.00 40.00 ? 469 GLU A O   1 
ATOM 3572 C CB  . GLU A 1 466 ? 27.848 83.528  -1.198 1.00 40.00 ? 469 GLU A CB  1 
ATOM 3573 C CG  . GLU A 1 466 ? 29.042 82.590  -1.209 1.00 40.00 ? 469 GLU A CG  1 
ATOM 3574 C CD  . GLU A 1 466 ? 30.182 82.944  -0.291 1.00 40.00 ? 469 GLU A CD  1 
ATOM 3575 O OE1 . GLU A 1 466 ? 31.067 83.764  -0.637 1.00 40.00 ? 469 GLU A OE1 1 
ATOM 3576 O OE2 . GLU A 1 466 ? 30.239 82.393  0.839  1.00 40.00 ? 469 GLU A OE2 1 
ATOM 3577 N N   . ARG A 1 467 ? 25.370 84.780  -2.765 1.00 40.00 ? 470 ARG A N   1 
ATOM 3578 C CA  . ARG A 1 467 ? 24.277 85.729  -2.877 1.00 40.00 ? 470 ARG A CA  1 
ATOM 3579 C C   . ARG A 1 467 ? 22.937 85.019  -3.073 1.00 40.00 ? 470 ARG A C   1 
ATOM 3580 O O   . ARG A 1 467 ? 21.976 85.199  -2.332 1.00 40.00 ? 470 ARG A O   1 
ATOM 3581 C CB  . ARG A 1 467 ? 24.535 86.683  -4.050 1.00 40.00 ? 470 ARG A CB  1 
ATOM 3582 C CG  . ARG A 1 467 ? 23.354 87.622  -4.290 1.00 40.00 ? 470 ARG A CG  1 
ATOM 3583 C CD  . ARG A 1 467 ? 23.448 88.274  -5.674 1.00 40.00 ? 470 ARG A CD  1 
ATOM 3584 N NE  . ARG A 1 467 ? 24.772 88.853  -5.886 1.00 40.00 ? 470 ARG A NE  1 
ATOM 3585 C CZ  . ARG A 1 467 ? 25.401 89.068  -7.029 1.00 40.00 ? 470 ARG A CZ  1 
ATOM 3586 N NH1 . ARG A 1 467 ? 24.853 88.770  -8.197 1.00 40.00 ? 470 ARG A NH1 1 
ATOM 3587 N NH2 . ARG A 1 467 ? 26.629 89.605  -6.998 1.00 40.00 ? 470 ARG A NH2 1 
ATOM 3588 N N   . ILE A 1 468 ? 22.936 84.180  -4.114 1.00 40.00 ? 471 ILE A N   1 
ATOM 3589 C CA  . ILE A 1 468 ? 21.740 83.396  -4.449 1.00 40.00 ? 471 ILE A CA  1 
ATOM 3590 C C   . ILE A 1 468 ? 21.351 82.576  -3.212 1.00 40.00 ? 471 ILE A C   1 
ATOM 3591 O O   . ILE A 1 468 ? 20.197 82.557  -2.796 1.00 40.00 ? 471 ILE A O   1 
ATOM 3592 C CB  . ILE A 1 468 ? 22.083 82.434  -5.602 1.00 40.00 ? 471 ILE A CB  1 
ATOM 3593 C CG1 . ILE A 1 468 ? 22.599 83.200  -6.822 1.00 40.00 ? 471 ILE A CG1 1 
ATOM 3594 C CG2 . ILE A 1 468 ? 20.888 81.576  -5.980 1.00 40.00 ? 471 ILE A CG2 1 
ATOM 3595 C CD1 . ILE A 1 468 ? 23.464 82.366  -7.747 1.00 40.00 ? 471 ILE A CD1 1 
ATOM 3596 N N   . PHE A 1 469 ? 22.412 81.936  -2.667 1.00 40.00 ? 472 PHE A N   1 
ATOM 3597 C CA  . PHE A 1 469 ? 22.257 81.114  -1.475 1.00 40.00 ? 472 PHE A CA  1 
ATOM 3598 C C   . PHE A 1 469 ? 21.476 81.911  -0.428 1.00 40.00 ? 472 PHE A C   1 
ATOM 3599 O O   . PHE A 1 469 ? 20.398 81.541  0.026  1.00 40.00 ? 472 PHE A O   1 
ATOM 3600 C CB  . PHE A 1 469 ? 23.618 80.757  -0.890 1.00 40.00 ? 472 PHE A CB  1 
ATOM 3601 C CG  . PHE A 1 469 ? 23.620 79.819  0.271  1.00 40.00 ? 472 PHE A CG  1 
ATOM 3602 C CD1 . PHE A 1 469 ? 22.506 79.087  0.653  1.00 40.00 ? 472 PHE A CD1 1 
ATOM 3603 C CD2 . PHE A 1 469 ? 24.789 79.645  1.019  1.00 40.00 ? 472 PHE A CD2 1 
ATOM 3604 C CE1 . PHE A 1 469 ? 22.539 78.213  1.726  1.00 40.00 ? 472 PHE A CE1 1 
ATOM 3605 C CE2 . PHE A 1 469 ? 24.826 78.778  2.094  1.00 40.00 ? 472 PHE A CE2 1 
ATOM 3606 C CZ  . PHE A 1 469 ? 23.701 78.059  2.452  1.00 40.00 ? 472 PHE A CZ  1 
ATOM 3607 N N   . ALA A 1 470 ? 22.067 83.067  -0.106 1.00 40.00 ? 473 ALA A N   1 
ATOM 3608 C CA  . ALA A 1 470 ? 21.470 83.963  0.873  1.00 40.00 ? 473 ALA A CA  1 
ATOM 3609 C C   . ALA A 1 470 ? 19.982 84.160  0.621  1.00 40.00 ? 473 ALA A C   1 
ATOM 3610 O O   . ALA A 1 470 ? 19.085 83.934  1.445  1.00 40.00 ? 473 ALA A O   1 
ATOM 3611 C CB  . ALA A 1 470 ? 22.212 85.276  0.781  1.00 40.00 ? 473 ALA A CB  1 
ATOM 3612 N N   . GLN A 1 471 ? 19.684 84.563  -0.626 1.00 40.00 ? 474 GLN A N   1 
ATOM 3613 C CA  . GLN A 1 471 ? 18.302 84.812  -1.038 1.00 40.00 ? 474 GLN A CA  1 
ATOM 3614 C C   . GLN A 1 471 ? 17.422 83.618  -0.714 1.00 40.00 ? 474 GLN A C   1 
ATOM 3615 O O   . GLN A 1 471 ? 16.287 83.697  -0.240 1.00 40.00 ? 474 GLN A O   1 
ATOM 3616 C CB  . GLN A 1 471 ? 18.258 85.191  -2.513 1.00 40.00 ? 474 GLN A CB  1 
ATOM 3617 C CG  . GLN A 1 471 ? 19.323 86.182  -2.970 1.00 40.00 ? 474 GLN A CG  1 
ATOM 3618 C CD  . GLN A 1 471 ? 19.109 86.737  -4.367 1.00 40.00 ? 474 GLN A CD  1 
ATOM 3619 O OE1 . GLN A 1 471 ? 20.070 86.993  -5.115 1.00 40.00 ? 474 GLN A OE1 1 
ATOM 3620 N NE2 . GLN A 1 471 ? 17.845 86.947  -4.752 1.00 40.00 ? 474 GLN A NE2 1 
ATOM 3621 N N   . ARG A 1 472 ? 18.003 82.434  -0.970 1.00 40.00 ? 475 ARG A N   1 
ATOM 3622 C CA  . ARG A 1 472 ? 17.269 81.189  -0.706 1.00 40.00 ? 475 ARG A CA  1 
ATOM 3623 C C   . ARG A 1 472 ? 16.955 81.069  0.776  1.00 40.00 ? 475 ARG A C   1 
ATOM 3624 O O   . ARG A 1 472 ? 15.810 80.852  1.187  1.00 40.00 ? 475 ARG A O   1 
ATOM 3625 C CB  . ARG A 1 472 ? 18.098 80.035  -1.221 1.00 40.00 ? 475 ARG A CB  1 
ATOM 3626 C CG  . ARG A 1 472 ? 17.232 78.822  -1.569 1.00 40.00 ? 475 ARG A CG  1 
ATOM 3627 C CD  . ARG A 1 472 ? 18.152 77.790  -2.186 1.00 40.00 ? 475 ARG A CD  1 
ATOM 3628 N NE  . ARG A 1 472 ? 18.431 76.671  -1.286 1.00 40.00 ? 475 ARG A NE  1 
ATOM 3629 C CZ  . ARG A 1 472 ? 19.684 76.195  -1.248 1.00 40.00 ? 475 ARG A CZ  1 
ATOM 3630 N NH1 . ARG A 1 472 ? 20.634 76.756  -1.998 1.00 40.00 ? 475 ARG A NH1 1 
ATOM 3631 N NH2 . ARG A 1 472 ? 19.918 75.160  -0.448 1.00 40.00 ? 475 ARG A NH2 1 
ATOM 3632 N N   . LEU A 1 473 ? 18.024 81.255  1.565  1.00 40.00 ? 476 LEU A N   1 
ATOM 3633 C CA  . LEU A 1 473 ? 17.910 81.225  3.021  1.00 40.00 ? 476 LEU A CA  1 
ATOM 3634 C C   . LEU A 1 473 ? 16.894 82.244  3.514  1.00 40.00 ? 476 LEU A C   1 
ATOM 3635 O O   . LEU A 1 473 ? 15.960 81.931  4.275  1.00 40.00 ? 476 LEU A O   1 
ATOM 3636 C CB  . LEU A 1 473 ? 19.296 81.485  3.622  1.00 40.00 ? 476 LEU A CB  1 
ATOM 3637 C CG  . LEU A 1 473 ? 20.289 80.314  3.549  1.00 40.00 ? 476 LEU A CG  1 
ATOM 3638 C CD1 . LEU A 1 473 ? 21.716 80.788  3.320  1.00 40.00 ? 476 LEU A CD1 1 
ATOM 3639 C CD2 . LEU A 1 473 ? 20.218 79.514  4.848  1.00 40.00 ? 476 LEU A CD2 1 
ATOM 3640 N N   . MET A 1 474 ? 16.996 83.492  3.013  1.00 40.00 ? 477 MET A N   1 
ATOM 3641 C CA  . MET A 1 474 ? 16.053 84.520  3.463  1.00 40.00 ? 477 MET A CA  1 
ATOM 3642 C C   . MET A 1 474 ? 14.604 84.110  3.204  1.00 40.00 ? 477 MET A C   1 
ATOM 3643 O O   . MET A 1 474 ? 13.662 84.358  3.942  1.00 40.00 ? 477 MET A O   1 
ATOM 3644 C CB  . MET A 1 474 ? 16.278 85.856  2.800  1.00 40.00 ? 477 MET A CB  1 
ATOM 3645 C CG  . MET A 1 474 ? 17.721 86.158  2.459  1.00 40.00 ? 477 MET A CG  1 
ATOM 3646 S SD  . MET A 1 474 ? 17.912 87.888  1.993  1.00 40.00 ? 477 MET A SD  1 
ATOM 3647 C CE  . MET A 1 474 ? 16.813 88.655  3.180  1.00 40.00 ? 477 MET A CE  1 
ATOM 3648 N N   . LYS A 1 475 ? 14.477 83.469  2.049  1.00 40.00 ? 478 LYS A N   1 
ATOM 3649 C CA  . LYS A 1 475 ? 13.203 82.966  1.574  1.00 40.00 ? 478 LYS A CA  1 
ATOM 3650 C C   . LYS A 1 475 ? 12.613 81.921  2.517  1.00 40.00 ? 478 LYS A C   1 
ATOM 3651 O O   . LYS A 1 475 ? 11.408 81.978  2.803  1.00 40.00 ? 478 LYS A O   1 
ATOM 3652 C CB  . LYS A 1 475 ? 13.462 82.356  0.189  1.00 40.00 ? 478 LYS A CB  1 
ATOM 3653 C CG  . LYS A 1 475 ? 12.980 83.215  -0.961 1.00 40.00 ? 478 LYS A CG  1 
ATOM 3654 C CD  . LYS A 1 475 ? 11.507 83.575  -0.818 1.00 40.00 ? 478 LYS A CD  1 
ATOM 3655 C CE  . LYS A 1 475 ? 10.610 82.366  -0.983 1.00 40.00 ? 478 LYS A CE  1 
ATOM 3656 N NZ  . LYS A 1 475 ? 11.343 81.095  -1.269 1.00 40.00 ? 478 LYS A NZ  1 
ATOM 3657 N N   . TYR A 1 476 ? 13.487 81.008  2.996  1.00 40.00 ? 479 TYR A N   1 
ATOM 3658 C CA  . TYR A 1 476 ? 12.995 79.962  3.895  1.00 40.00 ? 479 TYR A CA  1 
ATOM 3659 C C   . TYR A 1 476 ? 12.472 80.581  5.192  1.00 40.00 ? 479 TYR A C   1 
ATOM 3660 O O   . TYR A 1 476 ? 11.361 80.283  5.669  1.00 40.00 ? 479 TYR A O   1 
ATOM 3661 C CB  . TYR A 1 476 ? 14.064 78.931  4.149  1.00 40.00 ? 479 TYR A CB  1 
ATOM 3662 C CG  . TYR A 1 476 ? 14.608 78.064  3.047  1.00 40.00 ? 479 TYR A CG  1 
ATOM 3663 C CD1 . TYR A 1 476 ? 13.828 77.134  2.355  1.00 40.00 ? 479 TYR A CD1 1 
ATOM 3664 C CD2 . TYR A 1 476 ? 15.961 78.153  2.706  1.00 40.00 ? 479 TYR A CD2 1 
ATOM 3665 C CE1 . TYR A 1 476 ? 14.369 76.345  1.353  1.00 40.00 ? 479 TYR A CE1 1 
ATOM 3666 C CE2 . TYR A 1 476 ? 16.506 77.363  1.708  1.00 40.00 ? 479 TYR A CE2 1 
ATOM 3667 C CZ  . TYR A 1 476 ? 15.703 76.461  1.032  1.00 40.00 ? 479 TYR A CZ  1 
ATOM 3668 O OH  . TYR A 1 476 ? 16.280 75.704  0.054  1.00 40.00 ? 479 TYR A OH  1 
ATOM 3669 N N   . TRP A 1 477 ? 13.280 81.501  5.742  1.00 40.00 ? 480 TRP A N   1 
ATOM 3670 C CA  . TRP A 1 477 ? 12.953 82.172  7.002  1.00 40.00 ? 480 TRP A CA  1 
ATOM 3671 C C   . TRP A 1 477 ? 11.655 82.946  6.960  1.00 40.00 ? 480 TRP A C   1 
ATOM 3672 O O   . TRP A 1 477 ? 10.677 82.644  7.666  1.00 40.00 ? 480 TRP A O   1 
ATOM 3673 C CB  . TRP A 1 477 ? 14.159 82.981  7.500  1.00 40.00 ? 480 TRP A CB  1 
ATOM 3674 C CG  . TRP A 1 477 ? 14.942 82.231  8.551  1.00 40.00 ? 480 TRP A CG  1 
ATOM 3675 C CD1 . TRP A 1 477 ? 14.916 82.412  9.903  1.00 40.00 ? 480 TRP A CD1 1 
ATOM 3676 C CD2 . TRP A 1 477 ? 15.862 81.150  8.311  1.00 40.00 ? 480 TRP A CD2 1 
ATOM 3677 N NE1 . TRP A 1 477 ? 15.766 81.524  10.517 1.00 40.00 ? 480 TRP A NE1 1 
ATOM 3678 C CE2 . TRP A 1 477 ? 16.357 80.738  9.558  1.00 40.00 ? 480 TRP A CE2 1 
ATOM 3679 C CE3 . TRP A 1 477 ? 16.312 80.500  7.161  1.00 40.00 ? 480 TRP A CE3 1 
ATOM 3680 C CZ2 . TRP A 1 477 ? 17.267 79.698  9.670  1.00 40.00 ? 480 TRP A CZ2 1 
ATOM 3681 C CZ3 . TRP A 1 477 ? 17.222 79.467  7.278  1.00 40.00 ? 480 TRP A CZ3 1 
ATOM 3682 C CH2 . TRP A 1 477 ? 17.691 79.067  8.534  1.00 40.00 ? 480 TRP A CH2 1 
ATOM 3683 N N   . THR A 1 478 ? 11.582 83.925  6.074  1.00 40.00 ? 481 THR A N   1 
ATOM 3684 C CA  . THR A 1 478 ? 10.377 84.732  5.826  1.00 40.00 ? 481 THR A CA  1 
ATOM 3685 C C   . THR A 1 478 ? 9.170  83.842  5.503  1.00 40.00 ? 481 THR A C   1 
ATOM 3686 O O   . THR A 1 478 ? 8.049  84.111  5.963  1.00 40.00 ? 481 THR A O   1 
ATOM 3687 C CB  . THR A 1 478 ? 10.615 85.581  4.545  1.00 40.00 ? 481 THR A CB  1 
ATOM 3688 O OG1 . THR A 1 478 ? 11.353 84.707  3.654  1.00 40.00 ? 481 THR A OG1 1 
ATOM 3689 C CG2 . THR A 1 478 ? 11.435 86.804  4.878  1.00 40.00 ? 481 THR A CG2 1 
ATOM 3690 N N   . ASN A 1 479 ? 9.397  82.765  4.731  1.00 40.00 ? 482 ASN A N   1 
ATOM 3691 C CA  . ASN A 1 479 ? 8.328  81.821  4.441  1.00 40.00 ? 482 ASN A CA  1 
ATOM 3692 C C   . ASN A 1 479 ? 7.877  81.097  5.715  1.00 40.00 ? 482 ASN A C   1 
ATOM 3693 O O   . ASN A 1 479 ? 6.674  80.965  5.973  1.00 40.00 ? 482 ASN A O   1 
ATOM 3694 C CB  . ASN A 1 479 ? 8.798  80.781  3.442  1.00 40.00 ? 482 ASN A CB  1 
ATOM 3695 C CG  . ASN A 1 479 ? 8.285  80.974  2.035  1.00 40.00 ? 482 ASN A CG  1 
ATOM 3696 O OD1 . ASN A 1 479 ? 7.163  81.437  1.777  1.00 40.00 ? 482 ASN A OD1 1 
ATOM 3697 N ND2 . ASN A 1 479 ? 9.137  80.603  1.079  1.00 40.00 ? 482 ASN A ND2 1 
ATOM 3698 N N   . PHE A 1 480 ? 8.877  80.653  6.540  1.00 40.00 ? 483 PHE A N   1 
ATOM 3699 C CA  . PHE A 1 480 ? 8.453  79.992  7.792  1.00 40.00 ? 483 PHE A CA  1 
ATOM 3700 C C   . PHE A 1 480 ? 7.730  81.072  8.622  1.00 40.00 ? 483 PHE A C   1 
ATOM 3701 O O   . PHE A 1 480 ? 6.743  80.823  9.306  1.00 40.00 ? 483 PHE A O   1 
ATOM 3702 C CB  . PHE A 1 480 ? 9.603  79.351  8.554  1.00 40.00 ? 483 PHE A CB  1 
ATOM 3703 C CG  . PHE A 1 480 ? 9.212  78.948  9.968  1.00 40.00 ? 483 PHE A CG  1 
ATOM 3704 C CD1 . PHE A 1 480 ? 8.480  77.795  10.186 1.00 40.00 ? 483 PHE A CD1 1 
ATOM 3705 C CD2 . PHE A 1 480 ? 9.558  79.734  11.051 1.00 40.00 ? 483 PHE A CD2 1 
ATOM 3706 C CE1 . PHE A 1 480 ? 8.094  77.410  11.456 1.00 40.00 ? 483 PHE A CE1 1 
ATOM 3707 C CE2 . PHE A 1 480 ? 9.174  79.361  12.327 1.00 40.00 ? 483 PHE A CE2 1 
ATOM 3708 C CZ  . PHE A 1 480 ? 8.451  78.208  12.523 1.00 40.00 ? 483 PHE A CZ  1 
ATOM 3709 N N   . ALA A 1 481 ? 8.271  82.294  8.495  1.00 40.00 ? 484 ALA A N   1 
ATOM 3710 C CA  . ALA A 1 481 ? 7.706  83.433  9.170  1.00 40.00 ? 484 ALA A CA  1 
ATOM 3711 C C   . ALA A 1 481 ? 6.247  83.640  8.787  1.00 40.00 ? 484 ALA A C   1 
ATOM 3712 O O   . ALA A 1 481 ? 5.418  83.698  9.708  1.00 40.00 ? 484 ALA A O   1 
ATOM 3713 C CB  . ALA A 1 481 ? 8.495  84.703  8.903  1.00 40.00 ? 484 ALA A CB  1 
ATOM 3714 N N   . ARG A 1 482 ? 5.926  83.744  7.486  1.00 40.00 ? 485 ARG A N   1 
ATOM 3715 C CA  . ARG A 1 482 ? 4.510  83.996  7.170  1.00 40.00 ? 485 ARG A CA  1 
ATOM 3716 C C   . ARG A 1 482 ? 3.584  82.807  7.317  1.00 40.00 ? 485 ARG A C   1 
ATOM 3717 O O   . ARG A 1 482 ? 2.539  82.922  7.965  1.00 40.00 ? 485 ARG A O   1 
ATOM 3718 C CB  . ARG A 1 482 ? 4.279  84.718  5.858  1.00 40.00 ? 485 ARG A CB  1 
ATOM 3719 C CG  . ARG A 1 482 ? 5.144  84.309  4.688  1.00 40.00 ? 485 ARG A CG  1 
ATOM 3720 C CD  . ARG A 1 482 ? 5.688  85.510  3.915  1.00 40.00 ? 485 ARG A CD  1 
ATOM 3721 N NE  . ARG A 1 482 ? 6.693  85.082  2.943  1.00 40.00 ? 485 ARG A NE  1 
ATOM 3722 C CZ  . ARG A 1 482 ? 7.683  85.814  2.454  1.00 40.00 ? 485 ARG A CZ  1 
ATOM 3723 N NH1 . ARG A 1 482 ? 7.870  87.084  2.812  1.00 40.00 ? 485 ARG A NH1 1 
ATOM 3724 N NH2 . ARG A 1 482 ? 8.538  85.285  1.570  1.00 40.00 ? 485 ARG A NH2 1 
ATOM 3725 N N   . THR A 1 483 ? 3.932  81.679  6.744  1.00 40.00 ? 486 THR A N   1 
ATOM 3726 C CA  . THR A 1 483 ? 3.185  80.453  6.701  1.00 40.00 ? 486 THR A CA  1 
ATOM 3727 C C   . THR A 1 483 ? 3.339  79.520  7.893  1.00 40.00 ? 486 THR A C   1 
ATOM 3728 O O   . THR A 1 483 ? 2.365  79.045  8.481  1.00 40.00 ? 486 THR A O   1 
ATOM 3729 C CB  . THR A 1 483 ? 3.672  79.651  5.453  1.00 40.00 ? 486 THR A CB  1 
ATOM 3730 O OG1 . THR A 1 483 ? 4.874  78.943  5.790  1.00 40.00 ? 486 THR A OG1 1 
ATOM 3731 C CG2 . THR A 1 483 ? 4.007  80.573  4.288  1.00 40.00 ? 486 THR A CG2 1 
ATOM 3732 N N   . GLY A 1 484 ? 4.598  79.224  8.231  1.00 40.00 ? 487 GLY A N   1 
ATOM 3733 C CA  . GLY A 1 484 ? 4.943  78.275  9.291  1.00 40.00 ? 487 GLY A CA  1 
ATOM 3734 C C   . GLY A 1 484 ? 5.444  77.008  8.552  1.00 40.00 ? 487 GLY A C   1 
ATOM 3735 O O   . GLY A 1 484 ? 5.223  75.874  8.963  1.00 40.00 ? 487 GLY A O   1 
ATOM 3736 N N   . ASP A 1 485 ? 6.116  77.253  7.436  1.00 40.00 ? 488 ASP A N   1 
ATOM 3737 C CA  . ASP A 1 485 ? 6.657  76.205  6.566  1.00 40.00 ? 488 ASP A CA  1 
ATOM 3738 C C   . ASP A 1 485 ? 7.657  76.947  5.702  1.00 40.00 ? 488 ASP A C   1 
ATOM 3739 O O   . ASP A 1 485 ? 7.289  77.833  4.939  1.00 40.00 ? 488 ASP A O   1 
ATOM 3740 C CB  . ASP A 1 485 ? 5.542  75.679  5.700  1.00 40.00 ? 488 ASP A CB  1 
ATOM 3741 C CG  . ASP A 1 485 ? 5.743  74.527  4.760  1.00 40.00 ? 488 ASP A CG  1 
ATOM 3742 O OD1 . ASP A 1 485 ? 6.824  74.219  4.217  1.00 40.00 ? 488 ASP A OD1 1 
ATOM 3743 O OD2 . ASP A 1 485 ? 4.677  73.866  4.550  1.00 40.00 ? 488 ASP A OD2 1 
ATOM 3744 N N   . PRO A 1 486 ? 8.915  76.609  5.787  1.00 40.00 ? 489 PRO A N   1 
ATOM 3745 C CA  . PRO A 1 486 ? 9.939  77.289  5.018  1.00 40.00 ? 489 PRO A CA  1 
ATOM 3746 C C   . PRO A 1 486 ? 9.789  77.049  3.534  1.00 40.00 ? 489 PRO A C   1 
ATOM 3747 O O   . PRO A 1 486 ? 10.605 77.549  2.759  1.00 40.00 ? 489 PRO A O   1 
ATOM 3748 C CB  . PRO A 1 486 ? 11.234 76.653  5.529  1.00 40.00 ? 489 PRO A CB  1 
ATOM 3749 C CG  . PRO A 1 486 ? 10.829 75.313  6.049  1.00 40.00 ? 489 PRO A CG  1 
ATOM 3750 C CD  . PRO A 1 486 ? 9.463  75.558  6.678  1.00 40.00 ? 489 PRO A CD  1 
ATOM 3751 N N   . ASN A 1 487 ? 8.826  76.258  3.107  1.00 40.00 ? 490 ASN A N   1 
ATOM 3752 C CA  . ASN A 1 487 ? 8.643  75.874  1.746  1.00 40.00 ? 490 ASN A CA  1 
ATOM 3753 C C   . ASN A 1 487 ? 8.009  76.813  0.745  1.00 40.00 ? 490 ASN A C   1 
ATOM 3754 O O   . ASN A 1 487 ? 7.050  77.542  0.985  1.00 40.00 ? 490 ASN A O   1 
ATOM 3755 C CB  . ASN A 1 487 ? 7.893  74.535  1.682  1.00 40.00 ? 490 ASN A CB  1 
ATOM 3756 C CG  . ASN A 1 487 ? 8.873  73.396  1.906  1.00 40.00 ? 490 ASN A CG  1 
ATOM 3757 O OD1 . ASN A 1 487 ? 9.783  73.203  1.087  1.00 40.00 ? 490 ASN A OD1 1 
ATOM 3758 N ND2 . ASN A 1 487 ? 8.641  72.696  3.005  1.00 40.00 ? 490 ASN A ND2 1 
ATOM 3759 N N   . ASP A 1 488 ? 8.598  76.724  -0.461 1.00 40.00 ? 491 ASP A N   1 
ATOM 3760 C CA  . ASP A 1 488 ? 8.118  77.512  -1.621 1.00 40.00 ? 491 ASP A CA  1 
ATOM 3761 C C   . ASP A 1 488 ? 6.591  77.437  -1.568 1.00 40.00 ? 491 ASP A C   1 
ATOM 3762 O O   . ASP A 1 488 ? 5.988  76.379  -1.433 1.00 40.00 ? 491 ASP A O   1 
ATOM 3763 C CB  . ASP A 1 488 ? 8.741  77.027  -2.896 1.00 40.00 ? 491 ASP A CB  1 
ATOM 3764 N N   . PRO A 1 489 ? 5.970  78.594  -1.537 1.00 40.00 ? 492 PRO A N   1 
ATOM 3765 C CA  . PRO A 1 489 ? 4.565  78.842  -1.331 1.00 40.00 ? 492 PRO A CA  1 
ATOM 3766 C C   . PRO A 1 489 ? 3.649  77.665  -1.507 1.00 40.00 ? 492 PRO A C   1 
ATOM 3767 O O   . PRO A 1 489 ? 3.481  76.744  -0.722 1.00 40.00 ? 492 PRO A O   1 
ATOM 3768 C CB  . PRO A 1 489 ? 4.277  79.999  -2.281 1.00 40.00 ? 492 PRO A CB  1 
ATOM 3769 C CG  . PRO A 1 489 ? 5.595  80.579  -2.660 1.00 40.00 ? 492 PRO A CG  1 
ATOM 3770 C CD  . PRO A 1 489 ? 6.608  79.945  -1.705 1.00 40.00 ? 492 PRO A CD  1 
ATOM 3771 N N   . ARG A 1 490 ? 2.928  77.804  -2.599 1.00 40.00 ? 493 ARG A N   1 
ATOM 3772 C CA  . ARG A 1 490 ? 2.052  76.819  -3.189 1.00 40.00 ? 493 ARG A CA  1 
ATOM 3773 C C   . ARG A 1 490 ? 3.025  76.206  -4.242 1.00 40.00 ? 493 ARG A C   1 
ATOM 3774 O O   . ARG A 1 490 ? 3.130  75.015  -4.436 1.00 40.00 ? 493 ARG A O   1 
ATOM 3775 C CB  . ARG A 1 490 ? 0.882  77.465  -3.886 1.00 40.00 ? 493 ARG A CB  1 
ATOM 3776 N N   . ASP A 1 491 ? 3.787  77.132  -4.827 1.00 40.00 ? 494 ASP A N   1 
ATOM 3777 C CA  . ASP A 1 491 ? 4.788  76.842  -5.830 1.00 40.00 ? 494 ASP A CA  1 
ATOM 3778 C C   . ASP A 1 491 ? 5.750  75.756  -5.395 1.00 40.00 ? 494 ASP A C   1 
ATOM 3779 O O   . ASP A 1 491 ? 6.862  76.045  -4.937 1.00 40.00 ? 494 ASP A O   1 
ATOM 3780 C CB  . ASP A 1 491 ? 5.544  78.126  -6.190 1.00 40.00 ? 494 ASP A CB  1 
ATOM 3781 N N   . SER A 1 492 ? 5.383  74.491  -5.579 1.00 40.00 ? 495 SER A N   1 
ATOM 3782 C CA  . SER A 1 492 ? 6.189  73.339  -5.213 1.00 40.00 ? 495 SER A CA  1 
ATOM 3783 C C   . SER A 1 492 ? 7.436  73.219  -6.086 1.00 40.00 ? 495 SER A C   1 
ATOM 3784 O O   . SER A 1 492 ? 7.648  72.260  -6.834 1.00 40.00 ? 495 SER A O   1 
ATOM 3785 C CB  . SER A 1 492 ? 5.345  72.069  -5.289 1.00 40.00 ? 495 SER A CB  1 
ATOM 3786 N N   . LYS A 1 493 ? 8.312  74.200  -5.962 1.00 40.00 ? 496 LYS A N   1 
ATOM 3787 C CA  . LYS A 1 493 ? 9.537  74.365  -6.679 1.00 40.00 ? 496 LYS A CA  1 
ATOM 3788 C C   . LYS A 1 493 ? 10.615 73.358  -6.321 1.00 40.00 ? 496 LYS A C   1 
ATOM 3789 O O   . LYS A 1 493 ? 11.542 73.643  -5.549 1.00 40.00 ? 496 LYS A O   1 
ATOM 3790 C CB  . LYS A 1 493 ? 10.030 75.812  -6.444 1.00 40.00 ? 496 LYS A CB  1 
ATOM 3791 N N   . SER A 1 494 ? 10.529 72.162  -6.890 1.00 40.00 ? 497 SER A N   1 
ATOM 3792 C CA  . SER A 1 494 ? 11.553 71.144  -6.666 1.00 40.00 ? 497 SER A CA  1 
ATOM 3793 C C   . SER A 1 494 ? 11.785 70.676  -5.261 1.00 40.00 ? 497 SER A C   1 
ATOM 3794 O O   . SER A 1 494 ? 10.822 70.108  -4.674 1.00 40.00 ? 497 SER A O   1 
ATOM 3795 C CB  . SER A 1 494 ? 12.761 71.511  -7.520 1.00 40.00 ? 497 SER A CB  1 
ATOM 3796 N N   . PRO A 1 495 ? 12.960 70.718  -4.639 1.00 40.00 ? 498 PRO A N   1 
ATOM 3797 C CA  . PRO A 1 495 ? 13.203 70.115  -3.333 1.00 40.00 ? 498 PRO A CA  1 
ATOM 3798 C C   . PRO A 1 495 ? 12.354 70.593  -2.190 1.00 40.00 ? 498 PRO A C   1 
ATOM 3799 O O   . PRO A 1 495 ? 12.157 71.792  -1.997 1.00 40.00 ? 498 PRO A O   1 
ATOM 3800 C CB  . PRO A 1 495 ? 14.697 70.244  -3.117 1.00 40.00 ? 498 PRO A CB  1 
ATOM 3801 C CG  . PRO A 1 495 ? 15.273 70.505  -4.468 1.00 40.00 ? 498 PRO A CG  1 
ATOM 3802 C CD  . PRO A 1 495 ? 14.208 71.302  -5.192 1.00 40.00 ? 498 PRO A CD  1 
ATOM 3803 N N   . GLN A 1 496 ? 11.810 69.663  -1.393 1.00 40.00 ? 499 GLN A N   1 
ATOM 3804 C CA  . GLN A 1 496 ? 10.949 70.010  -0.282 1.00 40.00 ? 499 GLN A CA  1 
ATOM 3805 C C   . GLN A 1 496 ? 11.581 69.807  1.088  1.00 40.00 ? 499 GLN A C   1 
ATOM 3806 O O   . GLN A 1 496 ? 12.470 68.968  1.260  1.00 40.00 ? 499 GLN A O   1 
ATOM 3807 C CB  . GLN A 1 496 ? 9.634  69.246  -0.355 1.00 40.00 ? 499 GLN A CB  1 
ATOM 3808 C CG  . GLN A 1 496 ? 8.402  70.086  -0.102 1.00 40.00 ? 499 GLN A CG  1 
ATOM 3809 C CD  . GLN A 1 496 ? 8.095  71.128  -1.151 1.00 40.00 ? 499 GLN A CD  1 
ATOM 3810 O OE1 . GLN A 1 496 ? 7.060  71.802  -1.024 1.00 40.00 ? 499 GLN A OE1 1 
ATOM 3811 N NE2 . GLN A 1 496 ? 8.919  71.312  -2.187 1.00 40.00 ? 499 GLN A NE2 1 
ATOM 3812 N N   . TRP A 1 497 ? 11.125 70.604  2.069  1.00 40.00 ? 500 TRP A N   1 
ATOM 3813 C CA  . TRP A 1 497 ? 11.668 70.492  3.424  1.00 40.00 ? 500 TRP A CA  1 
ATOM 3814 C C   . TRP A 1 497 ? 10.596 69.869  4.318  1.00 40.00 ? 500 TRP A C   1 
ATOM 3815 O O   . TRP A 1 497 ? 9.601  70.492  4.630  1.00 40.00 ? 500 TRP A O   1 
ATOM 3816 C CB  . TRP A 1 497 ? 12.156 71.808  3.946  1.00 40.00 ? 500 TRP A CB  1 
ATOM 3817 C CG  . TRP A 1 497 ? 12.678 71.955  5.337  1.00 40.00 ? 500 TRP A CG  1 
ATOM 3818 C CD1 . TRP A 1 497 ? 12.396 71.194  6.433  1.00 40.00 ? 500 TRP A CD1 1 
ATOM 3819 C CD2 . TRP A 1 497 ? 13.600 72.957  5.803  1.00 40.00 ? 500 TRP A CD2 1 
ATOM 3820 N NE1 . TRP A 1 497 ? 13.059 71.656  7.535  1.00 40.00 ? 500 TRP A NE1 1 
ATOM 3821 C CE2 . TRP A 1 497 ? 13.806 72.738  7.177  1.00 40.00 ? 500 TRP A CE2 1 
ATOM 3822 C CE3 . TRP A 1 497 ? 14.254 74.033  5.184  1.00 40.00 ? 500 TRP A CE3 1 
ATOM 3823 C CZ2 . TRP A 1 497 ? 14.642 73.546  7.943  1.00 40.00 ? 500 TRP A CZ2 1 
ATOM 3824 C CZ3 . TRP A 1 497 ? 15.085 74.832  5.943  1.00 40.00 ? 500 TRP A CZ3 1 
ATOM 3825 C CH2 . TRP A 1 497 ? 15.268 74.583  7.308  1.00 40.00 ? 500 TRP A CH2 1 
ATOM 3826 N N   . PRO A 1 498 ? 10.856 68.628  4.720  1.00 40.00 ? 501 PRO A N   1 
ATOM 3827 C CA  . PRO A 1 498 ? 9.918  67.889  5.538  1.00 40.00 ? 501 PRO A CA  1 
ATOM 3828 C C   . PRO A 1 498 ? 10.043 68.160  7.011  1.00 40.00 ? 501 PRO A C   1 
ATOM 3829 O O   . PRO A 1 498 ? 11.161 68.304  7.514  1.00 40.00 ? 501 PRO A O   1 
ATOM 3830 C CB  . PRO A 1 498 ? 10.350 66.437  5.272  1.00 40.00 ? 501 PRO A CB  1 
ATOM 3831 C CG  . PRO A 1 498 ? 11.803 66.510  4.948  1.00 40.00 ? 501 PRO A CG  1 
ATOM 3832 C CD  . PRO A 1 498 ? 12.070 67.860  4.365  1.00 40.00 ? 501 PRO A CD  1 
ATOM 3833 N N   . PRO A 1 499 ? 8.937  68.149  7.733  1.00 40.00 ? 502 PRO A N   1 
ATOM 3834 C CA  . PRO A 1 499 ? 8.985  68.311  9.175  1.00 40.00 ? 502 PRO A CA  1 
ATOM 3835 C C   . PRO A 1 499 ? 9.846  67.266  9.882  1.00 40.00 ? 502 PRO A C   1 
ATOM 3836 O O   . PRO A 1 499 ? 9.783  66.071  9.588  1.00 40.00 ? 502 PRO A O   1 
ATOM 3837 C CB  . PRO A 1 499 ? 7.546  68.149  9.627  1.00 40.00 ? 502 PRO A CB  1 
ATOM 3838 C CG  . PRO A 1 499 ? 6.719  68.268  8.421  1.00 40.00 ? 502 PRO A CG  1 
ATOM 3839 C CD  . PRO A 1 499 ? 7.580  67.967  7.224  1.00 40.00 ? 502 PRO A CD  1 
ATOM 3840 N N   . TYR A 1 500 ? 10.656 67.712  10.843 1.00 40.00 ? 503 TYR A N   1 
ATOM 3841 C CA  . TYR A 1 500 ? 11.437 66.761  11.639 1.00 40.00 ? 503 TYR A CA  1 
ATOM 3842 C C   . TYR A 1 500 ? 10.368 66.011  12.471 1.00 40.00 ? 503 TYR A C   1 
ATOM 3843 O O   . TYR A 1 500 ? 9.449  66.627  12.999 1.00 40.00 ? 503 TYR A O   1 
ATOM 3844 C CB  . TYR A 1 500 ? 12.468 67.413  12.537 1.00 40.00 ? 503 TYR A CB  1 
ATOM 3845 C CG  . TYR A 1 500 ? 13.180 66.468  13.477 1.00 40.00 ? 503 TYR A CG  1 
ATOM 3846 C CD1 . TYR A 1 500 ? 12.528 66.061  14.634 1.00 40.00 ? 503 TYR A CD1 1 
ATOM 3847 C CD2 . TYR A 1 500 ? 14.462 65.991  13.225 1.00 40.00 ? 503 TYR A CD2 1 
ATOM 3848 C CE1 . TYR A 1 500 ? 13.132 65.189  15.517 1.00 40.00 ? 503 TYR A CE1 1 
ATOM 3849 C CE2 . TYR A 1 500 ? 15.098 65.118  14.107 1.00 40.00 ? 503 TYR A CE2 1 
ATOM 3850 C CZ  . TYR A 1 500 ? 14.412 64.733  15.243 1.00 40.00 ? 503 TYR A CZ  1 
ATOM 3851 O OH  . TYR A 1 500 ? 14.992 63.867  16.151 1.00 40.00 ? 503 TYR A OH  1 
ATOM 3852 N N   . THR A 1 501 ? 10.492 64.709  12.532 1.00 40.00 ? 504 THR A N   1 
ATOM 3853 C CA  . THR A 1 501 ? 9.591  63.789  13.179 1.00 40.00 ? 504 THR A CA  1 
ATOM 3854 C C   . THR A 1 501 ? 10.303 62.774  14.050 1.00 40.00 ? 504 THR A C   1 
ATOM 3855 O O   . THR A 1 501 ? 11.419 62.351  13.714 1.00 40.00 ? 504 THR A O   1 
ATOM 3856 C CB  . THR A 1 501 ? 8.926  62.986  12.006 1.00 40.00 ? 504 THR A CB  1 
ATOM 3857 O OG1 . THR A 1 501 ? 9.816  63.002  10.860 1.00 40.00 ? 504 THR A OG1 1 
ATOM 3858 C CG2 . THR A 1 501 ? 7.628  63.729  11.742 1.00 40.00 ? 504 THR A CG2 1 
ATOM 3859 N N   . THR A 1 502 ? 9.667  62.365  15.136 1.00 40.00 ? 505 THR A N   1 
ATOM 3860 C CA  . THR A 1 502 ? 10.297 61.357  15.992 1.00 40.00 ? 505 THR A CA  1 
ATOM 3861 C C   . THR A 1 502 ? 10.735 60.162  15.161 1.00 40.00 ? 505 THR A C   1 
ATOM 3862 O O   . THR A 1 502 ? 11.907 59.811  15.100 1.00 40.00 ? 505 THR A O   1 
ATOM 3863 C CB  . THR A 1 502 ? 9.309  60.923  17.081 1.00 40.00 ? 505 THR A CB  1 
ATOM 3864 O OG1 . THR A 1 502 ? 8.094  61.668  16.850 1.00 40.00 ? 505 THR A OG1 1 
ATOM 3865 C CG2 . THR A 1 502 ? 9.810  61.307  18.464 1.00 40.00 ? 505 THR A CG2 1 
ATOM 3866 N N   . ALA A 1 503 ? 9.791  59.535  14.478 1.00 40.00 ? 506 ALA A N   1 
ATOM 3867 C CA  . ALA A 1 503 ? 9.980  58.384  13.629 1.00 40.00 ? 506 ALA A CA  1 
ATOM 3868 C C   . ALA A 1 503 ? 10.920 58.588  12.467 1.00 40.00 ? 506 ALA A C   1 
ATOM 3869 O O   . ALA A 1 503 ? 11.911 57.840  12.337 1.00 40.00 ? 506 ALA A O   1 
ATOM 3870 C CB  . ALA A 1 503 ? 8.640  57.911  13.061 1.00 40.00 ? 506 ALA A CB  1 
ATOM 3871 N N   . ALA A 1 504 ? 10.650 59.531  11.572 1.00 40.00 ? 507 ALA A N   1 
ATOM 3872 C CA  . ALA A 1 504 ? 11.610 59.605  10.461 1.00 40.00 ? 507 ALA A CA  1 
ATOM 3873 C C   . ALA A 1 504 ? 12.845 60.410  10.792 1.00 40.00 ? 507 ALA A C   1 
ATOM 3874 O O   . ALA A 1 504 ? 13.867 60.117  10.162 1.00 40.00 ? 507 ALA A O   1 
ATOM 3875 C CB  . ALA A 1 504 ? 10.984 60.055  9.172  1.00 40.00 ? 507 ALA A CB  1 
ATOM 3876 N N   . GLN A 1 505 ? 12.747 61.393  11.698 1.00 40.00 ? 508 GLN A N   1 
ATOM 3877 C CA  . GLN A 1 505 ? 13.890 62.202  12.065 1.00 40.00 ? 508 GLN A CA  1 
ATOM 3878 C C   . GLN A 1 505 ? 14.525 62.923  10.881 1.00 40.00 ? 508 GLN A C   1 
ATOM 3879 O O   . GLN A 1 505 ? 15.743 62.847  10.638 1.00 40.00 ? 508 GLN A O   1 
ATOM 3880 C CB  . GLN A 1 505 ? 14.945 61.261  12.670 1.00 40.00 ? 508 GLN A CB  1 
ATOM 3881 C CG  . GLN A 1 505 ? 14.420 60.584  13.931 1.00 40.00 ? 508 GLN A CG  1 
ATOM 3882 C CD  . GLN A 1 505 ? 15.556 59.906  14.684 1.00 40.00 ? 508 GLN A CD  1 
ATOM 3883 O OE1 . GLN A 1 505 ? 16.738 60.255  14.546 1.00 40.00 ? 508 GLN A OE1 1 
ATOM 3884 N NE2 . GLN A 1 505 ? 15.177 58.921  15.493 1.00 40.00 ? 508 GLN A NE2 1 
ATOM 3885 N N   . GLN A 1 506 ? 13.687 63.639  10.141 1.00 40.00 ? 509 GLN A N   1 
ATOM 3886 C CA  . GLN A 1 506 ? 14.191 64.337  8.959  1.00 40.00 ? 509 GLN A CA  1 
ATOM 3887 C C   . GLN A 1 506 ? 14.653 65.765  9.179  1.00 40.00 ? 509 GLN A C   1 
ATOM 3888 O O   . GLN A 1 506 ? 14.010 66.591  9.827  1.00 40.00 ? 509 GLN A O   1 
ATOM 3889 C CB  . GLN A 1 506 ? 13.030 64.340  7.930  1.00 40.00 ? 509 GLN A CB  1 
ATOM 3890 C CG  . GLN A 1 506 ? 12.328 62.985  7.896  1.00 40.00 ? 509 GLN A CG  1 
ATOM 3891 C CD  . GLN A 1 506 ? 11.620 62.740  6.577  1.00 40.00 ? 509 GLN A CD  1 
ATOM 3892 O OE1 . GLN A 1 506 ? 10.386 62.651  6.589  1.00 40.00 ? 509 GLN A OE1 1 
ATOM 3893 N NE2 . GLN A 1 506 ? 12.363 62.626  5.477  1.00 40.00 ? 509 GLN A NE2 1 
ATOM 3894 N N   . TYR A 1 507 ? 15.775 66.069  8.536  1.00 40.00 ? 510 TYR A N   1 
ATOM 3895 C CA  . TYR A 1 507 ? 16.388 67.395  8.581  1.00 40.00 ? 510 TYR A CA  1 
ATOM 3896 C C   . TYR A 1 507 ? 17.041 67.647  7.228  1.00 40.00 ? 510 TYR A C   1 
ATOM 3897 O O   . TYR A 1 507 ? 17.221 66.670  6.475  1.00 40.00 ? 510 TYR A O   1 
ATOM 3898 C CB  . TYR A 1 507 ? 17.369 67.450  9.740  1.00 40.00 ? 510 TYR A CB  1 
ATOM 3899 C CG  . TYR A 1 507 ? 18.679 66.725  9.542  1.00 40.00 ? 510 TYR A CG  1 
ATOM 3900 C CD1 . TYR A 1 507 ? 19.723 67.311  8.839  1.00 40.00 ? 510 TYR A CD1 1 
ATOM 3901 C CD2 . TYR A 1 507 ? 18.897 65.463  10.067 1.00 40.00 ? 510 TYR A CD2 1 
ATOM 3902 C CE1 . TYR A 1 507 ? 20.928 66.672  8.654  1.00 40.00 ? 510 TYR A CE1 1 
ATOM 3903 C CE2 . TYR A 1 507 ? 20.096 64.810  9.888  1.00 40.00 ? 510 TYR A CE2 1 
ATOM 3904 C CZ  . TYR A 1 507 ? 21.111 65.412  9.182  1.00 40.00 ? 510 TYR A CZ  1 
ATOM 3905 O OH  . TYR A 1 507 ? 22.315 64.768  8.995  1.00 40.00 ? 510 TYR A OH  1 
ATOM 3906 N N   . VAL A 1 508 ? 17.406 68.871  6.885  1.00 40.00 ? 511 VAL A N   1 
ATOM 3907 C CA  . VAL A 1 508 ? 17.936 69.154  5.560  1.00 40.00 ? 511 VAL A CA  1 
ATOM 3908 C C   . VAL A 1 508 ? 19.290 69.802  5.497  1.00 40.00 ? 511 VAL A C   1 
ATOM 3909 O O   . VAL A 1 508 ? 19.650 70.558  6.404  1.00 40.00 ? 511 VAL A O   1 
ATOM 3910 C CB  . VAL A 1 508 ? 16.946 70.171  4.903  1.00 40.00 ? 511 VAL A CB  1 
ATOM 3911 C CG1 . VAL A 1 508 ? 15.615 69.513  4.582  1.00 40.00 ? 511 VAL A CG1 1 
ATOM 3912 C CG2 . VAL A 1 508 ? 16.706 71.358  5.835  1.00 40.00 ? 511 VAL A CG2 1 
ATOM 3913 N N   . SER A 1 509 ? 20.022 69.586  4.414  1.00 40.00 ? 512 SER A N   1 
ATOM 3914 C CA  . SER A 1 509 ? 21.330 70.225  4.310  1.00 40.00 ? 512 SER A CA  1 
ATOM 3915 C C   . SER A 1 509 ? 21.166 71.627  3.729  1.00 40.00 ? 512 SER A C   1 
ATOM 3916 O O   . SER A 1 509 ? 20.842 71.795  2.543  1.00 40.00 ? 512 SER A O   1 
ATOM 3917 C CB  . SER A 1 509 ? 22.288 69.368  3.511  1.00 40.00 ? 512 SER A CB  1 
ATOM 3918 O OG  . SER A 1 509 ? 23.133 70.188  2.716  1.00 40.00 ? 512 SER A OG  1 
ATOM 3919 N N   . LEU A 1 510 ? 21.358 72.642  4.575  1.00 40.00 ? 513 LEU A N   1 
ATOM 3920 C CA  . LEU A 1 510 ? 21.291 74.034  4.129  1.00 40.00 ? 513 LEU A CA  1 
ATOM 3921 C C   . LEU A 1 510 ? 22.680 74.366  3.574  1.00 40.00 ? 513 LEU A C   1 
ATOM 3922 O O   . LEU A 1 510 ? 23.636 74.591  4.309  1.00 40.00 ? 513 LEU A O   1 
ATOM 3923 C CB  . LEU A 1 510 ? 20.962 74.989  5.258  1.00 40.00 ? 513 LEU A CB  1 
ATOM 3924 C CG  . LEU A 1 510 ? 19.537 75.503  5.380  1.00 40.00 ? 513 LEU A CG  1 
ATOM 3925 C CD1 . LEU A 1 510 ? 19.205 76.446  4.228  1.00 40.00 ? 513 LEU A CD1 1 
ATOM 3926 C CD2 . LEU A 1 510 ? 18.504 74.380  5.401  1.00 40.00 ? 513 LEU A CD2 1 
ATOM 3927 N N   . ASN A 1 511 ? 22.804 74.333  2.261  1.00 40.00 ? 514 ASN A N   1 
ATOM 3928 C CA  . ASN A 1 511 ? 24.114 74.658  1.664  1.00 40.00 ? 514 ASN A CA  1 
ATOM 3929 C C   . ASN A 1 511 ? 23.914 74.958  0.177  1.00 40.00 ? 514 ASN A C   1 
ATOM 3930 O O   . ASN A 1 511 ? 22.795 74.843  -0.341 1.00 40.00 ? 514 ASN A O   1 
ATOM 3931 C CB  . ASN A 1 511 ? 25.114 73.565  1.958  1.00 40.00 ? 514 ASN A CB  1 
ATOM 3932 C CG  . ASN A 1 511 ? 25.693 72.927  0.699  1.00 40.00 ? 514 ASN A CG  1 
ATOM 3933 O OD1 . ASN A 1 511 ? 26.671 73.482  0.166  1.00 40.00 ? 514 ASN A OD1 1 
ATOM 3934 N ND2 . ASN A 1 511 ? 25.060 71.852  0.265  1.00 40.00 ? 514 ASN A ND2 1 
ATOM 3935 N N   . LEU A 1 512 ? 24.978 75.358  -0.493 1.00 40.00 ? 515 LEU A N   1 
ATOM 3936 C CA  . LEU A 1 512 ? 25.049 75.665  -1.892 1.00 40.00 ? 515 LEU A CA  1 
ATOM 3937 C C   . LEU A 1 512 ? 24.289 74.737  -2.816 1.00 40.00 ? 515 LEU A C   1 
ATOM 3938 O O   . LEU A 1 512 ? 23.596 75.215  -3.724 1.00 40.00 ? 515 LEU A O   1 
ATOM 3939 C CB  . LEU A 1 512 ? 26.535 75.737  -2.309 1.00 40.00 ? 515 LEU A CB  1 
ATOM 3940 C CG  . LEU A 1 512 ? 27.264 76.985  -1.785 1.00 40.00 ? 515 LEU A CG  1 
ATOM 3941 C CD1 . LEU A 1 512 ? 28.433 77.407  -2.662 1.00 40.00 ? 515 LEU A CD1 1 
ATOM 3942 C CD2 . LEU A 1 512 ? 26.311 78.180  -1.627 1.00 40.00 ? 515 LEU A CD2 1 
ATOM 3943 N N   . LYS A 1 513 ? 24.394 73.429  -2.644 1.00 40.00 ? 516 LYS A N   1 
ATOM 3944 C CA  . LYS A 1 513 ? 23.640 72.450  -3.425 1.00 40.00 ? 516 LYS A CA  1 
ATOM 3945 C C   . LYS A 1 513 ? 22.220 72.451  -2.854 1.00 40.00 ? 516 LYS A C   1 
ATOM 3946 O O   . LYS A 1 513 ? 22.029 72.693  -1.661 1.00 40.00 ? 516 LYS A O   1 
ATOM 3947 C CB  . LYS A 1 513 ? 24.263 71.073  -3.351 1.00 40.00 ? 516 LYS A CB  1 
ATOM 3948 C CG  . LYS A 1 513 ? 25.392 70.806  -4.322 1.00 40.00 ? 516 LYS A CG  1 
ATOM 3949 C CD  . LYS A 1 513 ? 26.384 71.934  -4.471 1.00 40.00 ? 516 LYS A CD  1 
ATOM 3950 C CE  . LYS A 1 513 ? 26.094 72.819  -5.675 1.00 40.00 ? 516 LYS A CE  1 
ATOM 3951 N NZ  . LYS A 1 513 ? 26.842 74.110  -5.669 1.00 40.00 ? 516 LYS A NZ  1 
ATOM 3952 N N   . PRO A 1 514 ? 21.227 72.233  -3.685 1.00 40.00 ? 517 PRO A N   1 
ATOM 3953 C CA  . PRO A 1 514 ? 19.840 72.258  -3.286 1.00 40.00 ? 517 PRO A CA  1 
ATOM 3954 C C   . PRO A 1 514 ? 19.521 71.410  -2.075 1.00 40.00 ? 517 PRO A C   1 
ATOM 3955 O O   . PRO A 1 514 ? 20.271 70.506  -1.733 1.00 40.00 ? 517 PRO A O   1 
ATOM 3956 C CB  . PRO A 1 514 ? 19.075 71.714  -4.492 1.00 40.00 ? 517 PRO A CB  1 
ATOM 3957 C CG  . PRO A 1 514 ? 19.993 71.858  -5.648 1.00 40.00 ? 517 PRO A CG  1 
ATOM 3958 C CD  . PRO A 1 514 ? 21.396 71.943  -5.135 1.00 40.00 ? 517 PRO A CD  1 
ATOM 3959 N N   . LEU A 1 515 ? 18.379 71.697  -1.451 1.00 40.00 ? 518 LEU A N   1 
ATOM 3960 C CA  . LEU A 1 515 ? 17.968 70.913  -0.297 1.00 40.00 ? 518 LEU A CA  1 
ATOM 3961 C C   . LEU A 1 515 ? 18.266 69.431  -0.502 1.00 40.00 ? 518 LEU A C   1 
ATOM 3962 O O   . LEU A 1 515 ? 18.097 68.888  -1.585 1.00 40.00 ? 518 LEU A O   1 
ATOM 3963 C CB  . LEU A 1 515 ? 16.485 71.057  0.024  1.00 40.00 ? 518 LEU A CB  1 
ATOM 3964 C CG  . LEU A 1 515 ? 16.130 72.112  1.070  1.00 40.00 ? 518 LEU A CG  1 
ATOM 3965 C CD1 . LEU A 1 515 ? 14.746 71.849  1.642  1.00 40.00 ? 518 LEU A CD1 1 
ATOM 3966 C CD2 . LEU A 1 515 ? 17.175 72.164  2.177  1.00 40.00 ? 518 LEU A CD2 1 
ATOM 3967 N N   . GLU A 1 516 ? 18.709 68.784  0.569  1.00 40.00 ? 519 GLU A N   1 
ATOM 3968 C CA  . GLU A 1 516 ? 19.042 67.358  0.517  1.00 40.00 ? 519 GLU A CA  1 
ATOM 3969 C C   . GLU A 1 516 ? 18.644 66.648  1.798  1.00 40.00 ? 519 GLU A C   1 
ATOM 3970 O O   . GLU A 1 516 ? 19.509 66.378  2.633  1.00 40.00 ? 519 GLU A O   1 
ATOM 3971 C CB  . GLU A 1 516 ? 20.542 67.221  0.255  1.00 40.00 ? 519 GLU A CB  1 
ATOM 3972 C CG  . GLU A 1 516 ? 20.993 65.789  0.065  1.00 40.00 ? 519 GLU A CG  1 
ATOM 3973 C CD  . GLU A 1 516 ? 22.461 65.600  0.401  1.00 40.00 ? 519 GLU A CD  1 
ATOM 3974 O OE1 . GLU A 1 516 ? 23.306 66.183  -0.314 1.00 40.00 ? 519 GLU A OE1 1 
ATOM 3975 O OE2 . GLU A 1 516 ? 22.738 64.873  1.378  1.00 40.00 ? 519 GLU A OE2 1 
ATOM 3976 N N   . VAL A 1 517 ? 17.370 66.315  1.992  1.00 40.00 ? 520 VAL A N   1 
ATOM 3977 C CA  . VAL A 1 517 ? 16.910 65.676  3.197  1.00 40.00 ? 520 VAL A CA  1 
ATOM 3978 C C   . VAL A 1 517 ? 17.751 64.513  3.723  1.00 40.00 ? 520 VAL A C   1 
ATOM 3979 O O   . VAL A 1 517 ? 18.217 63.656  2.985  1.00 40.00 ? 520 VAL A O   1 
ATOM 3980 C CB  . VAL A 1 517 ? 15.450 65.196  3.163  1.00 40.00 ? 520 VAL A CB  1 
ATOM 3981 C CG1 . VAL A 1 517 ? 15.032 64.768  4.583  1.00 40.00 ? 520 VAL A CG1 1 
ATOM 3982 C CG2 . VAL A 1 517 ? 14.509 66.257  2.655  1.00 40.00 ? 520 VAL A CG2 1 
ATOM 3983 N N   . ARG A 1 518 ? 17.929 64.523  5.067  1.00 40.00 ? 521 ARG A N   1 
ATOM 3984 C CA  . ARG A 1 518 ? 18.677 63.499  5.776  1.00 40.00 ? 521 ARG A CA  1 
ATOM 3985 C C   . ARG A 1 518 ? 17.924 62.997  7.000  1.00 40.00 ? 521 ARG A C   1 
ATOM 3986 O O   . ARG A 1 518 ? 16.926 63.630  7.383  1.00 40.00 ? 521 ARG A O   1 
ATOM 3987 C CB  . ARG A 1 518 ? 20.052 63.980  6.173  1.00 40.00 ? 521 ARG A CB  1 
ATOM 3988 C CG  . ARG A 1 518 ? 20.977 64.329  5.019  1.00 40.00 ? 521 ARG A CG  1 
ATOM 3989 C CD  . ARG A 1 518 ? 22.163 65.104  5.520  1.00 40.00 ? 521 ARG A CD  1 
ATOM 3990 N NE  . ARG A 1 518 ? 22.879 65.891  4.526  1.00 40.00 ? 521 ARG A NE  1 
ATOM 3991 C CZ  . ARG A 1 518 ? 24.026 66.541  4.775  1.00 40.00 ? 521 ARG A CZ  1 
ATOM 3992 N NH1 . ARG A 1 518 ? 24.594 66.513  5.989  1.00 40.00 ? 521 ARG A NH1 1 
ATOM 3993 N NH2 . ARG A 1 518 ? 24.617 67.236  3.805  1.00 40.00 ? 521 ARG A NH2 1 
ATOM 3994 N N   . ARG A 1 519 ? 18.343 61.849  7.554  1.00 40.00 ? 522 ARG A N   1 
ATOM 3995 C CA  . ARG A 1 519 ? 17.646 61.326  8.733  1.00 40.00 ? 522 ARG A CA  1 
ATOM 3996 C C   . ARG A 1 519 ? 18.591 61.120  9.921  1.00 40.00 ? 522 ARG A C   1 
ATOM 3997 O O   . ARG A 1 519 ? 19.718 60.637  9.794  1.00 40.00 ? 522 ARG A O   1 
ATOM 3998 C CB  . ARG A 1 519 ? 16.849 60.052  8.483  1.00 40.00 ? 522 ARG A CB  1 
ATOM 3999 C CG  . ARG A 1 519 ? 16.152 59.942  7.163  1.00 40.00 ? 522 ARG A CG  1 
ATOM 4000 C CD  . ARG A 1 519 ? 15.219 58.789  6.989  1.00 40.00 ? 522 ARG A CD  1 
ATOM 4001 N NE  . ARG A 1 519 ? 14.354 58.534  8.135  1.00 40.00 ? 522 ARG A NE  1 
ATOM 4002 C CZ  . ARG A 1 519 ? 14.130 57.280  8.555  1.00 40.00 ? 522 ARG A CZ  1 
ATOM 4003 N NH1 . ARG A 1 519 ? 14.723 56.272  7.919  1.00 40.00 ? 522 ARG A NH1 1 
ATOM 4004 N NH2 . ARG A 1 519 ? 13.337 57.084  9.599  1.00 40.00 ? 522 ARG A NH2 1 
ATOM 4005 N N   . GLY A 1 520 ? 18.090 61.498  11.097 1.00 40.00 ? 523 GLY A N   1 
ATOM 4006 C CA  . GLY A 1 520 ? 18.849 61.374  12.324 1.00 40.00 ? 523 GLY A CA  1 
ATOM 4007 C C   . GLY A 1 520 ? 19.951 62.408  12.479 1.00 40.00 ? 523 GLY A C   1 
ATOM 4008 O O   . GLY A 1 520 ? 20.946 62.424  11.732 1.00 40.00 ? 523 GLY A O   1 
ATOM 4009 N N   . LEU A 1 521 ? 19.768 63.293  13.458 1.00 40.00 ? 524 LEU A N   1 
ATOM 4010 C CA  . LEU A 1 521 ? 20.806 64.319  13.706 1.00 40.00 ? 524 LEU A CA  1 
ATOM 4011 C C   . LEU A 1 521 ? 21.776 63.669  14.685 1.00 40.00 ? 524 LEU A C   1 
ATOM 4012 O O   . LEU A 1 521 ? 21.323 63.369  15.804 1.00 40.00 ? 524 LEU A O   1 
ATOM 4013 C CB  . LEU A 1 521 ? 20.155 65.498  14.383 1.00 40.00 ? 524 LEU A CB  1 
ATOM 4014 C CG  . LEU A 1 521 ? 20.288 66.895  13.795 1.00 40.00 ? 524 LEU A CG  1 
ATOM 4015 C CD1 . LEU A 1 521 ? 19.829 67.876  14.860 1.00 40.00 ? 524 LEU A CD1 1 
ATOM 4016 C CD2 . LEU A 1 521 ? 21.703 67.182  13.324 1.00 40.00 ? 524 LEU A CD2 1 
ATOM 4017 N N   . ARG A 1 522 ? 22.963 63.335  14.241 1.00 40.00 ? 525 ARG A N   1 
ATOM 4018 C CA  . ARG A 1 522 ? 23.941 62.638  15.092 1.00 40.00 ? 525 ARG A CA  1 
ATOM 4019 C C   . ARG A 1 522 ? 23.292 61.605  15.990 1.00 40.00 ? 525 ARG A C   1 
ATOM 4020 O O   . ARG A 1 522 ? 23.692 61.446  17.149 1.00 40.00 ? 525 ARG A O   1 
ATOM 4021 C CB  . ARG A 1 522 ? 24.730 63.688  15.895 1.00 40.00 ? 525 ARG A CB  1 
ATOM 4022 C CG  . ARG A 1 522 ? 25.527 64.605  14.970 1.00 40.00 ? 525 ARG A CG  1 
ATOM 4023 C CD  . ARG A 1 522 ? 26.981 64.229  15.039 1.00 40.00 ? 525 ARG A CD  1 
ATOM 4024 N NE  . ARG A 1 522 ? 27.957 65.288  14.958 1.00 40.00 ? 525 ARG A NE  1 
ATOM 4025 C CZ  . ARG A 1 522 ? 28.036 66.321  14.128 1.00 40.00 ? 525 ARG A CZ  1 
ATOM 4026 N NH1 . ARG A 1 522 ? 27.120 66.539  13.185 1.00 40.00 ? 525 ARG A NH1 1 
ATOM 4027 N NH2 . ARG A 1 522 ? 29.056 67.177  14.215 1.00 40.00 ? 525 ARG A NH2 1 
ATOM 4028 N N   . ALA A 1 523 ? 22.324 60.839  15.532 1.00 40.00 ? 526 ALA A N   1 
ATOM 4029 C CA  . ALA A 1 523 ? 21.539 59.883  16.259 1.00 40.00 ? 526 ALA A CA  1 
ATOM 4030 C C   . ALA A 1 523 ? 22.230 59.034  17.303 1.00 40.00 ? 526 ALA A C   1 
ATOM 4031 O O   . ALA A 1 523 ? 21.730 58.955  18.443 1.00 40.00 ? 526 ALA A O   1 
ATOM 4032 C CB  . ALA A 1 523 ? 20.749 59.025  15.297 1.00 40.00 ? 526 ALA A CB  1 
ATOM 4033 N N   . GLN A 1 524 ? 23.336 58.377  16.990 1.00 40.00 ? 527 GLN A N   1 
ATOM 4034 C CA  . GLN A 1 524 ? 24.018 57.573  17.988 1.00 40.00 ? 527 GLN A CA  1 
ATOM 4035 C C   . GLN A 1 524 ? 24.578 58.473  19.086 1.00 40.00 ? 527 GLN A C   1 
ATOM 4036 O O   . GLN A 1 524 ? 24.221 58.415  20.245 1.00 40.00 ? 527 GLN A O   1 
ATOM 4037 C CB  . GLN A 1 524 ? 25.244 56.875  17.351 1.00 40.00 ? 527 GLN A CB  1 
ATOM 4038 C CG  . GLN A 1 524 ? 24.883 55.434  16.947 1.00 40.00 ? 527 GLN A CG  1 
ATOM 4039 C CD  . GLN A 1 524 ? 24.035 55.488  15.682 1.00 40.00 ? 527 GLN A CD  1 
ATOM 4040 O OE1 . GLN A 1 524 ? 24.005 56.528  14.993 1.00 40.00 ? 527 GLN A OE1 1 
ATOM 4041 N NE2 . GLN A 1 524 ? 23.351 54.415  15.361 1.00 40.00 ? 527 GLN A NE2 1 
ATOM 4042 N N   . THR A 1 525 ? 25.481 59.334  18.575 1.00 40.00 ? 528 THR A N   1 
ATOM 4043 C CA  . THR A 1 525 ? 26.180 60.294  19.395 1.00 40.00 ? 528 THR A CA  1 
ATOM 4044 C C   . THR A 1 525 ? 25.243 61.012  20.349 1.00 40.00 ? 528 THR A C   1 
ATOM 4045 O O   . THR A 1 525 ? 25.523 61.091  21.548 1.00 40.00 ? 528 THR A O   1 
ATOM 4046 C CB  . THR A 1 525 ? 26.909 61.344  18.545 1.00 40.00 ? 528 THR A CB  1 
ATOM 4047 O OG1 . THR A 1 525 ? 27.872 60.629  17.749 1.00 40.00 ? 528 THR A OG1 1 
ATOM 4048 C CG2 . THR A 1 525 ? 27.668 62.315  19.464 1.00 40.00 ? 528 THR A CG2 1 
ATOM 4049 N N   . CYS A 1 526 ? 24.115 61.489  19.808 1.00 40.00 ? 529 CYS A N   1 
ATOM 4050 C CA  . CYS A 1 526 ? 23.183 62.194  20.656 1.00 40.00 ? 529 CYS A CA  1 
ATOM 4051 C C   . CYS A 1 526 ? 22.445 61.246  21.556 1.00 40.00 ? 529 CYS A C   1 
ATOM 4052 O O   . CYS A 1 526 ? 21.917 61.677  22.609 1.00 40.00 ? 529 CYS A O   1 
ATOM 4053 C CB  . CYS A 1 526 ? 22.324 63.167  19.877 1.00 40.00 ? 529 CYS A CB  1 
ATOM 4054 S SG  . CYS A 1 526 ? 23.306 64.490  19.088 1.00 40.00 ? 529 CYS A SG  1 
ATOM 4055 N N   . ALA A 1 527 ? 22.467 59.950  21.217 1.00 40.00 ? 530 ALA A N   1 
ATOM 4056 C CA  . ALA A 1 527 ? 21.789 59.022  22.164 1.00 40.00 ? 530 ALA A CA  1 
ATOM 4057 C C   . ALA A 1 527 ? 22.730 58.917  23.364 1.00 40.00 ? 530 ALA A C   1 
ATOM 4058 O O   . ALA A 1 527 ? 22.314 58.880  24.510 1.00 40.00 ? 530 ALA A O   1 
ATOM 4059 C CB  . ALA A 1 527 ? 21.537 57.681  21.546 1.00 40.00 ? 530 ALA A CB  1 
ATOM 4060 N N   . PHE A 1 528 ? 24.029 58.926  23.029 1.00 40.00 ? 531 PHE A N   1 
ATOM 4061 C CA  . PHE A 1 528 ? 25.049 58.870  24.042 1.00 40.00 ? 531 PHE A CA  1 
ATOM 4062 C C   . PHE A 1 528 ? 24.837 59.958  25.105 1.00 40.00 ? 531 PHE A C   1 
ATOM 4063 O O   . PHE A 1 528 ? 24.724 59.661  26.300 1.00 40.00 ? 531 PHE A O   1 
ATOM 4064 C CB  . PHE A 1 528 ? 26.412 59.059  23.366 1.00 40.00 ? 531 PHE A CB  1 
ATOM 4065 C CG  . PHE A 1 528 ? 27.544 59.208  24.340 1.00 40.00 ? 531 PHE A CG  1 
ATOM 4066 C CD1 . PHE A 1 528 ? 27.685 58.350  25.415 1.00 40.00 ? 531 PHE A CD1 1 
ATOM 4067 C CD2 . PHE A 1 528 ? 28.453 60.230  24.192 1.00 40.00 ? 531 PHE A CD2 1 
ATOM 4068 C CE1 . PHE A 1 528 ? 28.712 58.513  26.321 1.00 40.00 ? 531 PHE A CE1 1 
ATOM 4069 C CE2 . PHE A 1 528 ? 29.483 60.389  25.092 1.00 40.00 ? 531 PHE A CE2 1 
ATOM 4070 C CZ  . PHE A 1 528 ? 29.623 59.526  26.163 1.00 40.00 ? 531 PHE A CZ  1 
ATOM 4071 N N   . TRP A 1 529 ? 24.830 61.193  24.589 1.00 40.00 ? 532 TRP A N   1 
ATOM 4072 C CA  . TRP A 1 529 ? 24.700 62.394  25.367 1.00 40.00 ? 532 TRP A CA  1 
ATOM 4073 C C   . TRP A 1 529 ? 23.320 62.557  25.986 1.00 40.00 ? 532 TRP A C   1 
ATOM 4074 O O   . TRP A 1 529 ? 23.196 62.744  27.212 1.00 40.00 ? 532 TRP A O   1 
ATOM 4075 C CB  . TRP A 1 529 ? 24.994 63.623  24.530 1.00 40.00 ? 532 TRP A CB  1 
ATOM 4076 C CG  . TRP A 1 529 ? 26.392 63.799  24.061 1.00 40.00 ? 532 TRP A CG  1 
ATOM 4077 C CD1 . TRP A 1 529 ? 26.872 63.613  22.783 1.00 40.00 ? 532 TRP A CD1 1 
ATOM 4078 C CD2 . TRP A 1 529 ? 27.527 64.225  24.823 1.00 40.00 ? 532 TRP A CD2 1 
ATOM 4079 N NE1 . TRP A 1 529 ? 28.221 63.888  22.723 1.00 40.00 ? 532 TRP A NE1 1 
ATOM 4080 C CE2 . TRP A 1 529 ? 28.639 64.269  23.961 1.00 40.00 ? 532 TRP A CE2 1 
ATOM 4081 C CE3 . TRP A 1 529 ? 27.702 64.582  26.170 1.00 40.00 ? 532 TRP A CE3 1 
ATOM 4082 C CZ2 . TRP A 1 529 ? 29.897 64.648  24.398 1.00 40.00 ? 532 TRP A CZ2 1 
ATOM 4083 C CZ3 . TRP A 1 529 ? 28.955 64.951  26.600 1.00 40.00 ? 532 TRP A CZ3 1 
ATOM 4084 C CH2 . TRP A 1 529 ? 30.055 64.977  25.725 1.00 40.00 ? 532 TRP A CH2 1 
ATOM 4085 N N   . ASN A 1 530 ? 22.275 62.486  25.153 1.00 40.00 ? 533 ASN A N   1 
ATOM 4086 C CA  . ASN A 1 530 ? 20.952 62.716  25.730 1.00 40.00 ? 533 ASN A CA  1 
ATOM 4087 C C   . ASN A 1 530 ? 20.406 61.566  26.528 1.00 40.00 ? 533 ASN A C   1 
ATOM 4088 O O   . ASN A 1 530 ? 19.622 61.836  27.456 1.00 40.00 ? 533 ASN A O   1 
ATOM 4089 C CB  . ASN A 1 530 ? 19.935 63.162  24.686 1.00 40.00 ? 533 ASN A CB  1 
ATOM 4090 C CG  . ASN A 1 530 ? 20.529 64.160  23.708 1.00 40.00 ? 533 ASN A CG  1 
ATOM 4091 O OD1 . ASN A 1 530 ? 21.472 64.912  24.001 1.00 40.00 ? 533 ASN A OD1 1 
ATOM 4092 N ND2 . ASN A 1 530 ? 19.959 64.135  22.505 1.00 40.00 ? 533 ASN A ND2 1 
ATOM 4093 N N   . ARG A 1 531 ? 20.771 60.314  26.236 1.00 40.00 ? 534 ARG A N   1 
ATOM 4094 C CA  . ARG A 1 531 ? 20.173 59.223  27.013 1.00 40.00 ? 534 ARG A CA  1 
ATOM 4095 C C   . ARG A 1 531 ? 21.072 58.615  28.086 1.00 40.00 ? 534 ARG A C   1 
ATOM 4096 O O   . ARG A 1 531 ? 20.635 58.495  29.241 1.00 40.00 ? 534 ARG A O   1 
ATOM 4097 C CB  . ARG A 1 531 ? 19.730 58.058  26.147 1.00 40.00 ? 534 ARG A CB  1 
ATOM 4098 C CG  . ARG A 1 531 ? 18.755 58.263  25.033 1.00 40.00 ? 534 ARG A CG  1 
ATOM 4099 C CD  . ARG A 1 531 ? 17.818 57.068  24.885 1.00 40.00 ? 534 ARG A CD  1 
ATOM 4100 N NE  . ARG A 1 531 ? 16.646 57.297  24.065 1.00 40.00 ? 534 ARG A NE  1 
ATOM 4101 C CZ  . ARG A 1 531 ? 16.655 57.953  22.903 1.00 40.00 ? 534 ARG A CZ  1 
ATOM 4102 N NH1 . ARG A 1 531 ? 17.740 58.497  22.356 1.00 40.00 ? 534 ARG A NH1 1 
ATOM 4103 N NH2 . ARG A 1 531 ? 15.484 58.051  22.280 1.00 40.00 ? 534 ARG A NH2 1 
ATOM 4104 N N   . PHE A 1 532 ? 22.255 58.168  27.740 1.00 40.00 ? 535 PHE A N   1 
ATOM 4105 C CA  . PHE A 1 532 ? 23.127 57.467  28.657 1.00 40.00 ? 535 PHE A CA  1 
ATOM 4106 C C   . PHE A 1 532 ? 23.975 58.294  29.590 1.00 40.00 ? 535 PHE A C   1 
ATOM 4107 O O   . PHE A 1 532 ? 23.954 58.217  30.835 1.00 40.00 ? 535 PHE A O   1 
ATOM 4108 C CB  . PHE A 1 532 ? 24.078 56.615  27.758 1.00 40.00 ? 535 PHE A CB  1 
ATOM 4109 C CG  . PHE A 1 532 ? 25.091 55.874  28.573 1.00 40.00 ? 535 PHE A CG  1 
ATOM 4110 C CD1 . PHE A 1 532 ? 24.682 55.070  29.633 1.00 40.00 ? 535 PHE A CD1 1 
ATOM 4111 C CD2 . PHE A 1 532 ? 26.444 55.994  28.287 1.00 40.00 ? 535 PHE A CD2 1 
ATOM 4112 C CE1 . PHE A 1 532 ? 25.570 54.390  30.407 1.00 40.00 ? 535 PHE A CE1 1 
ATOM 4113 C CE2 . PHE A 1 532 ? 27.375 55.303  29.060 1.00 40.00 ? 535 PHE A CE2 1 
ATOM 4114 C CZ  . PHE A 1 532 ? 26.922 54.519  30.113 1.00 40.00 ? 535 PHE A CZ  1 
ATOM 4115 N N   . LEU A 1 533 ? 24.758 59.215  28.990 1.00 40.00 ? 536 LEU A N   1 
ATOM 4116 C CA  . LEU A 1 533 ? 25.666 60.084  29.732 1.00 40.00 ? 536 LEU A CA  1 
ATOM 4117 C C   . LEU A 1 533 ? 25.121 60.642  31.018 1.00 40.00 ? 536 LEU A C   1 
ATOM 4118 O O   . LEU A 1 533 ? 25.763 60.546  32.059 1.00 40.00 ? 536 LEU A O   1 
ATOM 4119 C CB  . LEU A 1 533 ? 26.273 61.179  28.911 1.00 40.00 ? 536 LEU A CB  1 
ATOM 4120 C CG  . LEU A 1 533 ? 27.775 61.415  29.081 1.00 40.00 ? 536 LEU A CG  1 
ATOM 4121 C CD1 . LEU A 1 533 ? 28.002 62.904  29.334 1.00 40.00 ? 536 LEU A CD1 1 
ATOM 4122 C CD2 . LEU A 1 533 ? 28.382 60.525  30.124 1.00 40.00 ? 536 LEU A CD2 1 
ATOM 4123 N N   . PRO A 1 534 ? 23.932 61.215  30.977 1.00 40.00 ? 537 PRO A N   1 
ATOM 4124 C CA  . PRO A 1 534 ? 23.253 61.710  32.152 1.00 40.00 ? 537 PRO A CA  1 
ATOM 4125 C C   . PRO A 1 534 ? 23.150 60.633  33.214 1.00 40.00 ? 537 PRO A C   1 
ATOM 4126 O O   . PRO A 1 534 ? 23.645 60.874  34.326 1.00 40.00 ? 537 PRO A O   1 
ATOM 4127 C CB  . PRO A 1 534 ? 21.846 62.058  31.666 1.00 40.00 ? 537 PRO A CB  1 
ATOM 4128 C CG  . PRO A 1 534 ? 22.102 62.450  30.244 1.00 40.00 ? 537 PRO A CG  1 
ATOM 4129 C CD  . PRO A 1 534 ? 23.098 61.421  29.769 1.00 40.00 ? 537 PRO A CD  1 
ATOM 4130 N N   . LYS A 1 535 ? 22.614 59.433  32.922 1.00 40.00 ? 538 LYS A N   1 
ATOM 4131 C CA  . LYS A 1 535 ? 22.552 58.440  33.993 1.00 40.00 ? 538 LYS A CA  1 
ATOM 4132 C C   . LYS A 1 535 ? 23.944 58.125  34.523 1.00 40.00 ? 538 LYS A C   1 
ATOM 4133 O O   . LYS A 1 535 ? 24.066 57.746  35.685 1.00 40.00 ? 538 LYS A O   1 
ATOM 4134 C CB  . LYS A 1 535 ? 21.872 57.144  33.639 1.00 40.00 ? 538 LYS A CB  1 
ATOM 4135 C CG  . LYS A 1 535 ? 21.635 56.891  32.172 1.00 40.00 ? 538 LYS A CG  1 
ATOM 4136 C CD  . LYS A 1 535 ? 20.167 57.125  31.847 1.00 40.00 ? 538 LYS A CD  1 
ATOM 4137 C CE  . LYS A 1 535 ? 19.262 56.243  32.705 1.00 40.00 ? 538 LYS A CE  1 
ATOM 4138 N NZ  . LYS A 1 535 ? 18.241 55.614  31.799 1.00 40.00 ? 538 LYS A NZ  1 
ATOM 4139 N N   . LEU A 1 536 ? 24.964 58.236  33.657 1.00 40.00 ? 539 LEU A N   1 
ATOM 4140 C CA  . LEU A 1 536 ? 26.307 57.936  34.141 1.00 40.00 ? 539 LEU A CA  1 
ATOM 4141 C C   . LEU A 1 536 ? 26.649 58.998  35.193 1.00 40.00 ? 539 LEU A C   1 
ATOM 4142 O O   . LEU A 1 536 ? 27.167 58.700  36.245 1.00 40.00 ? 539 LEU A O   1 
ATOM 4143 C CB  . LEU A 1 536 ? 27.427 58.063  33.110 1.00 40.00 ? 539 LEU A CB  1 
ATOM 4144 C CG  . LEU A 1 536 ? 28.295 56.838  32.879 1.00 40.00 ? 539 LEU A CG  1 
ATOM 4145 C CD1 . LEU A 1 536 ? 29.533 57.168  32.071 1.00 40.00 ? 539 LEU A CD1 1 
ATOM 4146 C CD2 . LEU A 1 536 ? 28.680 56.159  34.179 1.00 40.00 ? 539 LEU A CD2 1 
ATOM 4147 N N   . LEU A 1 537 ? 26.368 60.237  34.787 1.00 40.00 ? 540 LEU A N   1 
ATOM 4148 C CA  . LEU A 1 537 ? 26.682 61.363  35.654 1.00 40.00 ? 540 LEU A CA  1 
ATOM 4149 C C   . LEU A 1 537 ? 25.916 61.331  36.942 1.00 40.00 ? 540 LEU A C   1 
ATOM 4150 O O   . LEU A 1 537 ? 26.481 61.546  38.015 1.00 40.00 ? 540 LEU A O   1 
ATOM 4151 C CB  . LEU A 1 537 ? 26.486 62.663  34.881 1.00 40.00 ? 540 LEU A CB  1 
ATOM 4152 C CG  . LEU A 1 537 ? 27.589 62.871  33.829 1.00 40.00 ? 540 LEU A CG  1 
ATOM 4153 C CD1 . LEU A 1 537 ? 27.343 64.099  32.975 1.00 40.00 ? 540 LEU A CD1 1 
ATOM 4154 C CD2 . LEU A 1 537 ? 28.943 62.930  34.551 1.00 40.00 ? 540 LEU A CD2 1 
ATOM 4155 N N   . SER A 1 538 ? 24.639 60.976  36.902 1.00 40.00 ? 541 SER A N   1 
ATOM 4156 C CA  . SER A 1 538 ? 23.819 60.897  38.099 1.00 40.00 ? 541 SER A CA  1 
ATOM 4157 C C   . SER A 1 538 ? 24.136 59.662  38.925 1.00 40.00 ? 541 SER A C   1 
ATOM 4158 O O   . SER A 1 538 ? 23.499 59.418  39.955 1.00 40.00 ? 541 SER A O   1 
ATOM 4159 C CB  . SER A 1 538 ? 22.327 60.931  37.784 1.00 40.00 ? 541 SER A CB  1 
ATOM 4160 O OG  . SER A 1 538 ? 21.968 60.120  36.687 1.00 40.00 ? 541 SER A OG  1 
ATOM 4161 N N   . ALA A 1 539 ? 25.071 58.844  38.484 1.00 40.00 ? 542 ALA A N   1 
ATOM 4162 C CA  . ALA A 1 539 ? 25.453 57.666  39.254 1.00 40.00 ? 542 ALA A CA  1 
ATOM 4163 C C   . ALA A 1 539 ? 26.741 58.058  39.999 1.00 40.00 ? 542 ALA A C   1 
ATOM 4164 O O   . ALA A 1 539 ? 26.918 57.731  41.160 1.00 40.00 ? 542 ALA A O   1 
ATOM 4165 C CB  . ALA A 1 539 ? 25.715 56.474  38.379 1.00 40.00 ? 542 ALA A CB  1 
ATOM 4166 N N   . THR A 1 540 ? 27.560 58.790  39.253 1.00 40.00 ? 543 THR A N   1 
ATOM 4167 C CA  . THR A 1 540 ? 28.860 59.243  39.758 1.00 40.00 ? 543 THR A CA  1 
ATOM 4168 C C   . THR A 1 540 ? 28.814 60.495  40.553 1.00 40.00 ? 543 THR A C   1 
ATOM 4169 O O   . THR A 1 540 ? 28.436 61.646  40.380 1.00 40.00 ? 543 THR A O   1 
ATOM 4170 C CB  . THR A 1 540 ? 29.844 59.086  38.576 1.00 40.00 ? 543 THR A CB  1 
ATOM 4171 O OG1 . THR A 1 540 ? 29.424 59.834  37.438 1.00 40.00 ? 543 THR A OG1 1 
ATOM 4172 C CG2 . THR A 1 540 ? 29.820 57.606  38.107 1.00 40.00 ? 543 THR A CG2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   4   ?   ?   ?   A . n 
A 1 2   ASP 2   5   5   ASP ASP A . n 
A 1 3   PRO 3   6   6   PRO PRO A . n 
A 1 4   GLN 4   7   7   GLN GLN A . n 
A 1 5   LEU 5   8   8   LEU LEU A . n 
A 1 6   LEU 6   9   9   LEU LEU A . n 
A 1 7   VAL 7   10  10  VAL VAL A . n 
A 1 8   ARG 8   11  11  ARG ARG A . n 
A 1 9   VAL 9   12  12  VAL VAL A . n 
A 1 10  ARG 10  13  13  ARG ARG A . n 
A 1 11  GLY 11  14  14  GLY GLY A . n 
A 1 12  GLY 12  15  15  GLY GLY A . n 
A 1 13  GLN 13  16  16  GLN GLN A . n 
A 1 14  LEU 14  17  17  LEU LEU A . n 
A 1 15  ARG 15  18  18  ARG ARG A . n 
A 1 16  GLY 16  19  19  GLY GLY A . n 
A 1 17  ILE 17  20  20  ILE ILE A . n 
A 1 18  ARG 18  21  21  ARG ARG A . n 
A 1 19  LEU 19  22  22  LEU LEU A . n 
A 1 20  LYS 20  23  23  LYS LYS A . n 
A 1 21  ALA 21  24  24  ALA ALA A . n 
A 1 22  PRO 22  25  25  PRO PRO A . n 
A 1 23  GLY 23  26  26  GLY GLY A . n 
A 1 24  GLY 24  27  27  GLY GLY A . n 
A 1 25  PRO 25  28  28  PRO PRO A . n 
A 1 26  VAL 26  29  29  VAL VAL A . n 
A 1 27  SER 27  30  30  SER SER A . n 
A 1 28  ALA 28  31  31  ALA ALA A . n 
A 1 29  PHE 29  32  32  PHE PHE A . n 
A 1 30  LEU 30  33  33  LEU LEU A . n 
A 1 31  GLY 31  34  34  GLY GLY A . n 
A 1 32  ILE 32  35  35  ILE ILE A . n 
A 1 33  PRO 33  36  36  PRO PRO A . n 
A 1 34  PHE 34  37  37  PHE PHE A . n 
A 1 35  ALA 35  38  38  ALA ALA A . n 
A 1 36  GLU 36  39  39  GLU GLU A . n 
A 1 37  PRO 37  40  40  PRO PRO A . n 
A 1 38  PRO 38  41  41  PRO PRO A . n 
A 1 39  VAL 39  42  42  VAL VAL A . n 
A 1 40  GLY 40  43  43  GLY GLY A . n 
A 1 41  SER 41  44  44  SER SER A . n 
A 1 42  ARG 42  45  45  ARG ARG A . n 
A 1 43  ARG 43  46  46  ARG ARG A . n 
A 1 44  PHE 44  47  47  PHE PHE A . n 
A 1 45  MET 45  48  48  MET MET A . n 
A 1 46  PRO 46  49  49  PRO PRO A . n 
A 1 47  PRO 47  50  50  PRO PRO A . n 
A 1 48  GLU 48  51  51  GLU GLU A . n 
A 1 49  PRO 49  52  52  PRO PRO A . n 
A 1 50  LYS 50  53  53  LYS LYS A . n 
A 1 51  ARG 51  54  54  ARG ARG A . n 
A 1 52  PRO 52  55  55  PRO PRO A . n 
A 1 53  TRP 53  56  56  TRP TRP A . n 
A 1 54  SER 54  57  57  SER SER A . n 
A 1 55  GLY 55  58  58  GLY GLY A . n 
A 1 56  VAL 56  59  59  VAL VAL A . n 
A 1 57  LEU 57  60  60  LEU LEU A . n 
A 1 58  ASP 58  61  61  ASP ASP A . n 
A 1 59  ALA 59  62  62  ALA ALA A . n 
A 1 60  THR 60  63  63  THR THR A . n 
A 1 61  THR 61  64  64  THR THR A . n 
A 1 62  PHE 62  65  65  PHE PHE A . n 
A 1 63  GLN 63  66  66  GLN GLN A . n 
A 1 64  ASN 64  67  67  ASN ASN A . n 
A 1 65  VAL 65  68  68  VAL VAL A . n 
A 1 66  CYS 66  69  69  CYS CYS A . n 
A 1 67  TYR 67  70  70  TYR TYR A . n 
A 1 68  GLN 68  71  71  GLN GLN A . n 
A 1 69  TYR 69  72  72  TYR TYR A . n 
A 1 70  VAL 70  73  73  VAL VAL A . n 
A 1 71  ASP 71  74  74  ASP ASP A . n 
A 1 72  THR 72  75  75  THR THR A . n 
A 1 73  LEU 73  76  76  LEU LEU A . n 
A 1 74  TYR 74  77  77  TYR TYR A . n 
A 1 75  PRO 75  78  78  PRO PRO A . n 
A 1 76  GLY 76  79  79  GLY GLY A . n 
A 1 77  PHE 77  80  80  PHE PHE A . n 
A 1 78  GLU 78  81  81  GLU GLU A . n 
A 1 79  GLY 79  82  82  GLY GLY A . n 
A 1 80  THR 80  83  83  THR THR A . n 
A 1 81  GLU 81  84  84  GLU GLU A . n 
A 1 82  MET 82  85  85  MET MET A . n 
A 1 83  TRP 83  86  86  TRP TRP A . n 
A 1 84  ASN 84  87  87  ASN ASN A . n 
A 1 85  PRO 85  88  88  PRO PRO A . n 
A 1 86  ASN 86  89  89  ASN ASN A . n 
A 1 87  ARG 87  90  90  ARG ARG A . n 
A 1 88  GLU 88  91  91  GLU GLU A . n 
A 1 89  LEU 89  92  92  LEU LEU A . n 
A 1 90  SER 90  93  93  SER SER A . n 
A 1 91  GLU 91  94  94  GLU GLU A . n 
A 1 92  ASP 92  95  95  ASP ASP A . n 
A 1 93  CYS 93  96  96  CYS CYS A . n 
A 1 94  LEU 94  97  97  LEU LEU A . n 
A 1 95  TYR 95  98  98  TYR TYR A . n 
A 1 96  LEU 96  99  99  LEU LEU A . n 
A 1 97  ASN 97  100 100 ASN ASN A . n 
A 1 98  VAL 98  101 101 VAL VAL A . n 
A 1 99  TRP 99  102 102 TRP TRP A . n 
A 1 100 THR 100 103 103 THR THR A . n 
A 1 101 PRO 101 104 104 PRO PRO A . n 
A 1 102 TYR 102 105 105 TYR TYR A . n 
A 1 103 PRO 103 106 106 PRO PRO A . n 
A 1 104 ARG 104 107 107 ARG ARG A . n 
A 1 105 PRO 105 108 108 PRO PRO A . n 
A 1 106 ALA 106 109 109 ALA ALA A . n 
A 1 107 SER 107 110 110 SER SER A . n 
A 1 108 PRO 108 111 111 PRO PRO A . n 
A 1 109 THR 109 112 112 THR THR A . n 
A 1 110 PRO 110 113 113 PRO PRO A . n 
A 1 111 VAL 111 114 114 VAL VAL A . n 
A 1 112 LEU 112 115 115 LEU LEU A . n 
A 1 113 ILE 113 116 116 ILE ILE A . n 
A 1 114 TRP 114 117 117 TRP TRP A . n 
A 1 115 ILE 115 118 118 ILE ILE A . n 
A 1 116 TYR 116 119 119 TYR TYR A . n 
A 1 117 GLY 117 120 120 GLY GLY A . n 
A 1 118 GLY 118 121 121 GLY GLY A . n 
A 1 119 GLY 119 122 122 GLY GLY A . n 
A 1 120 PHE 120 123 123 PHE PHE A . n 
A 1 121 TYR 121 124 124 TYR TYR A . n 
A 1 122 SER 122 125 125 SER SER A . n 
A 1 123 GLY 123 126 126 GLY GLY A . n 
A 1 124 ALA 124 127 127 ALA ALA A . n 
A 1 125 ALA 125 128 128 ALA ALA A . n 
A 1 126 SER 126 129 129 SER SER A . n 
A 1 127 LEU 127 130 130 LEU LEU A . n 
A 1 128 ASP 128 131 131 ASP ASP A . n 
A 1 129 VAL 129 132 132 VAL VAL A . n 
A 1 130 TYR 130 133 133 TYR TYR A . n 
A 1 131 ASP 131 134 134 ASP ASP A . n 
A 1 132 GLY 132 135 135 GLY GLY A . n 
A 1 133 ARG 133 136 136 ARG ARG A . n 
A 1 134 PHE 134 137 137 PHE PHE A . n 
A 1 135 LEU 135 138 138 LEU LEU A . n 
A 1 136 ALA 136 139 139 ALA ALA A . n 
A 1 137 GLN 137 140 140 GLN GLN A . n 
A 1 138 VAL 138 141 141 VAL VAL A . n 
A 1 139 GLU 139 142 142 GLU GLU A . n 
A 1 140 GLY 140 143 143 GLY GLY A . n 
A 1 141 ALA 141 144 144 ALA ALA A . n 
A 1 142 VAL 142 145 145 VAL VAL A . n 
A 1 143 LEU 143 146 146 LEU LEU A . n 
A 1 144 VAL 144 147 147 VAL VAL A . n 
A 1 145 SER 145 148 148 SER SER A . n 
A 1 146 MET 146 149 149 MET MET A . n 
A 1 147 ASN 147 150 150 ASN ASN A . n 
A 1 148 TYR 148 151 151 TYR TYR A . n 
A 1 149 ARG 149 152 152 ARG ARG A . n 
A 1 150 VAL 150 153 153 VAL VAL A . n 
A 1 151 GLY 151 154 154 GLY GLY A . n 
A 1 152 THR 152 155 155 THR THR A . n 
A 1 153 PHE 153 156 156 PHE PHE A . n 
A 1 154 GLY 154 157 157 GLY GLY A . n 
A 1 155 PHE 155 158 158 PHE PHE A . n 
A 1 156 LEU 156 159 159 LEU LEU A . n 
A 1 157 ALA 157 160 160 ALA ALA A . n 
A 1 158 LEU 158 161 161 LEU LEU A . n 
A 1 159 PRO 159 162 162 PRO PRO A . n 
A 1 160 GLY 160 163 163 GLY GLY A . n 
A 1 161 SER 161 164 164 SER SER A . n 
A 1 162 ARG 162 165 165 ARG ARG A . n 
A 1 163 GLU 163 166 166 GLU GLU A . n 
A 1 164 ALA 164 167 167 ALA ALA A . n 
A 1 165 PRO 165 168 168 PRO PRO A . n 
A 1 166 GLY 166 169 169 GLY GLY A . n 
A 1 167 ASN 167 170 170 ASN ASN A . n 
A 1 168 VAL 168 171 171 VAL VAL A . n 
A 1 169 GLY 169 172 172 GLY GLY A . n 
A 1 170 LEU 170 173 173 LEU LEU A . n 
A 1 171 LEU 171 174 174 LEU LEU A . n 
A 1 172 ASP 172 175 175 ASP ASP A . n 
A 1 173 GLN 173 176 176 GLN GLN A . n 
A 1 174 ARG 174 177 177 ARG ARG A . n 
A 1 175 LEU 175 178 178 LEU LEU A . n 
A 1 176 ALA 176 179 179 ALA ALA A . n 
A 1 177 LEU 177 180 180 LEU LEU A . n 
A 1 178 GLN 178 181 181 GLN GLN A . n 
A 1 179 TRP 179 182 182 TRP TRP A . n 
A 1 180 VAL 180 183 183 VAL VAL A . n 
A 1 181 GLN 181 184 184 GLN GLN A . n 
A 1 182 GLU 182 185 185 GLU GLU A . n 
A 1 183 ASN 183 186 186 ASN ASN A . n 
A 1 184 ILE 184 187 187 ILE ILE A . n 
A 1 185 ALA 185 188 188 ALA ALA A . n 
A 1 186 ALA 186 189 189 ALA ALA A . n 
A 1 187 PHE 187 190 190 PHE PHE A . n 
A 1 188 GLY 188 191 191 GLY GLY A . n 
A 1 189 GLY 189 192 192 GLY GLY A . n 
A 1 190 ASP 190 193 193 ASP ASP A . n 
A 1 191 PRO 191 194 194 PRO PRO A . n 
A 1 192 MET 192 195 195 MET MET A . n 
A 1 193 SER 193 196 196 SER SER A . n 
A 1 194 VAL 194 197 197 VAL VAL A . n 
A 1 195 THR 195 198 198 THR THR A . n 
A 1 196 LEU 196 199 199 LEU LEU A . n 
A 1 197 PHE 197 200 200 PHE PHE A . n 
A 1 198 GLY 198 201 201 GLY GLY A . n 
A 1 199 GLU 199 202 202 GLU GLU A . n 
A 1 200 SER 200 203 203 SER SER A . n 
A 1 201 ALA 201 204 204 ALA ALA A . n 
A 1 202 GLY 202 205 205 GLY GLY A . n 
A 1 203 ALA 203 206 206 ALA ALA A . n 
A 1 204 ALA 204 207 207 ALA ALA A . n 
A 1 205 SER 205 208 208 SER SER A . n 
A 1 206 VAL 206 209 209 VAL VAL A . n 
A 1 207 GLY 207 210 210 GLY GLY A . n 
A 1 208 MET 208 211 211 MET MET A . n 
A 1 209 HIS 209 212 212 HIS HIS A . n 
A 1 210 ILE 210 213 213 ILE ILE A . n 
A 1 211 LEU 211 214 214 LEU LEU A . n 
A 1 212 SER 212 215 215 SER SER A . n 
A 1 213 LEU 213 216 216 LEU LEU A . n 
A 1 214 PRO 214 217 217 PRO PRO A . n 
A 1 215 SER 215 218 218 SER SER A . n 
A 1 216 ARG 216 219 219 ARG ARG A . n 
A 1 217 SER 217 220 220 SER SER A . n 
A 1 218 LEU 218 221 221 LEU LEU A . n 
A 1 219 PHE 219 222 222 PHE PHE A . n 
A 1 220 HIS 220 223 223 HIS HIS A . n 
A 1 221 ARG 221 224 224 ARG ARG A . n 
A 1 222 ALA 222 225 225 ALA ALA A . n 
A 1 223 VAL 223 226 226 VAL VAL A . n 
A 1 224 LEU 224 227 227 LEU LEU A . n 
A 1 225 GLN 225 228 228 GLN GLN A . n 
A 1 226 SER 226 229 229 SER SER A . n 
A 1 227 GLY 227 230 230 GLY GLY A . n 
A 1 228 THR 228 231 231 THR THR A . n 
A 1 229 PRO 229 232 232 PRO PRO A . n 
A 1 230 ASN 230 233 233 ASN ASN A . n 
A 1 231 GLY 231 234 234 GLY GLY A . n 
A 1 232 PRO 232 235 235 PRO PRO A . n 
A 1 233 TRP 233 236 236 TRP TRP A . n 
A 1 234 ALA 234 237 237 ALA ALA A . n 
A 1 235 THR 235 238 238 THR THR A . n 
A 1 236 VAL 236 239 239 VAL VAL A . n 
A 1 237 SER 237 240 240 SER SER A . n 
A 1 238 ALA 238 241 241 ALA ALA A . n 
A 1 239 GLY 239 242 242 GLY GLY A . n 
A 1 240 GLU 240 243 243 GLU GLU A . n 
A 1 241 ALA 241 244 244 ALA ALA A . n 
A 1 242 ARG 242 245 245 ARG ARG A . n 
A 1 243 ARG 243 246 246 ARG ARG A . n 
A 1 244 ARG 244 247 247 ARG ARG A . n 
A 1 245 ALA 245 248 248 ALA ALA A . n 
A 1 246 THR 246 249 249 THR THR A . n 
A 1 247 LEU 247 250 250 LEU LEU A . n 
A 1 248 LEU 248 251 251 LEU LEU A . n 
A 1 249 ALA 249 252 252 ALA ALA A . n 
A 1 250 ARG 250 253 253 ARG ARG A . n 
A 1 251 LEU 251 254 254 LEU LEU A . n 
A 1 252 VAL 252 255 255 VAL VAL A . n 
A 1 253 GLY 253 256 256 GLY GLY A . n 
A 1 254 CYS 254 257 257 CYS CYS A . n 
A 1 255 PRO 255 258 258 PRO PRO A . n 
A 1 256 PRO 256 259 259 PRO PRO A . n 
A 1 257 GLY 257 260 260 GLY GLY A . n 
A 1 258 GLY 258 261 261 GLY GLY A . n 
A 1 259 ALA 259 262 262 ALA ALA A . n 
A 1 260 GLY 260 263 263 GLY GLY A . n 
A 1 261 GLY 261 264 264 GLY GLY A . n 
A 1 262 ASN 262 265 265 ASN ASN A . n 
A 1 263 ASP 263 266 266 ASP ASP A . n 
A 1 264 THR 264 267 267 THR THR A . n 
A 1 265 GLU 265 268 268 GLU GLU A . n 
A 1 266 LEU 266 269 269 LEU LEU A . n 
A 1 267 ILE 267 270 270 ILE ILE A . n 
A 1 268 ALA 268 271 271 ALA ALA A . n 
A 1 269 CYS 269 272 272 CYS CYS A . n 
A 1 270 LEU 270 273 273 LEU LEU A . n 
A 1 271 ARG 271 274 274 ARG ARG A . n 
A 1 272 THR 272 275 275 THR THR A . n 
A 1 273 ARG 273 276 276 ARG ARG A . n 
A 1 274 PRO 274 277 277 PRO PRO A . n 
A 1 275 ALA 275 278 278 ALA ALA A . n 
A 1 276 GLN 276 279 279 GLN GLN A . n 
A 1 277 ASP 277 280 280 ASP ASP A . n 
A 1 278 LEU 278 281 281 LEU LEU A . n 
A 1 279 VAL 279 282 282 VAL VAL A . n 
A 1 280 ASP 280 283 283 ASP ASP A . n 
A 1 281 HIS 281 284 284 HIS HIS A . n 
A 1 282 GLU 282 285 285 GLU GLU A . n 
A 1 283 TRP 283 286 286 TRP TRP A . n 
A 1 284 HIS 284 287 287 HIS HIS A . n 
A 1 285 VAL 285 288 288 VAL VAL A . n 
A 1 286 LEU 286 289 289 LEU LEU A . n 
A 1 287 PRO 287 290 290 PRO PRO A . n 
A 1 288 GLN 288 291 291 GLN GLN A . n 
A 1 289 GLU 289 292 292 GLU GLU A . n 
A 1 290 SER 290 293 293 SER SER A . n 
A 1 291 ILE 291 294 294 ILE ILE A . n 
A 1 292 PHE 292 295 295 PHE PHE A . n 
A 1 293 ARG 293 296 296 ARG ARG A . n 
A 1 294 PHE 294 297 297 PHE PHE A . n 
A 1 295 SER 295 298 298 SER SER A . n 
A 1 296 PHE 296 299 299 PHE PHE A . n 
A 1 297 VAL 297 300 300 VAL VAL A . n 
A 1 298 PRO 298 301 301 PRO PRO A . n 
A 1 299 VAL 299 302 302 VAL VAL A . n 
A 1 300 VAL 300 303 303 VAL VAL A . n 
A 1 301 ASP 301 304 304 ASP ASP A . n 
A 1 302 GLY 302 305 305 GLY GLY A . n 
A 1 303 ASP 303 306 306 ASP ASP A . n 
A 1 304 PHE 304 307 307 PHE PHE A . n 
A 1 305 LEU 305 308 308 LEU LEU A . n 
A 1 306 SER 306 309 309 SER SER A . n 
A 1 307 ASP 307 310 310 ASP ASP A . n 
A 1 308 THR 308 311 311 THR THR A . n 
A 1 309 PRO 309 312 312 PRO PRO A . n 
A 1 310 GLU 310 313 313 GLU GLU A . n 
A 1 311 ALA 311 314 314 ALA ALA A . n 
A 1 312 LEU 312 315 315 LEU LEU A . n 
A 1 313 ILE 313 316 316 ILE ILE A . n 
A 1 314 ASN 314 317 317 ASN ASN A . n 
A 1 315 THR 315 318 318 THR THR A . n 
A 1 316 GLY 316 319 319 GLY GLY A . n 
A 1 317 ASP 317 320 320 ASP ASP A . n 
A 1 318 PHE 318 321 321 PHE PHE A . n 
A 1 319 GLN 319 322 322 GLN GLN A . n 
A 1 320 ASP 320 323 323 ASP ASP A . n 
A 1 321 LEU 321 324 324 LEU LEU A . n 
A 1 322 GLN 322 325 325 GLN GLN A . n 
A 1 323 VAL 323 326 326 VAL VAL A . n 
A 1 324 LEU 324 327 327 LEU LEU A . n 
A 1 325 VAL 325 328 328 VAL VAL A . n 
A 1 326 GLY 326 329 329 GLY GLY A . n 
A 1 327 VAL 327 330 330 VAL VAL A . n 
A 1 328 VAL 328 331 331 VAL VAL A . n 
A 1 329 LYS 329 332 332 LYS LYS A . n 
A 1 330 ASP 330 333 333 ASP ASP A . n 
A 1 331 GLU 331 334 334 GLU GLU A . n 
A 1 332 GLY 332 335 335 GLY GLY A . n 
A 1 333 SER 333 336 336 SER SER A . n 
A 1 334 TYR 334 337 337 TYR TYR A . n 
A 1 335 PHE 335 338 338 PHE PHE A . n 
A 1 336 LEU 336 339 339 LEU LEU A . n 
A 1 337 VAL 337 340 340 VAL VAL A . n 
A 1 338 TYR 338 341 341 TYR TYR A . n 
A 1 339 GLY 339 342 342 GLY GLY A . n 
A 1 340 VAL 340 343 343 VAL VAL A . n 
A 1 341 PRO 341 344 344 PRO PRO A . n 
A 1 342 GLY 342 345 345 GLY GLY A . n 
A 1 343 PHE 343 346 346 PHE PHE A . n 
A 1 344 SER 344 347 347 SER SER A . n 
A 1 345 LYS 345 348 348 LYS LYS A . n 
A 1 346 ASP 346 349 349 ASP ASP A . n 
A 1 347 ASN 347 350 350 ASN ASN A . n 
A 1 348 GLU 348 351 351 GLU GLU A . n 
A 1 349 SER 349 352 352 SER SER A . n 
A 1 350 LEU 350 353 353 LEU LEU A . n 
A 1 351 ILE 351 354 354 ILE ILE A . n 
A 1 352 SER 352 355 355 SER SER A . n 
A 1 353 ARG 353 356 356 ARG ARG A . n 
A 1 354 ALA 354 357 357 ALA ALA A . n 
A 1 355 GLN 355 358 358 GLN GLN A . n 
A 1 356 PHE 356 359 359 PHE PHE A . n 
A 1 357 LEU 357 360 360 LEU LEU A . n 
A 1 358 ALA 358 361 361 ALA ALA A . n 
A 1 359 GLY 359 362 362 GLY GLY A . n 
A 1 360 VAL 360 363 363 VAL VAL A . n 
A 1 361 ARG 361 364 364 ARG ARG A . n 
A 1 362 ILE 362 365 365 ILE ILE A . n 
A 1 363 GLY 363 366 366 GLY GLY A . n 
A 1 364 VAL 364 367 367 VAL VAL A . n 
A 1 365 PRO 365 368 368 PRO PRO A . n 
A 1 366 GLN 366 369 369 GLN GLN A . n 
A 1 367 ALA 367 370 370 ALA ALA A . n 
A 1 368 SER 368 371 371 SER SER A . n 
A 1 369 ASP 369 372 372 ASP ASP A . n 
A 1 370 LEU 370 373 373 LEU LEU A . n 
A 1 371 ALA 371 374 374 ALA ALA A . n 
A 1 372 ALA 372 375 375 ALA ALA A . n 
A 1 373 GLU 373 376 376 GLU GLU A . n 
A 1 374 ALA 374 377 377 ALA ALA A . n 
A 1 375 VAL 375 378 378 VAL VAL A . n 
A 1 376 VAL 376 379 379 VAL VAL A . n 
A 1 377 LEU 377 380 380 LEU LEU A . n 
A 1 378 HIS 378 381 381 HIS HIS A . n 
A 1 379 TYR 379 382 382 TYR TYR A . n 
A 1 380 THR 380 383 383 THR THR A . n 
A 1 381 ASP 381 384 384 ASP ASP A . n 
A 1 382 TRP 382 385 385 TRP TRP A . n 
A 1 383 LEU 383 386 386 LEU LEU A . n 
A 1 384 HIS 384 387 387 HIS HIS A . n 
A 1 385 PRO 385 388 388 PRO PRO A . n 
A 1 386 GLU 386 389 389 GLU GLU A . n 
A 1 387 ASP 387 390 390 ASP ASP A . n 
A 1 388 PRO 388 391 391 PRO PRO A . n 
A 1 389 THR 389 392 392 THR THR A . n 
A 1 390 HIS 390 393 393 HIS HIS A . n 
A 1 391 LEU 391 394 394 LEU LEU A . n 
A 1 392 ARG 392 395 395 ARG ARG A . n 
A 1 393 ASP 393 396 396 ASP ASP A . n 
A 1 394 ALA 394 397 397 ALA ALA A . n 
A 1 395 MET 395 398 398 MET MET A . n 
A 1 396 SER 396 399 399 SER SER A . n 
A 1 397 ALA 397 400 400 ALA ALA A . n 
A 1 398 VAL 398 401 401 VAL VAL A . n 
A 1 399 VAL 399 402 402 VAL VAL A . n 
A 1 400 GLY 400 403 403 GLY GLY A . n 
A 1 401 ASP 401 404 404 ASP ASP A . n 
A 1 402 HIS 402 405 405 HIS HIS A . n 
A 1 403 ASN 403 406 406 ASN ASN A . n 
A 1 404 VAL 404 407 407 VAL VAL A . n 
A 1 405 VAL 405 408 408 VAL VAL A . n 
A 1 406 CYS 406 409 409 CYS CYS A . n 
A 1 407 PRO 407 410 410 PRO PRO A . n 
A 1 408 VAL 408 411 411 VAL VAL A . n 
A 1 409 ALA 409 412 412 ALA ALA A . n 
A 1 410 GLN 410 413 413 GLN GLN A . n 
A 1 411 LEU 411 414 414 LEU LEU A . n 
A 1 412 ALA 412 415 415 ALA ALA A . n 
A 1 413 GLY 413 416 416 GLY GLY A . n 
A 1 414 ARG 414 417 417 ARG ARG A . n 
A 1 415 LEU 415 418 418 LEU LEU A . n 
A 1 416 ALA 416 419 419 ALA ALA A . n 
A 1 417 ALA 417 420 420 ALA ALA A . n 
A 1 418 GLN 418 421 421 GLN GLN A . n 
A 1 419 GLY 419 422 422 GLY GLY A . n 
A 1 420 ALA 420 423 423 ALA ALA A . n 
A 1 421 ARG 421 424 424 ARG ARG A . n 
A 1 422 VAL 422 425 425 VAL VAL A . n 
A 1 423 TYR 423 426 426 TYR TYR A . n 
A 1 424 ALA 424 427 427 ALA ALA A . n 
A 1 425 TYR 425 428 428 TYR TYR A . n 
A 1 426 ILE 426 429 429 ILE ILE A . n 
A 1 427 PHE 427 430 430 PHE PHE A . n 
A 1 428 GLU 428 431 431 GLU GLU A . n 
A 1 429 HIS 429 432 432 HIS HIS A . n 
A 1 430 ARG 430 433 433 ARG ARG A . n 
A 1 431 ALA 431 434 434 ALA ALA A . n 
A 1 432 SER 432 435 435 SER SER A . n 
A 1 433 THR 433 436 436 THR THR A . n 
A 1 434 LEU 434 437 437 LEU LEU A . n 
A 1 435 THR 435 438 438 THR THR A . n 
A 1 436 TRP 436 439 439 TRP TRP A . n 
A 1 437 PRO 437 440 440 PRO PRO A . n 
A 1 438 LEU 438 441 441 LEU LEU A . n 
A 1 439 TRP 439 442 442 TRP TRP A . n 
A 1 440 MET 440 443 443 MET MET A . n 
A 1 441 GLY 441 444 444 GLY GLY A . n 
A 1 442 VAL 442 445 445 VAL VAL A . n 
A 1 443 PRO 443 446 446 PRO PRO A . n 
A 1 444 HIS 444 447 447 HIS HIS A . n 
A 1 445 GLY 445 448 448 GLY GLY A . n 
A 1 446 TYR 446 449 449 TYR TYR A . n 
A 1 447 GLU 447 450 450 GLU GLU A . n 
A 1 448 ILE 448 451 451 ILE ILE A . n 
A 1 449 GLU 449 452 452 GLU GLU A . n 
A 1 450 PHE 450 453 453 PHE PHE A . n 
A 1 451 ILE 451 454 454 ILE ILE A . n 
A 1 452 PHE 452 455 455 PHE PHE A . n 
A 1 453 GLY 453 456 456 GLY GLY A . n 
A 1 454 LEU 454 457 457 LEU LEU A . n 
A 1 455 PRO 455 458 458 PRO PRO A . n 
A 1 456 LEU 456 459 459 LEU LEU A . n 
A 1 457 ASP 457 460 460 ASP ASP A . n 
A 1 458 PRO 458 461 461 PRO PRO A . n 
A 1 459 SER 459 462 462 SER SER A . n 
A 1 460 LEU 460 463 463 LEU LEU A . n 
A 1 461 ASN 461 464 464 ASN ASN A . n 
A 1 462 TYR 462 465 465 TYR TYR A . n 
A 1 463 THR 463 466 466 THR THR A . n 
A 1 464 THR 464 467 467 THR THR A . n 
A 1 465 GLU 465 468 468 GLU GLU A . n 
A 1 466 GLU 466 469 469 GLU GLU A . n 
A 1 467 ARG 467 470 470 ARG ARG A . n 
A 1 468 ILE 468 471 471 ILE ILE A . n 
A 1 469 PHE 469 472 472 PHE PHE A . n 
A 1 470 ALA 470 473 473 ALA ALA A . n 
A 1 471 GLN 471 474 474 GLN GLN A . n 
A 1 472 ARG 472 475 475 ARG ARG A . n 
A 1 473 LEU 473 476 476 LEU LEU A . n 
A 1 474 MET 474 477 477 MET MET A . n 
A 1 475 LYS 475 478 478 LYS LYS A . n 
A 1 476 TYR 476 479 479 TYR TYR A . n 
A 1 477 TRP 477 480 480 TRP TRP A . n 
A 1 478 THR 478 481 481 THR THR A . n 
A 1 479 ASN 479 482 482 ASN ASN A . n 
A 1 480 PHE 480 483 483 PHE PHE A . n 
A 1 481 ALA 481 484 484 ALA ALA A . n 
A 1 482 ARG 482 485 485 ARG ARG A . n 
A 1 483 THR 483 486 486 THR THR A . n 
A 1 484 GLY 484 487 487 GLY GLY A . n 
A 1 485 ASP 485 488 488 ASP ASP A . n 
A 1 486 PRO 486 489 489 PRO PRO A . n 
A 1 487 ASN 487 490 490 ASN ASN A . n 
A 1 488 ASP 488 491 491 ASP ASP A . n 
A 1 489 PRO 489 492 492 PRO PRO A . n 
A 1 490 ARG 490 493 493 ARG ARG A . n 
A 1 491 ASP 491 494 494 ASP ASP A . n 
A 1 492 SER 492 495 495 SER SER A . n 
A 1 493 LYS 493 496 496 LYS LYS A . n 
A 1 494 SER 494 497 497 SER SER A . n 
A 1 495 PRO 495 498 498 PRO PRO A . n 
A 1 496 GLN 496 499 499 GLN GLN A . n 
A 1 497 TRP 497 500 500 TRP TRP A . n 
A 1 498 PRO 498 501 501 PRO PRO A . n 
A 1 499 PRO 499 502 502 PRO PRO A . n 
A 1 500 TYR 500 503 503 TYR TYR A . n 
A 1 501 THR 501 504 504 THR THR A . n 
A 1 502 THR 502 505 505 THR THR A . n 
A 1 503 ALA 503 506 506 ALA ALA A . n 
A 1 504 ALA 504 507 507 ALA ALA A . n 
A 1 505 GLN 505 508 508 GLN GLN A . n 
A 1 506 GLN 506 509 509 GLN GLN A . n 
A 1 507 TYR 507 510 510 TYR TYR A . n 
A 1 508 VAL 508 511 511 VAL VAL A . n 
A 1 509 SER 509 512 512 SER SER A . n 
A 1 510 LEU 510 513 513 LEU LEU A . n 
A 1 511 ASN 511 514 514 ASN ASN A . n 
A 1 512 LEU 512 515 515 LEU LEU A . n 
A 1 513 LYS 513 516 516 LYS LYS A . n 
A 1 514 PRO 514 517 517 PRO PRO A . n 
A 1 515 LEU 515 518 518 LEU LEU A . n 
A 1 516 GLU 516 519 519 GLU GLU A . n 
A 1 517 VAL 517 520 520 VAL VAL A . n 
A 1 518 ARG 518 521 521 ARG ARG A . n 
A 1 519 ARG 519 522 522 ARG ARG A . n 
A 1 520 GLY 520 523 523 GLY GLY A . n 
A 1 521 LEU 521 524 524 LEU LEU A . n 
A 1 522 ARG 522 525 525 ARG ARG A . n 
A 1 523 ALA 523 526 526 ALA ALA A . n 
A 1 524 GLN 524 527 527 GLN GLN A . n 
A 1 525 THR 525 528 528 THR THR A . n 
A 1 526 CYS 526 529 529 CYS CYS A . n 
A 1 527 ALA 527 530 530 ALA ALA A . n 
A 1 528 PHE 528 531 531 PHE PHE A . n 
A 1 529 TRP 529 532 532 TRP TRP A . n 
A 1 530 ASN 530 533 533 ASN ASN A . n 
A 1 531 ARG 531 534 534 ARG ARG A . n 
A 1 532 PHE 532 535 535 PHE PHE A . n 
A 1 533 LEU 533 536 536 LEU LEU A . n 
A 1 534 PRO 534 537 537 PRO PRO A . n 
A 1 535 LYS 535 538 538 LYS LYS A . n 
A 1 536 LEU 536 539 539 LEU LEU A . n 
A 1 537 LEU 537 540 540 LEU LEU A . n 
A 1 538 SER 538 541 541 SER SER A . n 
A 1 539 ALA 539 542 542 ALA ALA A . n 
A 1 540 THR 540 543 543 THR THR A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z           1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 14_555 -x+1/2,-y+1/2,z -1.0000000000 0.0000000000 0.0000000000 58.9900000000 0.0000000000 
-1.0000000000 0.0000000000 107.9350000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-12-29 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2014-05-21 
5 'Structure model' 1 4 2021-06-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Other                       
4 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' pdbx_struct_assembly     
2 5 'Structure model' pdbx_struct_assembly_gen 
3 5 'Structure model' pdbx_struct_oper_list    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_pdbx_struct_assembly.oligomeric_count'    
2 5 'Structure model' '_pdbx_struct_assembly.oligomeric_details'  
3 5 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO 'data reduction' .         ? 1 
SCALA 'data scaling'   .         ? 2 
AMoRE phasing          .         ? 3 
CNS   refinement       .         ? 4 
CCP4  'data scaling'   '(SCALA)' ? 5 
# 
_pdbx_entry_details.entry_id                 1C2B 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           
;THE SEQUENCE LISTED IN THE SEQRES RECORD IS OF 
MOUSE ACETYLCHOLINESTERASE, (CORRESPONDING TO 
THE STRUCTURE) NOT OF ELECTROPHORUS ELECTRICUS. 
AT THE RESOLUTION OF THE EXPERIMENTAL DATA (4.2A) 
NO SEQUENCE DISCREPANCIES CAN BE SEEN.
;
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 C   A GLY 261 ? ? 1_555 C   A ALA 262 ? ? 11_555 0.70 
2  1 N   A ALA 262 ? ? 1_555 C   A ALA 262 ? ? 11_555 0.78 
3  1 N   A ALA 262 ? ? 1_555 CA  A ALA 262 ? ? 11_555 0.79 
4  1 CA  A ALA 262 ? ? 1_555 CA  A ALA 262 ? ? 11_555 0.83 
5  1 CA  A GLY 261 ? ? 1_555 N   A GLY 263 ? ? 11_555 0.85 
6  1 CA  A GLY 261 ? ? 1_555 CA  A GLY 263 ? ? 11_555 0.92 
7  1 C   A GLY 261 ? ? 1_555 N   A GLY 263 ? ? 11_555 0.95 
8  1 CD  A ARG 21  ? ? 1_555 NH1 A ARG 21  ? ? 4_565  1.28 
9  1 NE  A ARG 21  ? ? 1_555 CZ  A ARG 21  ? ? 4_565  1.30 
10 1 CZ  A ARG 21  ? ? 1_555 CZ  A ARG 21  ? ? 4_565  1.35 
11 1 C   A GLY 261 ? ? 1_555 O   A ALA 262 ? ? 11_555 1.47 
12 1 N   A GLY 261 ? ? 1_555 N   A GLY 263 ? ? 11_555 1.55 
13 1 NE  A ARG 21  ? ? 1_555 NH2 A ARG 21  ? ? 4_565  1.59 
14 1 O   A GLY 261 ? ? 1_555 O   A ALA 262 ? ? 11_555 1.65 
15 1 CA  A ALA 262 ? ? 1_555 CB  A ALA 262 ? ? 11_555 1.65 
16 1 NE  A ARG 21  ? ? 1_555 NH1 A ARG 21  ? ? 4_565  1.67 
17 1 O   A GLY 261 ? ? 1_555 C   A ALA 262 ? ? 11_555 1.69 
18 1 N   A ALA 262 ? ? 1_555 N   A GLY 263 ? ? 11_555 1.72 
19 1 CA  A GLY 261 ? ? 1_555 C   A GLY 263 ? ? 11_555 1.75 
20 1 CB  A ALA 262 ? ? 1_555 CB  A ALA 262 ? ? 11_555 1.75 
21 1 C   A GLY 261 ? ? 1_555 CA  A GLY 263 ? ? 11_555 1.78 
22 1 N   A ALA 262 ? ? 1_555 CB  A ALA 262 ? ? 11_555 1.81 
23 1 N   A ALA 262 ? ? 1_555 O   A ALA 262 ? ? 11_555 1.85 
24 1 O   A ALA 262 ? ? 1_555 O   A ALA 262 ? ? 11_555 1.93 
25 1 CE2 A TYR 105 ? ? 1_555 OH  A TYR 105 ? ? 4_565  1.94 
26 1 O   A GLY 261 ? ? 1_555 N   A GLY 263 ? ? 11_555 2.01 
27 1 CA  A ALA 262 ? ? 1_555 C   A ALA 262 ? ? 11_555 2.02 
28 1 N   A ALA 262 ? ? 1_555 N   A ALA 262 ? ? 11_555 2.03 
29 1 CB  A ALA 109 ? ? 1_555 CB  A ALA 109 ? ? 3_555  2.03 
30 1 N   A GLY 261 ? ? 1_555 O   A GLY 263 ? ? 11_555 2.07 
31 1 CZ  A ARG 21  ? ? 1_555 NH1 A ARG 21  ? ? 4_565  2.07 
32 1 CD  A ARG 21  ? ? 1_555 CZ  A ARG 21  ? ? 4_565  2.12 
33 1 NH1 A ARG 21  ? ? 1_555 NH1 A ARG 21  ? ? 4_565  2.14 
34 1 CZ  A ARG 21  ? ? 1_555 NH2 A ARG 21  ? ? 4_565  2.17 
35 1 O   A GLY 261 ? ? 1_555 CA  A GLY 263 ? ? 11_555 2.19 
36 1 CA  A GLY 261 ? ? 1_555 O   A GLY 263 ? ? 11_555 2.19 
37 1 N   A GLY 261 ? ? 1_555 CA  A GLY 263 ? ? 11_555 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD A ARG 11  ? ? NE A ARG 11  ? ? CZ  A ARG 11  ? ? 132.58 123.60 8.98  1.40 N 
2  1 NE A ARG 11  ? ? CZ A ARG 11  ? ? NH1 A ARG 11  ? ? 124.61 120.30 4.31  0.50 N 
3  1 NE A ARG 152 ? ? CZ A ARG 152 ? ? NH2 A ARG 152 ? ? 123.33 120.30 3.03  0.50 N 
4  1 NE A ARG 224 ? ? CZ A ARG 224 ? ? NH2 A ARG 224 ? ? 116.93 120.30 -3.37 0.50 N 
5  1 NE A ARG 245 ? ? CZ A ARG 245 ? ? NH1 A ARG 245 ? ? 123.84 120.30 3.54  0.50 N 
6  1 NE A ARG 246 ? ? CZ A ARG 246 ? ? NH2 A ARG 246 ? ? 115.13 120.30 -5.17 0.50 N 
7  1 CD A ARG 247 ? ? NE A ARG 247 ? ? CZ  A ARG 247 ? ? 136.53 123.60 12.93 1.40 N 
8  1 NE A ARG 247 ? ? CZ A ARG 247 ? ? NH1 A ARG 247 ? ? 125.87 120.30 5.57  0.50 N 
9  1 NE A ARG 247 ? ? CZ A ARG 247 ? ? NH2 A ARG 247 ? ? 113.73 120.30 -6.57 0.50 N 
10 1 N  A ASN 265 ? ? CA A ASN 265 ? ? CB  A ASN 265 ? ? 122.50 110.60 11.90 1.80 N 
11 1 NE A ARG 274 ? ? CZ A ARG 274 ? ? NH1 A ARG 274 ? ? 123.90 120.30 3.60  0.50 N 
12 1 NE A ARG 274 ? ? CZ A ARG 274 ? ? NH2 A ARG 274 ? ? 114.37 120.30 -5.93 0.50 N 
13 1 CD A ARG 424 ? ? NE A ARG 424 ? ? CZ  A ARG 424 ? ? 132.03 123.60 8.43  1.40 N 
14 1 NE A ARG 475 ? ? CZ A ARG 475 ? ? NH2 A ARG 475 ? ? 117.26 120.30 -3.04 0.50 N 
15 1 CB A ASP 488 ? ? CG A ASP 488 ? ? OD1 A ASP 488 ? ? 125.31 118.30 7.01  0.90 N 
16 1 CA A THR 504 ? ? CB A THR 504 ? ? CG2 A THR 504 ? ? 103.99 112.40 -8.41 1.40 N 
17 1 NE A ARG 534 ? ? CZ A ARG 534 ? ? NH1 A ARG 534 ? ? 124.34 120.30 4.04  0.50 N 
18 1 NE A ARG 534 ? ? CZ A ARG 534 ? ? NH2 A ARG 534 ? ? 115.99 120.30 -4.31 0.50 N 
19 1 CA A THR 543 ? ? C  A THR 543 ? ? O   A THR 543 ? ? 136.67 120.10 16.57 2.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 32  ? ? -114.28 79.50   
2  1 PRO A 41  ? ? -89.43  45.26   
3  1 ALA A 62  ? ? -144.61 36.37   
4  1 THR A 75  ? ? -93.48  -91.44  
5  1 LEU A 76  ? ? 43.28   -74.69  
6  1 MET A 85  ? ? -47.52  -17.10  
7  1 SER A 93  ? ? -173.81 146.65  
8  1 ARG A 107 ? ? -31.11  141.66  
9  1 PRO A 108 ? ? -55.52  173.08  
10 1 PRO A 111 ? ? -47.08  91.06   
11 1 ASP A 134 ? ? -69.00  98.71   
12 1 PRO A 162 ? ? -39.90  134.19  
13 1 ALA A 167 ? ? -161.46 69.72   
14 1 ASN A 186 ? ? -158.07 -9.82   
15 1 ALA A 189 ? ? -59.16  -5.14   
16 1 SER A 203 ? ? 27.49   -120.87 
17 1 ALA A 262 ? ? -78.91  -158.06 
18 1 ASP A 306 ? ? -139.94 -88.80  
19 1 ASP A 323 ? ? 158.64  -31.09  
20 1 TYR A 341 ? ? -80.65  41.03   
21 1 SER A 371 ? ? -69.44  -179.31 
22 1 PRO A 388 ? ? -68.30  6.36    
23 1 ASN A 464 ? ? 51.66   79.17   
24 1 TYR A 465 ? ? -100.09 -158.51 
25 1 ASP A 488 ? ? -163.57 117.26  
26 1 PRO A 492 ? ? -16.47  -109.41 
27 1 ASP A 494 ? ? -51.52  84.11   
28 1 SER A 495 ? ? -68.39  64.81   
29 1 LYS A 496 ? ? -69.71  80.72   
30 1 SER A 497 ? ? 60.41   -123.62 
31 1 LEU A 518 ? ? -39.98  140.89  
32 1 ARG A 525 ? ? 38.43   40.49   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 491 ? CG  ? A ASP 488 CG  
2  1 Y 1 A ASP 491 ? OD1 ? A ASP 488 OD1 
3  1 Y 1 A ASP 491 ? OD2 ? A ASP 488 OD2 
4  1 Y 1 A ARG 493 ? CG  ? A ARG 490 CG  
5  1 Y 1 A ARG 493 ? CD  ? A ARG 490 CD  
6  1 Y 1 A ARG 493 ? NE  ? A ARG 490 NE  
7  1 Y 1 A ARG 493 ? CZ  ? A ARG 490 CZ  
8  1 Y 1 A ARG 493 ? NH1 ? A ARG 490 NH1 
9  1 Y 1 A ARG 493 ? NH2 ? A ARG 490 NH2 
10 1 Y 1 A ASP 494 ? CG  ? A ASP 491 CG  
11 1 Y 1 A ASP 494 ? OD1 ? A ASP 491 OD1 
12 1 Y 1 A ASP 494 ? OD2 ? A ASP 491 OD2 
13 1 Y 1 A SER 495 ? OG  ? A SER 492 OG  
14 1 Y 1 A LYS 496 ? CG  ? A LYS 493 CG  
15 1 Y 1 A LYS 496 ? CD  ? A LYS 493 CD  
16 1 Y 1 A LYS 496 ? CE  ? A LYS 493 CE  
17 1 Y 1 A LYS 496 ? NZ  ? A LYS 493 NZ  
18 1 Y 1 A SER 497 ? OG  ? A SER 494 OG  
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     GLU 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      4 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    GLU 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
#