data_1C2O
# 
_entry.id   1C2O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1C2O         
RCSB  RCSB009404   
WWPDB D_1000009404 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1eea . unspecified 
PDB 1C2B . unspecified 
PDB 1maa . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1C2O 
_pdbx_database_status.recvd_initial_deposition_date   1999-07-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, Y.'  1 
'Marchot, P.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Conformational flexibility of the acetylcholinesterase tetramer suggested by x-ray crystallography.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            274 
_citation.page_first                30370 
_citation.page_last                 30376 
_citation.year                      1999 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10521413 
_citation.pdbx_database_id_DOI      10.1074/jbc.274.43.30370 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bourne, Y.'   1 
primary 'Grassi, J.'   2 
primary 'Bougis, P.E.' 3 
primary 'Marchot, P.'  4 
# 
_cell.entry_id           1C2O 
_cell.length_a           211.160 
_cell.length_b           129.750 
_cell.length_c           195.420 
_cell.angle_alpha        90.00 
_cell.angle_beta         103.20 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1C2O 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           ACETYLCHOLINESTERASE 
_entity.formula_weight             59292.012 
_entity.pdbx_number_of_molecules   4 
_entity.pdbx_ec                    3.1.1.7 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'A4 FORM' 
_entity.details                    'SEE REMARK 450 FOR INFORMATION REGARDING THE SOURCE AND SEQUENCE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTE
MWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGS
REAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEA
RRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDL
QVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGD
HNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFA
RTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTE
MWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGS
REAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEA
RRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDL
QVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGD
HNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFA
RTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   PRO n 
1 3   GLN n 
1 4   LEU n 
1 5   LEU n 
1 6   VAL n 
1 7   ARG n 
1 8   VAL n 
1 9   ARG n 
1 10  GLY n 
1 11  GLY n 
1 12  GLN n 
1 13  LEU n 
1 14  ARG n 
1 15  GLY n 
1 16  ILE n 
1 17  ARG n 
1 18  LEU n 
1 19  LYS n 
1 20  ALA n 
1 21  PRO n 
1 22  GLY n 
1 23  GLY n 
1 24  PRO n 
1 25  VAL n 
1 26  SER n 
1 27  ALA n 
1 28  PHE n 
1 29  LEU n 
1 30  GLY n 
1 31  ILE n 
1 32  PRO n 
1 33  PHE n 
1 34  ALA n 
1 35  GLU n 
1 36  PRO n 
1 37  PRO n 
1 38  VAL n 
1 39  GLY n 
1 40  SER n 
1 41  ARG n 
1 42  ARG n 
1 43  PHE n 
1 44  MET n 
1 45  PRO n 
1 46  PRO n 
1 47  GLU n 
1 48  PRO n 
1 49  LYS n 
1 50  ARG n 
1 51  PRO n 
1 52  TRP n 
1 53  SER n 
1 54  GLY n 
1 55  VAL n 
1 56  LEU n 
1 57  ASP n 
1 58  ALA n 
1 59  THR n 
1 60  THR n 
1 61  PHE n 
1 62  GLN n 
1 63  ASN n 
1 64  VAL n 
1 65  CYS n 
1 66  TYR n 
1 67  GLN n 
1 68  TYR n 
1 69  VAL n 
1 70  ASP n 
1 71  THR n 
1 72  LEU n 
1 73  TYR n 
1 74  PRO n 
1 75  GLY n 
1 76  PHE n 
1 77  GLU n 
1 78  GLY n 
1 79  THR n 
1 80  GLU n 
1 81  MET n 
1 82  TRP n 
1 83  ASN n 
1 84  PRO n 
1 85  ASN n 
1 86  ARG n 
1 87  GLU n 
1 88  LEU n 
1 89  SER n 
1 90  GLU n 
1 91  ASP n 
1 92  CYS n 
1 93  LEU n 
1 94  TYR n 
1 95  LEU n 
1 96  ASN n 
1 97  VAL n 
1 98  TRP n 
1 99  THR n 
1 100 PRO n 
1 101 TYR n 
1 102 PRO n 
1 103 ARG n 
1 104 PRO n 
1 105 ALA n 
1 106 SER n 
1 107 PRO n 
1 108 THR n 
1 109 PRO n 
1 110 VAL n 
1 111 LEU n 
1 112 ILE n 
1 113 TRP n 
1 114 ILE n 
1 115 TYR n 
1 116 GLY n 
1 117 GLY n 
1 118 GLY n 
1 119 PHE n 
1 120 TYR n 
1 121 SER n 
1 122 GLY n 
1 123 ALA n 
1 124 ALA n 
1 125 SER n 
1 126 LEU n 
1 127 ASP n 
1 128 VAL n 
1 129 TYR n 
1 130 ASP n 
1 131 GLY n 
1 132 ARG n 
1 133 PHE n 
1 134 LEU n 
1 135 ALA n 
1 136 GLN n 
1 137 VAL n 
1 138 GLU n 
1 139 GLY n 
1 140 ALA n 
1 141 VAL n 
1 142 LEU n 
1 143 VAL n 
1 144 SER n 
1 145 MET n 
1 146 ASN n 
1 147 TYR n 
1 148 ARG n 
1 149 VAL n 
1 150 GLY n 
1 151 THR n 
1 152 PHE n 
1 153 GLY n 
1 154 PHE n 
1 155 LEU n 
1 156 ALA n 
1 157 LEU n 
1 158 PRO n 
1 159 GLY n 
1 160 SER n 
1 161 ARG n 
1 162 GLU n 
1 163 ALA n 
1 164 PRO n 
1 165 GLY n 
1 166 ASN n 
1 167 VAL n 
1 168 GLY n 
1 169 LEU n 
1 170 LEU n 
1 171 ASP n 
1 172 GLN n 
1 173 ARG n 
1 174 LEU n 
1 175 ALA n 
1 176 LEU n 
1 177 GLN n 
1 178 TRP n 
1 179 VAL n 
1 180 GLN n 
1 181 GLU n 
1 182 ASN n 
1 183 ILE n 
1 184 ALA n 
1 185 ALA n 
1 186 PHE n 
1 187 GLY n 
1 188 GLY n 
1 189 ASP n 
1 190 PRO n 
1 191 MET n 
1 192 SER n 
1 193 VAL n 
1 194 THR n 
1 195 LEU n 
1 196 PHE n 
1 197 GLY n 
1 198 GLU n 
1 199 SER n 
1 200 ALA n 
1 201 GLY n 
1 202 ALA n 
1 203 ALA n 
1 204 SER n 
1 205 VAL n 
1 206 GLY n 
1 207 MET n 
1 208 HIS n 
1 209 ILE n 
1 210 LEU n 
1 211 SER n 
1 212 LEU n 
1 213 PRO n 
1 214 SER n 
1 215 ARG n 
1 216 SER n 
1 217 LEU n 
1 218 PHE n 
1 219 HIS n 
1 220 ARG n 
1 221 ALA n 
1 222 VAL n 
1 223 LEU n 
1 224 GLN n 
1 225 SER n 
1 226 GLY n 
1 227 THR n 
1 228 PRO n 
1 229 ASN n 
1 230 GLY n 
1 231 PRO n 
1 232 TRP n 
1 233 ALA n 
1 234 THR n 
1 235 VAL n 
1 236 SER n 
1 237 ALA n 
1 238 GLY n 
1 239 GLU n 
1 240 ALA n 
1 241 ARG n 
1 242 ARG n 
1 243 ARG n 
1 244 ALA n 
1 245 THR n 
1 246 LEU n 
1 247 LEU n 
1 248 ALA n 
1 249 ARG n 
1 250 LEU n 
1 251 VAL n 
1 252 GLY n 
1 253 CYS n 
1 254 PRO n 
1 255 PRO n 
1 256 GLY n 
1 257 GLY n 
1 258 ALA n 
1 259 GLY n 
1 260 GLY n 
1 261 ASN n 
1 262 ASP n 
1 263 THR n 
1 264 GLU n 
1 265 LEU n 
1 266 ILE n 
1 267 ALA n 
1 268 CYS n 
1 269 LEU n 
1 270 ARG n 
1 271 THR n 
1 272 ARG n 
1 273 PRO n 
1 274 ALA n 
1 275 GLN n 
1 276 ASP n 
1 277 LEU n 
1 278 VAL n 
1 279 ASP n 
1 280 HIS n 
1 281 GLU n 
1 282 TRP n 
1 283 HIS n 
1 284 VAL n 
1 285 LEU n 
1 286 PRO n 
1 287 GLN n 
1 288 GLU n 
1 289 SER n 
1 290 ILE n 
1 291 PHE n 
1 292 ARG n 
1 293 PHE n 
1 294 SER n 
1 295 PHE n 
1 296 VAL n 
1 297 PRO n 
1 298 VAL n 
1 299 VAL n 
1 300 ASP n 
1 301 GLY n 
1 302 ASP n 
1 303 PHE n 
1 304 LEU n 
1 305 SER n 
1 306 ASP n 
1 307 THR n 
1 308 PRO n 
1 309 GLU n 
1 310 ALA n 
1 311 LEU n 
1 312 ILE n 
1 313 ASN n 
1 314 THR n 
1 315 GLY n 
1 316 ASP n 
1 317 PHE n 
1 318 GLN n 
1 319 ASP n 
1 320 LEU n 
1 321 GLN n 
1 322 VAL n 
1 323 LEU n 
1 324 VAL n 
1 325 GLY n 
1 326 VAL n 
1 327 VAL n 
1 328 LYS n 
1 329 ASP n 
1 330 GLU n 
1 331 GLY n 
1 332 SER n 
1 333 TYR n 
1 334 PHE n 
1 335 LEU n 
1 336 VAL n 
1 337 TYR n 
1 338 GLY n 
1 339 VAL n 
1 340 PRO n 
1 341 GLY n 
1 342 PHE n 
1 343 SER n 
1 344 LYS n 
1 345 ASP n 
1 346 ASN n 
1 347 GLU n 
1 348 SER n 
1 349 LEU n 
1 350 ILE n 
1 351 SER n 
1 352 ARG n 
1 353 ALA n 
1 354 GLN n 
1 355 PHE n 
1 356 LEU n 
1 357 ALA n 
1 358 GLY n 
1 359 VAL n 
1 360 ARG n 
1 361 ILE n 
1 362 GLY n 
1 363 VAL n 
1 364 PRO n 
1 365 GLN n 
1 366 ALA n 
1 367 SER n 
1 368 ASP n 
1 369 LEU n 
1 370 ALA n 
1 371 ALA n 
1 372 GLU n 
1 373 ALA n 
1 374 VAL n 
1 375 VAL n 
1 376 LEU n 
1 377 HIS n 
1 378 TYR n 
1 379 THR n 
1 380 ASP n 
1 381 TRP n 
1 382 LEU n 
1 383 HIS n 
1 384 PRO n 
1 385 GLU n 
1 386 ASP n 
1 387 PRO n 
1 388 THR n 
1 389 HIS n 
1 390 LEU n 
1 391 ARG n 
1 392 ASP n 
1 393 ALA n 
1 394 MET n 
1 395 SER n 
1 396 ALA n 
1 397 VAL n 
1 398 VAL n 
1 399 GLY n 
1 400 ASP n 
1 401 HIS n 
1 402 ASN n 
1 403 VAL n 
1 404 VAL n 
1 405 CYS n 
1 406 PRO n 
1 407 VAL n 
1 408 ALA n 
1 409 GLN n 
1 410 LEU n 
1 411 ALA n 
1 412 GLY n 
1 413 ARG n 
1 414 LEU n 
1 415 ALA n 
1 416 ALA n 
1 417 GLN n 
1 418 GLY n 
1 419 ALA n 
1 420 ARG n 
1 421 VAL n 
1 422 TYR n 
1 423 ALA n 
1 424 TYR n 
1 425 ILE n 
1 426 PHE n 
1 427 GLU n 
1 428 HIS n 
1 429 ARG n 
1 430 ALA n 
1 431 SER n 
1 432 THR n 
1 433 LEU n 
1 434 THR n 
1 435 TRP n 
1 436 PRO n 
1 437 LEU n 
1 438 TRP n 
1 439 MET n 
1 440 GLY n 
1 441 VAL n 
1 442 PRO n 
1 443 HIS n 
1 444 GLY n 
1 445 TYR n 
1 446 GLU n 
1 447 ILE n 
1 448 GLU n 
1 449 PHE n 
1 450 ILE n 
1 451 PHE n 
1 452 GLY n 
1 453 LEU n 
1 454 PRO n 
1 455 LEU n 
1 456 ASP n 
1 457 PRO n 
1 458 SER n 
1 459 LEU n 
1 460 ASN n 
1 461 TYR n 
1 462 THR n 
1 463 THR n 
1 464 GLU n 
1 465 GLU n 
1 466 ARG n 
1 467 ILE n 
1 468 PHE n 
1 469 ALA n 
1 470 GLN n 
1 471 ARG n 
1 472 LEU n 
1 473 MET n 
1 474 LYS n 
1 475 TYR n 
1 476 TRP n 
1 477 THR n 
1 478 ASN n 
1 479 PHE n 
1 480 ALA n 
1 481 ARG n 
1 482 THR n 
1 483 GLY n 
1 484 ASP n 
1 485 PRO n 
1 486 ASN n 
1 487 ASP n 
1 488 PRO n 
1 489 ARG n 
1 490 ASP n 
1 491 SER n 
1 492 LYS n 
1 493 SER n 
1 494 PRO n 
1 495 GLN n 
1 496 TRP n 
1 497 PRO n 
1 498 PRO n 
1 499 TYR n 
1 500 THR n 
1 501 THR n 
1 502 ALA n 
1 503 ALA n 
1 504 GLN n 
1 505 GLN n 
1 506 TYR n 
1 507 VAL n 
1 508 SER n 
1 509 LEU n 
1 510 ASN n 
1 511 LEU n 
1 512 LYS n 
1 513 PRO n 
1 514 LEU n 
1 515 GLU n 
1 516 VAL n 
1 517 ARG n 
1 518 ARG n 
1 519 GLY n 
1 520 LEU n 
1 521 ARG n 
1 522 ALA n 
1 523 GLN n 
1 524 THR n 
1 525 CYS n 
1 526 ALA n 
1 527 PHE n 
1 528 TRP n 
1 529 ASN n 
1 530 ARG n 
1 531 PHE n 
1 532 LEU n 
1 533 PRO n 
1 534 LYS n 
1 535 LEU n 
1 536 LEU n 
1 537 SER n 
1 538 ALA n 
1 539 THR n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'electric eel' 
_entity_src_nat.pdbx_organism_scientific   'Electrophorus electricus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      8005 
_entity_src_nat.genus                      Electrophorus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    'ELECTRIC ORGAN' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           36 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1C2O A 1 ? 539 ? P21836 36 ? 574 ? 5 543 
2 1 1C2O B 1 ? 539 ? P21836 36 ? 574 ? 5 543 
3 1 1C2O C 1 ? 539 ? P21836 36 ? 574 ? 5 543 
4 1 1C2O D 1 ? 539 ? P21836 36 ? 574 ? 5 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1C2O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.49 
_exptl_crystal.density_percent_sol   77.61 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    '1.4 M ammonium sulfate, VAPOR DIFFUSION, temperature 298K, pH 5.5' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-06-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1C2O 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             12 
_reflns.d_resolution_high            4.2 
_reflns.number_obs                   24590 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         66 
_reflns.pdbx_Rmerge_I_obs            0.18 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1C2O 
_refine.ls_number_reflns_obs                     24590 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             12.0 
_refine.ls_d_res_high                            4.2 
_refine.ls_percent_reflns_obs                    66 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.375 
_refine.ls_R_factor_R_free                       0.385 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16688 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               16688 
_refine_hist.d_res_high                       4.2 
_refine_hist.d_res_low                        12.0 
# 
_struct.entry_id                  1C2O 
_struct.title                     'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
_struct.pdbx_descriptor           ACETYLCHOLINESTERASE 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1C2O 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'SERINE HYDROLASE, ALPHA/BETA HYDROLASE, TETRAMER, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   VAL A 38  ? ARG A 42  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P2   2   PHE A 76  ? MET A 81  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P3   3   LEU A 126 ? ASP A 130 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P4   4   GLY A 131 ? VAL A 137 ? GLY A 135 VAL A 141 1 ? 7  
HELX_P HELX_P5   5   VAL A 149 ? LEU A 155 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P6   6   ASN A 166 ? ILE A 183 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P7   7   ALA A 184 ? PHE A 186 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P8   8   SER A 199 ? SER A 211 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P9   9   SER A 214 ? PHE A 218 ? SER A 218 PHE A 222 5 ? 5  
HELX_P HELX_P10  10  SER A 236 ? VAL A 251 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P11  11  ASN A 261 ? ARG A 270 ? ASN A 265 ARG A 274 1 ? 10 
HELX_P HELX_P12  12  PRO A 273 ? GLU A 281 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P13  13  TRP A 282 ? VAL A 284 ? TRP A 286 VAL A 288 5 ? 3  
HELX_P HELX_P14  14  THR A 307 ? GLY A 315 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P15  15  GLY A 331 ? TYR A 337 ? GLY A 335 TYR A 341 1 ? 7  
HELX_P HELX_P16  16  SER A 351 ? VAL A 363 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P17  17  SER A 367 ? THR A 379 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P18  18  ASP A 386 ? VAL A 403 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P19  19  VAL A 403 ? GLN A 417 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P20  20  PRO A 436 ? GLY A 440 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P21  21  GLU A 446 ? GLY A 452 ? GLU A 450 GLY A 456 1 ? 7  
HELX_P HELX_P22  22  LEU A 453 ? ASP A 456 ? LEU A 457 ASP A 460 5 ? 4  
HELX_P HELX_P23  23  THR A 462 ? THR A 482 ? THR A 466 THR A 486 1 ? 21 
HELX_P HELX_P24  24  ARG A 521 ? ARG A 530 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P25  25  ARG A 530 ? SER A 537 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P26  26  VAL B 38  ? ARG B 42  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P27  27  PHE B 76  ? MET B 81  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P28  28  LEU B 126 ? ASP B 130 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P29  29  GLY B 131 ? VAL B 137 ? GLY B 135 VAL B 141 1 ? 7  
HELX_P HELX_P30  30  VAL B 149 ? LEU B 155 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P31  31  ASN B 166 ? ILE B 183 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P32  32  ALA B 184 ? PHE B 186 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P33  33  SER B 199 ? SER B 211 ? SER B 203 SER B 215 1 ? 13 
HELX_P HELX_P34  34  SER B 214 ? PHE B 218 ? SER B 218 PHE B 222 5 ? 5  
HELX_P HELX_P35  35  SER B 236 ? VAL B 251 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P36  36  ASN B 261 ? ARG B 270 ? ASN B 265 ARG B 274 1 ? 10 
HELX_P HELX_P37  37  PRO B 273 ? GLU B 281 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P38  38  TRP B 282 ? VAL B 284 ? TRP B 286 VAL B 288 5 ? 3  
HELX_P HELX_P39  39  THR B 307 ? GLY B 315 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P40  40  GLY B 331 ? TYR B 337 ? GLY B 335 TYR B 341 1 ? 7  
HELX_P HELX_P41  41  SER B 351 ? VAL B 363 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P42  42  SER B 367 ? THR B 379 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P43  43  ASP B 386 ? VAL B 403 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P44  44  VAL B 403 ? GLN B 417 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P45  45  PRO B 436 ? GLY B 440 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P46  46  GLU B 446 ? GLY B 452 ? GLU B 450 GLY B 456 1 ? 7  
HELX_P HELX_P47  47  LEU B 453 ? ASP B 456 ? LEU B 457 ASP B 460 5 ? 4  
HELX_P HELX_P48  48  THR B 462 ? THR B 482 ? THR B 466 THR B 486 1 ? 21 
HELX_P HELX_P49  49  ARG B 521 ? ARG B 530 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P50  50  ARG B 530 ? SER B 537 ? ARG B 534 SER B 541 1 ? 8  
HELX_P HELX_P51  51  VAL C 38  ? ARG C 42  ? VAL C 42  ARG C 46  5 ? 5  
HELX_P HELX_P52  52  PHE C 76  ? MET C 81  ? PHE C 80  MET C 85  1 ? 6  
HELX_P HELX_P53  53  LEU C 126 ? ASP C 130 ? LEU C 130 ASP C 134 5 ? 5  
HELX_P HELX_P54  54  GLY C 131 ? VAL C 137 ? GLY C 135 VAL C 141 1 ? 7  
HELX_P HELX_P55  55  VAL C 149 ? LEU C 155 ? VAL C 153 LEU C 159 1 ? 7  
HELX_P HELX_P56  56  ASN C 166 ? ILE C 183 ? ASN C 170 ILE C 187 1 ? 18 
HELX_P HELX_P57  57  ALA C 184 ? PHE C 186 ? ALA C 188 PHE C 190 5 ? 3  
HELX_P HELX_P58  58  SER C 199 ? SER C 211 ? SER C 203 SER C 215 1 ? 13 
HELX_P HELX_P59  59  SER C 214 ? PHE C 218 ? SER C 218 PHE C 222 5 ? 5  
HELX_P HELX_P60  60  SER C 236 ? VAL C 251 ? SER C 240 VAL C 255 1 ? 16 
HELX_P HELX_P61  61  ASN C 261 ? ARG C 270 ? ASN C 265 ARG C 274 1 ? 10 
HELX_P HELX_P62  62  PRO C 273 ? GLU C 281 ? PRO C 277 GLU C 285 1 ? 9  
HELX_P HELX_P63  63  TRP C 282 ? VAL C 284 ? TRP C 286 VAL C 288 5 ? 3  
HELX_P HELX_P64  64  THR C 307 ? GLY C 315 ? THR C 311 GLY C 319 1 ? 9  
HELX_P HELX_P65  65  GLY C 331 ? TYR C 337 ? GLY C 335 TYR C 341 1 ? 7  
HELX_P HELX_P66  66  SER C 351 ? VAL C 363 ? SER C 355 VAL C 367 1 ? 13 
HELX_P HELX_P67  67  SER C 367 ? THR C 379 ? SER C 371 THR C 383 1 ? 13 
HELX_P HELX_P68  68  ASP C 386 ? VAL C 403 ? ASP C 390 VAL C 407 1 ? 18 
HELX_P HELX_P69  69  VAL C 403 ? GLN C 417 ? VAL C 407 GLN C 421 1 ? 15 
HELX_P HELX_P70  70  PRO C 436 ? GLY C 440 ? PRO C 440 GLY C 444 5 ? 5  
HELX_P HELX_P71  71  GLU C 446 ? GLY C 452 ? GLU C 450 GLY C 456 1 ? 7  
HELX_P HELX_P72  72  LEU C 453 ? ASP C 456 ? LEU C 457 ASP C 460 5 ? 4  
HELX_P HELX_P73  73  THR C 462 ? THR C 482 ? THR C 466 THR C 486 1 ? 21 
HELX_P HELX_P74  74  ARG C 521 ? ARG C 530 ? ARG C 525 ARG C 534 1 ? 10 
HELX_P HELX_P75  75  ARG C 530 ? SER C 537 ? ARG C 534 SER C 541 1 ? 8  
HELX_P HELX_P76  76  VAL D 38  ? ARG D 42  ? VAL D 42  ARG D 46  5 ? 5  
HELX_P HELX_P77  77  PHE D 76  ? MET D 81  ? PHE D 80  MET D 85  1 ? 6  
HELX_P HELX_P78  78  LEU D 126 ? ASP D 130 ? LEU D 130 ASP D 134 5 ? 5  
HELX_P HELX_P79  79  GLY D 131 ? VAL D 137 ? GLY D 135 VAL D 141 1 ? 7  
HELX_P HELX_P80  80  VAL D 149 ? LEU D 155 ? VAL D 153 LEU D 159 1 ? 7  
HELX_P HELX_P81  81  ASN D 166 ? ILE D 183 ? ASN D 170 ILE D 187 1 ? 18 
HELX_P HELX_P82  82  ALA D 184 ? PHE D 186 ? ALA D 188 PHE D 190 5 ? 3  
HELX_P HELX_P83  83  SER D 199 ? SER D 211 ? SER D 203 SER D 215 1 ? 13 
HELX_P HELX_P84  84  SER D 214 ? PHE D 218 ? SER D 218 PHE D 222 5 ? 5  
HELX_P HELX_P85  85  SER D 236 ? VAL D 251 ? SER D 240 VAL D 255 1 ? 16 
HELX_P HELX_P86  86  ASN D 261 ? ARG D 270 ? ASN D 265 ARG D 274 1 ? 10 
HELX_P HELX_P87  87  PRO D 273 ? GLU D 281 ? PRO D 277 GLU D 285 1 ? 9  
HELX_P HELX_P88  88  TRP D 282 ? VAL D 284 ? TRP D 286 VAL D 288 5 ? 3  
HELX_P HELX_P89  89  THR D 307 ? GLY D 315 ? THR D 311 GLY D 319 1 ? 9  
HELX_P HELX_P90  90  GLY D 331 ? TYR D 337 ? GLY D 335 TYR D 341 1 ? 7  
HELX_P HELX_P91  91  SER D 351 ? VAL D 363 ? SER D 355 VAL D 367 1 ? 13 
HELX_P HELX_P92  92  SER D 367 ? THR D 379 ? SER D 371 THR D 383 1 ? 13 
HELX_P HELX_P93  93  ASP D 386 ? VAL D 403 ? ASP D 390 VAL D 407 1 ? 18 
HELX_P HELX_P94  94  VAL D 403 ? GLN D 417 ? VAL D 407 GLN D 421 1 ? 15 
HELX_P HELX_P95  95  PRO D 436 ? GLY D 440 ? PRO D 440 GLY D 444 5 ? 5  
HELX_P HELX_P96  96  GLU D 446 ? GLY D 452 ? GLU D 450 GLY D 456 1 ? 7  
HELX_P HELX_P97  97  LEU D 453 ? ASP D 456 ? LEU D 457 ASP D 460 5 ? 4  
HELX_P HELX_P98  98  THR D 462 ? THR D 482 ? THR D 466 THR D 486 1 ? 21 
HELX_P HELX_P99  99  ARG D 521 ? ARG D 530 ? ARG D 525 ARG D 534 1 ? 10 
HELX_P HELX_P100 100 ARG D 530 ? SER D 537 ? ARG D 534 SER D 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 65  SG ? ? ? 1_555 A CYS 92  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.011 ? 
disulf2  disulf ? ? A CYS 253 SG ? ? ? 1_555 A CYS 268 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.011 ? 
disulf3  disulf ? ? A CYS 405 SG ? ? ? 1_555 A CYS 525 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.067 ? 
disulf4  disulf ? ? B CYS 65  SG ? ? ? 1_555 B CYS 92  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.012 ? 
disulf5  disulf ? ? B CYS 253 SG ? ? ? 1_555 B CYS 268 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.013 ? 
disulf6  disulf ? ? B CYS 405 SG ? ? ? 1_555 B CYS 525 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf7  disulf ? ? C CYS 65  SG ? ? ? 1_555 C CYS 92  SG ? ? C CYS 69  C CYS 96  1_555 ? ? ? ? ? ? ? 2.012 ? 
disulf8  disulf ? ? C CYS 253 SG ? ? ? 1_555 C CYS 268 SG ? ? C CYS 257 C CYS 272 1_555 ? ? ? ? ? ? ? 2.012 ? 
disulf9  disulf ? ? C CYS 405 SG ? ? ? 1_555 C CYS 525 SG ? ? C CYS 409 C CYS 529 1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf10 disulf ? ? D CYS 65  SG ? ? ? 1_555 D CYS 92  SG ? ? D CYS 69  D CYS 96  1_555 ? ? ? ? ? ? ? 2.013 ? 
disulf11 disulf ? ? D CYS 253 SG ? ? ? 1_555 D CYS 268 SG ? ? D CYS 257 D CYS 272 1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf12 disulf ? ? D CYS 405 SG ? ? ? 1_555 D CYS 525 SG ? ? D CYS 409 D CYS 529 1_555 ? ? ? ? ? ? ? 2.068 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 101 A . ? TYR 105 A PRO 102 A ? PRO 106 A 1 5.67  
2 CYS 253 A . ? CYS 257 A PRO 254 A ? PRO 258 A 1 -9.87 
3 TYR 101 B . ? TYR 105 B PRO 102 B ? PRO 106 B 1 5.84  
4 CYS 253 B . ? CYS 257 B PRO 254 B ? PRO 258 B 1 -9.89 
5 TYR 101 C . ? TYR 105 C PRO 102 C ? PRO 106 C 1 5.74  
6 CYS 253 C . ? CYS 257 C PRO 254 C ? PRO 258 C 1 -9.84 
7 TYR 101 D . ? TYR 105 D PRO 102 D ? PRO 106 D 1 5.67  
8 CYS 253 D . ? CYS 257 D PRO 254 D ? PRO 258 D 1 -9.94 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 2  ? 
C ? 9  ? 
D ? 10 ? 
E ? 3  ? 
F ? 2  ? 
G ? 9  ? 
H ? 10 ? 
I ? 3  ? 
J ? 2  ? 
K ? 9  ? 
L ? 10 ? 
M ? 3  ? 
N ? 2  ? 
O ? 9  ? 
P ? 10 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? parallel      
B 1 2  ? anti-parallel 
C 1 2  ? anti-parallel 
C 2 3  ? anti-parallel 
C 3 4  ? anti-parallel 
C 4 5  ? parallel      
C 5 6  ? parallel      
C 6 7  ? parallel      
C 7 8  ? parallel      
C 8 9  ? parallel      
D 1 2  ? anti-parallel 
D 2 3  ? anti-parallel 
D 3 4  ? parallel      
D 4 5  ? parallel      
D 5 6  ? parallel      
D 6 7  ? parallel      
D 7 8  ? parallel      
D 8 9  ? parallel      
D 9 10 ? anti-parallel 
E 1 2  ? anti-parallel 
E 2 3  ? parallel      
F 1 2  ? anti-parallel 
G 1 2  ? anti-parallel 
G 2 3  ? anti-parallel 
G 3 4  ? anti-parallel 
G 4 5  ? parallel      
G 5 6  ? parallel      
G 6 7  ? parallel      
G 7 8  ? parallel      
G 8 9  ? parallel      
H 1 2  ? anti-parallel 
H 2 3  ? anti-parallel 
H 3 4  ? parallel      
H 4 5  ? parallel      
H 5 6  ? parallel      
H 6 7  ? parallel      
H 7 8  ? parallel      
H 8 9  ? parallel      
H 9 10 ? anti-parallel 
I 1 2  ? anti-parallel 
I 2 3  ? parallel      
J 1 2  ? anti-parallel 
K 1 2  ? anti-parallel 
K 2 3  ? anti-parallel 
K 3 4  ? anti-parallel 
K 4 5  ? parallel      
K 5 6  ? parallel      
K 6 7  ? parallel      
K 7 8  ? parallel      
K 8 9  ? parallel      
L 1 2  ? anti-parallel 
L 2 3  ? anti-parallel 
L 3 4  ? parallel      
L 4 5  ? parallel      
L 5 6  ? parallel      
L 6 7  ? parallel      
L 7 8  ? parallel      
L 8 9  ? parallel      
L 9 10 ? anti-parallel 
M 1 2  ? anti-parallel 
M 2 3  ? parallel      
N 1 2  ? anti-parallel 
O 1 2  ? anti-parallel 
O 2 3  ? anti-parallel 
O 3 4  ? anti-parallel 
O 4 5  ? parallel      
O 5 6  ? parallel      
O 6 7  ? parallel      
O 7 8  ? parallel      
O 8 9  ? parallel      
P 1 2  ? anti-parallel 
P 2 3  ? anti-parallel 
P 3 4  ? parallel      
P 4 5  ? parallel      
P 5 6  ? parallel      
P 6 7  ? parallel      
P 7 8  ? parallel      
P 8 9  ? parallel      
P 9 10 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 5   ? VAL A 8   ? LEU A 9   VAL A 12  
A 2  GLY A 11  ? ARG A 14  ? GLY A 15  ARG A 18  
A 3  VAL A 55  ? ASP A 57  ? VAL A 59  ASP A 61  
B 1  ALA A 34  ? GLU A 35  ? ALA A 38  GLU A 39  
B 2  GLU A 47  ? PRO A 48  ? GLU A 51  PRO A 52  
C 1  ILE A 16  ? ALA A 20  ? ILE A 20  ALA A 24  
C 2  GLY A 23  ? ALA A 27  ? GLY A 27  ALA A 31  
C 3  TYR A 94  ? PRO A 100 ? TYR A 98  PRO A 104 
C 4  VAL A 141 ? MET A 145 ? VAL A 145 MET A 149 
C 5  THR A 108 ? ILE A 114 ? THR A 112 ILE A 118 
C 6  GLY A 188 ? GLU A 198 ? GLY A 192 GLU A 202 
C 7  ARG A 220 ? GLN A 224 ? ARG A 224 GLN A 228 
C 8  GLN A 321 ? VAL A 327 ? GLN A 325 VAL A 331 
C 9  ARG A 420 ? TYR A 422 ? ARG A 424 TYR A 426 
D 1  ILE A 31  ? PRO A 32  ? ILE A 35  PRO A 36  
D 2  TYR A 94  ? PRO A 100 ? TYR A 98  PRO A 104 
D 3  VAL A 141 ? MET A 145 ? VAL A 145 MET A 149 
D 4  THR A 108 ? ILE A 114 ? THR A 112 ILE A 118 
D 5  GLY A 188 ? GLU A 198 ? GLY A 192 GLU A 202 
D 6  ARG A 220 ? GLN A 224 ? ARG A 224 GLN A 228 
D 7  GLN A 321 ? VAL A 327 ? GLN A 325 VAL A 331 
D 8  TYR A 424 ? PHE A 426 ? TYR A 428 PHE A 430 
D 9  GLN A 505 ? LEU A 509 ? GLN A 509 LEU A 513 
D 10 ARG A 517 ? ARG A 518 ? ARG A 521 ARG A 522 
E 1  LEU B 5   ? VAL B 8   ? LEU B 9   VAL B 12  
E 2  GLY B 11  ? ARG B 14  ? GLY B 15  ARG B 18  
E 3  VAL B 55  ? ASP B 57  ? VAL B 59  ASP B 61  
F 1  ALA B 34  ? GLU B 35  ? ALA B 38  GLU B 39  
F 2  GLU B 47  ? PRO B 48  ? GLU B 51  PRO B 52  
G 1  ILE B 16  ? ALA B 20  ? ILE B 20  ALA B 24  
G 2  GLY B 23  ? ALA B 27  ? GLY B 27  ALA B 31  
G 3  TYR B 94  ? PRO B 100 ? TYR B 98  PRO B 104 
G 4  VAL B 141 ? MET B 145 ? VAL B 145 MET B 149 
G 5  THR B 108 ? ILE B 114 ? THR B 112 ILE B 118 
G 6  GLY B 188 ? GLU B 198 ? GLY B 192 GLU B 202 
G 7  ARG B 220 ? GLN B 224 ? ARG B 224 GLN B 228 
G 8  GLN B 321 ? VAL B 327 ? GLN B 325 VAL B 331 
G 9  ARG B 420 ? TYR B 422 ? ARG B 424 TYR B 426 
H 1  ILE B 31  ? PRO B 32  ? ILE B 35  PRO B 36  
H 2  TYR B 94  ? PRO B 100 ? TYR B 98  PRO B 104 
H 3  VAL B 141 ? MET B 145 ? VAL B 145 MET B 149 
H 4  THR B 108 ? ILE B 114 ? THR B 112 ILE B 118 
H 5  GLY B 188 ? GLU B 198 ? GLY B 192 GLU B 202 
H 6  ARG B 220 ? GLN B 224 ? ARG B 224 GLN B 228 
H 7  GLN B 321 ? VAL B 327 ? GLN B 325 VAL B 331 
H 8  TYR B 424 ? PHE B 426 ? TYR B 428 PHE B 430 
H 9  GLN B 505 ? LEU B 509 ? GLN B 509 LEU B 513 
H 10 ARG B 517 ? ARG B 518 ? ARG B 521 ARG B 522 
I 1  LEU C 5   ? VAL C 8   ? LEU C 9   VAL C 12  
I 2  GLY C 11  ? ARG C 14  ? GLY C 15  ARG C 18  
I 3  VAL C 55  ? ASP C 57  ? VAL C 59  ASP C 61  
J 1  ALA C 34  ? GLU C 35  ? ALA C 38  GLU C 39  
J 2  GLU C 47  ? PRO C 48  ? GLU C 51  PRO C 52  
K 1  ILE C 16  ? ALA C 20  ? ILE C 20  ALA C 24  
K 2  GLY C 23  ? ALA C 27  ? GLY C 27  ALA C 31  
K 3  TYR C 94  ? PRO C 100 ? TYR C 98  PRO C 104 
K 4  VAL C 141 ? MET C 145 ? VAL C 145 MET C 149 
K 5  THR C 108 ? ILE C 114 ? THR C 112 ILE C 118 
K 6  GLY C 188 ? GLU C 198 ? GLY C 192 GLU C 202 
K 7  ARG C 220 ? GLN C 224 ? ARG C 224 GLN C 228 
K 8  GLN C 321 ? VAL C 327 ? GLN C 325 VAL C 331 
K 9  ARG C 420 ? TYR C 422 ? ARG C 424 TYR C 426 
L 1  ILE C 31  ? PRO C 32  ? ILE C 35  PRO C 36  
L 2  TYR C 94  ? PRO C 100 ? TYR C 98  PRO C 104 
L 3  VAL C 141 ? MET C 145 ? VAL C 145 MET C 149 
L 4  THR C 108 ? ILE C 114 ? THR C 112 ILE C 118 
L 5  GLY C 188 ? GLU C 198 ? GLY C 192 GLU C 202 
L 6  ARG C 220 ? GLN C 224 ? ARG C 224 GLN C 228 
L 7  GLN C 321 ? VAL C 327 ? GLN C 325 VAL C 331 
L 8  TYR C 424 ? PHE C 426 ? TYR C 428 PHE C 430 
L 9  GLN C 505 ? LEU C 509 ? GLN C 509 LEU C 513 
L 10 ARG C 517 ? ARG C 518 ? ARG C 521 ARG C 522 
M 1  LEU D 5   ? VAL D 8   ? LEU D 9   VAL D 12  
M 2  GLY D 11  ? ARG D 14  ? GLY D 15  ARG D 18  
M 3  VAL D 55  ? ASP D 57  ? VAL D 59  ASP D 61  
N 1  ALA D 34  ? GLU D 35  ? ALA D 38  GLU D 39  
N 2  GLU D 47  ? PRO D 48  ? GLU D 51  PRO D 52  
O 1  ILE D 16  ? ALA D 20  ? ILE D 20  ALA D 24  
O 2  GLY D 23  ? ALA D 27  ? GLY D 27  ALA D 31  
O 3  TYR D 94  ? PRO D 100 ? TYR D 98  PRO D 104 
O 4  VAL D 141 ? MET D 145 ? VAL D 145 MET D 149 
O 5  THR D 108 ? ILE D 114 ? THR D 112 ILE D 118 
O 6  GLY D 188 ? GLU D 198 ? GLY D 192 GLU D 202 
O 7  ARG D 220 ? GLN D 224 ? ARG D 224 GLN D 228 
O 8  GLN D 321 ? VAL D 327 ? GLN D 325 VAL D 331 
O 9  ARG D 420 ? TYR D 422 ? ARG D 424 TYR D 426 
P 1  ILE D 31  ? PRO D 32  ? ILE D 35  PRO D 36  
P 2  TYR D 94  ? PRO D 100 ? TYR D 98  PRO D 104 
P 3  VAL D 141 ? MET D 145 ? VAL D 145 MET D 149 
P 4  THR D 108 ? ILE D 114 ? THR D 112 ILE D 118 
P 5  GLY D 188 ? GLU D 198 ? GLY D 192 GLU D 202 
P 6  ARG D 220 ? GLN D 224 ? ARG D 224 GLN D 228 
P 7  GLN D 321 ? VAL D 327 ? GLN D 325 VAL D 331 
P 8  TYR D 424 ? PHE D 426 ? TYR D 428 PHE D 430 
P 9  GLN D 505 ? LEU D 509 ? GLN D 509 LEU D 513 
P 10 ARG D 517 ? ARG D 518 ? ARG D 521 ARG D 522 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  N VAL A 8   ? N VAL A 12  O GLY A 11  ? O GLY A 15  
A 2 3  O GLN A 12  ? O GLN A 16  N LEU A 56  ? N LEU A 60  
B 1 2  N GLU A 35  ? N GLU A 39  O GLU A 47  ? O GLU A 51  
C 1 2  O ALA A 20  ? O ALA A 24  N GLY A 23  ? N GLY A 27  
C 2 3  N SER A 26  ? N SER A 30  O THR A 99  ? O THR A 103 
C 3 4  N TRP A 98  ? N TRP A 102 O LEU A 142 ? O LEU A 146 
C 4 5  N VAL A 141 ? N VAL A 145 O PRO A 109 ? O PRO A 113 
C 5 6  O THR A 108 ? O THR A 112 N ASP A 189 ? N ASP A 193 
C 6 7  O VAL A 193 ? O VAL A 197 N ARG A 220 ? N ARG A 224 
C 7 8  N ALA A 221 ? N ALA A 225 O GLN A 321 ? O GLN A 325 
C 8 9  N VAL A 322 ? N VAL A 326 O ARG A 420 ? O ARG A 424 
D 1 2  N ILE A 31  ? N ILE A 35  O LEU A 95  ? O LEU A 99  
D 2 3  N TRP A 98  ? N TRP A 102 O LEU A 142 ? O LEU A 146 
D 3 4  N VAL A 141 ? N VAL A 145 O PRO A 109 ? O PRO A 113 
D 4 5  O THR A 108 ? O THR A 112 N ASP A 189 ? N ASP A 193 
D 5 6  O VAL A 193 ? O VAL A 197 N ARG A 220 ? N ARG A 224 
D 6 7  N ALA A 221 ? N ALA A 225 O GLN A 321 ? O GLN A 325 
D 7 8  N VAL A 326 ? N VAL A 330 O TYR A 424 ? O TYR A 428 
D 8 9  N ILE A 425 ? N ILE A 429 O VAL A 507 ? O VAL A 511 
D 9 10 O TYR A 506 ? O TYR A 510 N ARG A 517 ? N ARG A 521 
E 1 2  N VAL B 8   ? N VAL B 12  O GLY B 11  ? O GLY B 15  
E 2 3  O GLN B 12  ? O GLN B 16  N LEU B 56  ? N LEU B 60  
F 1 2  N GLU B 35  ? N GLU B 39  O GLU B 47  ? O GLU B 51  
G 1 2  O ALA B 20  ? O ALA B 24  N GLY B 23  ? N GLY B 27  
G 2 3  N SER B 26  ? N SER B 30  O THR B 99  ? O THR B 103 
G 3 4  N TRP B 98  ? N TRP B 102 O LEU B 142 ? O LEU B 146 
G 4 5  N VAL B 141 ? N VAL B 145 O PRO B 109 ? O PRO B 113 
G 5 6  O THR B 108 ? O THR B 112 N ASP B 189 ? N ASP B 193 
G 6 7  O VAL B 193 ? O VAL B 197 N ARG B 220 ? N ARG B 224 
G 7 8  N ALA B 221 ? N ALA B 225 O GLN B 321 ? O GLN B 325 
G 8 9  N VAL B 322 ? N VAL B 326 O ARG B 420 ? O ARG B 424 
H 1 2  N ILE B 31  ? N ILE B 35  O LEU B 95  ? O LEU B 99  
H 2 3  N TRP B 98  ? N TRP B 102 O LEU B 142 ? O LEU B 146 
H 3 4  N VAL B 141 ? N VAL B 145 O PRO B 109 ? O PRO B 113 
H 4 5  O THR B 108 ? O THR B 112 N ASP B 189 ? N ASP B 193 
H 5 6  O VAL B 193 ? O VAL B 197 N ARG B 220 ? N ARG B 224 
H 6 7  N ALA B 221 ? N ALA B 225 O GLN B 321 ? O GLN B 325 
H 7 8  N VAL B 326 ? N VAL B 330 O TYR B 424 ? O TYR B 428 
H 8 9  N ILE B 425 ? N ILE B 429 O VAL B 507 ? O VAL B 511 
H 9 10 O TYR B 506 ? O TYR B 510 N ARG B 517 ? N ARG B 521 
I 1 2  N VAL C 8   ? N VAL C 12  O GLY C 11  ? O GLY C 15  
I 2 3  O GLN C 12  ? O GLN C 16  N LEU C 56  ? N LEU C 60  
J 1 2  N GLU C 35  ? N GLU C 39  O GLU C 47  ? O GLU C 51  
K 1 2  O ALA C 20  ? O ALA C 24  N GLY C 23  ? N GLY C 27  
K 2 3  N SER C 26  ? N SER C 30  O THR C 99  ? O THR C 103 
K 3 4  N TRP C 98  ? N TRP C 102 O LEU C 142 ? O LEU C 146 
K 4 5  N VAL C 141 ? N VAL C 145 O PRO C 109 ? O PRO C 113 
K 5 6  O THR C 108 ? O THR C 112 N ASP C 189 ? N ASP C 193 
K 6 7  O VAL C 193 ? O VAL C 197 N ARG C 220 ? N ARG C 224 
K 7 8  N ALA C 221 ? N ALA C 225 O GLN C 321 ? O GLN C 325 
K 8 9  N VAL C 322 ? N VAL C 326 O ARG C 420 ? O ARG C 424 
L 1 2  N ILE C 31  ? N ILE C 35  O LEU C 95  ? O LEU C 99  
L 2 3  N TRP C 98  ? N TRP C 102 O LEU C 142 ? O LEU C 146 
L 3 4  N VAL C 141 ? N VAL C 145 O PRO C 109 ? O PRO C 113 
L 4 5  O THR C 108 ? O THR C 112 N ASP C 189 ? N ASP C 193 
L 5 6  O VAL C 193 ? O VAL C 197 N ARG C 220 ? N ARG C 224 
L 6 7  N ALA C 221 ? N ALA C 225 O GLN C 321 ? O GLN C 325 
L 7 8  N VAL C 326 ? N VAL C 330 O TYR C 424 ? O TYR C 428 
L 8 9  N ILE C 425 ? N ILE C 429 O VAL C 507 ? O VAL C 511 
L 9 10 O TYR C 506 ? O TYR C 510 N ARG C 517 ? N ARG C 521 
M 1 2  N VAL D 8   ? N VAL D 12  O GLY D 11  ? O GLY D 15  
M 2 3  O GLN D 12  ? O GLN D 16  N LEU D 56  ? N LEU D 60  
N 1 2  N GLU D 35  ? N GLU D 39  O GLU D 47  ? O GLU D 51  
O 1 2  O ALA D 20  ? O ALA D 24  N GLY D 23  ? N GLY D 27  
O 2 3  N SER D 26  ? N SER D 30  O THR D 99  ? O THR D 103 
O 3 4  N TRP D 98  ? N TRP D 102 O LEU D 142 ? O LEU D 146 
O 4 5  N VAL D 141 ? N VAL D 145 O PRO D 109 ? O PRO D 113 
O 5 6  O THR D 108 ? O THR D 112 N ASP D 189 ? N ASP D 193 
O 6 7  O VAL D 193 ? O VAL D 197 N ARG D 220 ? N ARG D 224 
O 7 8  N ALA D 221 ? N ALA D 225 O GLN D 321 ? O GLN D 325 
O 8 9  N VAL D 322 ? N VAL D 326 O ARG D 420 ? O ARG D 424 
P 1 2  N ILE D 31  ? N ILE D 35  O LEU D 95  ? O LEU D 99  
P 2 3  N TRP D 98  ? N TRP D 102 O LEU D 142 ? O LEU D 146 
P 3 4  N VAL D 141 ? N VAL D 145 O PRO D 109 ? O PRO D 113 
P 4 5  O THR D 108 ? O THR D 112 N ASP D 189 ? N ASP D 193 
P 5 6  O VAL D 193 ? O VAL D 197 N ARG D 220 ? N ARG D 224 
P 6 7  N ALA D 221 ? N ALA D 225 O GLN D 321 ? O GLN D 325 
P 7 8  N VAL D 326 ? N VAL D 330 O TYR D 424 ? O TYR D 428 
P 8 9  N ILE D 425 ? N ILE D 429 O VAL D 507 ? O VAL D 511 
P 9 10 O TYR D 506 ? O TYR D 510 N ARG D 517 ? N ARG D 521 
# 
_database_PDB_matrix.entry_id          1C2O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1C2O 
_atom_sites.fract_transf_matrix[1][1]   0.004736 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001111 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007707 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005256 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . ASP A 1 1   ? 12.807  36.925  -85.472  1.00 40.00 ? 5   ASP A N   1 
ATOM 2     C CA  . ASP A 1 1   ? 14.023  36.575  -84.713  1.00 40.00 ? 5   ASP A CA  1 
ATOM 3     C C   . ASP A 1 1   ? 13.960  37.362  -83.421  1.00 40.00 ? 5   ASP A C   1 
ATOM 4     O O   . ASP A 1 1   ? 13.898  38.600  -83.447  1.00 40.00 ? 5   ASP A O   1 
ATOM 5     C CB  . ASP A 1 1   ? 15.241  36.915  -85.561  1.00 40.00 ? 5   ASP A CB  1 
ATOM 6     C CG  . ASP A 1 1   ? 16.544  36.553  -84.872  1.00 40.00 ? 5   ASP A CG  1 
ATOM 7     O OD1 . ASP A 1 1   ? 17.615  36.829  -85.455  1.00 40.00 ? 5   ASP A OD1 1 
ATOM 8     O OD2 . ASP A 1 1   ? 16.478  35.990  -83.755  1.00 40.00 ? 5   ASP A OD2 1 
ATOM 9     N N   . PRO A 1 2   ? 13.954  36.708  -82.269  1.00 40.00 ? 6   PRO A N   1 
ATOM 10    C CA  . PRO A 1 2   ? 13.848  37.396  -80.984  1.00 40.00 ? 6   PRO A CA  1 
ATOM 11    C C   . PRO A 1 2   ? 15.108  38.182  -80.683  1.00 40.00 ? 6   PRO A C   1 
ATOM 12    O O   . PRO A 1 2   ? 15.167  39.052  -79.818  1.00 40.00 ? 6   PRO A O   1 
ATOM 13    C CB  . PRO A 1 2   ? 13.653  36.276  -79.974  1.00 40.00 ? 6   PRO A CB  1 
ATOM 14    C CG  . PRO A 1 2   ? 14.332  35.106  -80.603  1.00 40.00 ? 6   PRO A CG  1 
ATOM 15    C CD  . PRO A 1 2   ? 14.045  35.246  -82.084  1.00 40.00 ? 6   PRO A CD  1 
ATOM 16    N N   . GLN A 1 3   ? 16.159  37.822  -81.438  1.00 40.00 ? 7   GLN A N   1 
ATOM 17    C CA  . GLN A 1 3   ? 17.435  38.511  -81.299  1.00 40.00 ? 7   GLN A CA  1 
ATOM 18    C C   . GLN A 1 3   ? 17.182  39.951  -81.747  1.00 40.00 ? 7   GLN A C   1 
ATOM 19    O O   . GLN A 1 3   ? 17.499  40.895  -81.036  1.00 40.00 ? 7   GLN A O   1 
ATOM 20    C CB  . GLN A 1 3   ? 18.507  37.843  -82.130  1.00 40.00 ? 7   GLN A CB  1 
ATOM 21    C CG  . GLN A 1 3   ? 19.014  36.508  -81.615  1.00 40.00 ? 7   GLN A CG  1 
ATOM 22    C CD  . GLN A 1 3   ? 19.538  36.545  -80.202  1.00 40.00 ? 7   GLN A CD  1 
ATOM 23    O OE1 . GLN A 1 3   ? 20.447  37.306  -79.864  1.00 40.00 ? 7   GLN A OE1 1 
ATOM 24    N NE2 . GLN A 1 3   ? 18.979  35.721  -79.319  1.00 40.00 ? 7   GLN A NE2 1 
ATOM 25    N N   . LEU A 1 4   ? 16.539  40.115  -82.898  1.00 40.00 ? 8   LEU A N   1 
ATOM 26    C CA  . LEU A 1 4   ? 16.255  41.441  -83.410  1.00 40.00 ? 8   LEU A CA  1 
ATOM 27    C C   . LEU A 1 4   ? 14.968  42.014  -82.872  1.00 40.00 ? 8   LEU A C   1 
ATOM 28    O O   . LEU A 1 4   ? 14.552  43.107  -83.306  1.00 40.00 ? 8   LEU A O   1 
ATOM 29    C CB  . LEU A 1 4   ? 16.274  41.355  -84.942  1.00 40.00 ? 8   LEU A CB  1 
ATOM 30    C CG  . LEU A 1 4   ? 17.386  40.548  -85.589  1.00 40.00 ? 8   LEU A CG  1 
ATOM 31    C CD1 . LEU A 1 4   ? 17.626  41.016  -87.021  1.00 40.00 ? 8   LEU A CD1 1 
ATOM 32    C CD2 . LEU A 1 4   ? 18.700  40.606  -84.824  1.00 40.00 ? 8   LEU A CD2 1 
ATOM 33    N N   . LEU A 1 5   ? 14.297  41.394  -81.919  1.00 40.00 ? 9   LEU A N   1 
ATOM 34    C CA  . LEU A 1 5   ? 13.012  42.004  -81.468  1.00 40.00 ? 9   LEU A CA  1 
ATOM 35    C C   . LEU A 1 5   ? 13.115  42.366  -80.012  1.00 40.00 ? 9   LEU A C   1 
ATOM 36    O O   . LEU A 1 5   ? 13.257  41.410  -79.226  1.00 40.00 ? 9   LEU A O   1 
ATOM 37    C CB  . LEU A 1 5   ? 11.915  40.964  -81.655  1.00 40.00 ? 9   LEU A CB  1 
ATOM 38    C CG  . LEU A 1 5   ? 10.574  41.261  -82.272  1.00 40.00 ? 9   LEU A CG  1 
ATOM 39    C CD1 . LEU A 1 5   ? 9.881   42.449  -81.608  1.00 40.00 ? 9   LEU A CD1 1 
ATOM 40    C CD2 . LEU A 1 5   ? 10.680  41.439  -83.784  1.00 40.00 ? 9   LEU A CD2 1 
ATOM 41    N N   . VAL A 1 6   ? 13.099  43.636  -79.609  1.00 40.00 ? 10  VAL A N   1 
ATOM 42    C CA  . VAL A 1 6   ? 13.277  43.841  -78.159  1.00 40.00 ? 10  VAL A CA  1 
ATOM 43    C C   . VAL A 1 6   ? 12.231  44.750  -77.562  1.00 40.00 ? 10  VAL A C   1 
ATOM 44    O O   . VAL A 1 6   ? 11.918  45.791  -78.178  1.00 40.00 ? 10  VAL A O   1 
ATOM 45    C CB  . VAL A 1 6   ? 14.654  44.456  -77.803  1.00 40.00 ? 10  VAL A CB  1 
ATOM 46    C CG1 . VAL A 1 6   ? 14.810  44.548  -76.286  1.00 40.00 ? 10  VAL A CG1 1 
ATOM 47    C CG2 . VAL A 1 6   ? 15.845  43.766  -78.420  1.00 40.00 ? 10  VAL A CG2 1 
ATOM 48    N N   . ARG A 1 7   ? 11.765  44.406  -76.364  1.00 40.00 ? 11  ARG A N   1 
ATOM 49    C CA  . ARG A 1 7   ? 10.779  45.325  -75.763  1.00 40.00 ? 11  ARG A CA  1 
ATOM 50    C C   . ARG A 1 7   ? 11.574  46.256  -74.836  1.00 40.00 ? 11  ARG A C   1 
ATOM 51    O O   . ARG A 1 7   ? 12.374  45.808  -74.021  1.00 40.00 ? 11  ARG A O   1 
ATOM 52    C CB  . ARG A 1 7   ? 9.609   44.678  -75.088  1.00 40.00 ? 11  ARG A CB  1 
ATOM 53    C CG  . ARG A 1 7   ? 8.985   45.414  -73.919  1.00 40.00 ? 11  ARG A CG  1 
ATOM 54    C CD  . ARG A 1 7   ? 8.066   46.519  -74.406  1.00 40.00 ? 11  ARG A CD  1 
ATOM 55    N NE  . ARG A 1 7   ? 6.671   46.160  -74.523  1.00 40.00 ? 11  ARG A NE  1 
ATOM 56    C CZ  . ARG A 1 7   ? 6.057   45.157  -75.117  1.00 40.00 ? 11  ARG A CZ  1 
ATOM 57    N NH1 . ARG A 1 7   ? 6.673   44.181  -75.781  1.00 40.00 ? 11  ARG A NH1 1 
ATOM 58    N NH2 . ARG A 1 7   ? 4.721   45.095  -75.053  1.00 40.00 ? 11  ARG A NH2 1 
ATOM 59    N N   . VAL A 1 8   ? 11.318  47.543  -75.061  1.00 40.00 ? 12  VAL A N   1 
ATOM 60    C CA  . VAL A 1 8   ? 11.986  48.584  -74.250  1.00 40.00 ? 12  VAL A CA  1 
ATOM 61    C C   . VAL A 1 8   ? 10.967  49.170  -73.314  1.00 40.00 ? 12  VAL A C   1 
ATOM 62    O O   . VAL A 1 8   ? 9.760   48.989  -73.534  1.00 40.00 ? 12  VAL A O   1 
ATOM 63    C CB  . VAL A 1 8   ? 12.625  49.591  -75.203  1.00 40.00 ? 12  VAL A CB  1 
ATOM 64    C CG1 . VAL A 1 8   ? 12.687  51.008  -74.689  1.00 40.00 ? 12  VAL A CG1 1 
ATOM 65    C CG2 . VAL A 1 8   ? 14.028  49.035  -75.500  1.00 40.00 ? 12  VAL A CG2 1 
ATOM 66    N N   . ARG A 1 9   ? 11.372  49.909  -72.308  1.00 40.00 ? 13  ARG A N   1 
ATOM 67    C CA  . ARG A 1 9   ? 10.488  50.501  -71.330  1.00 40.00 ? 13  ARG A CA  1 
ATOM 68    C C   . ARG A 1 9   ? 9.346   51.282  -71.921  1.00 40.00 ? 13  ARG A C   1 
ATOM 69    O O   . ARG A 1 9   ? 8.390   51.574  -71.178  1.00 40.00 ? 13  ARG A O   1 
ATOM 70    C CB  . ARG A 1 9   ? 11.263  51.404  -70.368  1.00 40.00 ? 13  ARG A CB  1 
ATOM 71    C CG  . ARG A 1 9   ? 10.567  51.715  -69.051  1.00 40.00 ? 13  ARG A CG  1 
ATOM 72    C CD  . ARG A 1 9   ? 11.594  52.033  -67.962  1.00 40.00 ? 13  ARG A CD  1 
ATOM 73    N NE  . ARG A 1 9   ? 11.058  52.653  -66.773  1.00 40.00 ? 13  ARG A NE  1 
ATOM 74    C CZ  . ARG A 1 9   ? 10.485  53.832  -66.584  1.00 40.00 ? 13  ARG A CZ  1 
ATOM 75    N NH1 . ARG A 1 9   ? 10.289  54.707  -67.566  1.00 40.00 ? 13  ARG A NH1 1 
ATOM 76    N NH2 . ARG A 1 9   ? 10.079  54.166  -65.349  1.00 40.00 ? 13  ARG A NH2 1 
ATOM 77    N N   . GLY A 1 10  ? 9.394   51.663  -73.203  1.00 40.00 ? 14  GLY A N   1 
ATOM 78    C CA  . GLY A 1 10  ? 8.340   52.398  -73.855  1.00 40.00 ? 14  GLY A CA  1 
ATOM 79    C C   . GLY A 1 10  ? 7.793   51.763  -75.123  1.00 40.00 ? 14  GLY A C   1 
ATOM 80    O O   . GLY A 1 10  ? 7.032   52.439  -75.877  1.00 40.00 ? 14  GLY A O   1 
ATOM 81    N N   . GLY A 1 11  ? 8.164   50.491  -75.387  1.00 40.00 ? 15  GLY A N   1 
ATOM 82    C CA  . GLY A 1 11  ? 7.621   49.894  -76.621  1.00 40.00 ? 15  GLY A CA  1 
ATOM 83    C C   . GLY A 1 11  ? 8.548   48.882  -77.249  1.00 40.00 ? 15  GLY A C   1 
ATOM 84    O O   . GLY A 1 11  ? 9.636   48.620  -76.728  1.00 40.00 ? 15  GLY A O   1 
ATOM 85    N N   . GLN A 1 12  ? 8.124   48.304  -78.352  1.00 40.00 ? 16  GLN A N   1 
ATOM 86    C CA  . GLN A 1 12  ? 8.883   47.283  -79.043  1.00 40.00 ? 16  GLN A CA  1 
ATOM 87    C C   . GLN A 1 12  ? 9.773   47.835  -80.134  1.00 40.00 ? 16  GLN A C   1 
ATOM 88    O O   . GLN A 1 12  ? 9.494   48.871  -80.754  1.00 40.00 ? 16  GLN A O   1 
ATOM 89    C CB  . GLN A 1 12  ? 7.888   46.271  -79.649  1.00 40.00 ? 16  GLN A CB  1 
ATOM 90    C CG  . GLN A 1 12  ? 7.321   45.292  -78.627  1.00 40.00 ? 16  GLN A CG  1 
ATOM 91    C CD  . GLN A 1 12  ? 7.042   43.928  -79.241  1.00 40.00 ? 16  GLN A CD  1 
ATOM 92    O OE1 . GLN A 1 12  ? 5.955   43.737  -79.809  1.00 40.00 ? 16  GLN A OE1 1 
ATOM 93    N NE2 . GLN A 1 12  ? 7.983   43.003  -79.147  1.00 40.00 ? 16  GLN A NE2 1 
ATOM 94    N N   . LEU A 1 13  ? 10.863  47.132  -80.398  1.00 40.00 ? 17  LEU A N   1 
ATOM 95    C CA  . LEU A 1 13  ? 11.786  47.598  -81.412  1.00 40.00 ? 17  LEU A CA  1 
ATOM 96    C C   . LEU A 1 13  ? 12.264  46.474  -82.305  1.00 40.00 ? 17  LEU A C   1 
ATOM 97    O O   . LEU A 1 13  ? 12.458  45.349  -81.805  1.00 40.00 ? 17  LEU A O   1 
ATOM 98    C CB  . LEU A 1 13  ? 13.085  48.125  -80.694  1.00 40.00 ? 17  LEU A CB  1 
ATOM 99    C CG  . LEU A 1 13  ? 12.904  49.261  -79.685  1.00 40.00 ? 17  LEU A CG  1 
ATOM 100   C CD1 . LEU A 1 13  ? 14.109  49.391  -78.772  1.00 40.00 ? 17  LEU A CD1 1 
ATOM 101   C CD2 . LEU A 1 13  ? 12.610  50.589  -80.397  1.00 40.00 ? 17  LEU A CD2 1 
ATOM 102   N N   . ARG A 1 14  ? 12.575  46.794  -83.548  1.00 40.00 ? 18  ARG A N   1 
ATOM 103   C CA  . ARG A 1 14  ? 13.146  45.722  -84.370  1.00 40.00 ? 18  ARG A CA  1 
ATOM 104   C C   . ARG A 1 14  ? 14.526  46.166  -84.847  1.00 40.00 ? 18  ARG A C   1 
ATOM 105   O O   . ARG A 1 14  ? 14.620  47.144  -85.594  1.00 40.00 ? 18  ARG A O   1 
ATOM 106   C CB  . ARG A 1 14  ? 12.275  45.321  -85.513  1.00 40.00 ? 18  ARG A CB  1 
ATOM 107   C CG  . ARG A 1 14  ? 12.935  45.133  -86.862  1.00 40.00 ? 18  ARG A CG  1 
ATOM 108   C CD  . ARG A 1 14  ? 12.232  44.091  -87.689  1.00 40.00 ? 18  ARG A CD  1 
ATOM 109   N NE  . ARG A 1 14  ? 10.863  44.413  -88.052  1.00 40.00 ? 18  ARG A NE  1 
ATOM 110   C CZ  . ARG A 1 14  ? 9.774   44.285  -87.305  1.00 40.00 ? 18  ARG A CZ  1 
ATOM 111   N NH1 . ARG A 1 14  ? 8.578   44.619  -87.793  1.00 40.00 ? 18  ARG A NH1 1 
ATOM 112   N NH2 . ARG A 1 14  ? 9.840   43.831  -86.059  1.00 40.00 ? 18  ARG A NH2 1 
ATOM 113   N N   . GLY A 1 15  ? 15.531  45.413  -84.407  1.00 40.00 ? 19  GLY A N   1 
ATOM 114   C CA  . GLY A 1 15  ? 16.900  45.716  -84.820  1.00 40.00 ? 19  GLY A CA  1 
ATOM 115   C C   . GLY A 1 15  ? 17.145  45.158  -86.225  1.00 40.00 ? 19  GLY A C   1 
ATOM 116   O O   . GLY A 1 15  ? 16.205  44.813  -86.941  1.00 40.00 ? 19  GLY A O   1 
ATOM 117   N N   . ILE A 1 16  ? 18.406  45.097  -86.613  1.00 40.00 ? 20  ILE A N   1 
ATOM 118   C CA  . ILE A 1 16  ? 18.831  44.557  -87.897  1.00 40.00 ? 20  ILE A CA  1 
ATOM 119   C C   . ILE A 1 16  ? 20.133  43.805  -87.586  1.00 40.00 ? 20  ILE A C   1 
ATOM 120   O O   . ILE A 1 16  ? 20.831  44.180  -86.649  1.00 40.00 ? 20  ILE A O   1 
ATOM 121   C CB  . ILE A 1 16  ? 19.013  45.561  -89.020  1.00 40.00 ? 20  ILE A CB  1 
ATOM 122   C CG1 . ILE A 1 16  ? 19.999  45.067  -90.108  1.00 40.00 ? 20  ILE A CG1 1 
ATOM 123   C CG2 . ILE A 1 16  ? 19.525  46.889  -88.487  1.00 40.00 ? 20  ILE A CG2 1 
ATOM 124   C CD1 . ILE A 1 16  ? 19.748  45.683  -91.473  1.00 40.00 ? 20  ILE A CD1 1 
ATOM 125   N N   . ARG A 1 17  ? 20.403  42.758  -88.337  1.00 40.00 ? 21  ARG A N   1 
ATOM 126   C CA  . ARG A 1 17  ? 21.582  41.928  -88.139  1.00 40.00 ? 21  ARG A CA  1 
ATOM 127   C C   . ARG A 1 17  ? 22.704  42.298  -89.104  1.00 40.00 ? 21  ARG A C   1 
ATOM 128   O O   . ARG A 1 17  ? 22.670  42.062  -90.309  1.00 40.00 ? 21  ARG A O   1 
ATOM 129   C CB  . ARG A 1 17  ? 21.186  40.464  -88.240  1.00 40.00 ? 21  ARG A CB  1 
ATOM 130   C CG  . ARG A 1 17  ? 22.161  39.502  -87.582  1.00 40.00 ? 21  ARG A CG  1 
ATOM 131   C CD  . ARG A 1 17  ? 21.982  38.111  -88.165  1.00 40.00 ? 21  ARG A CD  1 
ATOM 132   N NE  . ARG A 1 17  ? 22.698  38.019  -89.456  1.00 40.00 ? 21  ARG A NE  1 
ATOM 133   C CZ  . ARG A 1 17  ? 23.149  36.818  -89.841  1.00 40.00 ? 21  ARG A CZ  1 
ATOM 134   N NH1 . ARG A 1 17  ? 22.935  35.764  -89.046  1.00 40.00 ? 21  ARG A NH1 1 
ATOM 135   N NH2 . ARG A 1 17  ? 23.796  36.697  -90.985  1.00 40.00 ? 21  ARG A NH2 1 
ATOM 136   N N   . LEU A 1 18  ? 23.720  42.921  -88.506  1.00 40.00 ? 22  LEU A N   1 
ATOM 137   C CA  . LEU A 1 18  ? 24.879  43.399  -89.224  1.00 40.00 ? 22  LEU A CA  1 
ATOM 138   C C   . LEU A 1 18  ? 25.983  42.356  -89.285  1.00 40.00 ? 22  LEU A C   1 
ATOM 139   O O   . LEU A 1 18  ? 26.152  41.552  -88.368  1.00 40.00 ? 22  LEU A O   1 
ATOM 140   C CB  . LEU A 1 18  ? 25.417  44.645  -88.511  1.00 40.00 ? 22  LEU A CB  1 
ATOM 141   C CG  . LEU A 1 18  ? 24.885  46.017  -88.859  1.00 40.00 ? 22  LEU A CG  1 
ATOM 142   C CD1 . LEU A 1 18  ? 23.359  46.063  -88.884  1.00 40.00 ? 22  LEU A CD1 1 
ATOM 143   C CD2 . LEU A 1 18  ? 25.411  47.055  -87.873  1.00 40.00 ? 22  LEU A CD2 1 
ATOM 144   N N   . LYS A 1 19  ? 26.767  42.439  -90.367  1.00 40.00 ? 23  LYS A N   1 
ATOM 145   C CA  . LYS A 1 19  ? 27.852  41.482  -90.462  1.00 40.00 ? 23  LYS A CA  1 
ATOM 146   C C   . LYS A 1 19  ? 29.239  42.072  -90.349  1.00 40.00 ? 23  LYS A C   1 
ATOM 147   O O   . LYS A 1 19  ? 29.807  42.680  -91.250  1.00 40.00 ? 23  LYS A O   1 
ATOM 148   C CB  . LYS A 1 19  ? 27.664  40.590  -91.688  1.00 40.00 ? 23  LYS A CB  1 
ATOM 149   C CG  . LYS A 1 19  ? 26.874  39.321  -91.332  1.00 40.00 ? 23  LYS A CG  1 
ATOM 150   C CD  . LYS A 1 19  ? 26.347  38.640  -92.584  1.00 40.00 ? 23  LYS A CD  1 
ATOM 151   C CE  . LYS A 1 19  ? 24.974  39.159  -92.985  1.00 40.00 ? 23  LYS A CE  1 
ATOM 152   N NZ  . LYS A 1 19  ? 24.038  39.246  -91.830  1.00 40.00 ? 23  LYS A NZ  1 
ATOM 153   N N   . ALA A 1 20  ? 29.842  41.844  -89.172  1.00 40.00 ? 24  ALA A N   1 
ATOM 154   C CA  . ALA A 1 20  ? 31.225  42.270  -88.941  1.00 40.00 ? 24  ALA A CA  1 
ATOM 155   C C   . ALA A 1 20  ? 32.140  41.141  -89.424  1.00 40.00 ? 24  ALA A C   1 
ATOM 156   O O   . ALA A 1 20  ? 31.711  39.977  -89.416  1.00 40.00 ? 24  ALA A O   1 
ATOM 157   C CB  . ALA A 1 20  ? 31.437  42.442  -87.434  1.00 40.00 ? 24  ALA A CB  1 
ATOM 158   N N   . PRO A 1 21  ? 33.379  41.435  -89.779  1.00 40.00 ? 25  PRO A N   1 
ATOM 159   C CA  . PRO A 1 21  ? 34.344  40.437  -90.203  1.00 40.00 ? 25  PRO A CA  1 
ATOM 160   C C   . PRO A 1 21  ? 34.390  39.208  -89.320  1.00 40.00 ? 25  PRO A C   1 
ATOM 161   O O   . PRO A 1 21  ? 34.434  38.083  -89.858  1.00 40.00 ? 25  PRO A O   1 
ATOM 162   C CB  . PRO A 1 21  ? 35.669  41.193  -90.195  1.00 40.00 ? 25  PRO A CB  1 
ATOM 163   C CG  . PRO A 1 21  ? 35.303  42.611  -90.461  1.00 40.00 ? 25  PRO A CG  1 
ATOM 164   C CD  . PRO A 1 21  ? 33.949  42.806  -89.830  1.00 40.00 ? 25  PRO A CD  1 
ATOM 165   N N   . GLY A 1 22  ? 34.365  39.333  -87.988  1.00 40.00 ? 26  GLY A N   1 
ATOM 166   C CA  . GLY A 1 22  ? 34.398  38.159  -87.132  1.00 40.00 ? 26  GLY A CA  1 
ATOM 167   C C   . GLY A 1 22  ? 33.046  37.556  -86.826  1.00 40.00 ? 26  GLY A C   1 
ATOM 168   O O   . GLY A 1 22  ? 32.936  36.706  -85.931  1.00 40.00 ? 26  GLY A O   1 
ATOM 169   N N   . GLY A 1 23  ? 31.979  38.012  -87.471  1.00 40.00 ? 27  GLY A N   1 
ATOM 170   C CA  . GLY A 1 23  ? 30.665  37.491  -87.203  1.00 40.00 ? 27  GLY A CA  1 
ATOM 171   C C   . GLY A 1 23  ? 29.532  38.491  -87.212  1.00 40.00 ? 27  GLY A C   1 
ATOM 172   O O   . GLY A 1 23  ? 29.612  39.661  -87.592  1.00 40.00 ? 27  GLY A O   1 
ATOM 173   N N   . PRO A 1 24  ? 28.377  37.996  -86.772  1.00 40.00 ? 28  PRO A N   1 
ATOM 174   C CA  . PRO A 1 24  ? 27.155  38.761  -86.732  1.00 40.00 ? 28  PRO A CA  1 
ATOM 175   C C   . PRO A 1 24  ? 27.026  39.623  -85.495  1.00 40.00 ? 28  PRO A C   1 
ATOM 176   O O   . PRO A 1 24  ? 27.535  39.330  -84.413  1.00 40.00 ? 28  PRO A O   1 
ATOM 177   C CB  . PRO A 1 24  ? 26.077  37.673  -86.767  1.00 40.00 ? 28  PRO A CB  1 
ATOM 178   C CG  . PRO A 1 24  ? 26.693  36.565  -85.972  1.00 40.00 ? 28  PRO A CG  1 
ATOM 179   C CD  . PRO A 1 24  ? 28.172  36.611  -86.270  1.00 40.00 ? 28  PRO A CD  1 
ATOM 180   N N   . VAL A 1 25  ? 26.288  40.731  -85.713  1.00 40.00 ? 29  VAL A N   1 
ATOM 181   C CA  . VAL A 1 25  ? 26.008  41.688  -84.684  1.00 40.00 ? 29  VAL A CA  1 
ATOM 182   C C   . VAL A 1 25  ? 24.546  42.157  -84.724  1.00 40.00 ? 29  VAL A C   1 
ATOM 183   O O   . VAL A 1 25  ? 24.048  42.431  -85.810  1.00 40.00 ? 29  VAL A O   1 
ATOM 184   C CB  . VAL A 1 25  ? 26.789  43.013  -84.805  1.00 40.00 ? 29  VAL A CB  1 
ATOM 185   C CG1 . VAL A 1 25  ? 27.021  43.521  -83.382  1.00 40.00 ? 29  VAL A CG1 1 
ATOM 186   C CG2 . VAL A 1 25  ? 28.058  42.924  -85.612  1.00 40.00 ? 29  VAL A CG2 1 
ATOM 187   N N   . SER A 1 26  ? 23.974  42.299  -83.544  1.00 40.00 ? 30  SER A N   1 
ATOM 188   C CA  . SER A 1 26  ? 22.600  42.851  -83.473  1.00 40.00 ? 30  SER A CA  1 
ATOM 189   C C   . SER A 1 26  ? 22.791  44.384  -83.450  1.00 40.00 ? 30  SER A C   1 
ATOM 190   O O   . SER A 1 26  ? 23.768  44.836  -82.817  1.00 40.00 ? 30  SER A O   1 
ATOM 191   C CB  . SER A 1 26  ? 21.932  42.355  -82.201  1.00 40.00 ? 30  SER A CB  1 
ATOM 192   O OG  . SER A 1 26  ? 21.238  41.122  -82.358  1.00 40.00 ? 30  SER A OG  1 
ATOM 193   N N   . ALA A 1 27  ? 21.963  45.161  -84.105  1.00 40.00 ? 31  ALA A N   1 
ATOM 194   C CA  . ALA A 1 27  ? 22.120  46.610  -84.167  1.00 40.00 ? 31  ALA A CA  1 
ATOM 195   C C   . ALA A 1 27  ? 20.766  47.296  -84.111  1.00 40.00 ? 31  ALA A C   1 
ATOM 196   O O   . ALA A 1 27  ? 19.929  47.030  -84.976  1.00 40.00 ? 31  ALA A O   1 
ATOM 197   C CB  . ALA A 1 27  ? 22.778  46.964  -85.499  1.00 40.00 ? 31  ALA A CB  1 
ATOM 198   N N   . PHE A 1 28  ? 20.548  48.121  -83.089  1.00 40.00 ? 32  PHE A N   1 
ATOM 199   C CA  . PHE A 1 28  ? 19.242  48.787  -82.928  1.00 40.00 ? 32  PHE A CA  1 
ATOM 200   C C   . PHE A 1 28  ? 19.371  50.296  -83.097  1.00 40.00 ? 32  PHE A C   1 
ATOM 201   O O   . PHE A 1 28  ? 19.423  51.044  -82.129  1.00 40.00 ? 32  PHE A O   1 
ATOM 202   C CB  . PHE A 1 28  ? 18.669  48.480  -81.532  1.00 40.00 ? 32  PHE A CB  1 
ATOM 203   C CG  . PHE A 1 28  ? 18.373  47.020  -81.368  1.00 40.00 ? 32  PHE A CG  1 
ATOM 204   C CD1 . PHE A 1 28  ? 19.371  46.074  -81.260  1.00 40.00 ? 32  PHE A CD1 1 
ATOM 205   C CD2 . PHE A 1 28  ? 17.056  46.586  -81.333  1.00 40.00 ? 32  PHE A CD2 1 
ATOM 206   C CE1 . PHE A 1 28  ? 19.080  44.728  -81.122  1.00 40.00 ? 32  PHE A CE1 1 
ATOM 207   C CE2 . PHE A 1 28  ? 16.756  45.241  -81.185  1.00 40.00 ? 32  PHE A CE2 1 
ATOM 208   C CZ  . PHE A 1 28  ? 17.770  44.304  -81.076  1.00 40.00 ? 32  PHE A CZ  1 
ATOM 209   N N   . LEU A 1 29  ? 19.435  50.717  -84.327  1.00 40.00 ? 33  LEU A N   1 
ATOM 210   C CA  . LEU A 1 29  ? 19.611  52.074  -84.785  1.00 40.00 ? 33  LEU A CA  1 
ATOM 211   C C   . LEU A 1 29  ? 18.407  52.972  -84.809  1.00 40.00 ? 33  LEU A C   1 
ATOM 212   O O   . LEU A 1 29  ? 17.344  52.646  -85.388  1.00 40.00 ? 33  LEU A O   1 
ATOM 213   C CB  . LEU A 1 29  ? 20.154  51.827  -86.243  1.00 40.00 ? 33  LEU A CB  1 
ATOM 214   C CG  . LEU A 1 29  ? 21.640  51.510  -86.295  1.00 40.00 ? 33  LEU A CG  1 
ATOM 215   C CD1 . LEU A 1 29  ? 22.126  50.625  -85.160  1.00 40.00 ? 33  LEU A CD1 1 
ATOM 216   C CD2 . LEU A 1 29  ? 22.106  50.932  -87.623  1.00 40.00 ? 33  LEU A CD2 1 
ATOM 217   N N   . GLY A 1 30  ? 18.434  54.186  -84.250  1.00 40.00 ? 34  GLY A N   1 
ATOM 218   C CA  . GLY A 1 30  ? 17.260  55.056  -84.363  1.00 40.00 ? 34  GLY A CA  1 
ATOM 219   C C   . GLY A 1 30  ? 16.332  55.013  -83.174  1.00 40.00 ? 34  GLY A C   1 
ATOM 220   O O   . GLY A 1 30  ? 15.171  55.432  -83.289  1.00 40.00 ? 34  GLY A O   1 
ATOM 221   N N   . ILE A 1 31  ? 16.786  54.567  -82.004  1.00 40.00 ? 35  ILE A N   1 
ATOM 222   C CA  . ILE A 1 31  ? 15.808  54.572  -80.911  1.00 40.00 ? 35  ILE A CA  1 
ATOM 223   C C   . ILE A 1 31  ? 15.480  55.931  -80.330  1.00 40.00 ? 35  ILE A C   1 
ATOM 224   O O   . ILE A 1 31  ? 16.267  56.597  -79.652  1.00 40.00 ? 35  ILE A O   1 
ATOM 225   C CB  . ILE A 1 31  ? 16.241  53.652  -79.747  1.00 40.00 ? 35  ILE A CB  1 
ATOM 226   C CG1 . ILE A 1 31  ? 16.679  52.285  -80.240  1.00 40.00 ? 35  ILE A CG1 1 
ATOM 227   C CG2 . ILE A 1 31  ? 15.038  53.602  -78.785  1.00 40.00 ? 35  ILE A CG2 1 
ATOM 228   C CD1 . ILE A 1 31  ? 17.682  51.523  -79.401  1.00 40.00 ? 35  ILE A CD1 1 
ATOM 229   N N   . PRO A 1 32  ? 14.251  56.382  -80.505  1.00 40.00 ? 36  PRO A N   1 
ATOM 230   C CA  . PRO A 1 32  ? 13.858  57.669  -79.920  1.00 40.00 ? 36  PRO A CA  1 
ATOM 231   C C   . PRO A 1 32  ? 14.205  57.624  -78.434  1.00 40.00 ? 36  PRO A C   1 
ATOM 232   O O   . PRO A 1 32  ? 13.843  56.582  -77.848  1.00 40.00 ? 36  PRO A O   1 
ATOM 233   C CB  . PRO A 1 32  ? 12.345  57.720  -80.078  1.00 40.00 ? 36  PRO A CB  1 
ATOM 234   C CG  . PRO A 1 32  ? 11.923  56.435  -80.651  1.00 40.00 ? 36  PRO A CG  1 
ATOM 235   C CD  . PRO A 1 32  ? 13.141  55.755  -81.242  1.00 40.00 ? 36  PRO A CD  1 
ATOM 236   N N   . PHE A 1 33  ? 14.864  58.643  -77.917  1.00 40.00 ? 37  PHE A N   1 
ATOM 237   C CA  . PHE A 1 33  ? 15.120  58.581  -76.464  1.00 40.00 ? 37  PHE A CA  1 
ATOM 238   C C   . PHE A 1 33  ? 14.350  59.742  -75.851  1.00 40.00 ? 37  PHE A C   1 
ATOM 239   O O   . PHE A 1 33  ? 14.072  59.769  -74.666  1.00 40.00 ? 37  PHE A O   1 
ATOM 240   C CB  . PHE A 1 33  ? 16.522  58.543  -76.052  1.00 40.00 ? 37  PHE A CB  1 
ATOM 241   C CG  . PHE A 1 33  ? 17.437  59.671  -76.338  1.00 40.00 ? 37  PHE A CG  1 
ATOM 242   C CD1 . PHE A 1 33  ? 17.578  60.717  -75.438  1.00 40.00 ? 37  PHE A CD1 1 
ATOM 243   C CD2 . PHE A 1 33  ? 18.206  59.642  -77.504  1.00 40.00 ? 37  PHE A CD2 1 
ATOM 244   C CE1 . PHE A 1 33  ? 18.480  61.739  -75.696  1.00 40.00 ? 37  PHE A CE1 1 
ATOM 245   C CE2 . PHE A 1 33  ? 19.089  60.663  -77.780  1.00 40.00 ? 37  PHE A CE2 1 
ATOM 246   C CZ  . PHE A 1 33  ? 19.211  61.700  -76.868  1.00 40.00 ? 37  PHE A CZ  1 
ATOM 247   N N   . ALA A 1 34  ? 13.937  60.642  -76.755  1.00 40.00 ? 38  ALA A N   1 
ATOM 248   C CA  . ALA A 1 34  ? 13.177  61.799  -76.297  1.00 40.00 ? 38  ALA A CA  1 
ATOM 249   C C   . ALA A 1 34  ? 12.199  62.328  -77.344  1.00 40.00 ? 38  ALA A C   1 
ATOM 250   O O   . ALA A 1 34  ? 12.353  62.061  -78.546  1.00 40.00 ? 38  ALA A O   1 
ATOM 251   C CB  . ALA A 1 34  ? 14.161  62.961  -76.045  1.00 40.00 ? 38  ALA A CB  1 
ATOM 252   N N   . GLU A 1 35  ? 11.267  63.122  -76.819  1.00 40.00 ? 39  GLU A N   1 
ATOM 253   C CA  . GLU A 1 35  ? 10.309  63.806  -77.691  1.00 40.00 ? 39  GLU A CA  1 
ATOM 254   C C   . GLU A 1 35  ? 11.095  64.858  -78.487  1.00 40.00 ? 39  GLU A C   1 
ATOM 255   O O   . GLU A 1 35  ? 11.849  65.670  -77.915  1.00 40.00 ? 39  GLU A O   1 
ATOM 256   C CB  . GLU A 1 35  ? 9.218   64.525  -76.907  1.00 40.00 ? 39  GLU A CB  1 
ATOM 257   C CG  . GLU A 1 35  ? 8.121   63.639  -76.310  1.00 40.00 ? 39  GLU A CG  1 
ATOM 258   C CD  . GLU A 1 35  ? 7.264   62.951  -77.356  1.00 40.00 ? 39  GLU A CD  1 
ATOM 259   O OE1 . GLU A 1 35  ? 6.145   63.450  -77.580  1.00 40.00 ? 39  GLU A OE1 1 
ATOM 260   O OE2 . GLU A 1 35  ? 7.662   61.936  -77.970  1.00 40.00 ? 39  GLU A OE2 1 
ATOM 261   N N   . PRO A 1 36  ? 10.962  64.834  -79.810  1.00 40.00 ? 40  PRO A N   1 
ATOM 262   C CA  . PRO A 1 36  ? 11.614  65.776  -80.710  1.00 40.00 ? 40  PRO A CA  1 
ATOM 263   C C   . PRO A 1 36  ? 11.492  67.164  -80.083  1.00 40.00 ? 40  PRO A C   1 
ATOM 264   O O   . PRO A 1 36  ? 10.401  67.600  -79.690  1.00 40.00 ? 40  PRO A O   1 
ATOM 265   C CB  . PRO A 1 36  ? 10.830  65.663  -82.011  1.00 40.00 ? 40  PRO A CB  1 
ATOM 266   C CG  . PRO A 1 36  ? 10.359  64.270  -82.021  1.00 40.00 ? 40  PRO A CG  1 
ATOM 267   C CD  . PRO A 1 36  ? 10.062  63.947  -80.576  1.00 40.00 ? 40  PRO A CD  1 
ATOM 268   N N   . PRO A 1 37  ? 12.617  67.853  -79.985  1.00 40.00 ? 41  PRO A N   1 
ATOM 269   C CA  . PRO A 1 37  ? 12.707  69.163  -79.352  1.00 40.00 ? 41  PRO A CA  1 
ATOM 270   C C   . PRO A 1 37  ? 12.460  70.293  -80.331  1.00 40.00 ? 41  PRO A C   1 
ATOM 271   O O   . PRO A 1 37  ? 13.129  71.345  -80.368  1.00 40.00 ? 41  PRO A O   1 
ATOM 272   C CB  . PRO A 1 37  ? 14.155  69.136  -78.874  1.00 40.00 ? 41  PRO A CB  1 
ATOM 273   C CG  . PRO A 1 37  ? 14.862  68.478  -80.029  1.00 40.00 ? 41  PRO A CG  1 
ATOM 274   C CD  . PRO A 1 37  ? 13.937  67.412  -80.508  1.00 40.00 ? 41  PRO A CD  1 
ATOM 275   N N   . VAL A 1 38  ? 11.403  70.082  -81.131  1.00 40.00 ? 42  VAL A N   1 
ATOM 276   C CA  . VAL A 1 38  ? 11.046  71.038  -82.149  1.00 40.00 ? 42  VAL A CA  1 
ATOM 277   C C   . VAL A 1 38  ? 9.967   72.009  -81.721  1.00 40.00 ? 42  VAL A C   1 
ATOM 278   O O   . VAL A 1 38  ? 9.334   71.927  -80.662  1.00 40.00 ? 42  VAL A O   1 
ATOM 279   C CB  . VAL A 1 38  ? 10.575  70.273  -83.403  1.00 40.00 ? 42  VAL A CB  1 
ATOM 280   C CG1 . VAL A 1 38  ? 11.683  69.323  -83.812  1.00 40.00 ? 42  VAL A CG1 1 
ATOM 281   C CG2 . VAL A 1 38  ? 9.256   69.572  -83.102  1.00 40.00 ? 42  VAL A CG2 1 
ATOM 282   N N   . GLY A 1 39  ? 9.780   72.976  -82.651  1.00 40.00 ? 43  GLY A N   1 
ATOM 283   C CA  . GLY A 1 39  ? 8.749   73.950  -82.429  1.00 40.00 ? 43  GLY A CA  1 
ATOM 284   C C   . GLY A 1 39  ? 8.908   74.742  -81.162  1.00 40.00 ? 43  GLY A C   1 
ATOM 285   O O   . GLY A 1 39  ? 9.906   75.455  -81.042  1.00 40.00 ? 43  GLY A O   1 
ATOM 286   N N   . SER A 1 40  ? 8.012   74.629  -80.196  1.00 40.00 ? 44  SER A N   1 
ATOM 287   C CA  . SER A 1 40  ? 8.069   75.426  -78.986  1.00 40.00 ? 44  SER A CA  1 
ATOM 288   C C   . SER A 1 40  ? 8.984   74.782  -77.959  1.00 40.00 ? 44  SER A C   1 
ATOM 289   O O   . SER A 1 40  ? 9.057   75.234  -76.808  1.00 40.00 ? 44  SER A O   1 
ATOM 290   C CB  . SER A 1 40  ? 6.671   75.549  -78.359  1.00 40.00 ? 44  SER A CB  1 
ATOM 291   O OG  . SER A 1 40  ? 6.190   74.243  -78.044  1.00 40.00 ? 44  SER A OG  1 
ATOM 292   N N   . ARG A 1 41  ? 9.593   73.713  -78.447  1.00 40.00 ? 45  ARG A N   1 
ATOM 293   C CA  . ARG A 1 41  ? 10.514  72.946  -77.649  1.00 40.00 ? 45  ARG A CA  1 
ATOM 294   C C   . ARG A 1 41  ? 11.938  73.376  -77.923  1.00 40.00 ? 45  ARG A C   1 
ATOM 295   O O   . ARG A 1 41  ? 12.830  73.019  -77.153  1.00 40.00 ? 45  ARG A O   1 
ATOM 296   C CB  . ARG A 1 41  ? 10.328  71.443  -77.927  1.00 40.00 ? 45  ARG A CB  1 
ATOM 297   C CG  . ARG A 1 41  ? 9.407   70.723  -76.969  1.00 40.00 ? 45  ARG A CG  1 
ATOM 298   C CD  . ARG A 1 41  ? 8.708   71.670  -75.994  1.00 40.00 ? 45  ARG A CD  1 
ATOM 299   N NE  . ARG A 1 41  ? 9.429   71.836  -74.733  1.00 40.00 ? 45  ARG A NE  1 
ATOM 300   C CZ  . ARG A 1 41  ? 9.770   70.816  -73.948  1.00 40.00 ? 45  ARG A CZ  1 
ATOM 301   N NH1 . ARG A 1 41  ? 9.466   69.560  -74.279  1.00 40.00 ? 45  ARG A NH1 1 
ATOM 302   N NH2 . ARG A 1 41  ? 10.413  71.014  -72.809  1.00 40.00 ? 45  ARG A NH2 1 
ATOM 303   N N   . ARG A 1 42  ? 12.158  74.097  -79.015  1.00 40.00 ? 46  ARG A N   1 
ATOM 304   C CA  . ARG A 1 42  ? 13.542  74.511  -79.300  1.00 40.00 ? 46  ARG A CA  1 
ATOM 305   C C   . ARG A 1 42  ? 14.171  75.243  -78.119  1.00 40.00 ? 46  ARG A C   1 
ATOM 306   O O   . ARG A 1 42  ? 13.492  76.106  -77.516  1.00 40.00 ? 46  ARG A O   1 
ATOM 307   C CB  . ARG A 1 42  ? 13.522  75.454  -80.496  1.00 40.00 ? 46  ARG A CB  1 
ATOM 308   C CG  . ARG A 1 42  ? 14.933  75.713  -81.020  1.00 40.00 ? 46  ARG A CG  1 
ATOM 309   C CD  . ARG A 1 42  ? 14.821  76.686  -82.139  1.00 40.00 ? 46  ARG A CD  1 
ATOM 310   N NE  . ARG A 1 42  ? 14.862  76.167  -83.490  1.00 40.00 ? 46  ARG A NE  1 
ATOM 311   C CZ  . ARG A 1 42  ? 14.545  77.013  -84.504  1.00 40.00 ? 46  ARG A CZ  1 
ATOM 312   N NH1 . ARG A 1 42  ? 14.194  78.279  -84.199  1.00 40.00 ? 46  ARG A NH1 1 
ATOM 313   N NH2 . ARG A 1 42  ? 14.613  76.599  -85.768  1.00 40.00 ? 46  ARG A NH2 1 
ATOM 314   N N   . PHE A 1 43  ? 15.442  74.954  -77.812  1.00 40.00 ? 47  PHE A N   1 
ATOM 315   C CA  . PHE A 1 43  ? 16.156  75.575  -76.722  1.00 40.00 ? 47  PHE A CA  1 
ATOM 316   C C   . PHE A 1 43  ? 15.754  75.014  -75.359  1.00 40.00 ? 47  PHE A C   1 
ATOM 317   O O   . PHE A 1 43  ? 16.270  75.456  -74.315  1.00 40.00 ? 47  PHE A O   1 
ATOM 318   C CB  . PHE A 1 43  ? 16.063  77.120  -76.610  1.00 40.00 ? 47  PHE A CB  1 
ATOM 319   C CG  . PHE A 1 43  ? 16.296  77.799  -77.943  1.00 40.00 ? 47  PHE A CG  1 
ATOM 320   C CD1 . PHE A 1 43  ? 17.377  77.415  -78.723  1.00 40.00 ? 47  PHE A CD1 1 
ATOM 321   C CD2 . PHE A 1 43  ? 15.418  78.735  -78.438  1.00 40.00 ? 47  PHE A CD2 1 
ATOM 322   C CE1 . PHE A 1 43  ? 17.592  77.964  -79.953  1.00 40.00 ? 47  PHE A CE1 1 
ATOM 323   C CE2 . PHE A 1 43  ? 15.647  79.300  -79.656  1.00 40.00 ? 47  PHE A CE2 1 
ATOM 324   C CZ  . PHE A 1 43  ? 16.725  78.916  -80.420  1.00 40.00 ? 47  PHE A CZ  1 
ATOM 325   N N   . MET A 1 44  ? 14.854  74.049  -75.325  1.00 40.00 ? 48  MET A N   1 
ATOM 326   C CA  . MET A 1 44  ? 14.357  73.472  -74.100  1.00 40.00 ? 48  MET A CA  1 
ATOM 327   C C   . MET A 1 44  ? 15.048  72.175  -73.709  1.00 40.00 ? 48  MET A C   1 
ATOM 328   O O   . MET A 1 44  ? 15.525  71.352  -74.487  1.00 40.00 ? 48  MET A O   1 
ATOM 329   C CB  . MET A 1 44  ? 12.866  73.167  -74.225  1.00 40.00 ? 48  MET A CB  1 
ATOM 330   C CG  . MET A 1 44  ? 11.907  74.343  -74.156  1.00 40.00 ? 48  MET A CG  1 
ATOM 331   S SD  . MET A 1 44  ? 12.168  75.299  -72.667  1.00 40.00 ? 48  MET A SD  1 
ATOM 332   C CE  . MET A 1 44  ? 10.606  75.277  -71.832  1.00 40.00 ? 48  MET A CE  1 
ATOM 333   N N   . PRO A 1 45  ? 15.083  71.974  -72.391  1.00 40.00 ? 49  PRO A N   1 
ATOM 334   C CA  . PRO A 1 45  ? 15.670  70.728  -71.842  1.00 40.00 ? 49  PRO A CA  1 
ATOM 335   C C   . PRO A 1 45  ? 14.909  69.603  -72.520  1.00 40.00 ? 49  PRO A C   1 
ATOM 336   O O   . PRO A 1 45  ? 13.726  69.828  -72.830  1.00 40.00 ? 49  PRO A O   1 
ATOM 337   C CB  . PRO A 1 45  ? 15.448  70.865  -70.374  1.00 40.00 ? 49  PRO A CB  1 
ATOM 338   C CG  . PRO A 1 45  ? 14.623  72.062  -70.112  1.00 40.00 ? 49  PRO A CG  1 
ATOM 339   C CD  . PRO A 1 45  ? 14.566  72.894  -71.363  1.00 40.00 ? 49  PRO A CD  1 
ATOM 340   N N   . PRO A 1 46  ? 15.486  68.458  -72.786  1.00 40.00 ? 50  PRO A N   1 
ATOM 341   C CA  . PRO A 1 46  ? 14.800  67.392  -73.495  1.00 40.00 ? 50  PRO A CA  1 
ATOM 342   C C   . PRO A 1 46  ? 13.748  66.725  -72.641  1.00 40.00 ? 50  PRO A C   1 
ATOM 343   O O   . PRO A 1 46  ? 13.827  66.835  -71.425  1.00 40.00 ? 50  PRO A O   1 
ATOM 344   C CB  . PRO A 1 46  ? 15.890  66.408  -73.858  1.00 40.00 ? 50  PRO A CB  1 
ATOM 345   C CG  . PRO A 1 46  ? 16.905  66.609  -72.786  1.00 40.00 ? 50  PRO A CG  1 
ATOM 346   C CD  . PRO A 1 46  ? 16.848  68.071  -72.399  1.00 40.00 ? 50  PRO A CD  1 
ATOM 347   N N   . GLU A 1 47  ? 12.789  66.078  -73.295  1.00 40.00 ? 51  GLU A N   1 
ATOM 348   C CA  . GLU A 1 47  ? 11.728  65.348  -72.596  1.00 40.00 ? 51  GLU A CA  1 
ATOM 349   C C   . GLU A 1 47  ? 11.719  63.892  -73.078  1.00 40.00 ? 51  GLU A C   1 
ATOM 350   O O   . GLU A 1 47  ? 11.985  63.532  -74.230  1.00 40.00 ? 51  GLU A O   1 
ATOM 351   C CB  . GLU A 1 47  ? 10.370  65.970  -72.745  1.00 40.00 ? 51  GLU A CB  1 
ATOM 352   C CG  . GLU A 1 47  ? 9.882   66.720  -71.530  1.00 40.00 ? 51  GLU A CG  1 
ATOM 353   C CD  . GLU A 1 47  ? 8.691   67.633  -71.786  1.00 40.00 ? 51  GLU A CD  1 
ATOM 354   O OE1 . GLU A 1 47  ? 8.400   68.397  -70.818  1.00 40.00 ? 51  GLU A OE1 1 
ATOM 355   O OE2 . GLU A 1 47  ? 8.043   67.632  -72.862  1.00 40.00 ? 51  GLU A OE2 1 
ATOM 356   N N   . PRO A 1 48  ? 11.416  63.034  -72.126  1.00 40.00 ? 52  PRO A N   1 
ATOM 357   C CA  . PRO A 1 48  ? 11.411  61.601  -72.368  1.00 40.00 ? 52  PRO A CA  1 
ATOM 358   C C   . PRO A 1 48  ? 10.398  61.223  -73.441  1.00 40.00 ? 52  PRO A C   1 
ATOM 359   O O   . PRO A 1 48  ? 9.218   61.605  -73.395  1.00 40.00 ? 52  PRO A O   1 
ATOM 360   C CB  . PRO A 1 48  ? 11.124  60.993  -71.028  1.00 40.00 ? 52  PRO A CB  1 
ATOM 361   C CG  . PRO A 1 48  ? 10.916  62.064  -70.038  1.00 40.00 ? 52  PRO A CG  1 
ATOM 362   C CD  . PRO A 1 48  ? 11.051  63.392  -70.743  1.00 40.00 ? 52  PRO A CD  1 
ATOM 363   N N   . LYS A 1 49  ? 10.907  60.495  -74.435  1.00 40.00 ? 53  LYS A N   1 
ATOM 364   C CA  . LYS A 1 49  ? 10.094  60.011  -75.553  1.00 40.00 ? 53  LYS A CA  1 
ATOM 365   C C   . LYS A 1 49  ? 8.853   59.320  -75.004  1.00 40.00 ? 53  LYS A C   1 
ATOM 366   O O   . LYS A 1 49  ? 8.984   58.511  -74.074  1.00 40.00 ? 53  LYS A O   1 
ATOM 367   C CB  . LYS A 1 49  ? 10.943  58.992  -76.325  1.00 40.00 ? 53  LYS A CB  1 
ATOM 368   C CG  . LYS A 1 49  ? 10.530  58.539  -77.683  1.00 40.00 ? 53  LYS A CG  1 
ATOM 369   C CD  . LYS A 1 49  ? 9.092   58.837  -78.033  1.00 40.00 ? 53  LYS A CD  1 
ATOM 370   C CE  . LYS A 1 49  ? 8.810   58.868  -79.514  1.00 40.00 ? 53  LYS A CE  1 
ATOM 371   N NZ  . LYS A 1 49  ? 8.199   60.171  -79.910  1.00 40.00 ? 53  LYS A NZ  1 
ATOM 372   N N   . ARG A 1 50  ? 7.676   59.614  -75.550  1.00 40.00 ? 54  ARG A N   1 
ATOM 373   C CA  . ARG A 1 50  ? 6.431   58.959  -75.077  1.00 40.00 ? 54  ARG A CA  1 
ATOM 374   C C   . ARG A 1 50  ? 6.458   57.525  -75.561  1.00 40.00 ? 54  ARG A C   1 
ATOM 375   O O   . ARG A 1 50  ? 7.194   57.210  -76.516  1.00 40.00 ? 54  ARG A O   1 
ATOM 376   C CB  . ARG A 1 50  ? 5.225   59.743  -75.566  1.00 40.00 ? 54  ARG A CB  1 
ATOM 377   C CG  . ARG A 1 50  ? 4.785   60.805  -74.557  1.00 40.00 ? 54  ARG A CG  1 
ATOM 378   C CD  . ARG A 1 50  ? 4.172   62.039  -75.205  1.00 40.00 ? 54  ARG A CD  1 
ATOM 379   N NE  . ARG A 1 50  ? 2.906   61.727  -75.854  1.00 40.00 ? 54  ARG A NE  1 
ATOM 380   C CZ  . ARG A 1 50  ? 2.685   61.677  -77.163  1.00 40.00 ? 54  ARG A CZ  1 
ATOM 381   N NH1 . ARG A 1 50  ? 3.641   61.935  -78.053  1.00 40.00 ? 54  ARG A NH1 1 
ATOM 382   N NH2 . ARG A 1 50  ? 1.465   61.355  -77.617  1.00 40.00 ? 54  ARG A NH2 1 
ATOM 383   N N   . PRO A 1 51  ? 5.726   56.627  -74.907  1.00 40.00 ? 55  PRO A N   1 
ATOM 384   C CA  . PRO A 1 51  ? 5.712   55.217  -75.274  1.00 40.00 ? 55  PRO A CA  1 
ATOM 385   C C   . PRO A 1 51  ? 4.932   55.034  -76.570  1.00 40.00 ? 55  PRO A C   1 
ATOM 386   O O   . PRO A 1 51  ? 3.937   55.707  -76.788  1.00 40.00 ? 55  PRO A O   1 
ATOM 387   C CB  . PRO A 1 51  ? 5.094   54.544  -74.091  1.00 40.00 ? 55  PRO A CB  1 
ATOM 388   C CG  . PRO A 1 51  ? 4.667   55.581  -73.126  1.00 40.00 ? 55  PRO A CG  1 
ATOM 389   C CD  . PRO A 1 51  ? 4.788   56.911  -73.801  1.00 40.00 ? 55  PRO A CD  1 
ATOM 390   N N   . TRP A 1 52  ? 5.410   54.134  -77.437  1.00 40.00 ? 56  TRP A N   1 
ATOM 391   C CA  . TRP A 1 52  ? 4.735   53.907  -78.689  1.00 40.00 ? 56  TRP A CA  1 
ATOM 392   C C   . TRP A 1 52  ? 4.057   52.558  -78.837  1.00 40.00 ? 56  TRP A C   1 
ATOM 393   O O   . TRP A 1 52  ? 4.355   51.526  -78.226  1.00 40.00 ? 56  TRP A O   1 
ATOM 394   C CB  . TRP A 1 52  ? 5.742   54.008  -79.831  1.00 40.00 ? 56  TRP A CB  1 
ATOM 395   C CG  . TRP A 1 52  ? 6.892   53.068  -79.703  1.00 40.00 ? 56  TRP A CG  1 
ATOM 396   C CD1 . TRP A 1 52  ? 7.049   51.881  -80.351  1.00 40.00 ? 56  TRP A CD1 1 
ATOM 397   C CD2 . TRP A 1 52  ? 8.060   53.261  -78.894  1.00 40.00 ? 56  TRP A CD2 1 
ATOM 398   N NE1 . TRP A 1 52  ? 8.251   51.306  -79.985  1.00 40.00 ? 56  TRP A NE1 1 
ATOM 399   C CE2 . TRP A 1 52  ? 8.887   52.133  -79.090  1.00 40.00 ? 56  TRP A CE2 1 
ATOM 400   C CE3 . TRP A 1 52  ? 8.481   54.273  -78.018  1.00 40.00 ? 56  TRP A CE3 1 
ATOM 401   C CZ2 . TRP A 1 52  ? 10.118  51.987  -78.450  1.00 40.00 ? 56  TRP A CZ2 1 
ATOM 402   C CZ3 . TRP A 1 52  ? 9.704   54.113  -77.381  1.00 40.00 ? 56  TRP A CZ3 1 
ATOM 403   C CH2 . TRP A 1 52  ? 10.502  52.980  -77.599  1.00 40.00 ? 56  TRP A CH2 1 
ATOM 404   N N   . SER A 1 53  ? 3.098   52.536  -79.766  1.00 40.00 ? 57  SER A N   1 
ATOM 405   C CA  . SER A 1 53  ? 2.376   51.314  -80.083  1.00 40.00 ? 57  SER A CA  1 
ATOM 406   C C   . SER A 1 53  ? 3.190   50.523  -81.111  1.00 40.00 ? 57  SER A C   1 
ATOM 407   O O   . SER A 1 53  ? 4.149   51.009  -81.712  1.00 40.00 ? 57  SER A O   1 
ATOM 408   C CB  . SER A 1 53  ? 1.036   51.694  -80.740  1.00 40.00 ? 57  SER A CB  1 
ATOM 409   O OG  . SER A 1 53  ? 1.138   51.630  -82.166  1.00 40.00 ? 57  SER A OG  1 
ATOM 410   N N   . GLY A 1 54  ? 2.748   49.304  -81.353  1.00 40.00 ? 58  GLY A N   1 
ATOM 411   C CA  . GLY A 1 54  ? 3.353   48.435  -82.331  1.00 40.00 ? 58  GLY A CA  1 
ATOM 412   C C   . GLY A 1 54  ? 4.854   48.255  -82.153  1.00 40.00 ? 58  GLY A C   1 
ATOM 413   O O   . GLY A 1 54  ? 5.452   48.384  -81.078  1.00 40.00 ? 58  GLY A O   1 
ATOM 414   N N   . VAL A 1 55  ? 5.448   47.916  -83.303  1.00 40.00 ? 59  VAL A N   1 
ATOM 415   C CA  . VAL A 1 55  ? 6.876   47.637  -83.303  1.00 40.00 ? 59  VAL A CA  1 
ATOM 416   C C   . VAL A 1 55  ? 7.645   48.742  -83.990  1.00 40.00 ? 59  VAL A C   1 
ATOM 417   O O   . VAL A 1 55  ? 7.621   48.869  -85.215  1.00 40.00 ? 59  VAL A O   1 
ATOM 418   C CB  . VAL A 1 55  ? 7.129   46.268  -83.958  1.00 40.00 ? 59  VAL A CB  1 
ATOM 419   C CG1 . VAL A 1 55  ? 8.482   46.163  -84.638  1.00 40.00 ? 59  VAL A CG1 1 
ATOM 420   C CG2 . VAL A 1 55  ? 6.961   45.205  -82.867  1.00 40.00 ? 59  VAL A CG2 1 
ATOM 421   N N   . LEU A 1 56  ? 8.336   49.519  -83.145  1.00 40.00 ? 60  LEU A N   1 
ATOM 422   C CA  . LEU A 1 56  ? 9.161   50.611  -83.671  1.00 40.00 ? 60  LEU A CA  1 
ATOM 423   C C   . LEU A 1 56  ? 10.283  50.043  -84.537  1.00 40.00 ? 60  LEU A C   1 
ATOM 424   O O   . LEU A 1 56  ? 11.044  49.181  -84.071  1.00 40.00 ? 60  LEU A O   1 
ATOM 425   C CB  . LEU A 1 56  ? 9.764   51.364  -82.497  1.00 40.00 ? 60  LEU A CB  1 
ATOM 426   C CG  . LEU A 1 56  ? 10.555  52.647  -82.718  1.00 40.00 ? 60  LEU A CG  1 
ATOM 427   C CD1 . LEU A 1 56  ? 10.502  53.150  -84.136  1.00 40.00 ? 60  LEU A CD1 1 
ATOM 428   C CD2 . LEU A 1 56  ? 10.007  53.697  -81.733  1.00 40.00 ? 60  LEU A CD2 1 
ATOM 429   N N   . ASP A 1 57  ? 10.393  50.516  -85.764  1.00 40.00 ? 61  ASP A N   1 
ATOM 430   C CA  . ASP A 1 57  ? 11.473  50.013  -86.618  1.00 40.00 ? 61  ASP A CA  1 
ATOM 431   C C   . ASP A 1 57  ? 12.753  50.673  -86.101  1.00 40.00 ? 61  ASP A C   1 
ATOM 432   O O   . ASP A 1 57  ? 12.712  51.859  -85.780  1.00 40.00 ? 61  ASP A O   1 
ATOM 433   C CB  . ASP A 1 57  ? 11.248  50.343  -88.075  1.00 40.00 ? 61  ASP A CB  1 
ATOM 434   C CG  . ASP A 1 57  ? 12.498  50.100  -88.910  1.00 40.00 ? 61  ASP A CG  1 
ATOM 435   O OD1 . ASP A 1 57  ? 12.392  49.257  -89.834  1.00 40.00 ? 61  ASP A OD1 1 
ATOM 436   O OD2 . ASP A 1 57  ? 13.546  50.723  -88.632  1.00 40.00 ? 61  ASP A OD2 1 
ATOM 437   N N   . ALA A 1 58  ? 13.834  49.922  -86.049  1.00 40.00 ? 62  ALA A N   1 
ATOM 438   C CA  . ALA A 1 58  ? 15.082  50.523  -85.522  1.00 40.00 ? 62  ALA A CA  1 
ATOM 439   C C   . ALA A 1 58  ? 16.234  49.930  -86.311  1.00 40.00 ? 62  ALA A C   1 
ATOM 440   O O   . ALA A 1 58  ? 17.313  49.700  -85.791  1.00 40.00 ? 62  ALA A O   1 
ATOM 441   C CB  . ALA A 1 58  ? 15.131  50.199  -84.045  1.00 40.00 ? 62  ALA A CB  1 
ATOM 442   N N   . THR A 1 59  ? 15.946  49.725  -87.592  1.00 40.00 ? 63  THR A N   1 
ATOM 443   C CA  . THR A 1 59  ? 16.913  49.082  -88.473  1.00 40.00 ? 63  THR A CA  1 
ATOM 444   C C   . THR A 1 59  ? 17.795  50.054  -89.198  1.00 40.00 ? 63  THR A C   1 
ATOM 445   O O   . THR A 1 59  ? 18.589  49.674  -90.068  1.00 40.00 ? 63  THR A O   1 
ATOM 446   C CB  . THR A 1 59  ? 16.104  48.260  -89.507  1.00 40.00 ? 63  THR A CB  1 
ATOM 447   O OG1 . THR A 1 59  ? 15.675  49.052  -90.610  1.00 40.00 ? 63  THR A OG1 1 
ATOM 448   C CG2 . THR A 1 59  ? 14.880  47.673  -88.797  1.00 40.00 ? 63  THR A CG2 1 
ATOM 449   N N   . THR A 1 60  ? 17.597  51.340  -88.850  1.00 40.00 ? 64  THR A N   1 
ATOM 450   C CA  . THR A 1 60  ? 18.356  52.366  -89.550  1.00 40.00 ? 64  THR A CA  1 
ATOM 451   C C   . THR A 1 60  ? 18.728  53.620  -88.793  1.00 40.00 ? 64  THR A C   1 
ATOM 452   O O   . THR A 1 60  ? 18.152  53.985  -87.769  1.00 40.00 ? 64  THR A O   1 
ATOM 453   C CB  . THR A 1 60  ? 17.544  52.819  -90.800  1.00 40.00 ? 64  THR A CB  1 
ATOM 454   O OG1 . THR A 1 60  ? 18.476  53.576  -91.577  1.00 40.00 ? 64  THR A OG1 1 
ATOM 455   C CG2 . THR A 1 60  ? 16.372  53.660  -90.354  1.00 40.00 ? 64  THR A CG2 1 
ATOM 456   N N   . PHE A 1 61  ? 19.752  54.290  -89.346  1.00 40.00 ? 65  PHE A N   1 
ATOM 457   C CA  . PHE A 1 61  ? 20.269  55.509  -88.734  1.00 40.00 ? 65  PHE A CA  1 
ATOM 458   C C   . PHE A 1 61  ? 19.362  56.712  -88.930  1.00 40.00 ? 65  PHE A C   1 
ATOM 459   O O   . PHE A 1 61  ? 19.017  57.000  -90.068  1.00 40.00 ? 65  PHE A O   1 
ATOM 460   C CB  . PHE A 1 61  ? 21.637  55.819  -89.349  1.00 40.00 ? 65  PHE A CB  1 
ATOM 461   C CG  . PHE A 1 61  ? 22.806  55.288  -88.575  1.00 40.00 ? 65  PHE A CG  1 
ATOM 462   C CD1 . PHE A 1 61  ? 22.780  55.176  -87.188  1.00 40.00 ? 65  PHE A CD1 1 
ATOM 463   C CD2 . PHE A 1 61  ? 23.966  54.894  -89.249  1.00 40.00 ? 65  PHE A CD2 1 
ATOM 464   C CE1 . PHE A 1 61  ? 23.861  54.696  -86.478  1.00 40.00 ? 65  PHE A CE1 1 
ATOM 465   C CE2 . PHE A 1 61  ? 25.067  54.404  -88.564  1.00 40.00 ? 65  PHE A CE2 1 
ATOM 466   C CZ  . PHE A 1 61  ? 24.992  54.318  -87.190  1.00 40.00 ? 65  PHE A CZ  1 
ATOM 467   N N   . GLN A 1 62  ? 19.037  57.408  -87.869  1.00 40.00 ? 66  GLN A N   1 
ATOM 468   C CA  . GLN A 1 62  ? 18.220  58.599  -87.916  1.00 40.00 ? 66  GLN A CA  1 
ATOM 469   C C   . GLN A 1 62  ? 18.955  59.861  -88.353  1.00 40.00 ? 66  GLN A C   1 
ATOM 470   O O   . GLN A 1 62  ? 20.150  59.911  -88.689  1.00 40.00 ? 66  GLN A O   1 
ATOM 471   C CB  . GLN A 1 62  ? 17.641  58.772  -86.519  1.00 40.00 ? 66  GLN A CB  1 
ATOM 472   C CG  . GLN A 1 62  ? 16.316  57.988  -86.448  1.00 40.00 ? 66  GLN A CG  1 
ATOM 473   C CD  . GLN A 1 62  ? 15.303  58.620  -87.395  1.00 40.00 ? 66  GLN A CD  1 
ATOM 474   O OE1 . GLN A 1 62  ? 14.664  59.650  -87.254  1.00 40.00 ? 66  GLN A OE1 1 
ATOM 475   N NE2 . GLN A 1 62  ? 15.138  57.922  -88.528  1.00 40.00 ? 66  GLN A NE2 1 
ATOM 476   N N   . ASN A 1 63  ? 18.184  60.961  -88.384  1.00 40.00 ? 67  ASN A N   1 
ATOM 477   C CA  . ASN A 1 63  ? 18.641  62.261  -88.795  1.00 40.00 ? 67  ASN A CA  1 
ATOM 478   C C   . ASN A 1 63  ? 19.645  62.907  -87.829  1.00 40.00 ? 67  ASN A C   1 
ATOM 479   O O   . ASN A 1 63  ? 19.449  62.913  -86.613  1.00 40.00 ? 67  ASN A O   1 
ATOM 480   C CB  . ASN A 1 63  ? 17.494  63.275  -88.904  1.00 40.00 ? 67  ASN A CB  1 
ATOM 481   C CG  . ASN A 1 63  ? 16.426  62.889  -89.895  1.00 40.00 ? 67  ASN A CG  1 
ATOM 482   O OD1 . ASN A 1 63  ? 16.709  62.542  -91.043  1.00 40.00 ? 67  ASN A OD1 1 
ATOM 483   N ND2 . ASN A 1 63  ? 15.193  62.962  -89.408  1.00 40.00 ? 67  ASN A ND2 1 
ATOM 484   N N   . VAL A 1 64  ? 20.665  63.463  -88.453  1.00 40.00 ? 68  VAL A N   1 
ATOM 485   C CA  . VAL A 1 64  ? 21.709  64.200  -87.776  1.00 40.00 ? 68  VAL A CA  1 
ATOM 486   C C   . VAL A 1 64  ? 21.105  65.476  -87.197  1.00 40.00 ? 68  VAL A C   1 
ATOM 487   O O   . VAL A 1 64  ? 20.394  66.180  -87.967  1.00 40.00 ? 68  VAL A O   1 
ATOM 488   C CB  . VAL A 1 64  ? 22.666  64.691  -88.901  1.00 40.00 ? 68  VAL A CB  1 
ATOM 489   C CG1 . VAL A 1 64  ? 23.512  65.886  -88.477  1.00 40.00 ? 68  VAL A CG1 1 
ATOM 490   C CG2 . VAL A 1 64  ? 23.575  63.618  -89.448  1.00 40.00 ? 68  VAL A CG2 1 
ATOM 491   N N   . CYS A 1 65  ? 21.402  65.913  -85.988  1.00 40.00 ? 69  CYS A N   1 
ATOM 492   C CA  . CYS A 1 65  ? 20.884  67.208  -85.529  1.00 40.00 ? 69  CYS A CA  1 
ATOM 493   C C   . CYS A 1 65  ? 21.261  68.390  -86.439  1.00 40.00 ? 69  CYS A C   1 
ATOM 494   O O   . CYS A 1 65  ? 22.236  68.336  -87.200  1.00 40.00 ? 69  CYS A O   1 
ATOM 495   C CB  . CYS A 1 65  ? 21.437  67.489  -84.143  1.00 40.00 ? 69  CYS A CB  1 
ATOM 496   S SG  . CYS A 1 65  ? 20.760  66.410  -82.899  1.00 40.00 ? 69  CYS A SG  1 
ATOM 497   N N   . TYR A 1 66  ? 20.507  69.507  -86.348  1.00 40.00 ? 70  TYR A N   1 
ATOM 498   C CA  . TYR A 1 66  ? 20.742  70.658  -87.192  1.00 40.00 ? 70  TYR A CA  1 
ATOM 499   C C   . TYR A 1 66  ? 22.088  71.293  -86.988  1.00 40.00 ? 70  TYR A C   1 
ATOM 500   O O   . TYR A 1 66  ? 22.472  71.764  -85.910  1.00 40.00 ? 70  TYR A O   1 
ATOM 501   C CB  . TYR A 1 66  ? 19.566  71.680  -87.172  1.00 40.00 ? 70  TYR A CB  1 
ATOM 502   C CG  . TYR A 1 66  ? 19.489  72.262  -88.597  1.00 40.00 ? 70  TYR A CG  1 
ATOM 503   C CD1 . TYR A 1 66  ? 18.901  71.572  -89.644  1.00 40.00 ? 70  TYR A CD1 1 
ATOM 504   C CD2 . TYR A 1 66  ? 20.073  73.476  -88.880  1.00 40.00 ? 70  TYR A CD2 1 
ATOM 505   C CE1 . TYR A 1 66  ? 18.885  72.079  -90.916  1.00 40.00 ? 70  TYR A CE1 1 
ATOM 506   C CE2 . TYR A 1 66  ? 20.054  73.999  -90.155  1.00 40.00 ? 70  TYR A CE2 1 
ATOM 507   C CZ  . TYR A 1 66  ? 19.460  73.294  -91.183  1.00 40.00 ? 70  TYR A CZ  1 
ATOM 508   O OH  . TYR A 1 66  ? 19.486  73.858  -92.445  1.00 40.00 ? 70  TYR A OH  1 
ATOM 509   N N   . GLN A 1 67  ? 22.907  71.327  -88.059  1.00 40.00 ? 71  GLN A N   1 
ATOM 510   C CA  . GLN A 1 67  ? 24.252  71.877  -87.845  1.00 40.00 ? 71  GLN A CA  1 
ATOM 511   C C   . GLN A 1 67  ? 24.968  72.422  -89.052  1.00 40.00 ? 71  GLN A C   1 
ATOM 512   O O   . GLN A 1 67  ? 24.765  72.068  -90.209  1.00 40.00 ? 71  GLN A O   1 
ATOM 513   C CB  . GLN A 1 67  ? 25.044  70.660  -87.284  1.00 40.00 ? 71  GLN A CB  1 
ATOM 514   C CG  . GLN A 1 67  ? 25.172  69.546  -88.298  1.00 40.00 ? 71  GLN A CG  1 
ATOM 515   C CD  . GLN A 1 67  ? 26.170  68.492  -87.845  1.00 40.00 ? 71  GLN A CD  1 
ATOM 516   O OE1 . GLN A 1 67  ? 27.293  68.379  -88.368  1.00 40.00 ? 71  GLN A OE1 1 
ATOM 517   N NE2 . GLN A 1 67  ? 25.700  67.736  -86.853  1.00 40.00 ? 71  GLN A NE2 1 
ATOM 518   N N   . TYR A 1 68  ? 25.940  73.312  -88.768  1.00 40.00 ? 72  TYR A N   1 
ATOM 519   C CA  . TYR A 1 68  ? 26.739  73.866  -89.877  1.00 40.00 ? 72  TYR A CA  1 
ATOM 520   C C   . TYR A 1 68  ? 27.360  72.697  -90.621  1.00 40.00 ? 72  TYR A C   1 
ATOM 521   O O   . TYR A 1 68  ? 27.655  71.652  -90.038  1.00 40.00 ? 72  TYR A O   1 
ATOM 522   C CB  . TYR A 1 68  ? 27.793  74.803  -89.289  1.00 40.00 ? 72  TYR A CB  1 
ATOM 523   C CG  . TYR A 1 68  ? 28.899  75.202  -90.230  1.00 40.00 ? 72  TYR A CG  1 
ATOM 524   C CD1 . TYR A 1 68  ? 28.939  76.475  -90.769  1.00 40.00 ? 72  TYR A CD1 1 
ATOM 525   C CD2 . TYR A 1 68  ? 29.910  74.319  -90.573  1.00 40.00 ? 72  TYR A CD2 1 
ATOM 526   C CE1 . TYR A 1 68  ? 29.937  76.859  -91.637  1.00 40.00 ? 72  TYR A CE1 1 
ATOM 527   C CE2 . TYR A 1 68  ? 30.917  74.698  -91.436  1.00 40.00 ? 72  TYR A CE2 1 
ATOM 528   C CZ  . TYR A 1 68  ? 30.920  75.965  -91.969  1.00 40.00 ? 72  TYR A CZ  1 
ATOM 529   O OH  . TYR A 1 68  ? 31.925  76.332  -92.832  1.00 40.00 ? 72  TYR A OH  1 
ATOM 530   N N   . VAL A 1 69  ? 27.610  72.838  -91.902  1.00 40.00 ? 73  VAL A N   1 
ATOM 531   C CA  . VAL A 1 69  ? 28.242  71.769  -92.685  1.00 40.00 ? 73  VAL A CA  1 
ATOM 532   C C   . VAL A 1 69  ? 29.558  72.239  -93.264  1.00 40.00 ? 73  VAL A C   1 
ATOM 533   O O   . VAL A 1 69  ? 29.704  73.363  -93.779  1.00 40.00 ? 73  VAL A O   1 
ATOM 534   C CB  . VAL A 1 69  ? 27.317  71.272  -93.797  1.00 40.00 ? 73  VAL A CB  1 
ATOM 535   C CG1 . VAL A 1 69  ? 28.066  70.504  -94.865  1.00 40.00 ? 73  VAL A CG1 1 
ATOM 536   C CG2 . VAL A 1 69  ? 26.230  70.417  -93.197  1.00 40.00 ? 73  VAL A CG2 1 
ATOM 537   N N   . ASP A 1 70  ? 30.594  71.425  -93.149  1.00 40.00 ? 74  ASP A N   1 
ATOM 538   C CA  . ASP A 1 70  ? 31.868  71.962  -93.614  1.00 40.00 ? 74  ASP A CA  1 
ATOM 539   C C   . ASP A 1 70  ? 32.056  72.032  -95.104  1.00 40.00 ? 74  ASP A C   1 
ATOM 540   O O   . ASP A 1 70  ? 31.948  71.012  -95.773  1.00 40.00 ? 74  ASP A O   1 
ATOM 541   C CB  . ASP A 1 70  ? 33.033  71.228  -92.945  1.00 40.00 ? 74  ASP A CB  1 
ATOM 542   C CG  . ASP A 1 70  ? 34.298  72.072  -93.024  1.00 40.00 ? 74  ASP A CG  1 
ATOM 543   O OD1 . ASP A 1 70  ? 34.514  72.839  -92.068  1.00 40.00 ? 74  ASP A OD1 1 
ATOM 544   O OD2 . ASP A 1 70  ? 35.009  71.930  -94.034  1.00 40.00 ? 74  ASP A OD2 1 
ATOM 545   N N   . THR A 1 71  ? 32.389  73.229  -95.562  1.00 40.00 ? 75  THR A N   1 
ATOM 546   C CA  . THR A 1 71  ? 32.703  73.443  -96.975  1.00 40.00 ? 75  THR A CA  1 
ATOM 547   C C   . THR A 1 71  ? 34.224  73.299  -97.085  1.00 40.00 ? 75  THR A C   1 
ATOM 548   O O   . THR A 1 71  ? 34.726  72.169  -97.194  1.00 40.00 ? 75  THR A O   1 
ATOM 549   C CB  . THR A 1 71  ? 32.284  74.806  -97.513  1.00 40.00 ? 75  THR A CB  1 
ATOM 550   O OG1 . THR A 1 71  ? 31.511  75.557  -96.552  1.00 40.00 ? 75  THR A OG1 1 
ATOM 551   C CG2 . THR A 1 71  ? 31.398  74.628  -98.750  1.00 40.00 ? 75  THR A CG2 1 
ATOM 552   N N   . LEU A 1 72  ? 34.961  74.381  -96.958  1.00 40.00 ? 76  LEU A N   1 
ATOM 553   C CA  . LEU A 1 72  ? 36.405  74.423  -97.000  1.00 40.00 ? 76  LEU A CA  1 
ATOM 554   C C   . LEU A 1 72  ? 37.032  73.579  -98.093  1.00 40.00 ? 76  LEU A C   1 
ATOM 555   O O   . LEU A 1 72  ? 37.533  74.132  -99.082  1.00 40.00 ? 76  LEU A O   1 
ATOM 556   C CB  . LEU A 1 72  ? 37.056  74.102  -95.651  1.00 40.00 ? 76  LEU A CB  1 
ATOM 557   C CG  . LEU A 1 72  ? 38.596  74.210  -95.625  1.00 40.00 ? 76  LEU A CG  1 
ATOM 558   C CD1 . LEU A 1 72  ? 39.073  75.560  -96.123  1.00 40.00 ? 76  LEU A CD1 1 
ATOM 559   C CD2 . LEU A 1 72  ? 39.177  73.918  -94.251  1.00 40.00 ? 76  LEU A CD2 1 
ATOM 560   N N   . TYR A 1 73  ? 37.070  72.276  -97.959  1.00 40.00 ? 77  TYR A N   1 
ATOM 561   C CA  . TYR A 1 73  ? 37.646  71.366  -98.946  1.00 40.00 ? 77  TYR A CA  1 
ATOM 562   C C   . TYR A 1 73  ? 36.558  70.380  -99.368  1.00 40.00 ? 77  TYR A C   1 
ATOM 563   O O   . TYR A 1 73  ? 36.424  69.281  -98.829  1.00 40.00 ? 77  TYR A O   1 
ATOM 564   C CB  . TYR A 1 73  ? 38.831  70.644  -98.314  1.00 40.00 ? 77  TYR A CB  1 
ATOM 565   C CG  . TYR A 1 73  ? 40.029  71.511  -97.990  1.00 40.00 ? 77  TYR A CG  1 
ATOM 566   C CD1 . TYR A 1 73  ? 40.623  72.289  -98.978  1.00 40.00 ? 77  TYR A CD1 1 
ATOM 567   C CD2 . TYR A 1 73  ? 40.573  71.565  -96.716  1.00 40.00 ? 77  TYR A CD2 1 
ATOM 568   C CE1 . TYR A 1 73  ? 41.713  73.086  -98.706  1.00 40.00 ? 77  TYR A CE1 1 
ATOM 569   C CE2 . TYR A 1 73  ? 41.669  72.360  -96.433  1.00 40.00 ? 77  TYR A CE2 1 
ATOM 570   C CZ  . TYR A 1 73  ? 42.240  73.119  -97.434  1.00 40.00 ? 77  TYR A CZ  1 
ATOM 571   O OH  . TYR A 1 73  ? 43.336  73.914  -97.155  1.00 40.00 ? 77  TYR A OH  1 
ATOM 572   N N   . PRO A 1 74  ? 35.732  70.798  -100.321 1.00 40.00 ? 78  PRO A N   1 
ATOM 573   C CA  . PRO A 1 74  ? 34.611  70.015  -100.807 1.00 40.00 ? 78  PRO A CA  1 
ATOM 574   C C   . PRO A 1 74  ? 35.027  68.787  -101.578 1.00 40.00 ? 78  PRO A C   1 
ATOM 575   O O   . PRO A 1 74  ? 35.852  68.856  -102.493 1.00 40.00 ? 78  PRO A O   1 
ATOM 576   C CB  . PRO A 1 74  ? 33.820  70.981  -101.651 1.00 40.00 ? 78  PRO A CB  1 
ATOM 577   C CG  . PRO A 1 74  ? 34.737  72.085  -102.020 1.00 40.00 ? 78  PRO A CG  1 
ATOM 578   C CD  . PRO A 1 74  ? 35.848  72.087  -101.039 1.00 40.00 ? 78  PRO A CD  1 
ATOM 579   N N   . GLY A 1 75  ? 34.475  67.646  -101.155 1.00 40.00 ? 79  GLY A N   1 
ATOM 580   C CA  . GLY A 1 75  ? 34.820  66.390  -101.788 1.00 40.00 ? 79  GLY A CA  1 
ATOM 581   C C   . GLY A 1 75  ? 36.066  65.785  -101.159 1.00 40.00 ? 79  GLY A C   1 
ATOM 582   O O   . GLY A 1 75  ? 36.421  64.661  -101.556 1.00 40.00 ? 79  GLY A O   1 
ATOM 583   N N   . PHE A 1 76  ? 36.705  66.462  -100.208 1.00 40.00 ? 80  PHE A N   1 
ATOM 584   C CA  . PHE A 1 76  ? 37.904  65.939  -99.547  1.00 40.00 ? 80  PHE A CA  1 
ATOM 585   C C   . PHE A 1 76  ? 37.526  65.030  -98.383  1.00 40.00 ? 80  PHE A C   1 
ATOM 586   O O   . PHE A 1 76  ? 36.871  65.465  -97.427  1.00 40.00 ? 80  PHE A O   1 
ATOM 587   C CB  . PHE A 1 76  ? 38.790  67.081  -99.039  1.00 40.00 ? 80  PHE A CB  1 
ATOM 588   C CG  . PHE A 1 76  ? 39.930  66.649  -98.154  1.00 40.00 ? 80  PHE A CG  1 
ATOM 589   C CD1 . PHE A 1 76  ? 40.922  65.826  -98.640  1.00 40.00 ? 80  PHE A CD1 1 
ATOM 590   C CD2 . PHE A 1 76  ? 40.008  67.076  -96.839  1.00 40.00 ? 80  PHE A CD2 1 
ATOM 591   C CE1 . PHE A 1 76  ? 41.976  65.424  -97.847  1.00 40.00 ? 80  PHE A CE1 1 
ATOM 592   C CE2 . PHE A 1 76  ? 41.063  66.703  -96.044  1.00 40.00 ? 80  PHE A CE2 1 
ATOM 593   C CZ  . PHE A 1 76  ? 42.043  65.869  -96.546  1.00 40.00 ? 80  PHE A CZ  1 
ATOM 594   N N   . GLU A 1 77  ? 37.973  63.788  -98.432  1.00 40.00 ? 81  GLU A N   1 
ATOM 595   C CA  . GLU A 1 77  ? 37.664  62.828  -97.373  1.00 40.00 ? 81  GLU A CA  1 
ATOM 596   C C   . GLU A 1 77  ? 38.004  63.313  -95.977  1.00 40.00 ? 81  GLU A C   1 
ATOM 597   O O   . GLU A 1 77  ? 37.251  63.101  -95.011  1.00 40.00 ? 81  GLU A O   1 
ATOM 598   C CB  . GLU A 1 77  ? 38.398  61.496  -97.645  1.00 40.00 ? 81  GLU A CB  1 
ATOM 599   C CG  . GLU A 1 77  ? 37.981  60.372  -96.717  1.00 40.00 ? 81  GLU A CG  1 
ATOM 600   C CD  . GLU A 1 77  ? 39.041  59.301  -96.543  1.00 40.00 ? 81  GLU A CD  1 
ATOM 601   O OE1 . GLU A 1 77  ? 39.011  58.285  -97.285  1.00 40.00 ? 81  GLU A OE1 1 
ATOM 602   O OE2 . GLU A 1 77  ? 39.936  59.431  -95.661  1.00 40.00 ? 81  GLU A OE2 1 
ATOM 603   N N   . GLY A 1 78  ? 39.147  63.981  -95.820  1.00 40.00 ? 82  GLY A N   1 
ATOM 604   C CA  . GLY A 1 78  ? 39.578  64.440  -94.509  1.00 40.00 ? 82  GLY A CA  1 
ATOM 605   C C   . GLY A 1 78  ? 38.570  65.310  -93.776  1.00 40.00 ? 82  GLY A C   1 
ATOM 606   O O   . GLY A 1 78  ? 38.487  65.261  -92.535  1.00 40.00 ? 82  GLY A O   1 
ATOM 607   N N   . THR A 1 79  ? 37.853  66.145  -94.528  1.00 40.00 ? 83  THR A N   1 
ATOM 608   C CA  . THR A 1 79  ? 36.851  66.995  -93.895  1.00 40.00 ? 83  THR A CA  1 
ATOM 609   C C   . THR A 1 79  ? 35.473  66.337  -94.001  1.00 40.00 ? 83  THR A C   1 
ATOM 610   O O   . THR A 1 79  ? 34.714  66.270  -93.033  1.00 40.00 ? 83  THR A O   1 
ATOM 611   C CB  . THR A 1 79  ? 36.764  68.348  -94.620  1.00 40.00 ? 83  THR A CB  1 
ATOM 612   O OG1 . THR A 1 79  ? 36.946  68.125  -96.030  1.00 40.00 ? 83  THR A OG1 1 
ATOM 613   C CG2 . THR A 1 79  ? 37.831  69.307  -94.147  1.00 40.00 ? 83  THR A CG2 1 
ATOM 614   N N   . GLU A 1 80  ? 35.164  65.851  -95.205  1.00 40.00 ? 84  GLU A N   1 
ATOM 615   C CA  . GLU A 1 80  ? 33.861  65.251  -95.431  1.00 40.00 ? 84  GLU A CA  1 
ATOM 616   C C   . GLU A 1 80  ? 33.537  64.199  -94.405  1.00 40.00 ? 84  GLU A C   1 
ATOM 617   O O   . GLU A 1 80  ? 32.468  64.256  -93.778  1.00 40.00 ? 84  GLU A O   1 
ATOM 618   C CB  . GLU A 1 80  ? 33.725  64.695  -96.827  1.00 40.00 ? 84  GLU A CB  1 
ATOM 619   C CG  . GLU A 1 80  ? 33.817  65.656  -97.987  1.00 40.00 ? 84  GLU A CG  1 
ATOM 620   C CD  . GLU A 1 80  ? 32.798  66.761  -98.025  1.00 40.00 ? 84  GLU A CD  1 
ATOM 621   O OE1 . GLU A 1 80  ? 32.960  67.678  -98.879  1.00 40.00 ? 84  GLU A OE1 1 
ATOM 622   O OE2 . GLU A 1 80  ? 31.835  66.734  -97.213  1.00 40.00 ? 84  GLU A OE2 1 
ATOM 623   N N   . MET A 1 81  ? 34.452  63.283  -94.118  1.00 40.00 ? 85  MET A N   1 
ATOM 624   C CA  . MET A 1 81  ? 34.243  62.209  -93.143  1.00 40.00 ? 85  MET A CA  1 
ATOM 625   C C   . MET A 1 81  ? 33.659  62.662  -91.820  1.00 40.00 ? 85  MET A C   1 
ATOM 626   O O   . MET A 1 81  ? 33.168  61.862  -91.021  1.00 40.00 ? 85  MET A O   1 
ATOM 627   C CB  . MET A 1 81  ? 35.575  61.493  -92.878  1.00 40.00 ? 85  MET A CB  1 
ATOM 628   C CG  . MET A 1 81  ? 36.569  62.411  -92.168  1.00 40.00 ? 85  MET A CG  1 
ATOM 629   S SD  . MET A 1 81  ? 38.066  61.546  -91.671  1.00 40.00 ? 85  MET A SD  1 
ATOM 630   C CE  . MET A 1 81  ? 37.432  60.531  -90.342  1.00 40.00 ? 85  MET A CE  1 
ATOM 631   N N   . TRP A 1 82  ? 33.713  63.952  -91.524  1.00 40.00 ? 86  TRP A N   1 
ATOM 632   C CA  . TRP A 1 82  ? 33.196  64.515  -90.304  1.00 40.00 ? 86  TRP A CA  1 
ATOM 633   C C   . TRP A 1 82  ? 31.790  65.083  -90.432  1.00 40.00 ? 86  TRP A C   1 
ATOM 634   O O   . TRP A 1 82  ? 31.123  65.236  -89.411  1.00 40.00 ? 86  TRP A O   1 
ATOM 635   C CB  . TRP A 1 82  ? 34.190  65.613  -89.837  1.00 40.00 ? 86  TRP A CB  1 
ATOM 636   C CG  . TRP A 1 82  ? 35.535  65.014  -89.529  1.00 40.00 ? 86  TRP A CG  1 
ATOM 637   C CD1 . TRP A 1 82  ? 36.702  65.337  -90.145  1.00 40.00 ? 86  TRP A CD1 1 
ATOM 638   C CD2 . TRP A 1 82  ? 35.839  63.998  -88.570  1.00 40.00 ? 86  TRP A CD2 1 
ATOM 639   N NE1 . TRP A 1 82  ? 37.733  64.575  -89.625  1.00 40.00 ? 86  TRP A NE1 1 
ATOM 640   C CE2 . TRP A 1 82  ? 37.227  63.750  -88.664  1.00 40.00 ? 86  TRP A CE2 1 
ATOM 641   C CE3 . TRP A 1 82  ? 35.089  63.272  -87.644  1.00 40.00 ? 86  TRP A CE3 1 
ATOM 642   C CZ2 . TRP A 1 82  ? 37.881  62.823  -87.859  1.00 40.00 ? 86  TRP A CZ2 1 
ATOM 643   C CZ3 . TRP A 1 82  ? 35.724  62.336  -86.848  1.00 40.00 ? 86  TRP A CZ3 1 
ATOM 644   C CH2 . TRP A 1 82  ? 37.110  62.120  -86.958  1.00 40.00 ? 86  TRP A CH2 1 
ATOM 645   N N   . ASN A 1 83  ? 31.396  65.367  -91.648  1.00 40.00 ? 87  ASN A N   1 
ATOM 646   C CA  . ASN A 1 83  ? 30.131  65.913  -92.064  1.00 40.00 ? 87  ASN A CA  1 
ATOM 647   C C   . ASN A 1 83  ? 28.947  64.986  -91.866  1.00 40.00 ? 87  ASN A C   1 
ATOM 648   O O   . ASN A 1 83  ? 29.071  63.765  -91.712  1.00 40.00 ? 87  ASN A O   1 
ATOM 649   C CB  . ASN A 1 83  ? 30.292  66.316  -93.545  1.00 40.00 ? 87  ASN A CB  1 
ATOM 650   C CG  . ASN A 1 83  ? 30.615  67.785  -93.668  1.00 40.00 ? 87  ASN A CG  1 
ATOM 651   O OD1 . ASN A 1 83  ? 30.238  68.523  -92.734  1.00 40.00 ? 87  ASN A OD1 1 
ATOM 652   N ND2 . ASN A 1 83  ? 31.265  68.232  -94.738  1.00 40.00 ? 87  ASN A ND2 1 
ATOM 653   N N   . PRO A 1 84  ? 27.739  65.534  -91.855  1.00 40.00 ? 88  PRO A N   1 
ATOM 654   C CA  . PRO A 1 84  ? 26.527  64.755  -91.627  1.00 40.00 ? 88  PRO A CA  1 
ATOM 655   C C   . PRO A 1 84  ? 26.372  63.750  -92.751  1.00 40.00 ? 88  PRO A C   1 
ATOM 656   O O   . PRO A 1 84  ? 26.771  64.069  -93.880  1.00 40.00 ? 88  PRO A O   1 
ATOM 657   C CB  . PRO A 1 84  ? 25.433  65.761  -91.457  1.00 40.00 ? 88  PRO A CB  1 
ATOM 658   C CG  . PRO A 1 84  ? 26.010  67.108  -91.667  1.00 40.00 ? 88  PRO A CG  1 
ATOM 659   C CD  . PRO A 1 84  ? 27.444  66.968  -92.067  1.00 40.00 ? 88  PRO A CD  1 
ATOM 660   N N   . ASN A 1 85  ? 25.894  62.535  -92.426  1.00 40.00 ? 89  ASN A N   1 
ATOM 661   C CA  . ASN A 1 85  ? 25.768  61.518  -93.482  1.00 40.00 ? 89  ASN A CA  1 
ATOM 662   C C   . ASN A 1 85  ? 24.304  61.070  -93.563  1.00 40.00 ? 89  ASN A C   1 
ATOM 663   O O   . ASN A 1 85  ? 23.888  60.096  -94.192  1.00 40.00 ? 89  ASN A O   1 
ATOM 664   C CB  . ASN A 1 85  ? 26.665  60.318  -93.259  1.00 40.00 ? 89  ASN A CB  1 
ATOM 665   C CG  . ASN A 1 85  ? 26.362  59.596  -91.955  1.00 40.00 ? 89  ASN A CG  1 
ATOM 666   O OD1 . ASN A 1 85  ? 25.618  60.043  -91.072  1.00 40.00 ? 89  ASN A OD1 1 
ATOM 667   N ND2 . ASN A 1 85  ? 26.987  58.422  -91.783  1.00 40.00 ? 89  ASN A ND2 1 
ATOM 668   N N   . ARG A 1 86  ? 23.503  61.819  -92.825  1.00 40.00 ? 90  ARG A N   1 
ATOM 669   C CA  . ARG A 1 86  ? 22.073  61.623  -92.762  1.00 40.00 ? 90  ARG A CA  1 
ATOM 670   C C   . ARG A 1 86  ? 21.420  62.989  -92.980  1.00 40.00 ? 90  ARG A C   1 
ATOM 671   O O   . ARG A 1 86  ? 22.095  64.031  -93.147  1.00 40.00 ? 90  ARG A O   1 
ATOM 672   C CB  . ARG A 1 86  ? 21.753  60.997  -91.430  1.00 40.00 ? 90  ARG A CB  1 
ATOM 673   C CG  . ARG A 1 86  ? 21.664  59.501  -91.361  1.00 40.00 ? 90  ARG A CG  1 
ATOM 674   C CD  . ARG A 1 86  ? 21.760  58.774  -92.695  1.00 40.00 ? 90  ARG A CD  1 
ATOM 675   N NE  . ARG A 1 86  ? 21.899  57.349  -92.492  1.00 40.00 ? 90  ARG A NE  1 
ATOM 676   C CZ  . ARG A 1 86  ? 22.801  56.525  -93.017  1.00 40.00 ? 90  ARG A CZ  1 
ATOM 677   N NH1 . ARG A 1 86  ? 23.738  56.952  -93.858  1.00 40.00 ? 90  ARG A NH1 1 
ATOM 678   N NH2 . ARG A 1 86  ? 22.743  55.230  -92.662  1.00 40.00 ? 90  ARG A NH2 1 
ATOM 679   N N   . GLU A 1 87  ? 20.090  63.041  -93.036  1.00 40.00 ? 91  GLU A N   1 
ATOM 680   C CA  . GLU A 1 87  ? 19.497  64.352  -93.251  1.00 40.00 ? 91  GLU A CA  1 
ATOM 681   C C   . GLU A 1 87  ? 19.547  65.190  -91.992  1.00 40.00 ? 91  GLU A C   1 
ATOM 682   O O   . GLU A 1 87  ? 19.474  64.674  -90.877  1.00 40.00 ? 91  GLU A O   1 
ATOM 683   C CB  . GLU A 1 87  ? 18.077  64.209  -93.808  1.00 40.00 ? 91  GLU A CB  1 
ATOM 684   C CG  . GLU A 1 87  ? 18.165  64.118  -95.347  1.00 40.00 ? 91  GLU A CG  1 
ATOM 685   C CD  . GLU A 1 87  ? 16.829  64.452  -95.967  1.00 40.00 ? 91  GLU A CD  1 
ATOM 686   O OE1 . GLU A 1 87  ? 16.476  63.792  -96.973  1.00 40.00 ? 91  GLU A OE1 1 
ATOM 687   O OE2 . GLU A 1 87  ? 16.148  65.361  -95.435  1.00 40.00 ? 91  GLU A OE2 1 
ATOM 688   N N   . LEU A 1 88  ? 19.679  66.508  -92.255  1.00 40.00 ? 92  LEU A N   1 
ATOM 689   C CA  . LEU A 1 88  ? 19.696  67.402  -91.096  1.00 40.00 ? 92  LEU A CA  1 
ATOM 690   C C   . LEU A 1 88  ? 18.298  67.518  -90.533  1.00 40.00 ? 92  LEU A C   1 
ATOM 691   O O   . LEU A 1 88  ? 17.376  67.453  -91.338  1.00 40.00 ? 92  LEU A O   1 
ATOM 692   C CB  . LEU A 1 88  ? 20.154  68.795  -91.584  1.00 40.00 ? 92  LEU A CB  1 
ATOM 693   C CG  . LEU A 1 88  ? 21.694  68.743  -91.813  1.00 40.00 ? 92  LEU A CG  1 
ATOM 694   C CD1 . LEU A 1 88  ? 22.176  70.019  -92.444  1.00 40.00 ? 92  LEU A CD1 1 
ATOM 695   C CD2 . LEU A 1 88  ? 22.363  68.420  -90.481  1.00 40.00 ? 92  LEU A CD2 1 
ATOM 696   N N   . SER A 1 89  ? 18.118  67.707  -89.246  1.00 40.00 ? 93  SER A N   1 
ATOM 697   C CA  . SER A 1 89  ? 16.770  67.952  -88.776  1.00 40.00 ? 93  SER A CA  1 
ATOM 698   C C   . SER A 1 89  ? 16.739  68.300  -87.302  1.00 40.00 ? 93  SER A C   1 
ATOM 699   O O   . SER A 1 89  ? 17.476  67.661  -86.524  1.00 40.00 ? 93  SER A O   1 
ATOM 700   C CB  . SER A 1 89  ? 15.851  66.763  -89.007  1.00 40.00 ? 93  SER A CB  1 
ATOM 701   O OG  . SER A 1 89  ? 14.963  66.704  -87.869  1.00 40.00 ? 93  SER A OG  1 
ATOM 702   N N   . GLU A 1 90  ? 15.821  69.159  -86.856  1.00 40.00 ? 94  GLU A N   1 
ATOM 703   C CA  . GLU A 1 90  ? 15.776  69.402  -85.406  1.00 40.00 ? 94  GLU A CA  1 
ATOM 704   C C   . GLU A 1 90  ? 15.262  68.135  -84.743  1.00 40.00 ? 94  GLU A C   1 
ATOM 705   O O   . GLU A 1 90  ? 15.390  67.935  -83.523  1.00 40.00 ? 94  GLU A O   1 
ATOM 706   C CB  . GLU A 1 90  ? 14.945  70.625  -85.089  1.00 40.00 ? 94  GLU A CB  1 
ATOM 707   C CG  . GLU A 1 90  ? 15.522  71.949  -85.617  1.00 40.00 ? 94  GLU A CG  1 
ATOM 708   C CD  . GLU A 1 90  ? 14.869  73.130  -84.901  1.00 40.00 ? 94  GLU A CD  1 
ATOM 709   O OE1 . GLU A 1 90  ? 15.046  73.216  -83.646  1.00 40.00 ? 94  GLU A OE1 1 
ATOM 710   O OE2 . GLU A 1 90  ? 14.187  73.947  -85.557  1.00 40.00 ? 94  GLU A OE2 1 
ATOM 711   N N   . ASP A 1 91  ? 14.637  67.227  -85.491  1.00 40.00 ? 95  ASP A N   1 
ATOM 712   C CA  . ASP A 1 91  ? 14.160  65.982  -84.901  1.00 40.00 ? 95  ASP A CA  1 
ATOM 713   C C   . ASP A 1 91  ? 15.262  64.916  -85.077  1.00 40.00 ? 95  ASP A C   1 
ATOM 714   O O   . ASP A 1 91  ? 15.267  64.258  -86.133  1.00 40.00 ? 95  ASP A O   1 
ATOM 715   C CB  . ASP A 1 91  ? 12.867  65.525  -85.537  1.00 40.00 ? 95  ASP A CB  1 
ATOM 716   C CG  . ASP A 1 91  ? 12.324  64.315  -84.786  1.00 40.00 ? 95  ASP A CG  1 
ATOM 717   O OD1 . ASP A 1 91  ? 12.888  64.054  -83.682  1.00 40.00 ? 95  ASP A OD1 1 
ATOM 718   O OD2 . ASP A 1 91  ? 11.386  63.657  -85.268  1.00 40.00 ? 95  ASP A OD2 1 
ATOM 719   N N   . CYS A 1 92  ? 16.134  64.845  -84.050  1.00 40.00 ? 96  CYS A N   1 
ATOM 720   C CA  . CYS A 1 92  ? 17.324  64.021  -84.085  1.00 40.00 ? 96  CYS A CA  1 
ATOM 721   C C   . CYS A 1 92  ? 17.721  63.330  -82.806  1.00 40.00 ? 96  CYS A C   1 
ATOM 722   O O   . CYS A 1 92  ? 18.778  62.672  -82.772  1.00 40.00 ? 96  CYS A O   1 
ATOM 723   C CB  . CYS A 1 92  ? 18.539  64.951  -84.462  1.00 40.00 ? 96  CYS A CB  1 
ATOM 724   S SG  . CYS A 1 92  ? 18.788  66.285  -83.273  1.00 40.00 ? 96  CYS A SG  1 
ATOM 725   N N   . LEU A 1 93  ? 16.939  63.444  -81.748  1.00 40.00 ? 97  LEU A N   1 
ATOM 726   C CA  . LEU A 1 93  ? 17.238  62.802  -80.482  1.00 40.00 ? 97  LEU A CA  1 
ATOM 727   C C   . LEU A 1 93  ? 16.987  61.324  -80.442  1.00 40.00 ? 97  LEU A C   1 
ATOM 728   O O   . LEU A 1 93  ? 15.994  60.813  -79.890  1.00 40.00 ? 97  LEU A O   1 
ATOM 729   C CB  . LEU A 1 93  ? 16.457  63.497  -79.336  1.00 40.00 ? 97  LEU A CB  1 
ATOM 730   C CG  . LEU A 1 93  ? 16.926  64.945  -79.172  1.00 40.00 ? 97  LEU A CG  1 
ATOM 731   C CD1 . LEU A 1 93  ? 16.533  65.559  -77.838  1.00 40.00 ? 97  LEU A CD1 1 
ATOM 732   C CD2 . LEU A 1 93  ? 18.425  65.031  -79.398  1.00 40.00 ? 97  LEU A CD2 1 
ATOM 733   N N   . TYR A 1 94  ? 17.873  60.557  -81.063  1.00 40.00 ? 98  TYR A N   1 
ATOM 734   C CA  . TYR A 1 94  ? 17.826  59.109  -81.110  1.00 40.00 ? 98  TYR A CA  1 
ATOM 735   C C   . TYR A 1 94  ? 19.168  58.572  -80.636  1.00 40.00 ? 98  TYR A C   1 
ATOM 736   O O   . TYR A 1 94  ? 20.086  59.397  -80.510  1.00 40.00 ? 98  TYR A O   1 
ATOM 737   C CB  . TYR A 1 94  ? 17.604  58.662  -82.572  1.00 40.00 ? 98  TYR A CB  1 
ATOM 738   C CG  . TYR A 1 94  ? 16.327  59.315  -83.075  1.00 40.00 ? 98  TYR A CG  1 
ATOM 739   C CD1 . TYR A 1 94  ? 15.204  59.365  -82.256  1.00 40.00 ? 98  TYR A CD1 1 
ATOM 740   C CD2 . TYR A 1 94  ? 16.197  59.911  -84.279  1.00 40.00 ? 98  TYR A CD2 1 
ATOM 741   C CE1 . TYR A 1 94  ? 14.029  59.976  -82.632  1.00 40.00 ? 98  TYR A CE1 1 
ATOM 742   C CE2 . TYR A 1 94  ? 15.034  60.489  -84.725  1.00 40.00 ? 98  TYR A CE2 1 
ATOM 743   C CZ  . TYR A 1 94  ? 13.943  60.529  -83.900  1.00 40.00 ? 98  TYR A CZ  1 
ATOM 744   O OH  . TYR A 1 94  ? 12.782  61.122  -84.308  1.00 40.00 ? 98  TYR A OH  1 
ATOM 745   N N   . LEU A 1 95  ? 19.241  57.287  -80.341  1.00 40.00 ? 99  LEU A N   1 
ATOM 746   C CA  . LEU A 1 95  ? 20.553  56.731  -79.953  1.00 40.00 ? 99  LEU A CA  1 
ATOM 747   C C   . LEU A 1 95  ? 20.718  55.441  -80.715  1.00 40.00 ? 99  LEU A C   1 
ATOM 748   O O   . LEU A 1 95  ? 19.877  55.064  -81.549  1.00 40.00 ? 99  LEU A O   1 
ATOM 749   C CB  . LEU A 1 95  ? 20.620  56.589  -78.460  1.00 40.00 ? 99  LEU A CB  1 
ATOM 750   C CG  . LEU A 1 95  ? 19.573  55.692  -77.832  1.00 40.00 ? 99  LEU A CG  1 
ATOM 751   C CD1 . LEU A 1 95  ? 20.042  54.244  -78.044  1.00 40.00 ? 99  LEU A CD1 1 
ATOM 752   C CD2 . LEU A 1 95  ? 19.403  55.951  -76.333  1.00 40.00 ? 99  LEU A CD2 1 
ATOM 753   N N   . ASN A 1 96  ? 21.821  54.751  -80.559  1.00 40.00 ? 100 ASN A N   1 
ATOM 754   C CA  . ASN A 1 96  ? 22.001  53.478  -81.241  1.00 40.00 ? 100 ASN A CA  1 
ATOM 755   C C   . ASN A 1 96  ? 22.496  52.443  -80.233  1.00 40.00 ? 100 ASN A C   1 
ATOM 756   O O   . ASN A 1 96  ? 23.021  52.755  -79.154  1.00 40.00 ? 100 ASN A O   1 
ATOM 757   C CB  . ASN A 1 96  ? 22.999  53.548  -82.399  1.00 40.00 ? 100 ASN A CB  1 
ATOM 758   C CG  . ASN A 1 96  ? 22.607  54.734  -83.287  1.00 40.00 ? 100 ASN A CG  1 
ATOM 759   O OD1 . ASN A 1 96  ? 21.566  54.710  -83.902  1.00 40.00 ? 100 ASN A OD1 1 
ATOM 760   N ND2 . ASN A 1 96  ? 23.453  55.735  -83.229  1.00 40.00 ? 100 ASN A ND2 1 
ATOM 761   N N   . VAL A 1 97  ? 22.296  51.172  -80.599  1.00 40.00 ? 101 VAL A N   1 
ATOM 762   C CA  . VAL A 1 97  ? 22.806  50.090  -79.783  1.00 40.00 ? 101 VAL A CA  1 
ATOM 763   C C   . VAL A 1 97  ? 23.378  48.989  -80.697  1.00 40.00 ? 101 VAL A C   1 
ATOM 764   O O   . VAL A 1 97  ? 22.730  48.626  -81.689  1.00 40.00 ? 101 VAL A O   1 
ATOM 765   C CB  . VAL A 1 97  ? 21.790  49.434  -78.847  1.00 40.00 ? 101 VAL A CB  1 
ATOM 766   C CG1 . VAL A 1 97  ? 22.461  48.241  -78.149  1.00 40.00 ? 101 VAL A CG1 1 
ATOM 767   C CG2 . VAL A 1 97  ? 21.253  50.384  -77.773  1.00 40.00 ? 101 VAL A CG2 1 
ATOM 768   N N   . TRP A 1 98  ? 24.555  48.515  -80.330  1.00 40.00 ? 102 TRP A N   1 
ATOM 769   C CA  . TRP A 1 98  ? 25.127  47.369  -81.018  1.00 40.00 ? 102 TRP A CA  1 
ATOM 770   C C   . TRP A 1 98  ? 25.332  46.337  -79.872  1.00 40.00 ? 102 TRP A C   1 
ATOM 771   O O   . TRP A 1 98  ? 25.764  46.722  -78.793  1.00 40.00 ? 102 TRP A O   1 
ATOM 772   C CB  . TRP A 1 98  ? 26.343  47.522  -81.825  1.00 40.00 ? 102 TRP A CB  1 
ATOM 773   C CG  . TRP A 1 98  ? 26.497  48.495  -82.935  1.00 40.00 ? 102 TRP A CG  1 
ATOM 774   C CD1 . TRP A 1 98  ? 26.806  48.210  -84.248  1.00 40.00 ? 102 TRP A CD1 1 
ATOM 775   C CD2 . TRP A 1 98  ? 26.434  49.925  -82.873  1.00 40.00 ? 102 TRP A CD2 1 
ATOM 776   N NE1 . TRP A 1 98  ? 26.926  49.365  -85.002  1.00 40.00 ? 102 TRP A NE1 1 
ATOM 777   C CE2 . TRP A 1 98  ? 26.708  50.425  -84.164  1.00 40.00 ? 102 TRP A CE2 1 
ATOM 778   C CE3 . TRP A 1 98  ? 26.179  50.827  -81.834  1.00 40.00 ? 102 TRP A CE3 1 
ATOM 779   C CZ2 . TRP A 1 98  ? 26.701  51.782  -84.451  1.00 40.00 ? 102 TRP A CZ2 1 
ATOM 780   C CZ3 . TRP A 1 98  ? 26.177  52.176  -82.124  1.00 40.00 ? 102 TRP A CZ3 1 
ATOM 781   C CH2 . TRP A 1 98  ? 26.436  52.634  -83.419  1.00 40.00 ? 102 TRP A CH2 1 
ATOM 782   N N   . THR A 1 99  ? 24.945  45.111  -80.125  1.00 40.00 ? 103 THR A N   1 
ATOM 783   C CA  . THR A 1 99  ? 25.072  43.983  -79.197  1.00 40.00 ? 103 THR A CA  1 
ATOM 784   C C   . THR A 1 99  ? 25.558  42.844  -80.110  1.00 40.00 ? 103 THR A C   1 
ATOM 785   O O   . THR A 1 99  ? 25.156  42.841  -81.287  1.00 40.00 ? 103 THR A O   1 
ATOM 786   C CB  . THR A 1 99  ? 23.749  43.553  -78.568  1.00 40.00 ? 103 THR A CB  1 
ATOM 787   O OG1 . THR A 1 99  ? 23.301  44.518  -77.603  1.00 40.00 ? 103 THR A OG1 1 
ATOM 788   C CG2 . THR A 1 99  ? 23.788  42.213  -77.837  1.00 40.00 ? 103 THR A CG2 1 
ATOM 789   N N   . PRO A 1 100 ? 26.366  41.957  -79.571  1.00 40.00 ? 104 PRO A N   1 
ATOM 790   C CA  . PRO A 1 100 ? 26.846  40.796  -80.323  1.00 40.00 ? 104 PRO A CA  1 
ATOM 791   C C   . PRO A 1 100 ? 25.698  39.840  -80.644  1.00 40.00 ? 104 PRO A C   1 
ATOM 792   O O   . PRO A 1 100 ? 24.796  39.751  -79.800  1.00 40.00 ? 104 PRO A O   1 
ATOM 793   C CB  . PRO A 1 100 ? 27.820  40.149  -79.357  1.00 40.00 ? 104 PRO A CB  1 
ATOM 794   C CG  . PRO A 1 100 ? 27.338  40.542  -77.993  1.00 40.00 ? 104 PRO A CG  1 
ATOM 795   C CD  . PRO A 1 100 ? 26.841  41.954  -78.171  1.00 40.00 ? 104 PRO A CD  1 
ATOM 796   N N   . TYR A 1 101 ? 25.698  39.198  -81.799  1.00 40.00 ? 105 TYR A N   1 
ATOM 797   C CA  . TYR A 1 101 ? 24.648  38.246  -82.211  1.00 40.00 ? 105 TYR A CA  1 
ATOM 798   C C   . TYR A 1 101 ? 25.214  36.850  -81.940  1.00 40.00 ? 105 TYR A C   1 
ATOM 799   O O   . TYR A 1 101 ? 26.200  36.451  -82.566  1.00 40.00 ? 105 TYR A O   1 
ATOM 800   C CB  . TYR A 1 101 ? 24.348  38.372  -83.698  1.00 40.00 ? 105 TYR A CB  1 
ATOM 801   C CG  . TYR A 1 101 ? 23.158  37.589  -84.191  1.00 40.00 ? 105 TYR A CG  1 
ATOM 802   C CD1 . TYR A 1 101 ? 21.879  37.924  -83.747  1.00 40.00 ? 105 TYR A CD1 1 
ATOM 803   C CD2 . TYR A 1 101 ? 23.287  36.536  -85.093  1.00 40.00 ? 105 TYR A CD2 1 
ATOM 804   C CE1 . TYR A 1 101 ? 20.785  37.219  -84.203  1.00 40.00 ? 105 TYR A CE1 1 
ATOM 805   C CE2 . TYR A 1 101 ? 22.189  35.826  -85.545  1.00 40.00 ? 105 TYR A CE2 1 
ATOM 806   C CZ  . TYR A 1 101 ? 20.931  36.174  -85.086  1.00 40.00 ? 105 TYR A CZ  1 
ATOM 807   O OH  . TYR A 1 101 ? 19.800  35.498  -85.497  1.00 40.00 ? 105 TYR A OH  1 
ATOM 808   N N   . PRO A 1 102 ? 24.631  36.161  -80.982  1.00 40.00 ? 106 PRO A N   1 
ATOM 809   C CA  . PRO A 1 102 ? 23.451  36.565  -80.263  1.00 40.00 ? 106 PRO A CA  1 
ATOM 810   C C   . PRO A 1 102 ? 23.647  37.230  -78.925  1.00 40.00 ? 106 PRO A C   1 
ATOM 811   O O   . PRO A 1 102 ? 24.760  37.175  -78.390  1.00 40.00 ? 106 PRO A O   1 
ATOM 812   C CB  . PRO A 1 102 ? 22.832  35.175  -79.948  1.00 40.00 ? 106 PRO A CB  1 
ATOM 813   C CG  . PRO A 1 102 ? 24.059  34.399  -79.557  1.00 40.00 ? 106 PRO A CG  1 
ATOM 814   C CD  . PRO A 1 102 ? 25.099  34.797  -80.575  1.00 40.00 ? 106 PRO A CD  1 
ATOM 815   N N   . ARG A 1 103 ? 22.605  37.915  -78.462  1.00 40.00 ? 107 ARG A N   1 
ATOM 816   C CA  . ARG A 1 103 ? 22.681  38.626  -77.186  1.00 40.00 ? 107 ARG A CA  1 
ATOM 817   C C   . ARG A 1 103 ? 23.618  37.900  -76.241  1.00 40.00 ? 107 ARG A C   1 
ATOM 818   O O   . ARG A 1 103 ? 23.689  36.676  -76.221  1.00 40.00 ? 107 ARG A O   1 
ATOM 819   C CB  . ARG A 1 103 ? 21.294  38.803  -76.569  1.00 40.00 ? 107 ARG A CB  1 
ATOM 820   C CG  . ARG A 1 103 ? 20.610  40.050  -77.131  1.00 40.00 ? 107 ARG A CG  1 
ATOM 821   C CD  . ARG A 1 103 ? 19.706  40.698  -76.091  1.00 40.00 ? 107 ARG A CD  1 
ATOM 822   N NE  . ARG A 1 103 ? 18.338  40.203  -76.171  1.00 40.00 ? 107 ARG A NE  1 
ATOM 823   C CZ  . ARG A 1 103 ? 17.609  40.202  -77.282  1.00 40.00 ? 107 ARG A CZ  1 
ATOM 824   N NH1 . ARG A 1 103 ? 18.099  40.675  -78.427  1.00 40.00 ? 107 ARG A NH1 1 
ATOM 825   N NH2 . ARG A 1 103 ? 16.372  39.724  -77.265  1.00 40.00 ? 107 ARG A NH2 1 
ATOM 826   N N   . PRO A 1 104 ? 24.385  38.669  -75.479  1.00 40.00 ? 108 PRO A N   1 
ATOM 827   C CA  . PRO A 1 104 ? 25.342  38.102  -74.549  1.00 40.00 ? 108 PRO A CA  1 
ATOM 828   C C   . PRO A 1 104 ? 24.620  37.145  -73.610  1.00 40.00 ? 108 PRO A C   1 
ATOM 829   O O   . PRO A 1 104 ? 23.397  37.081  -73.609  1.00 40.00 ? 108 PRO A O   1 
ATOM 830   C CB  . PRO A 1 104 ? 25.905  39.272  -73.775  1.00 40.00 ? 108 PRO A CB  1 
ATOM 831   C CG  . PRO A 1 104 ? 25.062  40.451  -74.096  1.00 40.00 ? 108 PRO A CG  1 
ATOM 832   C CD  . PRO A 1 104 ? 24.367  40.148  -75.397  1.00 40.00 ? 108 PRO A CD  1 
ATOM 833   N N   . ALA A 1 105 ? 25.419  36.461  -72.813  1.00 40.00 ? 109 ALA A N   1 
ATOM 834   C CA  . ALA A 1 105 ? 24.866  35.484  -71.879  1.00 40.00 ? 109 ALA A CA  1 
ATOM 835   C C   . ALA A 1 105 ? 24.389  36.143  -70.588  1.00 40.00 ? 109 ALA A C   1 
ATOM 836   O O   . ALA A 1 105 ? 23.298  35.975  -70.070  1.00 40.00 ? 109 ALA A O   1 
ATOM 837   C CB  . ALA A 1 105 ? 25.956  34.454  -71.569  1.00 40.00 ? 109 ALA A CB  1 
ATOM 838   N N   . SER A 1 106 ? 25.316  36.930  -70.067  1.00 40.00 ? 110 SER A N   1 
ATOM 839   C CA  . SER A 1 106 ? 25.263  37.686  -68.834  1.00 40.00 ? 110 SER A CA  1 
ATOM 840   C C   . SER A 1 106 ? 25.525  39.170  -69.082  1.00 40.00 ? 110 SER A C   1 
ATOM 841   O O   . SER A 1 106 ? 26.079  39.544  -70.129  1.00 40.00 ? 110 SER A O   1 
ATOM 842   C CB  . SER A 1 106 ? 26.379  37.080  -67.956  1.00 40.00 ? 110 SER A CB  1 
ATOM 843   O OG  . SER A 1 106 ? 26.666  37.882  -66.842  1.00 40.00 ? 110 SER A OG  1 
ATOM 844   N N   . PRO A 1 107 ? 25.157  40.026  -68.136  1.00 40.00 ? 111 PRO A N   1 
ATOM 845   C CA  . PRO A 1 107 ? 25.330  41.450  -68.213  1.00 40.00 ? 111 PRO A CA  1 
ATOM 846   C C   . PRO A 1 107 ? 26.678  41.968  -68.656  1.00 40.00 ? 111 PRO A C   1 
ATOM 847   O O   . PRO A 1 107 ? 27.531  42.203  -67.784  1.00 40.00 ? 111 PRO A O   1 
ATOM 848   C CB  . PRO A 1 107 ? 25.077  41.912  -66.758  1.00 40.00 ? 111 PRO A CB  1 
ATOM 849   C CG  . PRO A 1 107 ? 24.046  40.948  -66.278  1.00 40.00 ? 111 PRO A CG  1 
ATOM 850   C CD  . PRO A 1 107 ? 24.483  39.632  -66.864  1.00 40.00 ? 111 PRO A CD  1 
ATOM 851   N N   . THR A 1 108 ? 26.860  42.182  -69.952  1.00 40.00 ? 112 THR A N   1 
ATOM 852   C CA  . THR A 1 108 ? 28.120  42.714  -70.483  1.00 40.00 ? 112 THR A CA  1 
ATOM 853   C C   . THR A 1 108 ? 28.234  44.181  -70.096  1.00 40.00 ? 112 THR A C   1 
ATOM 854   O O   . THR A 1 108 ? 27.220  44.847  -69.894  1.00 40.00 ? 112 THR A O   1 
ATOM 855   C CB  . THR A 1 108 ? 28.120  42.579  -72.019  1.00 40.00 ? 112 THR A CB  1 
ATOM 856   O OG1 . THR A 1 108 ? 28.253  41.174  -72.311  1.00 40.00 ? 112 THR A OG1 1 
ATOM 857   C CG2 . THR A 1 108 ? 29.201  43.296  -72.779  1.00 40.00 ? 112 THR A CG2 1 
ATOM 858   N N   . PRO A 1 109 ? 29.462  44.665  -70.000  1.00 40.00 ? 113 PRO A N   1 
ATOM 859   C CA  . PRO A 1 109 ? 29.732  46.072  -69.735  1.00 40.00 ? 113 PRO A CA  1 
ATOM 860   C C   . PRO A 1 109 ? 29.369  46.918  -70.962  1.00 40.00 ? 113 PRO A C   1 
ATOM 861   O O   . PRO A 1 109 ? 29.521  46.508  -72.131  1.00 40.00 ? 113 PRO A O   1 
ATOM 862   C CB  . PRO A 1 109 ? 31.241  46.076  -69.492  1.00 40.00 ? 113 PRO A CB  1 
ATOM 863   C CG  . PRO A 1 109 ? 31.748  44.996  -70.400  1.00 40.00 ? 113 PRO A CG  1 
ATOM 864   C CD  . PRO A 1 109 ? 30.725  43.901  -70.216  1.00 40.00 ? 113 PRO A CD  1 
ATOM 865   N N   . VAL A 1 110 ? 28.868  48.134  -70.702  1.00 40.00 ? 114 VAL A N   1 
ATOM 866   C CA  . VAL A 1 110 ? 28.501  49.025  -71.790  1.00 40.00 ? 114 VAL A CA  1 
ATOM 867   C C   . VAL A 1 110 ? 29.426  50.232  -71.948  1.00 40.00 ? 114 VAL A C   1 
ATOM 868   O O   . VAL A 1 110 ? 29.813  50.922  -71.005  1.00 40.00 ? 114 VAL A O   1 
ATOM 869   C CB  . VAL A 1 110 ? 27.082  49.614  -71.652  1.00 40.00 ? 114 VAL A CB  1 
ATOM 870   C CG1 . VAL A 1 110 ? 26.058  48.523  -71.888  1.00 40.00 ? 114 VAL A CG1 1 
ATOM 871   C CG2 . VAL A 1 110 ? 26.926  50.263  -70.281  1.00 40.00 ? 114 VAL A CG2 1 
ATOM 872   N N   . LEU A 1 111 ? 29.711  50.481  -73.212  1.00 40.00 ? 115 LEU A N   1 
ATOM 873   C CA  . LEU A 1 111 ? 30.500  51.596  -73.689  1.00 40.00 ? 115 LEU A CA  1 
ATOM 874   C C   . LEU A 1 111 ? 29.600  52.625  -74.395  1.00 40.00 ? 115 LEU A C   1 
ATOM 875   O O   . LEU A 1 111 ? 29.297  52.429  -75.582  1.00 40.00 ? 115 LEU A O   1 
ATOM 876   C CB  . LEU A 1 111 ? 31.518  51.099  -74.726  1.00 40.00 ? 115 LEU A CB  1 
ATOM 877   C CG  . LEU A 1 111 ? 32.984  51.092  -74.311  1.00 40.00 ? 115 LEU A CG  1 
ATOM 878   C CD1 . LEU A 1 111 ? 33.117  50.719  -72.840  1.00 40.00 ? 115 LEU A CD1 1 
ATOM 879   C CD2 . LEU A 1 111 ? 33.788  50.165  -75.214  1.00 40.00 ? 115 LEU A CD2 1 
ATOM 880   N N   . ILE A 1 112 ? 29.180  53.674  -73.720  1.00 40.00 ? 116 ILE A N   1 
ATOM 881   C CA  . ILE A 1 112 ? 28.358  54.759  -74.279  1.00 40.00 ? 116 ILE A CA  1 
ATOM 882   C C   . ILE A 1 112 ? 29.270  55.788  -74.947  1.00 40.00 ? 116 ILE A C   1 
ATOM 883   O O   . ILE A 1 112 ? 30.079  56.409  -74.227  1.00 40.00 ? 116 ILE A O   1 
ATOM 884   C CB  . ILE A 1 112 ? 27.628  55.426  -73.100  1.00 40.00 ? 116 ILE A CB  1 
ATOM 885   C CG1 . ILE A 1 112 ? 26.357  54.638  -72.752  1.00 40.00 ? 116 ILE A CG1 1 
ATOM 886   C CG2 . ILE A 1 112 ? 27.240  56.860  -73.303  1.00 40.00 ? 116 ILE A CG2 1 
ATOM 887   C CD1 . ILE A 1 112 ? 25.885  54.882  -71.315  1.00 40.00 ? 116 ILE A CD1 1 
ATOM 888   N N   . TRP A 1 113 ? 29.187  55.987  -76.252  1.00 40.00 ? 117 TRP A N   1 
ATOM 889   C CA  . TRP A 1 113 ? 30.070  56.940  -76.926  1.00 40.00 ? 117 TRP A CA  1 
ATOM 890   C C   . TRP A 1 113 ? 29.474  58.317  -77.129  1.00 40.00 ? 117 TRP A C   1 
ATOM 891   O O   . TRP A 1 113 ? 28.320  58.476  -77.536  1.00 40.00 ? 117 TRP A O   1 
ATOM 892   C CB  . TRP A 1 113 ? 30.481  56.379  -78.281  1.00 40.00 ? 117 TRP A CB  1 
ATOM 893   C CG  . TRP A 1 113 ? 30.995  57.370  -79.269  1.00 40.00 ? 117 TRP A CG  1 
ATOM 894   C CD1 . TRP A 1 113 ? 30.319  58.004  -80.259  1.00 40.00 ? 117 TRP A CD1 1 
ATOM 895   C CD2 . TRP A 1 113 ? 32.346  57.837  -79.354  1.00 40.00 ? 117 TRP A CD2 1 
ATOM 896   N NE1 . TRP A 1 113 ? 31.171  58.832  -80.971  1.00 40.00 ? 117 TRP A NE1 1 
ATOM 897   C CE2 . TRP A 1 113 ? 32.417  58.751  -80.433  1.00 40.00 ? 117 TRP A CE2 1 
ATOM 898   C CE3 . TRP A 1 113 ? 33.512  57.558  -78.626  1.00 40.00 ? 117 TRP A CE3 1 
ATOM 899   C CZ2 . TRP A 1 113 ? 33.598  59.385  -80.792  1.00 40.00 ? 117 TRP A CZ2 1 
ATOM 900   C CZ3 . TRP A 1 113 ? 34.670  58.192  -78.978  1.00 40.00 ? 117 TRP A CZ3 1 
ATOM 901   C CH2 . TRP A 1 113 ? 34.717  59.087  -80.050  1.00 40.00 ? 117 TRP A CH2 1 
ATOM 902   N N   . ILE A 1 114 ? 30.297  59.361  -76.904  1.00 40.00 ? 118 ILE A N   1 
ATOM 903   C CA  . ILE A 1 114 ? 29.785  60.722  -77.121  1.00 40.00 ? 118 ILE A CA  1 
ATOM 904   C C   . ILE A 1 114 ? 30.556  61.426  -78.212  1.00 40.00 ? 118 ILE A C   1 
ATOM 905   O O   . ILE A 1 114 ? 31.678  61.810  -77.966  1.00 40.00 ? 118 ILE A O   1 
ATOM 906   C CB  . ILE A 1 114 ? 29.794  61.540  -75.832  1.00 40.00 ? 118 ILE A CB  1 
ATOM 907   C CG1 . ILE A 1 114 ? 29.023  60.812  -74.727  1.00 40.00 ? 118 ILE A CG1 1 
ATOM 908   C CG2 . ILE A 1 114 ? 29.122  62.859  -76.142  1.00 40.00 ? 118 ILE A CG2 1 
ATOM 909   C CD1 . ILE A 1 114 ? 28.804  61.620  -73.450  1.00 40.00 ? 118 ILE A CD1 1 
ATOM 910   N N   . TYR A 1 115 ? 30.016  61.598  -79.405  1.00 40.00 ? 119 TYR A N   1 
ATOM 911   C CA  . TYR A 1 115 ? 30.722  62.244  -80.503  1.00 40.00 ? 119 TYR A CA  1 
ATOM 912   C C   . TYR A 1 115 ? 31.132  63.687  -80.174  1.00 40.00 ? 119 TYR A C   1 
ATOM 913   O O   . TYR A 1 115 ? 30.508  64.338  -79.314  1.00 40.00 ? 119 TYR A O   1 
ATOM 914   C CB  . TYR A 1 115 ? 29.897  62.246  -81.783  1.00 40.00 ? 119 TYR A CB  1 
ATOM 915   C CG  . TYR A 1 115 ? 28.612  63.039  -81.807  1.00 40.00 ? 119 TYR A CG  1 
ATOM 916   C CD1 . TYR A 1 115 ? 28.559  64.423  -81.845  1.00 40.00 ? 119 TYR A CD1 1 
ATOM 917   C CD2 . TYR A 1 115 ? 27.390  62.368  -81.825  1.00 40.00 ? 119 TYR A CD2 1 
ATOM 918   C CE1 . TYR A 1 115 ? 27.362  65.099  -81.883  1.00 40.00 ? 119 TYR A CE1 1 
ATOM 919   C CE2 . TYR A 1 115 ? 26.182  63.023  -81.861  1.00 40.00 ? 119 TYR A CE2 1 
ATOM 920   C CZ  . TYR A 1 115 ? 26.166  64.406  -81.887  1.00 40.00 ? 119 TYR A CZ  1 
ATOM 921   O OH  . TYR A 1 115 ? 24.957  65.078  -81.906  1.00 40.00 ? 119 TYR A OH  1 
ATOM 922   N N   . GLY A 1 116 ? 32.150  64.187  -80.891  1.00 40.00 ? 120 GLY A N   1 
ATOM 923   C CA  . GLY A 1 116 ? 32.558  65.563  -80.641  1.00 40.00 ? 120 GLY A CA  1 
ATOM 924   C C   . GLY A 1 116 ? 32.719  66.357  -81.935  1.00 40.00 ? 120 GLY A C   1 
ATOM 925   O O   . GLY A 1 116 ? 33.138  65.842  -82.977  1.00 40.00 ? 120 GLY A O   1 
ATOM 926   N N   . GLY A 1 117 ? 32.429  67.666  -81.890  1.00 40.00 ? 121 GLY A N   1 
ATOM 927   C CA  . GLY A 1 117 ? 32.607  68.507  -83.085  1.00 40.00 ? 121 GLY A CA  1 
ATOM 928   C C   . GLY A 1 117 ? 32.461  69.971  -82.686  1.00 40.00 ? 121 GLY A C   1 
ATOM 929   O O   . GLY A 1 117 ? 31.597  70.723  -83.173  1.00 40.00 ? 121 GLY A O   1 
ATOM 930   N N   . GLY A 1 118 ? 33.273  70.375  -81.704  1.00 40.00 ? 122 GLY A N   1 
ATOM 931   C CA  . GLY A 1 118 ? 33.253  71.746  -81.214  1.00 40.00 ? 122 GLY A CA  1 
ATOM 932   C C   . GLY A 1 118 ? 31.980  72.109  -80.507  1.00 40.00 ? 122 GLY A C   1 
ATOM 933   O O   . GLY A 1 118 ? 31.729  73.304  -80.273  1.00 40.00 ? 122 GLY A O   1 
ATOM 934   N N   . PHE A 1 119 ? 31.096  71.181  -80.208  1.00 40.00 ? 123 PHE A N   1 
ATOM 935   C CA  . PHE A 1 119 ? 29.793  71.464  -79.635  1.00 40.00 ? 123 PHE A CA  1 
ATOM 936   C C   . PHE A 1 119 ? 28.881  72.076  -80.706  1.00 40.00 ? 123 PHE A C   1 
ATOM 937   O O   . PHE A 1 119 ? 27.764  72.478  -80.386  1.00 40.00 ? 123 PHE A O   1 
ATOM 938   C CB  . PHE A 1 119 ? 29.890  72.450  -78.455  1.00 40.00 ? 123 PHE A CB  1 
ATOM 939   C CG  . PHE A 1 119 ? 30.318  71.778  -77.199  1.00 40.00 ? 123 PHE A CG  1 
ATOM 940   C CD1 . PHE A 1 119 ? 29.599  70.716  -76.680  1.00 40.00 ? 123 PHE A CD1 1 
ATOM 941   C CD2 . PHE A 1 119 ? 31.466  72.185  -76.535  1.00 40.00 ? 123 PHE A CD2 1 
ATOM 942   C CE1 . PHE A 1 119 ? 29.998  70.067  -75.529  1.00 40.00 ? 123 PHE A CE1 1 
ATOM 943   C CE2 . PHE A 1 119 ? 31.872  71.542  -75.373  1.00 40.00 ? 123 PHE A CE2 1 
ATOM 944   C CZ  . PHE A 1 119 ? 31.132  70.479  -74.880  1.00 40.00 ? 123 PHE A CZ  1 
ATOM 945   N N   . TYR A 1 120 ? 29.331  72.184  -81.938  1.00 40.00 ? 124 TYR A N   1 
ATOM 946   C CA  . TYR A 1 120 ? 28.609  72.816  -83.016  1.00 40.00 ? 124 TYR A CA  1 
ATOM 947   C C   . TYR A 1 120 ? 28.321  71.835  -84.140  1.00 40.00 ? 124 TYR A C   1 
ATOM 948   O O   . TYR A 1 120 ? 27.639  72.238  -85.083  1.00 40.00 ? 124 TYR A O   1 
ATOM 949   C CB  . TYR A 1 120 ? 29.363  74.020  -83.643  1.00 40.00 ? 124 TYR A CB  1 
ATOM 950   C CG  . TYR A 1 120 ? 30.490  73.617  -84.564  1.00 40.00 ? 124 TYR A CG  1 
ATOM 951   C CD1 . TYR A 1 120 ? 30.264  73.257  -85.868  1.00 40.00 ? 124 TYR A CD1 1 
ATOM 952   C CD2 . TYR A 1 120 ? 31.829  73.598  -84.128  1.00 40.00 ? 124 TYR A CD2 1 
ATOM 953   C CE1 . TYR A 1 120 ? 31.287  72.880  -86.712  1.00 40.00 ? 124 TYR A CE1 1 
ATOM 954   C CE2 . TYR A 1 120 ? 32.883  73.225  -84.950  1.00 40.00 ? 124 TYR A CE2 1 
ATOM 955   C CZ  . TYR A 1 120 ? 32.601  72.865  -86.255  1.00 40.00 ? 124 TYR A CZ  1 
ATOM 956   O OH  . TYR A 1 120 ? 33.621  72.469  -87.088  1.00 40.00 ? 124 TYR A OH  1 
ATOM 957   N N   . SER A 1 121 ? 28.873  70.631  -84.079  1.00 40.00 ? 125 SER A N   1 
ATOM 958   C CA  . SER A 1 121 ? 28.643  69.702  -85.203  1.00 40.00 ? 125 SER A CA  1 
ATOM 959   C C   . SER A 1 121 ? 28.763  68.280  -84.722  1.00 40.00 ? 125 SER A C   1 
ATOM 960   O O   . SER A 1 121 ? 28.968  68.139  -83.526  1.00 40.00 ? 125 SER A O   1 
ATOM 961   C CB  . SER A 1 121 ? 29.723  69.956  -86.260  1.00 40.00 ? 125 SER A CB  1 
ATOM 962   O OG  . SER A 1 121 ? 30.904  69.250  -85.909  1.00 40.00 ? 125 SER A OG  1 
ATOM 963   N N   . GLY A 1 122 ? 28.638  67.279  -85.581  1.00 40.00 ? 126 GLY A N   1 
ATOM 964   C CA  . GLY A 1 122 ? 28.768  65.895  -85.122  1.00 40.00 ? 126 GLY A CA  1 
ATOM 965   C C   . GLY A 1 122 ? 27.568  64.986  -85.176  1.00 40.00 ? 126 GLY A C   1 
ATOM 966   O O   . GLY A 1 122 ? 26.412  65.396  -85.007  1.00 40.00 ? 126 GLY A O   1 
ATOM 967   N N   . ALA A 1 123 ? 27.821  63.667  -85.247  1.00 40.00 ? 127 ALA A N   1 
ATOM 968   C CA  . ALA A 1 123 ? 26.770  62.678  -85.303  1.00 40.00 ? 127 ALA A CA  1 
ATOM 969   C C   . ALA A 1 123 ? 27.202  61.234  -85.089  1.00 40.00 ? 127 ALA A C   1 
ATOM 970   O O   . ALA A 1 123 ? 28.164  60.762  -85.712  1.00 40.00 ? 127 ALA A O   1 
ATOM 971   C CB  . ALA A 1 123 ? 26.171  62.712  -86.730  1.00 40.00 ? 127 ALA A CB  1 
ATOM 972   N N   . ALA A 1 124 ? 26.406  60.537  -84.275  1.00 40.00 ? 128 ALA A N   1 
ATOM 973   C CA  . ALA A 1 124 ? 26.662  59.114  -84.054  1.00 40.00 ? 128 ALA A CA  1 
ATOM 974   C C   . ALA A 1 124 ? 26.574  58.356  -85.359  1.00 40.00 ? 128 ALA A C   1 
ATOM 975   O O   . ALA A 1 124 ? 27.332  57.407  -85.640  1.00 40.00 ? 128 ALA A O   1 
ATOM 976   C CB  . ALA A 1 124 ? 25.727  58.617  -82.963  1.00 40.00 ? 128 ALA A CB  1 
ATOM 977   N N   . SER A 1 125 ? 25.755  58.726  -86.312  1.00 40.00 ? 129 SER A N   1 
ATOM 978   C CA  . SER A 1 125 ? 25.600  58.169  -87.638  1.00 40.00 ? 129 SER A CA  1 
ATOM 979   C C   . SER A 1 125 ? 26.922  58.012  -88.398  1.00 40.00 ? 129 SER A C   1 
ATOM 980   O O   . SER A 1 125 ? 27.010  57.326  -89.429  1.00 40.00 ? 129 SER A O   1 
ATOM 981   C CB  . SER A 1 125 ? 24.736  59.137  -88.504  1.00 40.00 ? 129 SER A CB  1 
ATOM 982   O OG  . SER A 1 125 ? 23.843  59.932  -87.733  1.00 40.00 ? 129 SER A OG  1 
ATOM 983   N N   . LEU A 1 126 ? 27.982  58.679  -87.968  1.00 40.00 ? 130 LEU A N   1 
ATOM 984   C CA  . LEU A 1 126 ? 29.243  58.631  -88.672  1.00 40.00 ? 130 LEU A CA  1 
ATOM 985   C C   . LEU A 1 126 ? 29.902  57.282  -88.790  1.00 40.00 ? 130 LEU A C   1 
ATOM 986   O O   . LEU A 1 126 ? 29.769  56.418  -87.916  1.00 40.00 ? 130 LEU A O   1 
ATOM 987   C CB  . LEU A 1 126 ? 30.216  59.652  -88.058  1.00 40.00 ? 130 LEU A CB  1 
ATOM 988   C CG  . LEU A 1 126 ? 29.808  61.105  -88.376  1.00 40.00 ? 130 LEU A CG  1 
ATOM 989   C CD1 . LEU A 1 126 ? 30.907  62.053  -87.968  1.00 40.00 ? 130 LEU A CD1 1 
ATOM 990   C CD2 . LEU A 1 126 ? 29.535  61.265  -89.873  1.00 40.00 ? 130 LEU A CD2 1 
ATOM 991   N N   . ASP A 1 127 ? 30.650  57.116  -89.877  1.00 40.00 ? 131 ASP A N   1 
ATOM 992   C CA  . ASP A 1 127 ? 31.340  55.865  -90.156  1.00 40.00 ? 131 ASP A CA  1 
ATOM 993   C C   . ASP A 1 127 ? 32.355  55.460  -89.121  1.00 40.00 ? 131 ASP A C   1 
ATOM 994   O O   . ASP A 1 127 ? 32.285  54.346  -88.576  1.00 40.00 ? 131 ASP A O   1 
ATOM 995   C CB  . ASP A 1 127 ? 32.017  55.912  -91.533  1.00 40.00 ? 131 ASP A CB  1 
ATOM 996   C CG  . ASP A 1 127 ? 31.038  55.674  -92.671  1.00 40.00 ? 131 ASP A CG  1 
ATOM 997   O OD1 . ASP A 1 127 ? 29.807  55.640  -92.400  1.00 40.00 ? 131 ASP A OD1 1 
ATOM 998   O OD2 . ASP A 1 127 ? 31.507  55.519  -93.818  1.00 40.00 ? 131 ASP A OD2 1 
ATOM 999   N N   . VAL A 1 128 ? 33.291  56.340  -88.773  1.00 40.00 ? 132 VAL A N   1 
ATOM 1000  C CA  . VAL A 1 128 ? 34.272  56.015  -87.743  1.00 40.00 ? 132 VAL A CA  1 
ATOM 1001  C C   . VAL A 1 128 ? 33.624  55.760  -86.392  1.00 40.00 ? 132 VAL A C   1 
ATOM 1002  O O   . VAL A 1 128 ? 34.384  55.396  -85.471  1.00 40.00 ? 132 VAL A O   1 
ATOM 1003  C CB  . VAL A 1 128 ? 35.363  57.071  -87.558  1.00 40.00 ? 132 VAL A CB  1 
ATOM 1004  C CG1 . VAL A 1 128 ? 36.029  57.401  -88.884  1.00 40.00 ? 132 VAL A CG1 1 
ATOM 1005  C CG2 . VAL A 1 128 ? 34.776  58.320  -86.934  1.00 40.00 ? 132 VAL A CG2 1 
ATOM 1006  N N   . TYR A 1 129 ? 32.320  55.940  -86.158  1.00 40.00 ? 133 TYR A N   1 
ATOM 1007  C CA  . TYR A 1 129 ? 31.830  55.631  -84.811  1.00 40.00 ? 133 TYR A CA  1 
ATOM 1008  C C   . TYR A 1 129 ? 30.990  54.351  -84.876  1.00 40.00 ? 133 TYR A C   1 
ATOM 1009  O O   . TYR A 1 129 ? 30.057  54.137  -84.093  1.00 40.00 ? 133 TYR A O   1 
ATOM 1010  C CB  . TYR A 1 129 ? 31.120  56.738  -84.079  1.00 40.00 ? 133 TYR A CB  1 
ATOM 1011  C CG  . TYR A 1 129 ? 31.650  58.148  -84.099  1.00 40.00 ? 133 TYR A CG  1 
ATOM 1012  C CD1 . TYR A 1 129 ? 33.010  58.401  -84.199  1.00 40.00 ? 133 TYR A CD1 1 
ATOM 1013  C CD2 . TYR A 1 129 ? 30.820  59.261  -84.016  1.00 40.00 ? 133 TYR A CD2 1 
ATOM 1014  C CE1 . TYR A 1 129 ? 33.540  59.660  -84.241  1.00 40.00 ? 133 TYR A CE1 1 
ATOM 1015  C CE2 . TYR A 1 129 ? 31.334  60.546  -84.058  1.00 40.00 ? 133 TYR A CE2 1 
ATOM 1016  C CZ  . TYR A 1 129 ? 32.694  60.746  -84.171  1.00 40.00 ? 133 TYR A CZ  1 
ATOM 1017  O OH  . TYR A 1 129 ? 33.224  62.012  -84.204  1.00 40.00 ? 133 TYR A OH  1 
ATOM 1018  N N   . ASP A 1 130 ? 31.336  53.502  -85.839  1.00 40.00 ? 134 ASP A N   1 
ATOM 1019  C CA  . ASP A 1 130 ? 30.660  52.228  -86.046  1.00 40.00 ? 134 ASP A CA  1 
ATOM 1020  C C   . ASP A 1 130 ? 30.956  51.270  -84.908  1.00 40.00 ? 134 ASP A C   1 
ATOM 1021  O O   . ASP A 1 130 ? 32.004  50.604  -84.939  1.00 40.00 ? 134 ASP A O   1 
ATOM 1022  C CB  . ASP A 1 130 ? 31.161  51.620  -87.364  1.00 40.00 ? 134 ASP A CB  1 
ATOM 1023  C CG  . ASP A 1 130 ? 30.340  50.443  -87.841  1.00 40.00 ? 134 ASP A CG  1 
ATOM 1024  O OD1 . ASP A 1 130 ? 30.474  50.125  -89.055  1.00 40.00 ? 134 ASP A OD1 1 
ATOM 1025  O OD2 . ASP A 1 130 ? 29.580  49.864  -87.030  1.00 40.00 ? 134 ASP A OD2 1 
ATOM 1026  N N   . GLY A 1 131 ? 30.043  51.155  -83.945  1.00 40.00 ? 135 GLY A N   1 
ATOM 1027  C CA  . GLY A 1 131 ? 30.245  50.269  -82.820  1.00 40.00 ? 135 GLY A CA  1 
ATOM 1028  C C   . GLY A 1 131 ? 30.162  48.787  -83.104  1.00 40.00 ? 135 GLY A C   1 
ATOM 1029  O O   . GLY A 1 131 ? 30.125  48.000  -82.132  1.00 40.00 ? 135 GLY A O   1 
ATOM 1030  N N   . ARG A 1 132 ? 30.115  48.304  -84.339  1.00 40.00 ? 136 ARG A N   1 
ATOM 1031  C CA  . ARG A 1 132 ? 29.993  46.881  -84.605  1.00 40.00 ? 136 ARG A CA  1 
ATOM 1032  C C   . ARG A 1 132 ? 31.214  46.076  -84.199  1.00 40.00 ? 136 ARG A C   1 
ATOM 1033  O O   . ARG A 1 132 ? 31.071  45.049  -83.489  1.00 40.00 ? 136 ARG A O   1 
ATOM 1034  C CB  . ARG A 1 132 ? 29.528  46.641  -86.025  1.00 40.00 ? 136 ARG A CB  1 
ATOM 1035  C CG  . ARG A 1 132 ? 30.532  46.114  -87.012  1.00 40.00 ? 136 ARG A CG  1 
ATOM 1036  C CD  . ARG A 1 132 ? 30.854  47.041  -88.131  1.00 40.00 ? 136 ARG A CD  1 
ATOM 1037  N NE  . ARG A 1 132 ? 30.511  46.709  -89.490  1.00 40.00 ? 136 ARG A NE  1 
ATOM 1038  C CZ  . ARG A 1 132 ? 29.368  46.886  -90.127  1.00 40.00 ? 136 ARG A CZ  1 
ATOM 1039  N NH1 . ARG A 1 132 ? 28.316  47.409  -89.511  1.00 40.00 ? 136 ARG A NH1 1 
ATOM 1040  N NH2 . ARG A 1 132 ? 29.242  46.541  -91.411  1.00 40.00 ? 136 ARG A NH2 1 
ATOM 1041  N N   . PHE A 1 133 ? 32.418  46.487  -84.569  1.00 40.00 ? 137 PHE A N   1 
ATOM 1042  C CA  . PHE A 1 133 ? 33.632  45.764  -84.190  1.00 40.00 ? 137 PHE A CA  1 
ATOM 1043  C C   . PHE A 1 133 ? 33.784  45.611  -82.690  1.00 40.00 ? 137 PHE A C   1 
ATOM 1044  O O   . PHE A 1 133 ? 33.882  44.496  -82.165  1.00 40.00 ? 137 PHE A O   1 
ATOM 1045  C CB  . PHE A 1 133 ? 34.868  46.440  -84.804  1.00 40.00 ? 137 PHE A CB  1 
ATOM 1046  C CG  . PHE A 1 133 ? 34.652  46.795  -86.252  1.00 40.00 ? 137 PHE A CG  1 
ATOM 1047  C CD1 . PHE A 1 133 ? 34.288  48.082  -86.617  1.00 40.00 ? 137 PHE A CD1 1 
ATOM 1048  C CD2 . PHE A 1 133 ? 34.777  45.836  -87.246  1.00 40.00 ? 137 PHE A CD2 1 
ATOM 1049  C CE1 . PHE A 1 133 ? 34.079  48.392  -87.955  1.00 40.00 ? 137 PHE A CE1 1 
ATOM 1050  C CE2 . PHE A 1 133 ? 34.569  46.141  -88.582  1.00 40.00 ? 137 PHE A CE2 1 
ATOM 1051  C CZ  . PHE A 1 133 ? 34.227  47.430  -88.945  1.00 40.00 ? 137 PHE A CZ  1 
ATOM 1052  N N   . LEU A 1 134 ? 33.727  46.688  -81.902  1.00 40.00 ? 138 LEU A N   1 
ATOM 1053  C CA  . LEU A 1 134 ? 33.835  46.576  -80.450  1.00 40.00 ? 138 LEU A CA  1 
ATOM 1054  C C   . LEU A 1 134 ? 32.765  45.695  -79.838  1.00 40.00 ? 138 LEU A C   1 
ATOM 1055  O O   . LEU A 1 134 ? 32.937  45.218  -78.693  1.00 40.00 ? 138 LEU A O   1 
ATOM 1056  C CB  . LEU A 1 134 ? 33.827  47.958  -79.783  1.00 40.00 ? 138 LEU A CB  1 
ATOM 1057  C CG  . LEU A 1 134 ? 35.084  48.796  -80.057  1.00 40.00 ? 138 LEU A CG  1 
ATOM 1058  C CD1 . LEU A 1 134 ? 34.757  50.213  -80.462  1.00 40.00 ? 138 LEU A CD1 1 
ATOM 1059  C CD2 . LEU A 1 134 ? 35.995  48.760  -78.834  1.00 40.00 ? 138 LEU A CD2 1 
ATOM 1060  N N   . ALA A 1 135 ? 31.635  45.465  -80.517  1.00 40.00 ? 139 ALA A N   1 
ATOM 1061  C CA  . ALA A 1 135 ? 30.641  44.572  -79.908  1.00 40.00 ? 139 ALA A CA  1 
ATOM 1062  C C   . ALA A 1 135 ? 30.988  43.160  -80.405  1.00 40.00 ? 139 ALA A C   1 
ATOM 1063  O O   . ALA A 1 135 ? 31.072  42.194  -79.671  1.00 40.00 ? 139 ALA A O   1 
ATOM 1064  C CB  . ALA A 1 135 ? 29.243  44.930  -80.332  1.00 40.00 ? 139 ALA A CB  1 
ATOM 1065  N N   . GLN A 1 136 ? 31.189  43.134  -81.737  1.00 40.00 ? 140 GLN A N   1 
ATOM 1066  C CA  . GLN A 1 136 ? 31.470  41.850  -82.367  1.00 40.00 ? 140 GLN A CA  1 
ATOM 1067  C C   . GLN A 1 136 ? 32.642  41.161  -81.681  1.00 40.00 ? 140 GLN A C   1 
ATOM 1068  O O   . GLN A 1 136 ? 32.513  40.110  -81.071  1.00 40.00 ? 140 GLN A O   1 
ATOM 1069  C CB  . GLN A 1 136 ? 31.740  42.018  -83.859  1.00 40.00 ? 140 GLN A CB  1 
ATOM 1070  C CG  . GLN A 1 136 ? 31.672  40.688  -84.614  1.00 40.00 ? 140 GLN A CG  1 
ATOM 1071  C CD  . GLN A 1 136 ? 32.979  39.925  -84.400  1.00 40.00 ? 140 GLN A CD  1 
ATOM 1072  O OE1 . GLN A 1 136 ? 34.017  40.378  -84.889  1.00 40.00 ? 140 GLN A OE1 1 
ATOM 1073  N NE2 . GLN A 1 136 ? 32.872  38.815  -83.686  1.00 40.00 ? 140 GLN A NE2 1 
ATOM 1074  N N   . VAL A 1 137 ? 33.800  41.772  -81.855  1.00 40.00 ? 141 VAL A N   1 
ATOM 1075  C CA  . VAL A 1 137 ? 35.055  41.306  -81.342  1.00 40.00 ? 141 VAL A CA  1 
ATOM 1076  C C   . VAL A 1 137 ? 35.159  41.326  -79.836  1.00 40.00 ? 141 VAL A C   1 
ATOM 1077  O O   . VAL A 1 137 ? 35.391  40.269  -79.231  1.00 40.00 ? 141 VAL A O   1 
ATOM 1078  C CB  . VAL A 1 137 ? 36.255  42.144  -81.865  1.00 40.00 ? 141 VAL A CB  1 
ATOM 1079  C CG1 . VAL A 1 137 ? 37.521  41.769  -81.114  1.00 40.00 ? 141 VAL A CG1 1 
ATOM 1080  C CG2 . VAL A 1 137 ? 36.413  42.013  -83.363  1.00 40.00 ? 141 VAL A CG2 1 
ATOM 1081  N N   . GLU A 1 138 ? 35.061  42.468  -79.169  1.00 40.00 ? 142 GLU A N   1 
ATOM 1082  C CA  . GLU A 1 138 ? 35.241  42.420  -77.707  1.00 40.00 ? 142 GLU A CA  1 
ATOM 1083  C C   . GLU A 1 138 ? 33.981  42.094  -76.939  1.00 40.00 ? 142 GLU A C   1 
ATOM 1084  O O   . GLU A 1 138 ? 33.949  42.161  -75.700  1.00 40.00 ? 142 GLU A O   1 
ATOM 1085  C CB  . GLU A 1 138 ? 35.944  43.681  -77.237  1.00 40.00 ? 142 GLU A CB  1 
ATOM 1086  C CG  . GLU A 1 138 ? 37.297  43.916  -77.904  1.00 40.00 ? 142 GLU A CG  1 
ATOM 1087  C CD  . GLU A 1 138 ? 38.337  42.928  -77.387  1.00 40.00 ? 142 GLU A CD  1 
ATOM 1088  O OE1 . GLU A 1 138 ? 38.257  42.548  -76.195  1.00 40.00 ? 142 GLU A OE1 1 
ATOM 1089  O OE2 . GLU A 1 138 ? 39.210  42.573  -78.206  1.00 40.00 ? 142 GLU A OE2 1 
ATOM 1090  N N   . GLY A 1 139 ? 32.919  41.721  -77.649  1.00 40.00 ? 143 GLY A N   1 
ATOM 1091  C CA  . GLY A 1 139 ? 31.647  41.328  -77.085  1.00 40.00 ? 143 GLY A CA  1 
ATOM 1092  C C   . GLY A 1 139 ? 31.052  42.364  -76.152  1.00 40.00 ? 143 GLY A C   1 
ATOM 1093  O O   . GLY A 1 139 ? 30.533  42.041  -75.081  1.00 40.00 ? 143 GLY A O   1 
ATOM 1094  N N   . ALA A 1 140 ? 31.138  43.636  -76.582  1.00 40.00 ? 144 ALA A N   1 
ATOM 1095  C CA  . ALA A 1 140 ? 30.662  44.715  -75.731  1.00 40.00 ? 144 ALA A CA  1 
ATOM 1096  C C   . ALA A 1 140 ? 29.331  45.271  -76.199  1.00 40.00 ? 144 ALA A C   1 
ATOM 1097  O O   . ALA A 1 140 ? 29.137  45.305  -77.412  1.00 40.00 ? 144 ALA A O   1 
ATOM 1098  C CB  . ALA A 1 140 ? 31.662  45.877  -75.771  1.00 40.00 ? 144 ALA A CB  1 
ATOM 1099  N N   . VAL A 1 141 ? 28.516  45.706  -75.239  1.00 40.00 ? 145 VAL A N   1 
ATOM 1100  C CA  . VAL A 1 141 ? 27.282  46.379  -75.641  1.00 40.00 ? 145 VAL A CA  1 
ATOM 1101  C C   . VAL A 1 141 ? 27.636  47.889  -75.766  1.00 40.00 ? 145 VAL A C   1 
ATOM 1102  O O   . VAL A 1 141 ? 27.878  48.549  -74.750  1.00 40.00 ? 145 VAL A O   1 
ATOM 1103  C CB  . VAL A 1 141 ? 26.139  46.288  -74.641  1.00 40.00 ? 145 VAL A CB  1 
ATOM 1104  C CG1 . VAL A 1 141 ? 24.927  47.092  -75.117  1.00 40.00 ? 145 VAL A CG1 1 
ATOM 1105  C CG2 . VAL A 1 141 ? 25.730  44.846  -74.373  1.00 40.00 ? 145 VAL A CG2 1 
ATOM 1106  N N   . LEU A 1 142 ? 27.647  48.370  -76.986  1.00 40.00 ? 146 LEU A N   1 
ATOM 1107  C CA  . LEU A 1 142 ? 27.974  49.745  -77.315  1.00 40.00 ? 146 LEU A CA  1 
ATOM 1108  C C   . LEU A 1 142 ? 26.781  50.620  -77.650  1.00 40.00 ? 146 LEU A C   1 
ATOM 1109  O O   . LEU A 1 142 ? 25.843  50.268  -78.388  1.00 40.00 ? 146 LEU A O   1 
ATOM 1110  C CB  . LEU A 1 142 ? 28.933  49.648  -78.536  1.00 40.00 ? 146 LEU A CB  1 
ATOM 1111  C CG  . LEU A 1 142 ? 29.688  50.941  -78.825  1.00 40.00 ? 146 LEU A CG  1 
ATOM 1112  C CD1 . LEU A 1 142 ? 30.992  50.664  -79.543  1.00 40.00 ? 146 LEU A CD1 1 
ATOM 1113  C CD2 . LEU A 1 142 ? 28.789  51.896  -79.610  1.00 40.00 ? 146 LEU A CD2 1 
ATOM 1114  N N   . VAL A 1 143 ? 26.755  51.856  -77.141  1.00 40.00 ? 147 VAL A N   1 
ATOM 1115  C CA  . VAL A 1 143 ? 25.649  52.774  -77.406  1.00 40.00 ? 147 VAL A CA  1 
ATOM 1116  C C   . VAL A 1 143 ? 26.166  54.132  -77.860  1.00 40.00 ? 147 VAL A C   1 
ATOM 1117  O O   . VAL A 1 143 ? 27.080  54.661  -77.199  1.00 40.00 ? 147 VAL A O   1 
ATOM 1118  C CB  . VAL A 1 143 ? 24.834  53.025  -76.112  1.00 40.00 ? 147 VAL A CB  1 
ATOM 1119  C CG1 . VAL A 1 143 ? 23.688  53.982  -76.396  1.00 40.00 ? 147 VAL A CG1 1 
ATOM 1120  C CG2 . VAL A 1 143 ? 24.313  51.742  -75.472  1.00 40.00 ? 147 VAL A CG2 1 
ATOM 1121  N N   . SER A 1 144 ? 25.592  54.717  -78.906  1.00 40.00 ? 148 SER A N   1 
ATOM 1122  C CA  . SER A 1 144 ? 26.039  56.058  -79.337  1.00 40.00 ? 148 SER A CA  1 
ATOM 1123  C C   . SER A 1 144 ? 24.801  56.908  -79.596  1.00 40.00 ? 148 SER A C   1 
ATOM 1124  O O   . SER A 1 144 ? 24.008  56.529  -80.477  1.00 40.00 ? 148 SER A O   1 
ATOM 1125  C CB  . SER A 1 144 ? 26.992  55.973  -80.507  1.00 40.00 ? 148 SER A CB  1 
ATOM 1126  O OG  . SER A 1 144 ? 26.407  55.746  -81.764  1.00 40.00 ? 148 SER A OG  1 
ATOM 1127  N N   . MET A 1 145 ? 24.597  58.002  -78.850  1.00 40.00 ? 149 MET A N   1 
ATOM 1128  C CA  . MET A 1 145 ? 23.444  58.869  -79.063  1.00 40.00 ? 149 MET A CA  1 
ATOM 1129  C C   . MET A 1 145 ? 23.762  60.157  -79.841  1.00 40.00 ? 149 MET A C   1 
ATOM 1130  O O   . MET A 1 145 ? 24.915  60.520  -80.051  1.00 40.00 ? 149 MET A O   1 
ATOM 1131  C CB  . MET A 1 145 ? 22.805  59.338  -77.751  1.00 40.00 ? 149 MET A CB  1 
ATOM 1132  C CG  . MET A 1 145 ? 23.439  60.614  -77.189  1.00 40.00 ? 149 MET A CG  1 
ATOM 1133  S SD  . MET A 1 145 ? 25.135  60.232  -76.621  1.00 40.00 ? 149 MET A SD  1 
ATOM 1134  C CE  . MET A 1 145 ? 24.871  60.509  -74.859  1.00 40.00 ? 149 MET A CE  1 
ATOM 1135  N N   . ASN A 1 146 ? 22.713  60.873  -80.235  1.00 40.00 ? 150 ASN A N   1 
ATOM 1136  C CA  . ASN A 1 146 ? 22.810  62.157  -80.901  1.00 40.00 ? 150 ASN A CA  1 
ATOM 1137  C C   . ASN A 1 146 ? 22.378  63.189  -79.835  1.00 40.00 ? 150 ASN A C   1 
ATOM 1138  O O   . ASN A 1 146 ? 21.470  62.870  -79.048  1.00 40.00 ? 150 ASN A O   1 
ATOM 1139  C CB  . ASN A 1 146 ? 21.861  62.304  -82.096  1.00 40.00 ? 150 ASN A CB  1 
ATOM 1140  C CG  . ASN A 1 146 ? 22.481  61.648  -83.320  1.00 40.00 ? 150 ASN A CG  1 
ATOM 1141  O OD1 . ASN A 1 146 ? 23.583  61.096  -83.174  1.00 40.00 ? 150 ASN A OD1 1 
ATOM 1142  N ND2 . ASN A 1 146 ? 21.815  61.708  -84.471  1.00 40.00 ? 150 ASN A ND2 1 
ATOM 1143  N N   . TYR A 1 147 ? 23.054  64.320  -79.778  1.00 40.00 ? 151 TYR A N   1 
ATOM 1144  C CA  . TYR A 1 147 ? 22.701  65.389  -78.843  1.00 40.00 ? 151 TYR A CA  1 
ATOM 1145  C C   . TYR A 1 147 ? 22.743  66.673  -79.711  1.00 40.00 ? 151 TYR A C   1 
ATOM 1146  O O   . TYR A 1 147 ? 23.521  66.771  -80.670  1.00 40.00 ? 151 TYR A O   1 
ATOM 1147  C CB  . TYR A 1 147 ? 23.589  65.536  -77.613  1.00 40.00 ? 151 TYR A CB  1 
ATOM 1148  C CG  . TYR A 1 147 ? 25.046  65.755  -77.960  1.00 40.00 ? 151 TYR A CG  1 
ATOM 1149  C CD1 . TYR A 1 147 ? 25.769  64.743  -78.578  1.00 40.00 ? 151 TYR A CD1 1 
ATOM 1150  C CD2 . TYR A 1 147 ? 25.694  66.956  -77.716  1.00 40.00 ? 151 TYR A CD2 1 
ATOM 1151  C CE1 . TYR A 1 147 ? 27.096  64.920  -78.898  1.00 40.00 ? 151 TYR A CE1 1 
ATOM 1152  C CE2 . TYR A 1 147 ? 27.038  67.142  -78.064  1.00 40.00 ? 151 TYR A CE2 1 
ATOM 1153  C CZ  . TYR A 1 147 ? 27.721  66.118  -78.665  1.00 40.00 ? 151 TYR A CZ  1 
ATOM 1154  O OH  . TYR A 1 147 ? 29.027  66.224  -79.039  1.00 40.00 ? 151 TYR A OH  1 
ATOM 1155  N N   . ARG A 1 148 ? 21.847  67.603  -79.415  1.00 40.00 ? 152 ARG A N   1 
ATOM 1156  C CA  . ARG A 1 148 ? 21.765  68.866  -80.092  1.00 40.00 ? 152 ARG A CA  1 
ATOM 1157  C C   . ARG A 1 148 ? 23.050  69.679  -79.935  1.00 40.00 ? 152 ARG A C   1 
ATOM 1158  O O   . ARG A 1 148 ? 23.390  70.043  -78.809  1.00 40.00 ? 152 ARG A O   1 
ATOM 1159  C CB  . ARG A 1 148 ? 20.631  69.706  -79.430  1.00 40.00 ? 152 ARG A CB  1 
ATOM 1160  C CG  . ARG A 1 148 ? 19.236  69.217  -79.720  1.00 40.00 ? 152 ARG A CG  1 
ATOM 1161  C CD  . ARG A 1 148 ? 18.102  70.006  -79.061  1.00 40.00 ? 152 ARG A CD  1 
ATOM 1162  N NE  . ARG A 1 148 ? 17.912  69.575  -77.682  1.00 40.00 ? 152 ARG A NE  1 
ATOM 1163  C CZ  . ARG A 1 148 ? 17.090  70.098  -76.802  1.00 40.00 ? 152 ARG A CZ  1 
ATOM 1164  N NH1 . ARG A 1 148 ? 16.325  71.106  -77.188  1.00 40.00 ? 152 ARG A NH1 1 
ATOM 1165  N NH2 . ARG A 1 148 ? 16.978  69.649  -75.533  1.00 40.00 ? 152 ARG A NH2 1 
ATOM 1166  N N   . VAL A 1 149 ? 23.711  70.018  -81.003  1.00 40.00 ? 153 VAL A N   1 
ATOM 1167  C CA  . VAL A 1 149 ? 24.848  70.908  -81.064  1.00 40.00 ? 153 VAL A CA  1 
ATOM 1168  C C   . VAL A 1 149 ? 24.378  72.328  -81.432  1.00 40.00 ? 153 VAL A C   1 
ATOM 1169  O O   . VAL A 1 149 ? 23.180  72.590  -81.625  1.00 40.00 ? 153 VAL A O   1 
ATOM 1170  C CB  . VAL A 1 149 ? 25.765  70.495  -82.242  1.00 40.00 ? 153 VAL A CB  1 
ATOM 1171  C CG1 . VAL A 1 149 ? 26.463  69.184  -81.951  1.00 40.00 ? 153 VAL A CG1 1 
ATOM 1172  C CG2 . VAL A 1 149 ? 24.951  70.368  -83.525  1.00 40.00 ? 153 VAL A CG2 1 
ATOM 1173  N N   . GLY A 1 150 ? 25.327  73.243  -81.636  1.00 40.00 ? 154 GLY A N   1 
ATOM 1174  C CA  . GLY A 1 150 ? 25.071  74.630  -82.007  1.00 40.00 ? 154 GLY A CA  1 
ATOM 1175  C C   . GLY A 1 150 ? 24.112  75.376  -81.105  1.00 40.00 ? 154 GLY A C   1 
ATOM 1176  O O   . GLY A 1 150 ? 23.888  75.164  -79.918  1.00 40.00 ? 154 GLY A O   1 
ATOM 1177  N N   . THR A 1 151 ? 23.417  76.364  -81.632  1.00 40.00 ? 155 THR A N   1 
ATOM 1178  C CA  . THR A 1 151 ? 22.442  77.197  -80.961  1.00 40.00 ? 155 THR A CA  1 
ATOM 1179  C C   . THR A 1 151 ? 21.359  76.330  -80.337  1.00 40.00 ? 155 THR A C   1 
ATOM 1180  O O   . THR A 1 151 ? 20.863  76.566  -79.245  1.00 40.00 ? 155 THR A O   1 
ATOM 1181  C CB  . THR A 1 151 ? 21.691  78.078  -82.030  1.00 40.00 ? 155 THR A CB  1 
ATOM 1182  O OG1 . THR A 1 151 ? 21.930  77.485  -83.314  1.00 40.00 ? 155 THR A OG1 1 
ATOM 1183  C CG2 . THR A 1 151 ? 22.304  79.471  -81.975  1.00 40.00 ? 155 THR A CG2 1 
ATOM 1184  N N   . PHE A 1 152 ? 20.959  75.319  -81.115  1.00 40.00 ? 156 PHE A N   1 
ATOM 1185  C CA  . PHE A 1 152 ? 19.894  74.412  -80.661  1.00 40.00 ? 156 PHE A CA  1 
ATOM 1186  C C   . PHE A 1 152 ? 20.335  73.691  -79.384  1.00 40.00 ? 156 PHE A C   1 
ATOM 1187  O O   . PHE A 1 152 ? 19.528  73.516  -78.468  1.00 40.00 ? 156 PHE A O   1 
ATOM 1188  C CB  . PHE A 1 152 ? 19.544  73.420  -81.763  1.00 40.00 ? 156 PHE A CB  1 
ATOM 1189  C CG  . PHE A 1 152 ? 19.506  74.014  -83.137  1.00 40.00 ? 156 PHE A CG  1 
ATOM 1190  C CD1 . PHE A 1 152 ? 18.369  74.689  -83.565  1.00 40.00 ? 156 PHE A CD1 1 
ATOM 1191  C CD2 . PHE A 1 152 ? 20.575  73.922  -84.005  1.00 40.00 ? 156 PHE A CD2 1 
ATOM 1192  C CE1 . PHE A 1 152 ? 18.318  75.264  -84.813  1.00 40.00 ? 156 PHE A CE1 1 
ATOM 1193  C CE2 . PHE A 1 152 ? 20.525  74.478  -85.268  1.00 40.00 ? 156 PHE A CE2 1 
ATOM 1194  C CZ  . PHE A 1 152 ? 19.402  75.157  -85.676  1.00 40.00 ? 156 PHE A CZ  1 
ATOM 1195  N N   . GLY A 1 153 ? 21.606  73.275  -79.312  1.00 40.00 ? 157 GLY A N   1 
ATOM 1196  C CA  . GLY A 1 153 ? 22.073  72.618  -78.139  1.00 40.00 ? 157 GLY A CA  1 
ATOM 1197  C C   . GLY A 1 153 ? 22.454  73.523  -76.994  1.00 40.00 ? 157 GLY A C   1 
ATOM 1198  O O   . GLY A 1 153 ? 22.350  73.186  -75.801  1.00 40.00 ? 157 GLY A O   1 
ATOM 1199  N N   . PHE A 1 154 ? 23.090  74.669  -77.357  1.00 40.00 ? 158 PHE A N   1 
ATOM 1200  C CA  . PHE A 1 154 ? 23.646  75.551  -76.329  1.00 40.00 ? 158 PHE A CA  1 
ATOM 1201  C C   . PHE A 1 154 ? 23.264  76.996  -76.330  1.00 40.00 ? 158 PHE A C   1 
ATOM 1202  O O   . PHE A 1 154 ? 23.598  77.694  -75.344  1.00 40.00 ? 158 PHE A O   1 
ATOM 1203  C CB  . PHE A 1 154 ? 25.165  75.356  -76.382  1.00 40.00 ? 158 PHE A CB  1 
ATOM 1204  C CG  . PHE A 1 154 ? 25.560  73.911  -76.142  1.00 40.00 ? 158 PHE A CG  1 
ATOM 1205  C CD1 . PHE A 1 154 ? 25.693  73.415  -74.862  1.00 40.00 ? 158 PHE A CD1 1 
ATOM 1206  C CD2 . PHE A 1 154 ? 25.759  73.039  -77.210  1.00 40.00 ? 158 PHE A CD2 1 
ATOM 1207  C CE1 . PHE A 1 154 ? 26.055  72.090  -74.667  1.00 40.00 ? 158 PHE A CE1 1 
ATOM 1208  C CE2 . PHE A 1 154 ? 26.095  71.708  -77.020  1.00 40.00 ? 158 PHE A CE2 1 
ATOM 1209  C CZ  . PHE A 1 154 ? 26.243  71.242  -75.753  1.00 40.00 ? 158 PHE A CZ  1 
ATOM 1210  N N   . LEU A 1 155 ? 22.519  77.510  -77.294  1.00 40.00 ? 159 LEU A N   1 
ATOM 1211  C CA  . LEU A 1 155 ? 22.165  78.937  -77.204  1.00 40.00 ? 159 LEU A CA  1 
ATOM 1212  C C   . LEU A 1 155 ? 21.620  79.187  -75.811  1.00 40.00 ? 159 LEU A C   1 
ATOM 1213  O O   . LEU A 1 155 ? 20.676  78.495  -75.459  1.00 40.00 ? 159 LEU A O   1 
ATOM 1214  C CB  . LEU A 1 155 ? 21.106  79.355  -78.242  1.00 40.00 ? 159 LEU A CB  1 
ATOM 1215  C CG  . LEU A 1 155 ? 20.761  80.855  -78.258  1.00 40.00 ? 159 LEU A CG  1 
ATOM 1216  C CD1 . LEU A 1 155 ? 20.331  81.314  -79.626  1.00 40.00 ? 159 LEU A CD1 1 
ATOM 1217  C CD2 . LEU A 1 155 ? 19.684  81.178  -77.233  1.00 40.00 ? 159 LEU A CD2 1 
ATOM 1218  N N   . ALA A 1 156 ? 22.129  80.133  -75.045  1.00 40.00 ? 160 ALA A N   1 
ATOM 1219  C CA  . ALA A 1 156 ? 21.453  80.254  -73.724  1.00 40.00 ? 160 ALA A CA  1 
ATOM 1220  C C   . ALA A 1 156 ? 21.251  81.678  -73.295  1.00 40.00 ? 160 ALA A C   1 
ATOM 1221  O O   . ALA A 1 156 ? 22.099  82.565  -73.532  1.00 40.00 ? 160 ALA A O   1 
ATOM 1222  C CB  . ALA A 1 156 ? 22.390  79.547  -72.718  1.00 40.00 ? 160 ALA A CB  1 
ATOM 1223  N N   . LEU A 1 157 ? 20.205  81.973  -72.572  1.00 40.00 ? 161 LEU A N   1 
ATOM 1224  C CA  . LEU A 1 157 ? 20.014  83.289  -71.974  1.00 40.00 ? 161 LEU A CA  1 
ATOM 1225  C C   . LEU A 1 157 ? 19.923  82.890  -70.490  1.00 40.00 ? 161 LEU A C   1 
ATOM 1226  O O   . LEU A 1 157 ? 18.856  82.582  -69.989  1.00 40.00 ? 161 LEU A O   1 
ATOM 1227  C CB  . LEU A 1 157 ? 18.742  83.965  -72.348  1.00 40.00 ? 161 LEU A CB  1 
ATOM 1228  C CG  . LEU A 1 157 ? 18.757  84.951  -73.512  1.00 40.00 ? 161 LEU A CG  1 
ATOM 1229  C CD1 . LEU A 1 157 ? 18.668  84.179  -74.817  1.00 40.00 ? 161 LEU A CD1 1 
ATOM 1230  C CD2 . LEU A 1 157 ? 17.560  85.881  -73.392  1.00 40.00 ? 161 LEU A CD2 1 
ATOM 1231  N N   . PRO A 1 158 ? 21.062  82.746  -69.869  1.00 40.00 ? 162 PRO A N   1 
ATOM 1232  C CA  . PRO A 1 158 ? 21.141  82.313  -68.484  1.00 40.00 ? 162 PRO A CA  1 
ATOM 1233  C C   . PRO A 1 158 ? 20.055  82.943  -67.634  1.00 40.00 ? 162 PRO A C   1 
ATOM 1234  O O   . PRO A 1 158 ? 19.791  84.128  -67.689  1.00 40.00 ? 162 PRO A O   1 
ATOM 1235  C CB  . PRO A 1 158 ? 22.508  82.728  -68.020  1.00 40.00 ? 162 PRO A CB  1 
ATOM 1236  C CG  . PRO A 1 158 ? 23.158  83.416  -69.159  1.00 40.00 ? 162 PRO A CG  1 
ATOM 1237  C CD  . PRO A 1 158 ? 22.428  83.001  -70.408  1.00 40.00 ? 162 PRO A CD  1 
ATOM 1238  N N   . GLY A 1 159 ? 19.424  82.086  -66.822  1.00 40.00 ? 163 GLY A N   1 
ATOM 1239  C CA  . GLY A 1 159 ? 18.368  82.474  -65.910  1.00 40.00 ? 163 GLY A CA  1 
ATOM 1240  C C   . GLY A 1 159 ? 16.967  82.329  -66.500  1.00 40.00 ? 163 GLY A C   1 
ATOM 1241  O O   . GLY A 1 159 ? 15.948  82.343  -65.807  1.00 40.00 ? 163 GLY A O   1 
ATOM 1242  N N   . SER A 1 160 ? 16.876  82.254  -67.821  1.00 40.00 ? 164 SER A N   1 
ATOM 1243  C CA  . SER A 1 160 ? 15.664  82.118  -68.548  1.00 40.00 ? 164 SER A CA  1 
ATOM 1244  C C   . SER A 1 160 ? 15.107  80.695  -68.346  1.00 40.00 ? 164 SER A C   1 
ATOM 1245  O O   . SER A 1 160 ? 15.885  79.760  -68.194  1.00 40.00 ? 164 SER A O   1 
ATOM 1246  C CB  . SER A 1 160 ? 15.914  82.253  -70.069  1.00 40.00 ? 164 SER A CB  1 
ATOM 1247  O OG  . SER A 1 160 ? 16.176  80.981  -70.646  1.00 40.00 ? 164 SER A OG  1 
ATOM 1248  N N   . ARG A 1 161 ? 13.787  80.646  -68.465  1.00 40.00 ? 165 ARG A N   1 
ATOM 1249  C CA  . ARG A 1 161 ? 13.043  79.423  -68.412  1.00 40.00 ? 165 ARG A CA  1 
ATOM 1250  C C   . ARG A 1 161 ? 13.097  78.698  -69.759  1.00 40.00 ? 165 ARG A C   1 
ATOM 1251  O O   . ARG A 1 161 ? 13.100  77.472  -69.797  1.00 40.00 ? 165 ARG A O   1 
ATOM 1252  C CB  . ARG A 1 161 ? 11.553  79.779  -68.176  1.00 40.00 ? 165 ARG A CB  1 
ATOM 1253  C CG  . ARG A 1 161 ? 10.871  78.786  -67.261  1.00 40.00 ? 165 ARG A CG  1 
ATOM 1254  C CD  . ARG A 1 161 ? 9.362   78.712  -67.444  1.00 40.00 ? 165 ARG A CD  1 
ATOM 1255  N NE  . ARG A 1 161 ? 9.026   77.955  -68.653  1.00 40.00 ? 165 ARG A NE  1 
ATOM 1256  C CZ  . ARG A 1 161 ? 8.401   78.486  -69.701  1.00 40.00 ? 165 ARG A CZ  1 
ATOM 1257  N NH1 . ARG A 1 161 ? 8.025   79.764  -69.712  1.00 40.00 ? 165 ARG A NH1 1 
ATOM 1258  N NH2 . ARG A 1 161 ? 8.143   77.732  -70.766  1.00 40.00 ? 165 ARG A NH2 1 
ATOM 1259  N N   . GLU A 1 162 ? 13.115  79.461  -70.849  1.00 40.00 ? 166 GLU A N   1 
ATOM 1260  C CA  . GLU A 1 162 ? 13.024  78.870  -72.169  1.00 40.00 ? 166 GLU A CA  1 
ATOM 1261  C C   . GLU A 1 162 ? 14.257  78.669  -73.005  1.00 40.00 ? 166 GLU A C   1 
ATOM 1262  O O   . GLU A 1 162 ? 14.173  78.182  -74.156  1.00 40.00 ? 166 GLU A O   1 
ATOM 1263  C CB  . GLU A 1 162 ? 12.050  79.756  -72.997  1.00 40.00 ? 166 GLU A CB  1 
ATOM 1264  C CG  . GLU A 1 162 ? 12.117  81.197  -72.510  1.00 40.00 ? 166 GLU A CG  1 
ATOM 1265  C CD  . GLU A 1 162 ? 10.982  81.564  -71.575  1.00 40.00 ? 166 GLU A CD  1 
ATOM 1266  O OE1 . GLU A 1 162 ? 9.876   80.984  -71.708  1.00 40.00 ? 166 GLU A OE1 1 
ATOM 1267  O OE2 . GLU A 1 162 ? 11.165  82.443  -70.697  1.00 40.00 ? 166 GLU A OE2 1 
ATOM 1268  N N   . ALA A 1 163 ? 15.413  79.049  -72.490  1.00 40.00 ? 167 ALA A N   1 
ATOM 1269  C CA  . ALA A 1 163 ? 16.682  78.833  -73.232  1.00 40.00 ? 167 ALA A CA  1 
ATOM 1270  C C   . ALA A 1 163 ? 17.728  78.954  -72.132  1.00 40.00 ? 167 ALA A C   1 
ATOM 1271  O O   . ALA A 1 163 ? 18.403  79.966  -71.932  1.00 40.00 ? 167 ALA A O   1 
ATOM 1272  C CB  . ALA A 1 163 ? 16.802  79.787  -74.346  1.00 40.00 ? 167 ALA A CB  1 
ATOM 1273  N N   . PRO A 1 164 ? 17.721  77.947  -71.260  1.00 40.00 ? 168 PRO A N   1 
ATOM 1274  C CA  . PRO A 1 164 ? 18.534  77.998  -70.051  1.00 40.00 ? 168 PRO A CA  1 
ATOM 1275  C C   . PRO A 1 164 ? 19.927  77.480  -70.200  1.00 40.00 ? 168 PRO A C   1 
ATOM 1276  O O   . PRO A 1 164 ? 20.774  77.614  -69.284  1.00 40.00 ? 168 PRO A O   1 
ATOM 1277  C CB  . PRO A 1 164 ? 17.607  77.230  -69.086  1.00 40.00 ? 168 PRO A CB  1 
ATOM 1278  C CG  . PRO A 1 164 ? 17.152  76.103  -69.948  1.00 40.00 ? 168 PRO A CG  1 
ATOM 1279  C CD  . PRO A 1 164 ? 16.917  76.699  -71.314  1.00 40.00 ? 168 PRO A CD  1 
ATOM 1280  N N   . GLY A 1 165 ? 20.212  76.879  -71.356  1.00 40.00 ? 169 GLY A N   1 
ATOM 1281  C CA  . GLY A 1 165 ? 21.507  76.360  -71.665  1.00 40.00 ? 169 GLY A CA  1 
ATOM 1282  C C   . GLY A 1 165 ? 21.840  74.947  -71.301  1.00 40.00 ? 169 GLY A C   1 
ATOM 1283  O O   . GLY A 1 165 ? 21.227  74.277  -70.466  1.00 40.00 ? 169 GLY A O   1 
ATOM 1284  N N   . ASN A 1 166 ? 22.891  74.450  -71.986  1.00 40.00 ? 170 ASN A N   1 
ATOM 1285  C CA  . ASN A 1 166 ? 23.404  73.108  -71.736  1.00 40.00 ? 170 ASN A CA  1 
ATOM 1286  C C   . ASN A 1 166 ? 22.415  72.033  -72.103  1.00 40.00 ? 170 ASN A C   1 
ATOM 1287  O O   . ASN A 1 166 ? 22.579  70.830  -71.803  1.00 40.00 ? 170 ASN A O   1 
ATOM 1288  C CB  . ASN A 1 166 ? 23.781  73.060  -70.250  1.00 40.00 ? 170 ASN A CB  1 
ATOM 1289  C CG  . ASN A 1 166 ? 24.882  73.995  -69.828  1.00 40.00 ? 170 ASN A CG  1 
ATOM 1290  O OD1 . ASN A 1 166 ? 25.877  74.191  -70.544  1.00 40.00 ? 170 ASN A OD1 1 
ATOM 1291  N ND2 . ASN A 1 166 ? 24.764  74.617  -68.652  1.00 40.00 ? 170 ASN A ND2 1 
ATOM 1292  N N   . VAL A 1 167 ? 21.358  72.400  -72.852  1.00 40.00 ? 171 VAL A N   1 
ATOM 1293  C CA  . VAL A 1 167 ? 20.385  71.367  -73.193  1.00 40.00 ? 171 VAL A CA  1 
ATOM 1294  C C   . VAL A 1 167 ? 21.001  70.275  -74.044  1.00 40.00 ? 171 VAL A C   1 
ATOM 1295  O O   . VAL A 1 167 ? 20.542  69.123  -73.999  1.00 40.00 ? 171 VAL A O   1 
ATOM 1296  C CB  . VAL A 1 167 ? 19.089  71.885  -73.793  1.00 40.00 ? 171 VAL A CB  1 
ATOM 1297  C CG1 . VAL A 1 167 ? 18.438  72.912  -72.859  1.00 40.00 ? 171 VAL A CG1 1 
ATOM 1298  C CG2 . VAL A 1 167 ? 19.301  72.446  -75.199  1.00 40.00 ? 171 VAL A CG2 1 
ATOM 1299  N N   . GLY A 1 168 ? 22.074  70.528  -74.785  1.00 40.00 ? 172 GLY A N   1 
ATOM 1300  C CA  . GLY A 1 168 ? 22.681  69.434  -75.564  1.00 40.00 ? 172 GLY A CA  1 
ATOM 1301  C C   . GLY A 1 168 ? 23.286  68.431  -74.560  1.00 40.00 ? 172 GLY A C   1 
ATOM 1302  O O   . GLY A 1 168 ? 23.466  67.227  -74.852  1.00 40.00 ? 172 GLY A O   1 
ATOM 1303  N N   . LEU A 1 169 ? 23.654  68.927  -73.366  1.00 40.00 ? 173 LEU A N   1 
ATOM 1304  C CA  . LEU A 1 169 ? 24.259  68.015  -72.393  1.00 40.00 ? 173 LEU A CA  1 
ATOM 1305  C C   . LEU A 1 169 ? 23.149  67.196  -71.752  1.00 40.00 ? 173 LEU A C   1 
ATOM 1306  O O   . LEU A 1 169 ? 23.305  65.993  -71.572  1.00 40.00 ? 173 LEU A O   1 
ATOM 1307  C CB  . LEU A 1 169 ? 25.031  68.755  -71.307  1.00 40.00 ? 173 LEU A CB  1 
ATOM 1308  C CG  . LEU A 1 169 ? 26.364  69.374  -71.735  1.00 40.00 ? 173 LEU A CG  1 
ATOM 1309  C CD1 . LEU A 1 169 ? 27.052  69.972  -70.526  1.00 40.00 ? 173 LEU A CD1 1 
ATOM 1310  C CD2 . LEU A 1 169 ? 27.270  68.350  -72.395  1.00 40.00 ? 173 LEU A CD2 1 
ATOM 1311  N N   . LEU A 1 170 ? 22.052  67.911  -71.470  1.00 40.00 ? 174 LEU A N   1 
ATOM 1312  C CA  . LEU A 1 170 ? 20.884  67.206  -70.913  1.00 40.00 ? 174 LEU A CA  1 
ATOM 1313  C C   . LEU A 1 170 ? 20.427  66.145  -71.896  1.00 40.00 ? 174 LEU A C   1 
ATOM 1314  O O   . LEU A 1 170 ? 19.921  65.096  -71.492  1.00 40.00 ? 174 LEU A O   1 
ATOM 1315  C CB  . LEU A 1 170 ? 19.746  68.205  -70.722  1.00 40.00 ? 174 LEU A CB  1 
ATOM 1316  C CG  . LEU A 1 170 ? 20.084  69.226  -69.645  1.00 40.00 ? 174 LEU A CG  1 
ATOM 1317  C CD1 . LEU A 1 170 ? 18.806  69.811  -69.088  1.00 40.00 ? 174 LEU A CD1 1 
ATOM 1318  C CD2 . LEU A 1 170 ? 20.846  68.594  -68.495  1.00 40.00 ? 174 LEU A CD2 1 
ATOM 1319  N N   . ASP A 1 171 ? 20.586  66.440  -73.198  1.00 40.00 ? 175 ASP A N   1 
ATOM 1320  C CA  . ASP A 1 171 ? 20.248  65.395  -74.165  1.00 40.00 ? 175 ASP A CA  1 
ATOM 1321  C C   . ASP A 1 171 ? 21.090  64.157  -73.801  1.00 40.00 ? 175 ASP A C   1 
ATOM 1322  O O   . ASP A 1 171 ? 20.532  63.088  -73.535  1.00 40.00 ? 175 ASP A O   1 
ATOM 1323  C CB  . ASP A 1 171 ? 20.529  65.807  -75.605  1.00 40.00 ? 175 ASP A CB  1 
ATOM 1324  C CG  . ASP A 1 171 ? 19.572  66.864  -76.142  1.00 40.00 ? 175 ASP A CG  1 
ATOM 1325  O OD1 . ASP A 1 171 ? 18.638  67.280  -75.404  1.00 40.00 ? 175 ASP A OD1 1 
ATOM 1326  O OD2 . ASP A 1 171 ? 19.785  67.259  -77.317  1.00 40.00 ? 175 ASP A OD2 1 
ATOM 1327  N N   . GLN A 1 172 ? 22.408  64.308  -73.749  1.00 40.00 ? 176 GLN A N   1 
ATOM 1328  C CA  . GLN A 1 172 ? 23.265  63.166  -73.429  1.00 40.00 ? 176 GLN A CA  1 
ATOM 1329  C C   . GLN A 1 172 ? 22.875  62.567  -72.077  1.00 40.00 ? 176 GLN A C   1 
ATOM 1330  O O   . GLN A 1 172 ? 22.782  61.331  -71.906  1.00 40.00 ? 176 GLN A O   1 
ATOM 1331  C CB  . GLN A 1 172 ? 24.735  63.540  -73.454  1.00 40.00 ? 176 GLN A CB  1 
ATOM 1332  C CG  . GLN A 1 172 ? 25.190  64.506  -74.543  1.00 40.00 ? 176 GLN A CG  1 
ATOM 1333  C CD  . GLN A 1 172 ? 26.532  65.156  -74.197  1.00 40.00 ? 176 GLN A CD  1 
ATOM 1334  O OE1 . GLN A 1 172 ? 26.726  65.595  -73.056  1.00 40.00 ? 176 GLN A OE1 1 
ATOM 1335  N NE2 . GLN A 1 172 ? 27.460  65.231  -75.149  1.00 40.00 ? 176 GLN A NE2 1 
ATOM 1336  N N   . ARG A 1 173 ? 22.590  63.420  -71.072  1.00 40.00 ? 177 ARG A N   1 
ATOM 1337  C CA  . ARG A 1 173 ? 22.249  62.820  -69.773  1.00 40.00 ? 177 ARG A CA  1 
ATOM 1338  C C   . ARG A 1 173 ? 21.010  61.943  -69.934  1.00 40.00 ? 177 ARG A C   1 
ATOM 1339  O O   . ARG A 1 173 ? 20.898  60.825  -69.419  1.00 40.00 ? 177 ARG A O   1 
ATOM 1340  C CB  . ARG A 1 173 ? 22.118  63.820  -68.676  1.00 40.00 ? 177 ARG A CB  1 
ATOM 1341  C CG  . ARG A 1 173 ? 21.159  63.541  -67.537  1.00 40.00 ? 177 ARG A CG  1 
ATOM 1342  C CD  . ARG A 1 173 ? 21.054  64.824  -66.662  1.00 40.00 ? 177 ARG A CD  1 
ATOM 1343  N NE  . ARG A 1 173 ? 22.332  65.085  -66.055  1.00 40.00 ? 177 ARG A NE  1 
ATOM 1344  C CZ  . ARG A 1 173 ? 22.689  66.093  -65.259  1.00 40.00 ? 177 ARG A CZ  1 
ATOM 1345  N NH1 . ARG A 1 173 ? 21.825  67.045  -64.904  1.00 40.00 ? 177 ARG A NH1 1 
ATOM 1346  N NH2 . ARG A 1 173 ? 23.960  66.126  -64.779  1.00 40.00 ? 177 ARG A NH2 1 
ATOM 1347  N N   . LEU A 1 174 ? 20.045  62.435  -70.715  1.00 40.00 ? 178 LEU A N   1 
ATOM 1348  C CA  . LEU A 1 174 ? 18.814  61.687  -70.935  1.00 40.00 ? 178 LEU A CA  1 
ATOM 1349  C C   . LEU A 1 174 ? 19.142  60.361  -71.602  1.00 40.00 ? 178 LEU A C   1 
ATOM 1350  O O   . LEU A 1 174 ? 18.656  59.311  -71.155  1.00 40.00 ? 178 LEU A O   1 
ATOM 1351  C CB  . LEU A 1 174 ? 17.867  62.518  -71.779  1.00 40.00 ? 178 LEU A CB  1 
ATOM 1352  C CG  . LEU A 1 174 ? 16.356  62.284  -71.679  1.00 40.00 ? 178 LEU A CG  1 
ATOM 1353  C CD1 . LEU A 1 174 ? 15.804  62.052  -73.082  1.00 40.00 ? 178 LEU A CD1 1 
ATOM 1354  C CD2 . LEU A 1 174 ? 15.981  61.186  -70.716  1.00 40.00 ? 178 LEU A CD2 1 
ATOM 1355  N N   . ALA A 1 175 ? 20.043  60.401  -72.599  1.00 40.00 ? 179 ALA A N   1 
ATOM 1356  C CA  . ALA A 1 175 ? 20.384  59.118  -73.244  1.00 40.00 ? 179 ALA A CA  1 
ATOM 1357  C C   . ALA A 1 175 ? 20.970  58.185  -72.193  1.00 40.00 ? 179 ALA A C   1 
ATOM 1358  O O   . ALA A 1 175 ? 20.768  56.979  -72.181  1.00 40.00 ? 179 ALA A O   1 
ATOM 1359  C CB  . ALA A 1 175 ? 21.366  59.333  -74.371  1.00 40.00 ? 179 ALA A CB  1 
ATOM 1360  N N   . LEU A 1 176 ? 21.729  58.795  -71.278  1.00 40.00 ? 180 LEU A N   1 
ATOM 1361  C CA  . LEU A 1 176 ? 22.320  58.006  -70.203  1.00 40.00 ? 180 LEU A CA  1 
ATOM 1362  C C   . LEU A 1 176 ? 21.224  57.397  -69.346  1.00 40.00 ? 180 LEU A C   1 
ATOM 1363  O O   . LEU A 1 176 ? 21.214  56.166  -69.137  1.00 40.00 ? 180 LEU A O   1 
ATOM 1364  C CB  . LEU A 1 176 ? 23.225  58.932  -69.417  1.00 40.00 ? 180 LEU A CB  1 
ATOM 1365  C CG  . LEU A 1 176 ? 24.734  58.841  -69.587  1.00 40.00 ? 180 LEU A CG  1 
ATOM 1366  C CD1 . LEU A 1 176 ? 25.237  58.427  -70.959  1.00 40.00 ? 180 LEU A CD1 1 
ATOM 1367  C CD2 . LEU A 1 176 ? 25.302  60.202  -69.183  1.00 40.00 ? 180 LEU A CD2 1 
ATOM 1368  N N   . GLN A 1 177 ? 20.228  58.182  -68.882  1.00 40.00 ? 181 GLN A N   1 
ATOM 1369  C CA  . GLN A 1 177 ? 19.195  57.588  -68.027  1.00 40.00 ? 181 GLN A CA  1 
ATOM 1370  C C   . GLN A 1 177 ? 18.439  56.501  -68.781  1.00 40.00 ? 181 GLN A C   1 
ATOM 1371  O O   . GLN A 1 177 ? 17.888  55.595  -68.155  1.00 40.00 ? 181 GLN A O   1 
ATOM 1372  C CB  . GLN A 1 177 ? 18.216  58.587  -67.442  1.00 40.00 ? 181 GLN A CB  1 
ATOM 1373  C CG  . GLN A 1 177 ? 18.866  59.890  -67.052  1.00 40.00 ? 181 GLN A CG  1 
ATOM 1374  C CD  . GLN A 1 177 ? 17.888  60.953  -66.596  1.00 40.00 ? 181 GLN A CD  1 
ATOM 1375  O OE1 . GLN A 1 177 ? 17.672  61.970  -67.282  1.00 40.00 ? 181 GLN A OE1 1 
ATOM 1376  N NE2 . GLN A 1 177 ? 17.295  60.736  -65.413  1.00 40.00 ? 181 GLN A NE2 1 
ATOM 1377  N N   . TRP A 1 178 ? 18.437  56.643  -70.105  1.00 40.00 ? 182 TRP A N   1 
ATOM 1378  C CA  . TRP A 1 178 ? 17.729  55.595  -70.847  1.00 40.00 ? 182 TRP A CA  1 
ATOM 1379  C C   . TRP A 1 178 ? 18.591  54.342  -70.807  1.00 40.00 ? 182 TRP A C   1 
ATOM 1380  O O   . TRP A 1 178 ? 18.117  53.286  -70.339  1.00 40.00 ? 182 TRP A O   1 
ATOM 1381  C CB  . TRP A 1 178 ? 17.418  56.047  -72.203  1.00 40.00 ? 182 TRP A CB  1 
ATOM 1382  C CG  . TRP A 1 178 ? 16.767  55.127  -73.147  1.00 40.00 ? 182 TRP A CG  1 
ATOM 1383  C CD1 . TRP A 1 178 ? 15.454  55.206  -73.500  1.00 40.00 ? 182 TRP A CD1 1 
ATOM 1384  C CD2 . TRP A 1 178 ? 17.329  54.042  -73.889  1.00 40.00 ? 182 TRP A CD2 1 
ATOM 1385  N NE1 . TRP A 1 178 ? 15.155  54.228  -74.429  1.00 40.00 ? 182 TRP A NE1 1 
ATOM 1386  C CE2 . TRP A 1 178 ? 16.293  53.503  -74.678  1.00 40.00 ? 182 TRP A CE2 1 
ATOM 1387  C CE3 . TRP A 1 178 ? 18.598  53.469  -73.976  1.00 40.00 ? 182 TRP A CE3 1 
ATOM 1388  C CZ2 . TRP A 1 178 ? 16.468  52.430  -75.550  1.00 40.00 ? 182 TRP A CZ2 1 
ATOM 1389  C CZ3 . TRP A 1 178 ? 18.769  52.407  -74.853  1.00 40.00 ? 182 TRP A CZ3 1 
ATOM 1390  C CH2 . TRP A 1 178 ? 17.718  51.887  -75.635  1.00 40.00 ? 182 TRP A CH2 1 
ATOM 1391  N N   . VAL A 1 179 ? 19.864  54.468  -71.165  1.00 40.00 ? 183 VAL A N   1 
ATOM 1392  C CA  . VAL A 1 179 ? 20.737  53.278  -71.091  1.00 40.00 ? 183 VAL A CA  1 
ATOM 1393  C C   . VAL A 1 179 ? 20.546  52.593  -69.741  1.00 40.00 ? 183 VAL A C   1 
ATOM 1394  O O   . VAL A 1 179 ? 20.343  51.378  -69.670  1.00 40.00 ? 183 VAL A O   1 
ATOM 1395  C CB  . VAL A 1 179 ? 22.173  53.651  -71.410  1.00 40.00 ? 183 VAL A CB  1 
ATOM 1396  C CG1 . VAL A 1 179 ? 22.966  53.960  -70.149  1.00 40.00 ? 183 VAL A CG1 1 
ATOM 1397  C CG2 . VAL A 1 179 ? 22.868  52.561  -72.227  1.00 40.00 ? 183 VAL A CG2 1 
ATOM 1398  N N   . GLN A 1 180 ? 20.525  53.372  -68.665  1.00 40.00 ? 184 GLN A N   1 
ATOM 1399  C CA  . GLN A 1 180 ? 20.282  52.874  -67.343  1.00 40.00 ? 184 GLN A CA  1 
ATOM 1400  C C   . GLN A 1 180 ? 19.068  51.956  -67.303  1.00 40.00 ? 184 GLN A C   1 
ATOM 1401  O O   . GLN A 1 180 ? 19.149  50.766  -67.019  1.00 40.00 ? 184 GLN A O   1 
ATOM 1402  C CB  . GLN A 1 180 ? 19.977  54.015  -66.363  1.00 40.00 ? 184 GLN A CB  1 
ATOM 1403  C CG  . GLN A 1 180 ? 20.478  53.825  -64.955  1.00 40.00 ? 184 GLN A CG  1 
ATOM 1404  C CD  . GLN A 1 180 ? 21.927  53.395  -64.858  1.00 40.00 ? 184 GLN A CD  1 
ATOM 1405  O OE1 . GLN A 1 180 ? 22.680  53.310  -65.840  1.00 40.00 ? 184 GLN A OE1 1 
ATOM 1406  N NE2 . GLN A 1 180 ? 22.371  53.096  -63.634  1.00 40.00 ? 184 GLN A NE2 1 
ATOM 1407  N N   . GLU A 1 181 ? 17.905  52.554  -67.605  1.00 40.00 ? 185 GLU A N   1 
ATOM 1408  C CA  . GLU A 1 181 ? 16.690  51.750  -67.492  1.00 40.00 ? 185 GLU A CA  1 
ATOM 1409  C C   . GLU A 1 181 ? 16.330  50.912  -68.664  1.00 40.00 ? 185 GLU A C   1 
ATOM 1410  O O   . GLU A 1 181 ? 15.127  50.580  -68.769  1.00 40.00 ? 185 GLU A O   1 
ATOM 1411  C CB  . GLU A 1 181 ? 15.539  52.672  -67.049  1.00 40.00 ? 185 GLU A CB  1 
ATOM 1412  C CG  . GLU A 1 181 ? 15.412  53.899  -67.940  1.00 40.00 ? 185 GLU A CG  1 
ATOM 1413  C CD  . GLU A 1 181 ? 14.201  54.731  -67.544  1.00 40.00 ? 185 GLU A CD  1 
ATOM 1414  O OE1 . GLU A 1 181 ? 14.083  55.082  -66.346  1.00 40.00 ? 185 GLU A OE1 1 
ATOM 1415  O OE2 . GLU A 1 181 ? 13.382  55.013  -68.464  1.00 40.00 ? 185 GLU A OE2 1 
ATOM 1416  N N   . ASN A 1 182 ? 17.198  50.545  -69.591  1.00 40.00 ? 186 ASN A N   1 
ATOM 1417  C CA  . ASN A 1 182 ? 16.767  49.733  -70.723  1.00 40.00 ? 186 ASN A CA  1 
ATOM 1418  C C   . ASN A 1 182 ? 17.919  48.990  -71.355  1.00 40.00 ? 186 ASN A C   1 
ATOM 1419  O O   . ASN A 1 182 ? 17.719  48.186  -72.270  1.00 40.00 ? 186 ASN A O   1 
ATOM 1420  C CB  . ASN A 1 182 ? 16.291  50.678  -71.864  1.00 40.00 ? 186 ASN A CB  1 
ATOM 1421  C CG  . ASN A 1 182 ? 14.899  51.203  -71.608  1.00 40.00 ? 186 ASN A CG  1 
ATOM 1422  O OD1 . ASN A 1 182 ? 13.947  50.453  -71.884  1.00 40.00 ? 186 ASN A OD1 1 
ATOM 1423  N ND2 . ASN A 1 182 ? 14.793  52.415  -71.051  1.00 40.00 ? 186 ASN A ND2 1 
ATOM 1424  N N   . ILE A 1 183 ? 19.165  49.308  -70.959  1.00 40.00 ? 187 ILE A N   1 
ATOM 1425  C CA  . ILE A 1 183 ? 20.242  48.627  -71.719  1.00 40.00 ? 187 ILE A CA  1 
ATOM 1426  C C   . ILE A 1 183 ? 20.247  47.152  -71.375  1.00 40.00 ? 187 ILE A C   1 
ATOM 1427  O O   . ILE A 1 183 ? 20.675  46.265  -72.125  1.00 40.00 ? 187 ILE A O   1 
ATOM 1428  C CB  . ILE A 1 183 ? 21.562  49.336  -71.475  1.00 40.00 ? 187 ILE A CB  1 
ATOM 1429  C CG1 . ILE A 1 183 ? 22.650  48.915  -72.461  1.00 40.00 ? 187 ILE A CG1 1 
ATOM 1430  C CG2 . ILE A 1 183 ? 21.994  49.051  -70.042  1.00 40.00 ? 187 ILE A CG2 1 
ATOM 1431  C CD1 . ILE A 1 183 ? 22.250  49.032  -73.926  1.00 40.00 ? 187 ILE A CD1 1 
ATOM 1432  N N   . ALA A 1 184 ? 19.722  46.896  -70.168  1.00 40.00 ? 188 ALA A N   1 
ATOM 1433  C CA  . ALA A 1 184 ? 19.552  45.576  -69.593  1.00 40.00 ? 188 ALA A CA  1 
ATOM 1434  C C   . ALA A 1 184 ? 19.031  44.626  -70.662  1.00 40.00 ? 188 ALA A C   1 
ATOM 1435  O O   . ALA A 1 184 ? 19.661  43.628  -71.009  1.00 40.00 ? 188 ALA A O   1 
ATOM 1436  C CB  . ALA A 1 184 ? 18.559  45.647  -68.435  1.00 40.00 ? 188 ALA A CB  1 
ATOM 1437  N N   . ALA A 1 185 ? 17.918  45.008  -71.293  1.00 40.00 ? 189 ALA A N   1 
ATOM 1438  C CA  . ALA A 1 185 ? 17.257  44.267  -72.341  1.00 40.00 ? 189 ALA A CA  1 
ATOM 1439  C C   . ALA A 1 185 ? 18.094  43.991  -73.569  1.00 40.00 ? 189 ALA A C   1 
ATOM 1440  O O   . ALA A 1 185 ? 17.660  43.297  -74.504  1.00 40.00 ? 189 ALA A O   1 
ATOM 1441  C CB  . ALA A 1 185 ? 15.936  44.939  -72.719  1.00 40.00 ? 189 ALA A CB  1 
ATOM 1442  N N   . PHE A 1 186 ? 19.302  44.512  -73.664  1.00 40.00 ? 190 PHE A N   1 
ATOM 1443  C CA  . PHE A 1 186 ? 20.143  44.260  -74.837  1.00 40.00 ? 190 PHE A CA  1 
ATOM 1444  C C   . PHE A 1 186 ? 21.335  43.405  -74.383  1.00 40.00 ? 190 PHE A C   1 
ATOM 1445  O O   . PHE A 1 186 ? 22.260  43.188  -75.160  1.00 40.00 ? 190 PHE A O   1 
ATOM 1446  C CB  . PHE A 1 186 ? 20.673  45.560  -75.465  1.00 40.00 ? 190 PHE A CB  1 
ATOM 1447  C CG  . PHE A 1 186 ? 19.543  46.402  -75.996  1.00 40.00 ? 190 PHE A CG  1 
ATOM 1448  C CD1 . PHE A 1 186 ? 18.754  47.144  -75.122  1.00 40.00 ? 190 PHE A CD1 1 
ATOM 1449  C CD2 . PHE A 1 186 ? 19.284  46.423  -77.360  1.00 40.00 ? 190 PHE A CD2 1 
ATOM 1450  C CE1 . PHE A 1 186 ? 17.711  47.899  -75.627  1.00 40.00 ? 190 PHE A CE1 1 
ATOM 1451  C CE2 . PHE A 1 186 ? 18.246  47.175  -77.874  1.00 40.00 ? 190 PHE A CE2 1 
ATOM 1452  C CZ  . PHE A 1 186 ? 17.460  47.915  -76.999  1.00 40.00 ? 190 PHE A CZ  1 
ATOM 1453  N N   . GLY A 1 187 ? 21.214  42.981  -73.126  1.00 40.00 ? 191 GLY A N   1 
ATOM 1454  C CA  . GLY A 1 187 ? 22.273  42.183  -72.522  1.00 40.00 ? 191 GLY A CA  1 
ATOM 1455  C C   . GLY A 1 187 ? 23.334  43.082  -71.896  1.00 40.00 ? 191 GLY A C   1 
ATOM 1456  O O   . GLY A 1 187 ? 24.425  42.594  -71.594  1.00 40.00 ? 191 GLY A O   1 
ATOM 1457  N N   . GLY A 1 188 ? 23.026  44.373  -71.719  1.00 40.00 ? 192 GLY A N   1 
ATOM 1458  C CA  . GLY A 1 188 ? 24.047  45.256  -71.135  1.00 40.00 ? 192 GLY A CA  1 
ATOM 1459  C C   . GLY A 1 188 ? 23.863  45.351  -69.618  1.00 40.00 ? 192 GLY A C   1 
ATOM 1460  O O   . GLY A 1 188 ? 22.764  45.203  -69.100  1.00 40.00 ? 192 GLY A O   1 
ATOM 1461  N N   . ASP A 1 189 ? 24.975  45.616  -68.951  1.00 40.00 ? 193 ASP A N   1 
ATOM 1462  C CA  . ASP A 1 189 ? 24.976  45.780  -67.510  1.00 40.00 ? 193 ASP A CA  1 
ATOM 1463  C C   . ASP A 1 189 ? 24.820  47.233  -67.144  1.00 40.00 ? 193 ASP A C   1 
ATOM 1464  O O   . ASP A 1 189 ? 25.786  48.030  -67.220  1.00 40.00 ? 193 ASP A O   1 
ATOM 1465  C CB  . ASP A 1 189 ? 26.348  45.304  -66.981  1.00 40.00 ? 193 ASP A CB  1 
ATOM 1466  C CG  . ASP A 1 189 ? 26.352  45.222  -65.460  1.00 40.00 ? 193 ASP A CG  1 
ATOM 1467  O OD1 . ASP A 1 189 ? 25.292  45.470  -64.830  1.00 40.00 ? 193 ASP A OD1 1 
ATOM 1468  O OD2 . ASP A 1 189 ? 27.424  44.912  -64.884  1.00 40.00 ? 193 ASP A OD2 1 
ATOM 1469  N N   . PRO A 1 190 ? 23.671  47.635  -66.616  1.00 40.00 ? 194 PRO A N   1 
ATOM 1470  C CA  . PRO A 1 190 ? 23.449  49.002  -66.163  1.00 40.00 ? 194 PRO A CA  1 
ATOM 1471  C C   . PRO A 1 190 ? 24.399  49.375  -65.028  1.00 40.00 ? 194 PRO A C   1 
ATOM 1472  O O   . PRO A 1 190 ? 24.389  50.500  -64.521  1.00 40.00 ? 194 PRO A O   1 
ATOM 1473  C CB  . PRO A 1 190 ? 22.021  48.977  -65.601  1.00 40.00 ? 194 PRO A CB  1 
ATOM 1474  C CG  . PRO A 1 190 ? 21.819  47.554  -65.232  1.00 40.00 ? 194 PRO A CG  1 
ATOM 1475  C CD  . PRO A 1 190 ? 22.488  46.791  -66.378  1.00 40.00 ? 194 PRO A CD  1 
ATOM 1476  N N   . MET A 1 191 ? 25.200  48.454  -64.552  1.00 40.00 ? 195 MET A N   1 
ATOM 1477  C CA  . MET A 1 191 ? 26.136  48.615  -63.486  1.00 40.00 ? 195 MET A CA  1 
ATOM 1478  C C   . MET A 1 191 ? 27.569  48.824  -63.952  1.00 40.00 ? 195 MET A C   1 
ATOM 1479  O O   . MET A 1 191 ? 28.411  49.187  -63.117  1.00 40.00 ? 195 MET A O   1 
ATOM 1480  C CB  . MET A 1 191 ? 26.066  47.415  -62.533  1.00 40.00 ? 195 MET A CB  1 
ATOM 1481  C CG  . MET A 1 191 ? 25.098  47.620  -61.382  1.00 40.00 ? 195 MET A CG  1 
ATOM 1482  S SD  . MET A 1 191 ? 24.532  49.341  -61.263  1.00 40.00 ? 195 MET A SD  1 
ATOM 1483  C CE  . MET A 1 191 ? 23.366  49.181  -59.901  1.00 40.00 ? 195 MET A CE  1 
ATOM 1484  N N   . SER A 1 192 ? 27.803  48.695  -65.248  1.00 40.00 ? 196 SER A N   1 
ATOM 1485  C CA  . SER A 1 192 ? 29.151  48.962  -65.763  1.00 40.00 ? 196 SER A CA  1 
ATOM 1486  C C   . SER A 1 192 ? 29.051  49.788  -67.047  1.00 40.00 ? 196 SER A C   1 
ATOM 1487  O O   . SER A 1 192 ? 29.263  49.403  -68.198  1.00 40.00 ? 196 SER A O   1 
ATOM 1488  C CB  . SER A 1 192 ? 29.995  47.732  -65.753  1.00 40.00 ? 196 SER A CB  1 
ATOM 1489  O OG  . SER A 1 192 ? 30.508  47.317  -66.992  1.00 40.00 ? 196 SER A OG  1 
ATOM 1490  N N   . VAL A 1 193 ? 28.670  51.055  -66.785  1.00 40.00 ? 197 VAL A N   1 
ATOM 1491  C CA  . VAL A 1 193 ? 28.539  52.086  -67.808  1.00 40.00 ? 197 VAL A CA  1 
ATOM 1492  C C   . VAL A 1 193 ? 29.867  52.862  -67.849  1.00 40.00 ? 197 VAL A C   1 
ATOM 1493  O O   . VAL A 1 193 ? 30.292  53.481  -66.870  1.00 40.00 ? 197 VAL A O   1 
ATOM 1494  C CB  . VAL A 1 193 ? 27.406  53.064  -67.455  1.00 40.00 ? 197 VAL A CB  1 
ATOM 1495  C CG1 . VAL A 1 193 ? 27.484  54.367  -68.211  1.00 40.00 ? 197 VAL A CG1 1 
ATOM 1496  C CG2 . VAL A 1 193 ? 26.053  52.390  -67.696  1.00 40.00 ? 197 VAL A CG2 1 
ATOM 1497  N N   . THR A 1 194 ? 30.521  52.796  -68.995  1.00 40.00 ? 198 THR A N   1 
ATOM 1498  C CA  . THR A 1 194 ? 31.778  53.513  -69.201  1.00 40.00 ? 198 THR A CA  1 
ATOM 1499  C C   . THR A 1 194 ? 31.590  54.554  -70.298  1.00 40.00 ? 198 THR A C   1 
ATOM 1500  O O   . THR A 1 194 ? 31.495  54.179  -71.486  1.00 40.00 ? 198 THR A O   1 
ATOM 1501  C CB  . THR A 1 194 ? 32.904  52.526  -69.538  1.00 40.00 ? 198 THR A CB  1 
ATOM 1502  O OG1 . THR A 1 194 ? 33.448  52.069  -68.293  1.00 40.00 ? 198 THR A OG1 1 
ATOM 1503  C CG2 . THR A 1 194 ? 34.029  53.110  -70.375  1.00 40.00 ? 198 THR A CG2 1 
ATOM 1504  N N   . LEU A 1 195 ? 31.506  55.843  -69.949  1.00 40.00 ? 199 LEU A N   1 
ATOM 1505  C CA  . LEU A 1 195 ? 31.337  56.867  -70.995  1.00 40.00 ? 199 LEU A CA  1 
ATOM 1506  C C   . LEU A 1 195 ? 32.635  57.027  -71.782  1.00 40.00 ? 199 LEU A C   1 
ATOM 1507  O O   . LEU A 1 195 ? 33.706  56.945  -71.177  1.00 40.00 ? 199 LEU A O   1 
ATOM 1508  C CB  . LEU A 1 195 ? 31.013  58.257  -70.397  1.00 40.00 ? 199 LEU A CB  1 
ATOM 1509  C CG  . LEU A 1 195 ? 29.796  58.342  -69.485  1.00 40.00 ? 199 LEU A CG  1 
ATOM 1510  C CD1 . LEU A 1 195 ? 29.639  59.703  -68.825  1.00 40.00 ? 199 LEU A CD1 1 
ATOM 1511  C CD2 . LEU A 1 195 ? 28.529  57.979  -70.273  1.00 40.00 ? 199 LEU A CD2 1 
ATOM 1512  N N   . PHE A 1 196 ? 32.579  57.329  -73.068  1.00 40.00 ? 200 PHE A N   1 
ATOM 1513  C CA  . PHE A 1 196 ? 33.838  57.598  -73.768  1.00 40.00 ? 200 PHE A CA  1 
ATOM 1514  C C   . PHE A 1 196 ? 33.629  58.463  -75.008  1.00 40.00 ? 200 PHE A C   1 
ATOM 1515  O O   . PHE A 1 196 ? 32.842  58.138  -75.904  1.00 40.00 ? 200 PHE A O   1 
ATOM 1516  C CB  . PHE A 1 196 ? 34.634  56.365  -74.053  1.00 40.00 ? 200 PHE A CB  1 
ATOM 1517  C CG  . PHE A 1 196 ? 34.289  55.588  -75.283  1.00 40.00 ? 200 PHE A CG  1 
ATOM 1518  C CD1 . PHE A 1 196 ? 33.010  55.055  -75.451  1.00 40.00 ? 200 PHE A CD1 1 
ATOM 1519  C CD2 . PHE A 1 196 ? 35.255  55.381  -76.268  1.00 40.00 ? 200 PHE A CD2 1 
ATOM 1520  C CE1 . PHE A 1 196 ? 32.714  54.326  -76.599  1.00 40.00 ? 200 PHE A CE1 1 
ATOM 1521  C CE2 . PHE A 1 196 ? 34.958  54.650  -77.414  1.00 40.00 ? 200 PHE A CE2 1 
ATOM 1522  C CZ  . PHE A 1 196 ? 33.687  54.125  -77.590  1.00 40.00 ? 200 PHE A CZ  1 
ATOM 1523  N N   . GLY A 1 197 ? 34.352  59.589  -75.071  1.00 40.00 ? 201 GLY A N   1 
ATOM 1524  C CA  . GLY A 1 197 ? 34.259  60.465  -76.222  1.00 40.00 ? 201 GLY A CA  1 
ATOM 1525  C C   . GLY A 1 197 ? 35.517  61.237  -76.552  1.00 40.00 ? 201 GLY A C   1 
ATOM 1526  O O   . GLY A 1 197 ? 36.464  61.402  -75.786  1.00 40.00 ? 201 GLY A O   1 
ATOM 1527  N N   . GLU A 1 198 ? 35.550  61.809  -77.733  1.00 40.00 ? 202 GLU A N   1 
ATOM 1528  C CA  . GLU A 1 198 ? 36.647  62.621  -78.240  1.00 40.00 ? 202 GLU A CA  1 
ATOM 1529  C C   . GLU A 1 198 ? 36.281  64.094  -78.288  1.00 40.00 ? 202 GLU A C   1 
ATOM 1530  O O   . GLU A 1 198 ? 35.163  64.466  -77.936  1.00 40.00 ? 202 GLU A O   1 
ATOM 1531  C CB  . GLU A 1 198 ? 37.028  62.038  -79.597  1.00 40.00 ? 202 GLU A CB  1 
ATOM 1532  C CG  . GLU A 1 198 ? 38.434  62.453  -79.998  1.00 40.00 ? 202 GLU A CG  1 
ATOM 1533  C CD  . GLU A 1 198 ? 38.290  63.598  -80.998  1.00 40.00 ? 202 GLU A CD  1 
ATOM 1534  O OE1 . GLU A 1 198 ? 37.152  64.120  -81.032  1.00 40.00 ? 202 GLU A OE1 1 
ATOM 1535  O OE2 . GLU A 1 198 ? 39.278  63.938  -81.686  1.00 40.00 ? 202 GLU A OE2 1 
ATOM 1536  N N   . SER A 1 199 ? 37.169  64.989  -78.639  1.00 40.00 ? 203 SER A N   1 
ATOM 1537  C CA  . SER A 1 199 ? 36.976  66.436  -78.682  1.00 40.00 ? 203 SER A CA  1 
ATOM 1538  C C   . SER A 1 199 ? 35.921  66.911  -77.695  1.00 40.00 ? 203 SER A C   1 
ATOM 1539  O O   . SER A 1 199 ? 36.016  66.648  -76.471  1.00 40.00 ? 203 SER A O   1 
ATOM 1540  C CB  . SER A 1 199 ? 36.725  66.907  -80.098  1.00 40.00 ? 203 SER A CB  1 
ATOM 1541  O OG  . SER A 1 199 ? 37.019  68.256  -80.385  1.00 40.00 ? 203 SER A OG  1 
ATOM 1542  N N   . ALA A 1 200 ? 34.840  67.574  -78.168  1.00 40.00 ? 204 ALA A N   1 
ATOM 1543  C CA  . ALA A 1 200 ? 33.846  68.033  -77.188  1.00 40.00 ? 204 ALA A CA  1 
ATOM 1544  C C   . ALA A 1 200 ? 33.077  66.893  -76.553  1.00 40.00 ? 204 ALA A C   1 
ATOM 1545  O O   . ALA A 1 200 ? 32.513  67.026  -75.447  1.00 40.00 ? 204 ALA A O   1 
ATOM 1546  C CB  . ALA A 1 200 ? 33.006  69.171  -77.660  1.00 40.00 ? 204 ALA A CB  1 
ATOM 1547  N N   . GLY A 1 201 ? 33.048  65.710  -77.162  1.00 40.00 ? 205 GLY A N   1 
ATOM 1548  C CA  . GLY A 1 201 ? 32.406  64.549  -76.483  1.00 40.00 ? 205 GLY A CA  1 
ATOM 1549  C C   . GLY A 1 201 ? 33.235  64.244  -75.214  1.00 40.00 ? 205 GLY A C   1 
ATOM 1550  O O   . GLY A 1 201 ? 32.671  64.091  -74.128  1.00 40.00 ? 205 GLY A O   1 
ATOM 1551  N N   . ALA A 1 202 ? 34.561  64.230  -75.349  1.00 40.00 ? 206 ALA A N   1 
ATOM 1552  C CA  . ALA A 1 202 ? 35.442  64.070  -74.192  1.00 40.00 ? 206 ALA A CA  1 
ATOM 1553  C C   . ALA A 1 202 ? 35.129  65.171  -73.169  1.00 40.00 ? 206 ALA A C   1 
ATOM 1554  O O   . ALA A 1 202 ? 34.814  64.904  -72.005  1.00 40.00 ? 206 ALA A O   1 
ATOM 1555  C CB  . ALA A 1 202 ? 36.879  64.260  -74.664  1.00 40.00 ? 206 ALA A CB  1 
ATOM 1556  N N   . ALA A 1 203 ? 35.079  66.422  -73.683  1.00 40.00 ? 207 ALA A N   1 
ATOM 1557  C CA  . ALA A 1 203 ? 34.751  67.550  -72.847  1.00 40.00 ? 207 ALA A CA  1 
ATOM 1558  C C   . ALA A 1 203 ? 33.448  67.298  -72.106  1.00 40.00 ? 207 ALA A C   1 
ATOM 1559  O O   . ALA A 1 203 ? 33.243  67.716  -70.969  1.00 40.00 ? 207 ALA A O   1 
ATOM 1560  C CB  . ALA A 1 203 ? 34.528  68.816  -73.655  1.00 40.00 ? 207 ALA A CB  1 
ATOM 1561  N N   . SER A 1 204 ? 32.542  66.655  -72.837  1.00 40.00 ? 208 SER A N   1 
ATOM 1562  C CA  . SER A 1 204 ? 31.219  66.337  -72.318  1.00 40.00 ? 208 SER A CA  1 
ATOM 1563  C C   . SER A 1 204 ? 31.312  65.320  -71.202  1.00 40.00 ? 208 SER A C   1 
ATOM 1564  O O   . SER A 1 204 ? 30.869  65.519  -70.049  1.00 40.00 ? 208 SER A O   1 
ATOM 1565  C CB  . SER A 1 204 ? 30.373  65.789  -73.471  1.00 40.00 ? 208 SER A CB  1 
ATOM 1566  O OG  . SER A 1 204 ? 30.134  66.788  -74.430  1.00 40.00 ? 208 SER A OG  1 
ATOM 1567  N N   . VAL A 1 205 ? 31.987  64.201  -71.571  1.00 40.00 ? 209 VAL A N   1 
ATOM 1568  C CA  . VAL A 1 205 ? 32.180  63.157  -70.554  1.00 40.00 ? 209 VAL A CA  1 
ATOM 1569  C C   . VAL A 1 205 ? 32.691  63.883  -69.287  1.00 40.00 ? 209 VAL A C   1 
ATOM 1570  O O   . VAL A 1 205 ? 32.233  63.586  -68.173  1.00 40.00 ? 209 VAL A O   1 
ATOM 1571  C CB  . VAL A 1 205 ? 33.312  62.190  -70.940  1.00 40.00 ? 209 VAL A CB  1 
ATOM 1572  C CG1 . VAL A 1 205 ? 33.666  61.352  -69.724  1.00 40.00 ? 209 VAL A CG1 1 
ATOM 1573  C CG2 . VAL A 1 205 ? 32.961  61.287  -72.109  1.00 40.00 ? 209 VAL A CG2 1 
ATOM 1574  N N   . GLY A 1 206 ? 33.644  64.831  -69.530  1.00 40.00 ? 210 GLY A N   1 
ATOM 1575  C CA  . GLY A 1 206 ? 34.172  65.556  -68.393  1.00 40.00 ? 210 GLY A CA  1 
ATOM 1576  C C   . GLY A 1 206 ? 33.086  66.225  -67.564  1.00 40.00 ? 210 GLY A C   1 
ATOM 1577  O O   . GLY A 1 206 ? 33.062  66.251  -66.321  1.00 40.00 ? 210 GLY A O   1 
ATOM 1578  N N   . MET A 1 207 ? 32.129  66.821  -68.299  1.00 40.00 ? 211 MET A N   1 
ATOM 1579  C CA  . MET A 1 207 ? 31.055  67.547  -67.587  1.00 40.00 ? 211 MET A CA  1 
ATOM 1580  C C   . MET A 1 207 ? 30.130  66.624  -66.854  1.00 40.00 ? 211 MET A C   1 
ATOM 1581  O O   . MET A 1 207 ? 29.570  66.872  -65.760  1.00 40.00 ? 211 MET A O   1 
ATOM 1582  C CB  . MET A 1 207 ? 30.426  68.545  -68.546  1.00 40.00 ? 211 MET A CB  1 
ATOM 1583  C CG  . MET A 1 207 ? 31.323  69.785  -68.551  1.00 40.00 ? 211 MET A CG  1 
ATOM 1584  S SD  . MET A 1 207 ? 30.870  71.012  -69.727  1.00 40.00 ? 211 MET A SD  1 
ATOM 1585  C CE  . MET A 1 207 ? 31.947  70.629  -71.125  1.00 40.00 ? 211 MET A CE  1 
ATOM 1586  N N   . HIS A 1 208 ? 30.027  65.395  -67.426  1.00 40.00 ? 212 HIS A N   1 
ATOM 1587  C CA  . HIS A 1 208 ? 29.178  64.478  -66.637  1.00 40.00 ? 212 HIS A CA  1 
ATOM 1588  C C   . HIS A 1 208 ? 29.863  64.232  -65.315  1.00 40.00 ? 212 HIS A C   1 
ATOM 1589  O O   . HIS A 1 208 ? 29.165  64.388  -64.299  1.00 40.00 ? 212 HIS A O   1 
ATOM 1590  C CB  . HIS A 1 208 ? 28.768  63.262  -67.434  1.00 40.00 ? 212 HIS A CB  1 
ATOM 1591  C CG  . HIS A 1 208 ? 27.743  63.666  -68.488  1.00 40.00 ? 212 HIS A CG  1 
ATOM 1592  N ND1 . HIS A 1 208 ? 27.867  63.303  -69.800  1.00 40.00 ? 212 HIS A ND1 1 
ATOM 1593  C CD2 . HIS A 1 208 ? 26.643  64.424  -68.391  1.00 40.00 ? 212 HIS A CD2 1 
ATOM 1594  C CE1 . HIS A 1 208 ? 26.866  63.817  -70.490  1.00 40.00 ? 212 HIS A CE1 1 
ATOM 1595  N NE2 . HIS A 1 208 ? 26.103  64.505  -69.645  1.00 40.00 ? 212 HIS A NE2 1 
ATOM 1596  N N   . ILE A 1 209 ? 31.167  63.956  -65.305  1.00 40.00 ? 213 ILE A N   1 
ATOM 1597  C CA  . ILE A 1 209 ? 31.879  63.733  -64.043  1.00 40.00 ? 213 ILE A CA  1 
ATOM 1598  C C   . ILE A 1 209 ? 31.735  64.945  -63.119  1.00 40.00 ? 213 ILE A C   1 
ATOM 1599  O O   . ILE A 1 209 ? 31.645  64.840  -61.901  1.00 40.00 ? 213 ILE A O   1 
ATOM 1600  C CB  . ILE A 1 209 ? 33.378  63.560  -64.294  1.00 40.00 ? 213 ILE A CB  1 
ATOM 1601  C CG1 . ILE A 1 209 ? 33.719  62.239  -64.961  1.00 40.00 ? 213 ILE A CG1 1 
ATOM 1602  C CG2 . ILE A 1 209 ? 34.157  63.722  -63.011  1.00 40.00 ? 213 ILE A CG2 1 
ATOM 1603  C CD1 . ILE A 1 209 ? 35.182  62.208  -65.437  1.00 40.00 ? 213 ILE A CD1 1 
ATOM 1604  N N   . LEU A 1 210 ? 31.736  66.145  -63.701  1.00 40.00 ? 214 LEU A N   1 
ATOM 1605  C CA  . LEU A 1 210 ? 31.665  67.362  -62.920  1.00 40.00 ? 214 LEU A CA  1 
ATOM 1606  C C   . LEU A 1 210 ? 30.251  67.679  -62.473  1.00 40.00 ? 214 LEU A C   1 
ATOM 1607  O O   . LEU A 1 210 ? 30.033  68.575  -61.647  1.00 40.00 ? 214 LEU A O   1 
ATOM 1608  C CB  . LEU A 1 210 ? 32.210  68.487  -63.816  1.00 40.00 ? 214 LEU A CB  1 
ATOM 1609  C CG  . LEU A 1 210 ? 33.640  68.955  -63.637  1.00 40.00 ? 214 LEU A CG  1 
ATOM 1610  C CD1 . LEU A 1 210 ? 34.260  68.408  -62.348  1.00 40.00 ? 214 LEU A CD1 1 
ATOM 1611  C CD2 . LEU A 1 210 ? 34.481  68.564  -64.854  1.00 40.00 ? 214 LEU A CD2 1 
ATOM 1612  N N   . SER A 1 211 ? 29.285  66.992  -63.078  1.00 40.00 ? 215 SER A N   1 
ATOM 1613  C CA  . SER A 1 211 ? 27.875  67.275  -62.756  1.00 40.00 ? 215 SER A CA  1 
ATOM 1614  C C   . SER A 1 211 ? 27.265  66.226  -61.855  1.00 40.00 ? 215 SER A C   1 
ATOM 1615  O O   . SER A 1 211 ? 27.266  65.027  -62.206  1.00 40.00 ? 215 SER A O   1 
ATOM 1616  C CB  . SER A 1 211 ? 27.130  67.385  -64.091  1.00 40.00 ? 215 SER A CB  1 
ATOM 1617  O OG  . SER A 1 211 ? 25.958  68.154  -63.939  1.00 40.00 ? 215 SER A OG  1 
ATOM 1618  N N   . LEU A 1 212 ? 26.728  66.636  -60.692  1.00 40.00 ? 216 LEU A N   1 
ATOM 1619  C CA  . LEU A 1 212 ? 26.216  65.579  -59.812  1.00 40.00 ? 216 LEU A CA  1 
ATOM 1620  C C   . LEU A 1 212 ? 25.275  64.613  -60.448  1.00 40.00 ? 216 LEU A C   1 
ATOM 1621  O O   . LEU A 1 212 ? 25.599  63.443  -60.694  1.00 40.00 ? 216 LEU A O   1 
ATOM 1622  C CB  . LEU A 1 212 ? 25.754  66.068  -58.452  1.00 40.00 ? 216 LEU A CB  1 
ATOM 1623  C CG  . LEU A 1 212 ? 26.810  65.819  -57.352  1.00 40.00 ? 216 LEU A CG  1 
ATOM 1624  C CD1 . LEU A 1 212 ? 28.217  65.550  -57.898  1.00 40.00 ? 216 LEU A CD1 1 
ATOM 1625  C CD2 . LEU A 1 212 ? 26.881  67.021  -56.404  1.00 40.00 ? 216 LEU A CD2 1 
ATOM 1626  N N   . PRO A 1 213 ? 24.091  65.062  -60.802  1.00 40.00 ? 217 PRO A N   1 
ATOM 1627  C CA  . PRO A 1 213 ? 23.108  64.214  -61.458  1.00 40.00 ? 217 PRO A CA  1 
ATOM 1628  C C   . PRO A 1 213 ? 23.720  63.347  -62.509  1.00 40.00 ? 217 PRO A C   1 
ATOM 1629  O O   . PRO A 1 213 ? 23.341  62.145  -62.572  1.00 40.00 ? 217 PRO A O   1 
ATOM 1630  C CB  . PRO A 1 213 ? 22.073  65.174  -61.967  1.00 40.00 ? 217 PRO A CB  1 
ATOM 1631  C CG  . PRO A 1 213 ? 22.143  66.319  -60.995  1.00 40.00 ? 217 PRO A CG  1 
ATOM 1632  C CD  . PRO A 1 213 ? 23.588  66.435  -60.576  1.00 40.00 ? 217 PRO A CD  1 
ATOM 1633  N N   . SER A 1 214 ? 24.703  63.711  -63.318  1.00 40.00 ? 218 SER A N   1 
ATOM 1634  C CA  . SER A 1 214 ? 25.174  62.654  -64.251  1.00 40.00 ? 218 SER A CA  1 
ATOM 1635  C C   . SER A 1 214 ? 25.885  61.510  -63.573  1.00 40.00 ? 218 SER A C   1 
ATOM 1636  O O   . SER A 1 214 ? 26.134  60.438  -64.161  1.00 40.00 ? 218 SER A O   1 
ATOM 1637  C CB  . SER A 1 214 ? 26.019  63.322  -65.350  1.00 40.00 ? 218 SER A CB  1 
ATOM 1638  O OG  . SER A 1 214 ? 25.118  64.163  -66.123  1.00 40.00 ? 218 SER A OG  1 
ATOM 1639  N N   . ARG A 1 215 ? 26.296  61.638  -62.322  1.00 40.00 ? 219 ARG A N   1 
ATOM 1640  C CA  . ARG A 1 215 ? 27.099  60.674  -61.612  1.00 40.00 ? 219 ARG A CA  1 
ATOM 1641  C C   . ARG A 1 215 ? 26.594  59.264  -61.538  1.00 40.00 ? 219 ARG A C   1 
ATOM 1642  O O   . ARG A 1 215 ? 27.264  58.280  -61.912  1.00 40.00 ? 219 ARG A O   1 
ATOM 1643  C CB  . ARG A 1 215 ? 27.378  61.193  -60.186  1.00 40.00 ? 219 ARG A CB  1 
ATOM 1644  C CG  . ARG A 1 215 ? 28.285  62.417  -60.170  1.00 40.00 ? 219 ARG A CG  1 
ATOM 1645  C CD  . ARG A 1 215 ? 29.625  62.165  -60.837  1.00 40.00 ? 219 ARG A CD  1 
ATOM 1646  N NE  . ARG A 1 215 ? 30.486  61.304  -60.025  1.00 40.00 ? 219 ARG A NE  1 
ATOM 1647  C CZ  . ARG A 1 215 ? 31.788  61.156  -60.235  1.00 40.00 ? 219 ARG A CZ  1 
ATOM 1648  N NH1 . ARG A 1 215 ? 32.348  61.829  -61.233  1.00 40.00 ? 219 ARG A NH1 1 
ATOM 1649  N NH2 . ARG A 1 215 ? 32.556  60.365  -59.490  1.00 40.00 ? 219 ARG A NH2 1 
ATOM 1650  N N   . SER A 1 216 ? 25.348  59.123  -61.058  1.00 40.00 ? 220 SER A N   1 
ATOM 1651  C CA  . SER A 1 216 ? 24.742  57.813  -60.942  1.00 40.00 ? 220 SER A CA  1 
ATOM 1652  C C   . SER A 1 216 ? 24.552  57.124  -62.270  1.00 40.00 ? 220 SER A C   1 
ATOM 1653  O O   . SER A 1 216 ? 23.967  56.035  -62.227  1.00 40.00 ? 220 SER A O   1 
ATOM 1654  C CB  . SER A 1 216 ? 23.338  57.911  -60.325  1.00 40.00 ? 220 SER A CB  1 
ATOM 1655  O OG  . SER A 1 216 ? 22.877  59.234  -60.458  1.00 40.00 ? 220 SER A OG  1 
ATOM 1656  N N   . LEU A 1 217 ? 24.901  57.677  -63.406  1.00 40.00 ? 221 LEU A N   1 
ATOM 1657  C CA  . LEU A 1 217 ? 24.555  56.976  -64.630  1.00 40.00 ? 221 LEU A CA  1 
ATOM 1658  C C   . LEU A 1 217 ? 25.744  56.377  -65.316  1.00 40.00 ? 221 LEU A C   1 
ATOM 1659  O O   . LEU A 1 217 ? 25.607  55.833  -66.426  1.00 40.00 ? 221 LEU A O   1 
ATOM 1660  C CB  . LEU A 1 217 ? 23.747  57.911  -65.522  1.00 40.00 ? 221 LEU A CB  1 
ATOM 1661  C CG  . LEU A 1 217 ? 23.041  59.138  -64.934  1.00 40.00 ? 221 LEU A CG  1 
ATOM 1662  C CD1 . LEU A 1 217 ? 22.393  59.848  -66.119  1.00 40.00 ? 221 LEU A CD1 1 
ATOM 1663  C CD2 . LEU A 1 217 ? 21.969  58.782  -63.923  1.00 40.00 ? 221 LEU A CD2 1 
ATOM 1664  N N   . PHE A 1 218 ? 26.897  56.482  -64.687  1.00 40.00 ? 222 PHE A N   1 
ATOM 1665  C CA  . PHE A 1 218 ? 28.089  55.889  -65.318  1.00 40.00 ? 222 PHE A CA  1 
ATOM 1666  C C   . PHE A 1 218 ? 29.094  55.580  -64.221  1.00 40.00 ? 222 PHE A C   1 
ATOM 1667  O O   . PHE A 1 218 ? 28.952  56.068  -63.093  1.00 40.00 ? 222 PHE A O   1 
ATOM 1668  C CB  . PHE A 1 218 ? 28.689  56.804  -66.359  1.00 40.00 ? 222 PHE A CB  1 
ATOM 1669  C CG  . PHE A 1 218 ? 29.316  58.032  -65.746  1.00 40.00 ? 222 PHE A CG  1 
ATOM 1670  C CD1 . PHE A 1 218 ? 28.489  59.014  -65.211  1.00 40.00 ? 222 PHE A CD1 1 
ATOM 1671  C CD2 . PHE A 1 218 ? 30.705  58.160  -65.719  1.00 40.00 ? 222 PHE A CD2 1 
ATOM 1672  C CE1 . PHE A 1 218 ? 29.057  60.143  -64.659  1.00 40.00 ? 222 PHE A CE1 1 
ATOM 1673  C CE2 . PHE A 1 218 ? 31.264  59.293  -65.170  1.00 40.00 ? 222 PHE A CE2 1 
ATOM 1674  C CZ  . PHE A 1 218 ? 30.439  60.278  -64.642  1.00 40.00 ? 222 PHE A CZ  1 
ATOM 1675  N N   . HIS A 1 219 ? 30.049  54.708  -64.527  1.00 40.00 ? 223 HIS A N   1 
ATOM 1676  C CA  . HIS A 1 219 ? 30.997  54.307  -63.470  1.00 40.00 ? 223 HIS A CA  1 
ATOM 1677  C C   . HIS A 1 219 ? 32.437  54.567  -63.844  1.00 40.00 ? 223 HIS A C   1 
ATOM 1678  O O   . HIS A 1 219 ? 33.256  54.953  -63.003  1.00 40.00 ? 223 HIS A O   1 
ATOM 1679  C CB  . HIS A 1 219 ? 30.688  52.838  -63.135  1.00 40.00 ? 223 HIS A CB  1 
ATOM 1680  C CG  . HIS A 1 219 ? 29.220  52.548  -62.933  1.00 40.00 ? 223 HIS A CG  1 
ATOM 1681  N ND1 . HIS A 1 219 ? 28.372  52.130  -63.940  1.00 40.00 ? 223 HIS A ND1 1 
ATOM 1682  C CD2 . HIS A 1 219 ? 28.463  52.684  -61.811  1.00 40.00 ? 223 HIS A CD2 1 
ATOM 1683  C CE1 . HIS A 1 219 ? 27.158  52.016  -63.430  1.00 40.00 ? 223 HIS A CE1 1 
ATOM 1684  N NE2 . HIS A 1 219 ? 27.177  52.320  -62.143  1.00 40.00 ? 223 HIS A NE2 1 
ATOM 1685  N N   . ARG A 1 220 ? 32.798  54.387  -65.106  1.00 40.00 ? 224 ARG A N   1 
ATOM 1686  C CA  . ARG A 1 220 ? 34.137  54.658  -65.617  1.00 40.00 ? 224 ARG A CA  1 
ATOM 1687  C C   . ARG A 1 220 ? 34.059  55.716  -66.712  1.00 40.00 ? 224 ARG A C   1 
ATOM 1688  O O   . ARG A 1 220 ? 32.953  55.970  -67.219  1.00 40.00 ? 224 ARG A O   1 
ATOM 1689  C CB  . ARG A 1 220 ? 34.802  53.346  -66.019  1.00 40.00 ? 224 ARG A CB  1 
ATOM 1690  C CG  . ARG A 1 220 ? 35.505  52.680  -64.850  1.00 40.00 ? 224 ARG A CG  1 
ATOM 1691  C CD  . ARG A 1 220 ? 36.091  51.305  -65.145  1.00 40.00 ? 224 ARG A CD  1 
ATOM 1692  N NE  . ARG A 1 220 ? 35.092  50.346  -65.553  1.00 40.00 ? 224 ARG A NE  1 
ATOM 1693  C CZ  . ARG A 1 220 ? 34.089  49.881  -64.815  1.00 40.00 ? 224 ARG A CZ  1 
ATOM 1694  N NH1 . ARG A 1 220 ? 33.904  50.237  -63.545  1.00 40.00 ? 224 ARG A NH1 1 
ATOM 1695  N NH2 . ARG A 1 220 ? 33.248  49.030  -65.408  1.00 40.00 ? 224 ARG A NH2 1 
ATOM 1696  N N   . ALA A 1 221 ? 35.140  56.378  -67.087  1.00 40.00 ? 225 ALA A N   1 
ATOM 1697  C CA  . ALA A 1 221 ? 35.138  57.440  -68.090  1.00 40.00 ? 225 ALA A CA  1 
ATOM 1698  C C   . ALA A 1 221 ? 36.421  57.527  -68.914  1.00 40.00 ? 225 ALA A C   1 
ATOM 1699  O O   . ALA A 1 221 ? 37.512  57.344  -68.352  1.00 40.00 ? 225 ALA A O   1 
ATOM 1700  C CB  . ALA A 1 221 ? 35.009  58.803  -67.379  1.00 40.00 ? 225 ALA A CB  1 
ATOM 1701  N N   . VAL A 1 222 ? 36.326  57.816  -70.191  1.00 40.00 ? 226 VAL A N   1 
ATOM 1702  C CA  . VAL A 1 222 ? 37.498  57.972  -71.038  1.00 40.00 ? 226 VAL A CA  1 
ATOM 1703  C C   . VAL A 1 222 ? 37.362  59.367  -71.661  1.00 40.00 ? 226 VAL A C   1 
ATOM 1704  O O   . VAL A 1 222 ? 36.210  59.830  -71.872  1.00 40.00 ? 226 VAL A O   1 
ATOM 1705  C CB  . VAL A 1 222 ? 37.522  56.979  -72.196  1.00 40.00 ? 226 VAL A CB  1 
ATOM 1706  C CG1 . VAL A 1 222 ? 38.759  57.096  -73.071  1.00 40.00 ? 226 VAL A CG1 1 
ATOM 1707  C CG2 . VAL A 1 222 ? 37.330  55.568  -71.692  1.00 40.00 ? 226 VAL A CG2 1 
ATOM 1708  N N   . LEU A 1 223 ? 38.446  60.101  -71.875  1.00 40.00 ? 227 LEU A N   1 
ATOM 1709  C CA  . LEU A 1 223 ? 38.327  61.448  -72.456  1.00 40.00 ? 227 LEU A CA  1 
ATOM 1710  C C   . LEU A 1 223 ? 39.429  61.551  -73.497  1.00 40.00 ? 227 LEU A C   1 
ATOM 1711  O O   . LEU A 1 223 ? 40.575  61.671  -73.061  1.00 40.00 ? 227 LEU A O   1 
ATOM 1712  C CB  . LEU A 1 223 ? 38.553  62.486  -71.368  1.00 40.00 ? 227 LEU A CB  1 
ATOM 1713  C CG  . LEU A 1 223 ? 37.547  62.578  -70.236  1.00 40.00 ? 227 LEU A CG  1 
ATOM 1714  C CD1 . LEU A 1 223 ? 37.765  61.572  -69.131  1.00 40.00 ? 227 LEU A CD1 1 
ATOM 1715  C CD2 . LEU A 1 223 ? 37.592  63.947  -69.540  1.00 40.00 ? 227 LEU A CD2 1 
ATOM 1716  N N   . GLN A 1 224 ? 39.146  61.437  -74.757  1.00 40.00 ? 228 GLN A N   1 
ATOM 1717  C CA  . GLN A 1 224 ? 40.169  61.504  -75.785  1.00 40.00 ? 228 GLN A CA  1 
ATOM 1718  C C   . GLN A 1 224 ? 40.274  62.889  -76.410  1.00 40.00 ? 228 GLN A C   1 
ATOM 1719  O O   . GLN A 1 224 ? 39.322  63.506  -76.897  1.00 40.00 ? 228 GLN A O   1 
ATOM 1720  C CB  . GLN A 1 224 ? 39.864  60.466  -76.877  1.00 40.00 ? 228 GLN A CB  1 
ATOM 1721  C CG  . GLN A 1 224 ? 39.311  59.159  -76.313  1.00 40.00 ? 228 GLN A CG  1 
ATOM 1722  C CD  . GLN A 1 224 ? 38.925  58.178  -77.409  1.00 40.00 ? 228 GLN A CD  1 
ATOM 1723  O OE1 . GLN A 1 224 ? 38.151  57.250  -77.163  1.00 40.00 ? 228 GLN A OE1 1 
ATOM 1724  N NE2 . GLN A 1 224 ? 39.478  58.378  -78.599  1.00 40.00 ? 228 GLN A NE2 1 
ATOM 1725  N N   . SER A 1 225 ? 41.501  63.435  -76.421  1.00 40.00 ? 229 SER A N   1 
ATOM 1726  C CA  . SER A 1 225 ? 41.775  64.729  -77.017  1.00 40.00 ? 229 SER A CA  1 
ATOM 1727  C C   . SER A 1 225 ? 40.816  65.803  -76.526  1.00 40.00 ? 229 SER A C   1 
ATOM 1728  O O   . SER A 1 225 ? 40.517  66.687  -77.368  1.00 40.00 ? 229 SER A O   1 
ATOM 1729  C CB  . SER A 1 225 ? 41.626  64.637  -78.544  1.00 40.00 ? 229 SER A CB  1 
ATOM 1730  O OG  . SER A 1 225 ? 42.690  64.038  -79.211  1.00 40.00 ? 229 SER A OG  1 
ATOM 1731  N N   . GLY A 1 226 ? 40.363  65.844  -75.275  1.00 40.00 ? 230 GLY A N   1 
ATOM 1732  C CA  . GLY A 1 226 ? 39.491  66.976  -74.950  1.00 40.00 ? 230 GLY A CA  1 
ATOM 1733  C C   . GLY A 1 226 ? 39.124  67.029  -73.527  1.00 40.00 ? 230 GLY A C   1 
ATOM 1734  O O   . GLY A 1 226 ? 39.109  65.938  -72.943  1.00 40.00 ? 230 GLY A O   1 
ATOM 1735  N N   . THR A 1 227 ? 38.851  68.127  -72.848  1.00 40.00 ? 231 THR A N   1 
ATOM 1736  C CA  . THR A 1 227 ? 38.498  68.065  -71.394  1.00 40.00 ? 231 THR A CA  1 
ATOM 1737  C C   . THR A 1 227 ? 37.446  69.101  -71.063  1.00 40.00 ? 231 THR A C   1 
ATOM 1738  O O   . THR A 1 227 ? 37.167  70.008  -71.862  1.00 40.00 ? 231 THR A O   1 
ATOM 1739  C CB  . THR A 1 227 ? 39.684  68.552  -70.560  1.00 40.00 ? 231 THR A CB  1 
ATOM 1740  O OG1 . THR A 1 227 ? 39.914  69.938  -70.993  1.00 40.00 ? 231 THR A OG1 1 
ATOM 1741  C CG2 . THR A 1 227 ? 40.926  67.718  -70.760  1.00 40.00 ? 231 THR A CG2 1 
ATOM 1742  N N   . PRO A 1 228 ? 36.899  69.103  -69.877  1.00 40.00 ? 232 PRO A N   1 
ATOM 1743  C CA  . PRO A 1 228 ? 35.888  70.121  -69.582  1.00 40.00 ? 232 PRO A CA  1 
ATOM 1744  C C   . PRO A 1 228 ? 36.545  71.413  -69.155  1.00 40.00 ? 232 PRO A C   1 
ATOM 1745  O O   . PRO A 1 228 ? 35.881  72.428  -68.997  1.00 40.00 ? 232 PRO A O   1 
ATOM 1746  C CB  . PRO A 1 228 ? 35.150  69.532  -68.381  1.00 40.00 ? 232 PRO A CB  1 
ATOM 1747  C CG  . PRO A 1 228 ? 36.231  68.772  -67.669  1.00 40.00 ? 232 PRO A CG  1 
ATOM 1748  C CD  . PRO A 1 228 ? 37.104  68.177  -68.770  1.00 40.00 ? 232 PRO A CD  1 
ATOM 1749  N N   . ASN A 1 229 ? 37.841  71.369  -68.860  1.00 40.00 ? 233 ASN A N   1 
ATOM 1750  C CA  . ASN A 1 229 ? 38.473  72.523  -68.249  1.00 40.00 ? 233 ASN A CA  1 
ATOM 1751  C C   . ASN A 1 229 ? 39.214  73.481  -69.101  1.00 40.00 ? 233 ASN A C   1 
ATOM 1752  O O   . ASN A 1 229 ? 39.447  74.648  -68.641  1.00 40.00 ? 233 ASN A O   1 
ATOM 1753  C CB  . ASN A 1 229 ? 39.276  71.959  -67.037  1.00 40.00 ? 233 ASN A CB  1 
ATOM 1754  C CG  . ASN A 1 229 ? 40.371  71.019  -67.548  1.00 40.00 ? 233 ASN A CG  1 
ATOM 1755  O OD1 . ASN A 1 229 ? 40.078  69.908  -67.969  1.00 40.00 ? 233 ASN A OD1 1 
ATOM 1756  N ND2 . ASN A 1 229 ? 41.615  71.465  -67.526  1.00 40.00 ? 233 ASN A ND2 1 
ATOM 1757  N N   . GLY A 1 230 ? 39.594  73.238  -70.342  1.00 40.00 ? 234 GLY A N   1 
ATOM 1758  C CA  . GLY A 1 230 ? 40.330  74.258  -71.105  1.00 40.00 ? 234 GLY A CA  1 
ATOM 1759  C C   . GLY A 1 230 ? 39.768  75.615  -71.409  1.00 40.00 ? 234 GLY A C   1 
ATOM 1760  O O   . GLY A 1 230 ? 38.835  76.188  -70.818  1.00 40.00 ? 234 GLY A O   1 
ATOM 1761  N N   . PRO A 1 231 ? 40.335  76.284  -72.437  1.00 40.00 ? 235 PRO A N   1 
ATOM 1762  C CA  . PRO A 1 231 ? 39.876  77.589  -72.877  1.00 40.00 ? 235 PRO A CA  1 
ATOM 1763  C C   . PRO A 1 231 ? 38.652  77.580  -73.784  1.00 40.00 ? 235 PRO A C   1 
ATOM 1764  O O   . PRO A 1 231 ? 38.005  78.624  -74.000  1.00 40.00 ? 235 PRO A O   1 
ATOM 1765  C CB  . PRO A 1 231 ? 41.063  78.108  -73.682  1.00 40.00 ? 235 PRO A CB  1 
ATOM 1766  C CG  . PRO A 1 231 ? 41.732  76.903  -74.214  1.00 40.00 ? 235 PRO A CG  1 
ATOM 1767  C CD  . PRO A 1 231 ? 41.460  75.790  -73.270  1.00 40.00 ? 235 PRO A CD  1 
ATOM 1768  N N   . TRP A 1 232 ? 38.246  76.471  -74.387  1.00 40.00 ? 236 TRP A N   1 
ATOM 1769  C CA  . TRP A 1 232 ? 37.150  76.519  -75.322  1.00 40.00 ? 236 TRP A CA  1 
ATOM 1770  C C   . TRP A 1 232 ? 35.871  75.764  -75.054  1.00 40.00 ? 236 TRP A C   1 
ATOM 1771  O O   . TRP A 1 232 ? 34.892  75.926  -75.812  1.00 40.00 ? 236 TRP A O   1 
ATOM 1772  C CB  . TRP A 1 232 ? 37.687  75.940  -76.657  1.00 40.00 ? 236 TRP A CB  1 
ATOM 1773  C CG  . TRP A 1 232 ? 38.195  74.536  -76.502  1.00 40.00 ? 236 TRP A CG  1 
ATOM 1774  C CD1 . TRP A 1 232 ? 39.496  74.176  -76.288  1.00 40.00 ? 236 TRP A CD1 1 
ATOM 1775  C CD2 . TRP A 1 232 ? 37.455  73.312  -76.516  1.00 40.00 ? 236 TRP A CD2 1 
ATOM 1776  N NE1 . TRP A 1 232 ? 39.615  72.820  -76.194  1.00 40.00 ? 236 TRP A NE1 1 
ATOM 1777  C CE2 . TRP A 1 232 ? 38.368  72.257  -76.327  1.00 40.00 ? 236 TRP A CE2 1 
ATOM 1778  C CE3 . TRP A 1 232 ? 36.102  72.994  -76.673  1.00 40.00 ? 236 TRP A CE3 1 
ATOM 1779  C CZ2 . TRP A 1 232 ? 37.991  70.915  -76.308  1.00 40.00 ? 236 TRP A CZ2 1 
ATOM 1780  C CZ3 . TRP A 1 232 ? 35.722  71.668  -76.643  1.00 40.00 ? 236 TRP A CZ3 1 
ATOM 1781  C CH2 . TRP A 1 232 ? 36.669  70.644  -76.453  1.00 40.00 ? 236 TRP A CH2 1 
ATOM 1782  N N   . ALA A 1 233 ? 35.826  74.893  -74.063  1.00 40.00 ? 237 ALA A N   1 
ATOM 1783  C CA  . ALA A 1 233 ? 34.638  74.096  -73.836  1.00 40.00 ? 237 ALA A CA  1 
ATOM 1784  C C   . ALA A 1 233 ? 33.670  74.743  -72.898  1.00 40.00 ? 237 ALA A C   1 
ATOM 1785  O O   . ALA A 1 233 ? 32.639  74.093  -72.604  1.00 40.00 ? 237 ALA A O   1 
ATOM 1786  C CB  . ALA A 1 233 ? 35.014  72.674  -73.509  1.00 40.00 ? 237 ALA A CB  1 
ATOM 1787  N N   . THR A 1 234 ? 33.856  75.965  -72.409  1.00 40.00 ? 238 THR A N   1 
ATOM 1788  C CA  . THR A 1 234 ? 32.748  76.523  -71.613  1.00 40.00 ? 238 THR A CA  1 
ATOM 1789  C C   . THR A 1 234 ? 32.818  78.048  -71.779  1.00 40.00 ? 238 THR A C   1 
ATOM 1790  O O   . THR A 1 234 ? 33.873  78.538  -72.143  1.00 40.00 ? 238 THR A O   1 
ATOM 1791  C CB  . THR A 1 234 ? 32.657  76.286  -70.132  1.00 40.00 ? 238 THR A CB  1 
ATOM 1792  O OG1 . THR A 1 234 ? 33.877  76.758  -69.481  1.00 40.00 ? 238 THR A OG1 1 
ATOM 1793  C CG2 . THR A 1 234 ? 32.381  74.860  -69.736  1.00 40.00 ? 238 THR A CG2 1 
ATOM 1794  N N   . VAL A 1 235 ? 31.752  78.763  -71.540  1.00 40.00 ? 239 VAL A N   1 
ATOM 1795  C CA  . VAL A 1 235 ? 31.727  80.217  -71.613  1.00 40.00 ? 239 VAL A CA  1 
ATOM 1796  C C   . VAL A 1 235 ? 31.014  80.709  -70.338  1.00 40.00 ? 239 VAL A C   1 
ATOM 1797  O O   . VAL A 1 235 ? 30.310  79.902  -69.708  1.00 40.00 ? 239 VAL A O   1 
ATOM 1798  C CB  . VAL A 1 235 ? 30.858  80.697  -72.790  1.00 40.00 ? 239 VAL A CB  1 
ATOM 1799  C CG1 . VAL A 1 235 ? 31.357  80.108  -74.093  1.00 40.00 ? 239 VAL A CG1 1 
ATOM 1800  C CG2 . VAL A 1 235 ? 29.425  80.243  -72.532  1.00 40.00 ? 239 VAL A CG2 1 
ATOM 1801  N N   . SER A 1 236 ? 31.120  81.956  -69.976  1.00 40.00 ? 240 SER A N   1 
ATOM 1802  C CA  . SER A 1 236 ? 30.380  82.365  -68.782  1.00 40.00 ? 240 SER A CA  1 
ATOM 1803  C C   . SER A 1 236 ? 28.960  82.704  -69.228  1.00 40.00 ? 240 SER A C   1 
ATOM 1804  O O   . SER A 1 236 ? 28.685  82.777  -70.405  1.00 40.00 ? 240 SER A O   1 
ATOM 1805  C CB  . SER A 1 236 ? 30.940  83.663  -68.191  1.00 40.00 ? 240 SER A CB  1 
ATOM 1806  O OG  . SER A 1 236 ? 31.108  84.655  -69.184  1.00 40.00 ? 240 SER A OG  1 
ATOM 1807  N N   . ALA A 1 237 ? 28.127  82.991  -68.255  1.00 40.00 ? 241 ALA A N   1 
ATOM 1808  C CA  . ALA A 1 237 ? 26.751  83.398  -68.469  1.00 40.00 ? 241 ALA A CA  1 
ATOM 1809  C C   . ALA A 1 237 ? 26.789  84.672  -69.310  1.00 40.00 ? 241 ALA A C   1 
ATOM 1810  O O   . ALA A 1 237 ? 26.254  84.721  -70.418  1.00 40.00 ? 241 ALA A O   1 
ATOM 1811  C CB  . ALA A 1 237 ? 26.094  83.709  -67.139  1.00 40.00 ? 241 ALA A CB  1 
ATOM 1812  N N   . GLY A 1 238 ? 27.479  85.680  -68.790  1.00 40.00 ? 242 GLY A N   1 
ATOM 1813  C CA  . GLY A 1 238 ? 27.600  86.955  -69.489  1.00 40.00 ? 242 GLY A CA  1 
ATOM 1814  C C   . GLY A 1 238 ? 27.931  86.789  -70.955  1.00 40.00 ? 242 GLY A C   1 
ATOM 1815  O O   . GLY A 1 238 ? 27.239  87.412  -71.789  1.00 40.00 ? 242 GLY A O   1 
ATOM 1816  N N   . GLU A 1 239 ? 28.918  85.960  -71.311  1.00 40.00 ? 243 GLU A N   1 
ATOM 1817  C CA  . GLU A 1 239 ? 29.234  85.858  -72.732  1.00 40.00 ? 243 GLU A CA  1 
ATOM 1818  C C   . GLU A 1 239 ? 28.150  85.113  -73.505  1.00 40.00 ? 243 GLU A C   1 
ATOM 1819  O O   . GLU A 1 239 ? 27.970  85.392  -74.679  1.00 40.00 ? 243 GLU A O   1 
ATOM 1820  C CB  . GLU A 1 239 ? 30.499  85.046  -72.985  1.00 40.00 ? 243 GLU A CB  1 
ATOM 1821  C CG  . GLU A 1 239 ? 31.607  85.890  -73.479  1.00 40.00 ? 243 GLU A CG  1 
ATOM 1822  C CD  . GLU A 1 239 ? 31.538  86.308  -74.909  1.00 40.00 ? 243 GLU A CD  1 
ATOM 1823  O OE1 . GLU A 1 239 ? 31.832  85.434  -75.751  1.00 40.00 ? 243 GLU A OE1 1 
ATOM 1824  O OE2 . GLU A 1 239 ? 31.221  87.500  -75.156  1.00 40.00 ? 243 GLU A OE2 1 
ATOM 1825  N N   . ALA A 1 240 ? 27.578  84.148  -72.785  1.00 40.00 ? 244 ALA A N   1 
ATOM 1826  C CA  . ALA A 1 240 ? 26.527  83.341  -73.380  1.00 40.00 ? 244 ALA A CA  1 
ATOM 1827  C C   . ALA A 1 240 ? 25.435  84.325  -73.825  1.00 40.00 ? 244 ALA A C   1 
ATOM 1828  O O   . ALA A 1 240 ? 25.009  84.485  -74.970  1.00 40.00 ? 244 ALA A O   1 
ATOM 1829  C CB  . ALA A 1 240 ? 25.995  82.404  -72.310  1.00 40.00 ? 244 ALA A CB  1 
ATOM 1830  N N   . ARG A 1 241 ? 25.002  85.088  -72.802  1.00 40.00 ? 245 ARG A N   1 
ATOM 1831  C CA  . ARG A 1 241 ? 23.968  86.062  -73.118  1.00 40.00 ? 245 ARG A CA  1 
ATOM 1832  C C   . ARG A 1 241 ? 24.398  86.924  -74.295  1.00 40.00 ? 245 ARG A C   1 
ATOM 1833  O O   . ARG A 1 241 ? 23.727  87.104  -75.318  1.00 40.00 ? 245 ARG A O   1 
ATOM 1834  C CB  . ARG A 1 241 ? 23.736  86.907  -71.886  1.00 40.00 ? 245 ARG A CB  1 
ATOM 1835  C CG  . ARG A 1 241 ? 22.795  88.069  -72.094  1.00 40.00 ? 245 ARG A CG  1 
ATOM 1836  C CD  . ARG A 1 241 ? 22.132  88.404  -70.761  1.00 40.00 ? 245 ARG A CD  1 
ATOM 1837  N NE  . ARG A 1 241 ? 21.043  89.370  -70.912  1.00 40.00 ? 245 ARG A NE  1 
ATOM 1838  C CZ  . ARG A 1 241 ? 19.922  89.125  -71.592  1.00 40.00 ? 245 ARG A CZ  1 
ATOM 1839  N NH1 . ARG A 1 241 ? 19.666  87.971  -72.207  1.00 40.00 ? 245 ARG A NH1 1 
ATOM 1840  N NH2 . ARG A 1 241 ? 19.009  90.092  -71.656  1.00 40.00 ? 245 ARG A NH2 1 
ATOM 1841  N N   . ARG A 1 242 ? 25.603  87.500  -74.149  1.00 40.00 ? 246 ARG A N   1 
ATOM 1842  C CA  . ARG A 1 242 ? 26.102  88.387  -75.198  1.00 40.00 ? 246 ARG A CA  1 
ATOM 1843  C C   . ARG A 1 242 ? 26.013  87.695  -76.543  1.00 40.00 ? 246 ARG A C   1 
ATOM 1844  O O   . ARG A 1 242 ? 25.618  88.356  -77.513  1.00 40.00 ? 246 ARG A O   1 
ATOM 1845  C CB  . ARG A 1 242 ? 27.488  88.869  -74.859  1.00 40.00 ? 246 ARG A CB  1 
ATOM 1846  C CG  . ARG A 1 242 ? 28.168  89.870  -75.740  1.00 40.00 ? 246 ARG A CG  1 
ATOM 1847  C CD  . ARG A 1 242 ? 29.611  89.504  -76.127  1.00 40.00 ? 246 ARG A CD  1 
ATOM 1848  N NE  . ARG A 1 242 ? 29.699  89.580  -77.575  1.00 40.00 ? 246 ARG A NE  1 
ATOM 1849  C CZ  . ARG A 1 242 ? 30.344  88.713  -78.342  1.00 40.00 ? 246 ARG A CZ  1 
ATOM 1850  N NH1 . ARG A 1 242 ? 30.996  87.694  -77.784  1.00 40.00 ? 246 ARG A NH1 1 
ATOM 1851  N NH2 . ARG A 1 242 ? 30.294  88.967  -79.659  1.00 40.00 ? 246 ARG A NH2 1 
ATOM 1852  N N   . ARG A 1 243 ? 26.313  86.378  -76.624  1.00 40.00 ? 247 ARG A N   1 
ATOM 1853  C CA  . ARG A 1 243 ? 26.222  85.818  -77.976  1.00 40.00 ? 247 ARG A CA  1 
ATOM 1854  C C   . ARG A 1 243 ? 24.826  85.387  -78.341  1.00 40.00 ? 247 ARG A C   1 
ATOM 1855  O O   . ARG A 1 243 ? 24.529  85.220  -79.536  1.00 40.00 ? 247 ARG A O   1 
ATOM 1856  C CB  . ARG A 1 243 ? 27.238  84.777  -78.328  1.00 40.00 ? 247 ARG A CB  1 
ATOM 1857  C CG  . ARG A 1 243 ? 28.627  84.986  -77.729  1.00 40.00 ? 247 ARG A CG  1 
ATOM 1858  C CD  . ARG A 1 243 ? 29.164  83.645  -77.214  1.00 40.00 ? 247 ARG A CD  1 
ATOM 1859  N NE  . ARG A 1 243 ? 30.563  83.709  -77.050  1.00 40.00 ? 247 ARG A NE  1 
ATOM 1860  C CZ  . ARG A 1 243 ? 31.573  82.908  -77.237  1.00 40.00 ? 247 ARG A CZ  1 
ATOM 1861  N NH1 . ARG A 1 243 ? 31.503  81.666  -77.677  1.00 40.00 ? 247 ARG A NH1 1 
ATOM 1862  N NH2 . ARG A 1 243 ? 32.762  83.453  -76.920  1.00 40.00 ? 247 ARG A NH2 1 
ATOM 1863  N N   . ALA A 1 244 ? 23.960  85.211  -77.358  1.00 40.00 ? 248 ALA A N   1 
ATOM 1864  C CA  . ALA A 1 244 ? 22.580  84.795  -77.688  1.00 40.00 ? 248 ALA A CA  1 
ATOM 1865  C C   . ALA A 1 244 ? 21.878  85.985  -78.335  1.00 40.00 ? 248 ALA A C   1 
ATOM 1866  O O   . ALA A 1 244 ? 21.531  86.044  -79.515  1.00 40.00 ? 248 ALA A O   1 
ATOM 1867  C CB  . ALA A 1 244 ? 21.882  84.391  -76.400  1.00 40.00 ? 248 ALA A CB  1 
ATOM 1868  N N   . THR A 1 245 ? 21.711  87.029  -77.514  1.00 40.00 ? 249 THR A N   1 
ATOM 1869  C CA  . THR A 1 245 ? 21.082  88.210  -78.040  1.00 40.00 ? 249 THR A CA  1 
ATOM 1870  C C   . THR A 1 245 ? 21.793  88.665  -79.319  1.00 40.00 ? 249 THR A C   1 
ATOM 1871  O O   . THR A 1 245 ? 21.170  89.023  -80.350  1.00 40.00 ? 249 THR A O   1 
ATOM 1872  C CB  . THR A 1 245 ? 21.234  89.362  -77.032  1.00 40.00 ? 249 THR A CB  1 
ATOM 1873  O OG1 . THR A 1 245 ? 22.608  89.695  -77.176  1.00 40.00 ? 249 THR A OG1 1 
ATOM 1874  C CG2 . THR A 1 245 ? 20.915  89.047  -75.611  1.00 40.00 ? 249 THR A CG2 1 
ATOM 1875  N N   . LEU A 1 246 ? 23.137  88.706  -79.362  1.00 40.00 ? 250 LEU A N   1 
ATOM 1876  C CA  . LEU A 1 246 ? 23.704  89.189  -80.640  1.00 40.00 ? 250 LEU A CA  1 
ATOM 1877  C C   . LEU A 1 246 ? 23.239  88.317  -81.792  1.00 40.00 ? 250 LEU A C   1 
ATOM 1878  O O   . LEU A 1 246 ? 22.739  88.801  -82.828  1.00 40.00 ? 250 LEU A O   1 
ATOM 1879  C CB  . LEU A 1 246 ? 25.202  89.386  -80.562  1.00 40.00 ? 250 LEU A CB  1 
ATOM 1880  C CG  . LEU A 1 246 ? 25.905  89.445  -81.925  1.00 40.00 ? 250 LEU A CG  1 
ATOM 1881  C CD1 . LEU A 1 246 ? 25.356  90.617  -82.688  1.00 40.00 ? 250 LEU A CD1 1 
ATOM 1882  C CD2 . LEU A 1 246 ? 27.393  89.456  -81.842  1.00 40.00 ? 250 LEU A CD2 1 
ATOM 1883  N N   . LEU A 1 247 ? 23.323  86.987  -81.621  1.00 40.00 ? 251 LEU A N   1 
ATOM 1884  C CA  . LEU A 1 247 ? 22.806  86.127  -82.673  1.00 40.00 ? 251 LEU A CA  1 
ATOM 1885  C C   . LEU A 1 247 ? 21.325  86.436  -82.977  1.00 40.00 ? 251 LEU A C   1 
ATOM 1886  O O   . LEU A 1 247 ? 20.902  86.563  -84.128  1.00 40.00 ? 251 LEU A O   1 
ATOM 1887  C CB  . LEU A 1 247 ? 22.874  84.629  -82.320  1.00 40.00 ? 251 LEU A CB  1 
ATOM 1888  C CG  . LEU A 1 247 ? 22.290  83.902  -83.590  1.00 40.00 ? 251 LEU A CG  1 
ATOM 1889  C CD1 . LEU A 1 247 ? 23.409  83.231  -84.335  1.00 40.00 ? 251 LEU A CD1 1 
ATOM 1890  C CD2 . LEU A 1 247 ? 21.151  83.056  -83.087  1.00 40.00 ? 251 LEU A CD2 1 
ATOM 1891  N N   . ALA A 1 248 ? 20.534  86.518  -81.901  1.00 40.00 ? 252 ALA A N   1 
ATOM 1892  C CA  . ALA A 1 248 ? 19.123  86.835  -82.114  1.00 40.00 ? 252 ALA A CA  1 
ATOM 1893  C C   . ALA A 1 248 ? 19.011  88.068  -83.006  1.00 40.00 ? 252 ALA A C   1 
ATOM 1894  O O   . ALA A 1 248 ? 18.360  88.063  -84.047  1.00 40.00 ? 252 ALA A O   1 
ATOM 1895  C CB  . ALA A 1 248 ? 18.414  87.081  -80.801  1.00 40.00 ? 252 ALA A CB  1 
ATOM 1896  N N   . ARG A 1 249 ? 19.590  89.177  -82.543  1.00 40.00 ? 253 ARG A N   1 
ATOM 1897  C CA  . ARG A 1 249 ? 19.556  90.455  -83.258  1.00 40.00 ? 253 ARG A CA  1 
ATOM 1898  C C   . ARG A 1 249 ? 19.911  90.272  -84.723  1.00 40.00 ? 253 ARG A C   1 
ATOM 1899  O O   . ARG A 1 249 ? 19.173  90.755  -85.569  1.00 40.00 ? 253 ARG A O   1 
ATOM 1900  C CB  . ARG A 1 249 ? 20.551  91.428  -82.682  1.00 40.00 ? 253 ARG A CB  1 
ATOM 1901  C CG  . ARG A 1 249 ? 20.276  92.882  -82.543  1.00 40.00 ? 253 ARG A CG  1 
ATOM 1902  C CD  . ARG A 1 249 ? 21.451  93.618  -81.939  1.00 40.00 ? 253 ARG A CD  1 
ATOM 1903  N NE  . ARG A 1 249 ? 21.557  93.537  -80.489  1.00 40.00 ? 253 ARG A NE  1 
ATOM 1904  C CZ  . ARG A 1 249 ? 22.684  93.128  -79.892  1.00 40.00 ? 253 ARG A CZ  1 
ATOM 1905  N NH1 . ARG A 1 249 ? 23.738  92.766  -80.626  1.00 40.00 ? 253 ARG A NH1 1 
ATOM 1906  N NH2 . ARG A 1 249 ? 22.705  93.067  -78.566  1.00 40.00 ? 253 ARG A NH2 1 
ATOM 1907  N N   . LEU A 1 250 ? 20.990  89.563  -85.072  1.00 40.00 ? 254 LEU A N   1 
ATOM 1908  C CA  . LEU A 1 250 ? 21.268  89.392  -86.496  1.00 40.00 ? 254 LEU A CA  1 
ATOM 1909  C C   . LEU A 1 250 ? 20.177  88.678  -87.280  1.00 40.00 ? 254 LEU A C   1 
ATOM 1910  O O   . LEU A 1 250 ? 20.137  88.647  -88.525  1.00 40.00 ? 254 LEU A O   1 
ATOM 1911  C CB  . LEU A 1 250 ? 22.533  88.510  -86.680  1.00 40.00 ? 254 LEU A CB  1 
ATOM 1912  C CG  . LEU A 1 250 ? 23.773  89.268  -86.192  1.00 40.00 ? 254 LEU A CG  1 
ATOM 1913  C CD1 . LEU A 1 250 ? 25.026  88.473  -86.274  1.00 40.00 ? 254 LEU A CD1 1 
ATOM 1914  C CD2 . LEU A 1 250 ? 23.863  90.520  -87.069  1.00 40.00 ? 254 LEU A CD2 1 
ATOM 1915  N N   . VAL A 1 251 ? 19.279  88.010  -86.598  1.00 40.00 ? 255 VAL A N   1 
ATOM 1916  C CA  . VAL A 1 251 ? 18.249  87.197  -87.224  1.00 40.00 ? 255 VAL A CA  1 
ATOM 1917  C C   . VAL A 1 251 ? 16.939  87.918  -87.132  1.00 40.00 ? 255 VAL A C   1 
ATOM 1918  O O   . VAL A 1 251 ? 15.876  87.457  -87.545  1.00 40.00 ? 255 VAL A O   1 
ATOM 1919  C CB  . VAL A 1 251 ? 18.332  85.828  -86.522  1.00 40.00 ? 255 VAL A CB  1 
ATOM 1920  C CG1 . VAL A 1 251 ? 17.194  85.533  -85.590  1.00 40.00 ? 255 VAL A CG1 1 
ATOM 1921  C CG2 . VAL A 1 251 ? 18.622  84.773  -87.575  1.00 40.00 ? 255 VAL A CG2 1 
ATOM 1922  N N   . GLY A 1 252 ? 17.014  89.140  -86.594  1.00 40.00 ? 256 GLY A N   1 
ATOM 1923  C CA  . GLY A 1 252 ? 15.825  89.974  -86.530  1.00 40.00 ? 256 GLY A CA  1 
ATOM 1924  C C   . GLY A 1 252 ? 15.052  89.728  -85.274  1.00 40.00 ? 256 GLY A C   1 
ATOM 1925  O O   . GLY A 1 252 ? 13.916  90.160  -85.167  1.00 40.00 ? 256 GLY A O   1 
ATOM 1926  N N   . CYS A 1 253 ? 15.678  89.028  -84.325  1.00 40.00 ? 257 CYS A N   1 
ATOM 1927  C CA  . CYS A 1 253 ? 14.989  88.810  -83.062  1.00 40.00 ? 257 CYS A CA  1 
ATOM 1928  C C   . CYS A 1 253 ? 15.523  89.654  -81.961  1.00 40.00 ? 257 CYS A C   1 
ATOM 1929  O O   . CYS A 1 253 ? 16.689  89.431  -81.709  1.00 40.00 ? 257 CYS A O   1 
ATOM 1930  C CB  . CYS A 1 253 ? 14.961  87.324  -82.721  1.00 40.00 ? 257 CYS A CB  1 
ATOM 1931  S SG  . CYS A 1 253 ? 13.728  86.502  -83.779  1.00 40.00 ? 257 CYS A SG  1 
ATOM 1932  N N   . PRO A 1 254 ? 14.746  90.504  -81.352  1.00 40.00 ? 258 PRO A N   1 
ATOM 1933  C CA  . PRO A 1 254 ? 13.412  90.937  -81.685  1.00 40.00 ? 258 PRO A CA  1 
ATOM 1934  C C   . PRO A 1 254 ? 13.569  92.020  -82.775  1.00 40.00 ? 258 PRO A C   1 
ATOM 1935  O O   . PRO A 1 254 ? 14.691  92.501  -82.978  1.00 40.00 ? 258 PRO A O   1 
ATOM 1936  C CB  . PRO A 1 254 ? 12.853  91.589  -80.432  1.00 40.00 ? 258 PRO A CB  1 
ATOM 1937  C CG  . PRO A 1 254 ? 14.072  92.337  -79.962  1.00 40.00 ? 258 PRO A CG  1 
ATOM 1938  C CD  . PRO A 1 254 ? 15.181  91.368  -80.240  1.00 40.00 ? 258 PRO A CD  1 
ATOM 1939  N N   . PRO A 1 255 ? 12.520  92.293  -83.517  1.00 40.00 ? 259 PRO A N   1 
ATOM 1940  C CA  . PRO A 1 255 ? 12.547  93.281  -84.614  1.00 40.00 ? 259 PRO A CA  1 
ATOM 1941  C C   . PRO A 1 255 ? 12.336  94.682  -84.057  1.00 40.00 ? 259 PRO A C   1 
ATOM 1942  O O   . PRO A 1 255 ? 11.599  94.852  -83.054  1.00 40.00 ? 259 PRO A O   1 
ATOM 1943  C CB  . PRO A 1 255 ? 11.402  92.828  -85.504  1.00 40.00 ? 259 PRO A CB  1 
ATOM 1944  C CG  . PRO A 1 255 ? 10.402  92.290  -84.538  1.00 40.00 ? 259 PRO A CG  1 
ATOM 1945  C CD  . PRO A 1 255 ? 11.167  91.715  -83.371  1.00 40.00 ? 259 PRO A CD  1 
ATOM 1946  N N   . GLY A 1 256 ? 13.012  95.674  -84.627  1.00 40.00 ? 260 GLY A N   1 
ATOM 1947  C CA  . GLY A 1 256 ? 12.855  97.016  -84.081  1.00 40.00 ? 260 GLY A CA  1 
ATOM 1948  C C   . GLY A 1 256 ? 13.730  97.270  -82.867  1.00 40.00 ? 260 GLY A C   1 
ATOM 1949  O O   . GLY A 1 256 ? 14.664  96.532  -82.577  1.00 40.00 ? 260 GLY A O   1 
ATOM 1950  N N   . GLY A 1 257 ? 13.437  98.361  -82.154  1.00 40.00 ? 261 GLY A N   1 
ATOM 1951  C CA  . GLY A 1 257 ? 14.155  98.792  -80.965  1.00 40.00 ? 261 GLY A CA  1 
ATOM 1952  C C   . GLY A 1 257 ? 13.447  98.394  -79.665  1.00 40.00 ? 261 GLY A C   1 
ATOM 1953  O O   . GLY A 1 257 ? 13.341  99.173  -78.714  1.00 40.00 ? 261 GLY A O   1 
ATOM 1954  N N   . ALA A 1 258 ? 12.990  97.160  -79.630  1.00 40.00 ? 262 ALA A N   1 
ATOM 1955  C CA  . ALA A 1 258 ? 12.241  96.461  -78.622  1.00 40.00 ? 262 ALA A CA  1 
ATOM 1956  C C   . ALA A 1 258 ? 13.059  95.964  -77.457  1.00 40.00 ? 262 ALA A C   1 
ATOM 1957  O O   . ALA A 1 258 ? 14.132  96.551  -77.271  1.00 40.00 ? 262 ALA A O   1 
ATOM 1958  C CB  . ALA A 1 258 ? 11.580  95.253  -79.323  1.00 40.00 ? 262 ALA A CB  1 
ATOM 1959  N N   . GLY A 1 259 ? 12.636  94.964  -76.688  1.00 40.00 ? 263 GLY A N   1 
ATOM 1960  C CA  . GLY A 1 259 ? 13.553  94.570  -75.657  1.00 40.00 ? 263 GLY A CA  1 
ATOM 1961  C C   . GLY A 1 259 ? 13.102  94.346  -74.269  1.00 40.00 ? 263 GLY A C   1 
ATOM 1962  O O   . GLY A 1 259 ? 11.960  94.517  -73.878  1.00 40.00 ? 263 GLY A O   1 
ATOM 1963  N N   . GLY A 1 260 ? 14.114  93.865  -73.530  1.00 40.00 ? 264 GLY A N   1 
ATOM 1964  C CA  . GLY A 1 260 ? 13.912  93.539  -72.143  1.00 40.00 ? 264 GLY A CA  1 
ATOM 1965  C C   . GLY A 1 260 ? 12.870  92.448  -72.009  1.00 40.00 ? 264 GLY A C   1 
ATOM 1966  O O   . GLY A 1 260 ? 12.208  92.490  -70.950  1.00 40.00 ? 264 GLY A O   1 
ATOM 1967  N N   . ASN A 1 261 ? 12.656  91.544  -72.957  1.00 40.00 ? 265 ASN A N   1 
ATOM 1968  C CA  . ASN A 1 261 ? 11.719  90.446  -72.676  1.00 40.00 ? 265 ASN A CA  1 
ATOM 1969  C C   . ASN A 1 261 ? 12.434  89.219  -73.248  1.00 40.00 ? 265 ASN A C   1 
ATOM 1970  O O   . ASN A 1 261 ? 12.491  88.977  -74.445  1.00 40.00 ? 265 ASN A O   1 
ATOM 1971  C CB  . ASN A 1 261 ? 10.265  90.561  -72.919  1.00 40.00 ? 265 ASN A CB  1 
ATOM 1972  C CG  . ASN A 1 261 ? 9.418   89.550  -72.147  1.00 40.00 ? 265 ASN A CG  1 
ATOM 1973  O OD1 . ASN A 1 261 ? 9.597   88.332  -72.316  1.00 40.00 ? 265 ASN A OD1 1 
ATOM 1974  N ND2 . ASN A 1 261 ? 8.495   90.008  -71.306  1.00 40.00 ? 265 ASN A ND2 1 
ATOM 1975  N N   . ASP A 1 262 ? 13.070  88.474  -72.311  1.00 40.00 ? 266 ASP A N   1 
ATOM 1976  C CA  . ASP A 1 262 ? 13.862  87.334  -72.835  1.00 40.00 ? 266 ASP A CA  1 
ATOM 1977  C C   . ASP A 1 262 ? 12.926  86.365  -73.511  1.00 40.00 ? 266 ASP A C   1 
ATOM 1978  O O   . ASP A 1 262 ? 13.138  85.845  -74.617  1.00 40.00 ? 266 ASP A O   1 
ATOM 1979  C CB  . ASP A 1 262 ? 14.837  86.830  -71.812  1.00 40.00 ? 266 ASP A CB  1 
ATOM 1980  C CG  . ASP A 1 262 ? 15.922  87.825  -71.388  1.00 40.00 ? 266 ASP A CG  1 
ATOM 1981  O OD1 . ASP A 1 262 ? 16.281  88.733  -72.192  1.00 40.00 ? 266 ASP A OD1 1 
ATOM 1982  O OD2 . ASP A 1 262 ? 16.465  87.746  -70.240  1.00 40.00 ? 266 ASP A OD2 1 
ATOM 1983  N N   . THR A 1 263 ? 11.756  86.198  -72.891  1.00 40.00 ? 267 THR A N   1 
ATOM 1984  C CA  . THR A 1 263 ? 10.722  85.336  -73.434  1.00 40.00 ? 267 THR A CA  1 
ATOM 1985  C C   . THR A 1 263 ? 10.293  85.689  -74.851  1.00 40.00 ? 267 THR A C   1 
ATOM 1986  O O   . THR A 1 263 ? 10.227  84.827  -75.723  1.00 40.00 ? 267 THR A O   1 
ATOM 1987  C CB  . THR A 1 263 ? 9.439   85.241  -72.585  1.00 40.00 ? 267 THR A CB  1 
ATOM 1988  O OG1 . THR A 1 263 ? 9.757   85.331  -71.188  1.00 40.00 ? 267 THR A OG1 1 
ATOM 1989  C CG2 . THR A 1 263 ? 8.808   83.879  -72.886  1.00 40.00 ? 267 THR A CG2 1 
ATOM 1990  N N   . GLU A 1 264 ? 10.032  86.969  -75.061  1.00 40.00 ? 268 GLU A N   1 
ATOM 1991  C CA  . GLU A 1 264 ? 9.656   87.389  -76.427  1.00 40.00 ? 268 GLU A CA  1 
ATOM 1992  C C   . GLU A 1 264 ? 10.808  87.072  -77.370  1.00 40.00 ? 268 GLU A C   1 
ATOM 1993  O O   . GLU A 1 264 ? 10.609  86.580  -78.462  1.00 40.00 ? 268 GLU A O   1 
ATOM 1994  C CB  . GLU A 1 264 ? 9.352   88.874  -76.429  1.00 40.00 ? 268 GLU A CB  1 
ATOM 1995  C CG  . GLU A 1 264 ? 8.204   89.202  -75.457  1.00 40.00 ? 268 GLU A CG  1 
ATOM 1996  C CD  . GLU A 1 264 ? 7.762   90.645  -75.645  1.00 40.00 ? 268 GLU A CD  1 
ATOM 1997  O OE1 . GLU A 1 264 ? 7.366   91.308  -74.658  1.00 40.00 ? 268 GLU A OE1 1 
ATOM 1998  O OE2 . GLU A 1 264 ? 7.821   91.117  -76.808  1.00 40.00 ? 268 GLU A OE2 1 
ATOM 1999  N N   . LEU A 1 265 ? 12.022  87.316  -76.862  1.00 40.00 ? 269 LEU A N   1 
ATOM 2000  C CA  . LEU A 1 265 ? 13.247  87.099  -77.617  1.00 40.00 ? 269 LEU A CA  1 
ATOM 2001  C C   . LEU A 1 265 ? 13.357  85.653  -78.053  1.00 40.00 ? 269 LEU A C   1 
ATOM 2002  O O   . LEU A 1 265 ? 13.546  85.332  -79.234  1.00 40.00 ? 269 LEU A O   1 
ATOM 2003  C CB  . LEU A 1 265 ? 14.439  87.530  -76.792  1.00 40.00 ? 269 LEU A CB  1 
ATOM 2004  C CG  . LEU A 1 265 ? 15.752  87.943  -77.456  1.00 40.00 ? 269 LEU A CG  1 
ATOM 2005  C CD1 . LEU A 1 265 ? 16.766  88.306  -76.354  1.00 40.00 ? 269 LEU A CD1 1 
ATOM 2006  C CD2 . LEU A 1 265 ? 16.353  86.836  -78.309  1.00 40.00 ? 269 LEU A CD2 1 
ATOM 2007  N N   . ILE A 1 266 ? 13.214  84.776  -77.045  1.00 40.00 ? 270 ILE A N   1 
ATOM 2008  C CA  . ILE A 1 266 ? 13.290  83.352  -77.415  1.00 40.00 ? 270 ILE A CA  1 
ATOM 2009  C C   . ILE A 1 266 ? 12.089  82.959  -78.305  1.00 40.00 ? 270 ILE A C   1 
ATOM 2010  O O   . ILE A 1 266 ? 12.166  82.210  -79.299  1.00 40.00 ? 270 ILE A O   1 
ATOM 2011  C CB  . ILE A 1 266 ? 13.369  82.430  -76.200  1.00 40.00 ? 270 ILE A CB  1 
ATOM 2012  C CG1 . ILE A 1 266 ? 14.072  83.030  -74.993  1.00 40.00 ? 270 ILE A CG1 1 
ATOM 2013  C CG2 . ILE A 1 266 ? 13.973  81.097  -76.642  1.00 40.00 ? 270 ILE A CG2 1 
ATOM 2014  C CD1 . ILE A 1 266 ? 15.549  82.764  -74.826  1.00 40.00 ? 270 ILE A CD1 1 
ATOM 2015  N N   . ALA A 1 267 ? 10.914  83.529  -77.973  1.00 40.00 ? 271 ALA A N   1 
ATOM 2016  C CA  . ALA A 1 267 ? 9.709   83.200  -78.747  1.00 40.00 ? 271 ALA A CA  1 
ATOM 2017  C C   . ALA A 1 267 ? 9.968   83.507  -80.213  1.00 40.00 ? 271 ALA A C   1 
ATOM 2018  O O   . ALA A 1 267 ? 9.750   82.708  -81.111  1.00 40.00 ? 271 ALA A O   1 
ATOM 2019  C CB  . ALA A 1 267 ? 8.494   83.929  -78.245  1.00 40.00 ? 271 ALA A CB  1 
ATOM 2020  N N   . CYS A 1 268 ? 10.488  84.723  -80.399  1.00 40.00 ? 272 CYS A N   1 
ATOM 2021  C CA  . CYS A 1 268 ? 10.851  85.181  -81.737  1.00 40.00 ? 272 CYS A CA  1 
ATOM 2022  C C   . CYS A 1 268 ? 11.853  84.215  -82.358  1.00 40.00 ? 272 CYS A C   1 
ATOM 2023  O O   . CYS A 1 268 ? 11.704  83.817  -83.514  1.00 40.00 ? 272 CYS A O   1 
ATOM 2024  C CB  . CYS A 1 268 ? 11.479  86.561  -81.606  1.00 40.00 ? 272 CYS A CB  1 
ATOM 2025  S SG  . CYS A 1 268 ? 12.011  87.294  -83.095  1.00 40.00 ? 272 CYS A SG  1 
ATOM 2026  N N   . LEU A 1 269 ? 12.918  83.859  -81.608  1.00 40.00 ? 273 LEU A N   1 
ATOM 2027  C CA  . LEU A 1 269 ? 13.956  82.976  -82.130  1.00 40.00 ? 273 LEU A CA  1 
ATOM 2028  C C   . LEU A 1 269 ? 13.409  81.615  -82.541  1.00 40.00 ? 273 LEU A C   1 
ATOM 2029  O O   . LEU A 1 269 ? 13.823  80.948  -83.500  1.00 40.00 ? 273 LEU A O   1 
ATOM 2030  C CB  . LEU A 1 269 ? 15.023  82.753  -81.052  1.00 40.00 ? 273 LEU A CB  1 
ATOM 2031  C CG  . LEU A 1 269 ? 16.267  83.640  -81.174  1.00 40.00 ? 273 LEU A CG  1 
ATOM 2032  C CD1 . LEU A 1 269 ? 17.006  83.646  -79.844  1.00 40.00 ? 273 LEU A CD1 1 
ATOM 2033  C CD2 . LEU A 1 269 ? 17.179  83.212  -82.309  1.00 40.00 ? 273 LEU A CD2 1 
ATOM 2034  N N   . ARG A 1 270 ? 12.399  81.207  -81.761  1.00 40.00 ? 274 ARG A N   1 
ATOM 2035  C CA  . ARG A 1 270 ? 11.757  79.924  -81.981  1.00 40.00 ? 274 ARG A CA  1 
ATOM 2036  C C   . ARG A 1 270 ? 11.011  79.858  -83.299  1.00 40.00 ? 274 ARG A C   1 
ATOM 2037  O O   . ARG A 1 270 ? 10.632  78.758  -83.714  1.00 40.00 ? 274 ARG A O   1 
ATOM 2038  C CB  . ARG A 1 270 ? 10.876  79.577  -80.785  1.00 40.00 ? 274 ARG A CB  1 
ATOM 2039  C CG  . ARG A 1 270 ? 11.149  78.197  -80.264  1.00 40.00 ? 274 ARG A CG  1 
ATOM 2040  C CD  . ARG A 1 270 ? 10.442  77.784  -79.032  1.00 40.00 ? 274 ARG A CD  1 
ATOM 2041  N NE  . ARG A 1 270 ? 10.064  78.714  -78.027  1.00 40.00 ? 274 ARG A NE  1 
ATOM 2042  C CZ  . ARG A 1 270 ? 10.634  78.754  -76.813  1.00 40.00 ? 274 ARG A CZ  1 
ATOM 2043  N NH1 . ARG A 1 270 ? 11.616  77.948  -76.429  1.00 40.00 ? 274 ARG A NH1 1 
ATOM 2044  N NH2 . ARG A 1 270 ? 10.130  79.691  -75.998  1.00 40.00 ? 274 ARG A NH2 1 
ATOM 2045  N N   . THR A 1 271 ? 10.813  80.955  -84.021  1.00 40.00 ? 275 THR A N   1 
ATOM 2046  C CA  . THR A 1 271 ? 10.125  80.922  -85.292  1.00 40.00 ? 275 THR A CA  1 
ATOM 2047  C C   . THR A 1 271 ? 11.067  80.912  -86.491  1.00 40.00 ? 275 THR A C   1 
ATOM 2048  O O   . THR A 1 271 ? 10.663  80.727  -87.644  1.00 40.00 ? 275 THR A O   1 
ATOM 2049  C CB  . THR A 1 271 ? 9.240   82.181  -85.518  1.00 40.00 ? 275 THR A CB  1 
ATOM 2050  O OG1 . THR A 1 271 ? 10.116  83.115  -86.177  1.00 40.00 ? 275 THR A OG1 1 
ATOM 2051  C CG2 . THR A 1 271 ? 8.688   82.810  -84.270  1.00 40.00 ? 275 THR A CG2 1 
ATOM 2052  N N   . ARG A 1 272 ? 12.339  81.229  -86.280  1.00 40.00 ? 276 ARG A N   1 
ATOM 2053  C CA  . ARG A 1 272 ? 13.259  81.298  -87.423  1.00 40.00 ? 276 ARG A CA  1 
ATOM 2054  C C   . ARG A 1 272 ? 13.652  79.927  -87.922  1.00 40.00 ? 276 ARG A C   1 
ATOM 2055  O O   . ARG A 1 272 ? 13.963  78.984  -87.163  1.00 40.00 ? 276 ARG A O   1 
ATOM 2056  C CB  . ARG A 1 272 ? 14.522  82.066  -87.007  1.00 40.00 ? 276 ARG A CB  1 
ATOM 2057  C CG  . ARG A 1 272 ? 14.144  83.347  -86.232  1.00 40.00 ? 276 ARG A CG  1 
ATOM 2058  C CD  . ARG A 1 272 ? 14.270  84.510  -87.219  1.00 40.00 ? 276 ARG A CD  1 
ATOM 2059  N NE  . ARG A 1 272 ? 13.710  85.771  -86.786  1.00 40.00 ? 276 ARG A NE  1 
ATOM 2060  C CZ  . ARG A 1 272 ? 12.528  86.242  -87.163  1.00 40.00 ? 276 ARG A CZ  1 
ATOM 2061  N NH1 . ARG A 1 272 ? 11.780  85.500  -87.983  1.00 40.00 ? 276 ARG A NH1 1 
ATOM 2062  N NH2 . ARG A 1 272 ? 12.091  87.412  -86.723  1.00 40.00 ? 276 ARG A NH2 1 
ATOM 2063  N N   . PRO A 1 273 ? 13.659  79.804  -89.241  1.00 40.00 ? 277 PRO A N   1 
ATOM 2064  C CA  . PRO A 1 273 ? 14.087  78.549  -89.869  1.00 40.00 ? 277 PRO A CA  1 
ATOM 2065  C C   . PRO A 1 273 ? 15.408  78.111  -89.243  1.00 40.00 ? 277 PRO A C   1 
ATOM 2066  O O   . PRO A 1 273 ? 16.322  78.948  -89.089  1.00 40.00 ? 277 PRO A O   1 
ATOM 2067  C CB  . PRO A 1 273 ? 14.353  78.978  -91.329  1.00 40.00 ? 277 PRO A CB  1 
ATOM 2068  C CG  . PRO A 1 273 ? 13.955  80.386  -91.517  1.00 40.00 ? 277 PRO A CG  1 
ATOM 2069  C CD  . PRO A 1 273 ? 13.372  80.864  -90.223  1.00 40.00 ? 277 PRO A CD  1 
ATOM 2070  N N   . ALA A 1 274 ? 15.592  76.836  -88.942  1.00 40.00 ? 278 ALA A N   1 
ATOM 2071  C CA  . ALA A 1 274 ? 16.850  76.364  -88.372  1.00 40.00 ? 278 ALA A CA  1 
ATOM 2072  C C   . ALA A 1 274 ? 18.055  76.959  -89.084  1.00 40.00 ? 278 ALA A C   1 
ATOM 2073  O O   . ALA A 1 274 ? 18.940  77.535  -88.419  1.00 40.00 ? 278 ALA A O   1 
ATOM 2074  C CB  . ALA A 1 274 ? 16.945  74.847  -88.408  1.00 40.00 ? 278 ALA A CB  1 
ATOM 2075  N N   . GLN A 1 275 ? 18.136  76.865  -90.407  1.00 40.00 ? 279 GLN A N   1 
ATOM 2076  C CA  . GLN A 1 275 ? 19.305  77.385  -91.102  1.00 40.00 ? 279 GLN A CA  1 
ATOM 2077  C C   . GLN A 1 275 ? 19.581  78.866  -90.931  1.00 40.00 ? 279 GLN A C   1 
ATOM 2078  O O   . GLN A 1 275 ? 20.695  79.357  -91.183  1.00 40.00 ? 279 GLN A O   1 
ATOM 2079  C CB  . GLN A 1 275 ? 19.162  77.110  -92.600  1.00 40.00 ? 279 GLN A CB  1 
ATOM 2080  C CG  . GLN A 1 275 ? 20.348  77.604  -93.410  1.00 40.00 ? 279 GLN A CG  1 
ATOM 2081  C CD  . GLN A 1 275 ? 21.576  76.786  -93.054  1.00 40.00 ? 279 GLN A CD  1 
ATOM 2082  O OE1 . GLN A 1 275 ? 21.444  75.613  -92.666  1.00 40.00 ? 279 GLN A OE1 1 
ATOM 2083  N NE2 . GLN A 1 275 ? 22.703  77.474  -93.165  1.00 40.00 ? 279 GLN A NE2 1 
ATOM 2084  N N   . ASP A 1 276 ? 18.551  79.630  -90.535  1.00 40.00 ? 280 ASP A N   1 
ATOM 2085  C CA  . ASP A 1 276 ? 18.775  81.075  -90.332  1.00 40.00 ? 280 ASP A CA  1 
ATOM 2086  C C   . ASP A 1 276 ? 19.763  81.193  -89.153  1.00 40.00 ? 280 ASP A C   1 
ATOM 2087  O O   . ASP A 1 276 ? 20.655  82.021  -89.211  1.00 40.00 ? 280 ASP A O   1 
ATOM 2088  C CB  . ASP A 1 276 ? 17.551  81.841  -89.881  1.00 40.00 ? 280 ASP A CB  1 
ATOM 2089  C CG  . ASP A 1 276 ? 16.697  82.294  -91.038  1.00 40.00 ? 280 ASP A CG  1 
ATOM 2090  O OD1 . ASP A 1 276 ? 16.731  81.571  -92.064  1.00 40.00 ? 280 ASP A OD1 1 
ATOM 2091  O OD2 . ASP A 1 276 ? 16.037  83.351  -90.838  1.00 40.00 ? 280 ASP A OD2 1 
ATOM 2092  N N   . LEU A 1 277 ? 19.538  80.384  -88.113  1.00 40.00 ? 281 LEU A N   1 
ATOM 2093  C CA  . LEU A 1 277 ? 20.446  80.437  -86.961  1.00 40.00 ? 281 LEU A CA  1 
ATOM 2094  C C   . LEU A 1 277 ? 21.841  79.992  -87.324  1.00 40.00 ? 281 LEU A C   1 
ATOM 2095  O O   . LEU A 1 277 ? 22.842  80.667  -87.114  1.00 40.00 ? 281 LEU A O   1 
ATOM 2096  C CB  . LEU A 1 277 ? 20.010  79.548  -85.810  1.00 40.00 ? 281 LEU A CB  1 
ATOM 2097  C CG  . LEU A 1 277 ? 18.872  80.067  -84.923  1.00 40.00 ? 281 LEU A CG  1 
ATOM 2098  C CD1 . LEU A 1 277 ? 18.593  81.535  -85.139  1.00 40.00 ? 281 LEU A CD1 1 
ATOM 2099  C CD2 . LEU A 1 277 ? 17.652  79.200  -85.102  1.00 40.00 ? 281 LEU A CD2 1 
ATOM 2100  N N   . VAL A 1 278 ? 21.921  78.829  -87.947  1.00 40.00 ? 282 VAL A N   1 
ATOM 2101  C CA  . VAL A 1 278 ? 23.240  78.305  -88.364  1.00 40.00 ? 282 VAL A CA  1 
ATOM 2102  C C   . VAL A 1 278 ? 23.945  79.364  -89.198  1.00 40.00 ? 282 VAL A C   1 
ATOM 2103  O O   . VAL A 1 278 ? 25.162  79.472  -89.161  1.00 40.00 ? 282 VAL A O   1 
ATOM 2104  C CB  . VAL A 1 278 ? 23.043  77.063  -89.257  1.00 40.00 ? 282 VAL A CB  1 
ATOM 2105  C CG1 . VAL A 1 278 ? 24.345  76.638  -89.868  1.00 40.00 ? 282 VAL A CG1 1 
ATOM 2106  C CG2 . VAL A 1 278 ? 22.334  75.962  -88.490  1.00 40.00 ? 282 VAL A CG2 1 
ATOM 2107  N N   . ASP A 1 279 ? 23.167  80.131  -89.978  1.00 40.00 ? 283 ASP A N   1 
ATOM 2108  C CA  . ASP A 1 279 ? 23.800  81.147  -90.800  1.00 40.00 ? 283 ASP A CA  1 
ATOM 2109  C C   . ASP A 1 279 ? 24.562  82.154  -89.972  1.00 40.00 ? 283 ASP A C   1 
ATOM 2110  O O   . ASP A 1 279 ? 25.608  82.636  -90.446  1.00 40.00 ? 283 ASP A O   1 
ATOM 2111  C CB  . ASP A 1 279 ? 22.776  81.815  -91.692  1.00 40.00 ? 283 ASP A CB  1 
ATOM 2112  C CG  . ASP A 1 279 ? 22.521  81.032  -92.963  1.00 40.00 ? 283 ASP A CG  1 
ATOM 2113  O OD1 . ASP A 1 279 ? 23.454  80.395  -93.463  1.00 40.00 ? 283 ASP A OD1 1 
ATOM 2114  O OD2 . ASP A 1 279 ? 21.383  81.069  -93.479  1.00 40.00 ? 283 ASP A OD2 1 
ATOM 2115  N N   . HIS A 1 280 ? 24.105  82.509  -88.768  1.00 40.00 ? 284 HIS A N   1 
ATOM 2116  C CA  . HIS A 1 280 ? 24.875  83.537  -88.057  1.00 40.00 ? 284 HIS A CA  1 
ATOM 2117  C C   . HIS A 1 280 ? 25.714  83.015  -86.939  1.00 40.00 ? 284 HIS A C   1 
ATOM 2118  O O   . HIS A 1 280 ? 26.317  83.824  -86.229  1.00 40.00 ? 284 HIS A O   1 
ATOM 2119  C CB  . HIS A 1 280 ? 23.883  84.594  -87.545  1.00 40.00 ? 284 HIS A CB  1 
ATOM 2120  C CG  . HIS A 1 280 ? 23.488  85.477  -88.712  1.00 40.00 ? 284 HIS A CG  1 
ATOM 2121  N ND1 . HIS A 1 280 ? 24.380  86.367  -89.273  1.00 40.00 ? 284 HIS A ND1 1 
ATOM 2122  C CD2 . HIS A 1 280 ? 22.348  85.578  -89.413  1.00 40.00 ? 284 HIS A CD2 1 
ATOM 2123  C CE1 . HIS A 1 280 ? 23.789  86.996  -90.264  1.00 40.00 ? 284 HIS A CE1 1 
ATOM 2124  N NE2 . HIS A 1 280 ? 22.561  86.543  -90.366  1.00 40.00 ? 284 HIS A NE2 1 
ATOM 2125  N N   . GLU A 1 281 ? 25.706  81.692  -86.752  1.00 40.00 ? 285 GLU A N   1 
ATOM 2126  C CA  . GLU A 1 281 ? 26.454  81.009  -85.724  1.00 40.00 ? 285 GLU A CA  1 
ATOM 2127  C C   . GLU A 1 281 ? 27.852  81.574  -85.494  1.00 40.00 ? 285 GLU A C   1 
ATOM 2128  O O   . GLU A 1 281 ? 28.219  81.943  -84.394  1.00 40.00 ? 285 GLU A O   1 
ATOM 2129  C CB  . GLU A 1 281 ? 26.690  79.521  -86.116  1.00 40.00 ? 285 GLU A CB  1 
ATOM 2130  C CG  . GLU A 1 281 ? 26.438  78.628  -84.927  1.00 40.00 ? 285 GLU A CG  1 
ATOM 2131  C CD  . GLU A 1 281 ? 26.853  77.201  -85.131  1.00 40.00 ? 285 GLU A CD  1 
ATOM 2132  O OE1 . GLU A 1 281 ? 27.324  76.665  -84.088  1.00 40.00 ? 285 GLU A OE1 1 
ATOM 2133  O OE2 . GLU A 1 281 ? 26.724  76.649  -86.237  1.00 40.00 ? 285 GLU A OE2 1 
ATOM 2134  N N   . TRP A 1 282 ? 28.618  81.592  -86.583  1.00 40.00 ? 286 TRP A N   1 
ATOM 2135  C CA  . TRP A 1 282 ? 29.983  82.060  -86.527  1.00 40.00 ? 286 TRP A CA  1 
ATOM 2136  C C   . TRP A 1 282 ? 30.177  83.548  -86.424  1.00 40.00 ? 286 TRP A C   1 
ATOM 2137  O O   . TRP A 1 282 ? 31.353  83.947  -86.365  1.00 40.00 ? 286 TRP A O   1 
ATOM 2138  C CB  . TRP A 1 282 ? 30.793  81.506  -87.712  1.00 40.00 ? 286 TRP A CB  1 
ATOM 2139  C CG  . TRP A 1 282 ? 30.755  80.008  -87.635  1.00 40.00 ? 286 TRP A CG  1 
ATOM 2140  C CD1 . TRP A 1 282 ? 30.171  79.148  -88.505  1.00 40.00 ? 286 TRP A CD1 1 
ATOM 2141  C CD2 . TRP A 1 282 ? 31.312  79.206  -86.587  1.00 40.00 ? 286 TRP A CD2 1 
ATOM 2142  N NE1 . TRP A 1 282 ? 30.333  77.850  -88.084  1.00 40.00 ? 286 TRP A NE1 1 
ATOM 2143  C CE2 . TRP A 1 282 ? 31.028  77.863  -86.901  1.00 40.00 ? 286 TRP A CE2 1 
ATOM 2144  C CE3 . TRP A 1 282 ? 32.013  79.500  -85.422  1.00 40.00 ? 286 TRP A CE3 1 
ATOM 2145  C CZ2 . TRP A 1 282 ? 31.432  76.803  -86.100  1.00 40.00 ? 286 TRP A CZ2 1 
ATOM 2146  C CZ3 . TRP A 1 282 ? 32.411  78.449  -84.621  1.00 40.00 ? 286 TRP A CZ3 1 
ATOM 2147  C CH2 . TRP A 1 282 ? 32.120  77.119  -84.963  1.00 40.00 ? 286 TRP A CH2 1 
ATOM 2148  N N   . HIS A 1 283 ? 29.169  84.389  -86.369  1.00 40.00 ? 287 HIS A N   1 
ATOM 2149  C CA  . HIS A 1 283 ? 29.395  85.815  -86.238  1.00 40.00 ? 287 HIS A CA  1 
ATOM 2150  C C   . HIS A 1 283 ? 29.298  86.284  -84.812  1.00 40.00 ? 287 HIS A C   1 
ATOM 2151  O O   . HIS A 1 283 ? 29.145  87.495  -84.568  1.00 40.00 ? 287 HIS A O   1 
ATOM 2152  C CB  . HIS A 1 283 ? 28.334  86.542  -87.081  1.00 40.00 ? 287 HIS A CB  1 
ATOM 2153  C CG  . HIS A 1 283 ? 28.421  86.140  -88.526  1.00 40.00 ? 287 HIS A CG  1 
ATOM 2154  N ND1 . HIS A 1 283 ? 27.457  86.520  -89.435  1.00 40.00 ? 287 HIS A ND1 1 
ATOM 2155  C CD2 . HIS A 1 283 ? 29.342  85.410  -89.202  1.00 40.00 ? 287 HIS A CD2 1 
ATOM 2156  C CE1 . HIS A 1 283 ? 27.791  86.014  -90.614  1.00 40.00 ? 287 HIS A CE1 1 
ATOM 2157  N NE2 . HIS A 1 283 ? 28.938  85.339  -90.500  1.00 40.00 ? 287 HIS A NE2 1 
ATOM 2158  N N   . VAL A 1 284 ? 29.314  85.418  -83.799  1.00 40.00 ? 288 VAL A N   1 
ATOM 2159  C CA  . VAL A 1 284 ? 29.158  86.032  -82.466  1.00 40.00 ? 288 VAL A CA  1 
ATOM 2160  C C   . VAL A 1 284 ? 30.426  85.879  -81.663  1.00 40.00 ? 288 VAL A C   1 
ATOM 2161  O O   . VAL A 1 284 ? 30.502  86.334  -80.520  1.00 40.00 ? 288 VAL A O   1 
ATOM 2162  C CB  . VAL A 1 284 ? 27.907  85.546  -81.750  1.00 40.00 ? 288 VAL A CB  1 
ATOM 2163  C CG1 . VAL A 1 284 ? 26.670  86.020  -82.489  1.00 40.00 ? 288 VAL A CG1 1 
ATOM 2164  C CG2 . VAL A 1 284 ? 27.863  84.039  -81.571  1.00 40.00 ? 288 VAL A CG2 1 
ATOM 2165  N N   . LEU A 1 285 ? 31.435  85.240  -82.282  1.00 40.00 ? 289 LEU A N   1 
ATOM 2166  C CA  . LEU A 1 285 ? 32.718  85.097  -81.538  1.00 40.00 ? 289 LEU A CA  1 
ATOM 2167  C C   . LEU A 1 285 ? 33.258  86.491  -81.329  1.00 40.00 ? 289 LEU A C   1 
ATOM 2168  O O   . LEU A 1 285 ? 32.989  87.338  -82.184  1.00 40.00 ? 289 LEU A O   1 
ATOM 2169  C CB  . LEU A 1 285 ? 33.678  84.168  -82.254  1.00 40.00 ? 289 LEU A CB  1 
ATOM 2170  C CG  . LEU A 1 285 ? 33.293  82.672  -82.107  1.00 40.00 ? 289 LEU A CG  1 
ATOM 2171  C CD1 . LEU A 1 285 ? 34.278  81.784  -82.849  1.00 40.00 ? 289 LEU A CD1 1 
ATOM 2172  C CD2 . LEU A 1 285 ? 33.172  82.285  -80.638  1.00 40.00 ? 289 LEU A CD2 1 
ATOM 2173  N N   . PRO A 1 286 ? 33.935  86.777  -80.246  1.00 40.00 ? 290 PRO A N   1 
ATOM 2174  C CA  . PRO A 1 286 ? 34.396  88.125  -79.972  1.00 40.00 ? 290 PRO A CA  1 
ATOM 2175  C C   . PRO A 1 286 ? 35.690  88.520  -80.614  1.00 40.00 ? 290 PRO A C   1 
ATOM 2176  O O   . PRO A 1 286 ? 36.001  89.716  -80.569  1.00 40.00 ? 290 PRO A O   1 
ATOM 2177  C CB  . PRO A 1 286 ? 34.428  88.178  -78.454  1.00 40.00 ? 290 PRO A CB  1 
ATOM 2178  C CG  . PRO A 1 286 ? 34.587  86.778  -77.998  1.00 40.00 ? 290 PRO A CG  1 
ATOM 2179  C CD  . PRO A 1 286 ? 34.291  85.864  -79.156  1.00 40.00 ? 290 PRO A CD  1 
ATOM 2180  N N   . GLN A 1 287 ? 36.469  87.611  -81.172  1.00 40.00 ? 291 GLN A N   1 
ATOM 2181  C CA  . GLN A 1 287 ? 37.727  87.907  -81.817  1.00 40.00 ? 291 GLN A CA  1 
ATOM 2182  C C   . GLN A 1 287 ? 37.992  86.946  -82.974  1.00 40.00 ? 291 GLN A C   1 
ATOM 2183  O O   . GLN A 1 287 ? 37.393  85.866  -83.031  1.00 40.00 ? 291 GLN A O   1 
ATOM 2184  C CB  . GLN A 1 287 ? 38.913  87.650  -80.872  1.00 40.00 ? 291 GLN A CB  1 
ATOM 2185  C CG  . GLN A 1 287 ? 38.885  88.313  -79.527  1.00 40.00 ? 291 GLN A CG  1 
ATOM 2186  C CD  . GLN A 1 287 ? 38.381  87.404  -78.437  1.00 40.00 ? 291 GLN A CD  1 
ATOM 2187  O OE1 . GLN A 1 287 ? 38.204  87.849  -77.301  1.00 40.00 ? 291 GLN A OE1 1 
ATOM 2188  N NE2 . GLN A 1 287 ? 38.139  86.132  -78.752  1.00 40.00 ? 291 GLN A NE2 1 
ATOM 2189  N N   . GLU A 1 288 ? 38.947  87.306  -83.824  1.00 40.00 ? 292 GLU A N   1 
ATOM 2190  C CA  . GLU A 1 288 ? 39.288  86.348  -84.896  1.00 40.00 ? 292 GLU A CA  1 
ATOM 2191  C C   . GLU A 1 288 ? 39.978  85.165  -84.203  1.00 40.00 ? 292 GLU A C   1 
ATOM 2192  O O   . GLU A 1 288 ? 40.696  85.459  -83.246  1.00 40.00 ? 292 GLU A O   1 
ATOM 2193  C CB  . GLU A 1 288 ? 40.109  86.968  -85.976  1.00 40.00 ? 292 GLU A CB  1 
ATOM 2194  C CG  . GLU A 1 288 ? 40.387  86.013  -87.104  1.00 40.00 ? 292 GLU A CG  1 
ATOM 2195  C CD  . GLU A 1 288 ? 41.477  86.441  -88.050  1.00 40.00 ? 292 GLU A CD  1 
ATOM 2196  O OE1 . GLU A 1 288 ? 41.983  87.583  -87.930  1.00 40.00 ? 292 GLU A OE1 1 
ATOM 2197  O OE2 . GLU A 1 288 ? 41.816  85.588  -88.920  1.00 40.00 ? 292 GLU A OE2 1 
ATOM 2198  N N   . SER A 1 289 ? 39.720  83.912  -84.570  1.00 40.00 ? 293 SER A N   1 
ATOM 2199  C CA  . SER A 1 289 ? 40.333  82.847  -83.795  1.00 40.00 ? 293 SER A CA  1 
ATOM 2200  C C   . SER A 1 289 ? 40.176  81.462  -84.382  1.00 40.00 ? 293 SER A C   1 
ATOM 2201  O O   . SER A 1 289 ? 39.605  81.288  -85.442  1.00 40.00 ? 293 SER A O   1 
ATOM 2202  C CB  . SER A 1 289 ? 39.627  82.868  -82.408  1.00 40.00 ? 293 SER A CB  1 
ATOM 2203  O OG  . SER A 1 289 ? 38.231  82.846  -82.618  1.00 40.00 ? 293 SER A OG  1 
ATOM 2204  N N   . ILE A 1 290 ? 40.737  80.473  -83.706  1.00 40.00 ? 294 ILE A N   1 
ATOM 2205  C CA  . ILE A 1 290 ? 40.651  79.075  -84.066  1.00 40.00 ? 294 ILE A CA  1 
ATOM 2206  C C   . ILE A 1 290 ? 40.469  78.277  -82.781  1.00 40.00 ? 294 ILE A C   1 
ATOM 2207  O O   . ILE A 1 290 ? 40.771  78.765  -81.689  1.00 40.00 ? 294 ILE A O   1 
ATOM 2208  C CB  . ILE A 1 290 ? 41.815  78.543  -84.869  1.00 40.00 ? 294 ILE A CB  1 
ATOM 2209  C CG1 . ILE A 1 290 ? 43.143  79.169  -84.424  1.00 40.00 ? 294 ILE A CG1 1 
ATOM 2210  C CG2 . ILE A 1 290 ? 41.588  78.820  -86.360  1.00 40.00 ? 294 ILE A CG2 1 
ATOM 2211  C CD1 . ILE A 1 290 ? 44.306  78.353  -84.980  1.00 40.00 ? 294 ILE A CD1 1 
ATOM 2212  N N   . PHE A 1 291 ? 39.875  77.103  -82.861  1.00 40.00 ? 295 PHE A N   1 
ATOM 2213  C CA  . PHE A 1 291 ? 39.684  76.339  -81.627  1.00 40.00 ? 295 PHE A CA  1 
ATOM 2214  C C   . PHE A 1 291 ? 38.958  77.161  -80.568  1.00 40.00 ? 295 PHE A C   1 
ATOM 2215  O O   . PHE A 1 291 ? 39.272  77.188  -79.379  1.00 40.00 ? 295 PHE A O   1 
ATOM 2216  C CB  . PHE A 1 291 ? 41.012  75.794  -81.101  1.00 40.00 ? 295 PHE A CB  1 
ATOM 2217  C CG  . PHE A 1 291 ? 40.865  74.396  -80.579  1.00 40.00 ? 295 PHE A CG  1 
ATOM 2218  C CD1 . PHE A 1 291 ? 39.838  74.085  -79.678  1.00 40.00 ? 295 PHE A CD1 1 
ATOM 2219  C CD2 . PHE A 1 291 ? 41.721  73.400  -80.986  1.00 40.00 ? 295 PHE A CD2 1 
ATOM 2220  C CE1 . PHE A 1 291 ? 39.643  72.813  -79.209  1.00 40.00 ? 295 PHE A CE1 1 
ATOM 2221  C CE2 . PHE A 1 291 ? 41.555  72.111  -80.492  1.00 40.00 ? 295 PHE A CE2 1 
ATOM 2222  C CZ  . PHE A 1 291 ? 40.520  71.820  -79.621  1.00 40.00 ? 295 PHE A CZ  1 
ATOM 2223  N N   . ARG A 1 292 ? 37.909  77.799  -81.053  1.00 40.00 ? 296 ARG A N   1 
ATOM 2224  C CA  . ARG A 1 292 ? 37.005  78.626  -80.248  1.00 40.00 ? 296 ARG A CA  1 
ATOM 2225  C C   . ARG A 1 292 ? 35.633  78.444  -80.855  1.00 40.00 ? 296 ARG A C   1 
ATOM 2226  O O   . ARG A 1 292 ? 35.566  78.345  -82.102  1.00 40.00 ? 296 ARG A O   1 
ATOM 2227  C CB  . ARG A 1 292 ? 37.525  80.044  -80.263  1.00 40.00 ? 296 ARG A CB  1 
ATOM 2228  C CG  . ARG A 1 292 ? 37.222  80.708  -78.932  1.00 40.00 ? 296 ARG A CG  1 
ATOM 2229  C CD  . ARG A 1 292 ? 38.365  80.750  -77.952  1.00 40.00 ? 296 ARG A CD  1 
ATOM 2230  N NE  . ARG A 1 292 ? 39.411  79.800  -78.245  1.00 40.00 ? 296 ARG A NE  1 
ATOM 2231  C CZ  . ARG A 1 292 ? 40.501  79.763  -77.457  1.00 40.00 ? 296 ARG A CZ  1 
ATOM 2232  N NH1 . ARG A 1 292 ? 40.555  80.632  -76.448  1.00 40.00 ? 296 ARG A NH1 1 
ATOM 2233  N NH2 . ARG A 1 292 ? 41.470  78.899  -77.689  1.00 40.00 ? 296 ARG A NH2 1 
ATOM 2234  N N   . PHE A 1 293 ? 34.592  78.158  -80.075  1.00 40.00 ? 297 PHE A N   1 
ATOM 2235  C CA  . PHE A 1 293 ? 33.285  77.881  -80.686  1.00 40.00 ? 297 PHE A CA  1 
ATOM 2236  C C   . PHE A 1 293 ? 32.189  78.744  -80.104  1.00 40.00 ? 297 PHE A C   1 
ATOM 2237  O O   . PHE A 1 293 ? 32.209  79.040  -78.904  1.00 40.00 ? 297 PHE A O   1 
ATOM 2238  C CB  . PHE A 1 293 ? 32.928  76.403  -80.572  1.00 40.00 ? 297 PHE A CB  1 
ATOM 2239  C CG  . PHE A 1 293 ? 34.100  75.537  -80.950  1.00 40.00 ? 297 PHE A CG  1 
ATOM 2240  C CD1 . PHE A 1 293 ? 34.483  75.478  -82.284  1.00 40.00 ? 297 PHE A CD1 1 
ATOM 2241  C CD2 . PHE A 1 293 ? 34.832  74.866  -79.993  1.00 40.00 ? 297 PHE A CD2 1 
ATOM 2242  C CE1 . PHE A 1 293 ? 35.588  74.717  -82.654  1.00 40.00 ? 297 PHE A CE1 1 
ATOM 2243  C CE2 . PHE A 1 293 ? 35.918  74.113  -80.375  1.00 40.00 ? 297 PHE A CE2 1 
ATOM 2244  C CZ  . PHE A 1 293 ? 36.302  74.046  -81.698  1.00 40.00 ? 297 PHE A CZ  1 
ATOM 2245  N N   . SER A 1 294 ? 31.215  79.145  -80.937  1.00 40.00 ? 298 SER A N   1 
ATOM 2246  C CA  . SER A 1 294 ? 30.200  80.073  -80.472  1.00 40.00 ? 298 SER A CA  1 
ATOM 2247  C C   . SER A 1 294 ? 29.222  79.639  -79.427  1.00 40.00 ? 298 SER A C   1 
ATOM 2248  O O   . SER A 1 294 ? 28.878  80.412  -78.519  1.00 40.00 ? 298 SER A O   1 
ATOM 2249  C CB  . SER A 1 294 ? 29.449  80.675  -81.666  1.00 40.00 ? 298 SER A CB  1 
ATOM 2250  O OG  . SER A 1 294 ? 30.381  81.109  -82.654  1.00 40.00 ? 298 SER A OG  1 
ATOM 2251  N N   . PHE A 1 295 ? 28.677  78.440  -79.649  1.00 40.00 ? 299 PHE A N   1 
ATOM 2252  C CA  . PHE A 1 295 ? 27.667  77.892  -78.722  1.00 40.00 ? 299 PHE A CA  1 
ATOM 2253  C C   . PHE A 1 295 ? 28.164  76.577  -78.161  1.00 40.00 ? 299 PHE A C   1 
ATOM 2254  O O   . PHE A 1 295 ? 28.483  75.630  -78.891  1.00 40.00 ? 299 PHE A O   1 
ATOM 2255  C CB  . PHE A 1 295 ? 26.301  77.833  -79.424  1.00 40.00 ? 299 PHE A CB  1 
ATOM 2256  C CG  . PHE A 1 295 ? 25.821  79.252  -79.689  1.00 40.00 ? 299 PHE A CG  1 
ATOM 2257  C CD1 . PHE A 1 295 ? 25.242  79.981  -78.675  1.00 40.00 ? 299 PHE A CD1 1 
ATOM 2258  C CD2 . PHE A 1 295 ? 26.031  79.844  -80.917  1.00 40.00 ? 299 PHE A CD2 1 
ATOM 2259  C CE1 . PHE A 1 295 ? 24.839  81.281  -78.866  1.00 40.00 ? 299 PHE A CE1 1 
ATOM 2260  C CE2 . PHE A 1 295 ? 25.637  81.143  -81.113  1.00 40.00 ? 299 PHE A CE2 1 
ATOM 2261  C CZ  . PHE A 1 295 ? 25.048  81.854  -80.094  1.00 40.00 ? 299 PHE A CZ  1 
ATOM 2262  N N   . VAL A 1 296 ? 28.370  76.566  -76.848  1.00 40.00 ? 300 VAL A N   1 
ATOM 2263  C CA  . VAL A 1 296 ? 28.938  75.503  -76.059  1.00 40.00 ? 300 VAL A CA  1 
ATOM 2264  C C   . VAL A 1 296 ? 28.449  75.622  -74.611  1.00 40.00 ? 300 VAL A C   1 
ATOM 2265  O O   . VAL A 1 296 ? 27.891  76.639  -74.239  1.00 40.00 ? 300 VAL A O   1 
ATOM 2266  C CB  . VAL A 1 296 ? 30.483  75.625  -75.947  1.00 40.00 ? 300 VAL A CB  1 
ATOM 2267  C CG1 . VAL A 1 296 ? 31.223  75.474  -77.257  1.00 40.00 ? 300 VAL A CG1 1 
ATOM 2268  C CG2 . VAL A 1 296 ? 30.788  76.956  -75.250  1.00 40.00 ? 300 VAL A CG2 1 
ATOM 2269  N N   . PRO A 1 297 ? 28.671  74.612  -73.796  1.00 40.00 ? 301 PRO A N   1 
ATOM 2270  C CA  . PRO A 1 297 ? 28.215  74.603  -72.422  1.00 40.00 ? 301 PRO A CA  1 
ATOM 2271  C C   . PRO A 1 297 ? 28.510  75.904  -71.729  1.00 40.00 ? 301 PRO A C   1 
ATOM 2272  O O   . PRO A 1 297 ? 29.577  76.478  -71.951  1.00 40.00 ? 301 PRO A O   1 
ATOM 2273  C CB  . PRO A 1 297 ? 28.959  73.483  -71.745  1.00 40.00 ? 301 PRO A CB  1 
ATOM 2274  C CG  . PRO A 1 297 ? 29.350  72.563  -72.851  1.00 40.00 ? 301 PRO A CG  1 
ATOM 2275  C CD  . PRO A 1 297 ? 29.336  73.333  -74.142  1.00 40.00 ? 301 PRO A CD  1 
ATOM 2276  N N   . VAL A 1 298 ? 27.572  76.315  -70.913  1.00 40.00 ? 302 VAL A N   1 
ATOM 2277  C CA  . VAL A 1 298 ? 27.728  77.568  -70.163  1.00 40.00 ? 302 VAL A CA  1 
ATOM 2278  C C   . VAL A 1 298 ? 27.779  77.275  -68.669  1.00 40.00 ? 302 VAL A C   1 
ATOM 2279  O O   . VAL A 1 298 ? 27.047  76.372  -68.214  1.00 40.00 ? 302 VAL A O   1 
ATOM 2280  C CB  . VAL A 1 298 ? 26.488  78.466  -70.414  1.00 40.00 ? 302 VAL A CB  1 
ATOM 2281  C CG1 . VAL A 1 298 ? 25.230  77.722  -70.031  1.00 40.00 ? 302 VAL A CG1 1 
ATOM 2282  C CG2 . VAL A 1 298 ? 26.593  79.757  -69.621  1.00 40.00 ? 302 VAL A CG2 1 
ATOM 2283  N N   . VAL A 1 299 ? 28.573  78.069  -67.973  1.00 40.00 ? 303 VAL A N   1 
ATOM 2284  C CA  . VAL A 1 299 ? 28.668  77.877  -66.499  1.00 40.00 ? 303 VAL A CA  1 
ATOM 2285  C C   . VAL A 1 299 ? 27.460  78.568  -65.908  1.00 40.00 ? 303 VAL A C   1 
ATOM 2286  O O   . VAL A 1 299 ? 27.503  79.754  -65.648  1.00 40.00 ? 303 VAL A O   1 
ATOM 2287  C CB  . VAL A 1 299 ? 29.997  78.471  -66.012  1.00 40.00 ? 303 VAL A CB  1 
ATOM 2288  C CG1 . VAL A 1 299 ? 30.074  78.571  -64.503  1.00 40.00 ? 303 VAL A CG1 1 
ATOM 2289  C CG2 . VAL A 1 299 ? 31.147  77.670  -66.612  1.00 40.00 ? 303 VAL A CG2 1 
ATOM 2290  N N   . ASP A 1 300 ? 26.357  77.864  -65.778  1.00 40.00 ? 304 ASP A N   1 
ATOM 2291  C CA  . ASP A 1 300 ? 25.082  78.385  -65.305  1.00 40.00 ? 304 ASP A CA  1 
ATOM 2292  C C   . ASP A 1 300 ? 24.965  78.376  -63.790  1.00 40.00 ? 304 ASP A C   1 
ATOM 2293  O O   . ASP A 1 300 ? 24.192  79.107  -63.202  1.00 40.00 ? 304 ASP A O   1 
ATOM 2294  C CB  . ASP A 1 300 ? 23.917  77.494  -65.776  1.00 40.00 ? 304 ASP A CB  1 
ATOM 2295  C CG  . ASP A 1 300 ? 24.268  76.020  -65.821  1.00 40.00 ? 304 ASP A CG  1 
ATOM 2296  O OD1 . ASP A 1 300 ? 25.240  75.554  -65.180  1.00 40.00 ? 304 ASP A OD1 1 
ATOM 2297  O OD2 . ASP A 1 300 ? 23.534  75.292  -66.553  1.00 40.00 ? 304 ASP A OD2 1 
ATOM 2298  N N   . GLY A 1 301 ? 25.705  77.455  -63.169  1.00 40.00 ? 305 GLY A N   1 
ATOM 2299  C CA  . GLY A 1 301 ? 25.586  77.337  -61.697  1.00 40.00 ? 305 GLY A CA  1 
ATOM 2300  C C   . GLY A 1 301 ? 24.418  76.367  -61.437  1.00 40.00 ? 305 GLY A C   1 
ATOM 2301  O O   . GLY A 1 301 ? 23.672  76.457  -60.470  1.00 40.00 ? 305 GLY A O   1 
ATOM 2302  N N   . ASP A 1 302 ? 24.251  75.452  -62.374  1.00 40.00 ? 306 ASP A N   1 
ATOM 2303  C CA  . ASP A 1 302 ? 23.238  74.429  -62.317  1.00 40.00 ? 306 ASP A CA  1 
ATOM 2304  C C   . ASP A 1 302 ? 23.947  73.184  -62.845  1.00 40.00 ? 306 ASP A C   1 
ATOM 2305  O O   . ASP A 1 302 ? 24.625  72.454  -62.129  1.00 40.00 ? 306 ASP A O   1 
ATOM 2306  C CB  . ASP A 1 302 ? 22.039  74.674  -63.204  1.00 40.00 ? 306 ASP A CB  1 
ATOM 2307  C CG  . ASP A 1 302 ? 20.960  73.612  -63.075  1.00 40.00 ? 306 ASP A CG  1 
ATOM 2308  O OD1 . ASP A 1 302 ? 20.251  73.638  -62.034  1.00 40.00 ? 306 ASP A OD1 1 
ATOM 2309  O OD2 . ASP A 1 302 ? 20.758  72.743  -63.957  1.00 40.00 ? 306 ASP A OD2 1 
ATOM 2310  N N   . PHE A 1 303 ? 23.867  73.042  -64.176  1.00 40.00 ? 307 PHE A N   1 
ATOM 2311  C CA  . PHE A 1 303 ? 24.530  71.828  -64.677  1.00 40.00 ? 307 PHE A CA  1 
ATOM 2312  C C   . PHE A 1 303 ? 25.977  71.816  -64.225  1.00 40.00 ? 307 PHE A C   1 
ATOM 2313  O O   . PHE A 1 303 ? 26.413  70.710  -63.918  1.00 40.00 ? 307 PHE A O   1 
ATOM 2314  C CB  . PHE A 1 303 ? 24.317  71.591  -66.107  1.00 40.00 ? 307 PHE A CB  1 
ATOM 2315  C CG  . PHE A 1 303 ? 24.730  70.253  -66.650  1.00 40.00 ? 307 PHE A CG  1 
ATOM 2316  C CD1 . PHE A 1 303 ? 26.039  69.893  -66.822  1.00 40.00 ? 307 PHE A CD1 1 
ATOM 2317  C CD2 . PHE A 1 303 ? 23.747  69.364  -67.040  1.00 40.00 ? 307 PHE A CD2 1 
ATOM 2318  C CE1 . PHE A 1 303 ? 26.381  68.685  -67.375  1.00 40.00 ? 307 PHE A CE1 1 
ATOM 2319  C CE2 . PHE A 1 303 ? 24.063  68.142  -67.590  1.00 40.00 ? 307 PHE A CE2 1 
ATOM 2320  C CZ  . PHE A 1 303 ? 25.390  67.797  -67.756  1.00 40.00 ? 307 PHE A CZ  1 
ATOM 2321  N N   . LEU A 1 304 ? 26.656  72.929  -64.216  1.00 40.00 ? 308 LEU A N   1 
ATOM 2322  C CA  . LEU A 1 304 ? 28.002  73.087  -63.673  1.00 40.00 ? 308 LEU A CA  1 
ATOM 2323  C C   . LEU A 1 304 ? 27.821  74.084  -62.504  1.00 40.00 ? 308 LEU A C   1 
ATOM 2324  O O   . LEU A 1 304 ? 27.304  75.202  -62.650  1.00 40.00 ? 308 LEU A O   1 
ATOM 2325  C CB  . LEU A 1 304 ? 28.997  73.547  -64.694  1.00 40.00 ? 308 LEU A CB  1 
ATOM 2326  C CG  . LEU A 1 304 ? 29.124  72.809  -66.020  1.00 40.00 ? 308 LEU A CG  1 
ATOM 2327  C CD1 . LEU A 1 304 ? 30.045  73.568  -66.968  1.00 40.00 ? 308 LEU A CD1 1 
ATOM 2328  C CD2 . LEU A 1 304 ? 29.715  71.413  -65.872  1.00 40.00 ? 308 LEU A CD2 1 
ATOM 2329  N N   . SER A 1 305 ? 28.157  73.693  -61.266  1.00 40.00 ? 309 SER A N   1 
ATOM 2330  C CA  . SER A 1 305 ? 27.919  74.569  -60.107  1.00 40.00 ? 309 SER A CA  1 
ATOM 2331  C C   . SER A 1 305 ? 28.878  75.742  -60.064  1.00 40.00 ? 309 SER A C   1 
ATOM 2332  O O   . SER A 1 305 ? 28.648  76.747  -59.399  1.00 40.00 ? 309 SER A O   1 
ATOM 2333  C CB  . SER A 1 305 ? 28.082  73.782  -58.798  1.00 40.00 ? 309 SER A CB  1 
ATOM 2334  O OG  . SER A 1 305 ? 28.817  72.592  -59.116  1.00 40.00 ? 309 SER A OG  1 
ATOM 2335  N N   . ASP A 1 306 ? 29.965  75.537  -60.778  1.00 40.00 ? 310 ASP A N   1 
ATOM 2336  C CA  . ASP A 1 306 ? 31.039  76.525  -60.851  1.00 40.00 ? 310 ASP A CA  1 
ATOM 2337  C C   . ASP A 1 306 ? 31.866  76.120  -62.068  1.00 40.00 ? 310 ASP A C   1 
ATOM 2338  O O   . ASP A 1 306 ? 31.562  75.048  -62.637  1.00 40.00 ? 310 ASP A O   1 
ATOM 2339  C CB  . ASP A 1 306 ? 31.909  76.306  -59.600  1.00 40.00 ? 310 ASP A CB  1 
ATOM 2340  C CG  . ASP A 1 306 ? 32.716  77.535  -59.262  1.00 40.00 ? 310 ASP A CG  1 
ATOM 2341  O OD1 . ASP A 1 306 ? 33.239  78.096  -60.247  1.00 40.00 ? 310 ASP A OD1 1 
ATOM 2342  O OD2 . ASP A 1 306 ? 32.808  77.920  -58.074  1.00 40.00 ? 310 ASP A OD2 1 
ATOM 2343  N N   . THR A 1 307 ? 32.852  76.894  -62.435  1.00 40.00 ? 311 THR A N   1 
ATOM 2344  C CA  . THR A 1 307 ? 33.685  76.503  -63.546  1.00 40.00 ? 311 THR A CA  1 
ATOM 2345  C C   . THR A 1 307 ? 34.293  75.122  -63.388  1.00 40.00 ? 311 THR A C   1 
ATOM 2346  O O   . THR A 1 307 ? 34.764  74.779  -62.292  1.00 40.00 ? 311 THR A O   1 
ATOM 2347  C CB  . THR A 1 307 ? 34.987  77.374  -63.465  1.00 40.00 ? 311 THR A CB  1 
ATOM 2348  O OG1 . THR A 1 307 ? 34.705  78.474  -62.612  1.00 40.00 ? 311 THR A OG1 1 
ATOM 2349  C CG2 . THR A 1 307 ? 35.280  77.822  -64.877  1.00 40.00 ? 311 THR A CG2 1 
ATOM 2350  N N   . PRO A 1 308 ? 34.459  74.447  -64.513  1.00 40.00 ? 312 PRO A N   1 
ATOM 2351  C CA  . PRO A 1 308 ? 35.183  73.184  -64.527  1.00 40.00 ? 312 PRO A CA  1 
ATOM 2352  C C   . PRO A 1 308 ? 36.521  73.391  -63.814  1.00 40.00 ? 312 PRO A C   1 
ATOM 2353  O O   . PRO A 1 308 ? 36.901  72.533  -63.003  1.00 40.00 ? 312 PRO A O   1 
ATOM 2354  C CB  . PRO A 1 308 ? 35.387  72.848  -65.985  1.00 40.00 ? 312 PRO A CB  1 
ATOM 2355  C CG  . PRO A 1 308 ? 34.615  73.821  -66.750  1.00 40.00 ? 312 PRO A CG  1 
ATOM 2356  C CD  . PRO A 1 308 ? 34.004  74.843  -65.841  1.00 40.00 ? 312 PRO A CD  1 
ATOM 2357  N N   . GLU A 1 309 ? 37.247  74.496  -64.061  1.00 40.00 ? 313 GLU A N   1 
ATOM 2358  C CA  . GLU A 1 309 ? 38.524  74.679  -63.339  1.00 40.00 ? 313 GLU A CA  1 
ATOM 2359  C C   . GLU A 1 309 ? 38.294  74.511  -61.847  1.00 40.00 ? 313 GLU A C   1 
ATOM 2360  O O   . GLU A 1 309 ? 38.767  73.543  -61.270  1.00 40.00 ? 313 GLU A O   1 
ATOM 2361  C CB  . GLU A 1 309 ? 39.171  76.030  -63.521  1.00 40.00 ? 313 GLU A CB  1 
ATOM 2362  C CG  . GLU A 1 309 ? 40.690  76.029  -63.476  1.00 40.00 ? 313 GLU A CG  1 
ATOM 2363  C CD  . GLU A 1 309 ? 41.275  75.520  -64.785  1.00 40.00 ? 313 GLU A CD  1 
ATOM 2364  O OE1 . GLU A 1 309 ? 40.612  75.592  -65.851  1.00 40.00 ? 313 GLU A OE1 1 
ATOM 2365  O OE2 . GLU A 1 309 ? 42.429  75.038  -64.754  1.00 40.00 ? 313 GLU A OE2 1 
ATOM 2366  N N   . ALA A 1 310 ? 37.503  75.405  -61.254  1.00 40.00 ? 314 ALA A N   1 
ATOM 2367  C CA  . ALA A 1 310 ? 37.208  75.267  -59.828  1.00 40.00 ? 314 ALA A CA  1 
ATOM 2368  C C   . ALA A 1 310 ? 36.766  73.854  -59.500  1.00 40.00 ? 314 ALA A C   1 
ATOM 2369  O O   . ALA A 1 310 ? 37.094  73.339  -58.436  1.00 40.00 ? 314 ALA A O   1 
ATOM 2370  C CB  . ALA A 1 310 ? 36.055  76.199  -59.429  1.00 40.00 ? 314 ALA A CB  1 
ATOM 2371  N N   . LEU A 1 311 ? 35.958  73.220  -60.349  1.00 40.00 ? 315 LEU A N   1 
ATOM 2372  C CA  . LEU A 1 311 ? 35.466  71.890  -60.000  1.00 40.00 ? 315 LEU A CA  1 
ATOM 2373  C C   . LEU A 1 311 ? 36.543  70.838  -59.973  1.00 40.00 ? 315 LEU A C   1 
ATOM 2374  O O   . LEU A 1 311 ? 36.696  70.209  -58.926  1.00 40.00 ? 315 LEU A O   1 
ATOM 2375  C CB  . LEU A 1 311 ? 34.298  71.426  -60.858  1.00 40.00 ? 315 LEU A CB  1 
ATOM 2376  C CG  . LEU A 1 311 ? 32.993  72.205  -60.742  1.00 40.00 ? 315 LEU A CG  1 
ATOM 2377  C CD1 . LEU A 1 311 ? 31.895  71.435  -61.467  1.00 40.00 ? 315 LEU A CD1 1 
ATOM 2378  C CD2 . LEU A 1 311 ? 32.616  72.491  -59.291  1.00 40.00 ? 315 LEU A CD2 1 
ATOM 2379  N N   . ILE A 1 312 ? 37.347  70.671  -61.016  1.00 40.00 ? 316 ILE A N   1 
ATOM 2380  C CA  . ILE A 1 312 ? 38.378  69.644  -60.962  1.00 40.00 ? 316 ILE A CA  1 
ATOM 2381  C C   . ILE A 1 312 ? 39.419  70.037  -59.912  1.00 40.00 ? 316 ILE A C   1 
ATOM 2382  O O   . ILE A 1 312 ? 40.317  69.290  -59.529  1.00 40.00 ? 316 ILE A O   1 
ATOM 2383  C CB  . ILE A 1 312 ? 39.183  69.505  -62.266  1.00 40.00 ? 316 ILE A CB  1 
ATOM 2384  C CG1 . ILE A 1 312 ? 39.891  70.836  -62.544  1.00 40.00 ? 316 ILE A CG1 1 
ATOM 2385  C CG2 . ILE A 1 312 ? 38.338  69.050  -63.430  1.00 40.00 ? 316 ILE A CG2 1 
ATOM 2386  C CD1 . ILE A 1 312 ? 41.088  70.728  -63.474  1.00 40.00 ? 316 ILE A CD1 1 
ATOM 2387  N N   . ASN A 1 313 ? 39.354  71.301  -59.523  1.00 40.00 ? 317 ASN A N   1 
ATOM 2388  C CA  . ASN A 1 313 ? 40.309  71.767  -58.527  1.00 40.00 ? 317 ASN A CA  1 
ATOM 2389  C C   . ASN A 1 313 ? 39.855  71.315  -57.166  1.00 40.00 ? 317 ASN A C   1 
ATOM 2390  O O   . ASN A 1 313 ? 40.745  70.957  -56.389  1.00 40.00 ? 317 ASN A O   1 
ATOM 2391  C CB  . ASN A 1 313 ? 40.518  73.257  -58.692  1.00 40.00 ? 317 ASN A CB  1 
ATOM 2392  C CG  . ASN A 1 313 ? 40.671  74.002  -57.389  1.00 40.00 ? 317 ASN A CG  1 
ATOM 2393  O OD1 . ASN A 1 313 ? 39.954  74.984  -57.135  1.00 40.00 ? 317 ASN A OD1 1 
ATOM 2394  N ND2 . ASN A 1 313 ? 41.603  73.531  -56.558  1.00 40.00 ? 317 ASN A ND2 1 
ATOM 2395  N N   . THR A 1 314 ? 38.581  71.307  -56.808  1.00 40.00 ? 318 THR A N   1 
ATOM 2396  C CA  . THR A 1 314 ? 38.207  70.888  -55.456  1.00 40.00 ? 318 THR A CA  1 
ATOM 2397  C C   . THR A 1 314 ? 37.227  69.735  -55.385  1.00 40.00 ? 318 THR A C   1 
ATOM 2398  O O   . THR A 1 314 ? 36.690  69.436  -54.314  1.00 40.00 ? 318 THR A O   1 
ATOM 2399  C CB  . THR A 1 314 ? 37.605  72.055  -54.647  1.00 40.00 ? 318 THR A CB  1 
ATOM 2400  O OG1 . THR A 1 314 ? 36.310  72.393  -55.170  1.00 40.00 ? 318 THR A OG1 1 
ATOM 2401  C CG2 . THR A 1 314 ? 38.524  73.262  -54.652  1.00 40.00 ? 318 THR A CG2 1 
ATOM 2402  N N   . GLY A 1 315 ? 36.967  69.080  -56.505  1.00 40.00 ? 319 GLY A N   1 
ATOM 2403  C CA  . GLY A 1 315 ? 36.011  67.975  -56.518  1.00 40.00 ? 319 GLY A CA  1 
ATOM 2404  C C   . GLY A 1 315 ? 36.611  66.767  -55.811  1.00 40.00 ? 319 GLY A C   1 
ATOM 2405  O O   . GLY A 1 315 ? 37.823  66.687  -55.686  1.00 40.00 ? 319 GLY A O   1 
ATOM 2406  N N   . ASP A 1 316 ? 35.767  65.851  -55.356  1.00 40.00 ? 320 ASP A N   1 
ATOM 2407  C CA  . ASP A 1 316 ? 36.257  64.618  -54.732  1.00 40.00 ? 320 ASP A CA  1 
ATOM 2408  C C   . ASP A 1 316 ? 36.128  63.531  -55.810  1.00 40.00 ? 320 ASP A C   1 
ATOM 2409  O O   . ASP A 1 316 ? 35.002  63.116  -56.098  1.00 40.00 ? 320 ASP A O   1 
ATOM 2410  C CB  . ASP A 1 316 ? 35.442  64.218  -53.514  1.00 40.00 ? 320 ASP A CB  1 
ATOM 2411  C CG  . ASP A 1 316 ? 36.031  63.031  -52.760  1.00 40.00 ? 320 ASP A CG  1 
ATOM 2412  O OD1 . ASP A 1 316 ? 36.225  61.955  -53.373  1.00 40.00 ? 320 ASP A OD1 1 
ATOM 2413  O OD2 . ASP A 1 316 ? 36.305  63.176  -51.543  1.00 40.00 ? 320 ASP A OD2 1 
ATOM 2414  N N   . PHE A 1 317 ? 37.236  63.138  -56.420  1.00 40.00 ? 321 PHE A N   1 
ATOM 2415  C CA  . PHE A 1 317 ? 37.162  62.119  -57.480  1.00 40.00 ? 321 PHE A CA  1 
ATOM 2416  C C   . PHE A 1 317 ? 37.845  60.852  -56.994  1.00 40.00 ? 321 PHE A C   1 
ATOM 2417  O O   . PHE A 1 317 ? 38.437  60.106  -57.774  1.00 40.00 ? 321 PHE A O   1 
ATOM 2418  C CB  . PHE A 1 317 ? 37.861  62.635  -58.750  1.00 40.00 ? 321 PHE A CB  1 
ATOM 2419  C CG  . PHE A 1 317 ? 37.451  64.051  -59.061  1.00 40.00 ? 321 PHE A CG  1 
ATOM 2420  C CD1 . PHE A 1 317 ? 36.168  64.297  -59.517  1.00 40.00 ? 321 PHE A CD1 1 
ATOM 2421  C CD2 . PHE A 1 317 ? 38.309  65.112  -58.866  1.00 40.00 ? 321 PHE A CD2 1 
ATOM 2422  C CE1 . PHE A 1 317 ? 35.757  65.585  -59.784  1.00 40.00 ? 321 PHE A CE1 1 
ATOM 2423  C CE2 . PHE A 1 317 ? 37.904  66.403  -59.144  1.00 40.00 ? 321 PHE A CE2 1 
ATOM 2424  C CZ  . PHE A 1 317 ? 36.627  66.648  -59.602  1.00 40.00 ? 321 PHE A CZ  1 
ATOM 2425  N N   . GLN A 1 318 ? 37.753  60.647  -55.686  1.00 40.00 ? 322 GLN A N   1 
ATOM 2426  C CA  . GLN A 1 318 ? 38.404  59.546  -55.008  1.00 40.00 ? 322 GLN A CA  1 
ATOM 2427  C C   . GLN A 1 318 ? 37.810  58.178  -55.190  1.00 40.00 ? 322 GLN A C   1 
ATOM 2428  O O   . GLN A 1 318 ? 37.233  57.644  -54.244  1.00 40.00 ? 322 GLN A O   1 
ATOM 2429  C CB  . GLN A 1 318 ? 38.456  59.876  -53.502  1.00 40.00 ? 322 GLN A CB  1 
ATOM 2430  C CG  . GLN A 1 318 ? 39.431  59.003  -52.722  1.00 40.00 ? 322 GLN A CG  1 
ATOM 2431  C CD  . GLN A 1 318 ? 38.920  58.803  -51.304  1.00 40.00 ? 322 GLN A CD  1 
ATOM 2432  O OE1 . GLN A 1 318 ? 38.264  59.691  -50.752  1.00 40.00 ? 322 GLN A OE1 1 
ATOM 2433  N NE2 . GLN A 1 318 ? 39.210  57.642  -50.725  1.00 40.00 ? 322 GLN A NE2 1 
ATOM 2434  N N   . ASP A 1 319 ? 37.901  57.597  -56.370  1.00 40.00 ? 323 ASP A N   1 
ATOM 2435  C CA  . ASP A 1 319 ? 37.354  56.300  -56.709  1.00 40.00 ? 323 ASP A CA  1 
ATOM 2436  C C   . ASP A 1 319 ? 37.179  56.188  -58.234  1.00 40.00 ? 323 ASP A C   1 
ATOM 2437  O O   . ASP A 1 319 ? 37.281  55.098  -58.807  1.00 40.00 ? 323 ASP A O   1 
ATOM 2438  C CB  . ASP A 1 319 ? 35.988  56.094  -56.039  1.00 40.00 ? 323 ASP A CB  1 
ATOM 2439  C CG  . ASP A 1 319 ? 34.933  57.008  -56.652  1.00 40.00 ? 323 ASP A CG  1 
ATOM 2440  O OD1 . ASP A 1 319 ? 34.948  58.225  -56.374  1.00 40.00 ? 323 ASP A OD1 1 
ATOM 2441  O OD2 . ASP A 1 319 ? 34.138  56.448  -57.429  1.00 40.00 ? 323 ASP A OD2 1 
ATOM 2442  N N   . LEU A 1 320 ? 36.911  57.333  -58.858  1.00 40.00 ? 324 LEU A N   1 
ATOM 2443  C CA  . LEU A 1 320 ? 36.718  57.399  -60.288  1.00 40.00 ? 324 LEU A CA  1 
ATOM 2444  C C   . LEU A 1 320 ? 37.854  56.791  -61.090  1.00 40.00 ? 324 LEU A C   1 
ATOM 2445  O O   . LEU A 1 320 ? 39.016  57.131  -60.871  1.00 40.00 ? 324 LEU A O   1 
ATOM 2446  C CB  . LEU A 1 320 ? 36.622  58.879  -60.643  1.00 40.00 ? 324 LEU A CB  1 
ATOM 2447  C CG  . LEU A 1 320 ? 35.640  59.424  -61.667  1.00 40.00 ? 324 LEU A CG  1 
ATOM 2448  C CD1 . LEU A 1 320 ? 36.004  60.896  -61.917  1.00 40.00 ? 324 LEU A CD1 1 
ATOM 2449  C CD2 . LEU A 1 320 ? 35.618  58.646  -62.971  1.00 40.00 ? 324 LEU A CD2 1 
ATOM 2450  N N   . GLN A 1 321 ? 37.563  55.914  -62.035  1.00 40.00 ? 325 GLN A N   1 
ATOM 2451  C CA  . GLN A 1 321 ? 38.652  55.403  -62.875  1.00 40.00 ? 325 GLN A CA  1 
ATOM 2452  C C   . GLN A 1 321 ? 38.512  56.254  -64.148  1.00 40.00 ? 325 GLN A C   1 
ATOM 2453  O O   . GLN A 1 321 ? 37.375  56.433  -64.589  1.00 40.00 ? 325 GLN A O   1 
ATOM 2454  C CB  . GLN A 1 321 ? 38.556  53.962  -63.279  1.00 40.00 ? 325 GLN A CB  1 
ATOM 2455  C CG  . GLN A 1 321 ? 39.114  52.940  -62.295  1.00 40.00 ? 325 GLN A CG  1 
ATOM 2456  C CD  . GLN A 1 321 ? 37.940  52.175  -61.678  1.00 40.00 ? 325 GLN A CD  1 
ATOM 2457  O OE1 . GLN A 1 321 ? 37.493  51.230  -62.331  1.00 40.00 ? 325 GLN A OE1 1 
ATOM 2458  N NE2 . GLN A 1 321 ? 37.504  52.624  -60.507  1.00 40.00 ? 325 GLN A NE2 1 
ATOM 2459  N N   . VAL A 1 322 ? 39.612  56.759  -64.680  1.00 40.00 ? 326 VAL A N   1 
ATOM 2460  C CA  . VAL A 1 322 ? 39.494  57.592  -65.863  1.00 40.00 ? 326 VAL A CA  1 
ATOM 2461  C C   . VAL A 1 322 ? 40.681  57.349  -66.789  1.00 40.00 ? 326 VAL A C   1 
ATOM 2462  O O   . VAL A 1 322 ? 41.827  57.494  -66.360  1.00 40.00 ? 326 VAL A O   1 
ATOM 2463  C CB  . VAL A 1 322 ? 39.648  59.081  -65.468  1.00 40.00 ? 326 VAL A CB  1 
ATOM 2464  C CG1 . VAL A 1 322 ? 39.677  59.870  -66.777  1.00 40.00 ? 326 VAL A CG1 1 
ATOM 2465  C CG2 . VAL A 1 322 ? 38.644  59.605  -64.474  1.00 40.00 ? 326 VAL A CG2 1 
ATOM 2466  N N   . LEU A 1 323 ? 40.409  57.048  -68.023  1.00 40.00 ? 327 LEU A N   1 
ATOM 2467  C CA  . LEU A 1 323 ? 41.502  56.907  -69.003  1.00 40.00 ? 327 LEU A CA  1 
ATOM 2468  C C   . LEU A 1 323 ? 41.518  58.258  -69.721  1.00 40.00 ? 327 LEU A C   1 
ATOM 2469  O O   . LEU A 1 323 ? 40.438  58.852  -69.952  1.00 40.00 ? 327 LEU A O   1 
ATOM 2470  C CB  . LEU A 1 323 ? 41.183  55.755  -69.943  1.00 40.00 ? 327 LEU A CB  1 
ATOM 2471  C CG  . LEU A 1 323 ? 42.246  55.297  -70.935  1.00 40.00 ? 327 LEU A CG  1 
ATOM 2472  C CD1 . LEU A 1 323 ? 41.660  54.362  -71.997  1.00 40.00 ? 327 LEU A CD1 1 
ATOM 2473  C CD2 . LEU A 1 323 ? 42.921  56.425  -71.695  1.00 40.00 ? 327 LEU A CD2 1 
ATOM 2474  N N   . VAL A 1 324 ? 42.656  58.818  -70.060  1.00 40.00 ? 328 VAL A N   1 
ATOM 2475  C CA  . VAL A 1 324 ? 42.750  60.116  -70.708  1.00 40.00 ? 328 VAL A CA  1 
ATOM 2476  C C   . VAL A 1 324 ? 43.896  60.082  -71.703  1.00 40.00 ? 328 VAL A C   1 
ATOM 2477  O O   . VAL A 1 324 ? 44.803  59.287  -71.413  1.00 40.00 ? 328 VAL A O   1 
ATOM 2478  C CB  . VAL A 1 324 ? 43.230  61.164  -69.679  1.00 40.00 ? 328 VAL A CB  1 
ATOM 2479  C CG1 . VAL A 1 324 ? 43.498  62.474  -70.414  1.00 40.00 ? 328 VAL A CG1 1 
ATOM 2480  C CG2 . VAL A 1 324 ? 42.228  61.387  -68.567  1.00 40.00 ? 328 VAL A CG2 1 
ATOM 2481  N N   . GLY A 1 325 ? 43.908  60.872  -72.760  1.00 40.00 ? 329 GLY A N   1 
ATOM 2482  C CA  . GLY A 1 325 ? 45.085  60.780  -73.633  1.00 40.00 ? 329 GLY A CA  1 
ATOM 2483  C C   . GLY A 1 325 ? 45.040  61.907  -74.637  1.00 40.00 ? 329 GLY A C   1 
ATOM 2484  O O   . GLY A 1 325 ? 44.246  62.836  -74.463  1.00 40.00 ? 329 GLY A O   1 
ATOM 2485  N N   . VAL A 1 326 ? 45.877  61.822  -75.658  1.00 40.00 ? 330 VAL A N   1 
ATOM 2486  C CA  . VAL A 1 326 ? 46.021  62.924  -76.620  1.00 40.00 ? 330 VAL A CA  1 
ATOM 2487  C C   . VAL A 1 326 ? 46.727  62.398  -77.862  1.00 40.00 ? 330 VAL A C   1 
ATOM 2488  O O   . VAL A 1 326 ? 47.336  61.315  -77.780  1.00 40.00 ? 330 VAL A O   1 
ATOM 2489  C CB  . VAL A 1 326 ? 46.991  63.895  -75.884  1.00 40.00 ? 330 VAL A CB  1 
ATOM 2490  C CG1 . VAL A 1 326 ? 48.039  64.495  -76.794  1.00 40.00 ? 330 VAL A CG1 1 
ATOM 2491  C CG2 . VAL A 1 326 ? 46.271  64.968  -75.100  1.00 40.00 ? 330 VAL A CG2 1 
ATOM 2492  N N   . VAL A 1 327 ? 46.698  63.099  -78.975  1.00 40.00 ? 331 VAL A N   1 
ATOM 2493  C CA  . VAL A 1 327 ? 47.388  62.596  -80.154  1.00 40.00 ? 331 VAL A CA  1 
ATOM 2494  C C   . VAL A 1 327 ? 48.664  63.369  -80.405  1.00 40.00 ? 331 VAL A C   1 
ATOM 2495  O O   . VAL A 1 327 ? 48.956  64.389  -79.763  1.00 40.00 ? 331 VAL A O   1 
ATOM 2496  C CB  . VAL A 1 327 ? 46.475  62.621  -81.387  1.00 40.00 ? 331 VAL A CB  1 
ATOM 2497  C CG1 . VAL A 1 327 ? 45.467  61.458  -81.291  1.00 40.00 ? 331 VAL A CG1 1 
ATOM 2498  C CG2 . VAL A 1 327 ? 45.713  63.923  -81.487  1.00 40.00 ? 331 VAL A CG2 1 
ATOM 2499  N N   . LYS A 1 328 ? 49.472  62.876  -81.348  1.00 40.00 ? 332 LYS A N   1 
ATOM 2500  C CA  . LYS A 1 328 ? 50.740  63.536  -81.628  1.00 40.00 ? 332 LYS A CA  1 
ATOM 2501  C C   . LYS A 1 328 ? 50.559  65.017  -81.937  1.00 40.00 ? 332 LYS A C   1 
ATOM 2502  O O   . LYS A 1 328 ? 51.166  65.846  -81.250  1.00 40.00 ? 332 LYS A O   1 
ATOM 2503  C CB  . LYS A 1 328 ? 51.543  62.804  -82.702  1.00 40.00 ? 332 LYS A CB  1 
ATOM 2504  C CG  . LYS A 1 328 ? 53.020  62.732  -82.380  1.00 40.00 ? 332 LYS A CG  1 
ATOM 2505  C CD  . LYS A 1 328 ? 53.987  62.478  -83.478  1.00 40.00 ? 332 LYS A CD  1 
ATOM 2506  C CE  . LYS A 1 328 ? 53.707  63.085  -84.828  1.00 40.00 ? 332 LYS A CE  1 
ATOM 2507  N NZ  . LYS A 1 328 ? 52.992  62.124  -85.734  1.00 40.00 ? 332 LYS A NZ  1 
ATOM 2508  N N   . ASP A 1 329 ? 49.760  65.385  -82.935  1.00 40.00 ? 333 ASP A N   1 
ATOM 2509  C CA  . ASP A 1 329 ? 49.603  66.789  -83.257  1.00 40.00 ? 333 ASP A CA  1 
ATOM 2510  C C   . ASP A 1 329 ? 48.205  67.374  -83.185  1.00 40.00 ? 333 ASP A C   1 
ATOM 2511  O O   . ASP A 1 329 ? 47.706  67.782  -84.235  1.00 40.00 ? 333 ASP A O   1 
ATOM 2512  C CB  . ASP A 1 329 ? 50.211  67.109  -84.635  1.00 40.00 ? 333 ASP A CB  1 
ATOM 2513  C CG  . ASP A 1 329 ? 51.378  66.227  -85.022  1.00 40.00 ? 333 ASP A CG  1 
ATOM 2514  O OD1 . ASP A 1 329 ? 51.166  64.994  -85.048  1.00 40.00 ? 333 ASP A OD1 1 
ATOM 2515  O OD2 . ASP A 1 329 ? 52.483  66.750  -85.297  1.00 40.00 ? 333 ASP A OD2 1 
ATOM 2516  N N   . GLU A 1 330 ? 47.586  67.528  -82.020  1.00 40.00 ? 334 GLU A N   1 
ATOM 2517  C CA  . GLU A 1 330 ? 46.270  68.126  -81.900  1.00 40.00 ? 334 GLU A CA  1 
ATOM 2518  C C   . GLU A 1 330 ? 46.083  69.362  -82.783  1.00 40.00 ? 334 GLU A C   1 
ATOM 2519  O O   . GLU A 1 330 ? 45.254  69.364  -83.710  1.00 40.00 ? 334 GLU A O   1 
ATOM 2520  C CB  . GLU A 1 330 ? 45.902  68.534  -80.475  1.00 40.00 ? 334 GLU A CB  1 
ATOM 2521  C CG  . GLU A 1 330 ? 46.101  67.478  -79.418  1.00 40.00 ? 334 GLU A CG  1 
ATOM 2522  C CD  . GLU A 1 330 ? 45.065  66.383  -79.420  1.00 40.00 ? 334 GLU A CD  1 
ATOM 2523  O OE1 . GLU A 1 330 ? 44.253  66.310  -80.371  1.00 40.00 ? 334 GLU A OE1 1 
ATOM 2524  O OE2 . GLU A 1 330 ? 45.029  65.563  -78.486  1.00 40.00 ? 334 GLU A OE2 1 
ATOM 2525  N N   . GLY A 1 331 ? 46.851  70.422  -82.566  1.00 40.00 ? 335 GLY A N   1 
ATOM 2526  C CA  . GLY A 1 331 ? 46.730  71.630  -83.290  1.00 40.00 ? 335 GLY A CA  1 
ATOM 2527  C C   . GLY A 1 331 ? 46.781  71.666  -84.773  1.00 40.00 ? 335 GLY A C   1 
ATOM 2528  O O   . GLY A 1 331 ? 46.246  72.648  -85.347  1.00 40.00 ? 335 GLY A O   1 
ATOM 2529  N N   . SER A 1 332 ? 47.397  70.744  -85.485  1.00 40.00 ? 336 SER A N   1 
ATOM 2530  C CA  . SER A 1 332 ? 47.533  70.825  -86.943  1.00 40.00 ? 336 SER A CA  1 
ATOM 2531  C C   . SER A 1 332 ? 46.268  71.114  -87.727  1.00 40.00 ? 336 SER A C   1 
ATOM 2532  O O   . SER A 1 332 ? 46.155  72.104  -88.455  1.00 40.00 ? 336 SER A O   1 
ATOM 2533  C CB  . SER A 1 332 ? 48.124  69.497  -87.460  1.00 40.00 ? 336 SER A CB  1 
ATOM 2534  O OG  . SER A 1 332 ? 47.546  68.461  -86.662  1.00 40.00 ? 336 SER A OG  1 
ATOM 2535  N N   . TYR A 1 333 ? 45.277  70.229  -87.612  1.00 40.00 ? 337 TYR A N   1 
ATOM 2536  C CA  . TYR A 1 333 ? 43.975  70.349  -88.294  1.00 40.00 ? 337 TYR A CA  1 
ATOM 2537  C C   . TYR A 1 333 ? 43.470  71.772  -88.226  1.00 40.00 ? 337 TYR A C   1 
ATOM 2538  O O   . TYR A 1 333 ? 43.273  72.405  -89.263  1.00 40.00 ? 337 TYR A O   1 
ATOM 2539  C CB  . TYR A 1 333 ? 43.001  69.392  -87.639  1.00 40.00 ? 337 TYR A CB  1 
ATOM 2540  C CG  . TYR A 1 333 ? 41.576  69.282  -88.046  1.00 40.00 ? 337 TYR A CG  1 
ATOM 2541  C CD1 . TYR A 1 333 ? 41.222  68.446  -89.099  1.00 40.00 ? 337 TYR A CD1 1 
ATOM 2542  C CD2 . TYR A 1 333 ? 40.552  69.954  -87.388  1.00 40.00 ? 337 TYR A CD2 1 
ATOM 2543  C CE1 . TYR A 1 333 ? 39.903  68.301  -89.514  1.00 40.00 ? 337 TYR A CE1 1 
ATOM 2544  C CE2 . TYR A 1 333 ? 39.235  69.816  -87.787  1.00 40.00 ? 337 TYR A CE2 1 
ATOM 2545  C CZ  . TYR A 1 333 ? 38.909  68.991  -88.852  1.00 40.00 ? 337 TYR A CZ  1 
ATOM 2546  O OH  . TYR A 1 333 ? 37.586  68.865  -89.234  1.00 40.00 ? 337 TYR A OH  1 
ATOM 2547  N N   . PHE A 1 334 ? 43.327  72.354  -87.030  1.00 40.00 ? 338 PHE A N   1 
ATOM 2548  C CA  . PHE A 1 334 ? 42.800  73.692  -86.896  1.00 40.00 ? 338 PHE A CA  1 
ATOM 2549  C C   . PHE A 1 334 ? 43.539  74.779  -87.613  1.00 40.00 ? 338 PHE A C   1 
ATOM 2550  O O   . PHE A 1 334 ? 42.996  75.886  -87.687  1.00 40.00 ? 338 PHE A O   1 
ATOM 2551  C CB  . PHE A 1 334 ? 42.796  74.125  -85.399  1.00 40.00 ? 338 PHE A CB  1 
ATOM 2552  C CG  . PHE A 1 334 ? 41.999  73.116  -84.624  1.00 40.00 ? 338 PHE A CG  1 
ATOM 2553  C CD1 . PHE A 1 334 ? 42.578  71.910  -84.285  1.00 40.00 ? 338 PHE A CD1 1 
ATOM 2554  C CD2 . PHE A 1 334 ? 40.689  73.349  -84.278  1.00 40.00 ? 338 PHE A CD2 1 
ATOM 2555  C CE1 . PHE A 1 334 ? 41.881  70.942  -83.588  1.00 40.00 ? 338 PHE A CE1 1 
ATOM 2556  C CE2 . PHE A 1 334 ? 39.977  72.383  -83.582  1.00 40.00 ? 338 PHE A CE2 1 
ATOM 2557  C CZ  . PHE A 1 334 ? 40.577  71.179  -83.247  1.00 40.00 ? 338 PHE A CZ  1 
ATOM 2558  N N   . LEU A 1 335 ? 44.770  74.553  -88.048  1.00 40.00 ? 339 LEU A N   1 
ATOM 2559  C CA  . LEU A 1 335 ? 45.492  75.677  -88.643  1.00 40.00 ? 339 LEU A CA  1 
ATOM 2560  C C   . LEU A 1 335 ? 44.961  76.045  -90.007  1.00 40.00 ? 339 LEU A C   1 
ATOM 2561  O O   . LEU A 1 335 ? 44.886  77.225  -90.358  1.00 40.00 ? 339 LEU A O   1 
ATOM 2562  C CB  . LEU A 1 335 ? 46.983  75.437  -88.615  1.00 40.00 ? 339 LEU A CB  1 
ATOM 2563  C CG  . LEU A 1 335 ? 47.610  75.207  -87.231  1.00 40.00 ? 339 LEU A CG  1 
ATOM 2564  C CD1 . LEU A 1 335 ? 49.094  74.921  -87.398  1.00 40.00 ? 339 LEU A CD1 1 
ATOM 2565  C CD2 . LEU A 1 335 ? 47.417  76.439  -86.363  1.00 40.00 ? 339 LEU A CD2 1 
ATOM 2566  N N   . VAL A 1 336 ? 44.520  75.061  -90.784  1.00 40.00 ? 340 VAL A N   1 
ATOM 2567  C CA  . VAL A 1 336 ? 44.005  75.251  -92.123  1.00 40.00 ? 340 VAL A CA  1 
ATOM 2568  C C   . VAL A 1 336 ? 42.770  76.143  -92.123  1.00 40.00 ? 340 VAL A C   1 
ATOM 2569  O O   . VAL A 1 336 ? 42.463  76.889  -93.058  1.00 40.00 ? 340 VAL A O   1 
ATOM 2570  C CB  . VAL A 1 336 ? 43.583  73.924  -92.784  1.00 40.00 ? 340 VAL A CB  1 
ATOM 2571  C CG1 . VAL A 1 336 ? 44.773  72.999  -92.931  1.00 40.00 ? 340 VAL A CG1 1 
ATOM 2572  C CG2 . VAL A 1 336 ? 42.471  73.246  -92.027  1.00 40.00 ? 340 VAL A CG2 1 
ATOM 2573  N N   . TYR A 1 337 ? 42.015  76.067  -91.035  1.00 40.00 ? 341 TYR A N   1 
ATOM 2574  C CA  . TYR A 1 337 ? 40.795  76.828  -90.878  1.00 40.00 ? 341 TYR A CA  1 
ATOM 2575  C C   . TYR A 1 337 ? 41.010  78.258  -90.453  1.00 40.00 ? 341 TYR A C   1 
ATOM 2576  O O   . TYR A 1 337 ? 40.235  78.758  -89.604  1.00 40.00 ? 341 TYR A O   1 
ATOM 2577  C CB  . TYR A 1 337 ? 39.891  76.110  -89.844  1.00 40.00 ? 341 TYR A CB  1 
ATOM 2578  C CG  . TYR A 1 337 ? 39.238  74.864  -90.384  1.00 40.00 ? 341 TYR A CG  1 
ATOM 2579  C CD1 . TYR A 1 337 ? 39.895  73.656  -90.484  1.00 40.00 ? 341 TYR A CD1 1 
ATOM 2580  C CD2 . TYR A 1 337 ? 37.922  74.896  -90.812  1.00 40.00 ? 341 TYR A CD2 1 
ATOM 2581  C CE1 . TYR A 1 337 ? 39.295  72.528  -91.002  1.00 40.00 ? 341 TYR A CE1 1 
ATOM 2582  C CE2 . TYR A 1 337 ? 37.294  73.786  -91.322  1.00 40.00 ? 341 TYR A CE2 1 
ATOM 2583  C CZ  . TYR A 1 337 ? 37.982  72.599  -91.416  1.00 40.00 ? 341 TYR A CZ  1 
ATOM 2584  O OH  . TYR A 1 337 ? 37.320  71.501  -91.919  1.00 40.00 ? 341 TYR A OH  1 
ATOM 2585  N N   . GLY A 1 338 ? 41.972  79.033  -90.934  1.00 40.00 ? 342 GLY A N   1 
ATOM 2586  C CA  . GLY A 1 338 ? 42.057  80.408  -90.458  1.00 40.00 ? 342 GLY A CA  1 
ATOM 2587  C C   . GLY A 1 338 ? 43.411  80.977  -90.128  1.00 40.00 ? 342 GLY A C   1 
ATOM 2588  O O   . GLY A 1 338 ? 43.478  82.151  -89.697  1.00 40.00 ? 342 GLY A O   1 
ATOM 2589  N N   . VAL A 1 339 ? 44.518  80.248  -90.281  1.00 40.00 ? 343 VAL A N   1 
ATOM 2590  C CA  . VAL A 1 339 ? 45.812  80.853  -89.965  1.00 40.00 ? 343 VAL A CA  1 
ATOM 2591  C C   . VAL A 1 339 ? 46.569  81.068  -91.272  1.00 40.00 ? 343 VAL A C   1 
ATOM 2592  O O   . VAL A 1 339 ? 47.042  80.135  -91.922  1.00 40.00 ? 343 VAL A O   1 
ATOM 2593  C CB  . VAL A 1 339 ? 46.622  80.054  -88.957  1.00 40.00 ? 343 VAL A CB  1 
ATOM 2594  C CG1 . VAL A 1 339 ? 47.958  80.739  -88.692  1.00 40.00 ? 343 VAL A CG1 1 
ATOM 2595  C CG2 . VAL A 1 339 ? 45.868  79.921  -87.637  1.00 40.00 ? 343 VAL A CG2 1 
ATOM 2596  N N   . PRO A 1 340 ? 46.654  82.339  -91.673  1.00 40.00 ? 344 PRO A N   1 
ATOM 2597  C CA  . PRO A 1 340 ? 47.284  82.704  -92.929  1.00 40.00 ? 344 PRO A CA  1 
ATOM 2598  C C   . PRO A 1 340 ? 48.627  82.017  -93.075  1.00 40.00 ? 344 PRO A C   1 
ATOM 2599  O O   . PRO A 1 340 ? 49.423  82.029  -92.148  1.00 40.00 ? 344 PRO A O   1 
ATOM 2600  C CB  . PRO A 1 340 ? 47.310  84.191  -92.943  1.00 40.00 ? 344 PRO A CB  1 
ATOM 2601  C CG  . PRO A 1 340 ? 46.528  84.665  -91.787  1.00 40.00 ? 344 PRO A CG  1 
ATOM 2602  C CD  . PRO A 1 340 ? 46.112  83.501  -90.958  1.00 40.00 ? 344 PRO A CD  1 
ATOM 2603  N N   . GLY A 1 341 ? 48.833  81.384  -94.223  1.00 40.00 ? 345 GLY A N   1 
ATOM 2604  C CA  . GLY A 1 341 ? 50.036  80.645  -94.539  1.00 40.00 ? 345 GLY A CA  1 
ATOM 2605  C C   . GLY A 1 341 ? 49.758  79.149  -94.511  1.00 40.00 ? 345 GLY A C   1 
ATOM 2606  O O   . GLY A 1 341 ? 50.513  78.362  -95.103  1.00 40.00 ? 345 GLY A O   1 
ATOM 2607  N N   . PHE A 1 342 ? 48.701  78.716  -93.820  1.00 40.00 ? 346 PHE A N   1 
ATOM 2608  C CA  . PHE A 1 342 ? 48.514  77.263  -93.798  1.00 40.00 ? 346 PHE A CA  1 
ATOM 2609  C C   . PHE A 1 342 ? 47.493  76.778  -94.807  1.00 40.00 ? 346 PHE A C   1 
ATOM 2610  O O   . PHE A 1 342 ? 46.473  77.422  -95.062  1.00 40.00 ? 346 PHE A O   1 
ATOM 2611  C CB  . PHE A 1 342 ? 48.143  76.841  -92.377  1.00 40.00 ? 346 PHE A CB  1 
ATOM 2612  C CG  . PHE A 1 342 ? 49.211  77.156  -91.365  1.00 40.00 ? 346 PHE A CG  1 
ATOM 2613  C CD1 . PHE A 1 342 ? 50.086  76.166  -90.964  1.00 40.00 ? 346 PHE A CD1 1 
ATOM 2614  C CD2 . PHE A 1 342 ? 49.335  78.420  -90.806  1.00 40.00 ? 346 PHE A CD2 1 
ATOM 2615  C CE1 . PHE A 1 342 ? 51.064  76.441  -90.028  1.00 40.00 ? 346 PHE A CE1 1 
ATOM 2616  C CE2 . PHE A 1 342 ? 50.317  78.699  -89.871  1.00 40.00 ? 346 PHE A CE2 1 
ATOM 2617  C CZ  . PHE A 1 342 ? 51.183  77.708  -89.490  1.00 40.00 ? 346 PHE A CZ  1 
ATOM 2618  N N   . SER A 1 343 ? 47.771  75.602  -95.360  1.00 40.00 ? 347 SER A N   1 
ATOM 2619  C CA  . SER A 1 343 ? 46.863  74.948  -96.281  1.00 40.00 ? 347 SER A CA  1 
ATOM 2620  C C   . SER A 1 343 ? 47.137  73.442  -96.258  1.00 40.00 ? 347 SER A C   1 
ATOM 2621  O O   . SER A 1 343 ? 48.255  73.012  -95.964  1.00 40.00 ? 347 SER A O   1 
ATOM 2622  C CB  . SER A 1 343 ? 47.058  75.453  -97.715  1.00 40.00 ? 347 SER A CB  1 
ATOM 2623  O OG  . SER A 1 343 ? 47.241  74.294  -98.547  1.00 40.00 ? 347 SER A OG  1 
ATOM 2624  N N   . LYS A 1 344 ? 46.161  72.647  -96.669  1.00 40.00 ? 348 LYS A N   1 
ATOM 2625  C CA  . LYS A 1 344 ? 46.406  71.198  -96.717  1.00 40.00 ? 348 LYS A CA  1 
ATOM 2626  C C   . LYS A 1 344 ? 47.134  70.887  -98.028  1.00 40.00 ? 348 LYS A C   1 
ATOM 2627  O O   . LYS A 1 344 ? 47.666  69.795  -98.238  1.00 40.00 ? 348 LYS A O   1 
ATOM 2628  C CB  . LYS A 1 344 ? 45.065  70.459  -96.653  1.00 40.00 ? 348 LYS A CB  1 
ATOM 2629  C CG  . LYS A 1 344 ? 44.286  70.346  -97.963  1.00 40.00 ? 348 LYS A CG  1 
ATOM 2630  C CD  . LYS A 1 344 ? 43.087  69.418  -97.750  1.00 40.00 ? 348 LYS A CD  1 
ATOM 2631  C CE  . LYS A 1 344 ? 42.666  68.703  -99.020  1.00 40.00 ? 348 LYS A CE  1 
ATOM 2632  N NZ  . LYS A 1 344 ? 43.450  67.450  -99.210  1.00 40.00 ? 348 LYS A NZ  1 
ATOM 2633  N N   . ASP A 1 345 ? 47.128  71.867  -98.927  1.00 40.00 ? 349 ASP A N   1 
ATOM 2634  C CA  . ASP A 1 345 ? 47.694  71.661  -100.240 1.00 40.00 ? 349 ASP A CA  1 
ATOM 2635  C C   . ASP A 1 345 ? 49.152  71.923  -100.430 1.00 40.00 ? 349 ASP A C   1 
ATOM 2636  O O   . ASP A 1 345 ? 49.704  71.373  -101.414 1.00 40.00 ? 349 ASP A O   1 
ATOM 2637  C CB  . ASP A 1 345 ? 46.785  72.326  -101.286 1.00 40.00 ? 349 ASP A CB  1 
ATOM 2638  C CG  . ASP A 1 345 ? 45.413  71.634  -101.292 1.00 40.00 ? 349 ASP A CG  1 
ATOM 2639  O OD1 . ASP A 1 345 ? 45.319  70.393  -101.145 1.00 40.00 ? 349 ASP A OD1 1 
ATOM 2640  O OD2 . ASP A 1 345 ? 44.410  72.373  -101.433 1.00 40.00 ? 349 ASP A OD2 1 
ATOM 2641  N N   . ASN A 1 346 ? 49.814  72.663  -99.545  1.00 40.00 ? 350 ASN A N   1 
ATOM 2642  C CA  . ASN A 1 346 ? 51.266  72.866  -99.622  1.00 40.00 ? 350 ASN A CA  1 
ATOM 2643  C C   . ASN A 1 346 ? 51.843  72.512  -98.251  1.00 40.00 ? 350 ASN A C   1 
ATOM 2644  O O   . ASN A 1 346 ? 51.092  72.199  -97.317  1.00 40.00 ? 350 ASN A O   1 
ATOM 2645  C CB  . ASN A 1 346 ? 51.651  74.268  -100.007 1.00 40.00 ? 350 ASN A CB  1 
ATOM 2646  C CG  . ASN A 1 346 ? 50.929  75.290  -99.138  1.00 40.00 ? 350 ASN A CG  1 
ATOM 2647  O OD1 . ASN A 1 346 ? 50.449  74.929  -98.062  1.00 40.00 ? 350 ASN A OD1 1 
ATOM 2648  N ND2 . ASN A 1 346 ? 50.895  76.494  -99.658  1.00 40.00 ? 350 ASN A ND2 1 
ATOM 2649  N N   . GLU A 1 347 ? 53.145  72.619  -98.083  1.00 40.00 ? 351 GLU A N   1 
ATOM 2650  C CA  . GLU A 1 347 ? 53.841  72.279  -96.850  1.00 40.00 ? 351 GLU A CA  1 
ATOM 2651  C C   . GLU A 1 347 ? 53.692  73.328  -95.769  1.00 40.00 ? 351 GLU A C   1 
ATOM 2652  O O   . GLU A 1 347 ? 54.188  73.187  -94.638  1.00 40.00 ? 351 GLU A O   1 
ATOM 2653  C CB  . GLU A 1 347 ? 55.323  72.069  -97.179  1.00 40.00 ? 351 GLU A CB  1 
ATOM 2654  C CG  . GLU A 1 347 ? 55.608  70.792  -97.956  1.00 40.00 ? 351 GLU A CG  1 
ATOM 2655  C CD  . GLU A 1 347 ? 57.017  70.286  -97.637  1.00 40.00 ? 351 GLU A CD  1 
ATOM 2656  O OE1 . GLU A 1 347 ? 57.168  69.452  -96.702  1.00 40.00 ? 351 GLU A OE1 1 
ATOM 2657  O OE2 . GLU A 1 347 ? 57.949  70.751  -98.329  1.00 40.00 ? 351 GLU A OE2 1 
ATOM 2658  N N   . SER A 1 348 ? 53.001  74.415  -96.115  1.00 40.00 ? 352 SER A N   1 
ATOM 2659  C CA  . SER A 1 348 ? 52.739  75.486  -95.172  1.00 40.00 ? 352 SER A CA  1 
ATOM 2660  C C   . SER A 1 348 ? 53.996  75.880  -94.402  1.00 40.00 ? 352 SER A C   1 
ATOM 2661  O O   . SER A 1 348 ? 54.024  75.933  -93.166  1.00 40.00 ? 352 SER A O   1 
ATOM 2662  C CB  . SER A 1 348 ? 51.592  75.123  -94.230  1.00 40.00 ? 352 SER A CB  1 
ATOM 2663  O OG  . SER A 1 348 ? 50.774  74.071  -94.688  1.00 40.00 ? 352 SER A OG  1 
ATOM 2664  N N   . LEU A 1 349 ? 55.075  76.147  -95.146  1.00 40.00 ? 353 LEU A N   1 
ATOM 2665  C CA  . LEU A 1 349 ? 56.307  76.617  -94.509  1.00 40.00 ? 353 LEU A CA  1 
ATOM 2666  C C   . LEU A 1 349 ? 56.098  78.129  -94.331  1.00 40.00 ? 353 LEU A C   1 
ATOM 2667  O O   . LEU A 1 349 ? 56.388  78.921  -95.224  1.00 40.00 ? 353 LEU A O   1 
ATOM 2668  C CB  . LEU A 1 349 ? 57.537  76.317  -95.312  1.00 40.00 ? 353 LEU A CB  1 
ATOM 2669  C CG  . LEU A 1 349 ? 58.227  74.967  -95.257  1.00 40.00 ? 353 LEU A CG  1 
ATOM 2670  C CD1 . LEU A 1 349 ? 57.659  73.996  -94.231  1.00 40.00 ? 353 LEU A CD1 1 
ATOM 2671  C CD2 . LEU A 1 349 ? 58.228  74.311  -96.646  1.00 40.00 ? 353 LEU A CD2 1 
ATOM 2672  N N   . ILE A 1 350 ? 55.556  78.521  -93.200  1.00 40.00 ? 354 ILE A N   1 
ATOM 2673  C CA  . ILE A 1 350 ? 55.263  79.916  -92.920  1.00 40.00 ? 354 ILE A CA  1 
ATOM 2674  C C   . ILE A 1 350 ? 56.451  80.798  -92.569  1.00 40.00 ? 354 ILE A C   1 
ATOM 2675  O O   . ILE A 1 350 ? 57.539  80.394  -92.169  1.00 40.00 ? 354 ILE A O   1 
ATOM 2676  C CB  . ILE A 1 350 ? 54.228  79.958  -91.766  1.00 40.00 ? 354 ILE A CB  1 
ATOM 2677  C CG1 . ILE A 1 350 ? 54.919  79.544  -90.459  1.00 40.00 ? 354 ILE A CG1 1 
ATOM 2678  C CG2 . ILE A 1 350 ? 53.110  78.957  -92.068  1.00 40.00 ? 354 ILE A CG2 1 
ATOM 2679  C CD1 . ILE A 1 350 ? 54.330  80.160  -89.210  1.00 40.00 ? 354 ILE A CD1 1 
ATOM 2680  N N   . SER A 1 351 ? 56.241  82.093  -92.725  1.00 40.00 ? 355 SER A N   1 
ATOM 2681  C CA  . SER A 1 351 ? 57.139  83.179  -92.427  1.00 40.00 ? 355 SER A CA  1 
ATOM 2682  C C   . SER A 1 351 ? 57.124  83.437  -90.921  1.00 40.00 ? 355 SER A C   1 
ATOM 2683  O O   . SER A 1 351 ? 56.208  82.923  -90.281  1.00 40.00 ? 355 SER A O   1 
ATOM 2684  C CB  . SER A 1 351 ? 56.573  84.489  -93.034  1.00 40.00 ? 355 SER A CB  1 
ATOM 2685  O OG  . SER A 1 351 ? 56.133  85.366  -91.991  1.00 40.00 ? 355 SER A OG  1 
ATOM 2686  N N   . ARG A 1 352 ? 58.021  84.276  -90.412  1.00 40.00 ? 356 ARG A N   1 
ATOM 2687  C CA  . ARG A 1 352 ? 57.956  84.561  -88.981  1.00 40.00 ? 356 ARG A CA  1 
ATOM 2688  C C   . ARG A 1 352 ? 56.729  85.407  -88.671  1.00 40.00 ? 356 ARG A C   1 
ATOM 2689  O O   . ARG A 1 352 ? 55.878  85.078  -87.837  1.00 40.00 ? 356 ARG A O   1 
ATOM 2690  C CB  . ARG A 1 352 ? 59.194  85.261  -88.450  1.00 40.00 ? 356 ARG A CB  1 
ATOM 2691  C CG  . ARG A 1 352 ? 59.559  84.743  -87.044  1.00 40.00 ? 356 ARG A CG  1 
ATOM 2692  C CD  . ARG A 1 352 ? 60.486  85.706  -86.339  1.00 40.00 ? 356 ARG A CD  1 
ATOM 2693  N NE  . ARG A 1 352 ? 60.187  85.902  -84.928  1.00 40.00 ? 356 ARG A NE  1 
ATOM 2694  C CZ  . ARG A 1 352 ? 60.278  84.909  -84.036  1.00 40.00 ? 356 ARG A CZ  1 
ATOM 2695  N NH1 . ARG A 1 352 ? 60.641  83.702  -84.447  1.00 40.00 ? 356 ARG A NH1 1 
ATOM 2696  N NH2 . ARG A 1 352 ? 59.993  85.146  -82.762  1.00 40.00 ? 356 ARG A NH2 1 
ATOM 2697  N N   . ALA A 1 353 ? 56.586  86.511  -89.392  1.00 40.00 ? 357 ALA A N   1 
ATOM 2698  C CA  . ALA A 1 353 ? 55.448  87.412  -89.215  1.00 40.00 ? 357 ALA A CA  1 
ATOM 2699  C C   . ALA A 1 353 ? 54.124  86.654  -89.239  1.00 40.00 ? 357 ALA A C   1 
ATOM 2700  O O   . ALA A 1 353 ? 53.182  86.964  -88.497  1.00 40.00 ? 357 ALA A O   1 
ATOM 2701  C CB  . ALA A 1 353 ? 55.441  88.499  -90.264  1.00 40.00 ? 357 ALA A CB  1 
ATOM 2702  N N   . GLN A 1 354 ? 54.037  85.654  -90.113  1.00 40.00 ? 358 GLN A N   1 
ATOM 2703  C CA  . GLN A 1 354 ? 52.832  84.830  -90.160  1.00 40.00 ? 358 GLN A CA  1 
ATOM 2704  C C   . GLN A 1 354 ? 52.697  84.172  -88.781  1.00 40.00 ? 358 GLN A C   1 
ATOM 2705  O O   . GLN A 1 354 ? 51.712  84.330  -88.054  1.00 40.00 ? 358 GLN A O   1 
ATOM 2706  C CB  . GLN A 1 354 ? 52.917  83.781  -91.270  1.00 40.00 ? 358 GLN A CB  1 
ATOM 2707  C CG  . GLN A 1 354 ? 52.781  84.385  -92.656  1.00 40.00 ? 358 GLN A CG  1 
ATOM 2708  C CD  . GLN A 1 354 ? 52.892  83.405  -93.798  1.00 40.00 ? 358 GLN A CD  1 
ATOM 2709  O OE1 . GLN A 1 354 ? 53.664  82.441  -93.834  1.00 40.00 ? 358 GLN A OE1 1 
ATOM 2710  N NE2 . GLN A 1 354 ? 52.066  83.659  -94.824  1.00 40.00 ? 358 GLN A NE2 1 
ATOM 2711  N N   . PHE A 1 355 ? 53.756  83.462  -88.380  1.00 40.00 ? 359 PHE A N   1 
ATOM 2712  C CA  . PHE A 1 355 ? 53.757  82.841  -87.054  1.00 40.00 ? 359 PHE A CA  1 
ATOM 2713  C C   . PHE A 1 355 ? 53.406  83.845  -85.954  1.00 40.00 ? 359 PHE A C   1 
ATOM 2714  O O   . PHE A 1 355 ? 52.633  83.528  -85.037  1.00 40.00 ? 359 PHE A O   1 
ATOM 2715  C CB  . PHE A 1 355 ? 55.108  82.187  -86.772  1.00 40.00 ? 359 PHE A CB  1 
ATOM 2716  C CG  . PHE A 1 355 ? 55.262  81.733  -85.344  1.00 40.00 ? 359 PHE A CG  1 
ATOM 2717  C CD1 . PHE A 1 355 ? 55.697  82.619  -84.370  1.00 40.00 ? 359 PHE A CD1 1 
ATOM 2718  C CD2 . PHE A 1 355 ? 54.969  80.435  -84.986  1.00 40.00 ? 359 PHE A CD2 1 
ATOM 2719  C CE1 . PHE A 1 355 ? 55.842  82.226  -83.049  1.00 40.00 ? 359 PHE A CE1 1 
ATOM 2720  C CE2 . PHE A 1 355 ? 55.104  80.046  -83.672  1.00 40.00 ? 359 PHE A CE2 1 
ATOM 2721  C CZ  . PHE A 1 355 ? 55.537  80.934  -82.702  1.00 40.00 ? 359 PHE A CZ  1 
ATOM 2722  N N   . LEU A 1 356 ? 53.964  85.072  -85.996  1.00 40.00 ? 360 LEU A N   1 
ATOM 2723  C CA  . LEU A 1 356 ? 53.592  86.040  -84.969  1.00 40.00 ? 360 LEU A CA  1 
ATOM 2724  C C   . LEU A 1 356 ? 52.082  86.280  -84.961  1.00 40.00 ? 360 LEU A C   1 
ATOM 2725  O O   . LEU A 1 356 ? 51.487  86.456  -83.898  1.00 40.00 ? 360 LEU A O   1 
ATOM 2726  C CB  . LEU A 1 356 ? 54.270  87.379  -85.159  1.00 40.00 ? 360 LEU A CB  1 
ATOM 2727  C CG  . LEU A 1 356 ? 55.686  87.594  -84.642  1.00 40.00 ? 360 LEU A CG  1 
ATOM 2728  C CD1 . LEU A 1 356 ? 56.073  86.568  -83.579  1.00 40.00 ? 360 LEU A CD1 1 
ATOM 2729  C CD2 . LEU A 1 356 ? 56.672  87.506  -85.810  1.00 40.00 ? 360 LEU A CD2 1 
ATOM 2730  N N   . ALA A 1 357 ? 51.480  86.334  -86.144  1.00 40.00 ? 361 ALA A N   1 
ATOM 2731  C CA  . ALA A 1 357 ? 50.036  86.584  -86.240  1.00 40.00 ? 361 ALA A CA  1 
ATOM 2732  C C   . ALA A 1 357 ? 49.234  85.367  -85.781  1.00 40.00 ? 361 ALA A C   1 
ATOM 2733  O O   . ALA A 1 357 ? 48.221  85.450  -85.098  1.00 40.00 ? 361 ALA A O   1 
ATOM 2734  C CB  . ALA A 1 357 ? 49.700  86.877  -87.676  1.00 40.00 ? 361 ALA A CB  1 
ATOM 2735  N N   . GLY A 1 358 ? 49.776  84.206  -86.184  1.00 40.00 ? 362 GLY A N   1 
ATOM 2736  C CA  . GLY A 1 358 ? 49.125  82.945  -85.840  1.00 40.00 ? 362 GLY A CA  1 
ATOM 2737  C C   . GLY A 1 358 ? 48.880  82.977  -84.339  1.00 40.00 ? 362 GLY A C   1 
ATOM 2738  O O   . GLY A 1 358 ? 47.779  82.814  -83.821  1.00 40.00 ? 362 GLY A O   1 
ATOM 2739  N N   . VAL A 1 359 ? 49.965  83.253  -83.614  1.00 40.00 ? 363 VAL A N   1 
ATOM 2740  C CA  . VAL A 1 359 ? 49.883  83.288  -82.159  1.00 40.00 ? 363 VAL A CA  1 
ATOM 2741  C C   . VAL A 1 359 ? 48.708  84.114  -81.693  1.00 40.00 ? 363 VAL A C   1 
ATOM 2742  O O   . VAL A 1 359 ? 48.024  83.713  -80.722  1.00 40.00 ? 363 VAL A O   1 
ATOM 2743  C CB  . VAL A 1 359 ? 51.199  83.703  -81.502  1.00 40.00 ? 363 VAL A CB  1 
ATOM 2744  C CG1 . VAL A 1 359 ? 50.995  84.011  -80.028  1.00 40.00 ? 363 VAL A CG1 1 
ATOM 2745  C CG2 . VAL A 1 359 ? 52.233  82.578  -81.652  1.00 40.00 ? 363 VAL A CG2 1 
ATOM 2746  N N   . ARG A 1 360 ? 48.382  85.233  -82.335  1.00 40.00 ? 364 ARG A N   1 
ATOM 2747  C CA  . ARG A 1 360 ? 47.225  86.000  -81.841  1.00 40.00 ? 364 ARG A CA  1 
ATOM 2748  C C   . ARG A 1 360 ? 45.904  85.376  -82.224  1.00 40.00 ? 364 ARG A C   1 
ATOM 2749  O O   . ARG A 1 360 ? 44.882  85.539  -81.518  1.00 40.00 ? 364 ARG A O   1 
ATOM 2750  C CB  . ARG A 1 360 ? 47.376  87.451  -82.247  1.00 40.00 ? 364 ARG A CB  1 
ATOM 2751  C CG  . ARG A 1 360 ? 48.836  87.888  -82.301  1.00 40.00 ? 364 ARG A CG  1 
ATOM 2752  C CD  . ARG A 1 360 ? 49.391  88.189  -80.945  1.00 40.00 ? 364 ARG A CD  1 
ATOM 2753  N NE  . ARG A 1 360 ? 48.442  88.615  -79.914  1.00 40.00 ? 364 ARG A NE  1 
ATOM 2754  C CZ  . ARG A 1 360 ? 48.464  89.863  -79.416  1.00 40.00 ? 364 ARG A CZ  1 
ATOM 2755  N NH1 . ARG A 1 360 ? 49.353  90.729  -79.897  1.00 40.00 ? 364 ARG A NH1 1 
ATOM 2756  N NH2 . ARG A 1 360 ? 47.608  90.220  -78.473  1.00 40.00 ? 364 ARG A NH2 1 
ATOM 2757  N N   . ILE A 1 361 ? 45.843  84.623  -83.310  1.00 40.00 ? 365 ILE A N   1 
ATOM 2758  C CA  . ILE A 1 361 ? 44.566  83.983  -83.682  1.00 40.00 ? 365 ILE A CA  1 
ATOM 2759  C C   . ILE A 1 361 ? 44.348  82.777  -82.765  1.00 40.00 ? 365 ILE A C   1 
ATOM 2760  O O   . ILE A 1 361 ? 43.299  82.556  -82.171  1.00 40.00 ? 365 ILE A O   1 
ATOM 2761  C CB  . ILE A 1 361 ? 44.691  83.488  -85.120  1.00 40.00 ? 365 ILE A CB  1 
ATOM 2762  C CG1 . ILE A 1 361 ? 44.472  84.646  -86.109  1.00 40.00 ? 365 ILE A CG1 1 
ATOM 2763  C CG2 . ILE A 1 361 ? 43.750  82.341  -85.436  1.00 40.00 ? 365 ILE A CG2 1 
ATOM 2764  C CD1 . ILE A 1 361 ? 44.889  84.214  -87.493  1.00 40.00 ? 365 ILE A CD1 1 
ATOM 2765  N N   . GLY A 1 362 ? 45.422  81.992  -82.681  1.00 40.00 ? 366 GLY A N   1 
ATOM 2766  C CA  . GLY A 1 362 ? 45.464  80.795  -81.864  1.00 40.00 ? 366 GLY A CA  1 
ATOM 2767  C C   . GLY A 1 362 ? 45.323  81.042  -80.379  1.00 40.00 ? 366 GLY A C   1 
ATOM 2768  O O   . GLY A 1 362 ? 44.882  80.120  -79.692  1.00 40.00 ? 366 GLY A O   1 
ATOM 2769  N N   . VAL A 1 363 ? 45.588  82.223  -79.837  1.00 40.00 ? 367 VAL A N   1 
ATOM 2770  C CA  . VAL A 1 363 ? 45.476  82.535  -78.411  1.00 40.00 ? 367 VAL A CA  1 
ATOM 2771  C C   . VAL A 1 363 ? 44.816  83.901  -78.332  1.00 40.00 ? 367 VAL A C   1 
ATOM 2772  O O   . VAL A 1 363 ? 45.355  84.941  -77.916  1.00 40.00 ? 367 VAL A O   1 
ATOM 2773  C CB  . VAL A 1 363 ? 46.900  82.682  -77.821  1.00 40.00 ? 367 VAL A CB  1 
ATOM 2774  C CG1 . VAL A 1 363 ? 46.824  82.680  -76.302  1.00 40.00 ? 367 VAL A CG1 1 
ATOM 2775  C CG2 . VAL A 1 363 ? 47.855  81.630  -78.345  1.00 40.00 ? 367 VAL A CG2 1 
ATOM 2776  N N   . PRO A 1 364 ? 43.574  83.924  -78.813  1.00 40.00 ? 368 PRO A N   1 
ATOM 2777  C CA  . PRO A 1 364 ? 42.796  85.149  -78.933  1.00 40.00 ? 368 PRO A CA  1 
ATOM 2778  C C   . PRO A 1 364 ? 42.602  85.904  -77.653  1.00 40.00 ? 368 PRO A C   1 
ATOM 2779  O O   . PRO A 1 364 ? 42.343  87.116  -77.672  1.00 40.00 ? 368 PRO A O   1 
ATOM 2780  C CB  . PRO A 1 364 ? 41.419  84.669  -79.408  1.00 40.00 ? 368 PRO A CB  1 
ATOM 2781  C CG  . PRO A 1 364 ? 41.377  83.256  -78.938  1.00 40.00 ? 368 PRO A CG  1 
ATOM 2782  C CD  . PRO A 1 364 ? 42.779  82.786  -79.319  1.00 40.00 ? 368 PRO A CD  1 
ATOM 2783  N N   . GLN A 1 365 ? 42.646  85.209  -76.531  1.00 40.00 ? 369 GLN A N   1 
ATOM 2784  C CA  . GLN A 1 365 ? 42.406  85.887  -75.261  1.00 40.00 ? 369 GLN A CA  1 
ATOM 2785  C C   . GLN A 1 365 ? 43.683  86.546  -74.761  1.00 40.00 ? 369 GLN A C   1 
ATOM 2786  O O   . GLN A 1 365 ? 43.642  87.272  -73.760  1.00 40.00 ? 369 GLN A O   1 
ATOM 2787  C CB  . GLN A 1 365 ? 41.948  84.882  -74.195  1.00 40.00 ? 369 GLN A CB  1 
ATOM 2788  C CG  . GLN A 1 365 ? 43.082  83.961  -73.757  1.00 40.00 ? 369 GLN A CG  1 
ATOM 2789  C CD  . GLN A 1 365 ? 43.225  82.724  -74.602  1.00 40.00 ? 369 GLN A CD  1 
ATOM 2790  O OE1 . GLN A 1 365 ? 43.289  82.769  -75.828  1.00 40.00 ? 369 GLN A OE1 1 
ATOM 2791  N NE2 . GLN A 1 365 ? 43.278  81.557  -73.942  1.00 40.00 ? 369 GLN A NE2 1 
ATOM 2792  N N   . ALA A 1 366 ? 44.801  86.240  -75.434  1.00 40.00 ? 370 ALA A N   1 
ATOM 2793  C CA  . ALA A 1 366 ? 46.041  86.775  -74.942  1.00 40.00 ? 370 ALA A CA  1 
ATOM 2794  C C   . ALA A 1 366 ? 46.238  88.248  -75.162  1.00 40.00 ? 370 ALA A C   1 
ATOM 2795  O O   . ALA A 1 366 ? 46.118  88.789  -76.255  1.00 40.00 ? 370 ALA A O   1 
ATOM 2796  C CB  . ALA A 1 366 ? 47.235  86.018  -75.529  1.00 40.00 ? 370 ALA A CB  1 
ATOM 2797  N N   . SER A 1 367 ? 46.669  88.893  -74.080  1.00 40.00 ? 371 SER A N   1 
ATOM 2798  C CA  . SER A 1 367 ? 47.107  90.299  -74.197  1.00 40.00 ? 371 SER A CA  1 
ATOM 2799  C C   . SER A 1 367 ? 48.413  90.294  -74.996  1.00 40.00 ? 371 SER A C   1 
ATOM 2800  O O   . SER A 1 367 ? 48.929  89.231  -75.376  1.00 40.00 ? 371 SER A O   1 
ATOM 2801  C CB  . SER A 1 367 ? 47.374  90.846  -72.796  1.00 40.00 ? 371 SER A CB  1 
ATOM 2802  O OG  . SER A 1 367 ? 48.610  90.406  -72.249  1.00 40.00 ? 371 SER A OG  1 
ATOM 2803  N N   . ASP A 1 368 ? 49.010  91.467  -75.217  1.00 40.00 ? 372 ASP A N   1 
ATOM 2804  C CA  . ASP A 1 368 ? 50.276  91.498  -75.966  1.00 40.00 ? 372 ASP A CA  1 
ATOM 2805  C C   . ASP A 1 368 ? 51.390  90.802  -75.192  1.00 40.00 ? 372 ASP A C   1 
ATOM 2806  O O   . ASP A 1 368 ? 52.029  89.874  -75.686  1.00 40.00 ? 372 ASP A O   1 
ATOM 2807  C CB  . ASP A 1 368 ? 50.749  92.901  -76.290  1.00 40.00 ? 372 ASP A CB  1 
ATOM 2808  C CG  . ASP A 1 368 ? 49.805  93.637  -77.210  1.00 40.00 ? 372 ASP A CG  1 
ATOM 2809  O OD1 . ASP A 1 368 ? 49.578  93.121  -78.318  1.00 40.00 ? 372 ASP A OD1 1 
ATOM 2810  O OD2 . ASP A 1 368 ? 49.314  94.699  -76.783  1.00 40.00 ? 372 ASP A OD2 1 
ATOM 2811  N N   . LEU A 1 369 ? 51.597  91.264  -73.956  1.00 40.00 ? 373 LEU A N   1 
ATOM 2812  C CA  . LEU A 1 369 ? 52.629  90.653  -73.133  1.00 40.00 ? 373 LEU A CA  1 
ATOM 2813  C C   . LEU A 1 369 ? 52.476  89.138  -73.141  1.00 40.00 ? 373 LEU A C   1 
ATOM 2814  O O   . LEU A 1 369 ? 53.451  88.413  -73.386  1.00 40.00 ? 373 LEU A O   1 
ATOM 2815  C CB  . LEU A 1 369 ? 52.524  91.193  -71.726  1.00 40.00 ? 373 LEU A CB  1 
ATOM 2816  C CG  . LEU A 1 369 ? 53.768  91.115  -70.852  1.00 40.00 ? 373 LEU A CG  1 
ATOM 2817  C CD1 . LEU A 1 369 ? 55.023  91.480  -71.606  1.00 40.00 ? 373 LEU A CD1 1 
ATOM 2818  C CD2 . LEU A 1 369 ? 53.565  92.038  -69.645  1.00 40.00 ? 373 LEU A CD2 1 
ATOM 2819  N N   . ALA A 1 370 ? 51.234  88.659  -72.895  1.00 40.00 ? 374 ALA A N   1 
ATOM 2820  C CA  . ALA A 1 370 ? 51.053  87.199  -72.880  1.00 40.00 ? 374 ALA A CA  1 
ATOM 2821  C C   . ALA A 1 370 ? 51.410  86.604  -74.227  1.00 40.00 ? 374 ALA A C   1 
ATOM 2822  O O   . ALA A 1 370 ? 52.081  85.575  -74.324  1.00 40.00 ? 374 ALA A O   1 
ATOM 2823  C CB  . ALA A 1 370 ? 49.665  86.836  -72.440  1.00 40.00 ? 374 ALA A CB  1 
ATOM 2824  N N   . ALA A 1 371 ? 51.010  87.267  -75.297  1.00 40.00 ? 375 ALA A N   1 
ATOM 2825  C CA  . ALA A 1 371 ? 51.399  86.758  -76.620  1.00 40.00 ? 375 ALA A CA  1 
ATOM 2826  C C   . ALA A 1 371 ? 52.923  86.680  -76.689  1.00 40.00 ? 375 ALA A C   1 
ATOM 2827  O O   . ALA A 1 371 ? 53.500  85.693  -77.133  1.00 40.00 ? 375 ALA A O   1 
ATOM 2828  C CB  . ALA A 1 371 ? 50.902  87.711  -77.697  1.00 40.00 ? 375 ALA A CB  1 
ATOM 2829  N N   . GLU A 1 372 ? 53.586  87.751  -76.236  1.00 40.00 ? 376 GLU A N   1 
ATOM 2830  C CA  . GLU A 1 372 ? 55.043  87.790  -76.227  1.00 40.00 ? 376 GLU A CA  1 
ATOM 2831  C C   . GLU A 1 372 ? 55.556  86.536  -75.524  1.00 40.00 ? 376 GLU A C   1 
ATOM 2832  O O   . GLU A 1 372 ? 56.363  85.753  -76.046  1.00 40.00 ? 376 GLU A O   1 
ATOM 2833  C CB  . GLU A 1 372 ? 55.519  89.055  -75.532  1.00 40.00 ? 376 GLU A CB  1 
ATOM 2834  C CG  . GLU A 1 372 ? 56.659  89.794  -76.257  1.00 40.00 ? 376 GLU A CG  1 
ATOM 2835  C CD  . GLU A 1 372 ? 56.138  91.094  -76.838  1.00 40.00 ? 376 GLU A CD  1 
ATOM 2836  O OE1 . GLU A 1 372 ? 55.773  91.970  -76.011  1.00 40.00 ? 376 GLU A OE1 1 
ATOM 2837  O OE2 . GLU A 1 372 ? 56.064  91.241  -78.082  1.00 40.00 ? 376 GLU A OE2 1 
ATOM 2838  N N   . ALA A 1 373 ? 55.043  86.308  -74.313  1.00 40.00 ? 377 ALA A N   1 
ATOM 2839  C CA  . ALA A 1 373 ? 55.412  85.111  -73.550  1.00 40.00 ? 377 ALA A CA  1 
ATOM 2840  C C   . ALA A 1 373 ? 55.315  83.859  -74.429  1.00 40.00 ? 377 ALA A C   1 
ATOM 2841  O O   . ALA A 1 373 ? 56.288  83.091  -74.547  1.00 40.00 ? 377 ALA A O   1 
ATOM 2842  C CB  . ALA A 1 373 ? 54.539  84.922  -72.328  1.00 40.00 ? 377 ALA A CB  1 
ATOM 2843  N N   . VAL A 1 374 ? 54.148  83.683  -75.077  1.00 40.00 ? 378 VAL A N   1 
ATOM 2844  C CA  . VAL A 1 374 ? 54.016  82.517  -75.946  1.00 40.00 ? 378 VAL A CA  1 
ATOM 2845  C C   . VAL A 1 374 ? 55.050  82.506  -77.058  1.00 40.00 ? 378 VAL A C   1 
ATOM 2846  O O   . VAL A 1 374 ? 55.648  81.461  -77.393  1.00 40.00 ? 378 VAL A O   1 
ATOM 2847  C CB  . VAL A 1 374 ? 52.605  82.476  -76.552  1.00 40.00 ? 378 VAL A CB  1 
ATOM 2848  C CG1 . VAL A 1 374 ? 52.431  81.195  -77.360  1.00 40.00 ? 378 VAL A CG1 1 
ATOM 2849  C CG2 . VAL A 1 374 ? 51.592  82.582  -75.421  1.00 40.00 ? 378 VAL A CG2 1 
ATOM 2850  N N   . VAL A 1 375 ? 55.309  83.666  -77.670  1.00 40.00 ? 379 VAL A N   1 
ATOM 2851  C CA  . VAL A 1 375 ? 56.288  83.640  -78.751  1.00 40.00 ? 379 VAL A CA  1 
ATOM 2852  C C   . VAL A 1 375 ? 57.671  83.256  -78.251  1.00 40.00 ? 379 VAL A C   1 
ATOM 2853  O O   . VAL A 1 375 ? 58.416  82.526  -78.906  1.00 40.00 ? 379 VAL A O   1 
ATOM 2854  C CB  . VAL A 1 375 ? 56.381  84.957  -79.523  1.00 40.00 ? 379 VAL A CB  1 
ATOM 2855  C CG1 . VAL A 1 375 ? 57.407  84.775  -80.630  1.00 40.00 ? 379 VAL A CG1 1 
ATOM 2856  C CG2 . VAL A 1 375 ? 55.018  85.312  -80.095  1.00 40.00 ? 379 VAL A CG2 1 
ATOM 2857  N N   . LEU A 1 376 ? 57.974  83.790  -77.058  1.00 40.00 ? 380 LEU A N   1 
ATOM 2858  C CA  . LEU A 1 376 ? 59.270  83.512  -76.428  1.00 40.00 ? 380 LEU A CA  1 
ATOM 2859  C C   . LEU A 1 376 ? 59.404  81.992  -76.312  1.00 40.00 ? 380 LEU A C   1 
ATOM 2860  O O   . LEU A 1 376 ? 60.350  81.366  -76.721  1.00 40.00 ? 380 LEU A O   1 
ATOM 2861  C CB  . LEU A 1 376 ? 59.286  84.015  -74.995  1.00 40.00 ? 380 LEU A CB  1 
ATOM 2862  C CG  . LEU A 1 376 ? 60.588  84.092  -74.236  1.00 40.00 ? 380 LEU A CG  1 
ATOM 2863  C CD1 . LEU A 1 376 ? 60.398  83.687  -72.783  1.00 40.00 ? 380 LEU A CD1 1 
ATOM 2864  C CD2 . LEU A 1 376 ? 61.732  83.334  -74.866  1.00 40.00 ? 380 LEU A CD2 1 
ATOM 2865  N N   . HIS A 1 377 ? 58.337  81.461  -75.693  1.00 40.00 ? 381 HIS A N   1 
ATOM 2866  C CA  . HIS A 1 377 ? 58.351  80.030  -75.461  1.00 40.00 ? 381 HIS A CA  1 
ATOM 2867  C C   . HIS A 1 377 ? 58.437  79.170  -76.700  1.00 40.00 ? 381 HIS A C   1 
ATOM 2868  O O   . HIS A 1 377 ? 59.142  78.147  -76.615  1.00 40.00 ? 381 HIS A O   1 
ATOM 2869  C CB  . HIS A 1 377 ? 57.161  79.586  -74.622  1.00 40.00 ? 381 HIS A CB  1 
ATOM 2870  C CG  . HIS A 1 377 ? 57.329  78.195  -74.102  1.00 40.00 ? 381 HIS A CG  1 
ATOM 2871  N ND1 . HIS A 1 377 ? 57.875  77.909  -72.873  1.00 40.00 ? 381 HIS A ND1 1 
ATOM 2872  C CD2 . HIS A 1 377 ? 57.008  77.010  -74.668  1.00 40.00 ? 381 HIS A CD2 1 
ATOM 2873  C CE1 . HIS A 1 377 ? 57.870  76.587  -72.700  1.00 40.00 ? 381 HIS A CE1 1 
ATOM 2874  N NE2 . HIS A 1 377 ? 57.353  76.010  -73.771  1.00 40.00 ? 381 HIS A NE2 1 
ATOM 2875  N N   . TYR A 1 378 ? 57.732  79.513  -77.789  1.00 40.00 ? 382 TYR A N   1 
ATOM 2876  C CA  . TYR A 1 378 ? 57.805  78.587  -78.930  1.00 40.00 ? 382 TYR A CA  1 
ATOM 2877  C C   . TYR A 1 378 ? 58.811  78.953  -79.989  1.00 40.00 ? 382 TYR A C   1 
ATOM 2878  O O   . TYR A 1 378 ? 59.077  78.131  -80.904  1.00 40.00 ? 382 TYR A O   1 
ATOM 2879  C CB  . TYR A 1 378 ? 56.407  78.382  -79.464  1.00 40.00 ? 382 TYR A CB  1 
ATOM 2880  C CG  . TYR A 1 378 ? 55.467  77.609  -78.571  1.00 40.00 ? 382 TYR A CG  1 
ATOM 2881  C CD1 . TYR A 1 378 ? 55.216  76.252  -78.804  1.00 40.00 ? 382 TYR A CD1 1 
ATOM 2882  C CD2 . TYR A 1 378 ? 54.812  78.224  -77.508  1.00 40.00 ? 382 TYR A CD2 1 
ATOM 2883  C CE1 . TYR A 1 378 ? 54.351  75.531  -78.034  1.00 40.00 ? 382 TYR A CE1 1 
ATOM 2884  C CE2 . TYR A 1 378 ? 53.943  77.491  -76.712  1.00 40.00 ? 382 TYR A CE2 1 
ATOM 2885  C CZ  . TYR A 1 378 ? 53.727  76.161  -76.993  1.00 40.00 ? 382 TYR A CZ  1 
ATOM 2886  O OH  . TYR A 1 378 ? 52.863  75.446  -76.168  1.00 40.00 ? 382 TYR A OH  1 
ATOM 2887  N N   . THR A 1 379 ? 59.415  80.143  -79.931  1.00 40.00 ? 383 THR A N   1 
ATOM 2888  C CA  . THR A 1 379 ? 60.427  80.495  -80.936  1.00 40.00 ? 383 THR A CA  1 
ATOM 2889  C C   . THR A 1 379 ? 61.714  79.684  -80.734  1.00 40.00 ? 383 THR A C   1 
ATOM 2890  O O   . THR A 1 379 ? 62.094  79.483  -79.576  1.00 40.00 ? 383 THR A O   1 
ATOM 2891  C CB  . THR A 1 379 ? 60.868  81.968  -80.765  1.00 40.00 ? 383 THR A CB  1 
ATOM 2892  O OG1 . THR A 1 379 ? 59.806  82.882  -81.044  1.00 40.00 ? 383 THR A OG1 1 
ATOM 2893  C CG2 . THR A 1 379 ? 62.071  82.247  -81.652  1.00 40.00 ? 383 THR A CG2 1 
ATOM 2894  N N   . ASP A 1 380 ? 62.397  79.251  -81.795  1.00 40.00 ? 384 ASP A N   1 
ATOM 2895  C CA  . ASP A 1 380 ? 63.689  78.585  -81.547  1.00 40.00 ? 384 ASP A CA  1 
ATOM 2896  C C   . ASP A 1 380 ? 64.744  79.686  -81.802  1.00 40.00 ? 384 ASP A C   1 
ATOM 2897  O O   . ASP A 1 380 ? 65.114  79.932  -82.947  1.00 40.00 ? 384 ASP A O   1 
ATOM 2898  C CB  . ASP A 1 380 ? 63.985  77.399  -82.425  1.00 40.00 ? 384 ASP A CB  1 
ATOM 2899  C CG  . ASP A 1 380 ? 65.479  77.077  -82.439  1.00 40.00 ? 384 ASP A CG  1 
ATOM 2900  O OD1 . ASP A 1 380 ? 66.160  77.421  -81.443  1.00 40.00 ? 384 ASP A OD1 1 
ATOM 2901  O OD2 . ASP A 1 380 ? 65.910  76.515  -83.454  1.00 40.00 ? 384 ASP A OD2 1 
ATOM 2902  N N   . TRP A 1 381 ? 65.272  80.308  -80.755  1.00 40.00 ? 385 TRP A N   1 
ATOM 2903  C CA  . TRP A 1 381 ? 66.214  81.399  -80.887  1.00 40.00 ? 385 TRP A CA  1 
ATOM 2904  C C   . TRP A 1 381 ? 67.508  81.131  -81.597  1.00 40.00 ? 385 TRP A C   1 
ATOM 2905  O O   . TRP A 1 381 ? 68.288  82.069  -81.922  1.00 40.00 ? 385 TRP A O   1 
ATOM 2906  C CB  . TRP A 1 381 ? 66.390  82.094  -79.546  1.00 40.00 ? 385 TRP A CB  1 
ATOM 2907  C CG  . TRP A 1 381 ? 65.063  82.505  -78.987  1.00 40.00 ? 385 TRP A CG  1 
ATOM 2908  C CD1 . TRP A 1 381 ? 64.320  81.823  -78.055  1.00 40.00 ? 385 TRP A CD1 1 
ATOM 2909  C CD2 . TRP A 1 381 ? 64.304  83.661  -79.327  1.00 40.00 ? 385 TRP A CD2 1 
ATOM 2910  N NE1 . TRP A 1 381 ? 63.151  82.486  -77.786  1.00 40.00 ? 385 TRP A NE1 1 
ATOM 2911  C CE2 . TRP A 1 381 ? 63.118  83.620  -78.557  1.00 40.00 ? 385 TRP A CE2 1 
ATOM 2912  C CE3 . TRP A 1 381 ? 64.503  84.725  -80.212  1.00 40.00 ? 385 TRP A CE3 1 
ATOM 2913  C CZ2 . TRP A 1 381 ? 62.144  84.610  -78.643  1.00 40.00 ? 385 TRP A CZ2 1 
ATOM 2914  C CZ3 . TRP A 1 381 ? 63.531  85.705  -80.290  1.00 40.00 ? 385 TRP A CZ3 1 
ATOM 2915  C CH2 . TRP A 1 381 ? 62.367  85.642  -79.513  1.00 40.00 ? 385 TRP A CH2 1 
ATOM 2916  N N   . LEU A 1 382 ? 67.799  79.871  -81.941  1.00 40.00 ? 386 LEU A N   1 
ATOM 2917  C CA  . LEU A 1 382 ? 68.990  79.643  -82.756  1.00 40.00 ? 386 LEU A CA  1 
ATOM 2918  C C   . LEU A 1 382 ? 68.524  79.767  -84.202  1.00 40.00 ? 386 LEU A C   1 
ATOM 2919  O O   . LEU A 1 382 ? 69.354  80.012  -85.074  1.00 40.00 ? 386 LEU A O   1 
ATOM 2920  C CB  . LEU A 1 382 ? 69.674  78.362  -82.456  1.00 40.00 ? 386 LEU A CB  1 
ATOM 2921  C CG  . LEU A 1 382 ? 71.180  78.220  -82.583  1.00 40.00 ? 386 LEU A CG  1 
ATOM 2922  C CD1 . LEU A 1 382 ? 71.532  77.324  -83.775  1.00 40.00 ? 386 LEU A CD1 1 
ATOM 2923  C CD2 . LEU A 1 382 ? 71.910  79.551  -82.764  1.00 40.00 ? 386 LEU A CD2 1 
ATOM 2924  N N   . HIS A 1 383 ? 67.239  79.607  -84.497  1.00 40.00 ? 387 HIS A N   1 
ATOM 2925  C CA  . HIS A 1 383 ? 66.719  79.743  -85.881  1.00 40.00 ? 387 HIS A CA  1 
ATOM 2926  C C   . HIS A 1 383 ? 65.327  80.365  -85.890  1.00 40.00 ? 387 HIS A C   1 
ATOM 2927  O O   . HIS A 1 383 ? 64.309  79.712  -86.192  1.00 40.00 ? 387 HIS A O   1 
ATOM 2928  C CB  . HIS A 1 383 ? 66.613  78.334  -86.475  1.00 40.00 ? 387 HIS A CB  1 
ATOM 2929  C CG  . HIS A 1 383 ? 67.834  77.484  -86.427  1.00 40.00 ? 387 HIS A CG  1 
ATOM 2930  N ND1 . HIS A 1 383 ? 68.045  76.505  -85.481  1.00 40.00 ? 387 HIS A ND1 1 
ATOM 2931  C CD2 . HIS A 1 383 ? 68.943  77.492  -87.204  1.00 40.00 ? 387 HIS A CD2 1 
ATOM 2932  C CE1 . HIS A 1 383 ? 69.206  75.924  -85.693  1.00 40.00 ? 387 HIS A CE1 1 
ATOM 2933  N NE2 . HIS A 1 383 ? 69.777  76.505  -86.729  1.00 40.00 ? 387 HIS A NE2 1 
ATOM 2934  N N   . PRO A 1 384 ? 65.190  81.623  -85.497  1.00 40.00 ? 388 PRO A N   1 
ATOM 2935  C CA  . PRO A 1 384 ? 63.914  82.271  -85.334  1.00 40.00 ? 388 PRO A CA  1 
ATOM 2936  C C   . PRO A 1 384 ? 63.136  82.530  -86.583  1.00 40.00 ? 388 PRO A C   1 
ATOM 2937  O O   . PRO A 1 384 ? 62.111  83.252  -86.556  1.00 40.00 ? 388 PRO A O   1 
ATOM 2938  C CB  . PRO A 1 384 ? 64.271  83.602  -84.657  1.00 40.00 ? 388 PRO A CB  1 
ATOM 2939  C CG  . PRO A 1 384 ? 65.635  83.891  -85.199  1.00 40.00 ? 388 PRO A CG  1 
ATOM 2940  C CD  . PRO A 1 384 ? 66.304  82.519  -85.097  1.00 40.00 ? 388 PRO A CD  1 
ATOM 2941  N N   . GLU A 1 385 ? 63.600  82.036  -87.724  1.00 40.00 ? 389 GLU A N   1 
ATOM 2942  C CA  . GLU A 1 385 ? 62.944  82.232  -88.991  1.00 40.00 ? 389 GLU A CA  1 
ATOM 2943  C C   . GLU A 1 385 ? 62.837  80.910  -89.747  1.00 40.00 ? 389 GLU A C   1 
ATOM 2944  O O   . GLU A 1 385 ? 62.281  80.913  -90.852  1.00 40.00 ? 389 GLU A O   1 
ATOM 2945  C CB  . GLU A 1 385 ? 63.630  83.224  -89.905  1.00 40.00 ? 389 GLU A CB  1 
ATOM 2946  C CG  . GLU A 1 385 ? 64.478  84.279  -89.254  1.00 40.00 ? 389 GLU A CG  1 
ATOM 2947  C CD  . GLU A 1 385 ? 63.821  85.641  -89.252  1.00 40.00 ? 389 GLU A CD  1 
ATOM 2948  O OE1 . GLU A 1 385 ? 63.007  85.917  -90.158  1.00 40.00 ? 389 GLU A OE1 1 
ATOM 2949  O OE2 . GLU A 1 385 ? 64.133  86.431  -88.333  1.00 40.00 ? 389 GLU A OE2 1 
ATOM 2950  N N   . ASP A 1 386 ? 63.359  79.839  -89.173  1.00 40.00 ? 390 ASP A N   1 
ATOM 2951  C CA  . ASP A 1 386 ? 63.225  78.560  -89.924  1.00 40.00 ? 390 ASP A CA  1 
ATOM 2952  C C   . ASP A 1 386 ? 61.726  78.329  -90.083  1.00 40.00 ? 390 ASP A C   1 
ATOM 2953  O O   . ASP A 1 386 ? 60.954  78.214  -89.113  1.00 40.00 ? 390 ASP A O   1 
ATOM 2954  C CB  . ASP A 1 386 ? 63.969  77.513  -89.144  1.00 40.00 ? 390 ASP A CB  1 
ATOM 2955  C CG  . ASP A 1 386 ? 63.603  76.108  -89.562  1.00 40.00 ? 390 ASP A CG  1 
ATOM 2956  O OD1 . ASP A 1 386 ? 63.554  75.861  -90.788  1.00 40.00 ? 390 ASP A OD1 1 
ATOM 2957  O OD2 . ASP A 1 386 ? 63.356  75.277  -88.659  1.00 40.00 ? 390 ASP A OD2 1 
ATOM 2958  N N   . PRO A 1 387 ? 61.248  78.339  -91.323  1.00 40.00 ? 391 PRO A N   1 
ATOM 2959  C CA  . PRO A 1 387 ? 59.828  78.166  -91.622  1.00 40.00 ? 391 PRO A CA  1 
ATOM 2960  C C   . PRO A 1 387 ? 59.339  76.840  -91.083  1.00 40.00 ? 391 PRO A C   1 
ATOM 2961  O O   . PRO A 1 387 ? 58.355  76.764  -90.325  1.00 40.00 ? 391 PRO A O   1 
ATOM 2962  C CB  . PRO A 1 387 ? 59.753  78.284  -93.127  1.00 40.00 ? 391 PRO A CB  1 
ATOM 2963  C CG  . PRO A 1 387 ? 61.120  77.848  -93.584  1.00 40.00 ? 391 PRO A CG  1 
ATOM 2964  C CD  . PRO A 1 387 ? 62.054  78.438  -92.553  1.00 40.00 ? 391 PRO A CD  1 
ATOM 2965  N N   . THR A 1 388 ? 60.043  75.752  -91.381  1.00 40.00 ? 392 THR A N   1 
ATOM 2966  C CA  . THR A 1 388 ? 59.636  74.464  -90.844  1.00 40.00 ? 392 THR A CA  1 
ATOM 2967  C C   . THR A 1 388 ? 59.415  74.482  -89.333  1.00 40.00 ? 392 THR A C   1 
ATOM 2968  O O   . THR A 1 388 ? 58.506  73.811  -88.820  1.00 40.00 ? 392 THR A O   1 
ATOM 2969  C CB  . THR A 1 388 ? 60.708  73.375  -91.101  1.00 40.00 ? 392 THR A CB  1 
ATOM 2970  O OG1 . THR A 1 388 ? 60.794  73.106  -92.504  1.00 40.00 ? 392 THR A OG1 1 
ATOM 2971  C CG2 . THR A 1 388 ? 60.329  72.096  -90.362  1.00 40.00 ? 392 THR A CG2 1 
ATOM 2972  N N   . HIS A 1 389 ? 60.311  75.175  -88.605  1.00 40.00 ? 393 HIS A N   1 
ATOM 2973  C CA  . HIS A 1 389 ? 60.143  75.184  -87.152  1.00 40.00 ? 393 HIS A CA  1 
ATOM 2974  C C   . HIS A 1 389 ? 58.893  75.980  -86.776  1.00 40.00 ? 393 HIS A C   1 
ATOM 2975  O O   . HIS A 1 389 ? 58.023  75.499  -86.071  1.00 40.00 ? 393 HIS A O   1 
ATOM 2976  C CB  . HIS A 1 389 ? 61.354  75.708  -86.395  1.00 40.00 ? 393 HIS A CB  1 
ATOM 2977  C CG  . HIS A 1 389 ? 61.113  75.588  -84.913  1.00 40.00 ? 393 HIS A CG  1 
ATOM 2978  N ND1 . HIS A 1 389 ? 61.428  74.448  -84.212  1.00 40.00 ? 393 HIS A ND1 1 
ATOM 2979  C CD2 . HIS A 1 389 ? 60.561  76.442  -84.018  1.00 40.00 ? 393 HIS A CD2 1 
ATOM 2980  C CE1 . HIS A 1 389 ? 61.093  74.611  -82.938  1.00 40.00 ? 393 HIS A CE1 1 
ATOM 2981  N NE2 . HIS A 1 389 ? 60.566  75.818  -82.794  1.00 40.00 ? 393 HIS A NE2 1 
ATOM 2982  N N   . LEU A 1 390 ? 58.832  77.194  -87.303  1.00 40.00 ? 394 LEU A N   1 
ATOM 2983  C CA  . LEU A 1 390 ? 57.695  78.083  -87.117  1.00 40.00 ? 394 LEU A CA  1 
ATOM 2984  C C   . LEU A 1 390 ? 56.397  77.305  -87.327  1.00 40.00 ? 394 LEU A C   1 
ATOM 2985  O O   . LEU A 1 390 ? 55.503  77.262  -86.476  1.00 40.00 ? 394 LEU A O   1 
ATOM 2986  C CB  . LEU A 1 390 ? 57.833  79.163  -88.207  1.00 40.00 ? 394 LEU A CB  1 
ATOM 2987  C CG  . LEU A 1 390 ? 58.922  80.195  -87.874  1.00 40.00 ? 394 LEU A CG  1 
ATOM 2988  C CD1 . LEU A 1 390 ? 59.235  81.054  -89.069  1.00 40.00 ? 394 LEU A CD1 1 
ATOM 2989  C CD2 . LEU A 1 390 ? 58.458  81.022  -86.676  1.00 40.00 ? 394 LEU A CD2 1 
ATOM 2990  N N   . ARG A 1 391 ? 56.329  76.636  -88.480  1.00 40.00 ? 395 ARG A N   1 
ATOM 2991  C CA  . ARG A 1 391 ? 55.177  75.827  -88.824  1.00 40.00 ? 395 ARG A CA  1 
ATOM 2992  C C   . ARG A 1 391 ? 54.774  74.896  -87.697  1.00 40.00 ? 395 ARG A C   1 
ATOM 2993  O O   . ARG A 1 391 ? 53.715  75.005  -87.079  1.00 40.00 ? 395 ARG A O   1 
ATOM 2994  C CB  . ARG A 1 391 ? 55.444  74.947  -90.057  1.00 40.00 ? 395 ARG A CB  1 
ATOM 2995  C CG  . ARG A 1 391 ? 54.163  74.214  -90.500  1.00 40.00 ? 395 ARG A CG  1 
ATOM 2996  C CD  . ARG A 1 391 ? 54.508  72.730  -90.526  1.00 40.00 ? 395 ARG A CD  1 
ATOM 2997  N NE  . ARG A 1 391 ? 55.082  72.351  -91.810  1.00 40.00 ? 395 ARG A NE  1 
ATOM 2998  C CZ  . ARG A 1 391 ? 55.958  71.377  -91.990  1.00 40.00 ? 395 ARG A CZ  1 
ATOM 2999  N NH1 . ARG A 1 391 ? 56.425  70.640  -90.992  1.00 40.00 ? 395 ARG A NH1 1 
ATOM 3000  N NH2 . ARG A 1 391 ? 56.388  71.142  -93.235  1.00 40.00 ? 395 ARG A NH2 1 
ATOM 3001  N N   . ASP A 1 392 ? 55.684  73.981  -87.389  1.00 40.00 ? 396 ASP A N   1 
ATOM 3002  C CA  . ASP A 1 392 ? 55.380  73.066  -86.281  1.00 40.00 ? 396 ASP A CA  1 
ATOM 3003  C C   . ASP A 1 392 ? 55.102  73.796  -84.986  1.00 40.00 ? 396 ASP A C   1 
ATOM 3004  O O   . ASP A 1 392 ? 54.337  73.293  -84.139  1.00 40.00 ? 396 ASP A O   1 
ATOM 3005  C CB  . ASP A 1 392 ? 56.498  72.038  -86.142  1.00 40.00 ? 396 ASP A CB  1 
ATOM 3006  C CG  . ASP A 1 392 ? 56.667  71.281  -87.456  1.00 40.00 ? 396 ASP A CG  1 
ATOM 3007  O OD1 . ASP A 1 392 ? 55.752  71.359  -88.304  1.00 40.00 ? 396 ASP A OD1 1 
ATOM 3008  O OD2 . ASP A 1 392 ? 57.701  70.611  -87.649  1.00 40.00 ? 396 ASP A OD2 1 
ATOM 3009  N N   . ALA A 1 393 ? 55.693  74.975  -84.794  1.00 40.00 ? 397 ALA A N   1 
ATOM 3010  C CA  . ALA A 1 393 ? 55.501  75.698  -83.536  1.00 40.00 ? 397 ALA A CA  1 
ATOM 3011  C C   . ALA A 1 393 ? 54.047  76.117  -83.371  1.00 40.00 ? 397 ALA A C   1 
ATOM 3012  O O   . ALA A 1 393 ? 53.439  75.910  -82.305  1.00 40.00 ? 397 ALA A O   1 
ATOM 3013  C CB  . ALA A 1 393 ? 56.446  76.870  -83.467  1.00 40.00 ? 397 ALA A CB  1 
ATOM 3014  N N   . MET A 1 394 ? 53.544  76.701  -84.472  1.00 40.00 ? 398 MET A N   1 
ATOM 3015  C CA  . MET A 1 394 ? 52.151  77.148  -84.547  1.00 40.00 ? 398 MET A CA  1 
ATOM 3016  C C   . MET A 1 394 ? 51.257  75.976  -84.148  1.00 40.00 ? 398 MET A C   1 
ATOM 3017  O O   . MET A 1 394 ? 50.471  76.072  -83.212  1.00 40.00 ? 398 MET A O   1 
ATOM 3018  C CB  . MET A 1 394 ? 51.800  77.522  -85.972  1.00 40.00 ? 398 MET A CB  1 
ATOM 3019  C CG  . MET A 1 394 ? 51.149  78.834  -86.283  1.00 40.00 ? 398 MET A CG  1 
ATOM 3020  S SD  . MET A 1 394 ? 50.306  79.620  -84.892  1.00 40.00 ? 398 MET A SD  1 
ATOM 3021  C CE  . MET A 1 394 ? 51.527  80.888  -84.571  1.00 40.00 ? 398 MET A CE  1 
ATOM 3022  N N   . SER A 1 395 ? 51.451  74.833  -84.819  1.00 40.00 ? 399 SER A N   1 
ATOM 3023  C CA  . SER A 1 395 ? 50.637  73.676  -84.469  1.00 40.00 ? 399 SER A CA  1 
ATOM 3024  C C   . SER A 1 395 ? 50.748  73.340  -82.992  1.00 40.00 ? 399 SER A C   1 
ATOM 3025  O O   . SER A 1 395 ? 49.757  72.962  -82.350  1.00 40.00 ? 399 SER A O   1 
ATOM 3026  C CB  . SER A 1 395 ? 50.998  72.497  -85.377  1.00 40.00 ? 399 SER A CB  1 
ATOM 3027  O OG  . SER A 1 395 ? 50.517  71.318  -84.741  1.00 40.00 ? 399 SER A OG  1 
ATOM 3028  N N   . ALA A 1 396 ? 51.942  73.478  -82.392  1.00 40.00 ? 400 ALA A N   1 
ATOM 3029  C CA  . ALA A 1 396 ? 52.065  73.168  -80.969  1.00 40.00 ? 400 ALA A CA  1 
ATOM 3030  C C   . ALA A 1 396 ? 51.343  74.213  -80.124  1.00 40.00 ? 400 ALA A C   1 
ATOM 3031  O O   . ALA A 1 396 ? 50.700  73.784  -79.148  1.00 40.00 ? 400 ALA A O   1 
ATOM 3032  C CB  . ALA A 1 396 ? 53.497  73.054  -80.481  1.00 40.00 ? 400 ALA A CB  1 
ATOM 3033  N N   . VAL A 1 397 ? 51.465  75.502  -80.467  1.00 40.00 ? 401 VAL A N   1 
ATOM 3034  C CA  . VAL A 1 397 ? 50.785  76.485  -79.606  1.00 40.00 ? 401 VAL A CA  1 
ATOM 3035  C C   . VAL A 1 397 ? 49.307  76.115  -79.493  1.00 40.00 ? 401 VAL A C   1 
ATOM 3036  O O   . VAL A 1 397 ? 48.714  76.069  -78.411  1.00 40.00 ? 401 VAL A O   1 
ATOM 3037  C CB  . VAL A 1 397 ? 50.900  77.918  -80.159  1.00 40.00 ? 401 VAL A CB  1 
ATOM 3038  C CG1 . VAL A 1 397 ? 50.146  78.931  -79.337  1.00 40.00 ? 401 VAL A CG1 1 
ATOM 3039  C CG2 . VAL A 1 397 ? 52.386  78.273  -80.260  1.00 40.00 ? 401 VAL A CG2 1 
ATOM 3040  N N   . VAL A 1 398 ? 48.732  75.857  -80.681  1.00 40.00 ? 402 VAL A N   1 
ATOM 3041  C CA  . VAL A 1 398 ? 47.333  75.505  -80.687  1.00 40.00 ? 402 VAL A CA  1 
ATOM 3042  C C   . VAL A 1 398 ? 47.043  74.202  -79.956  1.00 40.00 ? 402 VAL A C   1 
ATOM 3043  O O   . VAL A 1 398 ? 46.176  74.169  -79.092  1.00 40.00 ? 402 VAL A O   1 
ATOM 3044  C CB  . VAL A 1 398 ? 46.744  75.391  -82.098  1.00 40.00 ? 402 VAL A CB  1 
ATOM 3045  C CG1 . VAL A 1 398 ? 45.266  75.004  -81.954  1.00 40.00 ? 402 VAL A CG1 1 
ATOM 3046  C CG2 . VAL A 1 398 ? 46.917  76.717  -82.814  1.00 40.00 ? 402 VAL A CG2 1 
ATOM 3047  N N   . GLY A 1 399 ? 47.734  73.143  -80.327  1.00 40.00 ? 403 GLY A N   1 
ATOM 3048  C CA  . GLY A 1 399 ? 47.512  71.852  -79.707  1.00 40.00 ? 403 GLY A CA  1 
ATOM 3049  C C   . GLY A 1 399 ? 47.815  71.840  -78.224  1.00 40.00 ? 403 GLY A C   1 
ATOM 3050  O O   . GLY A 1 399 ? 47.107  71.157  -77.439  1.00 40.00 ? 403 GLY A O   1 
ATOM 3051  N N   . ASP A 1 400 ? 48.877  72.558  -77.789  1.00 40.00 ? 404 ASP A N   1 
ATOM 3052  C CA  . ASP A 1 400 ? 49.157  72.494  -76.363  1.00 40.00 ? 404 ASP A CA  1 
ATOM 3053  C C   . ASP A 1 400 ? 48.131  73.314  -75.589  1.00 40.00 ? 404 ASP A C   1 
ATOM 3054  O O   . ASP A 1 400 ? 47.714  72.881  -74.530  1.00 40.00 ? 404 ASP A O   1 
ATOM 3055  C CB  . ASP A 1 400 ? 50.525  73.044  -75.985  1.00 40.00 ? 404 ASP A CB  1 
ATOM 3056  C CG  . ASP A 1 400 ? 51.654  72.288  -76.662  1.00 40.00 ? 404 ASP A CG  1 
ATOM 3057  O OD1 . ASP A 1 400 ? 51.417  71.116  -77.061  1.00 40.00 ? 404 ASP A OD1 1 
ATOM 3058  O OD2 . ASP A 1 400 ? 52.735  72.912  -76.759  1.00 40.00 ? 404 ASP A OD2 1 
ATOM 3059  N N   . HIS A 1 401 ? 47.799  74.465  -76.135  1.00 40.00 ? 405 HIS A N   1 
ATOM 3060  C CA  . HIS A 1 401 ? 46.941  75.386  -75.447  1.00 40.00 ? 405 HIS A CA  1 
ATOM 3061  C C   . HIS A 1 401 ? 45.549  74.875  -75.202  1.00 40.00 ? 405 HIS A C   1 
ATOM 3062  O O   . HIS A 1 401 ? 45.032  75.142  -74.125  1.00 40.00 ? 405 HIS A O   1 
ATOM 3063  C CB  . HIS A 1 401 ? 46.874  76.701  -76.227  1.00 40.00 ? 405 HIS A CB  1 
ATOM 3064  C CG  . HIS A 1 401 ? 45.948  77.708  -75.615  1.00 40.00 ? 405 HIS A CG  1 
ATOM 3065  N ND1 . HIS A 1 401 ? 45.905  77.917  -74.249  1.00 40.00 ? 405 HIS A ND1 1 
ATOM 3066  C CD2 . HIS A 1 401 ? 45.057  78.561  -76.174  1.00 40.00 ? 405 HIS A CD2 1 
ATOM 3067  C CE1 . HIS A 1 401 ? 45.021  78.866  -73.989  1.00 40.00 ? 405 HIS A CE1 1 
ATOM 3068  N NE2 . HIS A 1 401 ? 44.498  79.273  -75.141  1.00 40.00 ? 405 HIS A NE2 1 
ATOM 3069  N N   . ASN A 1 402 ? 44.984  74.208  -76.197  1.00 40.00 ? 406 ASN A N   1 
ATOM 3070  C CA  . ASN A 1 402 ? 43.629  73.732  -76.164  1.00 40.00 ? 406 ASN A CA  1 
ATOM 3071  C C   . ASN A 1 402 ? 43.467  72.296  -75.724  1.00 40.00 ? 406 ASN A C   1 
ATOM 3072  O O   . ASN A 1 402 ? 42.464  71.942  -75.088  1.00 40.00 ? 406 ASN A O   1 
ATOM 3073  C CB  . ASN A 1 402 ? 43.030  73.809  -77.597  1.00 40.00 ? 406 ASN A CB  1 
ATOM 3074  C CG  . ASN A 1 402 ? 42.853  75.213  -78.090  1.00 40.00 ? 406 ASN A CG  1 
ATOM 3075  O OD1 . ASN A 1 402 ? 42.071  75.994  -77.550  1.00 40.00 ? 406 ASN A OD1 1 
ATOM 3076  N ND2 . ASN A 1 402 ? 43.602  75.521  -79.160  1.00 40.00 ? 406 ASN A ND2 1 
ATOM 3077  N N   . VAL A 1 403 ? 44.404  71.422  -76.116  1.00 40.00 ? 407 VAL A N   1 
ATOM 3078  C CA  . VAL A 1 403 ? 44.181  70.017  -75.772  1.00 40.00 ? 407 VAL A CA  1 
ATOM 3079  C C   . VAL A 1 403 ? 45.151  69.441  -74.792  1.00 40.00 ? 407 VAL A C   1 
ATOM 3080  O O   . VAL A 1 403 ? 44.781  69.103  -73.649  1.00 40.00 ? 407 VAL A O   1 
ATOM 3081  C CB  . VAL A 1 403 ? 44.098  69.181  -77.063  1.00 40.00 ? 407 VAL A CB  1 
ATOM 3082  C CG1 . VAL A 1 403 ? 43.550  67.801  -76.720  1.00 40.00 ? 407 VAL A CG1 1 
ATOM 3083  C CG2 . VAL A 1 403 ? 43.195  69.830  -78.115  1.00 40.00 ? 407 VAL A CG2 1 
ATOM 3084  N N   . VAL A 1 404 ? 46.439  69.384  -75.167  1.00 40.00 ? 408 VAL A N   1 
ATOM 3085  C CA  . VAL A 1 404 ? 47.421  68.776  -74.283  1.00 40.00 ? 408 VAL A CA  1 
ATOM 3086  C C   . VAL A 1 404 ? 47.542  69.294  -72.878  1.00 40.00 ? 408 VAL A C   1 
ATOM 3087  O O   . VAL A 1 404 ? 47.213  68.575  -71.929  1.00 40.00 ? 408 VAL A O   1 
ATOM 3088  C CB  . VAL A 1 404 ? 48.817  68.679  -74.908  1.00 40.00 ? 408 VAL A CB  1 
ATOM 3089  C CG1 . VAL A 1 404 ? 49.645  67.745  -74.037  1.00 40.00 ? 408 VAL A CG1 1 
ATOM 3090  C CG2 . VAL A 1 404 ? 48.717  68.117  -76.307  1.00 40.00 ? 408 VAL A CG2 1 
ATOM 3091  N N   . CYS A 1 405 ? 47.913  70.566  -72.712  1.00 40.00 ? 409 CYS A N   1 
ATOM 3092  C CA  . CYS A 1 405 ? 48.058  71.060  -71.328  1.00 40.00 ? 409 CYS A CA  1 
ATOM 3093  C C   . CYS A 1 405 ? 46.797  70.913  -70.518  1.00 40.00 ? 409 CYS A C   1 
ATOM 3094  O O   . CYS A 1 405 ? 46.825  70.465  -69.352  1.00 40.00 ? 409 CYS A O   1 
ATOM 3095  C CB  . CYS A 1 405 ? 48.725  72.417  -71.245  1.00 40.00 ? 409 CYS A CB  1 
ATOM 3096  S SG  . CYS A 1 405 ? 50.323  72.380  -72.159  1.00 40.00 ? 409 CYS A SG  1 
ATOM 3097  N N   . PRO A 1 406 ? 45.634  71.186  -71.082  1.00 40.00 ? 410 PRO A N   1 
ATOM 3098  C CA  . PRO A 1 406 ? 44.379  71.007  -70.368  1.00 40.00 ? 410 PRO A CA  1 
ATOM 3099  C C   . PRO A 1 406 ? 44.198  69.548  -69.953  1.00 40.00 ? 410 PRO A C   1 
ATOM 3100  O O   . PRO A 1 406 ? 43.746  69.261  -68.815  1.00 40.00 ? 410 PRO A O   1 
ATOM 3101  C CB  . PRO A 1 406 ? 43.340  71.481  -71.341  1.00 40.00 ? 410 PRO A CB  1 
ATOM 3102  C CG  . PRO A 1 406 ? 44.052  72.306  -72.365  1.00 40.00 ? 410 PRO A CG  1 
ATOM 3103  C CD  . PRO A 1 406 ? 45.452  71.755  -72.433  1.00 40.00 ? 410 PRO A CD  1 
ATOM 3104  N N   . VAL A 1 407 ? 44.590  68.610  -70.833  1.00 40.00 ? 411 VAL A N   1 
ATOM 3105  C CA  . VAL A 1 407 ? 44.503  67.184  -70.479  1.00 40.00 ? 411 VAL A CA  1 
ATOM 3106  C C   . VAL A 1 407 ? 45.373  66.922  -69.249  1.00 40.00 ? 411 VAL A C   1 
ATOM 3107  O O   . VAL A 1 407 ? 45.069  66.339  -68.225  1.00 40.00 ? 411 VAL A O   1 
ATOM 3108  C CB  . VAL A 1 407 ? 45.162  66.349  -71.607  1.00 40.00 ? 411 VAL A CB  1 
ATOM 3109  C CG1 . VAL A 1 407 ? 45.434  64.921  -71.195  1.00 40.00 ? 411 VAL A CG1 1 
ATOM 3110  C CG2 . VAL A 1 407 ? 44.288  66.390  -72.851  1.00 40.00 ? 411 VAL A CG2 1 
ATOM 3111  N N   . ALA A 1 408 ? 46.609  67.424  -69.409  1.00 40.00 ? 412 ALA A N   1 
ATOM 3112  C CA  . ALA A 1 408 ? 47.567  67.249  -68.298  1.00 40.00 ? 412 ALA A CA  1 
ATOM 3113  C C   . ALA A 1 408 ? 47.082  67.959  -67.051  1.00 40.00 ? 412 ALA A C   1 
ATOM 3114  O O   . ALA A 1 408 ? 47.167  67.416  -65.947  1.00 40.00 ? 412 ALA A O   1 
ATOM 3115  C CB  . ALA A 1 408 ? 48.951  67.640  -68.679  1.00 40.00 ? 412 ALA A CB  1 
ATOM 3116  N N   . GLN A 1 409 ? 46.492  69.145  -67.181  1.00 40.00 ? 413 GLN A N   1 
ATOM 3117  C CA  . GLN A 1 409 ? 45.994  69.814  -65.976  1.00 40.00 ? 413 GLN A CA  1 
ATOM 3118  C C   . GLN A 1 409 ? 44.906  68.969  -65.319  1.00 40.00 ? 413 GLN A C   1 
ATOM 3119  O O   . GLN A 1 409 ? 44.790  68.916  -64.079  1.00 40.00 ? 413 GLN A O   1 
ATOM 3120  C CB  . GLN A 1 409 ? 45.475  71.211  -66.261  1.00 40.00 ? 413 GLN A CB  1 
ATOM 3121  C CG  . GLN A 1 409 ? 44.679  71.828  -65.130  1.00 40.00 ? 413 GLN A CG  1 
ATOM 3122  C CD  . GLN A 1 409 ? 45.495  72.231  -63.934  1.00 40.00 ? 413 GLN A CD  1 
ATOM 3123  O OE1 . GLN A 1 409 ? 46.720  72.000  -63.863  1.00 40.00 ? 413 GLN A OE1 1 
ATOM 3124  N NE2 . GLN A 1 409 ? 44.840  72.852  -62.951  1.00 40.00 ? 413 GLN A NE2 1 
ATOM 3125  N N   . LEU A 1 410 ? 44.112  68.312  -66.171  1.00 40.00 ? 414 LEU A N   1 
ATOM 3126  C CA  . LEU A 1 410 ? 43.043  67.478  -65.601  1.00 40.00 ? 414 LEU A CA  1 
ATOM 3127  C C   . LEU A 1 410 ? 43.613  66.193  -65.030  1.00 40.00 ? 414 LEU A C   1 
ATOM 3128  O O   . LEU A 1 410 ? 43.234  65.816  -63.899  1.00 40.00 ? 414 LEU A O   1 
ATOM 3129  C CB  . LEU A 1 410 ? 41.956  67.193  -66.631  1.00 40.00 ? 414 LEU A CB  1 
ATOM 3130  C CG  . LEU A 1 410 ? 40.785  66.308  -66.270  1.00 40.00 ? 414 LEU A CG  1 
ATOM 3131  C CD1 . LEU A 1 410 ? 39.744  67.007  -65.419  1.00 40.00 ? 414 LEU A CD1 1 
ATOM 3132  C CD2 . LEU A 1 410 ? 40.151  65.692  -67.508  1.00 40.00 ? 414 LEU A CD2 1 
ATOM 3133  N N   . ALA A 1 411 ? 44.505  65.530  -65.775  1.00 40.00 ? 415 ALA A N   1 
ATOM 3134  C CA  . ALA A 1 411 ? 45.075  64.260  -65.287  1.00 40.00 ? 415 ALA A CA  1 
ATOM 3135  C C   . ALA A 1 411 ? 45.562  64.421  -63.850  1.00 40.00 ? 415 ALA A C   1 
ATOM 3136  O O   . ALA A 1 411 ? 45.116  63.793  -62.896  1.00 40.00 ? 415 ALA A O   1 
ATOM 3137  C CB  . ALA A 1 411 ? 46.235  63.796  -66.142  1.00 40.00 ? 415 ALA A CB  1 
ATOM 3138  N N   . GLY A 1 412 ? 46.495  65.363  -63.718  1.00 40.00 ? 416 GLY A N   1 
ATOM 3139  C CA  . GLY A 1 412 ? 47.081  65.675  -62.434  1.00 40.00 ? 416 GLY A CA  1 
ATOM 3140  C C   . GLY A 1 412 ? 46.073  66.073  -61.390  1.00 40.00 ? 416 GLY A C   1 
ATOM 3141  O O   . GLY A 1 412 ? 46.055  65.577  -60.274  1.00 40.00 ? 416 GLY A O   1 
ATOM 3142  N N   . ARG A 1 413 ? 45.147  66.971  -61.711  1.00 40.00 ? 417 ARG A N   1 
ATOM 3143  C CA  . ARG A 1 413 ? 44.152  67.379  -60.715  1.00 40.00 ? 417 ARG A CA  1 
ATOM 3144  C C   . ARG A 1 413 ? 43.319  66.199  -60.250  1.00 40.00 ? 417 ARG A C   1 
ATOM 3145  O O   . ARG A 1 413 ? 42.948  66.076  -59.081  1.00 40.00 ? 417 ARG A O   1 
ATOM 3146  C CB  . ARG A 1 413 ? 43.261  68.506  -61.268  1.00 40.00 ? 417 ARG A CB  1 
ATOM 3147  C CG  . ARG A 1 413 ? 43.667  69.853  -60.622  1.00 40.00 ? 417 ARG A CG  1 
ATOM 3148  C CD  . ARG A 1 413 ? 43.447  69.740  -59.113  1.00 40.00 ? 417 ARG A CD  1 
ATOM 3149  N NE  . ARG A 1 413 ? 44.421  70.511  -58.352  1.00 40.00 ? 417 ARG A NE  1 
ATOM 3150  C CZ  . ARG A 1 413 ? 44.274  71.832  -58.212  1.00 40.00 ? 417 ARG A CZ  1 
ATOM 3151  N NH1 . ARG A 1 413 ? 43.235  72.440  -58.772  1.00 40.00 ? 417 ARG A NH1 1 
ATOM 3152  N NH2 . ARG A 1 413 ? 45.163  72.540  -57.525  1.00 40.00 ? 417 ARG A NH2 1 
ATOM 3153  N N   . LEU A 1 414 ? 43.043  65.328  -61.224  1.00 40.00 ? 418 LEU A N   1 
ATOM 3154  C CA  . LEU A 1 414 ? 42.235  64.153  -60.885  1.00 40.00 ? 418 LEU A CA  1 
ATOM 3155  C C   . LEU A 1 414 ? 42.995  63.240  -59.933  1.00 40.00 ? 418 LEU A C   1 
ATOM 3156  O O   . LEU A 1 414 ? 42.571  62.904  -58.826  1.00 40.00 ? 418 LEU A O   1 
ATOM 3157  C CB  . LEU A 1 414 ? 41.820  63.471  -62.174  1.00 40.00 ? 418 LEU A CB  1 
ATOM 3158  C CG  . LEU A 1 414 ? 40.333  63.366  -62.492  1.00 40.00 ? 418 LEU A CG  1 
ATOM 3159  C CD1 . LEU A 1 414 ? 39.484  64.440  -61.832  1.00 40.00 ? 418 LEU A CD1 1 
ATOM 3160  C CD2 . LEU A 1 414 ? 40.177  63.334  -64.014  1.00 40.00 ? 418 LEU A CD2 1 
ATOM 3161  N N   . ALA A 1 415 ? 44.178  62.849  -60.407  1.00 40.00 ? 419 ALA A N   1 
ATOM 3162  C CA  . ALA A 1 415 ? 45.036  61.949  -59.631  1.00 40.00 ? 419 ALA A CA  1 
ATOM 3163  C C   . ALA A 1 415 ? 45.173  62.486  -58.222  1.00 40.00 ? 419 ALA A C   1 
ATOM 3164  O O   . ALA A 1 415 ? 44.798  61.845  -57.235  1.00 40.00 ? 419 ALA A O   1 
ATOM 3165  C CB  . ALA A 1 415 ? 46.372  61.724  -60.303  1.00 40.00 ? 419 ALA A CB  1 
ATOM 3166  N N   . ALA A 1 416 ? 45.626  63.717  -58.092  1.00 40.00 ? 420 ALA A N   1 
ATOM 3167  C CA  . ALA A 1 416 ? 45.772  64.364  -56.806  1.00 40.00 ? 420 ALA A CA  1 
ATOM 3168  C C   . ALA A 1 416 ? 44.505  64.310  -55.965  1.00 40.00 ? 420 ALA A C   1 
ATOM 3169  O O   . ALA A 1 416 ? 44.607  64.344  -54.735  1.00 40.00 ? 420 ALA A O   1 
ATOM 3170  C CB  . ALA A 1 416 ? 46.174  65.816  -56.994  1.00 40.00 ? 420 ALA A CB  1 
ATOM 3171  N N   . GLN A 1 417 ? 43.328  64.270  -56.575  1.00 40.00 ? 421 GLN A N   1 
ATOM 3172  C CA  . GLN A 1 417 ? 42.120  64.208  -55.787  1.00 40.00 ? 421 GLN A CA  1 
ATOM 3173  C C   . GLN A 1 417 ? 41.602  62.819  -55.483  1.00 40.00 ? 421 GLN A C   1 
ATOM 3174  O O   . GLN A 1 417 ? 40.575  62.722  -54.798  1.00 40.00 ? 421 GLN A O   1 
ATOM 3175  C CB  . GLN A 1 417 ? 41.020  65.029  -56.468  1.00 40.00 ? 421 GLN A CB  1 
ATOM 3176  C CG  . GLN A 1 417 ? 40.550  66.134  -55.512  1.00 40.00 ? 421 GLN A CG  1 
ATOM 3177  C CD  . GLN A 1 417 ? 41.391  67.379  -55.712  1.00 40.00 ? 421 GLN A CD  1 
ATOM 3178  O OE1 . GLN A 1 417 ? 41.353  68.302  -54.884  1.00 40.00 ? 421 GLN A OE1 1 
ATOM 3179  N NE2 . GLN A 1 417 ? 42.143  67.371  -56.814  1.00 40.00 ? 421 GLN A NE2 1 
ATOM 3180  N N   . GLY A 1 418 ? 42.223  61.749  -55.955  1.00 40.00 ? 422 GLY A N   1 
ATOM 3181  C CA  . GLY A 1 418 ? 41.717  60.416  -55.614  1.00 40.00 ? 422 GLY A CA  1 
ATOM 3182  C C   . GLY A 1 418 ? 41.575  59.532  -56.829  1.00 40.00 ? 422 GLY A C   1 
ATOM 3183  O O   . GLY A 1 418 ? 41.636  58.306  -56.777  1.00 40.00 ? 422 GLY A O   1 
ATOM 3184  N N   . ALA A 1 419 ? 41.331  60.154  -57.977  1.00 40.00 ? 423 ALA A N   1 
ATOM 3185  C CA  . ALA A 1 419 ? 41.110  59.374  -59.185  1.00 40.00 ? 423 ALA A CA  1 
ATOM 3186  C C   . ALA A 1 419 ? 42.233  58.375  -59.445  1.00 40.00 ? 423 ALA A C   1 
ATOM 3187  O O   . ALA A 1 419 ? 43.352  58.614  -59.037  1.00 40.00 ? 423 ALA A O   1 
ATOM 3188  C CB  . ALA A 1 419 ? 41.073  60.305  -60.416  1.00 40.00 ? 423 ALA A CB  1 
ATOM 3189  N N   . ARG A 1 420 ? 41.882  57.330  -60.161  1.00 40.00 ? 424 ARG A N   1 
ATOM 3190  C CA  . ARG A 1 420 ? 42.911  56.409  -60.640  1.00 40.00 ? 424 ARG A CA  1 
ATOM 3191  C C   . ARG A 1 420 ? 42.953  56.877  -62.116  1.00 40.00 ? 424 ARG A C   1 
ATOM 3192  O O   . ARG A 1 420 ? 41.903  56.776  -62.768  1.00 40.00 ? 424 ARG A O   1 
ATOM 3193  C CB  . ARG A 1 420 ? 42.595  54.950  -60.542  1.00 40.00 ? 424 ARG A CB  1 
ATOM 3194  C CG  . ARG A 1 420 ? 43.292  54.059  -61.565  1.00 40.00 ? 424 ARG A CG  1 
ATOM 3195  C CD  . ARG A 1 420 ? 42.811  52.628  -61.444  1.00 40.00 ? 424 ARG A CD  1 
ATOM 3196  N NE  . ARG A 1 420 ? 43.819  51.704  -60.997  1.00 40.00 ? 424 ARG A NE  1 
ATOM 3197  C CZ  . ARG A 1 420 ? 44.566  51.669  -59.910  1.00 40.00 ? 424 ARG A CZ  1 
ATOM 3198  N NH1 . ARG A 1 420 ? 44.503  52.589  -58.951  1.00 40.00 ? 424 ARG A NH1 1 
ATOM 3199  N NH2 . ARG A 1 420 ? 45.431  50.652  -59.768  1.00 40.00 ? 424 ARG A NH2 1 
ATOM 3200  N N   . VAL A 1 421 ? 44.034  57.469  -62.541  1.00 40.00 ? 425 VAL A N   1 
ATOM 3201  C CA  . VAL A 1 421 ? 44.049  57.997  -63.917  1.00 40.00 ? 425 VAL A CA  1 
ATOM 3202  C C   . VAL A 1 421 ? 45.000  57.219  -64.775  1.00 40.00 ? 425 VAL A C   1 
ATOM 3203  O O   . VAL A 1 421 ? 45.941  56.649  -64.218  1.00 40.00 ? 425 VAL A O   1 
ATOM 3204  C CB  . VAL A 1 421 ? 44.594  59.458  -63.811  1.00 40.00 ? 425 VAL A CB  1 
ATOM 3205  C CG1 . VAL A 1 421 ? 44.724  60.074  -65.186  1.00 40.00 ? 425 VAL A CG1 1 
ATOM 3206  C CG2 . VAL A 1 421 ? 43.757  60.268  -62.825  1.00 40.00 ? 425 VAL A CG2 1 
ATOM 3207  N N   . TYR A 1 422 ? 44.842  57.109  -66.071  1.00 40.00 ? 426 TYR A N   1 
ATOM 3208  C CA  . TYR A 1 422 ? 45.801  56.427  -66.947  1.00 40.00 ? 426 TYR A CA  1 
ATOM 3209  C C   . TYR A 1 422 ? 45.981  57.445  -68.081  1.00 40.00 ? 426 TYR A C   1 
ATOM 3210  O O   . TYR A 1 422 ? 44.993  58.148  -68.268  1.00 40.00 ? 426 TYR A O   1 
ATOM 3211  C CB  . TYR A 1 422 ? 45.325  55.118  -67.561  1.00 40.00 ? 426 TYR A CB  1 
ATOM 3212  C CG  . TYR A 1 422 ? 45.256  54.012  -66.529  1.00 40.00 ? 426 TYR A CG  1 
ATOM 3213  C CD1 . TYR A 1 422 ? 44.283  54.078  -65.529  1.00 40.00 ? 426 TYR A CD1 1 
ATOM 3214  C CD2 . TYR A 1 422 ? 46.125  52.938  -66.522  1.00 40.00 ? 426 TYR A CD2 1 
ATOM 3215  C CE1 . TYR A 1 422 ? 44.183  53.119  -64.543  1.00 40.00 ? 426 TYR A CE1 1 
ATOM 3216  C CE2 . TYR A 1 422 ? 46.032  51.960  -65.542  1.00 40.00 ? 426 TYR A CE2 1 
ATOM 3217  C CZ  . TYR A 1 422 ? 45.060  52.057  -64.562  1.00 40.00 ? 426 TYR A CZ  1 
ATOM 3218  O OH  . TYR A 1 422 ? 44.946  51.111  -63.582  1.00 40.00 ? 426 TYR A OH  1 
ATOM 3219  N N   . ALA A 1 423 ? 47.094  57.527  -68.755  1.00 40.00 ? 427 ALA A N   1 
ATOM 3220  C CA  . ALA A 1 423 ? 47.248  58.532  -69.807  1.00 40.00 ? 427 ALA A CA  1 
ATOM 3221  C C   . ALA A 1 423 ? 47.973  57.977  -71.008  1.00 40.00 ? 427 ALA A C   1 
ATOM 3222  O O   . ALA A 1 423 ? 48.628  56.931  -70.890  1.00 40.00 ? 427 ALA A O   1 
ATOM 3223  C CB  . ALA A 1 423 ? 48.005  59.717  -69.219  1.00 40.00 ? 427 ALA A CB  1 
ATOM 3224  N N   . TYR A 1 424 ? 47.904  58.652  -72.158  1.00 40.00 ? 428 TYR A N   1 
ATOM 3225  C CA  . TYR A 1 424 ? 48.567  58.056  -73.331  1.00 40.00 ? 428 TYR A CA  1 
ATOM 3226  C C   . TYR A 1 424 ? 48.880  59.060  -74.402  1.00 40.00 ? 428 TYR A C   1 
ATOM 3227  O O   . TYR A 1 424 ? 48.393  60.211  -74.343  1.00 40.00 ? 428 TYR A O   1 
ATOM 3228  C CB  . TYR A 1 424 ? 47.540  57.040  -73.896  1.00 40.00 ? 428 TYR A CB  1 
ATOM 3229  C CG  . TYR A 1 424 ? 46.309  57.603  -74.543  1.00 40.00 ? 428 TYR A CG  1 
ATOM 3230  C CD1 . TYR A 1 424 ? 45.077  57.551  -73.918  1.00 40.00 ? 428 TYR A CD1 1 
ATOM 3231  C CD2 . TYR A 1 424 ? 46.369  58.176  -75.824  1.00 40.00 ? 428 TYR A CD2 1 
ATOM 3232  C CE1 . TYR A 1 424 ? 43.921  58.044  -74.507  1.00 40.00 ? 428 TYR A CE1 1 
ATOM 3233  C CE2 . TYR A 1 424 ? 45.236  58.689  -76.431  1.00 40.00 ? 428 TYR A CE2 1 
ATOM 3234  C CZ  . TYR A 1 424 ? 44.019  58.608  -75.756  1.00 40.00 ? 428 TYR A CZ  1 
ATOM 3235  O OH  . TYR A 1 424 ? 42.903  59.130  -76.364  1.00 40.00 ? 428 TYR A OH  1 
ATOM 3236  N N   . ILE A 1 425 ? 49.636  58.686  -75.432  1.00 40.00 ? 429 ILE A N   1 
ATOM 3237  C CA  . ILE A 1 425 ? 49.879  59.665  -76.496  1.00 40.00 ? 429 ILE A CA  1 
ATOM 3238  C C   . ILE A 1 425 ? 49.711  58.908  -77.807  1.00 40.00 ? 429 ILE A C   1 
ATOM 3239  O O   . ILE A 1 425 ? 50.611  58.153  -78.163  1.00 40.00 ? 429 ILE A O   1 
ATOM 3240  C CB  . ILE A 1 425 ? 51.276  60.276  -76.469  1.00 40.00 ? 429 ILE A CB  1 
ATOM 3241  C CG1 . ILE A 1 425 ? 51.499  61.104  -75.204  1.00 40.00 ? 429 ILE A CG1 1 
ATOM 3242  C CG2 . ILE A 1 425 ? 51.565  61.164  -77.684  1.00 40.00 ? 429 ILE A CG2 1 
ATOM 3243  C CD1 . ILE A 1 425 ? 50.534  62.268  -75.076  1.00 40.00 ? 429 ILE A CD1 1 
ATOM 3244  N N   . PHE A 1 426 ? 48.589  59.074  -78.489  1.00 40.00 ? 430 PHE A N   1 
ATOM 3245  C CA  . PHE A 1 426 ? 48.454  58.283  -79.748  1.00 40.00 ? 430 PHE A CA  1 
ATOM 3246  C C   . PHE A 1 426 ? 49.474  58.810  -80.726  1.00 40.00 ? 430 PHE A C   1 
ATOM 3247  O O   . PHE A 1 426 ? 49.442  60.026  -80.969  1.00 40.00 ? 430 PHE A O   1 
ATOM 3248  C CB  . PHE A 1 426 ? 47.037  58.389  -80.230  1.00 40.00 ? 430 PHE A CB  1 
ATOM 3249  C CG  . PHE A 1 426 ? 46.641  57.464  -81.339  1.00 40.00 ? 430 PHE A CG  1 
ATOM 3250  C CD1 . PHE A 1 426 ? 45.994  56.264  -81.082  1.00 40.00 ? 430 PHE A CD1 1 
ATOM 3251  C CD2 . PHE A 1 426 ? 46.901  57.817  -82.661  1.00 40.00 ? 430 PHE A CD2 1 
ATOM 3252  C CE1 . PHE A 1 426 ? 45.619  55.432  -82.117  1.00 40.00 ? 430 PHE A CE1 1 
ATOM 3253  C CE2 . PHE A 1 426 ? 46.526  56.987  -83.698  1.00 40.00 ? 430 PHE A CE2 1 
ATOM 3254  C CZ  . PHE A 1 426 ? 45.885  55.803  -83.428  1.00 40.00 ? 430 PHE A CZ  1 
ATOM 3255  N N   . GLU A 1 427 ? 50.378  57.995  -81.249  1.00 40.00 ? 431 GLU A N   1 
ATOM 3256  C CA  . GLU A 1 427 ? 51.376  58.544  -82.166  1.00 40.00 ? 431 GLU A CA  1 
ATOM 3257  C C   . GLU A 1 427 ? 51.380  57.907  -83.536  1.00 40.00 ? 431 GLU A C   1 
ATOM 3258  O O   . GLU A 1 427 ? 52.217  58.275  -84.373  1.00 40.00 ? 431 GLU A O   1 
ATOM 3259  C CB  . GLU A 1 427 ? 52.768  58.494  -81.559  1.00 40.00 ? 431 GLU A CB  1 
ATOM 3260  C CG  . GLU A 1 427 ? 52.913  59.024  -80.146  1.00 40.00 ? 431 GLU A CG  1 
ATOM 3261  C CD  . GLU A 1 427 ? 54.322  58.888  -79.593  1.00 40.00 ? 431 GLU A CD  1 
ATOM 3262  O OE1 . GLU A 1 427 ? 54.935  59.913  -79.214  1.00 40.00 ? 431 GLU A OE1 1 
ATOM 3263  O OE2 . GLU A 1 427 ? 54.868  57.765  -79.528  1.00 40.00 ? 431 GLU A OE2 1 
ATOM 3264  N N   . HIS A 1 428 ? 50.467  56.977  -83.809  1.00 40.00 ? 432 HIS A N   1 
ATOM 3265  C CA  . HIS A 1 428 ? 50.446  56.325  -85.118  1.00 40.00 ? 432 HIS A CA  1 
ATOM 3266  C C   . HIS A 1 428 ? 49.569  57.027  -86.139  1.00 40.00 ? 432 HIS A C   1 
ATOM 3267  O O   . HIS A 1 428 ? 48.361  57.242  -86.022  1.00 40.00 ? 432 HIS A O   1 
ATOM 3268  C CB  . HIS A 1 428 ? 50.063  54.846  -85.004  1.00 40.00 ? 432 HIS A CB  1 
ATOM 3269  C CG  . HIS A 1 428 ? 49.826  54.218  -86.345  1.00 40.00 ? 432 HIS A CG  1 
ATOM 3270  N ND1 . HIS A 1 428 ? 50.754  54.329  -87.356  1.00 40.00 ? 432 HIS A ND1 1 
ATOM 3271  C CD2 . HIS A 1 428 ? 48.786  53.528  -86.861  1.00 40.00 ? 432 HIS A CD2 1 
ATOM 3272  C CE1 . HIS A 1 428 ? 50.303  53.712  -88.443  1.00 40.00 ? 432 HIS A CE1 1 
ATOM 3273  N NE2 . HIS A 1 428 ? 49.110  53.226  -88.170  1.00 40.00 ? 432 HIS A NE2 1 
ATOM 3274  N N   . ARG A 1 429 ? 50.223  57.433  -87.228  1.00 40.00 ? 433 ARG A N   1 
ATOM 3275  C CA  . ARG A 1 429 ? 49.523  58.135  -88.316  1.00 40.00 ? 433 ARG A CA  1 
ATOM 3276  C C   . ARG A 1 429 ? 48.926  57.081  -89.232  1.00 40.00 ? 433 ARG A C   1 
ATOM 3277  O O   . ARG A 1 429 ? 49.692  56.272  -89.765  1.00 40.00 ? 433 ARG A O   1 
ATOM 3278  C CB  . ARG A 1 429 ? 50.499  59.035  -89.040  1.00 40.00 ? 433 ARG A CB  1 
ATOM 3279  C CG  . ARG A 1 429 ? 50.057  59.500  -90.404  1.00 40.00 ? 433 ARG A CG  1 
ATOM 3280  C CD  . ARG A 1 429 ? 51.069  60.418  -91.059  1.00 40.00 ? 433 ARG A CD  1 
ATOM 3281  N NE  . ARG A 1 429 ? 50.551  61.696  -91.470  1.00 40.00 ? 433 ARG A NE  1 
ATOM 3282  C CZ  . ARG A 1 429 ? 50.146  61.989  -92.705  1.00 40.00 ? 433 ARG A CZ  1 
ATOM 3283  N NH1 . ARG A 1 429 ? 50.214  61.046  -93.643  1.00 40.00 ? 433 ARG A NH1 1 
ATOM 3284  N NH2 . ARG A 1 429 ? 49.682  63.187  -93.004  1.00 40.00 ? 433 ARG A NH2 1 
ATOM 3285  N N   . ALA A 1 430 ? 47.598  57.062  -89.368  1.00 40.00 ? 434 ALA A N   1 
ATOM 3286  C CA  . ALA A 1 430 ? 46.986  56.022  -90.215  1.00 40.00 ? 434 ALA A CA  1 
ATOM 3287  C C   . ALA A 1 430 ? 47.577  56.097  -91.615  1.00 40.00 ? 434 ALA A C   1 
ATOM 3288  O O   . ALA A 1 430 ? 47.899  57.186  -92.083  1.00 40.00 ? 434 ALA A O   1 
ATOM 3289  C CB  . ALA A 1 430 ? 45.491  56.118  -90.197  1.00 40.00 ? 434 ALA A CB  1 
ATOM 3290  N N   . SER A 1 431 ? 47.749  54.927  -92.244  1.00 40.00 ? 435 SER A N   1 
ATOM 3291  C CA  . SER A 1 431 ? 48.370  54.863  -93.568  1.00 40.00 ? 435 SER A CA  1 
ATOM 3292  C C   . SER A 1 431 ? 47.483  55.508  -94.629  1.00 40.00 ? 435 SER A C   1 
ATOM 3293  O O   . SER A 1 431 ? 47.929  56.125  -95.592  1.00 40.00 ? 435 SER A O   1 
ATOM 3294  C CB  . SER A 1 431 ? 48.701  53.434  -93.979  1.00 40.00 ? 435 SER A CB  1 
ATOM 3295  O OG  . SER A 1 431 ? 47.545  52.612  -93.996  1.00 40.00 ? 435 SER A OG  1 
ATOM 3296  N N   . THR A 1 432 ? 46.202  55.357  -94.383  1.00 40.00 ? 436 THR A N   1 
ATOM 3297  C CA  . THR A 1 432 ? 45.094  55.863  -95.156  1.00 40.00 ? 436 THR A CA  1 
ATOM 3298  C C   . THR A 1 432 ? 44.860  57.366  -95.030  1.00 40.00 ? 436 THR A C   1 
ATOM 3299  O O   . THR A 1 432 ? 44.181  57.958  -95.882  1.00 40.00 ? 436 THR A O   1 
ATOM 3300  C CB  . THR A 1 432 ? 43.834  55.137  -94.587  1.00 40.00 ? 436 THR A CB  1 
ATOM 3301  O OG1 . THR A 1 432 ? 43.694  55.542  -93.207  1.00 40.00 ? 436 THR A OG1 1 
ATOM 3302  C CG2 . THR A 1 432 ? 44.022  53.629  -94.629  1.00 40.00 ? 436 THR A CG2 1 
ATOM 3303  N N   . LEU A 1 433 ? 45.366  58.010  -93.986  1.00 40.00 ? 437 LEU A N   1 
ATOM 3304  C CA  . LEU A 1 433 ? 45.199  59.446  -93.742  1.00 40.00 ? 437 LEU A CA  1 
ATOM 3305  C C   . LEU A 1 433 ? 45.320  60.271  -95.014  1.00 40.00 ? 437 LEU A C   1 
ATOM 3306  O O   . LEU A 1 433 ? 46.297  60.192  -95.752  1.00 40.00 ? 437 LEU A O   1 
ATOM 3307  C CB  . LEU A 1 433 ? 46.203  59.873  -92.685  1.00 40.00 ? 437 LEU A CB  1 
ATOM 3308  C CG  . LEU A 1 433 ? 45.958  61.026  -91.739  1.00 40.00 ? 437 LEU A CG  1 
ATOM 3309  C CD1 . LEU A 1 433 ? 45.490  62.266  -92.496  1.00 40.00 ? 437 LEU A CD1 1 
ATOM 3310  C CD2 . LEU A 1 433 ? 44.965  60.683  -90.641  1.00 40.00 ? 437 LEU A CD2 1 
ATOM 3311  N N   . THR A 1 434 ? 44.327  61.095  -95.313  1.00 40.00 ? 438 THR A N   1 
ATOM 3312  C CA  . THR A 1 434 ? 44.291  61.915  -96.512  1.00 40.00 ? 438 THR A CA  1 
ATOM 3313  C C   . THR A 1 434 ? 44.805  63.338  -96.350  1.00 40.00 ? 438 THR A C   1 
ATOM 3314  O O   . THR A 1 434 ? 44.868  64.105  -97.332  1.00 40.00 ? 438 THR A O   1 
ATOM 3315  C CB  . THR A 1 434 ? 42.847  61.998  -97.080  1.00 40.00 ? 438 THR A CB  1 
ATOM 3316  O OG1 . THR A 1 434 ? 41.898  61.881  -96.014  1.00 40.00 ? 438 THR A OG1 1 
ATOM 3317  C CG2 . THR A 1 434 ? 42.649  60.860  -98.060  1.00 40.00 ? 438 THR A CG2 1 
ATOM 3318  N N   . TRP A 1 435 ? 45.137  63.699  -95.111  1.00 40.00 ? 439 TRP A N   1 
ATOM 3319  C CA  . TRP A 1 435 ? 45.688  65.045  -94.847  1.00 40.00 ? 439 TRP A CA  1 
ATOM 3320  C C   . TRP A 1 435 ? 47.172  64.980  -95.204  1.00 40.00 ? 439 TRP A C   1 
ATOM 3321  O O   . TRP A 1 435 ? 47.699  63.869  -95.367  1.00 40.00 ? 439 TRP A O   1 
ATOM 3322  C CB  . TRP A 1 435 ? 45.443  65.453  -93.425  1.00 40.00 ? 439 TRP A CB  1 
ATOM 3323  C CG  . TRP A 1 435 ? 44.042  65.718  -92.973  1.00 40.00 ? 439 TRP A CG  1 
ATOM 3324  C CD1 . TRP A 1 435 ? 43.223  64.844  -92.313  1.00 40.00 ? 439 TRP A CD1 1 
ATOM 3325  C CD2 . TRP A 1 435 ? 43.284  66.927  -93.104  1.00 40.00 ? 439 TRP A CD2 1 
ATOM 3326  N NE1 . TRP A 1 435 ? 42.012  65.438  -92.032  1.00 40.00 ? 439 TRP A NE1 1 
ATOM 3327  C CE2 . TRP A 1 435 ? 42.025  66.708  -92.508  1.00 40.00 ? 439 TRP A CE2 1 
ATOM 3328  C CE3 . TRP A 1 435 ? 43.554  68.175  -93.666  1.00 40.00 ? 439 TRP A CE3 1 
ATOM 3329  C CZ2 . TRP A 1 435 ? 41.036  67.683  -92.455  1.00 40.00 ? 439 TRP A CZ2 1 
ATOM 3330  C CZ3 . TRP A 1 435 ? 42.558  69.151  -93.616  1.00 40.00 ? 439 TRP A CZ3 1 
ATOM 3331  C CH2 . TRP A 1 435 ? 41.324  68.900  -93.013  1.00 40.00 ? 439 TRP A CH2 1 
ATOM 3332  N N   . PRO A 1 436 ? 47.824  66.110  -95.366  1.00 40.00 ? 440 PRO A N   1 
ATOM 3333  C CA  . PRO A 1 436 ? 49.229  66.151  -95.745  1.00 40.00 ? 440 PRO A CA  1 
ATOM 3334  C C   . PRO A 1 436 ? 50.095  65.658  -94.613  1.00 40.00 ? 440 PRO A C   1 
ATOM 3335  O O   . PRO A 1 436 ? 49.681  65.661  -93.436  1.00 40.00 ? 440 PRO A O   1 
ATOM 3336  C CB  . PRO A 1 436 ? 49.514  67.585  -96.099  1.00 40.00 ? 440 PRO A CB  1 
ATOM 3337  C CG  . PRO A 1 436 ? 48.372  68.386  -95.614  1.00 40.00 ? 440 PRO A CG  1 
ATOM 3338  C CD  . PRO A 1 436 ? 47.275  67.459  -95.192  1.00 40.00 ? 440 PRO A CD  1 
ATOM 3339  N N   . LEU A 1 437 ? 51.280  65.149  -94.941  1.00 40.00 ? 441 LEU A N   1 
ATOM 3340  C CA  . LEU A 1 437 ? 52.212  64.636  -93.951  1.00 40.00 ? 441 LEU A CA  1 
ATOM 3341  C C   . LEU A 1 437 ? 52.464  65.633  -92.831  1.00 40.00 ? 441 LEU A C   1 
ATOM 3342  O O   . LEU A 1 437 ? 52.457  65.288  -91.641  1.00 40.00 ? 441 LEU A O   1 
ATOM 3343  C CB  . LEU A 1 437 ? 53.549  64.342  -94.642  1.00 40.00 ? 441 LEU A CB  1 
ATOM 3344  C CG  . LEU A 1 437 ? 54.339  63.133  -94.136  1.00 40.00 ? 441 LEU A CG  1 
ATOM 3345  C CD1 . LEU A 1 437 ? 54.749  63.311  -92.680  1.00 40.00 ? 441 LEU A CD1 1 
ATOM 3346  C CD2 . LEU A 1 437 ? 53.549  61.843  -94.326  1.00 40.00 ? 441 LEU A CD2 1 
ATOM 3347  N N   . TRP A 1 438 ? 52.654  66.912  -93.195  1.00 40.00 ? 442 TRP A N   1 
ATOM 3348  C CA  . TRP A 1 438 ? 52.897  67.930  -92.194  1.00 40.00 ? 442 TRP A CA  1 
ATOM 3349  C C   . TRP A 1 438 ? 51.935  67.967  -91.035  1.00 40.00 ? 442 TRP A C   1 
ATOM 3350  O O   . TRP A 1 438 ? 52.336  68.486  -89.972  1.00 40.00 ? 442 TRP A O   1 
ATOM 3351  C CB  . TRP A 1 438 ? 53.084  69.266  -92.833  1.00 40.00 ? 442 TRP A CB  1 
ATOM 3352  C CG  . TRP A 1 438 ? 51.951  70.115  -93.250  1.00 40.00 ? 442 TRP A CG  1 
ATOM 3353  C CD1 . TRP A 1 438 ? 51.597  70.423  -94.545  1.00 40.00 ? 442 TRP A CD1 1 
ATOM 3354  C CD2 . TRP A 1 438 ? 51.041  70.842  -92.421  1.00 40.00 ? 442 TRP A CD2 1 
ATOM 3355  N NE1 . TRP A 1 438 ? 50.534  71.278  -94.567  1.00 40.00 ? 442 TRP A NE1 1 
ATOM 3356  C CE2 . TRP A 1 438 ? 50.173  71.545  -93.268  1.00 40.00 ? 442 TRP A CE2 1 
ATOM 3357  C CE3 . TRP A 1 438 ? 50.893  70.969  -91.040  1.00 40.00 ? 442 TRP A CE3 1 
ATOM 3358  C CZ2 . TRP A 1 438 ? 49.149  72.355  -92.780  1.00 40.00 ? 442 TRP A CZ2 1 
ATOM 3359  C CZ3 . TRP A 1 438 ? 49.879  71.761  -90.555  1.00 40.00 ? 442 TRP A CZ3 1 
ATOM 3360  C CH2 . TRP A 1 438 ? 49.012  72.446  -91.424  1.00 40.00 ? 442 TRP A CH2 1 
ATOM 3361  N N   . MET A 1 439 ? 50.726  67.476  -91.075  1.00 40.00 ? 443 MET A N   1 
ATOM 3362  C CA  . MET A 1 439 ? 49.800  67.515  -89.941  1.00 40.00 ? 443 MET A CA  1 
ATOM 3363  C C   . MET A 1 439 ? 50.004  66.310  -89.045  1.00 40.00 ? 443 MET A C   1 
ATOM 3364  O O   . MET A 1 439 ? 49.437  66.156  -87.934  1.00 40.00 ? 443 MET A O   1 
ATOM 3365  C CB  . MET A 1 439 ? 48.381  67.622  -90.522  1.00 40.00 ? 443 MET A CB  1 
ATOM 3366  C CG  . MET A 1 439 ? 48.304  68.712  -91.613  1.00 40.00 ? 443 MET A CG  1 
ATOM 3367  S SD  . MET A 1 439 ? 46.680  68.920  -92.334  1.00 40.00 ? 443 MET A SD  1 
ATOM 3368  C CE  . MET A 1 439 ? 45.944  70.183  -91.323  1.00 40.00 ? 443 MET A CE  1 
ATOM 3369  N N   . GLY A 1 440 ? 50.877  65.383  -89.512  1.00 40.00 ? 444 GLY A N   1 
ATOM 3370  C CA  . GLY A 1 440 ? 51.192  64.207  -88.729  1.00 40.00 ? 444 GLY A CA  1 
ATOM 3371  C C   . GLY A 1 440 ? 49.974  63.483  -88.221  1.00 40.00 ? 444 GLY A C   1 
ATOM 3372  O O   . GLY A 1 440 ? 49.225  62.958  -89.064  1.00 40.00 ? 444 GLY A O   1 
ATOM 3373  N N   . VAL A 1 441 ? 49.754  63.452  -86.922  1.00 40.00 ? 445 VAL A N   1 
ATOM 3374  C CA  . VAL A 1 441 ? 48.568  62.756  -86.377  1.00 40.00 ? 445 VAL A CA  1 
ATOM 3375  C C   . VAL A 1 441 ? 47.618  63.806  -85.823  1.00 40.00 ? 445 VAL A C   1 
ATOM 3376  O O   . VAL A 1 441 ? 47.739  64.239  -84.693  1.00 40.00 ? 445 VAL A O   1 
ATOM 3377  C CB  . VAL A 1 441 ? 48.992  61.772  -85.306  1.00 40.00 ? 445 VAL A CB  1 
ATOM 3378  C CG1 . VAL A 1 441 ? 47.880  61.454  -84.319  1.00 40.00 ? 445 VAL A CG1 1 
ATOM 3379  C CG2 . VAL A 1 441 ? 49.482  60.511  -85.998  1.00 40.00 ? 445 VAL A CG2 1 
ATOM 3380  N N   . PRO A 1 442 ? 46.699  64.254  -86.666  1.00 40.00 ? 446 PRO A N   1 
ATOM 3381  C CA  . PRO A 1 442 ? 45.760  65.299  -86.376  1.00 40.00 ? 446 PRO A CA  1 
ATOM 3382  C C   . PRO A 1 442 ? 44.698  64.970  -85.358  1.00 40.00 ? 446 PRO A C   1 
ATOM 3383  O O   . PRO A 1 442 ? 44.386  63.818  -85.103  1.00 40.00 ? 446 PRO A O   1 
ATOM 3384  C CB  . PRO A 1 442 ? 45.067  65.560  -87.721  1.00 40.00 ? 446 PRO A CB  1 
ATOM 3385  C CG  . PRO A 1 442 ? 46.048  65.048  -88.726  1.00 40.00 ? 446 PRO A CG  1 
ATOM 3386  C CD  . PRO A 1 442 ? 46.517  63.770  -88.077  1.00 40.00 ? 446 PRO A CD  1 
ATOM 3387  N N   . HIS A 1 443 ? 44.130  66.028  -84.805  1.00 40.00 ? 447 HIS A N   1 
ATOM 3388  C CA  . HIS A 1 443 ? 43.041  65.865  -83.828  1.00 40.00 ? 447 HIS A CA  1 
ATOM 3389  C C   . HIS A 1 443 ? 42.007  64.917  -84.424  1.00 40.00 ? 447 HIS A C   1 
ATOM 3390  O O   . HIS A 1 443 ? 41.611  65.089  -85.569  1.00 40.00 ? 447 HIS A O   1 
ATOM 3391  C CB  . HIS A 1 443 ? 42.469  67.250  -83.563  1.00 40.00 ? 447 HIS A CB  1 
ATOM 3392  C CG  . HIS A 1 443 ? 41.412  67.359  -82.540  1.00 40.00 ? 447 HIS A CG  1 
ATOM 3393  N ND1 . HIS A 1 443 ? 41.662  67.197  -81.184  1.00 40.00 ? 447 HIS A ND1 1 
ATOM 3394  C CD2 . HIS A 1 443 ? 40.085  67.616  -82.652  1.00 40.00 ? 447 HIS A CD2 1 
ATOM 3395  C CE1 . HIS A 1 443 ? 40.524  67.343  -80.518  1.00 40.00 ? 447 HIS A CE1 1 
ATOM 3396  N NE2 . HIS A 1 443 ? 39.546  67.596  -81.382  1.00 40.00 ? 447 HIS A NE2 1 
ATOM 3397  N N   . GLY A 1 444 ? 41.602  63.885  -83.684  1.00 40.00 ? 448 GLY A N   1 
ATOM 3398  C CA  . GLY A 1 444 ? 40.609  62.958  -84.165  1.00 40.00 ? 448 GLY A CA  1 
ATOM 3399  C C   . GLY A 1 444 ? 41.050  61.762  -84.941  1.00 40.00 ? 448 GLY A C   1 
ATOM 3400  O O   . GLY A 1 444 ? 40.235  60.876  -85.282  1.00 40.00 ? 448 GLY A O   1 
ATOM 3401  N N   . TYR A 1 445 ? 42.344  61.604  -85.240  1.00 40.00 ? 449 TYR A N   1 
ATOM 3402  C CA  . TYR A 1 445 ? 42.726  60.408  -86.005  1.00 40.00 ? 449 TYR A CA  1 
ATOM 3403  C C   . TYR A 1 445 ? 43.078  59.192  -85.209  1.00 40.00 ? 449 TYR A C   1 
ATOM 3404  O O   . TYR A 1 445 ? 43.789  58.292  -85.704  1.00 40.00 ? 449 TYR A O   1 
ATOM 3405  C CB  . TYR A 1 445 ? 43.667  60.886  -87.105  1.00 40.00 ? 449 TYR A CB  1 
ATOM 3406  C CG  . TYR A 1 445 ? 42.784  61.761  -88.008  1.00 40.00 ? 449 TYR A CG  1 
ATOM 3407  C CD1 . TYR A 1 445 ? 42.551  63.097  -87.736  1.00 40.00 ? 449 TYR A CD1 1 
ATOM 3408  C CD2 . TYR A 1 445 ? 42.164  61.175  -89.100  1.00 40.00 ? 449 TYR A CD2 1 
ATOM 3409  C CE1 . TYR A 1 445 ? 41.731  63.851  -88.559  1.00 40.00 ? 449 TYR A CE1 1 
ATOM 3410  C CE2 . TYR A 1 445 ? 41.360  61.931  -89.945  1.00 40.00 ? 449 TYR A CE2 1 
ATOM 3411  C CZ  . TYR A 1 445 ? 41.145  63.271  -89.663  1.00 40.00 ? 449 TYR A CZ  1 
ATOM 3412  O OH  . TYR A 1 445 ? 40.318  63.977  -90.512  1.00 40.00 ? 449 TYR A OH  1 
ATOM 3413  N N   . GLU A 1 446 ? 42.547  59.045  -83.987  1.00 40.00 ? 450 GLU A N   1 
ATOM 3414  C CA  . GLU A 1 446 ? 42.762  57.835  -83.207  1.00 40.00 ? 450 GLU A CA  1 
ATOM 3415  C C   . GLU A 1 446 ? 41.457  57.013  -83.299  1.00 40.00 ? 450 GLU A C   1 
ATOM 3416  O O   . GLU A 1 446 ? 41.425  55.800  -83.091  1.00 40.00 ? 450 GLU A O   1 
ATOM 3417  C CB  . GLU A 1 446 ? 42.981  58.123  -81.718  1.00 40.00 ? 450 GLU A CB  1 
ATOM 3418  C CG  . GLU A 1 446 ? 41.685  58.476  -80.966  1.00 40.00 ? 450 GLU A CG  1 
ATOM 3419  C CD  . GLU A 1 446 ? 41.535  59.978  -80.759  1.00 40.00 ? 450 GLU A CD  1 
ATOM 3420  O OE1 . GLU A 1 446 ? 41.869  60.723  -81.713  1.00 40.00 ? 450 GLU A OE1 1 
ATOM 3421  O OE2 . GLU A 1 446 ? 41.110  60.329  -79.631  1.00 40.00 ? 450 GLU A OE2 1 
ATOM 3422  N N   . ILE A 1 447 ? 40.336  57.732  -83.547  1.00 40.00 ? 451 ILE A N   1 
ATOM 3423  C CA  . ILE A 1 447 ? 39.012  57.132  -83.560  1.00 40.00 ? 451 ILE A CA  1 
ATOM 3424  C C   . ILE A 1 447 ? 38.894  55.901  -84.440  1.00 40.00 ? 451 ILE A C   1 
ATOM 3425  O O   . ILE A 1 447 ? 38.469  54.831  -83.952  1.00 40.00 ? 451 ILE A O   1 
ATOM 3426  C CB  . ILE A 1 447 ? 37.856  58.074  -83.915  1.00 40.00 ? 451 ILE A CB  1 
ATOM 3427  C CG1 . ILE A 1 447 ? 38.213  59.542  -83.840  1.00 40.00 ? 451 ILE A CG1 1 
ATOM 3428  C CG2 . ILE A 1 447 ? 36.649  57.725  -83.019  1.00 40.00 ? 451 ILE A CG2 1 
ATOM 3429  C CD1 . ILE A 1 447 ? 37.619  60.390  -82.741  1.00 40.00 ? 451 ILE A CD1 1 
ATOM 3430  N N   . GLU A 1 448 ? 39.319  56.059  -85.701  1.00 40.00 ? 452 GLU A N   1 
ATOM 3431  C CA  . GLU A 1 448 ? 39.356  54.912  -86.618  1.00 40.00 ? 452 GLU A CA  1 
ATOM 3432  C C   . GLU A 1 448 ? 39.893  53.698  -85.845  1.00 40.00 ? 452 GLU A C   1 
ATOM 3433  O O   . GLU A 1 448 ? 39.271  52.617  -85.794  1.00 40.00 ? 452 GLU A O   1 
ATOM 3434  C CB  . GLU A 1 448 ? 40.225  55.232  -87.810  1.00 40.00 ? 452 GLU A CB  1 
ATOM 3435  C CG  . GLU A 1 448 ? 40.443  56.700  -88.154  1.00 40.00 ? 452 GLU A CG  1 
ATOM 3436  C CD  . GLU A 1 448 ? 41.093  56.813  -89.528  1.00 40.00 ? 452 GLU A CD  1 
ATOM 3437  O OE1 . GLU A 1 448 ? 41.535  55.731  -89.992  1.00 40.00 ? 452 GLU A OE1 1 
ATOM 3438  O OE2 . GLU A 1 448 ? 41.217  57.858  -90.217  1.00 40.00 ? 452 GLU A OE2 1 
ATOM 3439  N N   . PHE A 1 449 ? 41.030  53.824  -85.157  1.00 40.00 ? 453 PHE A N   1 
ATOM 3440  C CA  . PHE A 1 449 ? 41.578  52.700  -84.403  1.00 40.00 ? 453 PHE A CA  1 
ATOM 3441  C C   . PHE A 1 449 ? 40.763  52.265  -83.226  1.00 40.00 ? 453 PHE A C   1 
ATOM 3442  O O   . PHE A 1 449 ? 40.329  51.087  -83.188  1.00 40.00 ? 453 PHE A O   1 
ATOM 3443  C CB  . PHE A 1 449 ? 43.057  52.980  -84.062  1.00 40.00 ? 453 PHE A CB  1 
ATOM 3444  C CG  . PHE A 1 449 ? 43.805  53.249  -85.356  1.00 40.00 ? 453 PHE A CG  1 
ATOM 3445  C CD1 . PHE A 1 449 ? 43.929  54.529  -85.848  1.00 40.00 ? 453 PHE A CD1 1 
ATOM 3446  C CD2 . PHE A 1 449 ? 44.345  52.214  -86.086  1.00 40.00 ? 453 PHE A CD2 1 
ATOM 3447  C CE1 . PHE A 1 449 ? 44.599  54.757  -87.045  1.00 40.00 ? 453 PHE A CE1 1 
ATOM 3448  C CE2 . PHE A 1 449 ? 45.016  52.437  -87.279  1.00 40.00 ? 453 PHE A CE2 1 
ATOM 3449  C CZ  . PHE A 1 449 ? 45.150  53.716  -87.774  1.00 40.00 ? 453 PHE A CZ  1 
ATOM 3450  N N   . ILE A 1 450 ? 40.486  53.128  -82.251  1.00 40.00 ? 454 ILE A N   1 
ATOM 3451  C CA  . ILE A 1 450 ? 39.676  52.655  -81.100  1.00 40.00 ? 454 ILE A CA  1 
ATOM 3452  C C   . ILE A 1 450 ? 38.442  51.914  -81.574  1.00 40.00 ? 454 ILE A C   1 
ATOM 3453  O O   . ILE A 1 450 ? 38.127  50.836  -81.092  1.00 40.00 ? 454 ILE A O   1 
ATOM 3454  C CB  . ILE A 1 450 ? 39.247  53.838  -80.220  1.00 40.00 ? 454 ILE A CB  1 
ATOM 3455  C CG1 . ILE A 1 450 ? 40.466  54.722  -79.912  1.00 40.00 ? 454 ILE A CG1 1 
ATOM 3456  C CG2 . ILE A 1 450 ? 38.578  53.411  -78.930  1.00 40.00 ? 454 ILE A CG2 1 
ATOM 3457  C CD1 . ILE A 1 450 ? 41.395  54.098  -78.900  1.00 40.00 ? 454 ILE A CD1 1 
ATOM 3458  N N   . PHE A 1 451 ? 37.704  52.460  -82.553  1.00 40.00 ? 455 PHE A N   1 
ATOM 3459  C CA  . PHE A 1 451 ? 36.497  51.782  -83.035  1.00 40.00 ? 455 PHE A CA  1 
ATOM 3460  C C   . PHE A 1 451 ? 36.780  50.481  -83.748  1.00 40.00 ? 455 PHE A C   1 
ATOM 3461  O O   . PHE A 1 451 ? 35.910  49.599  -83.763  1.00 40.00 ? 455 PHE A O   1 
ATOM 3462  C CB  . PHE A 1 451 ? 35.563  52.744  -83.815  1.00 40.00 ? 455 PHE A CB  1 
ATOM 3463  C CG  . PHE A 1 451 ? 34.673  53.475  -82.816  1.00 40.00 ? 455 PHE A CG  1 
ATOM 3464  C CD1 . PHE A 1 451 ? 35.092  54.685  -82.275  1.00 40.00 ? 455 PHE A CD1 1 
ATOM 3465  C CD2 . PHE A 1 451 ? 33.475  52.931  -82.399  1.00 40.00 ? 455 PHE A CD2 1 
ATOM 3466  C CE1 . PHE A 1 451 ? 34.304  55.334  -81.337  1.00 40.00 ? 455 PHE A CE1 1 
ATOM 3467  C CE2 . PHE A 1 451 ? 32.686  53.584  -81.465  1.00 40.00 ? 455 PHE A CE2 1 
ATOM 3468  C CZ  . PHE A 1 451 ? 33.091  54.789  -80.933  1.00 40.00 ? 455 PHE A CZ  1 
ATOM 3469  N N   . GLY A 1 452 ? 37.975  50.279  -84.282  1.00 40.00 ? 456 GLY A N   1 
ATOM 3470  C CA  . GLY A 1 452 ? 38.324  49.010  -84.886  1.00 40.00 ? 456 GLY A CA  1 
ATOM 3471  C C   . GLY A 1 452 ? 38.085  48.979  -86.364  1.00 40.00 ? 456 GLY A C   1 
ATOM 3472  O O   . GLY A 1 452 ? 38.059  47.917  -86.994  1.00 40.00 ? 456 GLY A O   1 
ATOM 3473  N N   . LEU A 1 453 ? 38.120  50.139  -87.029  1.00 40.00 ? 457 LEU A N   1 
ATOM 3474  C CA  . LEU A 1 453 ? 37.934  50.169  -88.476  1.00 40.00 ? 457 LEU A CA  1 
ATOM 3475  C C   . LEU A 1 453 ? 38.928  49.388  -89.274  1.00 40.00 ? 457 LEU A C   1 
ATOM 3476  O O   . LEU A 1 453 ? 38.610  48.840  -90.340  1.00 40.00 ? 457 LEU A O   1 
ATOM 3477  C CB  . LEU A 1 453 ? 37.729  51.600  -88.992  1.00 40.00 ? 457 LEU A CB  1 
ATOM 3478  C CG  . LEU A 1 453 ? 36.237  52.001  -88.961  1.00 40.00 ? 457 LEU A CG  1 
ATOM 3479  C CD1 . LEU A 1 453 ? 35.692  51.906  -87.539  1.00 40.00 ? 457 LEU A CD1 1 
ATOM 3480  C CD2 . LEU A 1 453 ? 36.010  53.378  -89.557  1.00 40.00 ? 457 LEU A CD2 1 
ATOM 3481  N N   . PRO A 1 454 ? 40.152  49.230  -88.820  1.00 40.00 ? 458 PRO A N   1 
ATOM 3482  C CA  . PRO A 1 454 ? 41.130  48.441  -89.594  1.00 40.00 ? 458 PRO A CA  1 
ATOM 3483  C C   . PRO A 1 454 ? 40.753  46.983  -89.662  1.00 40.00 ? 458 PRO A C   1 
ATOM 3484  O O   . PRO A 1 454 ? 41.100  46.319  -90.666  1.00 40.00 ? 458 PRO A O   1 
ATOM 3485  C CB  . PRO A 1 454 ? 42.461  48.824  -89.002  1.00 40.00 ? 458 PRO A CB  1 
ATOM 3486  C CG  . PRO A 1 454 ? 42.200  50.083  -88.223  1.00 40.00 ? 458 PRO A CG  1 
ATOM 3487  C CD  . PRO A 1 454 ? 40.817  49.814  -87.630  1.00 40.00 ? 458 PRO A CD  1 
ATOM 3488  N N   . LEU A 1 455 ? 39.971  46.436  -88.730  1.00 40.00 ? 459 LEU A N   1 
ATOM 3489  C CA  . LEU A 1 455 ? 39.506  45.048  -88.797  1.00 40.00 ? 459 LEU A CA  1 
ATOM 3490  C C   . LEU A 1 455 ? 38.711  44.796  -90.080  1.00 40.00 ? 459 LEU A C   1 
ATOM 3491  O O   . LEU A 1 455 ? 38.642  43.661  -90.579  1.00 40.00 ? 459 LEU A O   1 
ATOM 3492  C CB  . LEU A 1 455 ? 38.720  44.644  -87.541  1.00 40.00 ? 459 LEU A CB  1 
ATOM 3493  C CG  . LEU A 1 455 ? 39.499  44.463  -86.237  1.00 40.00 ? 459 LEU A CG  1 
ATOM 3494  C CD1 . LEU A 1 455 ? 39.595  45.715  -85.379  1.00 40.00 ? 459 LEU A CD1 1 
ATOM 3495  C CD2 . LEU A 1 455 ? 38.904  43.362  -85.366  1.00 40.00 ? 459 LEU A CD2 1 
ATOM 3496  N N   . ASP A 1 456 ? 38.100  45.804  -90.694  1.00 40.00 ? 460 ASP A N   1 
ATOM 3497  C CA  . ASP A 1 456 ? 37.394  45.632  -91.960  1.00 40.00 ? 460 ASP A CA  1 
ATOM 3498  C C   . ASP A 1 456 ? 38.429  45.587  -93.095  1.00 40.00 ? 460 ASP A C   1 
ATOM 3499  O O   . ASP A 1 456 ? 39.138  46.554  -93.391  1.00 40.00 ? 460 ASP A O   1 
ATOM 3500  C CB  . ASP A 1 456 ? 36.376  46.735  -92.202  1.00 40.00 ? 460 ASP A CB  1 
ATOM 3501  C CG  . ASP A 1 456 ? 35.609  46.638  -93.504  1.00 40.00 ? 460 ASP A CG  1 
ATOM 3502  O OD1 . ASP A 1 456 ? 35.995  45.891  -94.435  1.00 40.00 ? 460 ASP A OD1 1 
ATOM 3503  O OD2 . ASP A 1 456 ? 34.566  47.335  -93.626  1.00 40.00 ? 460 ASP A OD2 1 
ATOM 3504  N N   . PRO A 1 457 ? 38.487  44.449  -93.767  1.00 40.00 ? 461 PRO A N   1 
ATOM 3505  C CA  . PRO A 1 457 ? 39.414  44.191  -94.845  1.00 40.00 ? 461 PRO A CA  1 
ATOM 3506  C C   . PRO A 1 457 ? 39.234  45.051  -96.071  1.00 40.00 ? 461 PRO A C   1 
ATOM 3507  O O   . PRO A 1 457 ? 40.207  45.361  -96.780  1.00 40.00 ? 461 PRO A O   1 
ATOM 3508  C CB  . PRO A 1 457 ? 39.197  42.719  -95.188  1.00 40.00 ? 461 PRO A CB  1 
ATOM 3509  C CG  . PRO A 1 457 ? 38.601  42.143  -93.932  1.00 40.00 ? 461 PRO A CG  1 
ATOM 3510  C CD  . PRO A 1 457 ? 37.666  43.244  -93.453  1.00 40.00 ? 461 PRO A CD  1 
ATOM 3511  N N   . SER A 1 458 ? 37.993  45.439  -96.351  1.00 40.00 ? 462 SER A N   1 
ATOM 3512  C CA  . SER A 1 458 ? 37.739  46.274  -97.532  1.00 40.00 ? 462 SER A CA  1 
ATOM 3513  C C   . SER A 1 458 ? 38.461  47.610  -97.392  1.00 40.00 ? 462 SER A C   1 
ATOM 3514  O O   . SER A 1 458 ? 39.149  48.085  -98.290  1.00 40.00 ? 462 SER A O   1 
ATOM 3515  C CB  . SER A 1 458 ? 36.234  46.514  -97.656  1.00 40.00 ? 462 SER A CB  1 
ATOM 3516  O OG  . SER A 1 458 ? 35.842  47.498  -96.703  1.00 40.00 ? 462 SER A OG  1 
ATOM 3517  N N   . LEU A 1 459 ? 38.314  48.200  -96.214  1.00 40.00 ? 463 LEU A N   1 
ATOM 3518  C CA  . LEU A 1 459 ? 38.877  49.462  -95.802  1.00 40.00 ? 463 LEU A CA  1 
ATOM 3519  C C   . LEU A 1 459 ? 40.359  49.594  -96.028  1.00 40.00 ? 463 LEU A C   1 
ATOM 3520  O O   . LEU A 1 459 ? 40.883  50.682  -96.275  1.00 40.00 ? 463 LEU A O   1 
ATOM 3521  C CB  . LEU A 1 459 ? 38.613  49.636  -94.289  1.00 40.00 ? 463 LEU A CB  1 
ATOM 3522  C CG  . LEU A 1 459 ? 37.227  50.229  -94.019  1.00 40.00 ? 463 LEU A CG  1 
ATOM 3523  C CD1 . LEU A 1 459 ? 36.908  50.232  -92.541  1.00 40.00 ? 463 LEU A CD1 1 
ATOM 3524  C CD2 . LEU A 1 459 ? 37.167  51.634  -94.610  1.00 40.00 ? 463 LEU A CD2 1 
ATOM 3525  N N   . ASN A 1 460 ? 41.074  48.491  -96.000  1.00 40.00 ? 464 ASN A N   1 
ATOM 3526  C CA  . ASN A 1 460 ? 42.458  48.324  -96.254  1.00 40.00 ? 464 ASN A CA  1 
ATOM 3527  C C   . ASN A 1 460 ? 43.455  49.191  -95.523  1.00 40.00 ? 464 ASN A C   1 
ATOM 3528  O O   . ASN A 1 460 ? 44.061  50.144  -96.009  1.00 40.00 ? 464 ASN A O   1 
ATOM 3529  C CB  . ASN A 1 460 ? 42.731  48.287  -97.763  1.00 40.00 ? 464 ASN A CB  1 
ATOM 3530  C CG  . ASN A 1 460 ? 42.694  49.589  -98.499  1.00 40.00 ? 464 ASN A CG  1 
ATOM 3531  O OD1 . ASN A 1 460 ? 43.727  50.179  -98.831  1.00 40.00 ? 464 ASN A OD1 1 
ATOM 3532  N ND2 . ASN A 1 460 ? 41.526  50.132  -98.810  1.00 40.00 ? 464 ASN A ND2 1 
ATOM 3533  N N   . TYR A 1 461 ? 43.699  48.792  -94.272  1.00 40.00 ? 465 TYR A N   1 
ATOM 3534  C CA  . TYR A 1 461 ? 44.756  49.428  -93.478  1.00 40.00 ? 465 TYR A CA  1 
ATOM 3535  C C   . TYR A 1 461 ? 45.910  48.406  -93.617  1.00 40.00 ? 465 TYR A C   1 
ATOM 3536  O O   . TYR A 1 461 ? 45.868  47.586  -94.541  1.00 40.00 ? 465 TYR A O   1 
ATOM 3537  C CB  . TYR A 1 461 ? 44.397  49.543  -92.024  1.00 40.00 ? 465 TYR A CB  1 
ATOM 3538  C CG  . TYR A 1 461 ? 43.350  50.558  -91.663  1.00 40.00 ? 465 TYR A CG  1 
ATOM 3539  C CD1 . TYR A 1 461 ? 43.733  51.787  -91.134  1.00 40.00 ? 465 TYR A CD1 1 
ATOM 3540  C CD2 . TYR A 1 461 ? 41.998  50.315  -91.841  1.00 40.00 ? 465 TYR A CD2 1 
ATOM 3541  C CE1 . TYR A 1 461 ? 42.785  52.733  -90.792  1.00 40.00 ? 465 TYR A CE1 1 
ATOM 3542  C CE2 . TYR A 1 461 ? 41.045  51.252  -91.489  1.00 40.00 ? 465 TYR A CE2 1 
ATOM 3543  C CZ  . TYR A 1 461 ? 41.446  52.458  -90.966  1.00 40.00 ? 465 TYR A CZ  1 
ATOM 3544  O OH  . TYR A 1 461 ? 40.522  53.408  -90.613  1.00 40.00 ? 465 TYR A OH  1 
ATOM 3545  N N   . THR A 1 462 ? 46.855  48.426  -92.706  1.00 40.00 ? 466 THR A N   1 
ATOM 3546  C CA  . THR A 1 462 ? 47.923  47.430  -92.767  1.00 40.00 ? 466 THR A CA  1 
ATOM 3547  C C   . THR A 1 462 ? 47.618  46.418  -91.662  1.00 40.00 ? 466 THR A C   1 
ATOM 3548  O O   . THR A 1 462 ? 46.950  46.740  -90.674  1.00 40.00 ? 466 THR A O   1 
ATOM 3549  C CB  . THR A 1 462 ? 49.329  47.998  -92.589  1.00 40.00 ? 466 THR A CB  1 
ATOM 3550  O OG1 . THR A 1 462 ? 49.594  48.301  -91.208  1.00 40.00 ? 466 THR A OG1 1 
ATOM 3551  C CG2 . THR A 1 462 ? 49.521  49.238  -93.446  1.00 40.00 ? 466 THR A CG2 1 
ATOM 3552  N N   . THR A 1 463 ? 48.162  45.220  -91.828  1.00 40.00 ? 467 THR A N   1 
ATOM 3553  C CA  . THR A 1 463 ? 47.968  44.171  -90.824  1.00 40.00 ? 467 THR A CA  1 
ATOM 3554  C C   . THR A 1 463 ? 48.404  44.686  -89.462  1.00 40.00 ? 467 THR A C   1 
ATOM 3555  O O   . THR A 1 463 ? 47.742  44.456  -88.450  1.00 40.00 ? 467 THR A O   1 
ATOM 3556  C CB  . THR A 1 463 ? 48.744  42.921  -91.248  1.00 40.00 ? 467 THR A CB  1 
ATOM 3557  O OG1 . THR A 1 463 ? 48.835  42.913  -92.684  1.00 40.00 ? 467 THR A OG1 1 
ATOM 3558  C CG2 . THR A 1 463 ? 48.047  41.669  -90.753  1.00 40.00 ? 467 THR A CG2 1 
ATOM 3559  N N   . GLU A 1 464 ? 49.514  45.433  -89.445  1.00 40.00 ? 468 GLU A N   1 
ATOM 3560  C CA  . GLU A 1 464 ? 50.001  46.021  -88.196  1.00 40.00 ? 468 GLU A CA  1 
ATOM 3561  C C   . GLU A 1 464 ? 48.892  46.896  -87.614  1.00 40.00 ? 468 GLU A C   1 
ATOM 3562  O O   . GLU A 1 464 ? 48.471  46.735  -86.468  1.00 40.00 ? 468 GLU A O   1 
ATOM 3563  C CB  . GLU A 1 464 ? 51.274  46.820  -88.452  1.00 40.00 ? 468 GLU A CB  1 
ATOM 3564  C CG  . GLU A 1 464 ? 52.351  46.030  -89.196  1.00 40.00 ? 468 GLU A CG  1 
ATOM 3565  C CD  . GLU A 1 464 ? 52.257  46.226  -90.704  1.00 40.00 ? 468 GLU A CD  1 
ATOM 3566  O OE1 . GLU A 1 464 ? 52.721  47.288  -91.198  1.00 40.00 ? 468 GLU A OE1 1 
ATOM 3567  O OE2 . GLU A 1 464 ? 51.726  45.333  -91.403  1.00 40.00 ? 468 GLU A OE2 1 
ATOM 3568  N N   . GLU A 1 465 ? 48.370  47.773  -88.485  1.00 40.00 ? 469 GLU A N   1 
ATOM 3569  C CA  . GLU A 1 465 ? 47.271  48.666  -88.110  1.00 40.00 ? 469 GLU A CA  1 
ATOM 3570  C C   . GLU A 1 465 ? 46.116  47.855  -87.532  1.00 40.00 ? 469 GLU A C   1 
ATOM 3571  O O   . GLU A 1 465 ? 45.537  48.206  -86.497  1.00 40.00 ? 469 GLU A O   1 
ATOM 3572  C CB  . GLU A 1 465 ? 46.837  49.546  -89.284  1.00 40.00 ? 469 GLU A CB  1 
ATOM 3573  C CG  . GLU A 1 465 ? 47.975  50.376  -89.856  1.00 40.00 ? 469 GLU A CG  1 
ATOM 3574  C CD  . GLU A 1 465 ? 47.581  51.528  -90.743  1.00 40.00 ? 469 GLU A CD  1 
ATOM 3575  O OE1 . GLU A 1 465 ? 47.345  51.358  -91.965  1.00 40.00 ? 469 GLU A OE1 1 
ATOM 3576  O OE2 . GLU A 1 465 ? 47.500  52.679  -90.238  1.00 40.00 ? 469 GLU A OE2 1 
ATOM 3577  N N   . ARG A 1 466 ? 45.823  46.731  -88.186  1.00 40.00 ? 470 ARG A N   1 
ATOM 3578  C CA  . ARG A 1 466 ? 44.768  45.839  -87.735  1.00 40.00 ? 470 ARG A CA  1 
ATOM 3579  C C   . ARG A 1 466 ? 45.041  45.319  -86.323  1.00 40.00 ? 470 ARG A C   1 
ATOM 3580  O O   . ARG A 1 466 ? 44.243  45.453  -85.401  1.00 40.00 ? 470 ARG A O   1 
ATOM 3581  C CB  . ARG A 1 466 ? 44.635  44.661  -88.706  1.00 40.00 ? 470 ARG A CB  1 
ATOM 3582  C CG  . ARG A 1 466 ? 43.624  43.627  -88.210  1.00 40.00 ? 470 ARG A CG  1 
ATOM 3583  C CD  . ARG A 1 466 ? 43.792  42.298  -88.956  1.00 40.00 ? 470 ARG A CD  1 
ATOM 3584  N NE  . ARG A 1 466 ? 43.821  42.515  -90.400  1.00 40.00 ? 470 ARG A NE  1 
ATOM 3585  C CZ  . ARG A 1 466 ? 44.388  41.769  -91.332  1.00 40.00 ? 470 ARG A CZ  1 
ATOM 3586  N NH1 . ARG A 1 466 ? 45.036  40.651  -91.036  1.00 40.00 ? 470 ARG A NH1 1 
ATOM 3587  N NH2 . ARG A 1 466 ? 44.305  42.159  -92.611  1.00 40.00 ? 470 ARG A NH2 1 
ATOM 3588  N N   . ILE A 1 467 ? 46.235  44.729  -86.204  1.00 40.00 ? 471 ILE A N   1 
ATOM 3589  C CA  . ILE A 1 467 ? 46.679  44.180  -84.916  1.00 40.00 ? 471 ILE A CA  1 
ATOM 3590  C C   . ILE A 1 467 ? 46.633  45.311  -83.880  1.00 40.00 ? 471 ILE A C   1 
ATOM 3591  O O   . ILE A 1 467 ? 46.098  45.155  -82.787  1.00 40.00 ? 471 ILE A O   1 
ATOM 3592  C CB  . ILE A 1 467 ? 48.133  43.690  -85.059  1.00 40.00 ? 471 ILE A CB  1 
ATOM 3593  C CG1 . ILE A 1 467 ? 48.253  42.648  -86.172  1.00 40.00 ? 471 ILE A CG1 1 
ATOM 3594  C CG2 . ILE A 1 467 ? 48.658  43.130  -83.747  1.00 40.00 ? 471 ILE A CG2 1 
ATOM 3595  C CD1 . ILE A 1 467 ? 49.648  42.535  -86.756  1.00 40.00 ? 471 ILE A CD1 1 
ATOM 3596  N N   . PHE A 1 468 ? 47.214  46.447  -84.333  1.00 40.00 ? 472 PHE A N   1 
ATOM 3597  C CA  . PHE A 1 468 ? 47.261  47.644  -83.507  1.00 40.00 ? 472 PHE A CA  1 
ATOM 3598  C C   . PHE A 1 468 ? 45.863  47.908  -82.944  1.00 40.00 ? 472 PHE A C   1 
ATOM 3599  O O   . PHE A 1 468 ? 45.618  47.934  -81.742  1.00 40.00 ? 472 PHE A O   1 
ATOM 3600  C CB  . PHE A 1 468 ? 47.681  48.851  -84.336  1.00 40.00 ? 472 PHE A CB  1 
ATOM 3601  C CG  . PHE A 1 468 ? 47.885  50.134  -83.594  1.00 40.00 ? 472 PHE A CG  1 
ATOM 3602  C CD1 . PHE A 1 468 ? 47.963  50.201  -82.213  1.00 40.00 ? 472 PHE A CD1 1 
ATOM 3603  C CD2 . PHE A 1 468 ? 48.018  51.331  -84.304  1.00 40.00 ? 472 PHE A CD2 1 
ATOM 3604  C CE1 . PHE A 1 468 ? 48.168  51.400  -81.550  1.00 40.00 ? 472 PHE A CE1 1 
ATOM 3605  C CE2 . PHE A 1 468 ? 48.218  52.531  -83.648  1.00 40.00 ? 472 PHE A CE2 1 
ATOM 3606  C CZ  . PHE A 1 468 ? 48.293  52.570  -82.270  1.00 40.00 ? 472 PHE A CZ  1 
ATOM 3607  N N   . ALA A 1 469 ? 44.936  48.055  -83.898  1.00 40.00 ? 473 ALA A N   1 
ATOM 3608  C CA  . ALA A 1 469 ? 43.545  48.313  -83.554  1.00 40.00 ? 473 ALA A CA  1 
ATOM 3609  C C   . ALA A 1 469 ? 43.056  47.379  -82.457  1.00 40.00 ? 473 ALA A C   1 
ATOM 3610  O O   . ALA A 1 469 ? 42.568  47.746  -81.378  1.00 40.00 ? 473 ALA A O   1 
ATOM 3611  C CB  . ALA A 1 469 ? 42.737  48.129  -84.820  1.00 40.00 ? 473 ALA A CB  1 
ATOM 3612  N N   . GLN A 1 470 ? 43.242  46.073  -82.721  1.00 40.00 ? 474 GLN A N   1 
ATOM 3613  C CA  . GLN A 1 470 ? 42.820  45.036  -81.779  1.00 40.00 ? 474 GLN A CA  1 
ATOM 3614  C C   . GLN A 1 470 ? 43.376  45.314  -80.394  1.00 40.00 ? 474 GLN A C   1 
ATOM 3615  O O   . GLN A 1 470 ? 42.738  45.180  -79.346  1.00 40.00 ? 474 GLN A O   1 
ATOM 3616  C CB  . GLN A 1 470 ? 43.213  43.661  -82.305  1.00 40.00 ? 474 GLN A CB  1 
ATOM 3617  C CG  . GLN A 1 470 ? 42.946  43.424  -83.786  1.00 40.00 ? 474 GLN A CG  1 
ATOM 3618  C CD  . GLN A 1 470 ? 43.104  41.979  -84.231  1.00 40.00 ? 474 GLN A CD  1 
ATOM 3619  O OE1 . GLN A 1 470 ? 43.549  41.696  -85.358  1.00 40.00 ? 474 GLN A OE1 1 
ATOM 3620  N NE2 . GLN A 1 470 ? 42.736  41.031  -83.364  1.00 40.00 ? 474 GLN A NE2 1 
ATOM 3621  N N   . ARG A 1 471 ? 44.647  45.747  -80.398  1.00 40.00 ? 475 ARG A N   1 
ATOM 3622  C CA  . ARG A 1 471 ? 45.316  46.056  -79.128  1.00 40.00 ? 475 ARG A CA  1 
ATOM 3623  C C   . ARG A 1 471 ? 44.600  47.196  -78.416  1.00 40.00 ? 475 ARG A C   1 
ATOM 3624  O O   . ARG A 1 471 ? 44.232  47.103  -77.241  1.00 40.00 ? 475 ARG A O   1 
ATOM 3625  C CB  . ARG A 1 471 ? 46.765  46.376  -79.424  1.00 40.00 ? 475 ARG A CB  1 
ATOM 3626  C CG  . ARG A 1 471 ? 47.666  46.103  -78.217  1.00 40.00 ? 475 ARG A CG  1 
ATOM 3627  C CD  . ARG A 1 471 ? 49.091  46.338  -78.674  1.00 40.00 ? 475 ARG A CD  1 
ATOM 3628  N NE  . ARG A 1 471 ? 49.656  47.582  -78.151  1.00 40.00 ? 475 ARG A NE  1 
ATOM 3629  C CZ  . ARG A 1 471 ? 50.406  48.325  -78.979  1.00 40.00 ? 475 ARG A CZ  1 
ATOM 3630  N NH1 . ARG A 1 471 ? 50.597  47.934  -80.239  1.00 40.00 ? 475 ARG A NH1 1 
ATOM 3631  N NH2 . ARG A 1 471 ? 50.936  49.439  -78.482  1.00 40.00 ? 475 ARG A NH2 1 
ATOM 3632  N N   . LEU A 1 472 ? 44.386  48.264  -79.200  1.00 40.00 ? 476 LEU A N   1 
ATOM 3633  C CA  . LEU A 1 472 ? 43.670  49.437  -78.709  1.00 40.00 ? 476 LEU A CA  1 
ATOM 3634  C C   . LEU A 1 472 ? 42.287  49.062  -78.196  1.00 40.00 ? 476 LEU A C   1 
ATOM 3635  O O   . LEU A 1 472 ? 41.892  49.387  -77.062  1.00 40.00 ? 476 LEU A O   1 
ATOM 3636  C CB  . LEU A 1 472 ? 43.582  50.464  -79.841  1.00 40.00 ? 476 LEU A CB  1 
ATOM 3637  C CG  . LEU A 1 472 ? 44.879  51.231  -80.154  1.00 40.00 ? 476 LEU A CG  1 
ATOM 3638  C CD1 . LEU A 1 472 ? 45.033  51.513  -81.640  1.00 40.00 ? 476 LEU A CD1 1 
ATOM 3639  C CD2 . LEU A 1 472 ? 44.881  52.547  -79.379  1.00 40.00 ? 476 LEU A CD2 1 
ATOM 3640  N N   . MET A 1 473 ? 41.538  48.275  -78.996  1.00 40.00 ? 477 MET A N   1 
ATOM 3641  C CA  . MET A 1 473 ? 40.191  47.894  -78.562  1.00 40.00 ? 477 MET A CA  1 
ATOM 3642  C C   . MET A 1 473 ? 40.215  47.174  -77.215  1.00 40.00 ? 477 MET A C   1 
ATOM 3643  O O   . MET A 1 473 ? 39.367  47.289  -76.341  1.00 40.00 ? 477 MET A O   1 
ATOM 3644  C CB  . MET A 1 473 ? 39.486  46.998  -79.549  1.00 40.00 ? 477 MET A CB  1 
ATOM 3645  C CG  . MET A 1 473 ? 39.841  47.252  -80.997  1.00 40.00 ? 477 MET A CG  1 
ATOM 3646  S SD  . MET A 1 473 ? 38.706  46.374  -82.090  1.00 40.00 ? 477 MET A SD  1 
ATOM 3647  C CE  . MET A 1 473 ? 37.168  46.624  -81.207  1.00 40.00 ? 477 MET A CE  1 
ATOM 3648  N N   . LYS A 1 474 ? 41.263  46.366  -77.112  1.00 40.00 ? 478 LYS A N   1 
ATOM 3649  C CA  . LYS A 1 474 ? 41.521  45.574  -75.924  1.00 40.00 ? 478 LYS A CA  1 
ATOM 3650  C C   . LYS A 1 474 ? 41.741  46.447  -74.691  1.00 40.00 ? 478 LYS A C   1 
ATOM 3651  O O   . LYS A 1 474 ? 41.191  46.134  -73.626  1.00 40.00 ? 478 LYS A O   1 
ATOM 3652  C CB  . LYS A 1 474 ? 42.773  44.736  -76.220  1.00 40.00 ? 478 LYS A CB  1 
ATOM 3653  C CG  . LYS A 1 474 ? 42.483  43.277  -76.518  1.00 40.00 ? 478 LYS A CG  1 
ATOM 3654  C CD  . LYS A 1 474 ? 41.672  42.627  -75.404  1.00 40.00 ? 478 LYS A CD  1 
ATOM 3655  C CE  . LYS A 1 474 ? 42.472  42.492  -74.126  1.00 40.00 ? 478 LYS A CE  1 
ATOM 3656  N NZ  . LYS A 1 474 ? 43.875  42.998  -74.227  1.00 40.00 ? 478 LYS A NZ  1 
ATOM 3657  N N   . TYR A 1 475 ? 42.522  47.533  -74.879  1.00 40.00 ? 479 TYR A N   1 
ATOM 3658  C CA  . TYR A 1 475 ? 42.794  48.412  -73.738  1.00 40.00 ? 479 TYR A CA  1 
ATOM 3659  C C   . TYR A 1 475 ? 41.497  49.058  -73.244  1.00 40.00 ? 479 TYR A C   1 
ATOM 3660  O O   . TYR A 1 475 ? 41.175  49.063  -72.042  1.00 40.00 ? 479 TYR A O   1 
ATOM 3661  C CB  . TYR A 1 475 ? 43.838  49.438  -74.091  1.00 40.00 ? 479 TYR A CB  1 
ATOM 3662  C CG  . TYR A 1 475 ? 45.250  49.047  -74.437  1.00 40.00 ? 479 TYR A CG  1 
ATOM 3663  C CD1 . TYR A 1 475 ? 46.114  48.434  -73.524  1.00 40.00 ? 479 TYR A CD1 1 
ATOM 3664  C CD2 . TYR A 1 475 ? 45.752  49.330  -75.709  1.00 40.00 ? 479 TYR A CD2 1 
ATOM 3665  C CE1 . TYR A 1 475 ? 47.411  48.098  -73.877  1.00 40.00 ? 479 TYR A CE1 1 
ATOM 3666  C CE2 . TYR A 1 475 ? 47.048  49.000  -76.063  1.00 40.00 ? 479 TYR A CE2 1 
ATOM 3667  C CZ  . TYR A 1 475 ? 47.874  48.381  -75.141  1.00 40.00 ? 479 TYR A CZ  1 
ATOM 3668  O OH  . TYR A 1 475 ? 49.145  48.071  -75.532  1.00 40.00 ? 479 TYR A OH  1 
ATOM 3669  N N   . TRP A 1 476 ? 40.720  49.568  -74.213  1.00 40.00 ? 480 TRP A N   1 
ATOM 3670  C CA  . TRP A 1 476 ? 39.458  50.253  -73.920  1.00 40.00 ? 480 TRP A CA  1 
ATOM 3671  C C   . TRP A 1 476 ? 38.452  49.386  -73.196  1.00 40.00 ? 480 TRP A C   1 
ATOM 3672  O O   . TRP A 1 476 ? 38.061  49.643  -72.044  1.00 40.00 ? 480 TRP A O   1 
ATOM 3673  C CB  . TRP A 1 476 ? 38.918  50.933  -75.186  1.00 40.00 ? 480 TRP A CB  1 
ATOM 3674  C CG  . TRP A 1 476 ? 39.260  52.403  -75.220  1.00 40.00 ? 480 TRP A CG  1 
ATOM 3675  C CD1 . TRP A 1 476 ? 38.446  53.458  -74.929  1.00 40.00 ? 480 TRP A CD1 1 
ATOM 3676  C CD2 . TRP A 1 476 ? 40.539  52.968  -75.555  1.00 40.00 ? 480 TRP A CD2 1 
ATOM 3677  N NE1 . TRP A 1 476 ? 39.133  54.640  -75.071  1.00 40.00 ? 480 TRP A NE1 1 
ATOM 3678  C CE2 . TRP A 1 476 ? 40.421  54.362  -75.454  1.00 40.00 ? 480 TRP A CE2 1 
ATOM 3679  C CE3 . TRP A 1 476 ? 41.768  52.422  -75.934  1.00 40.00 ? 480 TRP A CE3 1 
ATOM 3680  C CZ2 . TRP A 1 476 ? 41.496  55.203  -75.708  1.00 40.00 ? 480 TRP A CZ2 1 
ATOM 3681  C CZ3 . TRP A 1 476 ? 42.833  53.265  -76.188  1.00 40.00 ? 480 TRP A CZ3 1 
ATOM 3682  C CH2 . TRP A 1 476 ? 42.693  54.650  -76.069  1.00 40.00 ? 480 TRP A CH2 1 
ATOM 3683  N N   . THR A 1 477 ? 38.058  48.292  -73.824  1.00 40.00 ? 481 THR A N   1 
ATOM 3684  C CA  . THR A 1 477 ? 37.153  47.286  -73.247  1.00 40.00 ? 481 THR A CA  1 
ATOM 3685  C C   . THR A 1 477 ? 37.674  46.777  -71.897  1.00 40.00 ? 481 THR A C   1 
ATOM 3686  O O   . THR A 1 477 ? 36.892  46.577  -70.955  1.00 40.00 ? 481 THR A O   1 
ATOM 3687  C CB  . THR A 1 477 ? 37.151  46.043  -74.181  1.00 40.00 ? 481 THR A CB  1 
ATOM 3688  O OG1 . THR A 1 477 ? 38.524  45.914  -74.630  1.00 40.00 ? 481 THR A OG1 1 
ATOM 3689  C CG2 . THR A 1 477 ? 36.233  46.275  -75.357  1.00 40.00 ? 481 THR A CG2 1 
ATOM 3690  N N   . ASN A 1 478 ? 39.001  46.590  -71.787  1.00 40.00 ? 482 ASN A N   1 
ATOM 3691  C CA  . ASN A 1 478 ? 39.593  46.190  -70.521  1.00 40.00 ? 482 ASN A CA  1 
ATOM 3692  C C   . ASN A 1 478 ? 39.430  47.292  -69.468  1.00 40.00 ? 482 ASN A C   1 
ATOM 3693  O O   . ASN A 1 478 ? 39.051  47.019  -68.323  1.00 40.00 ? 482 ASN A O   1 
ATOM 3694  C CB  . ASN A 1 478 ? 41.073  45.907  -70.694  1.00 40.00 ? 482 ASN A CB  1 
ATOM 3695  C CG  . ASN A 1 478 ? 41.443  44.445  -70.719  1.00 40.00 ? 482 ASN A CG  1 
ATOM 3696  O OD1 . ASN A 1 478 ? 40.850  43.580  -70.056  1.00 40.00 ? 482 ASN A OD1 1 
ATOM 3697  N ND2 . ASN A 1 478 ? 42.470  44.148  -71.517  1.00 40.00 ? 482 ASN A ND2 1 
ATOM 3698  N N   . PHE A 1 479 ? 39.697  48.568  -69.888  1.00 40.00 ? 483 PHE A N   1 
ATOM 3699  C CA  . PHE A 1 479 ? 39.503  49.643  -68.894  1.00 40.00 ? 483 PHE A CA  1 
ATOM 3700  C C   . PHE A 1 479 ? 37.995  49.658  -68.571  1.00 40.00 ? 483 PHE A C   1 
ATOM 3701  O O   . PHE A 1 479 ? 37.567  49.876  -67.440  1.00 40.00 ? 483 PHE A O   1 
ATOM 3702  C CB  . PHE A 1 479 ? 40.004  51.000  -69.366  1.00 40.00 ? 483 PHE A CB  1 
ATOM 3703  C CG  . PHE A 1 479 ? 39.530  52.138  -68.477  1.00 40.00 ? 483 PHE A CG  1 
ATOM 3704  C CD1 . PHE A 1 479 ? 40.148  52.379  -67.262  1.00 40.00 ? 483 PHE A CD1 1 
ATOM 3705  C CD2 . PHE A 1 479 ? 38.463  52.935  -68.853  1.00 40.00 ? 483 PHE A CD2 1 
ATOM 3706  C CE1 . PHE A 1 479 ? 39.730  53.396  -66.424  1.00 40.00 ? 483 PHE A CE1 1 
ATOM 3707  C CE2 . PHE A 1 479 ? 38.033  53.953  -68.020  1.00 40.00 ? 483 PHE A CE2 1 
ATOM 3708  C CZ  . PHE A 1 479 ? 38.664  54.178  -66.819  1.00 40.00 ? 483 PHE A CZ  1 
ATOM 3709  N N   . ALA A 1 480 ? 37.218  49.387  -69.631  1.00 40.00 ? 484 ALA A N   1 
ATOM 3710  C CA  . ALA A 1 480 ? 35.784  49.323  -69.507  1.00 40.00 ? 484 ALA A CA  1 
ATOM 3711  C C   . ALA A 1 480 ? 35.359  48.290  -68.474  1.00 40.00 ? 484 ALA A C   1 
ATOM 3712  O O   . ALA A 1 480 ? 34.614  48.673  -67.559  1.00 40.00 ? 484 ALA A O   1 
ATOM 3713  C CB  . ALA A 1 480 ? 35.113  49.029  -70.839  1.00 40.00 ? 484 ALA A CB  1 
ATOM 3714  N N   . ARG A 1 481 ? 35.810  47.030  -68.591  1.00 40.00 ? 485 ARG A N   1 
ATOM 3715  C CA  . ARG A 1 481 ? 35.329  46.058  -67.596  1.00 40.00 ? 485 ARG A CA  1 
ATOM 3716  C C   . ARG A 1 481 ? 35.952  46.164  -66.221  1.00 40.00 ? 485 ARG A C   1 
ATOM 3717  O O   . ARG A 1 481 ? 35.226  46.205  -65.222  1.00 40.00 ? 485 ARG A O   1 
ATOM 3718  C CB  . ARG A 1 481 ? 35.303  44.622  -68.082  1.00 40.00 ? 485 ARG A CB  1 
ATOM 3719  C CG  . ARG A 1 481 ? 36.469  44.165  -68.928  1.00 40.00 ? 485 ARG A CG  1 
ATOM 3720  C CD  . ARG A 1 481 ? 36.025  43.364  -70.151  1.00 40.00 ? 485 ARG A CD  1 
ATOM 3721  N NE  . ARG A 1 481 ? 37.153  43.138  -71.055  1.00 40.00 ? 485 ARG A NE  1 
ATOM 3722  C CZ  . ARG A 1 481 ? 37.088  42.926  -72.361  1.00 40.00 ? 485 ARG A CZ  1 
ATOM 3723  N NH1 . ARG A 1 481 ? 35.930  42.886  -73.019  1.00 40.00 ? 485 ARG A NH1 1 
ATOM 3724  N NH2 . ARG A 1 481 ? 38.211  42.741  -73.067  1.00 40.00 ? 485 ARG A NH2 1 
ATOM 3725  N N   . THR A 1 482 ? 37.261  46.214  -66.139  1.00 40.00 ? 486 THR A N   1 
ATOM 3726  C CA  . THR A 1 482 ? 38.060  46.254  -64.947  1.00 40.00 ? 486 THR A CA  1 
ATOM 3727  C C   . THR A 1 482 ? 38.294  47.624  -64.327  1.00 40.00 ? 486 THR A C   1 
ATOM 3728  O O   . THR A 1 482 ? 38.101  47.843  -63.129  1.00 40.00 ? 486 THR A O   1 
ATOM 3729  C CB  . THR A 1 482 ? 39.472  45.694  -65.311  1.00 40.00 ? 486 THR A CB  1 
ATOM 3730  O OG1 . THR A 1 482 ? 40.253  46.740  -65.906  1.00 40.00 ? 486 THR A OG1 1 
ATOM 3731  C CG2 . THR A 1 482 ? 39.385  44.566  -66.328  1.00 40.00 ? 486 THR A CG2 1 
ATOM 3732  N N   . GLY A 1 483 ? 38.752  48.560  -65.164  1.00 40.00 ? 487 GLY A N   1 
ATOM 3733  C CA  . GLY A 1 483 ? 39.120  49.911  -64.735  1.00 40.00 ? 487 GLY A CA  1 
ATOM 3734  C C   . GLY A 1 483 ? 40.670  49.935  -64.760  1.00 40.00 ? 487 GLY A C   1 
ATOM 3735  O O   . GLY A 1 483 ? 41.332  50.557  -63.935  1.00 40.00 ? 487 GLY A O   1 
ATOM 3736  N N   . ASP A 1 484 ? 41.213  49.222  -65.734  1.00 40.00 ? 488 ASP A N   1 
ATOM 3737  C CA  . ASP A 1 484 ? 42.660  49.084  -65.930  1.00 40.00 ? 488 ASP A CA  1 
ATOM 3738  C C   . ASP A 1 484 ? 42.774  48.559  -67.348  1.00 40.00 ? 488 ASP A C   1 
ATOM 3739  O O   . ASP A 1 484 ? 42.305  47.465  -67.650  1.00 40.00 ? 488 ASP A O   1 
ATOM 3740  C CB  . ASP A 1 484 ? 43.176  48.042  -64.970  1.00 40.00 ? 488 ASP A CB  1 
ATOM 3741  C CG  . ASP A 1 484 ? 44.637  47.728  -64.850  1.00 40.00 ? 488 ASP A CG  1 
ATOM 3742  O OD1 . ASP A 1 484 ? 45.480  47.856  -65.760  1.00 40.00 ? 488 ASP A OD1 1 
ATOM 3743  O OD2 . ASP A 1 484 ? 44.959  47.302  -63.694  1.00 40.00 ? 488 ASP A OD2 1 
ATOM 3744  N N   . PRO A 1 485 ? 43.390  49.296  -68.231  1.00 40.00 ? 489 PRO A N   1 
ATOM 3745  C CA  . PRO A 1 485 ? 43.517  48.884  -69.615  1.00 40.00 ? 489 PRO A CA  1 
ATOM 3746  C C   . PRO A 1 485 ? 44.389  47.660  -69.766  1.00 40.00 ? 489 PRO A C   1 
ATOM 3747  O O   . PRO A 1 485 ? 44.601  47.209  -70.892  1.00 40.00 ? 489 PRO A O   1 
ATOM 3748  C CB  . PRO A 1 485 ? 44.180  50.092  -70.278  1.00 40.00 ? 489 PRO A CB  1 
ATOM 3749  C CG  . PRO A 1 485 ? 44.904  50.790  -69.173  1.00 40.00 ? 489 PRO A CG  1 
ATOM 3750  C CD  . PRO A 1 485 ? 43.984  50.629  -67.968  1.00 40.00 ? 489 PRO A CD  1 
ATOM 3751  N N   . ASN A 1 486 ? 44.954  47.140  -68.693  1.00 40.00 ? 490 ASN A N   1 
ATOM 3752  C CA  . ASN A 1 486 ? 45.875  46.052  -68.717  1.00 40.00 ? 490 ASN A CA  1 
ATOM 3753  C C   . ASN A 1 486 ? 45.399  44.625  -68.882  1.00 40.00 ? 490 ASN A C   1 
ATOM 3754  O O   . ASN A 1 486 ? 44.396  44.160  -68.350  1.00 40.00 ? 490 ASN A O   1 
ATOM 3755  C CB  . ASN A 1 486 ? 46.776  46.110  -67.476  1.00 40.00 ? 490 ASN A CB  1 
ATOM 3756  C CG  . ASN A 1 486 ? 47.899  47.107  -67.713  1.00 40.00 ? 490 ASN A CG  1 
ATOM 3757  O OD1 . ASN A 1 486 ? 48.729  46.891  -68.605  1.00 40.00 ? 490 ASN A OD1 1 
ATOM 3758  N ND2 . ASN A 1 486 ? 47.867  48.152  -66.901  1.00 40.00 ? 490 ASN A ND2 1 
ATOM 3759  N N   . ASP A 1 487 ? 46.239  43.907  -69.657  1.00 40.00 ? 491 ASP A N   1 
ATOM 3760  C CA  . ASP A 1 487 ? 46.010  42.467  -69.923  1.00 40.00 ? 491 ASP A CA  1 
ATOM 3761  C C   . ASP A 1 487 ? 45.584  41.862  -68.584  1.00 40.00 ? 491 ASP A C   1 
ATOM 3762  O O   . ASP A 1 487 ? 46.204  42.058  -67.545  1.00 40.00 ? 491 ASP A O   1 
ATOM 3763  C CB  . ASP A 1 487 ? 47.216  41.841  -70.555  1.00 40.00 ? 491 ASP A CB  1 
ATOM 3764  N N   . PRO A 1 488 ? 44.433  41.230  -68.591  1.00 40.00 ? 492 PRO A N   1 
ATOM 3765  C CA  . PRO A 1 488 ? 43.704  40.698  -67.466  1.00 40.00 ? 492 PRO A CA  1 
ATOM 3766  C C   . PRO A 1 488 ? 44.477  40.537  -66.190  1.00 40.00 ? 492 PRO A C   1 
ATOM 3767  O O   . PRO A 1 488 ? 44.801  41.422  -65.411  1.00 40.00 ? 492 PRO A O   1 
ATOM 3768  C CB  . PRO A 1 488 ? 43.130  39.396  -68.012  1.00 40.00 ? 492 PRO A CB  1 
ATOM 3769  C CG  . PRO A 1 488 ? 43.237  39.470  -69.495  1.00 40.00 ? 492 PRO A CG  1 
ATOM 3770  C CD  . PRO A 1 488 ? 43.600  40.923  -69.804  1.00 40.00 ? 492 PRO A CD  1 
ATOM 3771  N N   . ARG A 1 489 ? 44.677  39.262  -65.931  1.00 40.00 ? 493 ARG A N   1 
ATOM 3772  C CA  . ARG A 1 489 ? 45.505  38.708  -64.886  1.00 40.00 ? 493 ARG A CA  1 
ATOM 3773  C C   . ARG A 1 489 ? 46.815  38.464  -65.698  1.00 40.00 ? 493 ARG A C   1 
ATOM 3774  O O   . ARG A 1 489 ? 47.918  38.743  -65.282  1.00 40.00 ? 493 ARG A O   1 
ATOM 3775  C CB  . ARG A 1 489 ? 44.961  37.397  -64.382  1.00 40.00 ? 493 ARG A CB  1 
ATOM 3776  N N   . ASP A 1 490 ? 46.569  38.007  -66.928  1.00 40.00 ? 494 ASP A N   1 
ATOM 3777  C CA  . ASP A 1 490 ? 47.599  37.709  -67.899  1.00 40.00 ? 494 ASP A CA  1 
ATOM 3778  C C   . ASP A 1 490 ? 48.567  38.856  -68.091  1.00 40.00 ? 494 ASP A C   1 
ATOM 3779  O O   . ASP A 1 490 ? 48.445  39.633  -69.047  1.00 40.00 ? 494 ASP A O   1 
ATOM 3780  C CB  . ASP A 1 490 ? 46.949  37.316  -69.232  1.00 40.00 ? 494 ASP A CB  1 
ATOM 3781  N N   . SER A 1 491 ? 49.583  38.958  -67.240  1.00 40.00 ? 495 SER A N   1 
ATOM 3782  C CA  . SER A 1 491 ? 50.594  40.003  -67.286  1.00 40.00 ? 495 SER A CA  1 
ATOM 3783  C C   . SER A 1 491 ? 51.494  39.865  -68.511  1.00 40.00 ? 495 SER A C   1 
ATOM 3784  O O   . SER A 1 491 ? 52.708  39.652  -68.440  1.00 40.00 ? 495 SER A O   1 
ATOM 3785  C CB  . SER A 1 491 ? 51.418  39.986  -66.000  1.00 40.00 ? 495 SER A CB  1 
ATOM 3786  N N   . LYS A 1 492 ? 50.893  40.031  -69.678  1.00 40.00 ? 496 LYS A N   1 
ATOM 3787  C CA  . LYS A 1 492 ? 51.477  39.920  -70.978  1.00 40.00 ? 496 LYS A CA  1 
ATOM 3788  C C   . LYS A 1 492 ? 52.456  41.027  -71.325  1.00 40.00 ? 496 LYS A C   1 
ATOM 3789  O O   . LYS A 1 492 ? 52.127  41.987  -72.036  1.00 40.00 ? 496 LYS A O   1 
ATOM 3790  C CB  . LYS A 1 492 ? 50.327  39.855  -72.008  1.00 40.00 ? 496 LYS A CB  1 
ATOM 3791  N N   . SER A 1 493 ? 53.687  40.911  -70.841  1.00 40.00 ? 497 SER A N   1 
ATOM 3792  C CA  . SER A 1 493 ? 54.723  41.888  -71.173  1.00 40.00 ? 497 SER A CA  1 
ATOM 3793  C C   . SER A 1 493 ? 54.494  43.316  -70.783  1.00 40.00 ? 497 SER A C   1 
ATOM 3794  O O   . SER A 1 493 ? 54.381  43.568  -69.549  1.00 40.00 ? 497 SER A O   1 
ATOM 3795  C CB  . SER A 1 493 ? 55.202  41.588  -72.589  1.00 40.00 ? 497 SER A CB  1 
ATOM 3796  N N   . PRO A 1 494 ? 54.512  44.340  -71.631  1.00 40.00 ? 498 PRO A N   1 
ATOM 3797  C CA  . PRO A 1 494 ? 54.445  45.736  -71.213  1.00 40.00 ? 498 PRO A CA  1 
ATOM 3798  C C   . PRO A 1 494 ? 53.241  46.156  -70.418  1.00 40.00 ? 498 PRO A C   1 
ATOM 3799  O O   . PRO A 1 494 ? 52.104  45.832  -70.761  1.00 40.00 ? 498 PRO A O   1 
ATOM 3800  C CB  . PRO A 1 494 ? 54.685  46.535  -72.478  1.00 40.00 ? 498 PRO A CB  1 
ATOM 3801  C CG  . PRO A 1 494 ? 55.303  45.577  -73.439  1.00 40.00 ? 498 PRO A CG  1 
ATOM 3802  C CD  . PRO A 1 494 ? 54.681  44.238  -73.103  1.00 40.00 ? 498 PRO A CD  1 
ATOM 3803  N N   . GLN A 1 495 ? 53.451  46.888  -69.315  1.00 40.00 ? 499 GLN A N   1 
ATOM 3804  C CA  . GLN A 1 495 ? 52.367  47.320  -68.460  1.00 40.00 ? 499 GLN A CA  1 
ATOM 3805  C C   . GLN A 1 495 ? 52.057  48.810  -68.539  1.00 40.00 ? 499 GLN A C   1 
ATOM 3806  O O   . GLN A 1 495 ? 52.931  49.623  -68.853  1.00 40.00 ? 499 GLN A O   1 
ATOM 3807  C CB  . GLN A 1 495 ? 52.632  46.929  -67.011  1.00 40.00 ? 499 GLN A CB  1 
ATOM 3808  C CG  . GLN A 1 495 ? 51.447  46.318  -66.298  1.00 40.00 ? 499 GLN A CG  1 
ATOM 3809  C CD  . GLN A 1 495 ? 51.010  44.963  -66.799  1.00 40.00 ? 499 GLN A CD  1 
ATOM 3810  O OE1 . GLN A 1 495 ? 50.081  44.388  -66.206  1.00 40.00 ? 499 GLN A OE1 1 
ATOM 3811  N NE2 . GLN A 1 495 ? 51.611  44.403  -67.853  1.00 40.00 ? 499 GLN A NE2 1 
ATOM 3812  N N   . TRP A 1 496 ? 50.789  49.163  -68.268  1.00 40.00 ? 500 TRP A N   1 
ATOM 3813  C CA  . TRP A 1 496 ? 50.386  50.570  -68.319  1.00 40.00 ? 500 TRP A CA  1 
ATOM 3814  C C   . TRP A 1 496 ? 50.139  51.046  -66.889  1.00 40.00 ? 500 TRP A C   1 
ATOM 3815  O O   . TRP A 1 496 ? 49.176  50.661  -66.257  1.00 40.00 ? 500 TRP A O   1 
ATOM 3816  C CB  . TRP A 1 496 ? 49.202  50.784  -69.209  1.00 40.00 ? 500 TRP A CB  1 
ATOM 3817  C CG  . TRP A 1 496 ? 48.564  52.125  -69.354  1.00 40.00 ? 500 TRP A CG  1 
ATOM 3818  C CD1 . TRP A 1 496 ? 48.569  53.166  -68.473  1.00 40.00 ? 500 TRP A CD1 1 
ATOM 3819  C CD2 . TRP A 1 496 ? 47.794  52.591  -70.479  1.00 40.00 ? 500 TRP A CD2 1 
ATOM 3820  N NE1 . TRP A 1 496 ? 47.854  54.226  -68.958  1.00 40.00 ? 500 TRP A NE1 1 
ATOM 3821  C CE2 . TRP A 1 496 ? 47.368  53.899  -70.189  1.00 40.00 ? 500 TRP A CE2 1 
ATOM 3822  C CE3 . TRP A 1 496 ? 47.408  52.007  -71.696  1.00 40.00 ? 500 TRP A CE3 1 
ATOM 3823  C CZ2 . TRP A 1 496 ? 46.585  54.640  -71.072  1.00 40.00 ? 500 TRP A CZ2 1 
ATOM 3824  C CZ3 . TRP A 1 496 ? 46.636  52.742  -72.572  1.00 40.00 ? 500 TRP A CZ3 1 
ATOM 3825  C CH2 . TRP A 1 496 ? 46.233  54.044  -72.252  1.00 40.00 ? 500 TRP A CH2 1 
ATOM 3826  N N   . PRO A 1 497 ? 51.039  51.908  -66.423  1.00 40.00 ? 501 PRO A N   1 
ATOM 3827  C CA  . PRO A 1 497 ? 50.964  52.420  -65.072  1.00 40.00 ? 501 PRO A CA  1 
ATOM 3828  C C   . PRO A 1 497 ? 50.065  53.614  -64.918  1.00 40.00 ? 501 PRO A C   1 
ATOM 3829  O O   . PRO A 1 497 ? 50.039  54.479  -65.798  1.00 40.00 ? 501 PRO A O   1 
ATOM 3830  C CB  . PRO A 1 497 ? 52.414  52.870  -64.828  1.00 40.00 ? 501 PRO A CB  1 
ATOM 3831  C CG  . PRO A 1 497 ? 52.953  53.218  -66.174  1.00 40.00 ? 501 PRO A CG  1 
ATOM 3832  C CD  . PRO A 1 497 ? 52.209  52.403  -67.184  1.00 40.00 ? 501 PRO A CD  1 
ATOM 3833  N N   . PRO A 1 498 ? 49.388  53.731  -63.789  1.00 40.00 ? 502 PRO A N   1 
ATOM 3834  C CA  . PRO A 1 498 ? 48.568  54.900  -63.528  1.00 40.00 ? 502 PRO A CA  1 
ATOM 3835  C C   . PRO A 1 498 ? 49.343  56.217  -63.581  1.00 40.00 ? 502 PRO A C   1 
ATOM 3836  O O   . PRO A 1 498 ? 50.447  56.339  -63.046  1.00 40.00 ? 502 PRO A O   1 
ATOM 3837  C CB  . PRO A 1 498 ? 48.046  54.696  -62.117  1.00 40.00 ? 502 PRO A CB  1 
ATOM 3838  C CG  . PRO A 1 498 ? 48.286  53.284  -61.790  1.00 40.00 ? 502 PRO A CG  1 
ATOM 3839  C CD  . PRO A 1 498 ? 49.373  52.767  -62.691  1.00 40.00 ? 502 PRO A CD  1 
ATOM 3840  N N   . TYR A 1 499 ? 48.755  57.227  -64.221  1.00 40.00 ? 503 TYR A N   1 
ATOM 3841  C CA  . TYR A 1 499 ? 49.384  58.552  -64.228  1.00 40.00 ? 503 TYR A CA  1 
ATOM 3842  C C   . TYR A 1 499 ? 49.270  59.022  -62.756  1.00 40.00 ? 503 TYR A C   1 
ATOM 3843  O O   . TYR A 1 499 ? 48.232  58.851  -62.129  1.00 40.00 ? 503 TYR A O   1 
ATOM 3844  C CB  . TYR A 1 499 ? 48.725  59.540  -65.168  1.00 40.00 ? 503 TYR A CB  1 
ATOM 3845  C CG  . TYR A 1 499 ? 49.259  60.952  -65.081  1.00 40.00 ? 503 TYR A CG  1 
ATOM 3846  C CD1 . TYR A 1 499 ? 48.832  61.762  -64.037  1.00 40.00 ? 503 TYR A CD1 1 
ATOM 3847  C CD2 . TYR A 1 499 ? 50.160  61.466  -66.007  1.00 40.00 ? 503 TYR A CD2 1 
ATOM 3848  C CE1 . TYR A 1 499 ? 49.301  63.054  -63.908  1.00 40.00 ? 503 TYR A CE1 1 
ATOM 3849  C CE2 . TYR A 1 499 ? 50.638  62.770  -65.906  1.00 40.00 ? 503 TYR A CE2 1 
ATOM 3850  C CZ  . TYR A 1 499 ? 50.193  63.543  -64.849  1.00 40.00 ? 503 TYR A CZ  1 
ATOM 3851  O OH  . TYR A 1 499 ? 50.638  64.842  -64.697  1.00 40.00 ? 503 TYR A OH  1 
ATOM 3852  N N   . THR A 1 500 ? 50.346  59.558  -62.238  1.00 40.00 ? 504 THR A N   1 
ATOM 3853  C CA  . THR A 1 500 ? 50.513  60.003  -60.878  1.00 40.00 ? 504 THR A CA  1 
ATOM 3854  C C   . THR A 1 500 ? 51.137  61.380  -60.778  1.00 40.00 ? 504 THR A C   1 
ATOM 3855  O O   . THR A 1 500 ? 51.987  61.734  -61.610  1.00 40.00 ? 504 THR A O   1 
ATOM 3856  C CB  . THR A 1 500 ? 51.542  58.997  -60.248  1.00 40.00 ? 504 THR A CB  1 
ATOM 3857  O OG1 . THR A 1 500 ? 52.355  58.431  -61.308  1.00 40.00 ? 504 THR A OG1 1 
ATOM 3858  C CG2 . THR A 1 500 ? 50.669  57.958  -59.568  1.00 40.00 ? 504 THR A CG2 1 
ATOM 3859  N N   . THR A 1 501 ? 50.753  62.141  -59.765  1.00 40.00 ? 505 THR A N   1 
ATOM 3860  C CA  . THR A 1 501 ? 51.353  63.467  -59.601  1.00 40.00 ? 505 THR A CA  1 
ATOM 3861  C C   . THR A 1 501 ? 52.871  63.363  -59.630  1.00 40.00 ? 505 THR A C   1 
ATOM 3862  O O   . THR A 1 501 ? 53.543  63.946  -60.473  1.00 40.00 ? 505 THR A O   1 
ATOM 3863  C CB  . THR A 1 501 ? 50.883  64.081  -58.279  1.00 40.00 ? 505 THR A CB  1 
ATOM 3864  O OG1 . THR A 1 501 ? 50.017  63.105  -57.661  1.00 40.00 ? 505 THR A OG1 1 
ATOM 3865  C CG2 . THR A 1 501 ? 50.047  65.329  -58.518  1.00 40.00 ? 505 THR A CG2 1 
ATOM 3866  N N   . ALA A 1 502 ? 53.431  62.584  -58.719  1.00 40.00 ? 506 ALA A N   1 
ATOM 3867  C CA  . ALA A 1 502 ? 54.844  62.340  -58.565  1.00 40.00 ? 506 ALA A CA  1 
ATOM 3868  C C   . ALA A 1 502 ? 55.526  61.719  -59.759  1.00 40.00 ? 506 ALA A C   1 
ATOM 3869  O O   . ALA A 1 502 ? 56.503  62.297  -60.281  1.00 40.00 ? 506 ALA A O   1 
ATOM 3870  C CB  . ALA A 1 502 ? 55.103  61.432  -57.361  1.00 40.00 ? 506 ALA A CB  1 
ATOM 3871  N N   . ALA A 1 503 ? 55.107  60.542  -60.205  1.00 40.00 ? 507 ALA A N   1 
ATOM 3872  C CA  . ALA A 1 503 ? 55.877  60.017  -61.343  1.00 40.00 ? 507 ALA A CA  1 
ATOM 3873  C C   . ALA A 1 503 ? 55.428  60.572  -62.675  1.00 40.00 ? 507 ALA A C   1 
ATOM 3874  O O   . ALA A 1 503 ? 56.284  60.594  -63.566  1.00 40.00 ? 507 ALA A O   1 
ATOM 3875  C CB  . ALA A 1 503 ? 55.945  58.516  -61.362  1.00 40.00 ? 507 ALA A CB  1 
ATOM 3876  N N   . GLN A 1 504 ? 54.152  60.957  -62.812  1.00 40.00 ? 508 GLN A N   1 
ATOM 3877  C CA  . GLN A 1 504 ? 53.657  61.500  -64.061  1.00 40.00 ? 508 GLN A CA  1 
ATOM 3878  C C   . GLN A 1 504 ? 53.834  60.556  -65.243  1.00 40.00 ? 508 GLN A C   1 
ATOM 3879  O O   . GLN A 1 504 ? 54.381  60.915  -66.300  1.00 40.00 ? 508 GLN A O   1 
ATOM 3880  C CB  . GLN A 1 504 ? 54.454  62.782  -64.353  1.00 40.00 ? 508 GLN A CB  1 
ATOM 3881  C CG  . GLN A 1 504 ? 54.237  63.826  -63.264  1.00 40.00 ? 508 GLN A CG  1 
ATOM 3882  C CD  . GLN A 1 504 ? 54.770  65.179  -63.708  1.00 40.00 ? 508 GLN A CD  1 
ATOM 3883  O OE1 . GLN A 1 504 ? 54.908  65.472  -64.906  1.00 40.00 ? 508 GLN A OE1 1 
ATOM 3884  N NE2 . GLN A 1 504 ? 55.071  66.015  -62.716  1.00 40.00 ? 508 GLN A NE2 1 
ATOM 3885  N N   . GLN A 1 505 ? 53.351  59.330  -65.064  1.00 40.00 ? 509 GLN A N   1 
ATOM 3886  C CA  . GLN A 1 505 ? 53.506  58.337  -66.124  1.00 40.00 ? 509 GLN A CA  1 
ATOM 3887  C C   . GLN A 1 505 ? 52.369  58.252  -67.126  1.00 40.00 ? 509 GLN A C   1 
ATOM 3888  O O   . GLN A 1 505 ? 51.183  58.233  -66.797  1.00 40.00 ? 509 GLN A O   1 
ATOM 3889  C CB  . GLN A 1 505 ? 53.653  56.965  -65.417  1.00 40.00 ? 509 GLN A CB  1 
ATOM 3890  C CG  . GLN A 1 505 ? 54.568  57.075  -64.200  1.00 40.00 ? 509 GLN A CG  1 
ATOM 3891  C CD  . GLN A 1 505 ? 55.197  55.744  -63.832  1.00 40.00 ? 509 GLN A CD  1 
ATOM 3892  O OE1 . GLN A 1 505 ? 54.890  55.239  -62.746  1.00 40.00 ? 509 GLN A OE1 1 
ATOM 3893  N NE2 . GLN A 1 505 ? 56.048  55.192  -64.696  1.00 40.00 ? 509 GLN A NE2 1 
ATOM 3894  N N   . TYR A 1 506 ? 52.771  58.111  -68.382  1.00 40.00 ? 510 TYR A N   1 
ATOM 3895  C CA  . TYR A 1 506 ? 51.847  57.979  -69.507  1.00 40.00 ? 510 TYR A CA  1 
ATOM 3896  C C   . TYR A 1 506 ? 52.496  57.057  -70.531  1.00 40.00 ? 510 TYR A C   1 
ATOM 3897  O O   . TYR A 1 506 ? 53.717  56.832  -70.425  1.00 40.00 ? 510 TYR A O   1 
ATOM 3898  C CB  . TYR A 1 506 ? 51.536  59.362  -70.058  1.00 40.00 ? 510 TYR A CB  1 
ATOM 3899  C CG  . TYR A 1 506 ? 52.622  60.016  -70.878  1.00 40.00 ? 510 TYR A CG  1 
ATOM 3900  C CD1 . TYR A 1 506 ? 52.800  59.697  -72.216  1.00 40.00 ? 510 TYR A CD1 1 
ATOM 3901  C CD2 . TYR A 1 506 ? 53.468  60.968  -70.335  1.00 40.00 ? 510 TYR A CD2 1 
ATOM 3902  C CE1 . TYR A 1 506 ? 53.777  60.287  -72.984  1.00 40.00 ? 510 TYR A CE1 1 
ATOM 3903  C CE2 . TYR A 1 506 ? 54.453  61.564  -71.090  1.00 40.00 ? 510 TYR A CE2 1 
ATOM 3904  C CZ  . TYR A 1 506 ? 54.609  61.225  -72.413  1.00 40.00 ? 510 TYR A CZ  1 
ATOM 3905  O OH  . TYR A 1 506 ? 55.593  61.814  -73.177  1.00 40.00 ? 510 TYR A OH  1 
ATOM 3906  N N   . VAL A 1 507 ? 51.768  56.529  -71.502  1.00 40.00 ? 511 VAL A N   1 
ATOM 3907  C CA  . VAL A 1 507 ? 52.342  55.562  -72.428  1.00 40.00 ? 511 VAL A CA  1 
ATOM 3908  C C   . VAL A 1 507 ? 52.251  55.893  -73.891  1.00 40.00 ? 511 VAL A C   1 
ATOM 3909  O O   . VAL A 1 507 ? 51.297  56.559  -74.310  1.00 40.00 ? 511 VAL A O   1 
ATOM 3910  C CB  . VAL A 1 507 ? 51.527  54.241  -72.239  1.00 40.00 ? 511 VAL A CB  1 
ATOM 3911  C CG1 . VAL A 1 507 ? 51.819  53.602  -70.893  1.00 40.00 ? 511 VAL A CG1 1 
ATOM 3912  C CG2 . VAL A 1 507 ? 50.029  54.518  -72.346  1.00 40.00 ? 511 VAL A CG2 1 
ATOM 3913  N N   . SER A 1 508 ? 53.175  55.386  -74.692  1.00 40.00 ? 512 SER A N   1 
ATOM 3914  C CA  . SER A 1 508 ? 53.096  55.665  -76.121  1.00 40.00 ? 512 SER A CA  1 
ATOM 3915  C C   . SER A 1 508 ? 52.181  54.645  -76.790  1.00 40.00 ? 512 SER A C   1 
ATOM 3916  O O   . SER A 1 508 ? 52.520  53.456  -76.906  1.00 40.00 ? 512 SER A O   1 
ATOM 3917  C CB  . SER A 1 508 ? 54.477  55.706  -76.740  1.00 40.00 ? 512 SER A CB  1 
ATOM 3918  O OG  . SER A 1 508 ? 54.447  55.146  -78.045  1.00 40.00 ? 512 SER A OG  1 
ATOM 3919  N N   . LEU A 1 509 ? 50.995  55.098  -77.204  1.00 40.00 ? 513 LEU A N   1 
ATOM 3920  C CA  . LEU A 1 509 ? 50.050  54.236  -77.914  1.00 40.00 ? 513 LEU A CA  1 
ATOM 3921  C C   . LEU A 1 509 ? 50.467  54.278  -79.388  1.00 40.00 ? 513 LEU A C   1 
ATOM 3922  O O   . LEU A 1 509 ? 50.214  55.239  -80.108  1.00 40.00 ? 513 LEU A O   1 
ATOM 3923  C CB  . LEU A 1 509 ? 48.618  54.716  -77.787  1.00 40.00 ? 513 LEU A CB  1 
ATOM 3924  C CG  . LEU A 1 509 ? 47.706  54.018  -76.793  1.00 40.00 ? 513 LEU A CG  1 
ATOM 3925  C CD1 . LEU A 1 509 ? 47.393  52.598  -77.254  1.00 40.00 ? 513 LEU A CD1 1 
ATOM 3926  C CD2 . LEU A 1 509 ? 48.306  53.950  -75.390  1.00 40.00 ? 513 LEU A CD2 1 
ATOM 3927  N N   . ASN A 1 510 ? 51.170  53.248  -79.824  1.00 40.00 ? 514 ASN A N   1 
ATOM 3928  C CA  . ASN A 1 510 ? 51.590  53.223  -81.238  1.00 40.00 ? 514 ASN A CA  1 
ATOM 3929  C C   . ASN A 1 510 ? 52.005  51.795  -81.597  1.00 40.00 ? 514 ASN A C   1 
ATOM 3930  O O   . ASN A 1 510 ? 52.015  50.905  -80.735  1.00 40.00 ? 514 ASN A O   1 
ATOM 3931  C CB  . ASN A 1 510 ? 52.646  54.271  -81.494  1.00 40.00 ? 514 ASN A CB  1 
ATOM 3932  C CG  . ASN A 1 510 ? 53.955  53.689  -82.017  1.00 40.00 ? 514 ASN A CG  1 
ATOM 3933  O OD1 . ASN A 1 510 ? 54.056  53.492  -83.241  1.00 40.00 ? 514 ASN A OD1 1 
ATOM 3934  N ND2 . ASN A 1 510 ? 54.857  53.403  -81.092  1.00 40.00 ? 514 ASN A ND2 1 
ATOM 3935  N N   . LEU A 1 511 ? 52.326  51.572  -82.860  1.00 40.00 ? 515 LEU A N   1 
ATOM 3936  C CA  . LEU A 1 511 ? 52.776  50.336  -83.430  1.00 40.00 ? 515 LEU A CA  1 
ATOM 3937  C C   . LEU A 1 511 ? 53.756  49.534  -82.597  1.00 40.00 ? 515 LEU A C   1 
ATOM 3938  O O   . LEU A 1 511 ? 53.595  48.315  -82.472  1.00 40.00 ? 515 LEU A O   1 
ATOM 3939  C CB  . LEU A 1 511 ? 53.370  50.620  -84.827  1.00 40.00 ? 515 LEU A CB  1 
ATOM 3940  C CG  . LEU A 1 511 ? 52.313  50.966  -85.889  1.00 40.00 ? 515 LEU A CG  1 
ATOM 3941  C CD1 . LEU A 1 511 ? 52.746  50.611  -87.302  1.00 40.00 ? 515 LEU A CD1 1 
ATOM 3942  C CD2 . LEU A 1 511 ? 50.968  50.281  -85.601  1.00 40.00 ? 515 LEU A CD2 1 
ATOM 3943  N N   . LYS A 1 512 ? 54.777  50.158  -82.031  1.00 40.00 ? 516 LYS A N   1 
ATOM 3944  C CA  . LYS A 1 512 ? 55.732  49.498  -81.141  1.00 40.00 ? 516 LYS A CA  1 
ATOM 3945  C C   . LYS A 1 512 ? 55.024  49.347  -79.793  1.00 40.00 ? 516 LYS A C   1 
ATOM 3946  O O   . LYS A 1 512 ? 54.188  50.177  -79.432  1.00 40.00 ? 516 LYS A O   1 
ATOM 3947  C CB  . LYS A 1 512 ? 57.014  50.291  -81.006  1.00 40.00 ? 516 LYS A CB  1 
ATOM 3948  C CG  . LYS A 1 512 ? 58.045  50.070  -82.088  1.00 40.00 ? 516 LYS A CG  1 
ATOM 3949  C CD  . LYS A 1 512 ? 57.492  50.010  -83.493  1.00 40.00 ? 516 LYS A CD  1 
ATOM 3950  C CE  . LYS A 1 512 ? 57.264  48.585  -83.976  1.00 40.00 ? 516 LYS A CE  1 
ATOM 3951  N NZ  . LYS A 1 512 ? 56.429  48.492  -85.209  1.00 40.00 ? 516 LYS A NZ  1 
ATOM 3952  N N   . PRO A 1 513 ? 55.307  48.287  -79.069  1.00 40.00 ? 517 PRO A N   1 
ATOM 3953  C CA  . PRO A 1 513 ? 54.672  47.999  -77.806  1.00 40.00 ? 517 PRO A CA  1 
ATOM 3954  C C   . PRO A 1 513 ? 54.683  49.148  -76.823  1.00 40.00 ? 517 PRO A C   1 
ATOM 3955  O O   . PRO A 1 513 ? 55.484  50.065  -76.944  1.00 40.00 ? 517 PRO A O   1 
ATOM 3956  C CB  . PRO A 1 513 ? 55.472  46.835  -77.221  1.00 40.00 ? 517 PRO A CB  1 
ATOM 3957  C CG  . PRO A 1 513 ? 56.193  46.230  -78.367  1.00 40.00 ? 517 PRO A CG  1 
ATOM 3958  C CD  . PRO A 1 513 ? 56.300  47.249  -79.457  1.00 40.00 ? 517 PRO A CD  1 
ATOM 3959  N N   . LEU A 1 514 ? 53.799  49.069  -75.827  1.00 40.00 ? 518 LEU A N   1 
ATOM 3960  C CA  . LEU A 1 514 ? 53.756  50.109  -74.813  1.00 40.00 ? 518 LEU A CA  1 
ATOM 3961  C C   . LEU A 1 514 ? 55.162  50.560  -74.426  1.00 40.00 ? 518 LEU A C   1 
ATOM 3962  O O   . LEU A 1 514 ? 56.082  49.762  -74.314  1.00 40.00 ? 518 LEU A O   1 
ATOM 3963  C CB  . LEU A 1 514 ? 53.034  49.675  -73.544  1.00 40.00 ? 518 LEU A CB  1 
ATOM 3964  C CG  . LEU A 1 514 ? 51.551  50.041  -73.462  1.00 40.00 ? 518 LEU A CG  1 
ATOM 3965  C CD1 . LEU A 1 514 ? 51.071  49.995  -72.020  1.00 40.00 ? 518 LEU A CD1 1 
ATOM 3966  C CD2 . LEU A 1 514 ? 51.288  51.410  -74.077  1.00 40.00 ? 518 LEU A CD2 1 
ATOM 3967  N N   . GLU A 1 515 ? 55.303  51.865  -74.216  1.00 40.00 ? 519 GLU A N   1 
ATOM 3968  C CA  . GLU A 1 515 ? 56.599  52.441  -73.845  1.00 40.00 ? 519 GLU A CA  1 
ATOM 3969  C C   . GLU A 1 515 ? 56.439  53.568  -72.842  1.00 40.00 ? 519 GLU A C   1 
ATOM 3970  O O   . GLU A 1 515 ? 56.516  54.737  -73.228  1.00 40.00 ? 519 GLU A O   1 
ATOM 3971  C CB  . GLU A 1 515 ? 57.294  52.933  -75.118  1.00 40.00 ? 519 GLU A CB  1 
ATOM 3972  C CG  . GLU A 1 515 ? 58.697  53.447  -74.880  1.00 40.00 ? 519 GLU A CG  1 
ATOM 3973  C CD  . GLU A 1 515 ? 59.131  54.438  -75.942  1.00 40.00 ? 519 GLU A CD  1 
ATOM 3974  O OE1 . GLU A 1 515 ? 59.258  54.021  -77.118  1.00 40.00 ? 519 GLU A OE1 1 
ATOM 3975  O OE2 . GLU A 1 515 ? 59.336  55.616  -75.581  1.00 40.00 ? 519 GLU A OE2 1 
ATOM 3976  N N   . VAL A 1 516 ? 56.232  53.278  -71.561  1.00 40.00 ? 520 VAL A N   1 
ATOM 3977  C CA  . VAL A 1 516 ? 56.031  54.291  -70.557  1.00 40.00 ? 520 VAL A CA  1 
ATOM 3978  C C   . VAL A 1 516 ? 56.983  55.487  -70.587  1.00 40.00 ? 520 VAL A C   1 
ATOM 3979  O O   . VAL A 1 516 ? 58.186  55.360  -70.773  1.00 40.00 ? 520 VAL A O   1 
ATOM 3980  C CB  . VAL A 1 516 ? 55.999  53.778  -69.108  1.00 40.00 ? 520 VAL A CB  1 
ATOM 3981  C CG1 . VAL A 1 516 ? 55.534  54.918  -68.185  1.00 40.00 ? 520 VAL A CG1 1 
ATOM 3982  C CG2 . VAL A 1 516 ? 55.092  52.586  -68.942  1.00 40.00 ? 520 VAL A CG2 1 
ATOM 3983  N N   . ARG A 1 517 ? 56.376  56.683  -70.390  1.00 40.00 ? 521 ARG A N   1 
ATOM 3984  C CA  . ARG A 1 517 ? 57.099  57.942  -70.357  1.00 40.00 ? 521 ARG A CA  1 
ATOM 3985  C C   . ARG A 1 517 ? 56.686  58.797  -69.165  1.00 40.00 ? 521 ARG A C   1 
ATOM 3986  O O   . ARG A 1 517 ? 55.679  58.467  -68.518  1.00 40.00 ? 521 ARG A O   1 
ATOM 3987  C CB  . ARG A 1 517 ? 56.926  58.723  -71.639  1.00 40.00 ? 521 ARG A CB  1 
ATOM 3988  C CG  . ARG A 1 517 ? 57.481  58.053  -72.885  1.00 40.00 ? 521 ARG A CG  1 
ATOM 3989  C CD  . ARG A 1 517 ? 56.958  58.739  -74.118  1.00 40.00 ? 521 ARG A CD  1 
ATOM 3990  N NE  . ARG A 1 517 ? 57.013  57.967  -75.350  1.00 40.00 ? 521 ARG A NE  1 
ATOM 3991  C CZ  . ARG A 1 517 ? 56.707  58.465  -76.558  1.00 40.00 ? 521 ARG A CZ  1 
ATOM 3992  N NH1 . ARG A 1 517 ? 56.311  59.738  -76.705  1.00 40.00 ? 521 ARG A NH1 1 
ATOM 3993  N NH2 . ARG A 1 517 ? 56.788  57.687  -77.634  1.00 40.00 ? 521 ARG A NH2 1 
ATOM 3994  N N   . ARG A 1 518 ? 57.484  59.824  -68.839  1.00 40.00 ? 522 ARG A N   1 
ATOM 3995  C CA  . ARG A 1 518 ? 57.129  60.671  -67.697  1.00 40.00 ? 522 ARG A CA  1 
ATOM 3996  C C   . ARG A 1 518 ? 57.007  62.148  -68.087  1.00 40.00 ? 522 ARG A C   1 
ATOM 3997  O O   . ARG A 1 518 ? 57.805  62.700  -68.846  1.00 40.00 ? 522 ARG A O   1 
ATOM 3998  C CB  . ARG A 1 518 ? 58.055  60.533  -66.494  1.00 40.00 ? 522 ARG A CB  1 
ATOM 3999  C CG  . ARG A 1 518 ? 58.576  59.161  -66.201  1.00 40.00 ? 522 ARG A CG  1 
ATOM 4000  C CD  . ARG A 1 518 ? 59.324  58.987  -64.920  1.00 40.00 ? 522 ARG A CD  1 
ATOM 4001  N NE  . ARG A 1 518 ? 58.716  59.643  -63.769  1.00 40.00 ? 522 ARG A NE  1 
ATOM 4002  C CZ  . ARG A 1 518 ? 59.471  60.310  -62.885  1.00 40.00 ? 522 ARG A CZ  1 
ATOM 4003  N NH1 . ARG A 1 518 ? 60.786  60.375  -63.082  1.00 40.00 ? 522 ARG A NH1 1 
ATOM 4004  N NH2 . ARG A 1 518 ? 58.885  60.895  -61.849  1.00 40.00 ? 522 ARG A NH2 1 
ATOM 4005  N N   . GLY A 1 519 ? 55.975  62.782  -67.533  1.00 40.00 ? 523 GLY A N   1 
ATOM 4006  C CA  . GLY A 1 519 ? 55.709  64.182  -67.794  1.00 40.00 ? 523 GLY A CA  1 
ATOM 4007  C C   . GLY A 1 519 ? 55.120  64.455  -69.167  1.00 40.00 ? 523 GLY A C   1 
ATOM 4008  O O   . GLY A 1 519 ? 55.771  64.269  -70.211  1.00 40.00 ? 523 GLY A O   1 
ATOM 4009  N N   . LEU A 1 520 ? 53.862  64.897  -69.168  1.00 40.00 ? 524 LEU A N   1 
ATOM 4010  C CA  . LEU A 1 520 ? 53.214  65.224  -70.459  1.00 40.00 ? 524 LEU A CA  1 
ATOM 4011  C C   . LEU A 1 520 ? 53.566  66.684  -70.718  1.00 40.00 ? 524 LEU A C   1 
ATOM 4012  O O   . LEU A 1 520 ? 53.130  67.516  -69.901  1.00 40.00 ? 524 LEU A O   1 
ATOM 4013  C CB  . LEU A 1 520 ? 51.723  65.109  -70.282  1.00 40.00 ? 524 LEU A CB  1 
ATOM 4014  C CG  . LEU A 1 520 ? 50.903  64.216  -71.201  1.00 40.00 ? 524 LEU A CG  1 
ATOM 4015  C CD1 . LEU A 1 520 ? 49.441  64.576  -70.992  1.00 40.00 ? 524 LEU A CD1 1 
ATOM 4016  C CD2 . LEU A 1 520 ? 51.323  64.354  -72.653  1.00 40.00 ? 524 LEU A CD2 1 
ATOM 4017  N N   . ARG A 1 521 ? 54.414  66.949  -71.681  1.00 40.00 ? 525 ARG A N   1 
ATOM 4018  C CA  . ARG A 1 521 ? 54.867  68.321  -71.957  1.00 40.00 ? 525 ARG A CA  1 
ATOM 4019  C C   . ARG A 1 521 ? 55.081  69.126  -70.691  1.00 40.00 ? 525 ARG A C   1 
ATOM 4020  O O   . ARG A 1 521 ? 54.769  70.321  -70.653  1.00 40.00 ? 525 ARG A O   1 
ATOM 4021  C CB  . ARG A 1 521 ? 53.855  68.992  -72.905  1.00 40.00 ? 525 ARG A CB  1 
ATOM 4022  C CG  . ARG A 1 521 ? 53.794  68.269  -74.247  1.00 40.00 ? 525 ARG A CG  1 
ATOM 4023  C CD  . ARG A 1 521 ? 54.508  69.093  -75.283  1.00 40.00 ? 525 ARG A CD  1 
ATOM 4024  N NE  . ARG A 1 521 ? 53.975  69.106  -76.622  1.00 40.00 ? 525 ARG A NE  1 
ATOM 4025  C CZ  . ARG A 1 521 ? 53.554  68.107  -77.390  1.00 40.00 ? 525 ARG A CZ  1 
ATOM 4026  N NH1 . ARG A 1 521 ? 53.557  66.844  -76.965  1.00 40.00 ? 525 ARG A NH1 1 
ATOM 4027  N NH2 . ARG A 1 521 ? 53.118  68.348  -78.628  1.00 40.00 ? 525 ARG A NH2 1 
ATOM 4028  N N   . ALA A 1 522 ? 55.638  68.570  -69.636  1.00 40.00 ? 526 ALA A N   1 
ATOM 4029  C CA  . ALA A 1 522 ? 55.832  69.145  -68.337  1.00 40.00 ? 526 ALA A CA  1 
ATOM 4030  C C   . ALA A 1 522 ? 56.231  70.601  -68.250  1.00 40.00 ? 526 ALA A C   1 
ATOM 4031  O O   . ALA A 1 522 ? 55.589  71.356  -67.493  1.00 40.00 ? 526 ALA A O   1 
ATOM 4032  C CB  . ALA A 1 522 ? 56.765  68.279  -67.521  1.00 40.00 ? 526 ALA A CB  1 
ATOM 4033  N N   . GLN A 1 523 ? 57.255  71.048  -68.960  1.00 40.00 ? 527 GLN A N   1 
ATOM 4034  C CA  . GLN A 1 523 ? 57.636  72.447  -68.899  1.00 40.00 ? 527 GLN A CA  1 
ATOM 4035  C C   . GLN A 1 523 ? 56.535  73.312  -69.506  1.00 40.00 ? 527 GLN A C   1 
ATOM 4036  O O   . GLN A 1 523 ? 55.911  74.140  -68.872  1.00 40.00 ? 527 GLN A O   1 
ATOM 4037  C CB  . GLN A 1 523 ? 58.888  72.688  -69.776  1.00 40.00 ? 527 GLN A CB  1 
ATOM 4038  C CG  . GLN A 1 523 ? 60.158  72.670  -68.905  1.00 40.00 ? 527 GLN A CG  1 
ATOM 4039  C CD  . GLN A 1 523 ? 60.471  71.223  -68.545  1.00 40.00 ? 527 GLN A CD  1 
ATOM 4040  O OE1 . GLN A 1 523 ? 59.946  70.290  -69.186  1.00 40.00 ? 527 GLN A OE1 1 
ATOM 4041  N NE2 . GLN A 1 523 ? 61.302  71.007  -67.550  1.00 40.00 ? 527 GLN A NE2 1 
ATOM 4042  N N   . THR A 1 524 ? 56.350  73.000  -70.803  1.00 40.00 ? 528 THR A N   1 
ATOM 4043  C CA  . THR A 1 524 ? 55.375  73.674  -71.626  1.00 40.00 ? 528 THR A CA  1 
ATOM 4044  C C   . THR A 1 524 ? 54.039  73.817  -70.920  1.00 40.00 ? 528 THR A C   1 
ATOM 4045  O O   . THR A 1 524 ? 53.477  74.914  -70.880  1.00 40.00 ? 528 THR A O   1 
ATOM 4046  C CB  . THR A 1 524 ? 55.149  72.940  -72.955  1.00 40.00 ? 528 THR A CB  1 
ATOM 4047  O OG1 . THR A 1 524 ? 56.412  72.938  -73.644  1.00 40.00 ? 528 THR A OG1 1 
ATOM 4048  C CG2 . THR A 1 524 ? 54.135  73.719  -73.809  1.00 40.00 ? 528 THR A CG2 1 
ATOM 4049  N N   . CYS A 1 525 ? 53.571  72.711  -70.331  1.00 40.00 ? 529 CYS A N   1 
ATOM 4050  C CA  . CYS A 1 525 ? 52.298  72.771  -69.651  1.00 40.00 ? 529 CYS A CA  1 
ATOM 4051  C C   . CYS A 1 525 ? 52.414  73.510  -68.351  1.00 40.00 ? 529 CYS A C   1 
ATOM 4052  O O   . CYS A 1 525 ? 51.391  74.011  -67.829  1.00 40.00 ? 529 CYS A O   1 
ATOM 4053  C CB  . CYS A 1 525 ? 51.618  71.421  -69.586  1.00 40.00 ? 529 CYS A CB  1 
ATOM 4054  S SG  . CYS A 1 525 ? 51.216  70.758  -71.240  1.00 40.00 ? 529 CYS A SG  1 
ATOM 4055  N N   . ALA A 1 526 ? 53.649  73.666  -67.853  1.00 40.00 ? 530 ALA A N   1 
ATOM 4056  C CA  . ALA A 1 526 ? 53.745  74.464  -66.599  1.00 40.00 ? 530 ALA A CA  1 
ATOM 4057  C C   . ALA A 1 526 ? 53.532  75.914  -67.030  1.00 40.00 ? 530 ALA A C   1 
ATOM 4058  O O   . ALA A 1 526 ? 52.879  76.699  -66.359  1.00 40.00 ? 530 ALA A O   1 
ATOM 4059  C CB  . ALA A 1 526 ? 55.068  74.282  -65.922  1.00 40.00 ? 530 ALA A CB  1 
ATOM 4060  N N   . PHE A 1 527 ? 54.080  76.206  -68.218  1.00 40.00 ? 531 PHE A N   1 
ATOM 4061  C CA  . PHE A 1 527 ? 53.942  77.520  -68.787  1.00 40.00 ? 531 PHE A CA  1 
ATOM 4062  C C   . PHE A 1 527 ? 52.469  77.952  -68.840  1.00 40.00 ? 531 PHE A C   1 
ATOM 4063  O O   . PHE A 1 527 ? 52.099  78.996  -68.291  1.00 40.00 ? 531 PHE A O   1 
ATOM 4064  C CB  . PHE A 1 527 ? 54.529  77.495  -70.205  1.00 40.00 ? 531 PHE A CB  1 
ATOM 4065  C CG  . PHE A 1 527 ? 54.275  78.758  -70.975  1.00 40.00 ? 531 PHE A CG  1 
ATOM 4066  C CD1 . PHE A 1 527 ? 54.498  80.002  -70.411  1.00 40.00 ? 531 PHE A CD1 1 
ATOM 4067  C CD2 . PHE A 1 527 ? 53.783  78.700  -72.258  1.00 40.00 ? 531 PHE A CD2 1 
ATOM 4068  C CE1 . PHE A 1 527 ? 54.234  81.158  -71.117  1.00 40.00 ? 531 PHE A CE1 1 
ATOM 4069  C CE2 . PHE A 1 527 ? 53.528  79.852  -72.966  1.00 40.00 ? 531 PHE A CE2 1 
ATOM 4070  C CZ  . PHE A 1 527 ? 53.757  81.092  -72.400  1.00 40.00 ? 531 PHE A CZ  1 
ATOM 4071  N N   . TRP A 1 528 ? 51.706  77.110  -69.544  1.00 40.00 ? 532 TRP A N   1 
ATOM 4072  C CA  . TRP A 1 528 ? 50.303  77.303  -69.792  1.00 40.00 ? 532 TRP A CA  1 
ATOM 4073  C C   . TRP A 1 528 ? 49.450  77.157  -68.538  1.00 40.00 ? 532 TRP A C   1 
ATOM 4074  O O   . TRP A 1 528 ? 48.664  78.062  -68.201  1.00 40.00 ? 532 TRP A O   1 
ATOM 4075  C CB  . TRP A 1 528 ? 49.791  76.329  -70.832  1.00 40.00 ? 532 TRP A CB  1 
ATOM 4076  C CG  . TRP A 1 528 ? 50.299  76.497  -72.218  1.00 40.00 ? 532 TRP A CG  1 
ATOM 4077  C CD1 . TRP A 1 528 ? 51.217  75.704  -72.871  1.00 40.00 ? 532 TRP A CD1 1 
ATOM 4078  C CD2 . TRP A 1 528 ? 49.921  77.493  -73.175  1.00 40.00 ? 532 TRP A CD2 1 
ATOM 4079  N NE1 . TRP A 1 528 ? 51.428  76.160  -74.156  1.00 40.00 ? 532 TRP A NE1 1 
ATOM 4080  C CE2 . TRP A 1 528 ? 50.641  77.250  -74.361  1.00 40.00 ? 532 TRP A CE2 1 
ATOM 4081  C CE3 . TRP A 1 528 ? 49.028  78.575  -73.137  1.00 40.00 ? 532 TRP A CE3 1 
ATOM 4082  C CZ2 . TRP A 1 528 ? 50.497  78.047  -75.486  1.00 40.00 ? 532 TRP A CZ2 1 
ATOM 4083  C CZ3 . TRP A 1 528 ? 48.893  79.366  -74.256  1.00 40.00 ? 532 TRP A CZ3 1 
ATOM 4084  C CH2 . TRP A 1 528 ? 49.630  79.113  -75.425  1.00 40.00 ? 532 TRP A CH2 1 
ATOM 4085  N N   . ASN A 1 529 ? 49.599  76.022  -67.842  1.00 40.00 ? 533 ASN A N   1 
ATOM 4086  C CA  . ASN A 1 529 ? 48.730  75.843  -66.680  1.00 40.00 ? 533 ASN A CA  1 
ATOM 4087  C C   . ASN A 1 529 ? 49.120  76.648  -65.474  1.00 40.00 ? 533 ASN A C   1 
ATOM 4088  O O   . ASN A 1 529 ? 48.211  76.985  -64.694  1.00 40.00 ? 533 ASN A O   1 
ATOM 4089  C CB  . ASN A 1 529 ? 48.564  74.376  -66.303  1.00 40.00 ? 533 ASN A CB  1 
ATOM 4090  C CG  . ASN A 1 529 ? 48.400  73.493  -67.528  1.00 40.00 ? 533 ASN A CG  1 
ATOM 4091  O OD1 . ASN A 1 529 ? 47.927  73.905  -68.597  1.00 40.00 ? 533 ASN A OD1 1 
ATOM 4092  N ND2 . ASN A 1 529 ? 48.834  72.245  -67.350  1.00 40.00 ? 533 ASN A ND2 1 
ATOM 4093  N N   . ARG A 1 530 ? 50.399  76.980  -65.274  1.00 40.00 ? 534 ARG A N   1 
ATOM 4094  C CA  . ARG A 1 530 ? 50.734  77.726  -64.057  1.00 40.00 ? 534 ARG A CA  1 
ATOM 4095  C C   . ARG A 1 530 ? 50.983  79.219  -64.250  1.00 40.00 ? 534 ARG A C   1 
ATOM 4096  O O   . ARG A 1 530 ? 50.390  80.027  -63.523  1.00 40.00 ? 534 ARG A O   1 
ATOM 4097  C CB  . ARG A 1 530 ? 51.976  77.194  -63.365  1.00 40.00 ? 534 ARG A CB  1 
ATOM 4098  C CG  . ARG A 1 530 ? 52.055  75.766  -62.929  1.00 40.00 ? 534 ARG A CG  1 
ATOM 4099  C CD  . ARG A 1 530 ? 52.823  75.624  -61.618  1.00 40.00 ? 534 ARG A CD  1 
ATOM 4100  N NE  . ARG A 1 530 ? 52.681  74.347  -60.951  1.00 40.00 ? 534 ARG A NE  1 
ATOM 4101  C CZ  . ARG A 1 530 ? 52.710  73.165  -61.570  1.00 40.00 ? 534 ARG A CZ  1 
ATOM 4102  N NH1 . ARG A 1 530 ? 52.857  73.007  -62.883  1.00 40.00 ? 534 ARG A NH1 1 
ATOM 4103  N NH2 . ARG A 1 530 ? 52.578  72.095  -60.789  1.00 40.00 ? 534 ARG A NH2 1 
ATOM 4104  N N   . PHE A 1 531 ? 51.877  79.601  -65.131  1.00 40.00 ? 535 PHE A N   1 
ATOM 4105  C CA  . PHE A 1 531 ? 52.269  80.982  -65.299  1.00 40.00 ? 535 PHE A CA  1 
ATOM 4106  C C   . PHE A 1 531 ? 51.394  81.861  -66.157  1.00 40.00 ? 535 PHE A C   1 
ATOM 4107  O O   . PHE A 1 531 ? 50.845  82.915  -65.776  1.00 40.00 ? 535 PHE A O   1 
ATOM 4108  C CB  . PHE A 1 531 ? 53.691  80.937  -65.941  1.00 40.00 ? 535 PHE A CB  1 
ATOM 4109  C CG  . PHE A 1 531 ? 54.210  82.309  -66.236  1.00 40.00 ? 535 PHE A CG  1 
ATOM 4110  C CD1 . PHE A 1 531 ? 54.231  83.278  -65.238  1.00 40.00 ? 535 PHE A CD1 1 
ATOM 4111  C CD2 . PHE A 1 531 ? 54.660  82.629  -67.510  1.00 40.00 ? 535 PHE A CD2 1 
ATOM 4112  C CE1 . PHE A 1 531 ? 54.681  84.540  -65.467  1.00 40.00 ? 535 PHE A CE1 1 
ATOM 4113  C CE2 . PHE A 1 531 ? 55.132  83.912  -67.771  1.00 40.00 ? 535 PHE A CE2 1 
ATOM 4114  C CZ  . PHE A 1 531 ? 55.127  84.851  -66.746  1.00 40.00 ? 535 PHE A CZ  1 
ATOM 4115  N N   . LEU A 1 532 ? 51.168  81.403  -67.407  1.00 40.00 ? 536 LEU A N   1 
ATOM 4116  C CA  . LEU A 1 532 ? 50.369  82.134  -68.384  1.00 40.00 ? 536 LEU A CA  1 
ATOM 4117  C C   . LEU A 1 532 ? 49.121  82.782  -67.846  1.00 40.00 ? 536 LEU A C   1 
ATOM 4118  O O   . LEU A 1 532 ? 48.887  83.965  -68.072  1.00 40.00 ? 536 LEU A O   1 
ATOM 4119  C CB  . LEU A 1 532 ? 50.053  81.355  -69.623  1.00 40.00 ? 536 LEU A CB  1 
ATOM 4120  C CG  . LEU A 1 532 ? 50.231  82.083  -70.956  1.00 40.00 ? 536 LEU A CG  1 
ATOM 4121  C CD1 . LEU A 1 532 ? 48.955  81.901  -71.777  1.00 40.00 ? 536 LEU A CD1 1 
ATOM 4122  C CD2 . LEU A 1 532 ? 50.637  83.516  -70.781  1.00 40.00 ? 536 LEU A CD2 1 
ATOM 4123  N N   . PRO A 1 533 ? 48.312  82.032  -67.121  1.00 40.00 ? 537 PRO A N   1 
ATOM 4124  C CA  . PRO A 1 533 ? 47.129  82.547  -66.470  1.00 40.00 ? 537 PRO A CA  1 
ATOM 4125  C C   . PRO A 1 533 ? 47.466  83.744  -65.603  1.00 40.00 ? 537 PRO A C   1 
ATOM 4126  O O   . PRO A 1 533 ? 46.877  84.810  -65.841  1.00 40.00 ? 537 PRO A O   1 
ATOM 4127  C CB  . PRO A 1 533 ? 46.655  81.406  -65.572  1.00 40.00 ? 537 PRO A CB  1 
ATOM 4128  C CG  . PRO A 1 533 ? 47.101  80.202  -66.343  1.00 40.00 ? 537 PRO A CG  1 
ATOM 4129  C CD  . PRO A 1 533 ? 48.477  80.588  -66.829  1.00 40.00 ? 537 PRO A CD  1 
ATOM 4130  N N   . LYS A 1 534 ? 48.428  83.661  -64.665  1.00 40.00 ? 538 LYS A N   1 
ATOM 4131  C CA  . LYS A 1 534 ? 48.704  84.855  -63.870  1.00 40.00 ? 538 LYS A CA  1 
ATOM 4132  C C   . LYS A 1 534 ? 49.126  86.017  -64.759  1.00 40.00 ? 538 LYS A C   1 
ATOM 4133  O O   . LYS A 1 534 ? 48.910  87.165  -64.381  1.00 40.00 ? 538 LYS A O   1 
ATOM 4134  C CB  . LYS A 1 534 ? 49.733  84.688  -62.782  1.00 40.00 ? 538 LYS A CB  1 
ATOM 4135  C CG  . LYS A 1 534 ? 50.581  83.445  -62.850  1.00 40.00 ? 538 LYS A CG  1 
ATOM 4136  C CD  . LYS A 1 534 ? 50.103  82.448  -61.803  1.00 40.00 ? 538 LYS A CD  1 
ATOM 4137  C CE  . LYS A 1 534 ? 50.136  83.055  -60.403  1.00 40.00 ? 538 LYS A CE  1 
ATOM 4138  N NZ  . LYS A 1 534 ? 50.785  82.058  -59.484  1.00 40.00 ? 538 LYS A NZ  1 
ATOM 4139  N N   . LEU A 1 535 ? 49.763  85.708  -65.898  1.00 40.00 ? 539 LEU A N   1 
ATOM 4140  C CA  . LEU A 1 535 ? 50.181  86.805  -66.767  1.00 40.00 ? 539 LEU A CA  1 
ATOM 4141  C C   . LEU A 1 535 ? 48.903  87.481  -67.275  1.00 40.00 ? 539 LEU A C   1 
ATOM 4142  O O   . LEU A 1 535 ? 48.793  88.687  -67.298  1.00 40.00 ? 539 LEU A O   1 
ATOM 4143  C CB  . LEU A 1 535 ? 50.917  86.398  -68.041  1.00 40.00 ? 539 LEU A CB  1 
ATOM 4144  C CG  . LEU A 1 535 ? 52.295  86.995  -68.263  1.00 40.00 ? 539 LEU A CG  1 
ATOM 4145  C CD1 . LEU A 1 535 ? 52.791  86.759  -69.675  1.00 40.00 ? 539 LEU A CD1 1 
ATOM 4146  C CD2 . LEU A 1 535 ? 52.337  88.474  -67.931  1.00 40.00 ? 539 LEU A CD2 1 
ATOM 4147  N N   . LEU A 1 536 ? 47.998  86.608  -67.723  1.00 40.00 ? 540 LEU A N   1 
ATOM 4148  C CA  . LEU A 1 536 ? 46.748  87.098  -68.286  1.00 40.00 ? 540 LEU A CA  1 
ATOM 4149  C C   . LEU A 1 536 ? 45.918  87.842  -67.286  1.00 40.00 ? 540 LEU A C   1 
ATOM 4150  O O   . LEU A 1 536 ? 45.391  88.915  -67.584  1.00 40.00 ? 540 LEU A O   1 
ATOM 4151  C CB  . LEU A 1 536 ? 46.000  85.936  -68.930  1.00 40.00 ? 540 LEU A CB  1 
ATOM 4152  C CG  . LEU A 1 536 ? 46.674  85.477  -70.235  1.00 40.00 ? 540 LEU A CG  1 
ATOM 4153  C CD1 . LEU A 1 536 ? 46.007  84.249  -70.825  1.00 40.00 ? 540 LEU A CD1 1 
ATOM 4154  C CD2 . LEU A 1 536 ? 46.684  86.658  -71.216  1.00 40.00 ? 540 LEU A CD2 1 
ATOM 4155  N N   . SER A 1 537 ? 45.843  87.364  -66.052  1.00 40.00 ? 541 SER A N   1 
ATOM 4156  C CA  . SER A 1 537 ? 45.076  88.024  -65.009  1.00 40.00 ? 541 SER A CA  1 
ATOM 4157  C C   . SER A 1 537 ? 45.785  89.262  -64.484  1.00 40.00 ? 541 SER A C   1 
ATOM 4158  O O   . SER A 1 537 ? 45.291  89.920  -63.561  1.00 40.00 ? 541 SER A O   1 
ATOM 4159  C CB  . SER A 1 537 ? 44.751  87.091  -63.848  1.00 40.00 ? 541 SER A CB  1 
ATOM 4160  O OG  . SER A 1 537 ? 45.840  86.287  -63.454  1.00 40.00 ? 541 SER A OG  1 
ATOM 4161  N N   . ALA A 1 538 ? 46.952  89.578  -65.007  1.00 40.00 ? 542 ALA A N   1 
ATOM 4162  C CA  . ALA A 1 538 ? 47.659  90.780  -64.578  1.00 40.00 ? 542 ALA A CA  1 
ATOM 4163  C C   . ALA A 1 538 ? 47.365  91.840  -65.655  1.00 40.00 ? 542 ALA A C   1 
ATOM 4164  O O   . ALA A 1 538 ? 47.122  92.995  -65.345  1.00 40.00 ? 542 ALA A O   1 
ATOM 4165  C CB  . ALA A 1 538 ? 49.141  90.561  -64.472  1.00 40.00 ? 542 ALA A CB  1 
ATOM 4166  N N   . THR A 1 539 ? 47.374  91.339  -66.882  1.00 40.00 ? 543 THR A N   1 
ATOM 4167  C CA  . THR A 1 539 ? 47.150  92.184  -68.060  1.00 40.00 ? 543 THR A CA  1 
ATOM 4168  C C   . THR A 1 539 ? 45.725  92.411  -68.397  1.00 40.00 ? 543 THR A C   1 
ATOM 4169  O O   . THR A 1 539 ? 44.751  91.718  -68.660  1.00 40.00 ? 543 THR A O   1 
ATOM 4170  C CB  . THR A 1 539 ? 48.153  91.685  -69.129  1.00 40.00 ? 543 THR A CB  1 
ATOM 4171  O OG1 . THR A 1 539 ? 47.964  90.302  -69.420  1.00 40.00 ? 543 THR A OG1 1 
ATOM 4172  C CG2 . THR A 1 539 ? 49.586  91.772  -68.538  1.00 40.00 ? 543 THR A CG2 1 
ATOM 4173  N N   . ASP B 1 1   ? 9.990   38.039  -19.118  1.00 40.00 ? 5   ASP B N   1 
ATOM 4174  C CA  . ASP B 1 1   ? 10.669  38.625  -17.945  1.00 40.00 ? 5   ASP B CA  1 
ATOM 4175  C C   . ASP B 1 1   ? 10.194  40.059  -17.852  1.00 40.00 ? 5   ASP B C   1 
ATOM 4176  O O   . ASP B 1 1   ? 10.377  40.840  -18.799  1.00 40.00 ? 5   ASP B O   1 
ATOM 4177  C CB  . ASP B 1 1   ? 12.173  38.505  -18.140  1.00 40.00 ? 5   ASP B CB  1 
ATOM 4178  C CG  . ASP B 1 1   ? 12.955  39.051  -16.961  1.00 40.00 ? 5   ASP B CG  1 
ATOM 4179  O OD1 . ASP B 1 1   ? 14.204  39.047  -17.030  1.00 40.00 ? 5   ASP B OD1 1 
ATOM 4180  O OD2 . ASP B 1 1   ? 12.308  39.472  -15.976  1.00 40.00 ? 5   ASP B OD2 1 
ATOM 4181  N N   . PRO B 1 2   ? 9.568   40.463  -16.756  1.00 40.00 ? 6   PRO B N   1 
ATOM 4182  C CA  . PRO B 1 2   ? 9.042   41.818  -16.614  1.00 40.00 ? 6   PRO B CA  1 
ATOM 4183  C C   . PRO B 1 2   ? 10.166  42.827  -16.504  1.00 40.00 ? 6   PRO B C   1 
ATOM 4184  O O   . PRO B 1 2   ? 10.000  44.038  -16.650  1.00 40.00 ? 6   PRO B O   1 
ATOM 4185  C CB  . PRO B 1 2   ? 8.225   41.770  -15.332  1.00 40.00 ? 6   PRO B CB  1 
ATOM 4186  C CG  . PRO B 1 2   ? 8.881   40.698  -14.530  1.00 40.00 ? 6   PRO B CG  1 
ATOM 4187  C CD  . PRO B 1 2   ? 9.301   39.658  -15.549  1.00 40.00 ? 6   PRO B CD  1 
ATOM 4188  N N   . GLN B 1 3   ? 11.354  42.279  -16.206  1.00 40.00 ? 7   GLN B N   1 
ATOM 4189  C CA  . GLN B 1 3   ? 12.545  43.113  -16.103  1.00 40.00 ? 7   GLN B CA  1 
ATOM 4190  C C   . GLN B 1 3   ? 12.780  43.678  -17.503  1.00 40.00 ? 7   GLN B C   1 
ATOM 4191  O O   . GLN B 1 3   ? 12.922  44.878  -17.680  1.00 40.00 ? 7   GLN B O   1 
ATOM 4192  C CB  . GLN B 1 3   ? 13.729  42.310  -15.612  1.00 40.00 ? 7   GLN B CB  1 
ATOM 4193  C CG  . GLN B 1 3   ? 13.707  41.919  -14.144  1.00 40.00 ? 7   GLN B CG  1 
ATOM 4194  C CD  . GLN B 1 3   ? 13.560  43.079  -13.194  1.00 40.00 ? 7   GLN B CD  1 
ATOM 4195  O OE1 . GLN B 1 3   ? 14.353  44.021  -13.190  1.00 40.00 ? 7   GLN B OE1 1 
ATOM 4196  N NE2 . GLN B 1 3   ? 12.531  43.053  -12.350  1.00 40.00 ? 7   GLN B NE2 1 
ATOM 4197  N N   . LEU B 1 4   ? 12.746  42.812  -18.512  1.00 40.00 ? 8   LEU B N   1 
ATOM 4198  C CA  . LEU B 1 4   ? 12.960  43.249  -19.875  1.00 40.00 ? 8   LEU B CA  1 
ATOM 4199  C C   . LEU B 1 4   ? 11.696  43.730  -20.545  1.00 40.00 ? 8   LEU B C   1 
ATOM 4200  O O   . LEU B 1 4   ? 11.718  44.042  -21.752  1.00 40.00 ? 8   LEU B O   1 
ATOM 4201  C CB  . LEU B 1 4   ? 13.629  42.091  -20.628  1.00 40.00 ? 8   LEU B CB  1 
ATOM 4202  C CG  . LEU B 1 4   ? 14.742  41.339  -19.921  1.00 40.00 ? 8   LEU B CG  1 
ATOM 4203  C CD1 . LEU B 1 4   ? 15.661  40.664  -20.934  1.00 40.00 ? 8   LEU B CD1 1 
ATOM 4204  C CD2 . LEU B 1 4   ? 15.578  42.219  -19.002  1.00 40.00 ? 8   LEU B CD2 1 
ATOM 4205  N N   . LEU B 1 5   ? 10.577  43.865  -19.858  1.00 40.00 ? 9   LEU B N   1 
ATOM 4206  C CA  . LEU B 1 5   ? 9.360   44.306  -20.600  1.00 40.00 ? 9   LEU B CA  1 
ATOM 4207  C C   . LEU B 1 5   ? 8.883   45.617  -20.039  1.00 40.00 ? 9   LEU B C   1 
ATOM 4208  O O   . LEU B 1 5   ? 8.490   45.590  -18.856  1.00 40.00 ? 9   LEU B O   1 
ATOM 4209  C CB  . LEU B 1 5   ? 8.283   43.248  -20.396  1.00 40.00 ? 9   LEU B CB  1 
ATOM 4210  C CG  . LEU B 1 5   ? 7.424   42.700  -21.506  1.00 40.00 ? 9   LEU B CG  1 
ATOM 4211  C CD1 . LEU B 1 5   ? 6.743   43.807  -22.307  1.00 40.00 ? 9   LEU B CD1 1 
ATOM 4212  C CD2 . LEU B 1 5   ? 8.207   41.749  -22.405  1.00 40.00 ? 9   LEU B CD2 1 
ATOM 4213  N N   . VAL B 1 6   ? 8.925   46.737  -20.759  1.00 40.00 ? 10  VAL B N   1 
ATOM 4214  C CA  . VAL B 1 6   ? 8.488   47.959  -20.055  1.00 40.00 ? 10  VAL B CA  1 
ATOM 4215  C C   . VAL B 1 6   ? 7.473   48.755  -20.838  1.00 40.00 ? 10  VAL B C   1 
ATOM 4216  O O   . VAL B 1 6   ? 7.656   48.924  -22.061  1.00 40.00 ? 10  VAL B O   1 
ATOM 4217  C CB  . VAL B 1 6   ? 9.660   48.925  -19.739  1.00 40.00 ? 10  VAL B CB  1 
ATOM 4218  C CG1 . VAL B 1 6   ? 9.156   50.113  -18.925  1.00 40.00 ? 10  VAL B CG1 1 
ATOM 4219  C CG2 . VAL B 1 6   ? 10.851  48.287  -19.067  1.00 40.00 ? 10  VAL B CG2 1 
ATOM 4220  N N   . ARG B 1 7   ? 6.478   49.292  -20.136  1.00 40.00 ? 11  ARG B N   1 
ATOM 4221  C CA  . ARG B 1 7   ? 5.517   50.111  -20.898  1.00 40.00 ? 11  ARG B CA  1 
ATOM 4222  C C   . ARG B 1 7   ? 5.983   51.568  -20.751  1.00 40.00 ? 11  ARG B C   1 
ATOM 4223  O O   . ARG B 1 7   ? 6.254   52.037  -19.648  1.00 40.00 ? 11  ARG B O   1 
ATOM 4224  C CB  . ARG B 1 7   ? 4.074   49.917  -20.550  1.00 40.00 ? 11  ARG B CB  1 
ATOM 4225  C CG  . ARG B 1 7   ? 3.149   51.108  -20.722  1.00 40.00 ? 11  ARG B CG  1 
ATOM 4226  C CD  . ARG B 1 7   ? 2.751   51.276  -22.176  1.00 40.00 ? 11  ARG B CD  1 
ATOM 4227  N NE  . ARG B 1 7   ? 1.509   50.649  -22.559  1.00 40.00 ? 11  ARG B NE  1 
ATOM 4228  C CZ  . ARG B 1 7   ? 1.042   49.428  -22.401  1.00 40.00 ? 11  ARG B CZ  1 
ATOM 4229  N NH1 . ARG B 1 7   ? 1.694   48.444  -21.785  1.00 40.00 ? 11  ARG B NH1 1 
ATOM 4230  N NH2 . ARG B 1 7   ? -0.173  49.140  -22.880  1.00 40.00 ? 11  ARG B NH2 1 
ATOM 4231  N N   . VAL B 1 8   ? 6.092   52.193  -21.920  1.00 40.00 ? 12  VAL B N   1 
ATOM 4232  C CA  . VAL B 1 8   ? 6.519   53.606  -21.967  1.00 40.00 ? 12  VAL B CA  1 
ATOM 4233  C C   . VAL B 1 8   ? 5.321   54.442  -22.321  1.00 40.00 ? 12  VAL B C   1 
ATOM 4234  O O   . VAL B 1 8   ? 4.320   53.899  -22.809  1.00 40.00 ? 12  VAL B O   1 
ATOM 4235  C CB  . VAL B 1 8   ? 7.681   53.719  -22.951  1.00 40.00 ? 12  VAL B CB  1 
ATOM 4236  C CG1 . VAL B 1 8   ? 7.772   55.034  -23.685  1.00 40.00 ? 12  VAL B CG1 1 
ATOM 4237  C CG2 . VAL B 1 8   ? 8.947   53.449  -22.115  1.00 40.00 ? 12  VAL B CG2 1 
ATOM 4238  N N   . ARG B 1 9   ? 5.377   55.743  -22.151  1.00 40.00 ? 13  ARG B N   1 
ATOM 4239  C CA  . ARG B 1 9   ? 4.278   56.644  -22.427  1.00 40.00 ? 13  ARG B CA  1 
ATOM 4240  C C   . ARG B 1 9   ? 3.672   56.476  -23.794  1.00 40.00 ? 13  ARG B C   1 
ATOM 4241  O O   . ARG B 1 9   ? 2.559   56.994  -24.009  1.00 40.00 ? 13  ARG B O   1 
ATOM 4242  C CB  . ARG B 1 9   ? 4.708   58.100  -22.249  1.00 40.00 ? 13  ARG B CB  1 
ATOM 4243  C CG  . ARG B 1 9   ? 3.580   59.101  -22.059  1.00 40.00 ? 13  ARG B CG  1 
ATOM 4244  C CD  . ARG B 1 9   ? 4.068   60.323  -21.278  1.00 40.00 ? 13  ARG B CD  1 
ATOM 4245  N NE  . ARG B 1 9   ? 3.192   61.472  -21.316  1.00 40.00 ? 13  ARG B NE  1 
ATOM 4246  C CZ  . ARG B 1 9   ? 2.821   62.254  -22.317  1.00 40.00 ? 13  ARG B CZ  1 
ATOM 4247  N NH1 . ARG B 1 9   ? 3.236   62.076  -23.569  1.00 40.00 ? 13  ARG B NH1 1 
ATOM 4248  N NH2 . ARG B 1 9   ? 1.986   63.276  -22.068  1.00 40.00 ? 13  ARG B NH2 1 
ATOM 4249  N N   . GLY B 1 10  ? 4.345   55.813  -24.742  1.00 40.00 ? 14  GLY B N   1 
ATOM 4250  C CA  . GLY B 1 10  ? 3.832   55.589  -26.072  1.00 40.00 ? 14  GLY B CA  1 
ATOM 4251  C C   . GLY B 1 10  ? 3.786   54.138  -26.517  1.00 40.00 ? 14  GLY B C   1 
ATOM 4252  O O   . GLY B 1 10  ? 3.567   53.869  -27.734  1.00 40.00 ? 14  GLY B O   1 
ATOM 4253  N N   . GLY B 1 11  ? 3.994   53.194  -25.572  1.00 40.00 ? 15  GLY B N   1 
ATOM 4254  C CA  . GLY B 1 11  ? 3.945   51.792  -26.025  1.00 40.00 ? 15  GLY B CA  1 
ATOM 4255  C C   . GLY B 1 11  ? 4.849   50.880  -25.234  1.00 40.00 ? 15  GLY B C   1 
ATOM 4256  O O   . GLY B 1 11  ? 5.533   51.323  -24.308  1.00 40.00 ? 15  GLY B O   1 
ATOM 4257  N N   . GLN B 1 12  ? 4.849   49.610  -25.581  1.00 40.00 ? 16  GLN B N   1 
ATOM 4258  C CA  . GLN B 1 12  ? 5.634   48.610  -24.887  1.00 40.00 ? 16  GLN B CA  1 
ATOM 4259  C C   . GLN B 1 12  ? 6.992   48.379  -25.506  1.00 40.00 ? 16  GLN B C   1 
ATOM 4260  O O   . GLN B 1 12  ? 7.207   48.550  -26.714  1.00 40.00 ? 16  GLN B O   1 
ATOM 4261  C CB  . GLN B 1 12  ? 4.835   47.289  -24.887  1.00 40.00 ? 16  GLN B CB  1 
ATOM 4262  C CG  . GLN B 1 12  ? 3.708   47.260  -23.858  1.00 40.00 ? 16  GLN B CG  1 
ATOM 4263  C CD  . GLN B 1 12  ? 3.480   45.860  -23.306  1.00 40.00 ? 16  GLN B CD  1 
ATOM 4264  O OE1 . GLN B 1 12  ? 2.734   45.085  -23.925  1.00 40.00 ? 16  GLN B OE1 1 
ATOM 4265  N NE2 . GLN B 1 12  ? 4.101   45.529  -22.185  1.00 40.00 ? 16  GLN B NE2 1 
ATOM 4266  N N   . LEU B 1 13  ? 7.938   47.966  -24.678  1.00 40.00 ? 17  LEU B N   1 
ATOM 4267  C CA  . LEU B 1 13  ? 9.281   47.744  -25.180  1.00 40.00 ? 17  LEU B CA  1 
ATOM 4268  C C   . LEU B 1 13  ? 9.883   46.468  -24.636  1.00 40.00 ? 17  LEU B C   1 
ATOM 4269  O O   . LEU B 1 13  ? 9.630   46.134  -23.461  1.00 40.00 ? 17  LEU B O   1 
ATOM 4270  C CB  . LEU B 1 13  ? 10.210  48.895  -24.635  1.00 40.00 ? 17  LEU B CB  1 
ATOM 4271  C CG  . LEU B 1 13  ? 9.819   50.329  -25.001  1.00 40.00 ? 17  LEU B CG  1 
ATOM 4272  C CD1 . LEU B 1 13  ? 10.506  51.338  -24.103  1.00 40.00 ? 17  LEU B CD1 1 
ATOM 4273  C CD2 . LEU B 1 13  ? 10.111  50.620  -26.480  1.00 40.00 ? 17  LEU B CD2 1 
ATOM 4274  N N   . ARG B 1 14  ? 10.759  45.849  -25.409  1.00 40.00 ? 18  ARG B N   1 
ATOM 4275  C CA  . ARG B 1 14  ? 11.422  44.678  -24.827  1.00 40.00 ? 18  ARG B CA  1 
ATOM 4276  C C   . ARG B 1 14  ? 12.928  44.929  -24.830  1.00 40.00 ? 18  ARG B C   1 
ATOM 4277  O O   . ARG B 1 14  ? 13.516  45.051  -25.910  1.00 40.00 ? 18  ARG B O   1 
ATOM 4278  C CB  . ARG B 1 14  ? 11.079  43.398  -25.511  1.00 40.00 ? 18  ARG B CB  1 
ATOM 4279  C CG  . ARG B 1 14  ? 12.214  42.444  -25.823  1.00 40.00 ? 18  ARG B CG  1 
ATOM 4280  C CD  . ARG B 1 14  ? 11.763  41.008  -25.799  1.00 40.00 ? 18  ARG B CD  1 
ATOM 4281  N NE  . ARG B 1 14  ? 10.772  40.657  -26.800  1.00 40.00 ? 18  ARG B NE  1 
ATOM 4282  C CZ  . ARG B 1 14  ? 9.464   40.873  -26.760  1.00 40.00 ? 18  ARG B CZ  1 
ATOM 4283  N NH1 . ARG B 1 14  ? 8.685   40.477  -27.767  1.00 40.00 ? 18  ARG B NH1 1 
ATOM 4284  N NH2 . ARG B 1 14  ? 8.896   41.490  -25.730  1.00 40.00 ? 18  ARG B NH2 1 
ATOM 4285  N N   . GLY B 1 15  ? 13.483  44.973  -23.623  1.00 40.00 ? 19  GLY B N   1 
ATOM 4286  C CA  . GLY B 1 15  ? 14.927  45.176  -23.495  1.00 40.00 ? 19  GLY B CA  1 
ATOM 4287  C C   . GLY B 1 15  ? 15.652  43.850  -23.739  1.00 40.00 ? 19  GLY B C   1 
ATOM 4288  O O   . GLY B 1 15  ? 15.069  42.900  -24.264  1.00 40.00 ? 19  GLY B O   1 
ATOM 4289  N N   . ILE B 1 16  ? 16.919  43.807  -23.376  1.00 40.00 ? 20  ILE B N   1 
ATOM 4290  C CA  . ILE B 1 16  ? 17.755  42.619  -23.494  1.00 40.00 ? 20  ILE B CA  1 
ATOM 4291  C C   . ILE B 1 16  ? 18.630  42.637  -22.231  1.00 40.00 ? 20  ILE B C   1 
ATOM 4292  O O   . ILE B 1 16  ? 18.906  43.714  -21.710  1.00 40.00 ? 20  ILE B O   1 
ATOM 4293  C CB  . ILE B 1 16  ? 18.588  42.505  -24.757  1.00 40.00 ? 20  ILE B CB  1 
ATOM 4294  C CG1 . ILE B 1 16  ? 19.840  41.616  -24.567  1.00 40.00 ? 20  ILE B CG1 1 
ATOM 4295  C CG2 . ILE B 1 16  ? 19.052  43.874  -25.229  1.00 40.00 ? 20  ILE B CG2 1 
ATOM 4296  C CD1 . ILE B 1 16  ? 20.326  40.976  -25.858  1.00 40.00 ? 20  ILE B CD1 1 
ATOM 4297  N N   . ARG B 1 17  ? 19.003  41.467  -21.756  1.00 40.00 ? 21  ARG B N   1 
ATOM 4298  C CA  . ARG B 1 17  ? 19.804  41.326  -20.549  1.00 40.00 ? 21  ARG B CA  1 
ATOM 4299  C C   . ARG B 1 17  ? 21.280  41.119  -20.870  1.00 40.00 ? 21  ARG B C   1 
ATOM 4300  O O   . ARG B 1 17  ? 21.731  40.087  -21.360  1.00 40.00 ? 21  ARG B O   1 
ATOM 4301  C CB  . ARG B 1 17  ? 19.230  40.206  -19.696  1.00 40.00 ? 21  ARG B CB  1 
ATOM 4302  C CG  . ARG B 1 17  ? 19.626  40.265  -18.231  1.00 40.00 ? 21  ARG B CG  1 
ATOM 4303  C CD  . ARG B 1 17  ? 19.468  38.893  -17.600  1.00 40.00 ? 21  ARG B CD  1 
ATOM 4304  N NE  . ARG B 1 17  ? 20.642  38.058  -17.927  1.00 40.00 ? 21  ARG B NE  1 
ATOM 4305  C CZ  . ARG B 1 17  ? 20.986  37.092  -17.067  1.00 40.00 ? 21  ARG B CZ  1 
ATOM 4306  N NH1 . ARG B 1 17  ? 20.259  36.928  -15.955  1.00 40.00 ? 21  ARG B NH1 1 
ATOM 4307  N NH2 . ARG B 1 17  ? 22.035  36.329  -17.322  1.00 40.00 ? 21  ARG B NH2 1 
ATOM 4308  N N   . LEU B 1 18  ? 22.030  42.185  -20.580  1.00 40.00 ? 22  LEU B N   1 
ATOM 4309  C CA  . LEU B 1 18  ? 23.449  42.234  -20.832  1.00 40.00 ? 22  LEU B CA  1 
ATOM 4310  C C   . LEU B 1 18  ? 24.259  41.749  -19.639  1.00 40.00 ? 22  LEU B C   1 
ATOM 4311  O O   . LEU B 1 18  ? 23.862  41.921  -18.486  1.00 40.00 ? 22  LEU B O   1 
ATOM 4312  C CB  . LEU B 1 18  ? 23.843  43.684  -21.137  1.00 40.00 ? 22  LEU B CB  1 
ATOM 4313  C CG  . LEU B 1 18  ? 23.778  44.216  -22.552  1.00 40.00 ? 22  LEU B CG  1 
ATOM 4314  C CD1 . LEU B 1 18  ? 22.453  43.893  -23.235  1.00 40.00 ? 22  LEU B CD1 1 
ATOM 4315  C CD2 . LEU B 1 18  ? 24.003  45.724  -22.560  1.00 40.00 ? 22  LEU B CD2 1 
ATOM 4316  N N   . LYS B 1 19  ? 25.437  41.195  -19.956  1.00 40.00 ? 23  LYS B N   1 
ATOM 4317  C CA  . LYS B 1 19  ? 26.260  40.737  -18.851  1.00 40.00 ? 23  LYS B CA  1 
ATOM 4318  C C   . LYS B 1 19  ? 27.541  41.512  -18.644  1.00 40.00 ? 23  LYS B C   1 
ATOM 4319  O O   . LYS B 1 19  ? 28.546  41.384  -19.336  1.00 40.00 ? 23  LYS B O   1 
ATOM 4320  C CB  . LYS B 1 19  ? 26.464  39.228  -18.936  1.00 40.00 ? 23  LYS B CB  1 
ATOM 4321  C CG  . LYS B 1 19  ? 25.380  38.478  -18.146  1.00 40.00 ? 23  LYS B CG  1 
ATOM 4322  C CD  . LYS B 1 19  ? 25.334  37.010  -18.540  1.00 40.00 ? 23  LYS B CD  1 
ATOM 4323  C CE  . LYS B 1 19  ? 24.395  36.758  -19.708  1.00 40.00 ? 23  LYS B CE  1 
ATOM 4324  N NZ  . LYS B 1 19  ? 23.083  37.443  -19.543  1.00 40.00 ? 23  LYS B NZ  1 
ATOM 4325  N N   . ALA B 1 20  ? 27.518  42.346  -17.591  1.00 40.00 ? 24  ALA B N   1 
ATOM 4326  C CA  . ALA B 1 20  ? 28.714  43.096  -17.202  1.00 40.00 ? 24  ALA B CA  1 
ATOM 4327  C C   . ALA B 1 20  ? 29.523  42.210  -16.252  1.00 40.00 ? 24  ALA B C   1 
ATOM 4328  O O   . ALA B 1 20  ? 28.929  41.358  -15.574  1.00 40.00 ? 24  ALA B O   1 
ATOM 4329  C CB  . ALA B 1 20  ? 28.276  44.345  -16.429  1.00 40.00 ? 24  ALA B CB  1 
ATOM 4330  N N   . PRO B 1 21  ? 30.826  42.419  -16.139  1.00 40.00 ? 25  PRO B N   1 
ATOM 4331  C CA  . PRO B 1 21  ? 31.678  41.669  -15.235  1.00 40.00 ? 25  PRO B CA  1 
ATOM 4332  C C   . PRO B 1 21  ? 31.109  41.511  -13.839  1.00 40.00 ? 25  PRO B C   1 
ATOM 4333  O O   . PRO B 1 21  ? 31.174  40.397  -13.286  1.00 40.00 ? 25  PRO B O   1 
ATOM 4334  C CB  . PRO B 1 21  ? 32.980  42.463  -15.230  1.00 40.00 ? 25  PRO B CB  1 
ATOM 4335  C CG  . PRO B 1 21  ? 33.034  43.122  -16.564  1.00 40.00 ? 25  PRO B CG  1 
ATOM 4336  C CD  . PRO B 1 21  ? 31.601  43.406  -16.934  1.00 40.00 ? 25  PRO B CD  1 
ATOM 4337  N N   . GLY B 1 22  ? 30.529  42.551  -13.227  1.00 40.00 ? 26  GLY B N   1 
ATOM 4338  C CA  . GLY B 1 22  ? 29.970  42.407  -11.890  1.00 40.00 ? 26  GLY B CA  1 
ATOM 4339  C C   . GLY B 1 22  ? 28.534  41.935  -11.852  1.00 40.00 ? 26  GLY B C   1 
ATOM 4340  O O   . GLY B 1 22  ? 27.892  42.000  -10.793  1.00 40.00 ? 26  GLY B O   1 
ATOM 4341  N N   . GLY B 1 23  ? 27.957  41.532  -12.978  1.00 40.00 ? 27  GLY B N   1 
ATOM 4342  C CA  . GLY B 1 23  ? 26.589  41.094  -13.003  1.00 40.00 ? 27  GLY B CA  1 
ATOM 4343  C C   . GLY B 1 23  ? 25.777  41.496  -14.211  1.00 40.00 ? 27  GLY B C   1 
ATOM 4344  O O   . GLY B 1 23  ? 26.228  42.006  -15.239  1.00 40.00 ? 27  GLY B O   1 
ATOM 4345  N N   . PRO B 1 24  ? 24.475  41.233  -14.095  1.00 40.00 ? 28  PRO B N   1 
ATOM 4346  C CA  . PRO B 1 24  ? 23.522  41.495  -15.145  1.00 40.00 ? 28  PRO B CA  1 
ATOM 4347  C C   . PRO B 1 24  ? 23.029  42.926  -15.164  1.00 40.00 ? 28  PRO B C   1 
ATOM 4348  O O   . PRO B 1 24  ? 22.952  43.626  -14.156  1.00 40.00 ? 28  PRO B O   1 
ATOM 4349  C CB  . PRO B 1 24  ? 22.388  40.518  -14.815  1.00 40.00 ? 28  PRO B CB  1 
ATOM 4350  C CG  . PRO B 1 24  ? 22.380  40.501  -13.320  1.00 40.00 ? 28  PRO B CG  1 
ATOM 4351  C CD  . PRO B 1 24  ? 23.823  40.643  -12.897  1.00 40.00 ? 28  PRO B CD  1 
ATOM 4352  N N   . VAL B 1 25  ? 22.676  43.331  -16.402  1.00 40.00 ? 29  VAL B N   1 
ATOM 4353  C CA  . VAL B 1 25  ? 22.155  44.639  -16.667  1.00 40.00 ? 29  VAL B CA  1 
ATOM 4354  C C   . VAL B 1 25  ? 20.971  44.596  -17.642  1.00 40.00 ? 29  VAL B C   1 
ATOM 4355  O O   . VAL B 1 25  ? 21.054  43.883  -18.636  1.00 40.00 ? 29  VAL B O   1 
ATOM 4356  C CB  . VAL B 1 25  ? 23.140  45.593  -17.376  1.00 40.00 ? 29  VAL B CB  1 
ATOM 4357  C CG1 . VAL B 1 25  ? 22.819  47.005  -16.887  1.00 40.00 ? 29  VAL B CG1 1 
ATOM 4358  C CG2 . VAL B 1 25  ? 24.592  45.231  -17.214  1.00 40.00 ? 29  VAL B CG2 1 
ATOM 4359  N N   . SER B 1 26  ? 19.979  45.415  -17.351  1.00 40.00 ? 30  SER B N   1 
ATOM 4360  C CA  . SER B 1 26  ? 18.840  45.526  -18.291  1.00 40.00 ? 30  SER B CA  1 
ATOM 4361  C C   . SER B 1 26  ? 19.278  46.590  -19.321  1.00 40.00 ? 30  SER B C   1 
ATOM 4362  O O   . SER B 1 26  ? 19.945  47.558  -18.904  1.00 40.00 ? 30  SER B O   1 
ATOM 4363  C CB  . SER B 1 26  ? 17.606  45.972  -17.523  1.00 40.00 ? 30  SER B CB  1 
ATOM 4364  O OG  . SER B 1 26  ? 16.835  44.897  -16.995  1.00 40.00 ? 30  SER B OG  1 
ATOM 4365  N N   . ALA B 1 27  ? 18.976  46.444  -20.591  1.00 40.00 ? 31  ALA B N   1 
ATOM 4366  C CA  . ALA B 1 27  ? 19.407  47.383  -21.619  1.00 40.00 ? 31  ALA B CA  1 
ATOM 4367  C C   . ALA B 1 27  ? 18.315  47.574  -22.657  1.00 40.00 ? 31  ALA B C   1 
ATOM 4368  O O   . ALA B 1 27  ? 17.903  46.591  -23.275  1.00 40.00 ? 31  ALA B O   1 
ATOM 4369  C CB  . ALA B 1 27  ? 20.632  46.800  -22.317  1.00 40.00 ? 31  ALA B CB  1 
ATOM 4370  N N   . PHE B 1 28  ? 17.827  48.806  -22.801  1.00 40.00 ? 32  PHE B N   1 
ATOM 4371  C CA  . PHE B 1 28  ? 16.729  49.071  -23.750  1.00 40.00 ? 32  PHE B CA  1 
ATOM 4372  C C   . PHE B 1 28  ? 17.193  49.968  -24.891  1.00 40.00 ? 32  PHE B C   1 
ATOM 4373  O O   . PHE B 1 28  ? 16.954  51.169  -24.897  1.00 40.00 ? 32  PHE B O   1 
ATOM 4374  C CB  . PHE B 1 28  ? 15.561  49.753  -23.014  1.00 40.00 ? 32  PHE B CB  1 
ATOM 4375  C CG  . PHE B 1 28  ? 14.960  48.848  -21.980  1.00 40.00 ? 32  PHE B CG  1 
ATOM 4376  C CD1 . PHE B 1 28  ? 15.620  48.526  -20.813  1.00 40.00 ? 32  PHE B CD1 1 
ATOM 4377  C CD2 . PHE B 1 28  ? 13.705  48.299  -22.193  1.00 40.00 ? 32  PHE B CD2 1 
ATOM 4378  C CE1 . PHE B 1 28  ? 15.055  47.679  -19.873  1.00 40.00 ? 32  PHE B CE1 1 
ATOM 4379  C CE2 . PHE B 1 28  ? 13.129  47.457  -21.254  1.00 40.00 ? 32  PHE B CE2 1 
ATOM 4380  C CZ  . PHE B 1 28  ? 13.803  47.146  -20.086  1.00 40.00 ? 32  PHE B CZ  1 
ATOM 4381  N N   . LEU B 1 29  ? 17.861  49.369  -25.834  1.00 40.00 ? 33  LEU B N   1 
ATOM 4382  C CA  . LEU B 1 29  ? 18.466  49.966  -27.001  1.00 40.00 ? 33  LEU B CA  1 
ATOM 4383  C C   . LEU B 1 29  ? 17.579  50.273  -28.173  1.00 40.00 ? 33  LEU B C   1 
ATOM 4384  O O   . LEU B 1 29  ? 16.833  49.408  -28.691  1.00 40.00 ? 33  LEU B O   1 
ATOM 4385  C CB  . LEU B 1 29  ? 19.534  48.872  -27.377  1.00 40.00 ? 33  LEU B CB  1 
ATOM 4386  C CG  . LEU B 1 29  ? 20.807  48.955  -26.551  1.00 40.00 ? 33  LEU B CG  1 
ATOM 4387  C CD1 . LEU B 1 29  ? 20.580  49.301  -25.090  1.00 40.00 ? 33  LEU B CD1 1 
ATOM 4388  C CD2 . LEU B 1 29  ? 21.692  47.720  -26.647  1.00 40.00 ? 33  LEU B CD2 1 
ATOM 4389  N N   . GLY B 1 30  ? 17.583  51.478  -28.754  1.00 40.00 ? 34  GLY B N   1 
ATOM 4390  C CA  . GLY B 1 30  ? 16.757  51.711  -29.941  1.00 40.00 ? 34  GLY B CA  1 
ATOM 4391  C C   . GLY B 1 30  ? 15.414  52.337  -29.657  1.00 40.00 ? 34  GLY B C   1 
ATOM 4392  O O   . GLY B 1 30  ? 14.516  52.270  -30.511  1.00 40.00 ? 34  GLY B O   1 
ATOM 4393  N N   . ILE B 1 31  ? 15.224  52.986  -28.512  1.00 40.00 ? 35  ILE B N   1 
ATOM 4394  C CA  . ILE B 1 31  ? 13.885  53.565  -28.337  1.00 40.00 ? 35  ILE B CA  1 
ATOM 4395  C C   . ILE B 1 31  ? 13.593  54.804  -29.158  1.00 40.00 ? 35  ILE B C   1 
ATOM 4396  O O   . ILE B 1 31  ? 14.112  55.903  -28.952  1.00 40.00 ? 35  ILE B O   1 
ATOM 4397  C CB  . ILE B 1 31  ? 13.591  53.898  -26.855  1.00 40.00 ? 35  ILE B CB  1 
ATOM 4398  C CG1 . ILE B 1 31  ? 13.941  52.742  -25.938  1.00 40.00 ? 35  ILE B CG1 1 
ATOM 4399  C CG2 . ILE B 1 31  ? 12.102  54.294  -26.805  1.00 40.00 ? 35  ILE B CG2 1 
ATOM 4400  C CD1 . ILE B 1 31  ? 14.319  53.069  -24.509  1.00 40.00 ? 35  ILE B CD1 1 
ATOM 4401  N N   . PRO B 1 32  ? 12.668  54.703  -30.095  1.00 40.00 ? 36  PRO B N   1 
ATOM 4402  C CA  . PRO B 1 32  ? 12.301  55.881  -30.887  1.00 40.00 ? 36  PRO B CA  1 
ATOM 4403  C C   . PRO B 1 32  ? 11.954  57.000  -29.912  1.00 40.00 ? 36  PRO B C   1 
ATOM 4404  O O   . PRO B 1 32  ? 11.188  56.663  -28.984  1.00 40.00 ? 36  PRO B O   1 
ATOM 4405  C CB  . PRO B 1 32  ? 11.048  55.468  -31.642  1.00 40.00 ? 36  PRO B CB  1 
ATOM 4406  C CG  . PRO B 1 32  ? 10.689  54.118  -31.185  1.00 40.00 ? 36  PRO B CG  1 
ATOM 4407  C CD  . PRO B 1 32  ? 11.896  53.514  -30.496  1.00 40.00 ? 36  PRO B CD  1 
ATOM 4408  N N   . PHE B 1 33  ? 12.497  58.189  -30.104  1.00 40.00 ? 37  PHE B N   1 
ATOM 4409  C CA  . PHE B 1 33  ? 12.078  59.254  -29.170  1.00 40.00 ? 37  PHE B CA  1 
ATOM 4410  C C   . PHE B 1 33  ? 11.344  60.289  -30.014  1.00 40.00 ? 37  PHE B C   1 
ATOM 4411  O O   . PHE B 1 33  ? 10.589  61.100  -29.513  1.00 40.00 ? 37  PHE B O   1 
ATOM 4412  C CB  . PHE B 1 33  ? 13.126  59.836  -28.336  1.00 40.00 ? 37  PHE B CB  1 
ATOM 4413  C CG  . PHE B 1 33  ? 14.265  60.570  -28.931  1.00 40.00 ? 37  PHE B CG  1 
ATOM 4414  C CD1 . PHE B 1 33  ? 14.189  61.936  -29.157  1.00 40.00 ? 37  PHE B CD1 1 
ATOM 4415  C CD2 . PHE B 1 33  ? 15.445  59.878  -29.216  1.00 40.00 ? 37  PHE B CD2 1 
ATOM 4416  C CE1 . PHE B 1 33  ? 15.283  62.619  -29.666  1.00 40.00 ? 37  PHE B CE1 1 
ATOM 4417  C CE2 . PHE B 1 33  ? 16.530  60.543  -29.744  1.00 40.00 ? 37  PHE B CE2 1 
ATOM 4418  C CZ  . PHE B 1 33  ? 16.432  61.908  -29.962  1.00 40.00 ? 37  PHE B CZ  1 
ATOM 4419  N N   . ALA B 1 34  ? 11.539  60.134  -31.332  1.00 40.00 ? 38  ALA B N   1 
ATOM 4420  C CA  . ALA B 1 34  ? 10.883  61.056  -32.250  1.00 40.00 ? 38  ALA B CA  1 
ATOM 4421  C C   . ALA B 1 34  ? 10.575  60.431  -33.609  1.00 40.00 ? 38  ALA B C   1 
ATOM 4422  O O   . ALA B 1 34  ? 11.184  59.422  -33.995  1.00 40.00 ? 38  ALA B O   1 
ATOM 4423  C CB  . ALA B 1 34  ? 11.852  62.219  -32.553  1.00 40.00 ? 38  ALA B CB  1 
ATOM 4424  N N   . GLU B 1 35  ? 9.668   61.126  -34.298  1.00 40.00 ? 39  GLU B N   1 
ATOM 4425  C CA  . GLU B 1 35  ? 9.329   60.733  -35.668  1.00 40.00 ? 39  GLU B CA  1 
ATOM 4426  C C   . GLU B 1 35  ? 10.562  61.022  -36.538  1.00 40.00 ? 39  GLU B C   1 
ATOM 4427  O O   . GLU B 1 35  ? 11.126  62.135  -36.510  1.00 40.00 ? 39  GLU B O   1 
ATOM 4428  C CB  . GLU B 1 35  ? 8.157   61.530  -36.229  1.00 40.00 ? 39  GLU B CB  1 
ATOM 4429  C CG  . GLU B 1 35  ? 6.769   61.140  -35.717  1.00 40.00 ? 39  GLU B CG  1 
ATOM 4430  C CD  . GLU B 1 35  ? 6.342   59.745  -36.134  1.00 40.00 ? 39  GLU B CD  1 
ATOM 4431  O OE1 . GLU B 1 35  ? 5.546   59.663  -37.086  1.00 40.00 ? 39  GLU B OE1 1 
ATOM 4432  O OE2 . GLU B 1 35  ? 6.776   58.724  -35.553  1.00 40.00 ? 39  GLU B OE2 1 
ATOM 4433  N N   . PRO B 1 36  ? 11.015  60.018  -37.287  1.00 40.00 ? 40  PRO B N   1 
ATOM 4434  C CA  . PRO B 1 36  ? 12.154  60.134  -38.187  1.00 40.00 ? 40  PRO B CA  1 
ATOM 4435  C C   . PRO B 1 36  ? 12.030  61.468  -38.918  1.00 40.00 ? 40  PRO B C   1 
ATOM 4436  O O   . PRO B 1 36  ? 10.976  61.798  -39.483  1.00 40.00 ? 40  PRO B O   1 
ATOM 4437  C CB  . PRO B 1 36  ? 12.009  58.945  -39.132  1.00 40.00 ? 40  PRO B CB  1 
ATOM 4438  C CG  . PRO B 1 36  ? 11.343  57.922  -38.313  1.00 40.00 ? 40  PRO B CG  1 
ATOM 4439  C CD  . PRO B 1 36  ? 10.393  58.689  -37.424  1.00 40.00 ? 40  PRO B CD  1 
ATOM 4440  N N   . PRO B 1 37  ? 13.104  62.240  -38.900  1.00 40.00 ? 41  PRO B N   1 
ATOM 4441  C CA  . PRO B 1 37  ? 13.149  63.576  -39.481  1.00 40.00 ? 41  PRO B CA  1 
ATOM 4442  C C   . PRO B 1 37  ? 13.564  63.554  -40.939  1.00 40.00 ? 41  PRO B C   1 
ATOM 4443  O O   . PRO B 1 37  ? 14.364  64.366  -41.450  1.00 40.00 ? 41  PRO B O   1 
ATOM 4444  C CB  . PRO B 1 37  ? 14.210  64.221  -38.601  1.00 40.00 ? 41  PRO B CB  1 
ATOM 4445  C CG  . PRO B 1 37  ? 15.215  63.112  -38.444  1.00 40.00 ? 41  PRO B CG  1 
ATOM 4446  C CD  . PRO B 1 37  ? 14.413  61.863  -38.307  1.00 40.00 ? 41  PRO B CD  1 
ATOM 4447  N N   . VAL B 1 38  ? 12.941  62.606  -41.656  1.00 40.00 ? 42  VAL B N   1 
ATOM 4448  C CA  . VAL B 1 38  ? 13.243  62.420  -43.053  1.00 40.00 ? 42  VAL B CA  1 
ATOM 4449  C C   . VAL B 1 38  ? 12.286  63.126  -43.984  1.00 40.00 ? 42  VAL B C   1 
ATOM 4450  O O   . VAL B 1 38  ? 11.252  63.698  -43.619  1.00 40.00 ? 42  VAL B O   1 
ATOM 4451  C CB  . VAL B 1 38  ? 13.237  60.907  -43.364  1.00 40.00 ? 42  VAL B CB  1 
ATOM 4452  C CG1 . VAL B 1 38  ? 14.215  60.232  -42.424  1.00 40.00 ? 42  VAL B CG1 1 
ATOM 4453  C CG2 . VAL B 1 38  ? 11.815  60.375  -43.239  1.00 40.00 ? 42  VAL B CG2 1 
ATOM 4454  N N   . GLY B 1 39  ? 12.703  63.048  -45.272  1.00 40.00 ? 43  GLY B N   1 
ATOM 4455  C CA  . GLY B 1 39  ? 11.877  63.619  -46.297  1.00 40.00 ? 43  GLY B CA  1 
ATOM 4456  C C   . GLY B 1 39  ? 11.609  65.088  -46.128  1.00 40.00 ? 43  GLY B C   1 
ATOM 4457  O O   . GLY B 1 39  ? 12.567  65.863  -46.170  1.00 40.00 ? 43  GLY B O   1 
ATOM 4458  N N   . SER B 1 40  ? 10.380  65.514  -45.901  1.00 40.00 ? 44  SER B N   1 
ATOM 4459  C CA  . SER B 1 40  ? 10.047  66.923  -45.811  1.00 40.00 ? 44  SER B CA  1 
ATOM 4460  C C   . SER B 1 40  ? 10.290  67.443  -44.404  1.00 40.00 ? 44  SER B C   1 
ATOM 4461  O O   . SER B 1 40  ? 9.936   68.588  -44.086  1.00 40.00 ? 44  SER B O   1 
ATOM 4462  C CB  . SER B 1 40  ? 8.565   67.149  -46.147  1.00 40.00 ? 44  SER B CB  1 
ATOM 4463  O OG  . SER B 1 40  ? 7.764   66.414  -45.222  1.00 40.00 ? 44  SER B OG  1 
ATOM 4464  N N   . ARG B 1 41  ? 10.844  66.524  -43.629  1.00 40.00 ? 45  ARG B N   1 
ATOM 4465  C CA  . ARG B 1 41  ? 11.168  66.800  -42.254  1.00 40.00 ? 45  ARG B CA  1 
ATOM 4466  C C   . ARG B 1 41  ? 12.622  67.198  -42.121  1.00 40.00 ? 45  ARG B C   1 
ATOM 4467  O O   . ARG B 1 41  ? 13.006  67.719  -41.072  1.00 40.00 ? 45  ARG B O   1 
ATOM 4468  C CB  . ARG B 1 41  ? 10.847  65.573  -41.378  1.00 40.00 ? 45  ARG B CB  1 
ATOM 4469  C CG  . ARG B 1 41  ? 9.487   65.590  -40.722  1.00 40.00 ? 45  ARG B CG  1 
ATOM 4470  C CD  . ARG B 1 41  ? 8.621   66.763  -41.185  1.00 40.00 ? 45  ARG B CD  1 
ATOM 4471  N NE  . ARG B 1 41  ? 8.739   67.939  -40.327  1.00 40.00 ? 45  ARG B NE  1 
ATOM 4472  C CZ  . ARG B 1 41  ? 8.508   67.913  -39.013  1.00 40.00 ? 45  ARG B CZ  1 
ATOM 4473  N NH1 . ARG B 1 41  ? 8.154   66.784  -38.400  1.00 40.00 ? 45  ARG B NH1 1 
ATOM 4474  N NH2 . ARG B 1 41  ? 8.617   69.006  -38.279  1.00 40.00 ? 45  ARG B NH2 1 
ATOM 4475  N N   . ARG B 1 42  ? 13.421  66.931  -43.144  1.00 40.00 ? 46  ARG B N   1 
ATOM 4476  C CA  . ARG B 1 42  ? 14.841  67.303  -43.023  1.00 40.00 ? 46  ARG B CA  1 
ATOM 4477  C C   . ARG B 1 42  ? 15.016  68.775  -42.662  1.00 40.00 ? 46  ARG B C   1 
ATOM 4478  O O   . ARG B 1 42  ? 14.312  69.625  -43.253  1.00 40.00 ? 46  ARG B O   1 
ATOM 4479  C CB  . ARG B 1 42  ? 15.517  67.052  -44.364  1.00 40.00 ? 46  ARG B CB  1 
ATOM 4480  C CG  . ARG B 1 42  ? 17.038  67.153  -44.246  1.00 40.00 ? 46  ARG B CG  1 
ATOM 4481  C CD  . ARG B 1 42  ? 17.602  66.960  -45.607  1.00 40.00 ? 46  ARG B CD  1 
ATOM 4482  N NE  . ARG B 1 42  ? 18.133  65.653  -45.936  1.00 40.00 ? 46  ARG B NE  1 
ATOM 4483  C CZ  . ARG B 1 42  ? 18.450  65.405  -47.232  1.00 40.00 ? 46  ARG B CZ  1 
ATOM 4484  N NH1 . ARG B 1 42  ? 18.239  66.378  -48.142  1.00 40.00 ? 46  ARG B NH1 1 
ATOM 4485  N NH2 . ARG B 1 42  ? 18.985  64.237  -47.581  1.00 40.00 ? 46  ARG B NH2 1 
ATOM 4486  N N   . PHE B 1 43  ? 15.948  69.084  -41.752  1.00 40.00 ? 47  PHE B N   1 
ATOM 4487  C CA  . PHE B 1 43  ? 16.216  70.438  -41.324  1.00 40.00 ? 47  PHE B CA  1 
ATOM 4488  C C   . PHE B 1 43  ? 15.167  70.966  -40.349  1.00 40.00 ? 47  PHE B C   1 
ATOM 4489  O O   . PHE B 1 43  ? 15.249  72.122  -39.896  1.00 40.00 ? 47  PHE B O   1 
ATOM 4490  C CB  . PHE B 1 43  ? 16.370  71.511  -42.434  1.00 40.00 ? 47  PHE B CB  1 
ATOM 4491  C CG  . PHE B 1 43  ? 17.280  71.043  -43.550  1.00 40.00 ? 47  PHE B CG  1 
ATOM 4492  C CD1 . PHE B 1 43  ? 18.503  70.468  -43.237  1.00 40.00 ? 47  PHE B CD1 1 
ATOM 4493  C CD2 . PHE B 1 43  ? 16.892  71.107  -44.869  1.00 40.00 ? 47  PHE B CD2 1 
ATOM 4494  C CE1 . PHE B 1 43  ? 19.327  69.987  -44.211  1.00 40.00 ? 47  PHE B CE1 1 
ATOM 4495  C CE2 . PHE B 1 43  ? 17.730  70.648  -45.841  1.00 40.00 ? 47  PHE B CE2 1 
ATOM 4496  C CZ  . PHE B 1 43  ? 18.942  70.082  -45.522  1.00 40.00 ? 47  PHE B CZ  1 
ATOM 4497  N N   . MET B 1 44  ? 14.181  70.160  -39.999  1.00 40.00 ? 48  MET B N   1 
ATOM 4498  C CA  . MET B 1 44  ? 13.104  70.554  -39.125  1.00 40.00 ? 48  MET B CA  1 
ATOM 4499  C C   . MET B 1 44  ? 13.306  70.139  -37.677  1.00 40.00 ? 48  MET B C   1 
ATOM 4500  O O   . MET B 1 44  ? 13.916  69.144  -37.293  1.00 40.00 ? 48  MET B O   1 
ATOM 4501  C CB  . MET B 1 44  ? 11.791  69.937  -39.593  1.00 40.00 ? 48  MET B CB  1 
ATOM 4502  C CG  . MET B 1 44  ? 11.130  70.545  -40.817  1.00 40.00 ? 48  MET B CG  1 
ATOM 4503  S SD  . MET B 1 44  ? 10.888  72.307  -40.608  1.00 40.00 ? 48  MET B SD  1 
ATOM 4504  C CE  . MET B 1 44  ? 9.142   72.550  -40.795  1.00 40.00 ? 48  MET B CE  1 
ATOM 4505  N N   . PRO B 1 45  ? 12.728  70.967  -36.807  1.00 40.00 ? 49  PRO B N   1 
ATOM 4506  C CA  . PRO B 1 45  ? 12.777  70.676  -35.353  1.00 40.00 ? 49  PRO B CA  1 
ATOM 4507  C C   . PRO B 1 45  ? 12.194  69.282  -35.212  1.00 40.00 ? 49  PRO B C   1 
ATOM 4508  O O   . PRO B 1 45  ? 11.330  68.945  -36.037  1.00 40.00 ? 49  PRO B O   1 
ATOM 4509  C CB  . PRO B 1 45  ? 11.968  71.777  -34.758  1.00 40.00 ? 49  PRO B CB  1 
ATOM 4510  C CG  . PRO B 1 45  ? 11.346  72.569  -35.838  1.00 40.00 ? 49  PRO B CG  1 
ATOM 4511  C CD  . PRO B 1 45  ? 11.992  72.198  -37.144  1.00 40.00 ? 49  PRO B CD  1 
ATOM 4512  N N   . PRO B 1 46  ? 12.609  68.465  -34.275  1.00 40.00 ? 50  PRO B N   1 
ATOM 4513  C CA  . PRO B 1 46  ? 12.119  67.105  -34.161  1.00 40.00 ? 50  PRO B CA  1 
ATOM 4514  C C   . PRO B 1 46  ? 10.696  67.051  -33.653  1.00 40.00 ? 50  PRO B C   1 
ATOM 4515  O O   . PRO B 1 46  ? 10.257  68.018  -33.048  1.00 40.00 ? 50  PRO B O   1 
ATOM 4516  C CB  . PRO B 1 46  ? 13.056  66.434  -33.182  1.00 40.00 ? 50  PRO B CB  1 
ATOM 4517  C CG  . PRO B 1 46  ? 13.523  67.566  -32.328  1.00 40.00 ? 50  PRO B CG  1 
ATOM 4518  C CD  . PRO B 1 46  ? 13.570  68.791  -33.214  1.00 40.00 ? 50  PRO B CD  1 
ATOM 4519  N N   . GLU B 1 47  ? 10.017  65.944  -33.933  1.00 40.00 ? 51  GLU B N   1 
ATOM 4520  C CA  . GLU B 1 47  ? 8.646   65.736  -33.465  1.00 40.00 ? 51  GLU B CA  1 
ATOM 4521  C C   . GLU B 1 47  ? 8.578   64.431  -32.662  1.00 40.00 ? 51  GLU B C   1 
ATOM 4522  O O   . GLU B 1 47  ? 9.252   63.422  -32.904  1.00 40.00 ? 51  GLU B O   1 
ATOM 4523  C CB  . GLU B 1 47  ? 7.627   65.737  -34.568  1.00 40.00 ? 51  GLU B CB  1 
ATOM 4524  C CG  . GLU B 1 47  ? 6.804   67.000  -34.668  1.00 40.00 ? 51  GLU B CG  1 
ATOM 4525  C CD  . GLU B 1 47  ? 6.036   67.150  -35.972  1.00 40.00 ? 51  GLU B CD  1 
ATOM 4526  O OE1 . GLU B 1 47  ? 5.496   68.285  -36.132  1.00 40.00 ? 51  GLU B OE1 1 
ATOM 4527  O OE2 . GLU B 1 47  ? 5.932   66.229  -36.820  1.00 40.00 ? 51  GLU B OE2 1 
ATOM 4528  N N   . PRO B 1 48  ? 7.740   64.490  -31.647  1.00 40.00 ? 52  PRO B N   1 
ATOM 4529  C CA  . PRO B 1 48  ? 7.580   63.375  -30.730  1.00 40.00 ? 52  PRO B CA  1 
ATOM 4530  C C   . PRO B 1 48  ? 7.083   62.127  -31.453  1.00 40.00 ? 52  PRO B C   1 
ATOM 4531  O O   . PRO B 1 48  ? 6.095   62.152  -32.201  1.00 40.00 ? 52  PRO B O   1 
ATOM 4532  C CB  . PRO B 1 48  ? 6.631   63.880  -29.685  1.00 40.00 ? 52  PRO B CB  1 
ATOM 4533  C CG  . PRO B 1 48  ? 6.213   65.250  -30.024  1.00 40.00 ? 52  PRO B CG  1 
ATOM 4534  C CD  . PRO B 1 48  ? 6.884   65.642  -31.320  1.00 40.00 ? 52  PRO B CD  1 
ATOM 4535  N N   . LYS B 1 49  ? 7.834   61.045  -31.242  1.00 40.00 ? 53  LYS B N   1 
ATOM 4536  C CA  . LYS B 1 49  ? 7.513   59.742  -31.828  1.00 40.00 ? 53  LYS B CA  1 
ATOM 4537  C C   . LYS B 1 49  ? 6.055   59.412  -31.545  1.00 40.00 ? 53  LYS B C   1 
ATOM 4538  O O   . LYS B 1 49  ? 5.616   59.582  -30.397  1.00 40.00 ? 53  LYS B O   1 
ATOM 4539  C CB  . LYS B 1 49  ? 8.411   58.703  -31.142  1.00 40.00 ? 53  LYS B CB  1 
ATOM 4540  C CG  . LYS B 1 49  ? 8.556   57.336  -31.713  1.00 40.00 ? 53  LYS B CG  1 
ATOM 4541  C CD  . LYS B 1 49  ? 7.494   56.961  -32.720  1.00 40.00 ? 53  LYS B CD  1 
ATOM 4542  C CE  . LYS B 1 49  ? 7.896   55.849  -33.657  1.00 40.00 ? 53  LYS B CE  1 
ATOM 4543  N NZ  . LYS B 1 49  ? 7.769   56.283  -35.079  1.00 40.00 ? 53  LYS B NZ  1 
ATOM 4544  N N   . ARG B 1 50  ? 5.308   58.950  -32.544  1.00 40.00 ? 54  ARG B N   1 
ATOM 4545  C CA  . ARG B 1 50  ? 3.886   58.589  -32.332  1.00 40.00 ? 54  ARG B CA  1 
ATOM 4546  C C   . ARG B 1 50  ? 3.855   57.306  -31.531  1.00 40.00 ? 54  ARG B C   1 
ATOM 4547  O O   . ARG B 1 50  ? 4.864   56.570  -31.504  1.00 40.00 ? 54  ARG B O   1 
ATOM 4548  C CB  . ARG B 1 50  ? 3.179   58.484  -33.673  1.00 40.00 ? 54  ARG B CB  1 
ATOM 4549  C CG  . ARG B 1 50  ? 2.543   59.812  -34.093  1.00 40.00 ? 54  ARG B CG  1 
ATOM 4550  C CD  . ARG B 1 50  ? 2.513   60.018  -35.601  1.00 40.00 ? 54  ARG B CD  1 
ATOM 4551  N NE  . ARG B 1 50  ? 1.621   59.067  -36.251  1.00 40.00 ? 54  ARG B NE  1 
ATOM 4552  C CZ  . ARG B 1 50  ? 1.988   58.040  -37.010  1.00 40.00 ? 54  ARG B CZ  1 
ATOM 4553  N NH1 . ARG B 1 50  ? 3.265   57.776  -37.278  1.00 40.00 ? 54  ARG B NH1 1 
ATOM 4554  N NH2 . ARG B 1 50  ? 1.051   57.233  -37.527  1.00 40.00 ? 54  ARG B NH2 1 
ATOM 4555  N N   . PRO B 1 51  ? 2.762   57.028  -30.827  1.00 40.00 ? 55  PRO B N   1 
ATOM 4556  C CA  . PRO B 1 51  ? 2.650   55.833  -29.999  1.00 40.00 ? 55  PRO B CA  1 
ATOM 4557  C C   . PRO B 1 51  ? 2.494   54.607  -30.887  1.00 40.00 ? 55  PRO B C   1 
ATOM 4558  O O   . PRO B 1 51  ? 1.835   54.672  -31.912  1.00 40.00 ? 55  PRO B O   1 
ATOM 4559  C CB  . PRO B 1 51  ? 1.467   56.111  -29.127  1.00 40.00 ? 55  PRO B CB  1 
ATOM 4560  C CG  . PRO B 1 51  ? 0.863   57.394  -29.546  1.00 40.00 ? 55  PRO B CG  1 
ATOM 4561  C CD  . PRO B 1 51  ? 1.507   57.805  -30.832  1.00 40.00 ? 55  PRO B CD  1 
ATOM 4562  N N   . TRP B 1 52  ? 3.128   53.496  -30.493  1.00 40.00 ? 56  TRP B N   1 
ATOM 4563  C CA  . TRP B 1 52  ? 3.036   52.294  -31.282  1.00 40.00 ? 56  TRP B CA  1 
ATOM 4564  C C   . TRP B 1 52  ? 2.257   51.153  -30.655  1.00 40.00 ? 56  TRP B C   1 
ATOM 4565  O O   . TRP B 1 52  ? 2.063   50.985  -29.448  1.00 40.00 ? 56  TRP B O   1 
ATOM 4566  C CB  . TRP B 1 52  ? 4.439   51.758  -31.550  1.00 40.00 ? 56  TRP B CB  1 
ATOM 4567  C CG  . TRP B 1 52  ? 5.225   51.488  -30.311  1.00 40.00 ? 56  TRP B CG  1 
ATOM 4568  C CD1 . TRP B 1 52  ? 5.428   50.276  -29.724  1.00 40.00 ? 56  TRP B CD1 1 
ATOM 4569  C CD2 . TRP B 1 52  ? 5.938   52.454  -29.529  1.00 40.00 ? 56  TRP B CD2 1 
ATOM 4570  N NE1 . TRP B 1 52  ? 6.221   50.427  -28.606  1.00 40.00 ? 56  TRP B NE1 1 
ATOM 4571  C CE2 . TRP B 1 52  ? 6.544   51.756  -28.463  1.00 40.00 ? 56  TRP B CE2 1 
ATOM 4572  C CE3 . TRP B 1 52  ? 6.114   53.842  -29.624  1.00 40.00 ? 56  TRP B CE3 1 
ATOM 4573  C CZ2 . TRP B 1 52  ? 7.326   52.394  -27.499  1.00 40.00 ? 56  TRP B CZ2 1 
ATOM 4574  C CZ3 . TRP B 1 52  ? 6.884   54.468  -28.655  1.00 40.00 ? 56  TRP B CZ3 1 
ATOM 4575  C CH2 . TRP B 1 52  ? 7.474   53.745  -27.608  1.00 40.00 ? 56  TRP B CH2 1 
ATOM 4576  N N   . SER B 1 53  ? 1.811   50.257  -31.541  1.00 40.00 ? 57  SER B N   1 
ATOM 4577  C CA  . SER B 1 53  ? 1.088   49.067  -31.118  1.00 40.00 ? 57  SER B CA  1 
ATOM 4578  C C   . SER B 1 53  ? 2.110   47.986  -30.750  1.00 40.00 ? 57  SER B C   1 
ATOM 4579  O O   . SER B 1 53  ? 3.305   48.082  -31.029  1.00 40.00 ? 57  SER B O   1 
ATOM 4580  C CB  . SER B 1 53  ? 0.263   48.545  -32.309  1.00 40.00 ? 57  SER B CB  1 
ATOM 4581  O OG  . SER B 1 53  ? 0.963   47.497  -32.986  1.00 40.00 ? 57  SER B OG  1 
ATOM 4582  N N   . GLY B 1 54  ? 1.600   46.914  -30.173  1.00 40.00 ? 58  GLY B N   1 
ATOM 4583  C CA  . GLY B 1 54  ? 2.401   45.771  -29.809  1.00 40.00 ? 58  GLY B CA  1 
ATOM 4584  C C   . GLY B 1 54  ? 3.612   46.112  -28.955  1.00 40.00 ? 58  GLY B C   1 
ATOM 4585  O O   . GLY B 1 54  ? 3.696   47.106  -28.219  1.00 40.00 ? 58  GLY B O   1 
ATOM 4586  N N   . VAL B 1 55  ? 4.575   45.191  -29.077  1.00 40.00 ? 59  VAL B N   1 
ATOM 4587  C CA  . VAL B 1 55  ? 5.783   45.322  -28.275  1.00 40.00 ? 59  VAL B CA  1 
ATOM 4588  C C   . VAL B 1 55  ? 6.963   45.721  -29.131  1.00 40.00 ? 59  VAL B C   1 
ATOM 4589  O O   . VAL B 1 55  ? 7.498   44.913  -29.895  1.00 40.00 ? 59  VAL B O   1 
ATOM 4590  C CB  . VAL B 1 55  ? 6.040   44.007  -27.519  1.00 40.00 ? 59  VAL B CB  1 
ATOM 4591  C CG1 . VAL B 1 55  ? 7.509   43.748  -27.241  1.00 40.00 ? 59  VAL B CG1 1 
ATOM 4592  C CG2 . VAL B 1 55  ? 5.221   44.063  -26.223  1.00 40.00 ? 59  VAL B CG2 1 
ATOM 4593  N N   . LEU B 1 56  ? 7.345   46.993  -28.959  1.00 40.00 ? 60  LEU B N   1 
ATOM 4594  C CA  . LEU B 1 56  ? 8.501   47.510  -29.696  1.00 40.00 ? 60  LEU B CA  1 
ATOM 4595  C C   . LEU B 1 56  ? 9.765   46.760  -29.277  1.00 40.00 ? 60  LEU B C   1 
ATOM 4596  O O   . LEU B 1 56  ? 10.072  46.698  -28.077  1.00 40.00 ? 60  LEU B O   1 
ATOM 4597  C CB  . LEU B 1 56  ? 8.661   48.984  -29.365  1.00 40.00 ? 60  LEU B CB  1 
ATOM 4598  C CG  . LEU B 1 56  ? 9.688   49.840  -30.094  1.00 40.00 ? 60  LEU B CG  1 
ATOM 4599  C CD1 . LEU B 1 56  ? 10.351  49.134  -31.246  1.00 40.00 ? 60  LEU B CD1 1 
ATOM 4600  C CD2 . LEU B 1 56  ? 8.969   51.119  -30.562  1.00 40.00 ? 60  LEU B CD2 1 
ATOM 4601  N N   . ASP B 1 57  ? 10.482  46.207  -30.238  1.00 40.00 ? 61  ASP B N   1 
ATOM 4602  C CA  . ASP B 1 57  ? 11.715  45.499  -29.877  1.00 40.00 ? 61  ASP B CA  1 
ATOM 4603  C C   . ASP B 1 57  ? 12.738  46.588  -29.549  1.00 40.00 ? 61  ASP B C   1 
ATOM 4604  O O   . ASP B 1 57  ? 12.779  47.588  -30.259  1.00 40.00 ? 61  ASP B O   1 
ATOM 4605  C CB  . ASP B 1 57  ? 12.208  44.614  -30.996  1.00 40.00 ? 61  ASP B CB  1 
ATOM 4606  C CG  . ASP B 1 57  ? 13.630  44.126  -30.743  1.00 40.00 ? 61  ASP B CG  1 
ATOM 4607  O OD1 . ASP B 1 57  ? 13.783  42.883  -30.668  1.00 40.00 ? 61  ASP B OD1 1 
ATOM 4608  O OD2 . ASP B 1 57  ? 14.549  44.966  -30.613  1.00 40.00 ? 61  ASP B OD2 1 
ATOM 4609  N N   . ALA B 1 58  ? 13.529  46.372  -28.516  1.00 40.00 ? 62  ALA B N   1 
ATOM 4610  C CA  . ALA B 1 58  ? 14.511  47.420  -28.153  1.00 40.00 ? 62  ALA B CA  1 
ATOM 4611  C C   . ALA B 1 58  ? 15.760  46.716  -27.662  1.00 40.00 ? 62  ALA B C   1 
ATOM 4612  O O   . ALA B 1 58  ? 16.443  47.178  -26.762  1.00 40.00 ? 62  ALA B O   1 
ATOM 4613  C CB  . ALA B 1 58  ? 13.851  48.285  -27.101  1.00 40.00 ? 62  ALA B CB  1 
ATOM 4614  N N   . THR B 1 59  ? 16.026  45.593  -28.319  1.00 40.00 ? 63  THR B N   1 
ATOM 4615  C CA  . THR B 1 59  ? 17.143  44.747  -27.920  1.00 40.00 ? 63  THR B CA  1 
ATOM 4616  C C   . THR B 1 59  ? 18.417  45.056  -28.652  1.00 40.00 ? 63  THR B C   1 
ATOM 4617  O O   . THR B 1 59  ? 19.423  44.352  -28.510  1.00 40.00 ? 63  THR B O   1 
ATOM 4618  C CB  . THR B 1 59  ? 16.732  43.283  -28.211  1.00 40.00 ? 63  THR B CB  1 
ATOM 4619  O OG1 . THR B 1 59  ? 16.978  42.911  -29.563  1.00 40.00 ? 63  THR B OG1 1 
ATOM 4620  C CG2 . THR B 1 59  ? 15.236  43.143  -27.912  1.00 40.00 ? 63  THR B CG2 1 
ATOM 4621  N N   . THR B 1 60  ? 18.327  46.107  -29.488  1.00 40.00 ? 64  THR B N   1 
ATOM 4622  C CA  . THR B 1 60  ? 19.486  46.440  -30.302  1.00 40.00 ? 64  THR B CA  1 
ATOM 4623  C C   . THR B 1 60  ? 19.716  47.892  -30.655  1.00 40.00 ? 64  THR B C   1 
ATOM 4624  O O   . THR B 1 60  ? 18.829  48.745  -30.614  1.00 40.00 ? 64  THR B O   1 
ATOM 4625  C CB  . THR B 1 60  ? 19.398  45.656  -31.644  1.00 40.00 ? 64  THR B CB  1 
ATOM 4626  O OG1 . THR B 1 60  ? 20.699  45.797  -32.227  1.00 40.00 ? 64  THR B OG1 1 
ATOM 4627  C CG2 . THR B 1 60  ? 18.324  46.271  -32.510  1.00 40.00 ? 64  THR B CG2 1 
ATOM 4628  N N   . PHE B 1 61  ? 20.983  48.157  -31.015  1.00 40.00 ? 65  PHE B N   1 
ATOM 4629  C CA  . PHE B 1 61  ? 21.394  49.513  -31.364  1.00 40.00 ? 65  PHE B CA  1 
ATOM 4630  C C   . PHE B 1 61  ? 20.900  49.960  -32.731  1.00 40.00 ? 65  PHE B C   1 
ATOM 4631  O O   . PHE B 1 61  ? 21.146  49.252  -33.697  1.00 40.00 ? 65  PHE B O   1 
ATOM 4632  C CB  . PHE B 1 61  ? 22.926  49.573  -31.351  1.00 40.00 ? 65  PHE B CB  1 
ATOM 4633  C CG  . PHE B 1 61  ? 23.522  50.042  -30.057  1.00 40.00 ? 65  PHE B CG  1 
ATOM 4634  C CD1 . PHE B 1 61  ? 22.873  50.964  -29.240  1.00 40.00 ? 65  PHE B CD1 1 
ATOM 4635  C CD2 . PHE B 1 61  ? 24.763  49.553  -29.646  1.00 40.00 ? 65  PHE B CD2 1 
ATOM 4636  C CE1 . PHE B 1 61  ? 23.430  51.399  -28.056  1.00 40.00 ? 65  PHE B CE1 1 
ATOM 4637  C CE2 . PHE B 1 61  ? 25.346  49.969  -28.459  1.00 40.00 ? 65  PHE B CE2 1 
ATOM 4638  C CZ  . PHE B 1 61  ? 24.666  50.888  -27.689  1.00 40.00 ? 65  PHE B CZ  1 
ATOM 4639  N N   . GLN B 1 62  ? 20.280  51.111  -32.805  1.00 40.00 ? 66  GLN B N   1 
ATOM 4640  C CA  . GLN B 1 62  ? 19.799  51.677  -34.045  1.00 40.00 ? 66  GLN B CA  1 
ATOM 4641  C C   . GLN B 1 62  ? 20.868  52.351  -34.898  1.00 40.00 ? 66  GLN B C   1 
ATOM 4642  O O   . GLN B 1 62  ? 22.075  52.406  -34.613  1.00 40.00 ? 66  GLN B O   1 
ATOM 4643  C CB  . GLN B 1 62  ? 18.713  52.673  -33.663  1.00 40.00 ? 66  GLN B CB  1 
ATOM 4644  C CG  . GLN B 1 62  ? 17.370  51.919  -33.601  1.00 40.00 ? 66  GLN B CG  1 
ATOM 4645  C CD  . GLN B 1 62  ? 17.005  51.425  -34.999  1.00 40.00 ? 66  GLN B CD  1 
ATOM 4646  O OE1 . GLN B 1 62  ? 16.569  52.062  -35.944  1.00 40.00 ? 66  GLN B OE1 1 
ATOM 4647  N NE2 . GLN B 1 62  ? 17.224  50.114  -35.166  1.00 40.00 ? 66  GLN B NE2 1 
ATOM 4648  N N   . ASN B 1 63  ? 20.404  52.881  -36.041  1.00 40.00 ? 67  ASN B N   1 
ATOM 4649  C CA  . ASN B 1 63  ? 21.224  53.537  -37.023  1.00 40.00 ? 67  ASN B CA  1 
ATOM 4650  C C   . ASN B 1 63  ? 21.807  54.881  -36.557  1.00 40.00 ? 67  ASN B C   1 
ATOM 4651  O O   . ASN B 1 63  ? 21.105  55.719  -35.991  1.00 40.00 ? 67  ASN B O   1 
ATOM 4652  C CB  . ASN B 1 63  ? 20.446  53.871  -38.304  1.00 40.00 ? 67  ASN B CB  1 
ATOM 4653  C CG  . ASN B 1 63  ? 19.864  52.667  -38.999  1.00 40.00 ? 67  ASN B CG  1 
ATOM 4654  O OD1 . ASN B 1 63  ? 20.552  51.672  -39.244  1.00 40.00 ? 67  ASN B OD1 1 
ATOM 4655  N ND2 . ASN B 1 63  ? 18.580  52.795  -39.306  1.00 40.00 ? 67  ASN B ND2 1 
ATOM 4656  N N   . VAL B 1 64  ? 23.079  55.019  -36.874  1.00 40.00 ? 68  VAL B N   1 
ATOM 4657  C CA  . VAL B 1 64  ? 23.841  56.221  -36.614  1.00 40.00 ? 68  VAL B CA  1 
ATOM 4658  C C   . VAL B 1 64  ? 23.289  57.343  -37.490  1.00 40.00 ? 68  VAL B C   1 
ATOM 4659  O O   . VAL B 1 64  ? 23.127  57.091  -38.715  1.00 40.00 ? 68  VAL B O   1 
ATOM 4660  C CB  . VAL B 1 64  ? 25.263  55.941  -37.179  1.00 40.00 ? 68  VAL B CB  1 
ATOM 4661  C CG1 . VAL B 1 64  ? 26.044  57.216  -37.473  1.00 40.00 ? 68  VAL B CG1 1 
ATOM 4662  C CG2 . VAL B 1 64  ? 26.106  55.042  -36.307  1.00 40.00 ? 68  VAL B CG2 1 
ATOM 4663  N N   . CYS B 1 65  ? 23.106  58.566  -37.038  1.00 40.00 ? 69  CYS B N   1 
ATOM 4664  C CA  . CYS B 1 65  ? 22.685  59.632  -37.954  1.00 40.00 ? 69  CYS B CA  1 
ATOM 4665  C C   . CYS B 1 65  ? 23.630  59.834  -39.151  1.00 40.00 ? 69  CYS B C   1 
ATOM 4666  O O   . CYS B 1 65  ? 24.813  59.465  -39.113  1.00 40.00 ? 69  CYS B O   1 
ATOM 4667  C CB  . CYS B 1 65  ? 22.621  60.940  -37.184  1.00 40.00 ? 69  CYS B CB  1 
ATOM 4668  S SG  . CYS B 1 65  ? 21.287  60.983  -36.007  1.00 40.00 ? 69  CYS B SG  1 
ATOM 4669  N N   . TYR B 1 66  ? 23.134  60.467  -40.235  1.00 40.00 ? 70  TYR B N   1 
ATOM 4670  C CA  . TYR B 1 66  ? 23.917  60.663  -41.434  1.00 40.00 ? 70  TYR B CA  1 
ATOM 4671  C C   . TYR B 1 66  ? 25.131  61.524  -41.227  1.00 40.00 ? 70  TYR B C   1 
ATOM 4672  O O   . TYR B 1 66  ? 25.088  62.695  -40.831  1.00 40.00 ? 70  TYR B O   1 
ATOM 4673  C CB  . TYR B 1 66  ? 23.059  61.090  -42.662  1.00 40.00 ? 70  TYR B CB  1 
ATOM 4674  C CG  . TYR B 1 66  ? 23.718  60.425  -43.887  1.00 40.00 ? 70  TYR B CG  1 
ATOM 4675  C CD1 . TYR B 1 66  ? 23.529  59.087  -44.189  1.00 40.00 ? 70  TYR B CD1 1 
ATOM 4676  C CD2 . TYR B 1 66  ? 24.579  61.145  -44.685  1.00 40.00 ? 70  TYR B CD2 1 
ATOM 4677  C CE1 . TYR B 1 66  ? 24.161  58.497  -45.253  1.00 40.00 ? 70  TYR B CE1 1 
ATOM 4678  C CE2 . TYR B 1 66  ? 25.212  60.562  -45.763  1.00 40.00 ? 70  TYR B CE2 1 
ATOM 4679  C CZ  . TYR B 1 66  ? 25.007  59.227  -46.045  1.00 40.00 ? 70  TYR B CZ  1 
ATOM 4680  O OH  . TYR B 1 66  ? 25.685  58.691  -47.128  1.00 40.00 ? 70  TYR B OH  1 
ATOM 4681  N N   . GLN B 1 67  ? 26.326  60.955  -41.486  1.00 40.00 ? 71  GLN B N   1 
ATOM 4682  C CA  . GLN B 1 67  ? 27.518  61.764  -41.212  1.00 40.00 ? 71  GLN B CA  1 
ATOM 4683  C C   . GLN B 1 67  ? 28.774  61.409  -41.960  1.00 40.00 ? 71  GLN B C   1 
ATOM 4684  O O   . GLN B 1 67  ? 29.036  60.296  -42.407  1.00 40.00 ? 71  GLN B O   1 
ATOM 4685  C CB  . GLN B 1 67  ? 27.749  61.547  -39.688  1.00 40.00 ? 71  GLN B CB  1 
ATOM 4686  C CG  . GLN B 1 67  ? 28.097  60.112  -39.364  1.00 40.00 ? 71  GLN B CG  1 
ATOM 4687  C CD  . GLN B 1 67  ? 28.588  59.967  -37.931  1.00 40.00 ? 71  GLN B CD  1 
ATOM 4688  O OE1 . GLN B 1 67  ? 29.785  59.765  -37.659  1.00 40.00 ? 71  GLN B OE1 1 
ATOM 4689  N NE2 . GLN B 1 67  ? 27.605  60.084  -37.041  1.00 40.00 ? 71  GLN B NE2 1 
ATOM 4690  N N   . TYR B 1 68  ? 29.670  62.409  -42.054  1.00 40.00 ? 72  TYR B N   1 
ATOM 4691  C CA  . TYR B 1 68  ? 30.961  62.148  -42.722  1.00 40.00 ? 72  TYR B CA  1 
ATOM 4692  C C   . TYR B 1 68  ? 31.617  60.983  -42.006  1.00 40.00 ? 72  TYR B C   1 
ATOM 4693  O O   . TYR B 1 68  ? 31.432  60.784  -40.804  1.00 40.00 ? 72  TYR B O   1 
ATOM 4694  C CB  . TYR B 1 68  ? 31.804  63.420  -42.651  1.00 40.00 ? 72  TYR B CB  1 
ATOM 4695  C CG  . TYR B 1 68  ? 33.262  63.246  -42.987  1.00 40.00 ? 72  TYR B CG  1 
ATOM 4696  C CD1 . TYR B 1 68  ? 33.764  63.702  -44.192  1.00 40.00 ? 72  TYR B CD1 1 
ATOM 4697  C CD2 . TYR B 1 68  ? 34.141  62.642  -42.102  1.00 40.00 ? 72  TYR B CD2 1 
ATOM 4698  C CE1 . TYR B 1 68  ? 35.094  63.546  -44.524  1.00 40.00 ? 72  TYR B CE1 1 
ATOM 4699  C CE2 . TYR B 1 68  ? 35.474  62.489  -42.423  1.00 40.00 ? 72  TYR B CE2 1 
ATOM 4700  C CZ  . TYR B 1 68  ? 35.942  62.936  -43.638  1.00 40.00 ? 72  TYR B CZ  1 
ATOM 4701  O OH  . TYR B 1 68  ? 37.269  62.775  -43.949  1.00 40.00 ? 72  TYR B OH  1 
ATOM 4702  N N   . VAL B 1 69  ? 32.422  60.205  -42.693  1.00 40.00 ? 73  VAL B N   1 
ATOM 4703  C CA  . VAL B 1 69  ? 33.123  59.078  -42.067  1.00 40.00 ? 73  VAL B CA  1 
ATOM 4704  C C   . VAL B 1 69  ? 34.621  59.258  -42.172  1.00 40.00 ? 73  VAL B C   1 
ATOM 4705  O O   . VAL B 1 69  ? 35.179  59.655  -43.211  1.00 40.00 ? 73  VAL B O   1 
ATOM 4706  C CB  . VAL B 1 69  ? 32.700  57.744  -42.687  1.00 40.00 ? 73  VAL B CB  1 
ATOM 4707  C CG1 . VAL B 1 69  ? 33.686  56.635  -42.386  1.00 40.00 ? 73  VAL B CG1 1 
ATOM 4708  C CG2 . VAL B 1 69  ? 31.323  57.379  -42.192  1.00 40.00 ? 73  VAL B CG2 1 
ATOM 4709  N N   . ASP B 1 70  ? 35.336  59.035  -41.082  1.00 40.00 ? 74  ASP B N   1 
ATOM 4710  C CA  . ASP B 1 70  ? 36.759  59.333  -41.193  1.00 40.00 ? 74  ASP B CA  1 
ATOM 4711  C C   . ASP B 1 70  ? 37.584  58.343  -41.966  1.00 40.00 ? 74  ASP B C   1 
ATOM 4712  O O   . ASP B 1 70  ? 37.595  57.167  -41.624  1.00 40.00 ? 74  ASP B O   1 
ATOM 4713  C CB  . ASP B 1 70  ? 37.357  59.591  -39.809  1.00 40.00 ? 74  ASP B CB  1 
ATOM 4714  C CG  . ASP B 1 70  ? 38.663  60.366  -39.941  1.00 40.00 ? 74  ASP B CG  1 
ATOM 4715  O OD1 . ASP B 1 70  ? 38.579  61.605  -39.897  1.00 40.00 ? 74  ASP B OD1 1 
ATOM 4716  O OD2 . ASP B 1 70  ? 39.704  59.700  -40.083  1.00 40.00 ? 74  ASP B OD2 1 
ATOM 4717  N N   . THR B 1 71  ? 38.298  58.871  -42.950  1.00 40.00 ? 75  THR B N   1 
ATOM 4718  C CA  . THR B 1 71  ? 39.229  58.059  -43.735  1.00 40.00 ? 75  THR B CA  1 
ATOM 4719  C C   . THR B 1 71  ? 40.593  58.220  -43.054  1.00 40.00 ? 75  THR B C   1 
ATOM 4720  O O   . THR B 1 71  ? 40.874  57.511  -42.075  1.00 40.00 ? 75  THR B O   1 
ATOM 4721  C CB  . THR B 1 71  ? 39.343  58.472  -45.199  1.00 40.00 ? 75  THR B CB  1 
ATOM 4722  O OG1 . THR B 1 71  ? 38.381  59.489  -45.555  1.00 40.00 ? 75  THR B OG1 1 
ATOM 4723  C CG2 . THR B 1 71  ? 39.069  57.268  -46.102  1.00 40.00 ? 75  THR B CG2 1 
ATOM 4724  N N   . LEU B 1 72  ? 41.385  59.184  -43.470  1.00 40.00 ? 76  LEU B N   1 
ATOM 4725  C CA  . LEU B 1 72  ? 42.683  59.501  -42.920  1.00 40.00 ? 76  LEU B CA  1 
ATOM 4726  C C   . LEU B 1 72  ? 43.556  58.295  -42.628  1.00 40.00 ? 76  LEU B C   1 
ATOM 4727  O O   . LEU B 1 72  ? 44.531  58.053  -43.355  1.00 40.00 ? 76  LEU B O   1 
ATOM 4728  C CB  . LEU B 1 72  ? 42.610  60.407  -41.687  1.00 40.00 ? 76  LEU B CB  1 
ATOM 4729  C CG  . LEU B 1 72  ? 43.976  60.836  -41.109  1.00 40.00 ? 76  LEU B CG  1 
ATOM 4730  C CD1 . LEU B 1 72  ? 44.860  61.467  -42.168  1.00 40.00 ? 76  LEU B CD1 1 
ATOM 4731  C CD2 . LEU B 1 72  ? 43.837  61.765  -39.913  1.00 40.00 ? 76  LEU B CD2 1 
ATOM 4732  N N   . TYR B 1 73  ? 43.291  57.547  -41.584  1.00 40.00 ? 77  TYR B N   1 
ATOM 4733  C CA  . TYR B 1 73  ? 44.061  56.362  -41.208  1.00 40.00 ? 77  TYR B CA  1 
ATOM 4734  C C   . TYR B 1 73  ? 43.107  55.172  -41.168  1.00 40.00 ? 77  TYR B C   1 
ATOM 4735  O O   . TYR B 1 73  ? 42.553  54.810  -40.128  1.00 40.00 ? 77  TYR B O   1 
ATOM 4736  C CB  . TYR B 1 73  ? 44.701  56.606  -39.845  1.00 40.00 ? 77  TYR B CB  1 
ATOM 4737  C CG  . TYR B 1 73  ? 45.773  57.673  -39.806  1.00 40.00 ? 77  TYR B CG  1 
ATOM 4738  C CD1 . TYR B 1 73  ? 46.870  57.601  -40.656  1.00 40.00 ? 77  TYR B CD1 1 
ATOM 4739  C CD2 . TYR B 1 73  ? 45.709  58.750  -38.933  1.00 40.00 ? 77  TYR B CD2 1 
ATOM 4740  C CE1 . TYR B 1 73  ? 47.858  58.561  -40.640  1.00 40.00 ? 77  TYR B CE1 1 
ATOM 4741  C CE2 . TYR B 1 73  ? 46.697  59.716  -38.906  1.00 40.00 ? 77  TYR B CE2 1 
ATOM 4742  C CZ  . TYR B 1 73  ? 47.775  59.617  -39.761  1.00 40.00 ? 77  TYR B CZ  1 
ATOM 4743  O OH  . TYR B 1 73  ? 48.766  60.582  -39.733  1.00 40.00 ? 77  TYR B OH  1 
ATOM 4744  N N   . PRO B 1 74  ? 42.871  54.576  -42.331  1.00 40.00 ? 78  PRO B N   1 
ATOM 4745  C CA  . PRO B 1 74  ? 41.950  53.464  -42.487  1.00 40.00 ? 78  PRO B CA  1 
ATOM 4746  C C   . PRO B 1 74  ? 42.427  52.194  -41.830  1.00 40.00 ? 78  PRO B C   1 
ATOM 4747  O O   . PRO B 1 74  ? 43.566  51.761  -42.027  1.00 40.00 ? 78  PRO B O   1 
ATOM 4748  C CB  . PRO B 1 74  ? 41.799  53.314  -43.979  1.00 40.00 ? 78  PRO B CB  1 
ATOM 4749  C CG  . PRO B 1 74  ? 42.969  53.974  -44.603  1.00 40.00 ? 78  PRO B CG  1 
ATOM 4750  C CD  . PRO B 1 74  ? 43.523  54.928  -43.613  1.00 40.00 ? 78  PRO B CD  1 
ATOM 4751  N N   . GLY B 1 75  ? 41.548  51.629  -40.996  1.00 40.00 ? 79  GLY B N   1 
ATOM 4752  C CA  . GLY B 1 75  ? 41.895  50.426  -40.272  1.00 40.00 ? 79  GLY B CA  1 
ATOM 4753  C C   . GLY B 1 75  ? 42.610  50.758  -38.970  1.00 40.00 ? 79  GLY B C   1 
ATOM 4754  O O   . GLY B 1 75  ? 42.890  49.812  -38.213  1.00 40.00 ? 79  GLY B O   1 
ATOM 4755  N N   . PHE B 1 76  ? 42.886  52.028  -38.688  1.00 40.00 ? 80  PHE B N   1 
ATOM 4756  C CA  . PHE B 1 76  ? 43.557  52.429  -37.450  1.00 40.00 ? 80  PHE B CA  1 
ATOM 4757  C C   . PHE B 1 76  ? 42.548  52.590  -36.315  1.00 40.00 ? 80  PHE B C   1 
ATOM 4758  O O   . PHE B 1 76  ? 41.637  53.421  -36.393  1.00 40.00 ? 80  PHE B O   1 
ATOM 4759  C CB  . PHE B 1 76  ? 44.325  53.738  -37.643  1.00 40.00 ? 80  PHE B CB  1 
ATOM 4760  C CG  . PHE B 1 76  ? 44.867  54.347  -36.373  1.00 40.00 ? 80  PHE B CG  1 
ATOM 4761  C CD1 . PHE B 1 76  ? 45.803  53.673  -35.617  1.00 40.00 ? 80  PHE B CD1 1 
ATOM 4762  C CD2 . PHE B 1 76  ? 44.441  55.593  -35.948  1.00 40.00 ? 80  PHE B CD2 1 
ATOM 4763  C CE1 . PHE B 1 76  ? 46.311  54.215  -34.456  1.00 40.00 ? 80  PHE B CE1 1 
ATOM 4764  C CE2 . PHE B 1 76  ? 44.957  56.155  -34.804  1.00 40.00 ? 80  PHE B CE2 1 
ATOM 4765  C CZ  . PHE B 1 76  ? 45.885  55.461  -34.056  1.00 40.00 ? 80  PHE B CZ  1 
ATOM 4766  N N   . GLU B 1 77  ? 42.738  51.838  -35.246  1.00 40.00 ? 81  GLU B N   1 
ATOM 4767  C CA  . GLU B 1 77  ? 41.827  51.904  -34.101  1.00 40.00 ? 81  GLU B CA  1 
ATOM 4768  C C   . GLU B 1 77  ? 41.608  53.306  -33.565  1.00 40.00 ? 81  GLU B C   1 
ATOM 4769  O O   . GLU B 1 77  ? 40.487  53.699  -33.204  1.00 40.00 ? 81  GLU B O   1 
ATOM 4770  C CB  . GLU B 1 77  ? 42.350  50.997  -32.964  1.00 40.00 ? 81  GLU B CB  1 
ATOM 4771  C CG  . GLU B 1 77  ? 41.372  50.838  -31.818  1.00 40.00 ? 81  GLU B CG  1 
ATOM 4772  C CD  . GLU B 1 77  ? 42.036  50.496  -30.496  1.00 40.00 ? 81  GLU B CD  1 
ATOM 4773  O OE1 . GLU B 1 77  ? 42.144  49.287  -30.164  1.00 40.00 ? 81  GLU B OE1 1 
ATOM 4774  O OE2 . GLU B 1 77  ? 42.463  51.414  -29.743  1.00 40.00 ? 81  GLU B OE2 1 
ATOM 4775  N N   . GLY B 1 78  ? 42.670  54.109  -33.492  1.00 40.00 ? 82  GLY B N   1 
ATOM 4776  C CA  . GLY B 1 78  ? 42.563  55.452  -32.943  1.00 40.00 ? 82  GLY B CA  1 
ATOM 4777  C C   . GLY B 1 78  ? 41.518  56.330  -33.608  1.00 40.00 ? 82  GLY B C   1 
ATOM 4778  O O   . GLY B 1 78  ? 40.895  57.176  -32.940  1.00 40.00 ? 82  GLY B O   1 
ATOM 4779  N N   . THR B 1 79  ? 41.365  56.176  -34.923  1.00 40.00 ? 83  THR B N   1 
ATOM 4780  C CA  . THR B 1 79  ? 40.361  56.971  -35.624  1.00 40.00 ? 83  THR B CA  1 
ATOM 4781  C C   . THR B 1 79  ? 39.073  56.160  -35.775  1.00 40.00 ? 83  THR B C   1 
ATOM 4782  O O   . THR B 1 79  ? 37.972  56.647  -35.523  1.00 40.00 ? 83  THR B O   1 
ATOM 4783  C CB  . THR B 1 79  ? 40.848  57.314  -37.041  1.00 40.00 ? 83  THR B CB  1 
ATOM 4784  O OG1 . THR B 1 79  ? 41.583  56.190  -37.560  1.00 40.00 ? 83  THR B OG1 1 
ATOM 4785  C CG2 . THR B 1 79  ? 41.759  58.520  -37.043  1.00 40.00 ? 83  THR B CG2 1 
ATOM 4786  N N   . GLU B 1 80  ? 39.236  54.902  -36.195  1.00 40.00 ? 84  GLU B N   1 
ATOM 4787  C CA  . GLU B 1 80  ? 38.075  54.058  -36.422  1.00 40.00 ? 84  GLU B CA  1 
ATOM 4788  C C   . GLU B 1 80  ? 37.151  54.039  -35.234  1.00 40.00 ? 84  GLU B C   1 
ATOM 4789  O O   . GLU B 1 80  ? 35.946  54.293  -35.386  1.00 40.00 ? 84  GLU B O   1 
ATOM 4790  C CB  . GLU B 1 80  ? 38.461  52.656  -36.821  1.00 40.00 ? 84  GLU B CB  1 
ATOM 4791  C CG  . GLU B 1 80  ? 39.225  52.468  -38.110  1.00 40.00 ? 84  GLU B CG  1 
ATOM 4792  C CD  . GLU B 1 80  ? 38.545  52.940  -39.366  1.00 40.00 ? 84  GLU B CD  1 
ATOM 4793  O OE1 . GLU B 1 80  ? 39.228  52.961  -40.428  1.00 40.00 ? 84  GLU B OE1 1 
ATOM 4794  O OE2 . GLU B 1 80  ? 37.338  53.298  -39.310  1.00 40.00 ? 84  GLU B OE2 1 
ATOM 4795  N N   . MET B 1 81  ? 37.664  53.846  -34.026  1.00 40.00 ? 85  MET B N   1 
ATOM 4796  C CA  . MET B 1 81  ? 36.857  53.800  -32.804  1.00 40.00 ? 85  MET B CA  1 
ATOM 4797  C C   . MET B 1 81  ? 35.851  54.923  -32.669  1.00 40.00 ? 85  MET B C   1 
ATOM 4798  O O   . MET B 1 81  ? 34.923  54.869  -31.857  1.00 40.00 ? 85  MET B O   1 
ATOM 4799  C CB  . MET B 1 81  ? 37.787  53.815  -31.581  1.00 40.00 ? 85  MET B CB  1 
ATOM 4800  C CG  . MET B 1 81  ? 38.522  55.150  -31.456  1.00 40.00 ? 85  MET B CG  1 
ATOM 4801  S SD  . MET B 1 81  ? 39.465  55.271  -29.929  1.00 40.00 ? 85  MET B SD  1 
ATOM 4802  C CE  . MET B 1 81  ? 38.143  55.426  -28.736  1.00 40.00 ? 85  MET B CE  1 
ATOM 4803  N N   . TRP B 1 82  ? 36.008  55.996  -33.431  1.00 40.00 ? 86  TRP B N   1 
ATOM 4804  C CA  . TRP B 1 82  ? 35.124  57.132  -33.403  1.00 40.00 ? 86  TRP B CA  1 
ATOM 4805  C C   . TRP B 1 82  ? 34.044  57.102  -34.474  1.00 40.00 ? 86  TRP B C   1 
ATOM 4806  O O   . TRP B 1 82  ? 33.040  57.792  -34.318  1.00 40.00 ? 86  TRP B O   1 
ATOM 4807  C CB  . TRP B 1 82  ? 35.997  58.409  -33.540  1.00 40.00 ? 86  TRP B CB  1 
ATOM 4808  C CG  . TRP B 1 82  ? 36.938  58.535  -32.374  1.00 40.00 ? 86  TRP B CG  1 
ATOM 4809  C CD1 . TRP B 1 82  ? 38.293  58.558  -32.457  1.00 40.00 ? 86  TRP B CD1 1 
ATOM 4810  C CD2 . TRP B 1 82  ? 36.605  58.627  -30.989  1.00 40.00 ? 86  TRP B CD2 1 
ATOM 4811  N NE1 . TRP B 1 82  ? 38.836  58.662  -31.187  1.00 40.00 ? 86  TRP B NE1 1 
ATOM 4812  C CE2 . TRP B 1 82  ? 37.823  58.702  -30.278  1.00 40.00 ? 86  TRP B CE2 1 
ATOM 4813  C CE3 . TRP B 1 82  ? 35.407  58.655  -30.272  1.00 40.00 ? 86  TRP B CE3 1 
ATOM 4814  C CZ2 . TRP B 1 82  ? 37.876  58.821  -28.892  1.00 40.00 ? 86  TRP B CZ2 1 
ATOM 4815  C CZ3 . TRP B 1 82  ? 35.448  58.757  -28.894  1.00 40.00 ? 86  TRP B CZ3 1 
ATOM 4816  C CH2 . TRP B 1 82  ? 36.678  58.840  -28.216  1.00 40.00 ? 86  TRP B CH2 1 
ATOM 4817  N N   . ASN B 1 83  ? 34.277  56.324  -35.503  1.00 40.00 ? 87  ASN B N   1 
ATOM 4818  C CA  . ASN B 1 83  ? 33.444  56.102  -36.656  1.00 40.00 ? 87  ASN B CA  1 
ATOM 4819  C C   . ASN B 1 83  ? 32.146  55.378  -36.364  1.00 40.00 ? 87  ASN B C   1 
ATOM 4820  O O   . ASN B 1 83  ? 31.961  54.714  -35.335  1.00 40.00 ? 87  ASN B O   1 
ATOM 4821  C CB  . ASN B 1 83  ? 34.302  55.333  -37.678  1.00 40.00 ? 87  ASN B CB  1 
ATOM 4822  C CG  . ASN B 1 83  ? 34.913  56.279  -38.686  1.00 40.00 ? 87  ASN B CG  1 
ATOM 4823  O OD1 . ASN B 1 83  ? 34.308  57.353  -38.882  1.00 40.00 ? 87  ASN B OD1 1 
ATOM 4824  N ND2 . ASN B 1 83  ? 36.032  55.942  -39.317  1.00 40.00 ? 87  ASN B ND2 1 
ATOM 4825  N N   . PRO B 1 84  ? 31.175  55.478  -37.264  1.00 40.00 ? 88  PRO B N   1 
ATOM 4826  C CA  . PRO B 1 84  ? 29.866  54.864  -37.078  1.00 40.00 ? 88  PRO B CA  1 
ATOM 4827  C C   . PRO B 1 84  ? 30.032  53.361  -37.011  1.00 40.00 ? 88  PRO B C   1 
ATOM 4828  O O   . PRO B 1 84  ? 30.935  52.842  -37.684  1.00 40.00 ? 88  PRO B O   1 
ATOM 4829  C CB  . PRO B 1 84  ? 29.012  55.407  -38.180  1.00 40.00 ? 88  PRO B CB  1 
ATOM 4830  C CG  . PRO B 1 84  ? 29.857  56.264  -39.037  1.00 40.00 ? 88  PRO B CG  1 
ATOM 4831  C CD  . PRO B 1 84  ? 31.270  56.200  -38.553  1.00 40.00 ? 88  PRO B CD  1 
ATOM 4832  N N   . ASN B 1 85  ? 29.246  52.692  -36.146  1.00 40.00 ? 89  ASN B N   1 
ATOM 4833  C CA  . ASN B 1 85  ? 29.411  51.235  -36.022  1.00 40.00 ? 89  ASN B CA  1 
ATOM 4834  C C   . ASN B 1 85  ? 28.072  50.561  -36.347  1.00 40.00 ? 89  ASN B C   1 
ATOM 4835  O O   . ASN B 1 85  ? 27.801  49.376  -36.146  1.00 40.00 ? 89  ASN B O   1 
ATOM 4836  C CB  . ASN B 1 85  ? 29.882  50.807  -34.647  1.00 40.00 ? 89  ASN B CB  1 
ATOM 4837  C CG  . ASN B 1 85  ? 28.916  51.208  -33.544  1.00 40.00 ? 89  ASN B CG  1 
ATOM 4838  O OD1 . ASN B 1 85  ? 27.959  51.974  -33.708  1.00 40.00 ? 89  ASN B OD1 1 
ATOM 4839  N ND2 . ASN B 1 85  ? 29.177  50.701  -32.331  1.00 40.00 ? 89  ASN B ND2 1 
ATOM 4840  N N   . ARG B 1 86  ? 27.182  51.408  -36.834  1.00 40.00 ? 90  ARG B N   1 
ATOM 4841  C CA  . ARG B 1 86  ? 25.859  51.011  -37.255  1.00 40.00 ? 90  ARG B CA  1 
ATOM 4842  C C   . ARG B 1 86  ? 25.627  51.605  -38.645  1.00 40.00 ? 90  ARG B C   1 
ATOM 4843  O O   . ARG B 1 86  ? 26.489  52.315  -39.217  1.00 40.00 ? 90  ARG B O   1 
ATOM 4844  C CB  . ARG B 1 86  ? 24.881  51.490  -36.213  1.00 40.00 ? 90  ARG B CB  1 
ATOM 4845  C CG  . ARG B 1 86  ? 24.499  50.541  -35.117  1.00 40.00 ? 90  ARG B CG  1 
ATOM 4846  C CD  . ARG B 1 86  ? 25.031  49.120  -35.262  1.00 40.00 ? 90  ARG B CD  1 
ATOM 4847  N NE  . ARG B 1 86  ? 24.805  48.365  -34.052  1.00 40.00 ? 90  ARG B NE  1 
ATOM 4848  C CZ  . ARG B 1 86  ? 25.677  47.644  -33.354  1.00 40.00 ? 90  ARG B CZ  1 
ATOM 4849  N NH1 . ARG B 1 86  ? 26.947  47.523  -33.727  1.00 40.00 ? 90  ARG B NH1 1 
ATOM 4850  N NH2 . ARG B 1 86  ? 25.234  47.038  -32.238  1.00 40.00 ? 90  ARG B NH2 1 
ATOM 4851  N N   . GLU B 1 87  ? 24.489  51.305  -39.268  1.00 40.00 ? 91  GLU B N   1 
ATOM 4852  C CA  . GLU B 1 87  ? 24.302  51.878  -40.592  1.00 40.00 ? 91  GLU B CA  1 
ATOM 4853  C C   . GLU B 1 87  ? 23.949  53.349  -40.509  1.00 40.00 ? 91  GLU B C   1 
ATOM 4854  O O   . GLU B 1 87  ? 23.307  53.799  -39.562  1.00 40.00 ? 91  GLU B O   1 
ATOM 4855  C CB  . GLU B 1 87  ? 23.266  51.070  -41.379  1.00 40.00 ? 91  GLU B CB  1 
ATOM 4856  C CG  . GLU B 1 87  ? 23.999  49.919  -42.103  1.00 40.00 ? 91  GLU B CG  1 
ATOM 4857  C CD  . GLU B 1 87  ? 23.150  49.395  -43.240  1.00 40.00 ? 91  GLU B CD  1 
ATOM 4858  O OE1 . GLU B 1 87  ? 23.157  48.158  -43.445  1.00 40.00 ? 91  GLU B OE1 1 
ATOM 4859  O OE2 . GLU B 1 87  ? 22.485  50.226  -43.905  1.00 40.00 ? 91  GLU B OE2 1 
ATOM 4860  N N   . LEU B 1 88  ? 24.422  54.053  -41.560  1.00 40.00 ? 92  LEU B N   1 
ATOM 4861  C CA  . LEU B 1 88  ? 24.099  55.479  -41.585  1.00 40.00 ? 92  LEU B CA  1 
ATOM 4862  C C   . LEU B 1 88  ? 22.641  55.655  -41.951  1.00 40.00 ? 92  LEU B C   1 
ATOM 4863  O O   . LEU B 1 88  ? 22.167  54.827  -42.722  1.00 40.00 ? 92  LEU B O   1 
ATOM 4864  C CB  . LEU B 1 88  ? 24.970  56.141  -42.675  1.00 40.00 ? 92  LEU B CB  1 
ATOM 4865  C CG  . LEU B 1 88  ? 26.415  56.282  -42.116  1.00 40.00 ? 92  LEU B CG  1 
ATOM 4866  C CD1 . LEU B 1 88  ? 27.349  56.766  -43.190  1.00 40.00 ? 92  LEU B CD1 1 
ATOM 4867  C CD2 . LEU B 1 88  ? 26.368  57.178  -40.885  1.00 40.00 ? 92  LEU B CD2 1 
ATOM 4868  N N   . SER B 1 89  ? 21.957  56.668  -41.471  1.00 40.00 ? 93  SER B N   1 
ATOM 4869  C CA  . SER B 1 89  ? 20.610  56.869  -41.963  1.00 40.00 ? 93  SER B CA  1 
ATOM 4870  C C   . SER B 1 89  ? 20.003  58.156  -41.440  1.00 40.00 ? 93  SER B C   1 
ATOM 4871  O O   . SER B 1 89  ? 20.197  58.462  -40.244  1.00 40.00 ? 93  SER B O   1 
ATOM 4872  C CB  . SER B 1 89  ? 19.683  55.722  -41.600  1.00 40.00 ? 93  SER B CB  1 
ATOM 4873  O OG  . SER B 1 89  ? 18.393  56.308  -41.315  1.00 40.00 ? 93  SER B OG  1 
ATOM 4874  N N   . GLU B 1 90  ? 19.159  58.840  -42.212  1.00 40.00 ? 94  GLU B N   1 
ATOM 4875  C CA  . GLU B 1 90  ? 18.532  60.035  -41.628  1.00 40.00 ? 94  GLU B CA  1 
ATOM 4876  C C   . GLU B 1 90  ? 17.558  59.571  -40.559  1.00 40.00 ? 94  GLU B C   1 
ATOM 4877  O O   . GLU B 1 90  ? 17.104  60.348  -39.703  1.00 40.00 ? 94  GLU B O   1 
ATOM 4878  C CB  . GLU B 1 90  ? 17.886  60.884  -42.701  1.00 40.00 ? 94  GLU B CB  1 
ATOM 4879  C CG  . GLU B 1 90  ? 18.866  61.497  -43.715  1.00 40.00 ? 94  GLU B CG  1 
ATOM 4880  C CD  . GLU B 1 90  ? 18.198  62.646  -44.467  1.00 40.00 ? 94  GLU B CD  1 
ATOM 4881  O OE1 . GLU B 1 90  ? 17.820  63.648  -43.782  1.00 40.00 ? 94  GLU B OE1 1 
ATOM 4882  O OE2 . GLU B 1 90  ? 18.030  62.556  -45.703  1.00 40.00 ? 94  GLU B OE2 1 
ATOM 4883  N N   . ASP B 1 91  ? 17.166  58.298  -40.558  1.00 40.00 ? 95  ASP B N   1 
ATOM 4884  C CA  . ASP B 1 91  ? 16.262  57.800  -39.528  1.00 40.00 ? 95  ASP B CA  1 
ATOM 4885  C C   . ASP B 1 91  ? 17.114  57.219  -38.382  1.00 40.00 ? 95  ASP B C   1 
ATOM 4886  O O   . ASP B 1 91  ? 17.457  56.026  -38.464  1.00 40.00 ? 95  ASP B O   1 
ATOM 4887  C CB  . ASP B 1 91  ? 15.313  56.759  -40.075  1.00 40.00 ? 95  ASP B CB  1 
ATOM 4888  C CG  . ASP B 1 91  ? 14.287  56.388  -39.013  1.00 40.00 ? 95  ASP B CG  1 
ATOM 4889  O OD1 . ASP B 1 91  ? 14.256  57.138  -37.991  1.00 40.00 ? 95  ASP B OD1 1 
ATOM 4890  O OD2 . ASP B 1 91  ? 13.549  55.402  -39.181  1.00 40.00 ? 95  ASP B OD2 1 
ATOM 4891  N N   . CYS B 1 92  ? 17.422  58.106  -37.412  1.00 40.00 ? 96  CYS B N   1 
ATOM 4892  C CA  . CYS B 1 92  ? 18.336  57.802  -36.330  1.00 40.00 ? 96  CYS B CA  1 
ATOM 4893  C C   . CYS B 1 92  ? 18.001  58.360  -34.971  1.00 40.00 ? 96  CYS B C   1 
ATOM 4894  O O   . CYS B 1 92  ? 18.798  58.186  -34.029  1.00 40.00 ? 96  CYS B O   1 
ATOM 4895  C CB  . CYS B 1 92  ? 19.741  58.406  -36.708  1.00 40.00 ? 96  CYS B CB  1 
ATOM 4896  S SG  . CYS B 1 92  ? 19.687  60.197  -36.940  1.00 40.00 ? 96  CYS B SG  1 
ATOM 4897  N N   . LEU B 1 93  ? 16.872  59.026  -34.813  1.00 40.00 ? 97  LEU B N   1 
ATOM 4898  C CA  . LEU B 1 93  ? 16.467  59.586  -33.537  1.00 40.00 ? 97  LEU B CA  1 
ATOM 4899  C C   . LEU B 1 93  ? 15.957  58.590  -32.538  1.00 40.00 ? 97  LEU B C   1 
ATOM 4900  O O   . LEU B 1 93  ? 14.748  58.436  -32.281  1.00 40.00 ? 97  LEU B O   1 
ATOM 4901  C CB  . LEU B 1 93  ? 15.407  60.696  -33.758  1.00 40.00 ? 97  LEU B CB  1 
ATOM 4902  C CG  . LEU B 1 93  ? 16.014  61.868  -34.533  1.00 40.00 ? 97  LEU B CG  1 
ATOM 4903  C CD1 . LEU B 1 93  ? 15.201  63.147  -34.429  1.00 40.00 ? 97  LEU B CD1 1 
ATOM 4904  C CD2 . LEU B 1 93  ? 17.452  62.093  -34.091  1.00 40.00 ? 97  LEU B CD2 1 
ATOM 4905  N N   . TYR B 1 94  ? 16.867  57.833  -31.939  1.00 40.00 ? 98  TYR B N   1 
ATOM 4906  C CA  . TYR B 1 94  ? 16.582  56.842  -30.924  1.00 40.00 ? 98  TYR B CA  1 
ATOM 4907  C C   . TYR B 1 94  ? 17.460  57.126  -29.714  1.00 40.00 ? 98  TYR B C   1 
ATOM 4908  O O   . TYR B 1 94  ? 18.364  57.961  -29.869  1.00 40.00 ? 98  TYR B O   1 
ATOM 4909  C CB  . TYR B 1 94  ? 16.939  55.443  -31.475  1.00 40.00 ? 98  TYR B CB  1 
ATOM 4910  C CG  . TYR B 1 94  ? 16.152  55.227  -32.758  1.00 40.00 ? 98  TYR B CG  1 
ATOM 4911  C CD1 . TYR B 1 94  ? 14.817  55.602  -32.823  1.00 40.00 ? 98  TYR B CD1 1 
ATOM 4912  C CD2 . TYR B 1 94  ? 16.673  54.720  -33.896  1.00 40.00 ? 98  TYR B CD2 1 
ATOM 4913  C CE1 . TYR B 1 94  ? 14.056  55.474  -33.963  1.00 40.00 ? 98  TYR B CE1 1 
ATOM 4914  C CE2 . TYR B 1 94  ? 15.948  54.520  -35.045  1.00 40.00 ? 98  TYR B CE2 1 
ATOM 4915  C CZ  . TYR B 1 94  ? 14.634  54.901  -35.086  1.00 40.00 ? 98  TYR B CZ  1 
ATOM 4916  O OH  . TYR B 1 94  ? 13.897  54.741  -36.225  1.00 40.00 ? 98  TYR B OH  1 
ATOM 4917  N N   . LEU B 1 95  ? 17.160  56.513  -28.585  1.00 40.00 ? 99  LEU B N   1 
ATOM 4918  C CA  . LEU B 1 95  ? 18.045  56.717  -27.420  1.00 40.00 ? 99  LEU B CA  1 
ATOM 4919  C C   . LEU B 1 95  ? 18.288  55.357  -26.817  1.00 40.00 ? 99  LEU B C   1 
ATOM 4920  O O   . LEU B 1 95  ? 17.838  54.323  -27.340  1.00 40.00 ? 99  LEU B O   1 
ATOM 4921  C CB  . LEU B 1 95  ? 17.428  57.717  -26.486  1.00 40.00 ? 99  LEU B CB  1 
ATOM 4922  C CG  . LEU B 1 95  ? 16.070  57.352  -25.929  1.00 40.00 ? 99  LEU B CG  1 
ATOM 4923  C CD1 . LEU B 1 95  ? 16.309  56.352  -24.787  1.00 40.00 ? 99  LEU B CD1 1 
ATOM 4924  C CD2 . LEU B 1 95  ? 15.314  58.567  -25.385  1.00 40.00 ? 99  LEU B CD2 1 
ATOM 4925  N N   . ASN B 1 96  ? 19.064  55.262  -25.767  1.00 40.00 ? 100 ASN B N   1 
ATOM 4926  C CA  . ASN B 1 96  ? 19.287  53.974  -25.125  1.00 40.00 ? 100 ASN B CA  1 
ATOM 4927  C C   . ASN B 1 96  ? 19.095  54.131  -23.619  1.00 40.00 ? 100 ASN B C   1 
ATOM 4928  O O   . ASN B 1 96  ? 19.144  55.232  -23.047  1.00 40.00 ? 100 ASN B O   1 
ATOM 4929  C CB  . ASN B 1 96  ? 20.682  53.403  -25.383  1.00 40.00 ? 100 ASN B CB  1 
ATOM 4930  C CG  . ASN B 1 96  ? 20.943  53.454  -26.891  1.00 40.00 ? 100 ASN B CG  1 
ATOM 4931  O OD1 . ASN B 1 96  ? 20.289  52.764  -27.640  1.00 40.00 ? 100 ASN B OD1 1 
ATOM 4932  N ND2 . ASN B 1 96  ? 21.848  54.339  -27.239  1.00 40.00 ? 100 ASN B ND2 1 
ATOM 4933  N N   . VAL B 1 97  ? 18.845  52.990  -22.969  1.00 40.00 ? 101 VAL B N   1 
ATOM 4934  C CA  . VAL B 1 97  ? 18.741  52.982  -21.524  1.00 40.00 ? 101 VAL B CA  1 
ATOM 4935  C C   . VAL B 1 97  ? 19.441  51.726  -20.971  1.00 40.00 ? 101 VAL B C   1 
ATOM 4936  O O   . VAL B 1 97  ? 19.236  50.629  -21.508  1.00 40.00 ? 101 VAL B O   1 
ATOM 4937  C CB  . VAL B 1 97  ? 17.317  53.005  -20.966  1.00 40.00 ? 101 VAL B CB  1 
ATOM 4938  C CG1 . VAL B 1 97  ? 17.387  52.874  -19.436  1.00 40.00 ? 101 VAL B CG1 1 
ATOM 4939  C CG2 . VAL B 1 97  ? 16.552  54.285  -21.308  1.00 40.00 ? 101 VAL B CG2 1 
ATOM 4940  N N   . TRP B 1 98  ? 20.233  51.940  -19.934  1.00 40.00 ? 102 TRP B N   1 
ATOM 4941  C CA  . TRP B 1 98  ? 20.825  50.820  -19.225  1.00 40.00 ? 102 TRP B CA  1 
ATOM 4942  C C   . TRP B 1 98  ? 20.316  51.014  -17.767  1.00 40.00 ? 102 TRP B C   1 
ATOM 4943  O O   . TRP B 1 98  ? 20.299  52.141  -17.290  1.00 40.00 ? 102 TRP B O   1 
ATOM 4944  C CB  . TRP B 1 98  ? 22.276  50.603  -19.264  1.00 40.00 ? 102 TRP B CB  1 
ATOM 4945  C CG  . TRP B 1 98  ? 23.073  50.473  -20.508  1.00 40.00 ? 102 TRP B CG  1 
ATOM 4946  C CD1 . TRP B 1 98  ? 23.864  49.405  -20.877  1.00 40.00 ? 102 TRP B CD1 1 
ATOM 4947  C CD2 . TRP B 1 98  ? 23.253  51.442  -21.547  1.00 40.00 ? 102 TRP B CD2 1 
ATOM 4948  N NE1 . TRP B 1 98  ? 24.512  49.645  -22.076  1.00 40.00 ? 102 TRP B NE1 1 
ATOM 4949  C CE2 . TRP B 1 98  ? 24.149  50.898  -22.494  1.00 40.00 ? 102 TRP B CE2 1 
ATOM 4950  C CE3 . TRP B 1 98  ? 22.740  52.727  -21.756  1.00 40.00 ? 102 TRP B CE3 1 
ATOM 4951  C CZ2 . TRP B 1 98  ? 24.518  51.580  -23.645  1.00 40.00 ? 102 TRP B CZ2 1 
ATOM 4952  C CZ3 . TRP B 1 98  ? 23.115  53.404  -22.902  1.00 40.00 ? 102 TRP B CZ3 1 
ATOM 4953  C CH2 . TRP B 1 98  ? 23.989  52.824  -23.825  1.00 40.00 ? 102 TRP B CH2 1 
ATOM 4954  N N   . THR B 1 99  ? 19.863  49.943  -17.168  1.00 40.00 ? 103 THR B N   1 
ATOM 4955  C CA  . THR B 1 99  ? 19.363  49.902  -15.789  1.00 40.00 ? 103 THR B CA  1 
ATOM 4956  C C   . THR B 1 99  ? 19.981  48.602  -15.243  1.00 40.00 ? 103 THR B C   1 
ATOM 4957  O O   . THR B 1 99  ? 20.138  47.663  -16.040  1.00 40.00 ? 103 THR B O   1 
ATOM 4958  C CB  . THR B 1 99  ? 17.843  49.781  -15.690  1.00 40.00 ? 103 THR B CB  1 
ATOM 4959  O OG1 . THR B 1 99  ? 17.207  51.013  -16.063  1.00 40.00 ? 103 THR B OG1 1 
ATOM 4960  C CG2 . THR B 1 99  ? 17.315  49.439  -14.298  1.00 40.00 ? 103 THR B CG2 1 
ATOM 4961  N N   . PRO B 1 100 ? 20.294  48.588  -13.965  1.00 40.00 ? 104 PRO B N   1 
ATOM 4962  C CA  . PRO B 1 100 ? 20.834  47.389  -13.317  1.00 40.00 ? 104 PRO B CA  1 
ATOM 4963  C C   . PRO B 1 100 ? 19.786  46.278  -13.271  1.00 40.00 ? 104 PRO B C   1 
ATOM 4964  O O   . PRO B 1 100 ? 18.607  46.630  -13.128  1.00 40.00 ? 104 PRO B O   1 
ATOM 4965  C CB  . PRO B 1 100 ? 21.151  47.876  -11.918  1.00 40.00 ? 104 PRO B CB  1 
ATOM 4966  C CG  . PRO B 1 100 ? 20.206  49.013  -11.675  1.00 40.00 ? 104 PRO B CG  1 
ATOM 4967  C CD  . PRO B 1 100 ? 20.103  49.701  -13.013  1.00 40.00 ? 104 PRO B CD  1 
ATOM 4968  N N   . TYR B 1 101 ? 20.170  45.022  -13.422  1.00 40.00 ? 105 TYR B N   1 
ATOM 4969  C CA  . TYR B 1 101 ? 19.249  43.871  -13.385  1.00 40.00 ? 105 TYR B CA  1 
ATOM 4970  C C   . TYR B 1 101 ? 19.374  43.275  -11.980  1.00 40.00 ? 105 TYR B C   1 
ATOM 4971  O O   . TYR B 1 101 ? 20.443  42.778  -11.612  1.00 40.00 ? 105 TYR B O   1 
ATOM 4972  C CB  . TYR B 1 101 ? 19.656  42.811  -14.400  1.00 40.00 ? 105 TYR B CB  1 
ATOM 4973  C CG  . TYR B 1 101 ? 18.678  41.680  -14.591  1.00 40.00 ? 105 TYR B CG  1 
ATOM 4974  C CD1 . TYR B 1 101 ? 17.419  41.939  -15.130  1.00 40.00 ? 105 TYR B CD1 1 
ATOM 4975  C CD2 . TYR B 1 101 ? 18.991  40.366  -14.247  1.00 40.00 ? 105 TYR B CD2 1 
ATOM 4976  C CE1 . TYR B 1 101 ? 16.524  40.907  -15.317  1.00 40.00 ? 105 TYR B CE1 1 
ATOM 4977  C CE2 . TYR B 1 101 ? 18.089  39.332  -14.431  1.00 40.00 ? 105 TYR B CE2 1 
ATOM 4978  C CZ  . TYR B 1 101 ? 16.846  39.616  -14.965  1.00 40.00 ? 105 TYR B CZ  1 
ATOM 4979  O OH  . TYR B 1 101 ? 15.904  38.626  -15.164  1.00 40.00 ? 105 TYR B OH  1 
ATOM 4980  N N   . PRO B 1 102 ? 18.318  43.387  -11.204  1.00 40.00 ? 106 PRO B N   1 
ATOM 4981  C CA  . PRO B 1 102 ? 17.039  43.909  -11.607  1.00 40.00 ? 106 PRO B CA  1 
ATOM 4982  C C   . PRO B 1 102 ? 16.750  45.357  -11.292  1.00 40.00 ? 106 PRO B C   1 
ATOM 4983  O O   . PRO B 1 102 ? 17.490  45.951  -10.498  1.00 40.00 ? 106 PRO B O   1 
ATOM 4984  C CB  . PRO B 1 102 ? 16.102  43.089  -10.678  1.00 40.00 ? 106 PRO B CB  1 
ATOM 4985  C CG  . PRO B 1 102 ? 16.871  43.134  -9.386   1.00 40.00 ? 106 PRO B CG  1 
ATOM 4986  C CD  . PRO B 1 102 ? 18.304  42.889  -9.792   1.00 40.00 ? 106 PRO B CD  1 
ATOM 4987  N N   . ARG B 1 103 ? 15.757  45.910  -11.980  1.00 40.00 ? 107 ARG B N   1 
ATOM 4988  C CA  . ARG B 1 103 ? 15.399  47.312  -11.784  1.00 40.00 ? 107 ARG B CA  1 
ATOM 4989  C C   . ARG B 1 103 ? 15.680  47.728  -10.352  1.00 40.00 ? 107 ARG B C   1 
ATOM 4990  O O   . ARG B 1 103 ? 15.510  46.956  -9.415   1.00 40.00 ? 107 ARG B O   1 
ATOM 4991  C CB  . ARG B 1 103 ? 13.940  47.570  -12.160  1.00 40.00 ? 107 ARG B CB  1 
ATOM 4992  C CG  . ARG B 1 103 ? 13.810  47.830  -13.661  1.00 40.00 ? 107 ARG B CG  1 
ATOM 4993  C CD  . ARG B 1 103 ? 12.681  48.807  -13.956  1.00 40.00 ? 107 ARG B CD  1 
ATOM 4994  N NE  . ARG B 1 103 ? 11.418  48.125  -14.208  1.00 40.00 ? 107 ARG B NE  1 
ATOM 4995  C CZ  . ARG B 1 103 ? 11.258  47.162  -15.108  1.00 40.00 ? 107 ARG B CZ  1 
ATOM 4996  N NH1 . ARG B 1 103 ? 12.277  46.752  -15.866  1.00 40.00 ? 107 ARG B NH1 1 
ATOM 4997  N NH2 . ARG B 1 103 ? 10.073  46.587  -15.264  1.00 40.00 ? 107 ARG B NH2 1 
ATOM 4998  N N   . PRO B 1 104 ? 16.164  48.952  -10.185  1.00 40.00 ? 108 PRO B N   1 
ATOM 4999  C CA  . PRO B 1 104 ? 16.500  49.461  -8.870   1.00 40.00 ? 108 PRO B CA  1 
ATOM 5000  C C   . PRO B 1 104 ? 15.278  49.353  -7.967   1.00 40.00 ? 108 PRO B C   1 
ATOM 5001  O O   . PRO B 1 104 ? 14.188  49.042  -8.430   1.00 40.00 ? 108 PRO B O   1 
ATOM 5002  C CB  . PRO B 1 104 ? 16.873  50.912  -9.076   1.00 40.00 ? 108 PRO B CB  1 
ATOM 5003  C CG  . PRO B 1 104 ? 16.488  51.268  -10.464  1.00 40.00 ? 108 PRO B CG  1 
ATOM 5004  C CD  . PRO B 1 104 ? 16.384  49.976  -11.230  1.00 40.00 ? 108 PRO B CD  1 
ATOM 5005  N N   . ALA B 1 105 ? 15.511  49.656  -6.703   1.00 40.00 ? 109 ALA B N   1 
ATOM 5006  C CA  . ALA B 1 105 ? 14.439  49.569  -5.714   1.00 40.00 ? 109 ALA B CA  1 
ATOM 5007  C C   . ALA B 1 105 ? 13.576  50.826  -5.705   1.00 40.00 ? 109 ALA B C   1 
ATOM 5008  O O   . ALA B 1 105 ? 12.358  50.851  -5.758   1.00 40.00 ? 109 ALA B O   1 
ATOM 5009  C CB  . ALA B 1 105 ? 15.075  49.357  -4.340   1.00 40.00 ? 109 ALA B CB  1 
ATOM 5010  N N   . SER B 1 106 ? 14.310  51.924  -5.614   1.00 40.00 ? 110 SER B N   1 
ATOM 5011  C CA  . SER B 1 106 ? 13.868  53.297  -5.527   1.00 40.00 ? 110 SER B CA  1 
ATOM 5012  C C   . SER B 1 106 ? 14.478  54.149  -6.637   1.00 40.00 ? 110 SER B C   1 
ATOM 5013  O O   . SER B 1 106 ? 15.489  53.762  -7.243   1.00 40.00 ? 110 SER B O   1 
ATOM 5014  C CB  . SER B 1 106 ? 14.357  53.781  -4.145   1.00 40.00 ? 110 SER B CB  1 
ATOM 5015  O OG  . SER B 1 106 ? 14.271  55.175  -4.012   1.00 40.00 ? 110 SER B OG  1 
ATOM 5016  N N   . PRO B 1 107 ? 13.898  55.313  -6.907   1.00 40.00 ? 111 PRO B N   1 
ATOM 5017  C CA  . PRO B 1 107 ? 14.345  56.229  -7.922   1.00 40.00 ? 111 PRO B CA  1 
ATOM 5018  C C   . PRO B 1 107 ? 15.821  56.547  -7.976   1.00 40.00 ? 111 PRO B C   1 
ATOM 5019  O O   . PRO B 1 107 ? 16.237  57.518  -7.324   1.00 40.00 ? 111 PRO B O   1 
ATOM 5020  C CB  . PRO B 1 107 ? 13.572  57.528  -7.584   1.00 40.00 ? 111 PRO B CB  1 
ATOM 5021  C CG  . PRO B 1 107 ? 12.278  57.015  -7.051   1.00 40.00 ? 111 PRO B CG  1 
ATOM 5022  C CD  . PRO B 1 107 ? 12.679  55.826  -6.219   1.00 40.00 ? 111 PRO B CD  1 
ATOM 5023  N N   . THR B 1 108 ? 16.583  55.790  -8.753   1.00 40.00 ? 112 THR B N   1 
ATOM 5024  C CA  . THR B 1 108 ? 18.023  56.033  -8.902   1.00 40.00 ? 112 THR B CA  1 
ATOM 5025  C C   . THR B 1 108 ? 18.225  57.299  -9.722   1.00 40.00 ? 112 THR B C   1 
ATOM 5026  O O   . THR B 1 108 ? 17.365  57.659  -10.524  1.00 40.00 ? 112 THR B O   1 
ATOM 5027  C CB  . THR B 1 108 ? 18.669  54.835  -9.629   1.00 40.00 ? 112 THR B CB  1 
ATOM 5028  O OG1 . THR B 1 108 ? 18.655  53.733  -8.700   1.00 40.00 ? 112 THR B OG1 1 
ATOM 5029  C CG2 . THR B 1 108 ? 20.082  54.995  -10.111  1.00 40.00 ? 112 THR B CG2 1 
ATOM 5030  N N   . PRO B 1 109 ? 19.353  57.957  -9.511   1.00 40.00 ? 113 PRO B N   1 
ATOM 5031  C CA  . PRO B 1 109 ? 19.735  59.131  -10.287  1.00 40.00 ? 113 PRO B CA  1 
ATOM 5032  C C   . PRO B 1 109 ? 20.103  58.720  -11.717  1.00 40.00 ? 113 PRO B C   1 
ATOM 5033  O O   . PRO B 1 109 ? 20.671  57.640  -11.981  1.00 40.00 ? 113 PRO B O   1 
ATOM 5034  C CB  . PRO B 1 109 ? 20.960  59.641  -9.529   1.00 40.00 ? 113 PRO B CB  1 
ATOM 5035  C CG  . PRO B 1 109 ? 21.604  58.389  -9.013   1.00 40.00 ? 113 PRO B CG  1 
ATOM 5036  C CD  . PRO B 1 109 ? 20.421  57.578  -8.540   1.00 40.00 ? 113 PRO B CD  1 
ATOM 5037  N N   . VAL B 1 110 ? 19.773  59.593  -12.677  1.00 40.00 ? 114 VAL B N   1 
ATOM 5038  C CA  . VAL B 1 110 ? 20.084  59.311  -14.069  1.00 40.00 ? 114 VAL B CA  1 
ATOM 5039  C C   . VAL B 1 110 ? 21.191  60.194  -14.649  1.00 40.00 ? 114 VAL B C   1 
ATOM 5040  O O   . VAL B 1 110 ? 21.247  61.412  -14.486  1.00 40.00 ? 114 VAL B O   1 
ATOM 5041  C CB  . VAL B 1 110 ? 18.883  59.484  -15.018  1.00 40.00 ? 114 VAL B CB  1 
ATOM 5042  C CG1 . VAL B 1 110 ? 17.883  58.373  -14.774  1.00 40.00 ? 114 VAL B CG1 1 
ATOM 5043  C CG2 . VAL B 1 110 ? 18.268  60.865  -14.820  1.00 40.00 ? 114 VAL B CG2 1 
ATOM 5044  N N   . LEU B 1 111 ? 22.039  59.507  -15.393  1.00 40.00 ? 115 LEU B N   1 
ATOM 5045  C CA  . LEU B 1 111 ? 23.145  60.067  -16.137  1.00 40.00 ? 115 LEU B CA  1 
ATOM 5046  C C   . LEU B 1 111 ? 22.850  60.033  -17.646  1.00 40.00 ? 115 LEU B C   1 
ATOM 5047  O O   . LEU B 1 111 ? 23.062  58.980  -18.268  1.00 40.00 ? 115 LEU B O   1 
ATOM 5048  C CB  . LEU B 1 111 ? 24.405  59.216  -15.906  1.00 40.00 ? 115 LEU B CB  1 
ATOM 5049  C CG  . LEU B 1 111 ? 25.513  59.833  -15.063  1.00 40.00 ? 115 LEU B CG  1 
ATOM 5050  C CD1 . LEU B 1 111 ? 24.923  60.679  -13.945  1.00 40.00 ? 115 LEU B CD1 1 
ATOM 5051  C CD2 . LEU B 1 111 ? 26.446  58.751  -14.533  1.00 40.00 ? 115 LEU B CD2 1 
ATOM 5052  N N   . ILE B 1 112 ? 22.376  61.115  -18.228  1.00 40.00 ? 116 ILE B N   1 
ATOM 5053  C CA  . ILE B 1 112 ? 22.092  61.242  -19.665  1.00 40.00 ? 116 ILE B CA  1 
ATOM 5054  C C   . ILE B 1 112 ? 23.377  61.635  -20.397  1.00 40.00 ? 116 ILE B C   1 
ATOM 5055  O O   . ILE B 1 112 ? 23.889  62.740  -20.127  1.00 40.00 ? 116 ILE B O   1 
ATOM 5056  C CB  . ILE B 1 112 ? 21.060  62.370  -19.826  1.00 40.00 ? 116 ILE B CB  1 
ATOM 5057  C CG1 . ILE B 1 112 ? 19.644  61.825  -19.591  1.00 40.00 ? 116 ILE B CG1 1 
ATOM 5058  C CG2 . ILE B 1 112 ? 21.069  63.078  -21.147  1.00 40.00 ? 116 ILE B CG2 1 
ATOM 5059  C CD1 . ILE B 1 112 ? 18.645  62.918  -19.195  1.00 40.00 ? 116 ILE B CD1 1 
ATOM 5060  N N   . TRP B 1 113 ? 23.909  60.805  -21.280  1.00 40.00 ? 117 TRP B N   1 
ATOM 5061  C CA  . TRP B 1 113 ? 25.154  61.138  -21.971  1.00 40.00 ? 117 TRP B CA  1 
ATOM 5062  C C   . TRP B 1 113 ? 24.971  61.762  -23.338  1.00 40.00 ? 117 TRP B C   1 
ATOM 5063  O O   . TRP B 1 113 ? 24.158  61.318  -24.154  1.00 40.00 ? 117 TRP B O   1 
ATOM 5064  C CB  . TRP B 1 113 ? 26.005  59.881  -22.117  1.00 40.00 ? 117 TRP B CB  1 
ATOM 5065  C CG  . TRP B 1 113 ? 27.068  59.931  -23.158  1.00 40.00 ? 117 TRP B CG  1 
ATOM 5066  C CD1 . TRP B 1 113 ? 27.020  59.483  -24.438  1.00 40.00 ? 117 TRP B CD1 1 
ATOM 5067  C CD2 . TRP B 1 113 ? 28.383  60.475  -22.983  1.00 40.00 ? 117 TRP B CD2 1 
ATOM 5068  N NE1 . TRP B 1 113 ? 28.232  59.700  -25.071  1.00 40.00 ? 117 TRP B NE1 1 
ATOM 5069  C CE2 . TRP B 1 113 ? 29.081  60.309  -24.202  1.00 40.00 ? 117 TRP B CE2 1 
ATOM 5070  C CE3 . TRP B 1 113 ? 29.041  61.074  -21.900  1.00 40.00 ? 117 TRP B CE3 1 
ATOM 5071  C CZ2 . TRP B 1 113 ? 30.395  60.726  -24.365  1.00 40.00 ? 117 TRP B CZ2 1 
ATOM 5072  C CZ3 . TRP B 1 113 ? 30.331  61.490  -22.069  1.00 40.00 ? 117 TRP B CZ3 1 
ATOM 5073  C CH2 . TRP B 1 113 ? 31.005  61.314  -23.281  1.00 40.00 ? 117 TRP B CH2 1 
ATOM 5074  N N   . ILE B 1 114 ? 25.789  62.790  -23.638  1.00 40.00 ? 118 ILE B N   1 
ATOM 5075  C CA  . ILE B 1 114 ? 25.681  63.414  -24.965  1.00 40.00 ? 118 ILE B CA  1 
ATOM 5076  C C   . ILE B 1 114 ? 26.967  63.258  -25.744  1.00 40.00 ? 118 ILE B C   1 
ATOM 5077  O O   . ILE B 1 114 ? 27.919  63.934  -25.424  1.00 40.00 ? 118 ILE B O   1 
ATOM 5078  C CB  . ILE B 1 114 ? 25.279  64.881  -24.866  1.00 40.00 ? 118 ILE B CB  1 
ATOM 5079  C CG1 . ILE B 1 114 ? 23.985  65.034  -24.060  1.00 40.00 ? 118 ILE B CG1 1 
ATOM 5080  C CG2 . ILE B 1 114 ? 25.064  65.374  -26.281  1.00 40.00 ? 118 ILE B CG2 1 
ATOM 5081  C CD1 . ILE B 1 114 ? 23.386  66.437  -24.058  1.00 40.00 ? 118 ILE B CD1 1 
ATOM 5082  N N   . TYR B 1 115 ? 27.041  62.390  -26.739  1.00 40.00 ? 119 TYR B N   1 
ATOM 5083  C CA  . TYR B 1 115 ? 28.259  62.176  -27.506  1.00 40.00 ? 119 TYR B CA  1 
ATOM 5084  C C   . TYR B 1 115 ? 28.741  63.451  -28.215  1.00 40.00 ? 119 TYR B C   1 
ATOM 5085  O O   . TYR B 1 115 ? 27.936  64.359  -28.490  1.00 40.00 ? 119 TYR B O   1 
ATOM 5086  C CB  . TYR B 1 115 ? 28.091  61.071  -28.538  1.00 40.00 ? 119 TYR B CB  1 
ATOM 5087  C CG  . TYR B 1 115 ? 27.112  61.290  -29.670  1.00 40.00 ? 119 TYR B CG  1 
ATOM 5088  C CD1 . TYR B 1 115 ? 27.335  62.160  -30.727  1.00 40.00 ? 119 TYR B CD1 1 
ATOM 5089  C CD2 . TYR B 1 115 ? 25.921  60.568  -29.699  1.00 40.00 ? 119 TYR B CD2 1 
ATOM 5090  C CE1 . TYR B 1 115 ? 26.423  62.310  -31.742  1.00 40.00 ? 119 TYR B CE1 1 
ATOM 5091  C CE2 . TYR B 1 115 ? 24.991  60.706  -30.703  1.00 40.00 ? 119 TYR B CE2 1 
ATOM 5092  C CZ  . TYR B 1 115 ? 25.243  61.591  -31.736  1.00 40.00 ? 119 TYR B CZ  1 
ATOM 5093  O OH  . TYR B 1 115 ? 24.307  61.750  -32.745  1.00 40.00 ? 119 TYR B OH  1 
ATOM 5094  N N   . GLY B 1 116 ? 30.042  63.485  -28.541  1.00 40.00 ? 120 GLY B N   1 
ATOM 5095  C CA  . GLY B 1 116 ? 30.546  64.657  -29.243  1.00 40.00 ? 120 GLY B CA  1 
ATOM 5096  C C   . GLY B 1 116 ? 31.396  64.278  -30.453  1.00 40.00 ? 120 GLY B C   1 
ATOM 5097  O O   . GLY B 1 116 ? 32.125  63.282  -30.461  1.00 40.00 ? 120 GLY B O   1 
ATOM 5098  N N   . GLY B 1 117 ? 31.363  65.104  -31.510  1.00 40.00 ? 121 GLY B N   1 
ATOM 5099  C CA  . GLY B 1 117 ? 32.190  64.832  -32.694  1.00 40.00 ? 121 GLY B CA  1 
ATOM 5100  C C   . GLY B 1 117 ? 32.159  66.048  -33.612  1.00 40.00 ? 121 GLY B C   1 
ATOM 5101  O O   . GLY B 1 117 ? 31.746  65.998  -34.786  1.00 40.00 ? 121 GLY B O   1 
ATOM 5102  N N   . GLY B 1 118 ? 32.520  67.200  -33.041  1.00 40.00 ? 122 GLY B N   1 
ATOM 5103  C CA  . GLY B 1 118 ? 32.541  68.449  -33.791  1.00 40.00 ? 122 GLY B CA  1 
ATOM 5104  C C   . GLY B 1 118 ? 31.177  68.918  -34.208  1.00 40.00 ? 122 GLY B C   1 
ATOM 5105  O O   . GLY B 1 118 ? 31.074  69.814  -35.062  1.00 40.00 ? 122 GLY B O   1 
ATOM 5106  N N   . PHE B 1 119 ? 30.099  68.329  -33.737  1.00 40.00 ? 123 PHE B N   1 
ATOM 5107  C CA  . PHE B 1 119 ? 28.753  68.641  -34.181  1.00 40.00 ? 123 PHE B CA  1 
ATOM 5108  C C   . PHE B 1 119 ? 28.526  68.070  -35.586  1.00 40.00 ? 123 PHE B C   1 
ATOM 5109  O O   . PHE B 1 119 ? 27.479  68.318  -36.174  1.00 40.00 ? 123 PHE B O   1 
ATOM 5110  C CB  . PHE B 1 119 ? 28.505  70.163  -34.228  1.00 40.00 ? 123 PHE B CB  1 
ATOM 5111  C CG  . PHE B 1 119 ? 28.212  70.724  -32.881  1.00 40.00 ? 123 PHE B CG  1 
ATOM 5112  C CD1 . PHE B 1 119 ? 27.158  70.242  -32.125  1.00 40.00 ? 123 PHE B CD1 1 
ATOM 5113  C CD2 . PHE B 1 119 ? 29.010  71.722  -32.344  1.00 40.00 ? 123 PHE B CD2 1 
ATOM 5114  C CE1 . PHE B 1 119 ? 26.890  70.736  -30.865  1.00 40.00 ? 123 PHE B CE1 1 
ATOM 5115  C CE2 . PHE B 1 119 ? 28.744  72.230  -31.078  1.00 40.00 ? 123 PHE B CE2 1 
ATOM 5116  C CZ  . PHE B 1 119 ? 27.681  71.727  -30.343  1.00 40.00 ? 123 PHE B CZ  1 
ATOM 5117  N N   . TYR B 1 120 ? 29.480  67.350  -36.139  1.00 40.00 ? 124 TYR B N   1 
ATOM 5118  C CA  . TYR B 1 120 ? 29.428  66.827  -37.483  1.00 40.00 ? 124 TYR B CA  1 
ATOM 5119  C C   . TYR B 1 120 ? 29.485  65.309  -37.490  1.00 40.00 ? 124 TYR B C   1 
ATOM 5120  O O   . TYR B 1 120 ? 29.369  64.743  -38.576  1.00 40.00 ? 124 TYR B O   1 
ATOM 5121  C CB  . TYR B 1 120 ? 30.587  67.329  -38.387  1.00 40.00 ? 124 TYR B CB  1 
ATOM 5122  C CG  . TYR B 1 120 ? 31.908  66.647  -38.116  1.00 40.00 ? 124 TYR B CG  1 
ATOM 5123  C CD1 . TYR B 1 120 ? 32.211  65.420  -38.649  1.00 40.00 ? 124 TYR B CD1 1 
ATOM 5124  C CD2 . TYR B 1 120 ? 32.894  67.245  -37.308  1.00 40.00 ? 124 TYR B CD2 1 
ATOM 5125  C CE1 . TYR B 1 120 ? 33.410  64.790  -38.398  1.00 40.00 ? 124 TYR B CE1 1 
ATOM 5126  C CE2 . TYR B 1 120 ? 34.113  66.639  -37.037  1.00 40.00 ? 124 TYR B CE2 1 
ATOM 5127  C CZ  . TYR B 1 120 ? 34.366  65.398  -37.592  1.00 40.00 ? 124 TYR B CZ  1 
ATOM 5128  O OH  . TYR B 1 120 ? 35.556  64.763  -37.324  1.00 40.00 ? 124 TYR B OH  1 
ATOM 5129  N N   . SER B 1 121 ? 29.723  64.684  -36.344  1.00 40.00 ? 125 SER B N   1 
ATOM 5130  C CA  . SER B 1 121 ? 29.841  63.212  -36.365  1.00 40.00 ? 125 SER B CA  1 
ATOM 5131  C C   . SER B 1 121 ? 29.476  62.656  -35.014  1.00 40.00 ? 125 SER B C   1 
ATOM 5132  O O   . SER B 1 121 ? 29.108  63.471  -34.181  1.00 40.00 ? 125 SER B O   1 
ATOM 5133  C CB  . SER B 1 121 ? 31.299  62.855  -36.665  1.00 40.00 ? 125 SER B CB  1 
ATOM 5134  O OG  . SER B 1 121 ? 32.057  62.906  -35.468  1.00 40.00 ? 125 SER B OG  1 
ATOM 5135  N N   . GLY B 1 122 ? 29.556  61.351  -34.794  1.00 40.00 ? 126 GLY B N   1 
ATOM 5136  C CA  . GLY B 1 122 ? 29.216  60.803  -33.479  1.00 40.00 ? 126 GLY B CA  1 
ATOM 5137  C C   . GLY B 1 122 ? 28.017  59.904  -33.343  1.00 40.00 ? 126 GLY B C   1 
ATOM 5138  O O   . GLY B 1 122 ? 26.999  60.040  -34.036  1.00 40.00 ? 126 GLY B O   1 
ATOM 5139  N N   . ALA B 1 123 ? 28.030  59.043  -32.311  1.00 40.00 ? 127 ALA B N   1 
ATOM 5140  C CA  . ALA B 1 123 ? 26.945  58.123  -32.055  1.00 40.00 ? 127 ALA B CA  1 
ATOM 5141  C C   . ALA B 1 123 ? 26.967  57.426  -30.701  1.00 40.00 ? 127 ALA B C   1 
ATOM 5142  O O   . ALA B 1 123 ? 28.001  56.879  -30.289  1.00 40.00 ? 127 ALA B O   1 
ATOM 5143  C CB  . ALA B 1 123 ? 27.044  56.983  -33.098  1.00 40.00 ? 127 ALA B CB  1 
ATOM 5144  N N   . ALA B 1 124 ? 25.785  57.382  -30.087  1.00 40.00 ? 128 ALA B N   1 
ATOM 5145  C CA  . ALA B 1 124 ? 25.654  56.664  -28.819  1.00 40.00 ? 128 ALA B CA  1 
ATOM 5146  C C   . ALA B 1 124 ? 26.005  55.206  -29.001  1.00 40.00 ? 128 ALA B C   1 
ATOM 5147  O O   . ALA B 1 124 ? 26.621  54.549  -28.139  1.00 40.00 ? 128 ALA B O   1 
ATOM 5148  C CB  . ALA B 1 124 ? 24.263  56.920  -28.258  1.00 40.00 ? 128 ALA B CB  1 
ATOM 5149  N N   . SER B 1 125 ? 25.765  54.579  -30.127  1.00 40.00 ? 129 SER B N   1 
ATOM 5150  C CA  . SER B 1 125 ? 26.104  53.223  -30.497  1.00 40.00 ? 129 SER B CA  1 
ATOM 5151  C C   . SER B 1 125 ? 27.573  52.862  -30.237  1.00 40.00 ? 129 SER B C   1 
ATOM 5152  O O   . SER B 1 125 ? 27.972  51.687  -30.251  1.00 40.00 ? 129 SER B O   1 
ATOM 5153  C CB  . SER B 1 125 ? 25.896  53.042  -32.032  1.00 40.00 ? 129 SER B CB  1 
ATOM 5154  O OG  . SER B 1 125 ? 24.920  53.924  -32.572  1.00 40.00 ? 129 SER B OG  1 
ATOM 5155  N N   . LEU B 1 126 ? 28.440  53.843  -30.053  1.00 40.00 ? 130 LEU B N   1 
ATOM 5156  C CA  . LEU B 1 126 ? 29.850  53.580  -29.870  1.00 40.00 ? 130 LEU B CA  1 
ATOM 5157  C C   . LEU B 1 126 ? 30.235  52.757  -28.668  1.00 40.00 ? 130 LEU B C   1 
ATOM 5158  O O   . LEU B 1 126 ? 29.579  52.794  -27.622  1.00 40.00 ? 130 LEU B O   1 
ATOM 5159  C CB  . LEU B 1 126 ? 30.627  54.909  -29.880  1.00 40.00 ? 130 LEU B CB  1 
ATOM 5160  C CG  . LEU B 1 126 ? 30.672  55.542  -31.285  1.00 40.00 ? 130 LEU B CG  1 
ATOM 5161  C CD1 . LEU B 1 126 ? 31.636  56.701  -31.300  1.00 40.00 ? 130 LEU B CD1 1 
ATOM 5162  C CD2 . LEU B 1 126 ? 31.112  54.507  -32.320  1.00 40.00 ? 130 LEU B CD2 1 
ATOM 5163  N N   . ASP B 1 127 ? 31.338  52.028  -28.819  1.00 40.00 ? 131 ASP B N   1 
ATOM 5164  C CA  . ASP B 1 127 ? 31.837  51.159  -27.765  1.00 40.00 ? 131 ASP B CA  1 
ATOM 5165  C C   . ASP B 1 127 ? 32.207  51.863  -26.487  1.00 40.00 ? 131 ASP B C   1 
ATOM 5166  O O   . ASP B 1 127 ? 31.703  51.510  -25.407  1.00 40.00 ? 131 ASP B O   1 
ATOM 5167  C CB  . ASP B 1 127 ? 33.041  50.344  -28.256  1.00 40.00 ? 131 ASP B CB  1 
ATOM 5168  C CG  . ASP B 1 127 ? 32.631  49.149  -29.103  1.00 40.00 ? 131 ASP B CG  1 
ATOM 5169  O OD1 . ASP B 1 127 ? 31.422  49.053  -29.447  1.00 40.00 ? 131 ASP B OD1 1 
ATOM 5170  O OD2 . ASP B 1 127 ? 33.515  48.323  -29.410  1.00 40.00 ? 131 ASP B OD2 1 
ATOM 5171  N N   . VAL B 1 128 ? 33.041  52.899  -26.553  1.00 40.00 ? 132 VAL B N   1 
ATOM 5172  C CA  . VAL B 1 128 ? 33.397  53.646  -25.353  1.00 40.00 ? 132 VAL B CA  1 
ATOM 5173  C C   . VAL B 1 128 ? 32.191  54.311  -24.708  1.00 40.00 ? 132 VAL B C   1 
ATOM 5174  O O   . VAL B 1 128 ? 32.395  54.906  -23.630  1.00 40.00 ? 132 VAL B O   1 
ATOM 5175  C CB  . VAL B 1 128 ? 34.471  54.711  -25.569  1.00 40.00 ? 132 VAL B CB  1 
ATOM 5176  C CG1 . VAL B 1 128 ? 35.697  54.117  -26.247  1.00 40.00 ? 132 VAL B CG1 1 
ATOM 5177  C CG2 . VAL B 1 128 ? 33.911  55.851  -26.395  1.00 40.00 ? 132 VAL B CG2 1 
ATOM 5178  N N   . TYR B 1 129 ? 30.975  54.311  -25.260  1.00 40.00 ? 133 TYR B N   1 
ATOM 5179  C CA  . TYR B 1 129 ? 29.899  54.973  -24.515  1.00 40.00 ? 133 TYR B CA  1 
ATOM 5180  C C   . TYR B 1 129 ? 28.952  53.902  -23.963  1.00 40.00 ? 133 TYR B C   1 
ATOM 5181  O O   . TYR B 1 129 ? 27.749  54.121  -23.776  1.00 40.00 ? 133 TYR B O   1 
ATOM 5182  C CB  . TYR B 1 129 ? 29.159  56.071  -25.228  1.00 40.00 ? 133 TYR B CB  1 
ATOM 5183  C CG  . TYR B 1 129 ? 29.891  57.096  -26.052  1.00 40.00 ? 133 TYR B CG  1 
ATOM 5184  C CD1 . TYR B 1 129 ? 31.180  57.490  -25.721  1.00 40.00 ? 133 TYR B CD1 1 
ATOM 5185  C CD2 . TYR B 1 129 ? 29.329  57.704  -27.169  1.00 40.00 ? 133 TYR B CD2 1 
ATOM 5186  C CE1 . TYR B 1 129 ? 31.895  58.402  -26.445  1.00 40.00 ? 133 TYR B CE1 1 
ATOM 5187  C CE2 . TYR B 1 129 ? 30.037  58.629  -27.918  1.00 40.00 ? 133 TYR B CE2 1 
ATOM 5188  C CZ  . TYR B 1 129 ? 31.320  58.980  -27.556  1.00 40.00 ? 133 TYR B CZ  1 
ATOM 5189  O OH  . TYR B 1 129 ? 32.033  59.902  -28.280  1.00 40.00 ? 133 TYR B OH  1 
ATOM 5190  N N   . ASP B 1 130 ? 29.521  52.726  -23.714  1.00 40.00 ? 134 ASP B N   1 
ATOM 5191  C CA  . ASP B 1 130 ? 28.782  51.590  -23.174  1.00 40.00 ? 134 ASP B CA  1 
ATOM 5192  C C   . ASP B 1 130 ? 28.371  51.850  -21.737  1.00 40.00 ? 134 ASP B C   1 
ATOM 5193  O O   . ASP B 1 130 ? 29.186  51.622  -20.829  1.00 40.00 ? 134 ASP B O   1 
ATOM 5194  C CB  . ASP B 1 130 ? 29.686  50.352  -23.229  1.00 40.00 ? 134 ASP B CB  1 
ATOM 5195  C CG  . ASP B 1 130 ? 28.953  49.054  -22.966  1.00 40.00 ? 134 ASP B CG  1 
ATOM 5196  O OD1 . ASP B 1 130 ? 29.542  47.998  -23.330  1.00 40.00 ? 134 ASP B OD1 1 
ATOM 5197  O OD2 . ASP B 1 130 ? 27.826  49.093  -22.423  1.00 40.00 ? 134 ASP B OD2 1 
ATOM 5198  N N   . GLY B 1 131 ? 27.127  52.270  -21.517  1.00 40.00 ? 135 GLY B N   1 
ATOM 5199  C CA  . GLY B 1 131 ? 26.652  52.545  -20.180  1.00 40.00 ? 135 GLY B CA  1 
ATOM 5200  C C   . GLY B 1 131 ? 26.430  51.351  -19.280  1.00 40.00 ? 135 GLY B C   1 
ATOM 5201  O O   . GLY B 1 131 ? 25.831  51.527  -18.199  1.00 40.00 ? 135 GLY B O   1 
ATOM 5202  N N   . ARG B 1 132 ? 26.839  50.132  -19.611  1.00 40.00 ? 136 ARG B N   1 
ATOM 5203  C CA  . ARG B 1 132 ? 26.585  48.979  -18.763  1.00 40.00 ? 136 ARG B CA  1 
ATOM 5204  C C   . ARG B 1 132 ? 27.338  49.014  -17.445  1.00 40.00 ? 136 ARG B C   1 
ATOM 5205  O O   . ARG B 1 132 ? 26.713  48.822  -16.370  1.00 40.00 ? 136 ARG B O   1 
ATOM 5206  C CB  . ARG B 1 132 ? 26.750  47.694  -19.544  1.00 40.00 ? 136 ARG B CB  1 
ATOM 5207  C CG  . ARG B 1 132 ? 27.969  46.856  -19.269  1.00 40.00 ? 136 ARG B CG  1 
ATOM 5208  C CD  . ARG B 1 132 ? 28.909  46.727  -20.417  1.00 40.00 ? 136 ARG B CD  1 
ATOM 5209  N NE  . ARG B 1 132 ? 29.138  45.453  -21.045  1.00 40.00 ? 136 ARG B NE  1 
ATOM 5210  C CZ  . ARG B 1 132 ? 28.440  44.856  -21.996  1.00 40.00 ? 136 ARG B CZ  1 
ATOM 5211  N NH1 . ARG B 1 132 ? 27.342  45.413  -22.488  1.00 40.00 ? 136 ARG B NH1 1 
ATOM 5212  N NH2 . ARG B 1 132 ? 28.826  43.676  -22.486  1.00 40.00 ? 136 ARG B NH2 1 
ATOM 5213  N N   . PHE B 1 133 ? 28.635  49.281  -17.442  1.00 40.00 ? 137 PHE B N   1 
ATOM 5214  C CA  . PHE B 1 133 ? 29.409  49.348  -16.200  1.00 40.00 ? 137 PHE B CA  1 
ATOM 5215  C C   . PHE B 1 133 ? 28.860  50.365  -15.219  1.00 40.00 ? 137 PHE B C   1 
ATOM 5216  O O   . PHE B 1 133 ? 28.514  50.036  -14.079  1.00 40.00 ? 137 PHE B O   1 
ATOM 5217  C CB  . PHE B 1 133 ? 30.890  49.622  -16.511  1.00 40.00 ? 137 PHE B CB  1 
ATOM 5218  C CG  . PHE B 1 133 ? 31.394  48.761  -17.639  1.00 40.00 ? 137 PHE B CG  1 
ATOM 5219  C CD1 . PHE B 1 133 ? 31.467  49.262  -18.930  1.00 40.00 ? 137 PHE B CD1 1 
ATOM 5220  C CD2 . PHE B 1 133 ? 31.761  47.442  -17.417  1.00 40.00 ? 137 PHE B CD2 1 
ATOM 5221  C CE1 . PHE B 1 133 ? 31.922  48.451  -19.964  1.00 40.00 ? 137 PHE B CE1 1 
ATOM 5222  C CE2 . PHE B 1 133 ? 32.216  46.631  -18.447  1.00 40.00 ? 137 PHE B CE2 1 
ATOM 5223  C CZ  . PHE B 1 133 ? 32.307  47.139  -19.729  1.00 40.00 ? 137 PHE B CZ  1 
ATOM 5224  N N   . LEU B 1 134 ? 28.665  51.628  -15.607  1.00 40.00 ? 138 LEU B N   1 
ATOM 5225  C CA  . LEU B 1 134 ? 28.108  52.627  -14.700  1.00 40.00 ? 138 LEU B CA  1 
ATOM 5226  C C   . LEU B 1 134 ? 26.736  52.255  -14.174  1.00 40.00 ? 138 LEU B C   1 
ATOM 5227  O O   . LEU B 1 134 ? 26.302  52.807  -13.136  1.00 40.00 ? 138 LEU B O   1 
ATOM 5228  C CB  . LEU B 1 134 ? 28.064  54.013  -15.359  1.00 40.00 ? 138 LEU B CB  1 
ATOM 5229  C CG  . LEU B 1 134 ? 29.444  54.642  -15.591  1.00 40.00 ? 138 LEU B CG  1 
ATOM 5230  C CD1 . LEU B 1 134 ? 29.594  55.206  -16.986  1.00 40.00 ? 138 LEU B CD1 1 
ATOM 5231  C CD2 . LEU B 1 134 ? 29.710  55.702  -14.530  1.00 40.00 ? 138 LEU B CD2 1 
ATOM 5232  N N   . ALA B 1 135 ? 25.994  51.364  -14.841  1.00 40.00 ? 139 ALA B N   1 
ATOM 5233  C CA  . ALA B 1 135 ? 24.691  51.001  -14.277  1.00 40.00 ? 139 ALA B CA  1 
ATOM 5234  C C   . ALA B 1 135 ? 24.953  49.792  -13.363  1.00 40.00 ? 139 ALA B C   1 
ATOM 5235  O O   . ALA B 1 135 ? 24.530  49.708  -12.225  1.00 40.00 ? 139 ALA B O   1 
ATOM 5236  C CB  . ALA B 1 135 ? 23.708  50.620  -15.350  1.00 40.00 ? 139 ALA B CB  1 
ATOM 5237  N N   . GLN B 1 136 ? 25.706  48.858  -13.977  1.00 40.00 ? 140 GLN B N   1 
ATOM 5238  C CA  . GLN B 1 136 ? 25.991  47.623  -13.257  1.00 40.00 ? 140 GLN B CA  1 
ATOM 5239  C C   . GLN B 1 136 ? 26.600  47.924  -11.895  1.00 40.00 ? 140 GLN B C   1 
ATOM 5240  O O   . GLN B 1 136 ? 26.028  47.649  -10.851  1.00 40.00 ? 140 GLN B O   1 
ATOM 5241  C CB  . GLN B 1 136 ? 26.911  46.715  -14.071  1.00 40.00 ? 140 GLN B CB  1 
ATOM 5242  C CG  . GLN B 1 136 ? 26.934  45.281  -13.530  1.00 40.00 ? 140 GLN B CG  1 
ATOM 5243  C CD  . GLN B 1 136 ? 27.854  45.225  -12.312  1.00 40.00 ? 140 GLN B CD  1 
ATOM 5244  O OE1 . GLN B 1 136 ? 29.065  45.396  -12.469  1.00 40.00 ? 140 GLN B OE1 1 
ATOM 5245  N NE2 . GLN B 1 136 ? 27.245  44.988  -11.158  1.00 40.00 ? 140 GLN B NE2 1 
ATOM 5246  N N   . VAL B 1 137 ? 27.808  48.453  -11.952  1.00 40.00 ? 141 VAL B N   1 
ATOM 5247  C CA  . VAL B 1 137 ? 28.607  48.794  -10.811  1.00 40.00 ? 141 VAL B CA  1 
ATOM 5248  C C   . VAL B 1 137 ? 28.046  49.919  -9.972   1.00 40.00 ? 141 VAL B C   1 
ATOM 5249  O O   . VAL B 1 137 ? 27.793  49.714  -8.776   1.00 40.00 ? 141 VAL B O   1 
ATOM 5250  C CB  . VAL B 1 137 ? 30.045  49.232  -11.204  1.00 40.00 ? 141 VAL B CB  1 
ATOM 5251  C CG1 . VAL B 1 137 ? 30.765  49.807  -9.997   1.00 40.00 ? 141 VAL B CG1 1 
ATOM 5252  C CG2 . VAL B 1 137 ? 30.810  48.099  -11.847  1.00 40.00 ? 141 VAL B CG2 1 
ATOM 5253  N N   . GLU B 1 138 ? 27.877  51.130  -10.492  1.00 40.00 ? 142 GLU B N   1 
ATOM 5254  C CA  . GLU B 1 138 ? 27.391  52.194  -9.595   1.00 40.00 ? 142 GLU B CA  1 
ATOM 5255  C C   . GLU B 1 138 ? 25.886  52.256  -9.470   1.00 40.00 ? 142 GLU B C   1 
ATOM 5256  O O   . GLU B 1 138 ? 25.331  53.188  -8.867   1.00 40.00 ? 142 GLU B O   1 
ATOM 5257  C CB  . GLU B 1 138 ? 28.037  53.513  -9.972   1.00 40.00 ? 142 GLU B CB  1 
ATOM 5258  C CG  . GLU B 1 138 ? 29.563  53.484  -9.937   1.00 40.00 ? 142 GLU B CG  1 
ATOM 5259  C CD  . GLU B 1 138 ? 30.074  53.440  -8.501   1.00 40.00 ? 142 GLU B CD  1 
ATOM 5260  O OE1 . GLU B 1 138 ? 29.414  54.034  -7.616   1.00 40.00 ? 142 GLU B OE1 1 
ATOM 5261  O OE2 . GLU B 1 138 ? 31.136  52.807  -8.317   1.00 40.00 ? 142 GLU B OE2 1 
ATOM 5262  N N   . GLY B 1 139 ? 25.191  51.266  -10.021  1.00 40.00 ? 143 GLY B N   1 
ATOM 5263  C CA  . GLY B 1 139 ? 23.752  51.135  -9.962   1.00 40.00 ? 143 GLY B CA  1 
ATOM 5264  C C   . GLY B 1 139 ? 23.012  52.355  -10.468  1.00 40.00 ? 143 GLY B C   1 
ATOM 5265  O O   . GLY B 1 139 ? 22.030  52.804  -9.872   1.00 40.00 ? 143 GLY B O   1 
ATOM 5266  N N   . ALA B 1 140 ? 23.508  52.898  -11.595  1.00 40.00 ? 144 ALA B N   1 
ATOM 5267  C CA  . ALA B 1 140 ? 22.914  54.114  -12.127  1.00 40.00 ? 144 ALA B CA  1 
ATOM 5268  C C   . ALA B 1 140 ? 22.048  53.848  -13.342  1.00 40.00 ? 144 ALA B C   1 
ATOM 5269  O O   . ALA B 1 140 ? 22.413  52.953  -14.099  1.00 40.00 ? 144 ALA B O   1 
ATOM 5270  C CB  . ALA B 1 140 ? 24.029  55.068  -12.582  1.00 40.00 ? 144 ALA B CB  1 
ATOM 5271  N N   . VAL B 1 141 ? 20.992  54.647  -13.485  1.00 40.00 ? 145 VAL B N   1 
ATOM 5272  C CA  . VAL B 1 141 ? 20.201  54.527  -14.708  1.00 40.00 ? 145 VAL B CA  1 
ATOM 5273  C C   . VAL B 1 141 ? 20.845  55.504  -15.735  1.00 40.00 ? 145 VAL B C   1 
ATOM 5274  O O   . VAL B 1 141 ? 20.737  56.726  -15.571  1.00 40.00 ? 145 VAL B O   1 
ATOM 5275  C CB  . VAL B 1 141 ? 18.744  54.938  -14.582  1.00 40.00 ? 145 VAL B CB  1 
ATOM 5276  C CG1 . VAL B 1 141 ? 18.029  54.854  -15.933  1.00 40.00 ? 145 VAL B CG1 1 
ATOM 5277  C CG2 . VAL B 1 141 ? 18.002  54.094  -13.554  1.00 40.00 ? 145 VAL B CG2 1 
ATOM 5278  N N   . LEU B 1 142 ? 21.475  54.942  -16.739  1.00 40.00 ? 146 LEU B N   1 
ATOM 5279  C CA  . LEU B 1 142 ? 22.157  55.678  -17.785  1.00 40.00 ? 146 LEU B CA  1 
ATOM 5280  C C   . LEU B 1 142 ? 21.415  55.746  -19.106  1.00 40.00 ? 146 LEU B C   1 
ATOM 5281  O O   . LEU B 1 142 ? 20.842  54.778  -19.636  1.00 40.00 ? 146 LEU B O   1 
ATOM 5282  C CB  . LEU B 1 142 ? 23.517  54.944  -17.970  1.00 40.00 ? 146 LEU B CB  1 
ATOM 5283  C CG  . LEU B 1 142 ? 24.546  55.749  -18.757  1.00 40.00 ? 146 LEU B CG  1 
ATOM 5284  C CD1 . LEU B 1 142 ? 25.957  55.336  -18.396  1.00 40.00 ? 146 LEU B CD1 1 
ATOM 5285  C CD2 . LEU B 1 142 ? 24.269  55.610  -20.254  1.00 40.00 ? 146 LEU B CD2 1 
ATOM 5286  N N   . VAL B 1 143 ? 21.395  56.921  -19.748  1.00 40.00 ? 147 VAL B N   1 
ATOM 5287  C CA  . VAL B 1 143 ? 20.704  57.086  -21.023  1.00 40.00 ? 147 VAL B CA  1 
ATOM 5288  C C   . VAL B 1 143 ? 21.605  57.763  -22.047  1.00 40.00 ? 147 VAL B C   1 
ATOM 5289  O O   . VAL B 1 143 ? 22.221  58.788  -21.697  1.00 40.00 ? 147 VAL B O   1 
ATOM 5290  C CB  . VAL B 1 143 ? 19.468  58.004  -20.853  1.00 40.00 ? 147 VAL B CB  1 
ATOM 5291  C CG1 . VAL B 1 143 ? 18.757  58.174  -22.185  1.00 40.00 ? 147 VAL B CG1 1 
ATOM 5292  C CG2 . VAL B 1 143 ? 18.496  57.510  -19.787  1.00 40.00 ? 147 VAL B CG2 1 
ATOM 5293  N N   . SER B 1 144 ? 21.662  57.263  -23.277  1.00 40.00 ? 148 SER B N   1 
ATOM 5294  C CA  . SER B 1 144 ? 22.492  57.930  -24.305  1.00 40.00 ? 148 SER B CA  1 
ATOM 5295  C C   . SER B 1 144 ? 21.668  58.027  -25.583  1.00 40.00 ? 148 SER B C   1 
ATOM 5296  O O   . SER B 1 144 ? 21.282  56.968  -26.112  1.00 40.00 ? 148 SER B O   1 
ATOM 5297  C CB  . SER B 1 144 ? 23.823  57.239  -24.472  1.00 40.00 ? 148 SER B CB  1 
ATOM 5298  O OG  . SER B 1 144 ? 23.815  56.055  -25.227  1.00 40.00 ? 148 SER B OG  1 
ATOM 5299  N N   . MET B 1 145 ? 21.363  59.239  -26.070  1.00 40.00 ? 149 MET B N   1 
ATOM 5300  C CA  . MET B 1 145 ? 20.599  59.399  -27.301  1.00 40.00 ? 149 MET B CA  1 
ATOM 5301  C C   . MET B 1 145 ? 21.454  59.751  -28.529  1.00 40.00 ? 149 MET B C   1 
ATOM 5302  O O   . MET B 1 145 ? 22.628  60.093  -28.425  1.00 40.00 ? 149 MET B O   1 
ATOM 5303  C CB  . MET B 1 145 ? 19.551  60.513  -27.206  1.00 40.00 ? 149 MET B CB  1 
ATOM 5304  C CG  . MET B 1 145 ? 20.100  61.895  -27.574  1.00 40.00 ? 149 MET B CG  1 
ATOM 5305  S SD  . MET B 1 145 ? 21.275  62.428  -26.278  1.00 40.00 ? 149 MET B SD  1 
ATOM 5306  C CE  . MET B 1 145 ? 20.327  63.826  -25.647  1.00 40.00 ? 149 MET B CE  1 
ATOM 5307  N N   . ASN B 1 146 ? 20.832  59.706  -29.703  1.00 40.00 ? 150 ASN B N   1 
ATOM 5308  C CA  . ASN B 1 146 ? 21.444  60.088  -30.963  1.00 40.00 ? 150 ASN B CA  1 
ATOM 5309  C C   . ASN B 1 146 ? 20.787  61.440  -31.325  1.00 40.00 ? 150 ASN B C   1 
ATOM 5310  O O   . ASN B 1 146 ? 19.585  61.600  -31.048  1.00 40.00 ? 150 ASN B O   1 
ATOM 5311  C CB  . ASN B 1 146 ? 21.153  59.111  -32.109  1.00 40.00 ? 150 ASN B CB  1 
ATOM 5312  C CG  . ASN B 1 146 ? 22.112  57.934  -32.027  1.00 40.00 ? 150 ASN B CG  1 
ATOM 5313  O OD1 . ASN B 1 146 ? 22.920  57.922  -31.083  1.00 40.00 ? 150 ASN B OD1 1 
ATOM 5314  N ND2 . ASN B 1 146 ? 22.038  56.996  -32.967  1.00 40.00 ? 150 ASN B ND2 1 
ATOM 5315  N N   . TYR B 1 147 ? 21.567  62.372  -31.840  1.00 40.00 ? 151 TYR B N   1 
ATOM 5316  C CA  . TYR B 1 147 ? 21.042  63.671  -32.268  1.00 40.00 ? 151 TYR B CA  1 
ATOM 5317  C C   . TYR B 1 147 ? 21.691  63.893  -33.657  1.00 40.00 ? 151 TYR B C   1 
ATOM 5318  O O   . TYR B 1 147 ? 22.813  63.436  -33.921  1.00 40.00 ? 151 TYR B O   1 
ATOM 5319  C CB  . TYR B 1 147 ? 21.317  64.851  -31.344  1.00 40.00 ? 151 TYR B CB  1 
ATOM 5320  C CG  . TYR B 1 147 ? 22.793  65.062  -31.082  1.00 40.00 ? 151 TYR B CG  1 
ATOM 5321  C CD1 . TYR B 1 147 ? 23.513  64.112  -30.371  1.00 40.00 ? 151 TYR B CD1 1 
ATOM 5322  C CD2 . TYR B 1 147 ? 23.478  66.168  -31.560  1.00 40.00 ? 151 TYR B CD2 1 
ATOM 5323  C CE1 . TYR B 1 147 ? 24.856  64.291  -30.119  1.00 40.00 ? 151 TYR B CE1 1 
ATOM 5324  C CE2 . TYR B 1 147 ? 24.848  66.336  -31.320  1.00 40.00 ? 151 TYR B CE2 1 
ATOM 5325  C CZ  . TYR B 1 147 ? 25.523  65.379  -30.609  1.00 40.00 ? 151 TYR B CZ  1 
ATOM 5326  O OH  . TYR B 1 147 ? 26.860  65.469  -30.342  1.00 40.00 ? 151 TYR B OH  1 
ATOM 5327  N N   . ARG B 1 148 ? 20.947  64.517  -34.556  1.00 40.00 ? 152 ARG B N   1 
ATOM 5328  C CA  . ARG B 1 148 ? 21.400  64.842  -35.879  1.00 40.00 ? 152 ARG B CA  1 
ATOM 5329  C C   . ARG B 1 148 ? 22.612  65.770  -35.852  1.00 40.00 ? 152 ARG B C   1 
ATOM 5330  O O   . ARG B 1 148 ? 22.489  66.897  -35.371  1.00 40.00 ? 152 ARG B O   1 
ATOM 5331  C CB  . ARG B 1 148 ? 20.264  65.620  -36.611  1.00 40.00 ? 152 ARG B CB  1 
ATOM 5332  C CG  . ARG B 1 148 ? 19.073  64.782  -36.991  1.00 40.00 ? 152 ARG B CG  1 
ATOM 5333  C CD  . ARG B 1 148 ? 17.932  65.526  -37.689  1.00 40.00 ? 152 ARG B CD  1 
ATOM 5334  N NE  . ARG B 1 148 ? 17.085  66.196  -36.711  1.00 40.00 ? 152 ARG B NE  1 
ATOM 5335  C CZ  . ARG B 1 148 ? 16.071  66.995  -36.964  1.00 40.00 ? 152 ARG B CZ  1 
ATOM 5336  N NH1 . ARG B 1 148 ? 15.751  67.208  -38.230  1.00 40.00 ? 152 ARG B NH1 1 
ATOM 5337  N NH2 . ARG B 1 148 ? 15.340  67.591  -36.000  1.00 40.00 ? 152 ARG B NH2 1 
ATOM 5338  N N   . VAL B 1 149 ? 23.721  65.367  -36.399  1.00 40.00 ? 153 VAL B N   1 
ATOM 5339  C CA  . VAL B 1 149 ? 24.916  66.157  -36.608  1.00 40.00 ? 153 VAL B CA  1 
ATOM 5340  C C   . VAL B 1 149 ? 24.922  66.718  -38.041  1.00 40.00 ? 153 VAL B C   1 
ATOM 5341  O O   . VAL B 1 149 ? 23.997  66.487  -38.838  1.00 40.00 ? 153 VAL B O   1 
ATOM 5342  C CB  . VAL B 1 149 ? 26.160  65.237  -36.555  1.00 40.00 ? 153 VAL B CB  1 
ATOM 5343  C CG1 . VAL B 1 149 ? 26.408  64.740  -35.147  1.00 40.00 ? 153 VAL B CG1 1 
ATOM 5344  C CG2 . VAL B 1 149 ? 25.978  64.049  -37.492  1.00 40.00 ? 153 VAL B CG2 1 
ATOM 5345  N N   . GLY B 1 150 ? 26.013  67.380  -38.426  1.00 40.00 ? 154 GLY B N   1 
ATOM 5346  C CA  . GLY B 1 150 ? 26.203  67.964  -39.749  1.00 40.00 ? 154 GLY B CA  1 
ATOM 5347  C C   . GLY B 1 150 ? 25.103  68.894  -40.209  1.00 40.00 ? 154 GLY B C   1 
ATOM 5348  O O   . GLY B 1 150 ? 24.349  69.564  -39.511  1.00 40.00 ? 154 GLY B O   1 
ATOM 5349  N N   . THR B 1 151 ? 24.900  69.008  -41.508  1.00 40.00 ? 155 THR B N   1 
ATOM 5350  C CA  . THR B 1 151 ? 23.903  69.825  -42.165  1.00 40.00 ? 155 THR B CA  1 
ATOM 5351  C C   . THR B 1 151 ? 22.517  69.467  -41.646  1.00 40.00 ? 155 THR B C   1 
ATOM 5352  O O   . THR B 1 151 ? 21.648  70.302  -41.438  1.00 40.00 ? 155 THR B O   1 
ATOM 5353  C CB  . THR B 1 151 ? 23.866  69.464  -43.698  1.00 40.00 ? 155 THR B CB  1 
ATOM 5354  O OG1 . THR B 1 151 ? 24.526  68.201  -43.853  1.00 40.00 ? 155 THR B OG1 1 
ATOM 5355  C CG2 . THR B 1 151 ? 24.639  70.553  -44.433  1.00 40.00 ? 155 THR B CG2 1 
ATOM 5356  N N   . PHE B 1 152 ? 22.317  68.156  -41.491  1.00 40.00 ? 156 PHE B N   1 
ATOM 5357  C CA  . PHE B 1 152 ? 21.013  67.654  -41.027  1.00 40.00 ? 156 PHE B CA  1 
ATOM 5358  C C   . PHE B 1 152 ? 20.716  68.200  -39.629  1.00 40.00 ? 156 PHE B C   1 
ATOM 5359  O O   . PHE B 1 152 ? 19.573  68.570  -39.346  1.00 40.00 ? 156 PHE B O   1 
ATOM 5360  C CB  . PHE B 1 152 ? 21.005  66.130  -41.040  1.00 40.00 ? 156 PHE B CB  1 
ATOM 5361  C CG  . PHE B 1 152 ? 21.677  65.518  -42.228  1.00 40.00 ? 156 PHE B CG  1 
ATOM 5362  C CD1 . PHE B 1 152 ? 20.985  65.401  -43.427  1.00 40.00 ? 156 PHE B CD1 1 
ATOM 5363  C CD2 . PHE B 1 152 ? 22.980  65.066  -42.183  1.00 40.00 ? 156 PHE B CD2 1 
ATOM 5364  C CE1 . PHE B 1 152 ? 21.588  64.867  -44.541  1.00 40.00 ? 156 PHE B CE1 1 
ATOM 5365  C CE2 . PHE B 1 152 ? 23.587  64.508  -43.288  1.00 40.00 ? 156 PHE B CE2 1 
ATOM 5366  C CZ  . PHE B 1 152 ? 22.900  64.413  -44.474  1.00 40.00 ? 156 PHE B CZ  1 
ATOM 5367  N N   . GLY B 1 153 ? 21.728  68.259  -38.755  1.00 40.00 ? 157 GLY B N   1 
ATOM 5368  C CA  . GLY B 1 153 ? 21.509  68.778  -37.446  1.00 40.00 ? 157 GLY B CA  1 
ATOM 5369  C C   . GLY B 1 153 ? 21.511  70.282  -37.333  1.00 40.00 ? 157 GLY B C   1 
ATOM 5370  O O   . GLY B 1 153 ? 20.839  70.901  -36.491  1.00 40.00 ? 157 GLY B O   1 
ATOM 5371  N N   . PHE B 1 154 ? 22.440  70.914  -38.104  1.00 40.00 ? 158 PHE B N   1 
ATOM 5372  C CA  . PHE B 1 154 ? 22.646  72.355  -37.965  1.00 40.00 ? 158 PHE B CA  1 
ATOM 5373  C C   . PHE B 1 154 ? 22.573  73.218  -39.184  1.00 40.00 ? 158 PHE B C   1 
ATOM 5374  O O   . PHE B 1 154 ? 22.566  74.461  -39.026  1.00 40.00 ? 158 PHE B O   1 
ATOM 5375  C CB  . PHE B 1 154 ? 23.972  72.523  -37.217  1.00 40.00 ? 158 PHE B CB  1 
ATOM 5376  C CG  . PHE B 1 154 ? 23.949  71.837  -35.865  1.00 40.00 ? 158 PHE B CG  1 
ATOM 5377  C CD1 . PHE B 1 154 ? 23.418  72.465  -34.756  1.00 40.00 ? 158 PHE B CD1 1 
ATOM 5378  C CD2 . PHE B 1 154 ? 24.429  70.537  -35.716  1.00 40.00 ? 158 PHE B CD2 1 
ATOM 5379  C CE1 . PHE B 1 154 ? 23.409  71.816  -33.530  1.00 40.00 ? 158 PHE B CE1 1 
ATOM 5380  C CE2 . PHE B 1 154 ? 24.399  69.875  -34.500  1.00 40.00 ? 158 PHE B CE2 1 
ATOM 5381  C CZ  . PHE B 1 154 ? 23.892  70.518  -33.415  1.00 40.00 ? 158 PHE B CZ  1 
ATOM 5382  N N   . LEU B 1 155 ? 22.430  72.694  -40.390  1.00 40.00 ? 159 LEU B N   1 
ATOM 5383  C CA  . LEU B 1 155 ? 22.340  73.618  -41.534  1.00 40.00 ? 159 LEU B CA  1 
ATOM 5384  C C   . LEU B 1 155 ? 21.300  74.666  -41.198  1.00 40.00 ? 159 LEU B C   1 
ATOM 5385  O O   . LEU B 1 155 ? 20.188  74.258  -40.895  1.00 40.00 ? 159 LEU B O   1 
ATOM 5386  C CB  . LEU B 1 155 ? 21.937  72.909  -42.841  1.00 40.00 ? 159 LEU B CB  1 
ATOM 5387  C CG  . LEU B 1 155 ? 21.914  73.803  -44.092  1.00 40.00 ? 159 LEU B CG  1 
ATOM 5388  C CD1 . LEU B 1 155 ? 22.214  73.023  -45.342  1.00 40.00 ? 159 LEU B CD1 1 
ATOM 5389  C CD2 . LEU B 1 155 ? 20.577  74.520  -44.228  1.00 40.00 ? 159 LEU B CD2 1 
ATOM 5390  N N   . ALA B 1 156 ? 21.589  75.954  -41.266  1.00 40.00 ? 160 ALA B N   1 
ATOM 5391  C CA  . ALA B 1 156 ? 20.439  76.837  -40.926  1.00 40.00 ? 160 ALA B CA  1 
ATOM 5392  C C   . ALA B 1 156 ? 20.337  78.036  -41.824  1.00 40.00 ? 160 ALA B C   1 
ATOM 5393  O O   . ALA B 1 156 ? 21.349  78.634  -42.246  1.00 40.00 ? 160 ALA B O   1 
ATOM 5394  C CB  . ALA B 1 156 ? 20.698  77.307  -39.476  1.00 40.00 ? 160 ALA B CB  1 
ATOM 5395  N N   . LEU B 1 157 ? 19.153  78.521  -42.088  1.00 40.00 ? 161 LEU B N   1 
ATOM 5396  C CA  . LEU B 1 157 ? 18.966  79.775  -42.809  1.00 40.00 ? 161 LEU B CA  1 
ATOM 5397  C C   . LEU B 1 157 ? 18.167  80.564  -41.758  1.00 40.00 ? 161 LEU B C   1 
ATOM 5398  O O   . LEU B 1 157 ? 16.952  80.490  -41.708  1.00 40.00 ? 161 LEU B O   1 
ATOM 5399  C CB  . LEU B 1 157 ? 18.132  79.668  -44.038  1.00 40.00 ? 161 LEU B CB  1 
ATOM 5400  C CG  . LEU B 1 157 ? 18.832  79.477  -45.378  1.00 40.00 ? 161 LEU B CG  1 
ATOM 5401  C CD1 . LEU B 1 157 ? 19.180  78.007  -45.552  1.00 40.00 ? 161 LEU B CD1 1 
ATOM 5402  C CD2 . LEU B 1 157 ? 17.894  79.909  -46.496  1.00 40.00 ? 161 LEU B CD2 1 
ATOM 5403  N N   . PRO B 1 158 ? 18.874  81.170  -40.842  1.00 40.00 ? 162 PRO B N   1 
ATOM 5404  C CA  . PRO B 1 158 ? 18.262  81.902  -39.748  1.00 40.00 ? 162 PRO B CA  1 
ATOM 5405  C C   . PRO B 1 158 ? 17.050  82.690  -40.207  1.00 40.00 ? 162 PRO B C   1 
ATOM 5406  O O   . PRO B 1 158 ? 17.058  83.370  -41.214  1.00 40.00 ? 162 PRO B O   1 
ATOM 5407  C CB  . PRO B 1 158 ? 19.341  82.812  -39.231  1.00 40.00 ? 162 PRO B CB  1 
ATOM 5408  C CG  . PRO B 1 158 ? 20.535  82.583  -40.076  1.00 40.00 ? 162 PRO B CG  1 
ATOM 5409  C CD  . PRO B 1 158 ? 20.359  81.248  -40.748  1.00 40.00 ? 162 PRO B CD  1 
ATOM 5410  N N   . GLY B 1 159 ? 15.983  82.577  -39.406  1.00 40.00 ? 163 GLY B N   1 
ATOM 5411  C CA  . GLY B 1 159 ? 14.725  83.256  -39.640  1.00 40.00 ? 163 GLY B CA  1 
ATOM 5412  C C   . GLY B 1 159 ? 13.722  82.427  -40.437  1.00 40.00 ? 163 GLY B C   1 
ATOM 5413  O O   . GLY B 1 159 ? 12.524  82.711  -40.499  1.00 40.00 ? 163 GLY B O   1 
ATOM 5414  N N   . SER B 1 160 ? 14.203  81.403  -41.131  1.00 40.00 ? 164 SER B N   1 
ATOM 5415  C CA  . SER B 1 160 ? 13.425  80.523  -41.927  1.00 40.00 ? 164 SER B CA  1 
ATOM 5416  C C   . SER B 1 160 ? 12.586  79.612  -41.010  1.00 40.00 ? 164 SER B C   1 
ATOM 5417  O O   . SER B 1 160 ? 13.035  79.280  -39.918  1.00 40.00 ? 164 SER B O   1 
ATOM 5418  C CB  . SER B 1 160 ? 14.331  79.568  -42.740  1.00 40.00 ? 164 SER B CB  1 
ATOM 5419  O OG  . SER B 1 160 ? 14.583  78.374  -42.009  1.00 40.00 ? 164 SER B OG  1 
ATOM 5420  N N   . ARG B 1 161 ? 11.465  79.204  -41.589  1.00 40.00 ? 165 ARG B N   1 
ATOM 5421  C CA  . ARG B 1 161 ? 10.563  78.275  -40.975  1.00 40.00 ? 165 ARG B CA  1 
ATOM 5422  C C   . ARG B 1 161 ? 11.065  76.838  -41.146  1.00 40.00 ? 165 ARG B C   1 
ATOM 5423  O O   . ARG B 1 161 ? 10.857  76.009  -40.267  1.00 40.00 ? 165 ARG B O   1 
ATOM 5424  C CB  . ARG B 1 161 ? 9.212   78.351  -41.732  1.00 40.00 ? 165 ARG B CB  1 
ATOM 5425  C CG  . ARG B 1 161 ? 8.028   78.210  -40.799  1.00 40.00 ? 165 ARG B CG  1 
ATOM 5426  C CD  . ARG B 1 161 ? 6.765   77.698  -41.471  1.00 40.00 ? 165 ARG B CD  1 
ATOM 5427  N NE  . ARG B 1 161 ? 6.857   76.253  -41.709  1.00 40.00 ? 165 ARG B NE  1 
ATOM 5428  C CZ  . ARG B 1 161 ? 6.859   75.708  -42.922  1.00 40.00 ? 165 ARG B CZ  1 
ATOM 5429  N NH1 . ARG B 1 161 ? 6.769   76.455  -44.021  1.00 40.00 ? 165 ARG B NH1 1 
ATOM 5430  N NH2 . ARG B 1 161 ? 6.958   74.388  -43.049  1.00 40.00 ? 165 ARG B NH2 1 
ATOM 5431  N N   . GLU B 1 162 ? 11.693  76.556  -42.283  1.00 40.00 ? 166 GLU B N   1 
ATOM 5432  C CA  . GLU B 1 162 ? 12.081  75.195  -42.597  1.00 40.00 ? 166 GLU B CA  1 
ATOM 5433  C C   . GLU B 1 162 ? 13.495  74.732  -42.386  1.00 40.00 ? 166 GLU B C   1 
ATOM 5434  O O   . GLU B 1 162 ? 13.832  73.564  -42.683  1.00 40.00 ? 166 GLU B O   1 
ATOM 5435  C CB  . GLU B 1 162 ? 11.744  74.964  -44.100  1.00 40.00 ? 166 GLU B CB  1 
ATOM 5436  C CG  . GLU B 1 162 ? 11.856  76.275  -44.864  1.00 40.00 ? 166 GLU B CG  1 
ATOM 5437  C CD  . GLU B 1 162 ? 10.516  76.940  -45.105  1.00 40.00 ? 166 GLU B CD  1 
ATOM 5438  O OE1 . GLU B 1 162 ? 9.494   76.222  -45.215  1.00 40.00 ? 166 GLU B OE1 1 
ATOM 5439  O OE2 . GLU B 1 162 ? 10.455  78.191  -45.201  1.00 40.00 ? 166 GLU B OE2 1 
ATOM 5440  N N   . ALA B 1 163 ? 14.356  75.607  -41.903  1.00 40.00 ? 167 ALA B N   1 
ATOM 5441  C CA  . ALA B 1 163 ? 15.759  75.209  -41.614  1.00 40.00 ? 167 ALA B CA  1 
ATOM 5442  C C   . ALA B 1 163 ? 16.225  76.315  -40.674  1.00 40.00 ? 167 ALA B C   1 
ATOM 5443  O O   . ALA B 1 163 ? 16.916  77.270  -41.026  1.00 40.00 ? 167 ALA B O   1 
ATOM 5444  C CB  . ALA B 1 163 ? 16.526  75.057  -42.862  1.00 40.00 ? 167 ALA B CB  1 
ATOM 5445  N N   . PRO B 1 164 ? 15.655  76.281  -39.471  1.00 40.00 ? 168 PRO B N   1 
ATOM 5446  C CA  . PRO B 1 164 ? 15.853  77.368  -38.519  1.00 40.00 ? 168 PRO B CA  1 
ATOM 5447  C C   . PRO B 1 164 ? 17.052  77.227  -37.638  1.00 40.00 ? 168 PRO B C   1 
ATOM 5448  O O   . PRO B 1 164 ? 17.425  78.163  -36.890  1.00 40.00 ? 168 PRO B O   1 
ATOM 5449  C CB  . PRO B 1 164 ? 14.477  77.358  -37.824  1.00 40.00 ? 168 PRO B CB  1 
ATOM 5450  C CG  . PRO B 1 164 ? 14.243  75.894  -37.653  1.00 40.00 ? 168 PRO B CG  1 
ATOM 5451  C CD  . PRO B 1 164 ? 14.740  75.247  -38.921  1.00 40.00 ? 168 PRO B CD  1 
ATOM 5452  N N   . GLY B 1 165 ? 17.696  76.062  -37.699  1.00 40.00 ? 169 GLY B N   1 
ATOM 5453  C CA  . GLY B 1 165 ? 18.877  75.782  -36.945  1.00 40.00 ? 169 GLY B CA  1 
ATOM 5454  C C   . GLY B 1 165 ? 18.755  75.192  -35.575  1.00 40.00 ? 169 GLY B C   1 
ATOM 5455  O O   . GLY B 1 165 ? 17.726  75.221  -34.891  1.00 40.00 ? 169 GLY B O   1 
ATOM 5456  N N   . ASN B 1 166 ? 19.887  74.605  -35.140  1.00 40.00 ? 170 ASN B N   1 
ATOM 5457  C CA  . ASN B 1 166 ? 19.984  74.017  -33.807  1.00 40.00 ? 170 ASN B CA  1 
ATOM 5458  C C   . ASN B 1 166 ? 19.076  72.830  -33.630  1.00 40.00 ? 170 ASN B C   1 
ATOM 5459  O O   . ASN B 1 166 ? 18.867  72.294  -32.520  1.00 40.00 ? 170 ASN B O   1 
ATOM 5460  C CB  . ASN B 1 166 ? 19.659  75.142  -32.816  1.00 40.00 ? 170 ASN B CB  1 
ATOM 5461  C CG  . ASN B 1 166 ? 20.619  76.303  -32.815  1.00 40.00 ? 170 ASN B CG  1 
ATOM 5462  O OD1 . ASN B 1 166 ? 21.843  76.133  -32.928  1.00 40.00 ? 170 ASN B OD1 1 
ATOM 5463  N ND2 . ASN B 1 166 ? 20.116  77.533  -32.688  1.00 40.00 ? 170 ASN B ND2 1 
ATOM 5464  N N   . VAL B 1 167 ? 18.535  72.297  -34.745  1.00 40.00 ? 171 VAL B N   1 
ATOM 5465  C CA  . VAL B 1 167 ? 17.637  71.158  -34.578  1.00 40.00 ? 171 VAL B CA  1 
ATOM 5466  C C   . VAL B 1 167 ? 18.353  69.964  -33.978  1.00 40.00 ? 171 VAL B C   1 
ATOM 5467  O O   . VAL B 1 167 ? 17.716  69.140  -33.301  1.00 40.00 ? 171 VAL B O   1 
ATOM 5468  C CB  . VAL B 1 167 ? 16.852  70.779  -35.822  1.00 40.00 ? 171 VAL B CB  1 
ATOM 5469  C CG1 . VAL B 1 167 ? 16.061  71.983  -36.343  1.00 40.00 ? 171 VAL B CG1 1 
ATOM 5470  C CG2 . VAL B 1 167 ? 17.754  70.180  -36.899  1.00 40.00 ? 171 VAL B CG2 1 
ATOM 5471  N N   . GLY B 1 168 ? 19.666  69.831  -34.111  1.00 40.00 ? 172 GLY B N   1 
ATOM 5472  C CA  . GLY B 1 168 ? 20.340  68.685  -33.477  1.00 40.00 ? 172 GLY B CA  1 
ATOM 5473  C C   . GLY B 1 168 ? 20.253  68.886  -31.950  1.00 40.00 ? 172 GLY B C   1 
ATOM 5474  O O   . GLY B 1 168 ? 20.317  67.926  -31.149  1.00 40.00 ? 172 GLY B O   1 
ATOM 5475  N N   . LEU B 1 169 ? 20.147  70.155  -31.517  1.00 40.00 ? 173 LEU B N   1 
ATOM 5476  C CA  . LEU B 1 169 ? 20.090  70.392  -30.074  1.00 40.00 ? 173 LEU B CA  1 
ATOM 5477  C C   . LEU B 1 169 ? 18.683  70.074  -29.593  1.00 40.00 ? 173 LEU B C   1 
ATOM 5478  O O   . LEU B 1 169 ? 18.520  69.449  -28.550  1.00 40.00 ? 173 LEU B O   1 
ATOM 5479  C CB  . LEU B 1 169 ? 20.433  71.830  -29.708  1.00 40.00 ? 173 LEU B CB  1 
ATOM 5480  C CG  . LEU B 1 169 ? 21.907  72.221  -29.835  1.00 40.00 ? 173 LEU B CG  1 
ATOM 5481  C CD1 . LEU B 1 169 ? 22.098  73.640  -29.337  1.00 40.00 ? 173 LEU B CD1 1 
ATOM 5482  C CD2 . LEU B 1 169 ? 22.807  71.272  -29.063  1.00 40.00 ? 173 LEU B CD2 1 
ATOM 5483  N N   . LEU B 1 170 ? 17.723  70.505  -30.424  1.00 40.00 ? 174 LEU B N   1 
ATOM 5484  C CA  . LEU B 1 170 ? 16.323  70.187  -30.095  1.00 40.00 ? 174 LEU B CA  1 
ATOM 5485  C C   . LEU B 1 170 ? 16.152  68.679  -30.038  1.00 40.00 ? 174 LEU B C   1 
ATOM 5486  O O   . LEU B 1 170 ? 15.340  68.174  -29.263  1.00 40.00 ? 174 LEU B O   1 
ATOM 5487  C CB  . LEU B 1 170 ? 15.420  70.728  -31.198  1.00 40.00 ? 174 LEU B CB  1 
ATOM 5488  C CG  . LEU B 1 170 ? 15.435  72.250  -31.228  1.00 40.00 ? 174 LEU B CG  1 
ATOM 5489  C CD1 . LEU B 1 170 ? 14.173  72.754  -31.891  1.00 40.00 ? 174 LEU B CD1 1 
ATOM 5490  C CD2 . LEU B 1 170 ? 15.493  72.834  -29.829  1.00 40.00 ? 174 LEU B CD2 1 
ATOM 5491  N N   . ASP B 1 171 ? 16.915  67.968  -30.888  1.00 40.00 ? 175 ASP B N   1 
ATOM 5492  C CA  . ASP B 1 171 ? 16.846  66.510  -30.784  1.00 40.00 ? 175 ASP B CA  1 
ATOM 5493  C C   . ASP B 1 171 ? 17.203  66.148  -29.328  1.00 40.00 ? 175 ASP B C   1 
ATOM 5494  O O   . ASP B 1 171 ? 16.400  65.515  -28.636  1.00 40.00 ? 175 ASP B O   1 
ATOM 5495  C CB  . ASP B 1 171 ? 17.797  65.804  -31.741  1.00 40.00 ? 175 ASP B CB  1 
ATOM 5496  C CG  . ASP B 1 171 ? 17.381  65.897  -33.204  1.00 40.00 ? 175 ASP B CG  1 
ATOM 5497  O OD1 . ASP B 1 171 ? 16.311  66.498  -33.502  1.00 40.00 ? 175 ASP B OD1 1 
ATOM 5498  O OD2 . ASP B 1 171 ? 18.151  65.352  -34.036  1.00 40.00 ? 175 ASP B OD2 1 
ATOM 5499  N N   . GLN B 1 172 ? 18.368  66.576  -28.862  1.00 40.00 ? 176 GLN B N   1 
ATOM 5500  C CA  . GLN B 1 172 ? 18.777  66.246  -27.493  1.00 40.00 ? 176 GLN B CA  1 
ATOM 5501  C C   . GLN B 1 172 ? 17.734  66.744  -26.492  1.00 40.00 ? 176 GLN B C   1 
ATOM 5502  O O   . GLN B 1 172 ? 17.351  66.036  -25.534  1.00 40.00 ? 176 GLN B O   1 
ATOM 5503  C CB  . GLN B 1 172 ? 20.152  66.797  -27.167  1.00 40.00 ? 176 GLN B CB  1 
ATOM 5504  C CG  . GLN B 1 172 ? 21.204  66.744  -28.271  1.00 40.00 ? 176 GLN B CG  1 
ATOM 5505  C CD  . GLN B 1 172 ? 22.355  67.714  -28.000  1.00 40.00 ? 176 GLN B CD  1 
ATOM 5506  O OE1 . GLN B 1 172 ? 22.111  68.869  -27.627  1.00 40.00 ? 176 GLN B OE1 1 
ATOM 5507  N NE2 . GLN B 1 172 ? 23.601  67.281  -28.179  1.00 40.00 ? 176 GLN B NE2 1 
ATOM 5508  N N   . ARG B 1 173 ? 17.202  67.965  -26.696  1.00 40.00 ? 177 ARG B N   1 
ATOM 5509  C CA  . ARG B 1 173 ? 16.226  68.435  -25.699  1.00 40.00 ? 177 ARG B CA  1 
ATOM 5510  C C   . ARG B 1 173 ? 15.042  67.471  -25.662  1.00 40.00 ? 177 ARG B C   1 
ATOM 5511  O O   . ARG B 1 173 ? 14.516  67.082  -24.612  1.00 40.00 ? 177 ARG B O   1 
ATOM 5512  C CB  . ARG B 1 173 ? 15.815  69.855  -25.896  1.00 40.00 ? 177 ARG B CB  1 
ATOM 5513  C CG  . ARG B 1 173 ? 14.422  70.282  -25.482  1.00 40.00 ? 177 ARG B CG  1 
ATOM 5514  C CD  . ARG B 1 173 ? 14.184  71.733  -25.994  1.00 40.00 ? 177 ARG B CD  1 
ATOM 5515  N NE  . ARG B 1 173 ? 15.095  72.623  -25.326  1.00 40.00 ? 177 ARG B NE  1 
ATOM 5516  C CZ  . ARG B 1 173 ? 15.250  73.939  -25.486  1.00 40.00 ? 177 ARG B CZ  1 
ATOM 5517  N NH1 . ARG B 1 173 ? 14.506  74.626  -26.355  1.00 40.00 ? 177 ARG B NH1 1 
ATOM 5518  N NH2 . ARG B 1 173 ? 16.166  74.586  -24.723  1.00 40.00 ? 177 ARG B NH2 1 
ATOM 5519  N N   . LEU B 1 174 ? 14.623  67.018  -26.845  1.00 40.00 ? 178 LEU B N   1 
ATOM 5520  C CA  . LEU B 1 174 ? 13.495  66.096  -26.931  1.00 40.00 ? 178 LEU B CA  1 
ATOM 5521  C C   . LEU B 1 174 ? 13.831  64.818  -26.180  1.00 40.00 ? 178 LEU B C   1 
ATOM 5522  O O   . LEU B 1 174 ? 13.017  64.345  -25.374  1.00 40.00 ? 178 LEU B O   1 
ATOM 5523  C CB  . LEU B 1 174 ? 13.182  65.821  -28.387  1.00 40.00 ? 178 LEU B CB  1 
ATOM 5524  C CG  . LEU B 1 174 ? 11.762  65.407  -28.795  1.00 40.00 ? 178 LEU B CG  1 
ATOM 5525  C CD1 . LEU B 1 174 ? 11.845  64.124  -29.608  1.00 40.00 ? 178 LEU B CD1 1 
ATOM 5526  C CD2 . LEU B 1 174 ? 10.812  65.301  -27.630  1.00 40.00 ? 178 LEU B CD2 1 
ATOM 5527  N N   . ALA B 1 175 ? 15.068  64.323  -26.367  1.00 40.00 ? 179 ALA B N   1 
ATOM 5528  C CA  . ALA B 1 175 ? 15.413  63.091  -25.633  1.00 40.00 ? 179 ALA B CA  1 
ATOM 5529  C C   . ALA B 1 175 ? 15.301  63.367  -24.140  1.00 40.00 ? 179 ALA B C   1 
ATOM 5530  O O   . ALA B 1 175 ? 14.897  62.541  -23.336  1.00 40.00 ? 179 ALA B O   1 
ATOM 5531  C CB  . ALA B 1 175 ? 16.809  62.635  -25.987  1.00 40.00 ? 179 ALA B CB  1 
ATOM 5532  N N   . LEU B 1 176 ? 15.684  64.596  -23.778  1.00 40.00 ? 180 LEU B N   1 
ATOM 5533  C CA  . LEU B 1 176 ? 15.592  64.984  -22.376  1.00 40.00 ? 180 LEU B CA  1 
ATOM 5534  C C   . LEU B 1 176 ? 14.142  64.962  -21.928  1.00 40.00 ? 180 LEU B C   1 
ATOM 5535  O O   . LEU B 1 176 ? 13.814  64.302  -20.917  1.00 40.00 ? 180 LEU B O   1 
ATOM 5536  C CB  . LEU B 1 176 ? 16.219  66.358  -22.253  1.00 40.00 ? 180 LEU B CB  1 
ATOM 5537  C CG  . LEU B 1 176 ? 17.605  66.507  -21.648  1.00 40.00 ? 180 LEU B CG  1 
ATOM 5538  C CD1 . LEU B 1 176 ? 18.570  65.356  -21.871  1.00 40.00 ? 180 LEU B CD1 1 
ATOM 5539  C CD2 . LEU B 1 176 ? 18.180  67.817  -22.190  1.00 40.00 ? 180 LEU B CD2 1 
ATOM 5540  N N   . GLN B 1 177 ? 13.207  65.592  -22.668  1.00 40.00 ? 181 GLN B N   1 
ATOM 5541  C CA  . GLN B 1 177 ? 11.815  65.593  -22.205  1.00 40.00 ? 181 GLN B CA  1 
ATOM 5542  C C   . GLN B 1 177 ? 11.277  64.172  -22.130  1.00 40.00 ? 181 GLN B C   1 
ATOM 5543  O O   . GLN B 1 177 ? 10.353  63.906  -21.360  1.00 40.00 ? 181 GLN B O   1 
ATOM 5544  C CB  . GLN B 1 177 ? 10.880  66.453  -23.032  1.00 40.00 ? 181 GLN B CB  1 
ATOM 5545  C CG  . GLN B 1 177 ? 11.523  67.733  -23.505  1.00 40.00 ? 181 GLN B CG  1 
ATOM 5546  C CD  . GLN B 1 177 ? 10.657  68.545  -24.447  1.00 40.00 ? 181 GLN B CD  1 
ATOM 5547  O OE1 . GLN B 1 177 ? 10.950  68.669  -25.651  1.00 40.00 ? 181 GLN B OE1 1 
ATOM 5548  N NE2 . GLN B 1 177 ? 9.579   69.125  -23.899  1.00 40.00 ? 181 GLN B NE2 1 
ATOM 5549  N N   . TRP B 1 178 ? 11.878  63.306  -22.948  1.00 40.00 ? 182 TRP B N   1 
ATOM 5550  C CA  . TRP B 1 178 ? 11.385  61.926  -22.873  1.00 40.00 ? 182 TRP B CA  1 
ATOM 5551  C C   . TRP B 1 178 ? 11.896  61.324  -21.574  1.00 40.00 ? 182 TRP B C   1 
ATOM 5552  O O   . TRP B 1 178 ? 11.082  60.867  -20.748  1.00 40.00 ? 182 TRP B O   1 
ATOM 5553  C CB  . TRP B 1 178 ? 11.783  61.174  -24.063  1.00 40.00 ? 182 TRP B CB  1 
ATOM 5554  C CG  . TRP B 1 178 ? 11.451  59.747  -24.170  1.00 40.00 ? 182 TRP B CG  1 
ATOM 5555  C CD1 . TRP B 1 178 ? 10.462  59.254  -24.966  1.00 40.00 ? 182 TRP B CD1 1 
ATOM 5556  C CD2 . TRP B 1 178 ? 12.072  58.625  -23.539  1.00 40.00 ? 182 TRP B CD2 1 
ATOM 5557  N NE1 . TRP B 1 178 ? 10.425  57.876  -24.874  1.00 40.00 ? 182 TRP B NE1 1 
ATOM 5558  C CE2 . TRP B 1 178 ? 11.403  57.472  -24.001  1.00 40.00 ? 182 TRP B CE2 1 
ATOM 5559  C CE3 . TRP B 1 178 ? 13.124  58.464  -22.635  1.00 40.00 ? 182 TRP B CE3 1 
ATOM 5560  C CZ2 . TRP B 1 178 ? 11.742  56.177  -23.611  1.00 40.00 ? 182 TRP B CZ2 1 
ATOM 5561  C CZ3 . TRP B 1 178 ? 13.460  57.173  -22.258  1.00 40.00 ? 182 TRP B CZ3 1 
ATOM 5562  C CH2 . TRP B 1 178 ? 12.780  56.037  -22.737  1.00 40.00 ? 182 TRP B CH2 1 
ATOM 5563  N N   . VAL B 1 179 ? 13.197  61.429  -21.328  1.00 40.00 ? 183 VAL B N   1 
ATOM 5564  C CA  . VAL B 1 179 ? 13.716  60.894  -20.052  1.00 40.00 ? 183 VAL B CA  1 
ATOM 5565  C C   . VAL B 1 179 ? 12.835  61.378  -18.903  1.00 40.00 ? 183 VAL B C   1 
ATOM 5566  O O   . VAL B 1 179 ? 12.403  60.589  -18.061  1.00 40.00 ? 183 VAL B O   1 
ATOM 5567  C CB  . VAL B 1 179 ? 15.189  61.225  -19.896  1.00 40.00 ? 183 VAL B CB  1 
ATOM 5568  C CG1 . VAL B 1 179 ? 15.396  62.513  -19.113  1.00 40.00 ? 183 VAL B CG1 1 
ATOM 5569  C CG2 . VAL B 1 179 ? 15.958  60.072  -19.247  1.00 40.00 ? 183 VAL B CG2 1 
ATOM 5570  N N   . GLN B 1 180 ? 12.491  62.661  -18.905  1.00 40.00 ? 184 GLN B N   1 
ATOM 5571  C CA  . GLN B 1 180 ? 11.611  63.236  -17.931  1.00 40.00 ? 184 GLN B CA  1 
ATOM 5572  C C   . GLN B 1 180 ? 10.356  62.397  -17.745  1.00 40.00 ? 184 GLN B C   1 
ATOM 5573  O O   . GLN B 1 180 ? 10.087  61.838  -16.685  1.00 40.00 ? 184 GLN B O   1 
ATOM 5574  C CB  . GLN B 1 180 ? 11.124  64.624  -18.368  1.00 40.00 ? 184 GLN B CB  1 
ATOM 5575  C CG  . GLN B 1 180 ? 10.917  65.626  -17.263  1.00 40.00 ? 184 GLN B CG  1 
ATOM 5576  C CD  . GLN B 1 180 ? 12.073  65.733  -16.290  1.00 40.00 ? 184 GLN B CD  1 
ATOM 5577  O OE1 . GLN B 1 180 ? 13.151  65.134  -16.440  1.00 40.00 ? 184 GLN B OE1 1 
ATOM 5578  N NE2 . GLN B 1 180 ? 11.879  66.520  -15.229  1.00 40.00 ? 184 GLN B NE2 1 
ATOM 5579  N N   . GLU B 1 181 ? 9.571   62.313  -18.831  1.00 40.00 ? 185 GLU B N   1 
ATOM 5580  C CA  . GLU B 1 181 ? 8.304   61.601  -18.688  1.00 40.00 ? 185 GLU B CA  1 
ATOM 5581  C C   . GLU B 1 181 ? 8.343   60.125  -18.855  1.00 40.00 ? 185 GLU B C   1 
ATOM 5582  O O   . GLU B 1 181 ? 7.267   59.564  -19.172  1.00 40.00 ? 185 GLU B O   1 
ATOM 5583  C CB  . GLU B 1 181 ? 7.266   62.272  -19.607  1.00 40.00 ? 185 GLU B CB  1 
ATOM 5584  C CG  . GLU B 1 181 ? 7.767   62.403  -21.037  1.00 40.00 ? 185 GLU B CG  1 
ATOM 5585  C CD  . GLU B 1 181 ? 6.678   62.968  -21.939  1.00 40.00 ? 185 GLU B CD  1 
ATOM 5586  O OE1 . GLU B 1 181 ? 6.118   64.038  -21.602  1.00 40.00 ? 185 GLU B OE1 1 
ATOM 5587  O OE2 . GLU B 1 181 ? 6.409   62.311  -22.983  1.00 40.00 ? 185 GLU B OE2 1 
ATOM 5588  N N   . ASN B 1 182 ? 9.444   59.406  -18.721  1.00 40.00 ? 186 ASN B N   1 
ATOM 5589  C CA  . ASN B 1 182 ? 9.408   57.962  -18.915  1.00 40.00 ? 186 ASN B CA  1 
ATOM 5590  C C   . ASN B 1 182 ? 10.562  57.271  -18.230  1.00 40.00 ? 186 ASN B C   1 
ATOM 5591  O O   . ASN B 1 182 ? 10.637  56.040  -18.216  1.00 40.00 ? 186 ASN B O   1 
ATOM 5592  C CB  . ASN B 1 182 ? 9.659   57.653  -20.420  1.00 40.00 ? 186 ASN B CB  1 
ATOM 5593  C CG  . ASN B 1 182 ? 8.415   57.874  -21.248  1.00 40.00 ? 186 ASN B CG  1 
ATOM 5594  O OD1 . ASN B 1 182 ? 7.560   56.975  -21.246  1.00 40.00 ? 186 ASN B OD1 1 
ATOM 5595  N ND2 . ASN B 1 182 ? 8.301   59.047  -21.882  1.00 40.00 ? 186 ASN B ND2 1 
ATOM 5596  N N   . ILE B 1 183 ? 11.545  58.042  -17.730  1.00 40.00 ? 187 ILE B N   1 
ATOM 5597  C CA  . ILE B 1 183 ? 12.700  57.283  -17.190  1.00 40.00 ? 187 ILE B CA  1 
ATOM 5598  C C   . ILE B 1 183 ? 12.287  56.564  -15.922  1.00 40.00 ? 187 ILE B C   1 
ATOM 5599  O O   . ILE B 1 183 ? 12.828  55.537  -15.496  1.00 40.00 ? 187 ILE B O   1 
ATOM 5600  C CB  . ILE B 1 183 ? 13.889  58.215  -17.026  1.00 40.00 ? 187 ILE B CB  1 
ATOM 5601  C CG1 . ILE B 1 183 ? 15.201  57.465  -16.793  1.00 40.00 ? 187 ILE B CG1 1 
ATOM 5602  C CG2 . ILE B 1 183 ? 13.594  59.158  -15.863  1.00 40.00 ? 187 ILE B CG2 1 
ATOM 5603  C CD1 . ILE B 1 183 ? 15.506  56.394  -17.835  1.00 40.00 ? 187 ILE B CD1 1 
ATOM 5604  N N   . ALA B 1 184 ? 11.252  57.152  -15.306  1.00 40.00 ? 188 ALA B N   1 
ATOM 5605  C CA  . ALA B 1 184 ? 10.609  56.666  -14.100  1.00 40.00 ? 188 ALA B CA  1 
ATOM 5606  C C   . ALA B 1 184 ? 10.442  55.155  -14.197  1.00 40.00 ? 188 ALA B C   1 
ATOM 5607  O O   . ALA B 1 184 ? 10.965  54.389  -13.386  1.00 40.00 ? 188 ALA B O   1 
ATOM 5608  C CB  . ALA B 1 184 ? 9.243   57.329  -13.944  1.00 40.00 ? 188 ALA B CB  1 
ATOM 5609  N N   . ALA B 1 185 ? 9.805   54.704  -15.280  1.00 40.00 ? 189 ALA B N   1 
ATOM 5610  C CA  . ALA B 1 185 ? 9.542   53.317  -15.577  1.00 40.00 ? 189 ALA B CA  1 
ATOM 5611  C C   . ALA B 1 185 ? 10.763  52.432  -15.685  1.00 40.00 ? 189 ALA B C   1 
ATOM 5612  O O   . ALA B 1 185 ? 10.661  51.207  -15.861  1.00 40.00 ? 189 ALA B O   1 
ATOM 5613  C CB  . ALA B 1 185 ? 8.668   53.195  -16.825  1.00 40.00 ? 189 ALA B CB  1 
ATOM 5614  N N   . PHE B 1 186 ? 11.965  52.973  -15.613  1.00 40.00 ? 190 PHE B N   1 
ATOM 5615  C CA  . PHE B 1 186 ? 13.171  52.145  -15.708  1.00 40.00 ? 190 PHE B CA  1 
ATOM 5616  C C   . PHE B 1 186 ? 13.868  52.174  -14.340  1.00 40.00 ? 190 PHE B C   1 
ATOM 5617  O O   . PHE B 1 186 ? 14.982  51.674  -14.212  1.00 40.00 ? 190 PHE B O   1 
ATOM 5618  C CB  . PHE B 1 186 ? 14.150  52.661  -16.776  1.00 40.00 ? 190 PHE B CB  1 
ATOM 5619  C CG  . PHE B 1 186 ? 13.540  52.579  -18.151  1.00 40.00 ? 190 PHE B CG  1 
ATOM 5620  C CD1 . PHE B 1 186 ? 12.599  53.524  -18.555  1.00 40.00 ? 190 PHE B CD1 1 
ATOM 5621  C CD2 . PHE B 1 186 ? 13.910  51.552  -19.007  1.00 40.00 ? 190 PHE B CD2 1 
ATOM 5622  C CE1 . PHE B 1 186 ? 12.038  53.425  -19.814  1.00 40.00 ? 190 PHE B CE1 1 
ATOM 5623  C CE2 . PHE B 1 186 ? 13.356  51.446  -20.268  1.00 40.00 ? 190 PHE B CE2 1 
ATOM 5624  C CZ  . PHE B 1 186 ? 12.418  52.389  -20.668  1.00 40.00 ? 190 PHE B CZ  1 
ATOM 5625  N N   . GLY B 1 187 ? 13.136  52.778  -13.403  1.00 40.00 ? 191 GLY B N   1 
ATOM 5626  C CA  . GLY B 1 187 ? 13.660  52.924  -12.053  1.00 40.00 ? 191 GLY B CA  1 
ATOM 5627  C C   . GLY B 1 187 ? 14.487  54.201  -11.930  1.00 40.00 ? 191 GLY B C   1 
ATOM 5628  O O   . GLY B 1 187 ? 15.228  54.339  -10.956  1.00 40.00 ? 191 GLY B O   1 
ATOM 5629  N N   . GLY B 1 188 ? 14.377  55.106  -12.909  1.00 40.00 ? 192 GLY B N   1 
ATOM 5630  C CA  . GLY B 1 188 ? 15.183  56.332  -12.817  1.00 40.00 ? 192 GLY B CA  1 
ATOM 5631  C C   . GLY B 1 188 ? 14.379  57.448  -12.148  1.00 40.00 ? 192 GLY B C   1 
ATOM 5632  O O   . GLY B 1 188 ? 13.159  57.485  -12.218  1.00 40.00 ? 192 GLY B O   1 
ATOM 5633  N N   . ASP B 1 189 ? 15.115  58.349  -11.518  1.00 40.00 ? 193 ASP B N   1 
ATOM 5634  C CA  . ASP B 1 189 ? 14.522  59.497  -10.863  1.00 40.00 ? 193 ASP B CA  1 
ATOM 5635  C C   . ASP B 1 189 ? 14.489  60.680  -11.794  1.00 40.00 ? 193 ASP B C   1 
ATOM 5636  O O   . ASP B 1 189 ? 15.521  61.361  -12.017  1.00 40.00 ? 193 ASP B O   1 
ATOM 5637  C CB  . ASP B 1 189 ? 15.415  59.870  -9.657   1.00 40.00 ? 193 ASP B CB  1 
ATOM 5638  C CG  . ASP B 1 189 ? 14.738  60.915  -8.777   1.00 40.00 ? 193 ASP B CG  1 
ATOM 5639  O OD1 . ASP B 1 189 ? 13.576  61.300  -9.063   1.00 40.00 ? 193 ASP B OD1 1 
ATOM 5640  O OD2 . ASP B 1 189 ? 15.377  61.365  -7.794   1.00 40.00 ? 193 ASP B OD2 1 
ATOM 5641  N N   . PRO B 1 190 ? 13.321  61.073  -12.286  1.00 40.00 ? 194 PRO B N   1 
ATOM 5642  C CA  . PRO B 1 190 ? 13.178  62.247  -13.137  1.00 40.00 ? 194 PRO B CA  1 
ATOM 5643  C C   . PRO B 1 190 ? 13.591  63.521  -12.403  1.00 40.00 ? 194 PRO B C   1 
ATOM 5644  O O   . PRO B 1 190 ? 13.567  64.621  -12.958  1.00 40.00 ? 194 PRO B O   1 
ATOM 5645  C CB  . PRO B 1 190 ? 11.670  62.321  -13.414  1.00 40.00 ? 194 PRO B CB  1 
ATOM 5646  C CG  . PRO B 1 190 ? 11.072  61.611  -12.257  1.00 40.00 ? 194 PRO B CG  1 
ATOM 5647  C CD  . PRO B 1 190 ? 12.021  60.430  -12.032  1.00 40.00 ? 194 PRO B CD  1 
ATOM 5648  N N   . MET B 1 191 ? 13.921  63.436  -11.139  1.00 40.00 ? 195 MET B N   1 
ATOM 5649  C CA  . MET B 1 191 ? 14.311  64.520  -10.293  1.00 40.00 ? 195 MET B CA  1 
ATOM 5650  C C   . MET B 1 191 ? 15.814  64.635  -10.096  1.00 40.00 ? 195 MET B C   1 
ATOM 5651  O O   . MET B 1 191 ? 16.260  65.661  -9.562   1.00 40.00 ? 195 MET B O   1 
ATOM 5652  C CB  . MET B 1 191 ? 13.615  64.405  -8.930   1.00 40.00 ? 195 MET B CB  1 
ATOM 5653  C CG  . MET B 1 191 ? 12.298  65.156  -8.867   1.00 40.00 ? 195 MET B CG  1 
ATOM 5654  S SD  . MET B 1 191 ? 12.062  66.244  -10.300  1.00 40.00 ? 195 MET B SD  1 
ATOM 5655  C CE  . MET B 1 191 ? 10.413  66.868  -9.938   1.00 40.00 ? 195 MET B CE  1 
ATOM 5656  N N   . SER B 1 192 ? 16.563  63.666  -10.601  1.00 40.00 ? 196 SER B N   1 
ATOM 5657  C CA  . SER B 1 192 ? 18.024  63.766  -10.510  1.00 40.00 ? 196 SER B CA  1 
ATOM 5658  C C   . SER B 1 192 ? 18.645  63.358  -11.848  1.00 40.00 ? 196 SER B C   1 
ATOM 5659  O O   . SER B 1 192 ? 19.261  62.321  -12.094  1.00 40.00 ? 196 SER B O   1 
ATOM 5660  C CB  . SER B 1 192 ? 18.536  63.152  -9.252   1.00 40.00 ? 196 SER B CB  1 
ATOM 5661  O OG  . SER B 1 192 ? 19.451  62.100  -9.399   1.00 40.00 ? 196 SER B OG  1 
ATOM 5662  N N   . VAL B 1 193 ? 18.427  64.294  -12.795  1.00 40.00 ? 197 VAL B N   1 
ATOM 5663  C CA  . VAL B 1 193 ? 18.948  64.203  -14.152  1.00 40.00 ? 197 VAL B CA  1 
ATOM 5664  C C   . VAL B 1 193 ? 20.277  64.974  -14.191  1.00 40.00 ? 197 VAL B C   1 
ATOM 5665  O O   . VAL B 1 193 ? 20.338  66.181  -13.939  1.00 40.00 ? 197 VAL B O   1 
ATOM 5666  C CB  . VAL B 1 193 ? 17.972  64.849  -15.153  1.00 40.00 ? 197 VAL B CB  1 
ATOM 5667  C CG1 . VAL B 1 193 ? 18.610  65.175  -16.480  1.00 40.00 ? 197 VAL B CG1 1 
ATOM 5668  C CG2 . VAL B 1 193 ? 16.764  63.935  -15.355  1.00 40.00 ? 197 VAL B CG2 1 
ATOM 5669  N N   . THR B 1 194 ? 21.340  64.245  -14.484  1.00 40.00 ? 198 THR B N   1 
ATOM 5670  C CA  . THR B 1 194 ? 22.670  64.846  -14.596  1.00 40.00 ? 198 THR B CA  1 
ATOM 5671  C C   . THR B 1 194 ? 23.173  64.694  -16.026  1.00 40.00 ? 198 THR B C   1 
ATOM 5672  O O   . THR B 1 194 ? 23.538  63.569  -16.429  1.00 40.00 ? 198 THR B O   1 
ATOM 5673  C CB  . THR B 1 194 ? 23.628  64.203  -13.582  1.00 40.00 ? 198 THR B CB  1 
ATOM 5674  O OG1 . THR B 1 194 ? 23.480  64.924  -12.351  1.00 40.00 ? 198 THR B OG1 1 
ATOM 5675  C CG2 . THR B 1 194 ? 25.089  64.230  -13.990  1.00 40.00 ? 198 THR B CG2 1 
ATOM 5676  N N   . LEU B 1 195 ? 23.183  65.773  -16.817  1.00 40.00 ? 199 LEU B N   1 
ATOM 5677  C CA  . LEU B 1 195 ? 23.678  65.649  -18.200  1.00 40.00 ? 199 LEU B CA  1 
ATOM 5678  C C   . LEU B 1 195 ? 25.193  65.475  -18.198  1.00 40.00 ? 199 LEU B C   1 
ATOM 5679  O O   . LEU B 1 195 ? 25.858  66.094  -17.364  1.00 40.00 ? 199 LEU B O   1 
ATOM 5680  C CB  . LEU B 1 195 ? 23.385  66.924  -19.031  1.00 40.00 ? 199 LEU B CB  1 
ATOM 5681  C CG  . LEU B 1 195 ? 21.931  67.369  -19.113  1.00 40.00 ? 199 LEU B CG  1 
ATOM 5682  C CD1 . LEU B 1 195 ? 21.755  68.704  -19.820  1.00 40.00 ? 199 LEU B CD1 1 
ATOM 5683  C CD2 . LEU B 1 195 ? 21.090  66.282  -19.801  1.00 40.00 ? 199 LEU B CD2 1 
ATOM 5684  N N   . PHE B 1 196 ? 25.759  64.731  -19.133  1.00 40.00 ? 200 PHE B N   1 
ATOM 5685  C CA  . PHE B 1 196 ? 27.222  64.678  -19.181  1.00 40.00 ? 200 PHE B CA  1 
ATOM 5686  C C   . PHE B 1 196 ? 27.737  64.306  -20.569  1.00 40.00 ? 200 PHE B C   1 
ATOM 5687  O O   . PHE B 1 196 ? 27.375  63.272  -21.140  1.00 40.00 ? 200 PHE B O   1 
ATOM 5688  C CB  . PHE B 1 196 ? 27.822  63.841  -18.099  1.00 40.00 ? 200 PHE B CB  1 
ATOM 5689  C CG  . PHE B 1 196 ? 27.911  62.367  -18.334  1.00 40.00 ? 200 PHE B CG  1 
ATOM 5690  C CD1 . PHE B 1 196 ? 26.759  61.615  -18.569  1.00 40.00 ? 200 PHE B CD1 1 
ATOM 5691  C CD2 . PHE B 1 196 ? 29.154  61.733  -18.309  1.00 40.00 ? 200 PHE B CD2 1 
ATOM 5692  C CE1 . PHE B 1 196 ? 26.865  60.243  -18.776  1.00 40.00 ? 200 PHE B CE1 1 
ATOM 5693  C CE2 . PHE B 1 196 ? 29.256  60.361  -18.514  1.00 40.00 ? 200 PHE B CE2 1 
ATOM 5694  C CZ  . PHE B 1 196 ? 28.116  59.610  -18.754  1.00 40.00 ? 200 PHE B CZ  1 
ATOM 5695  N N   . GLY B 1 197 ? 28.607  65.156  -21.124  1.00 40.00 ? 201 GLY B N   1 
ATOM 5696  C CA  . GLY B 1 197 ? 29.186  64.881  -22.425  1.00 40.00 ? 201 GLY B CA  1 
ATOM 5697  C C   . GLY B 1 197 ? 30.581  65.424  -22.641  1.00 40.00 ? 201 GLY B C   1 
ATOM 5698  O O   . GLY B 1 197 ? 31.114  66.294  -21.955  1.00 40.00 ? 201 GLY B O   1 
ATOM 5699  N N   . GLU B 1 198 ? 31.229  64.955  -23.681  1.00 40.00 ? 202 GLU B N   1 
ATOM 5700  C CA  . GLU B 1 198 ? 32.564  65.361  -24.090  1.00 40.00 ? 202 GLU B CA  1 
ATOM 5701  C C   . GLU B 1 198 ? 32.533  66.213  -25.347  1.00 40.00 ? 202 GLU B C   1 
ATOM 5702  O O   . GLU B 1 198 ? 31.464  66.465  -25.898  1.00 40.00 ? 202 GLU B O   1 
ATOM 5703  C CB  . GLU B 1 198 ? 33.384  64.084  -24.234  1.00 40.00 ? 202 GLU B CB  1 
ATOM 5704  C CG  . GLU B 1 198 ? 34.876  64.377  -24.165  1.00 40.00 ? 202 GLU B CG  1 
ATOM 5705  C CD  . GLU B 1 198 ? 35.392  64.373  -25.602  1.00 40.00 ? 202 GLU B CD  1 
ATOM 5706  O OE1 . GLU B 1 198 ? 34.500  64.441  -26.478  1.00 40.00 ? 202 GLU B OE1 1 
ATOM 5707  O OE2 . GLU B 1 198 ? 36.627  64.316  -25.808  1.00 40.00 ? 202 GLU B OE2 1 
ATOM 5708  N N   . SER B 1 199 ? 33.634  66.742  -25.819  1.00 40.00 ? 203 SER B N   1 
ATOM 5709  C CA  . SER B 1 199 ? 33.745  67.618  -26.983  1.00 40.00 ? 203 SER B CA  1 
ATOM 5710  C C   . SER B 1 199 ? 32.475  68.407  -27.244  1.00 40.00 ? 203 SER B C   1 
ATOM 5711  O O   . SER B 1 199 ? 31.978  69.141  -26.353  1.00 40.00 ? 203 SER B O   1 
ATOM 5712  C CB  . SER B 1 199 ? 34.230  66.848  -28.195  1.00 40.00 ? 203 SER B CB  1 
ATOM 5713  O OG  . SER B 1 199 ? 34.859  67.590  -29.215  1.00 40.00 ? 203 SER B OG  1 
ATOM 5714  N N   . ALA B 1 200 ? 31.850  68.263  -28.434  1.00 40.00 ? 204 ALA B N   1 
ATOM 5715  C CA  . ALA B 1 200 ? 30.631  69.053  -28.660  1.00 40.00 ? 204 ALA B CA  1 
ATOM 5716  C C   . ALA B 1 200 ? 29.468  68.594  -27.803  1.00 40.00 ? 204 ALA B C   1 
ATOM 5717  O O   . ALA B 1 200 ? 28.512  69.355  -27.543  1.00 40.00 ? 204 ALA B O   1 
ATOM 5718  C CB  . ALA B 1 200 ? 30.302  69.273  -30.097  1.00 40.00 ? 204 ALA B CB  1 
ATOM 5719  N N   . GLY B 1 201 ? 29.490  67.373  -27.276  1.00 40.00 ? 205 GLY B N   1 
ATOM 5720  C CA  . GLY B 1 201 ? 28.415  66.961  -26.330  1.00 40.00 ? 205 GLY B CA  1 
ATOM 5721  C C   . GLY B 1 201 ? 28.537  67.861  -25.078  1.00 40.00 ? 205 GLY B C   1 
ATOM 5722  O O   . GLY B 1 201 ? 27.542  68.418  -24.617  1.00 40.00 ? 205 GLY B O   1 
ATOM 5723  N N   . ALA B 1 202 ? 29.764  68.045  -24.586  1.00 40.00 ? 206 ALA B N   1 
ATOM 5724  C CA  . ALA B 1 202 ? 30.007  68.970  -23.479  1.00 40.00 ? 206 ALA B CA  1 
ATOM 5725  C C   . ALA B 1 202 ? 29.488  70.362  -23.866  1.00 40.00 ? 206 ALA B C   1 
ATOM 5726  O O   . ALA B 1 202 ? 28.653  70.958  -23.177  1.00 40.00 ? 206 ALA B O   1 
ATOM 5727  C CB  . ALA B 1 202 ? 31.514  69.069  -23.272  1.00 40.00 ? 206 ALA B CB  1 
ATOM 5728  N N   . ALA B 1 203 ? 29.896  70.799  -25.080  1.00 40.00 ? 207 ALA B N   1 
ATOM 5729  C CA  . ALA B 1 203 ? 29.448  72.071  -25.594  1.00 40.00 ? 207 ALA B CA  1 
ATOM 5730  C C   . ALA B 1 203 ? 27.932  72.154  -25.554  1.00 40.00 ? 207 ALA B C   1 
ATOM 5731  O O   . ALA B 1 203 ? 27.333  73.203  -25.335  1.00 40.00 ? 207 ALA B O   1 
ATOM 5732  C CB  . ALA B 1 203 ? 29.838  72.268  -27.048  1.00 40.00 ? 207 ALA B CB  1 
ATOM 5733  N N   . SER B 1 204 ? 27.333  71.005  -25.854  1.00 40.00 ? 208 SER B N   1 
ATOM 5734  C CA  . SER B 1 204 ? 25.886  70.879  -25.896  1.00 40.00 ? 208 SER B CA  1 
ATOM 5735  C C   . SER B 1 204 ? 25.293  71.040  -24.513  1.00 40.00 ? 208 SER B C   1 
ATOM 5736  O O   . SER B 1 204 ? 24.437  71.903  -24.224  1.00 40.00 ? 208 SER B O   1 
ATOM 5737  C CB  . SER B 1 204 ? 25.540  69.501  -26.469  1.00 40.00 ? 208 SER B CB  1 
ATOM 5738  O OG  . SER B 1 204 ? 25.930  69.411  -27.816  1.00 40.00 ? 208 SER B OG  1 
ATOM 5739  N N   . VAL B 1 205 ? 25.845  70.187  -23.609  1.00 40.00 ? 209 VAL B N   1 
ATOM 5740  C CA  . VAL B 1 205 ? 25.380  70.279  -22.216  1.00 40.00 ? 209 VAL B CA  1 
ATOM 5741  C C   . VAL B 1 205 ? 25.414  71.783  -21.854  1.00 40.00 ? 209 VAL B C   1 
ATOM 5742  O O   . VAL B 1 205 ? 24.469  72.292  -21.230  1.00 40.00 ? 209 VAL B O   1 
ATOM 5743  C CB  . VAL B 1 205 ? 26.369  69.618  -21.244  1.00 40.00 ? 209 VAL B CB  1 
ATOM 5744  C CG1 . VAL B 1 205 ? 25.997  70.023  -19.828  1.00 40.00 ? 209 VAL B CG1 1 
ATOM 5745  C CG2 . VAL B 1 205 ? 26.403  68.103  -21.358  1.00 40.00 ? 209 VAL B CG2 1 
ATOM 5746  N N   . GLY B 1 206 ? 26.532  72.439  -22.281  1.00 40.00 ? 210 GLY B N   1 
ATOM 5747  C CA  . GLY B 1 206 ? 26.635  73.852  -21.981  1.00 40.00 ? 210 GLY B CA  1 
ATOM 5748  C C   . GLY B 1 206 ? 25.441  74.652  -22.479  1.00 40.00 ? 210 GLY B C   1 
ATOM 5749  O O   . GLY B 1 206 ? 24.881  75.558  -21.840  1.00 40.00 ? 210 GLY B O   1 
ATOM 5750  N N   . MET B 1 207 ? 25.027  74.300  -23.710  1.00 40.00 ? 211 MET B N   1 
ATOM 5751  C CA  . MET B 1 207 ? 23.904  75.055  -24.308  1.00 40.00 ? 211 MET B CA  1 
ATOM 5752  C C   . MET B 1 207 ? 22.597  74.773  -23.624  1.00 40.00 ? 211 MET B C   1 
ATOM 5753  O O   . MET B 1 207 ? 21.675  75.602  -23.452  1.00 40.00 ? 211 MET B O   1 
ATOM 5754  C CB  . MET B 1 207 ? 23.946  74.875  -25.817  1.00 40.00 ? 211 MET B CB  1 
ATOM 5755  C CG  . MET B 1 207 ? 24.968  75.883  -26.353  1.00 40.00 ? 211 MET B CG  1 
ATOM 5756  S SD  . MET B 1 207 ? 25.305  75.739  -28.074  1.00 40.00 ? 211 MET B SD  1 
ATOM 5757  C CE  . MET B 1 207 ? 26.795  74.715  -28.093  1.00 40.00 ? 211 MET B CE  1 
ATOM 5758  N N   . HIS B 1 208 ? 22.533  73.532  -23.074  1.00 40.00 ? 212 HIS B N   1 
ATOM 5759  C CA  . HIS B 1 208 ? 21.271  73.313  -22.334  1.00 40.00 ? 212 HIS B CA  1 
ATOM 5760  C C   . HIS B 1 208 ? 21.254  74.258  -21.156  1.00 40.00 ? 212 HIS B C   1 
ATOM 5761  O O   . HIS B 1 208 ? 20.226  74.941  -21.016  1.00 40.00 ? 212 HIS B O   1 
ATOM 5762  C CB  . HIS B 1 208 ? 21.033  71.851  -22.042  1.00 40.00 ? 212 HIS B CB  1 
ATOM 5763  C CG  . HIS B 1 208 ? 20.664  71.128  -23.331  1.00 40.00 ? 212 HIS B CG  1 
ATOM 5764  N ND1 . HIS B 1 208 ? 21.277  69.969  -23.721  1.00 40.00 ? 212 HIS B ND1 1 
ATOM 5765  C CD2 . HIS B 1 208 ? 19.790  71.453  -24.296  1.00 40.00 ? 212 HIS B CD2 1 
ATOM 5766  C CE1 . HIS B 1 208 ? 20.789  69.587  -24.886  1.00 40.00 ? 212 HIS B CE1 1 
ATOM 5767  N NE2 . HIS B 1 208 ? 19.875  70.482  -25.256  1.00 40.00 ? 212 HIS B NE2 1 
ATOM 5768  N N   . ILE B 1 209 ? 22.347  74.371  -20.404  1.00 40.00 ? 213 ILE B N   1 
ATOM 5769  C CA  . ILE B 1 209 ? 22.385  75.293  -19.267  1.00 40.00 ? 213 ILE B CA  1 
ATOM 5770  C C   . ILE B 1 209 ? 22.079  76.723  -19.717  1.00 40.00 ? 213 ILE B C   1 
ATOM 5771  O O   . ILE B 1 209 ? 21.450  77.514  -19.023  1.00 40.00 ? 213 ILE B O   1 
ATOM 5772  C CB  . ILE B 1 209 ? 23.786  75.329  -18.648  1.00 40.00 ? 213 ILE B CB  1 
ATOM 5773  C CG1 . ILE B 1 209 ? 24.136  74.055  -17.896  1.00 40.00 ? 213 ILE B CG1 1 
ATOM 5774  C CG2 . ILE B 1 209 ? 23.942  76.533  -17.751  1.00 40.00 ? 213 ILE B CG2 1 
ATOM 5775  C CD1 . ILE B 1 209 ? 25.626  74.014  -17.518  1.00 40.00 ? 213 ILE B CD1 1 
ATOM 5776  N N   . LEU B 1 210 ? 22.554  77.091  -20.908  1.00 40.00 ? 214 LEU B N   1 
ATOM 5777  C CA  . LEU B 1 210 ? 22.373  78.435  -21.411  1.00 40.00 ? 214 LEU B CA  1 
ATOM 5778  C C   . LEU B 1 210 ? 20.991  78.656  -21.992  1.00 40.00 ? 214 LEU B C   1 
ATOM 5779  O O   . LEU B 1 210 ? 20.605  79.793  -22.294  1.00 40.00 ? 214 LEU B O   1 
ATOM 5780  C CB  . LEU B 1 210 ? 23.450  78.647  -22.487  1.00 40.00 ? 214 LEU B CB  1 
ATOM 5781  C CG  . LEU B 1 210 ? 24.720  79.398  -22.136  1.00 40.00 ? 214 LEU B CG  1 
ATOM 5782  C CD1 . LEU B 1 210 ? 24.603  80.106  -20.783  1.00 40.00 ? 214 LEU B CD1 1 
ATOM 5783  C CD2 . LEU B 1 210 ? 25.918  78.449  -22.153  1.00 40.00 ? 214 LEU B CD2 1 
ATOM 5784  N N   . SER B 1 211 ? 20.278  77.555  -22.218  1.00 40.00 ? 215 SER B N   1 
ATOM 5785  C CA  . SER B 1 211 ? 18.947  77.663  -22.842  1.00 40.00 ? 215 SER B CA  1 
ATOM 5786  C C   . SER B 1 211 ? 17.824  77.492  -21.843  1.00 40.00 ? 215 SER B C   1 
ATOM 5787  O O   . SER B 1 211 ? 17.760  76.453  -21.153  1.00 40.00 ? 215 SER B O   1 
ATOM 5788  C CB  . SER B 1 211 ? 18.891  76.607  -23.952  1.00 40.00 ? 215 SER B CB  1 
ATOM 5789  O OG  . SER B 1 211 ? 17.932  76.964  -24.922  1.00 40.00 ? 215 SER B OG  1 
ATOM 5790  N N   . LEU B 1 212 ? 16.918  78.483  -21.742  1.00 40.00 ? 216 LEU B N   1 
ATOM 5791  C CA  . LEU B 1 212 ? 15.891  78.311  -20.709  1.00 40.00 ? 216 LEU B CA  1 
ATOM 5792  C C   . LEU B 1 212 ? 15.162  77.011  -20.737  1.00 40.00 ? 216 LEU B C   1 
ATOM 5793  O O   . LEU B 1 212 ? 15.341  76.136  -19.877  1.00 40.00 ? 216 LEU B O   1 
ATOM 5794  C CB  . LEU B 1 212 ? 14.984  79.512  -20.529  1.00 40.00 ? 216 LEU B CB  1 
ATOM 5795  C CG  . LEU B 1 212 ? 15.390  80.376  -19.315  1.00 40.00 ? 216 LEU B CG  1 
ATOM 5796  C CD1 . LEU B 1 212 ? 16.818  80.117  -18.824  1.00 40.00 ? 216 LEU B CD1 1 
ATOM 5797  C CD2 . LEU B 1 212 ? 15.258  81.864  -19.656  1.00 40.00 ? 216 LEU B CD2 1 
ATOM 5798  N N   . PRO B 1 213 ? 14.353  76.789  -21.749  1.00 40.00 ? 217 PRO B N   1 
ATOM 5799  C CA  . PRO B 1 213 ? 13.618  75.544  -21.894  1.00 40.00 ? 217 PRO B CA  1 
ATOM 5800  C C   . PRO B 1 213 ? 14.457  74.351  -21.567  1.00 40.00 ? 217 PRO B C   1 
ATOM 5801  O O   . PRO B 1 213 ? 13.930  73.434  -20.878  1.00 40.00 ? 217 PRO B O   1 
ATOM 5802  C CB  . PRO B 1 213 ? 13.104  75.577  -23.301  1.00 40.00 ? 217 PRO B CB  1 
ATOM 5803  C CG  . PRO B 1 213 ? 12.952  77.043  -23.590  1.00 40.00 ? 217 PRO B CG  1 
ATOM 5804  C CD  . PRO B 1 213 ? 14.064  77.742  -22.844  1.00 40.00 ? 217 PRO B CD  1 
ATOM 5805  N N   . SER B 1 214 ? 15.742  74.220  -21.858  1.00 40.00 ? 218 SER B N   1 
ATOM 5806  C CA  . SER B 1 214 ? 16.370  72.956  -21.390  1.00 40.00 ? 218 SER B CA  1 
ATOM 5807  C C   . SER B 1 214 ? 16.492  72.856  -19.888  1.00 40.00 ? 218 SER B C   1 
ATOM 5808  O O   . SER B 1 214 ? 16.769  71.782  -19.316  1.00 40.00 ? 218 SER B O   1 
ATOM 5809  C CB  . SER B 1 214 ? 17.716  72.788  -22.116  1.00 40.00 ? 218 SER B CB  1 
ATOM 5810  O OG  . SER B 1 214 ? 17.410  72.584  -23.524  1.00 40.00 ? 218 SER B OG  1 
ATOM 5811  N N   . ARG B 1 215 ? 16.334  73.933  -19.138  1.00 40.00 ? 219 ARG B N   1 
ATOM 5812  C CA  . ARG B 1 215 ? 16.554  73.990  -17.715  1.00 40.00 ? 219 ARG B CA  1 
ATOM 5813  C C   . ARG B 1 215 ? 15.821  73.008  -16.854  1.00 40.00 ? 219 ARG B C   1 
ATOM 5814  O O   . ARG B 1 215 ? 16.392  72.240  -16.054  1.00 40.00 ? 219 ARG B O   1 
ATOM 5815  C CB  . ARG B 1 215 ? 16.273  75.421  -17.212  1.00 40.00 ? 219 ARG B CB  1 
ATOM 5816  C CG  . ARG B 1 215 ? 17.291  76.436  -17.722  1.00 40.00 ? 219 ARG B CG  1 
ATOM 5817  C CD  . ARG B 1 215 ? 18.717  76.084  -17.335  1.00 40.00 ? 219 ARG B CD  1 
ATOM 5818  N NE  . ARG B 1 215 ? 18.965  76.296  -15.908  1.00 40.00 ? 219 ARG B NE  1 
ATOM 5819  C CZ  . ARG B 1 215 ? 20.176  76.333  -15.369  1.00 40.00 ? 219 ARG B CZ  1 
ATOM 5820  N NH1 . ARG B 1 215 ? 21.227  76.178  -16.165  1.00 40.00 ? 219 ARG B NH1 1 
ATOM 5821  N NH2 . ARG B 1 215 ? 20.384  76.521  -14.069  1.00 40.00 ? 219 ARG B NH2 1 
ATOM 5822  N N   . SER B 1 216 ? 14.486  72.987  -17.014  1.00 40.00 ? 220 SER B N   1 
ATOM 5823  C CA  . SER B 1 216 ? 13.661  72.079  -16.244  1.00 40.00 ? 220 SER B CA  1 
ATOM 5824  C C   . SER B 1 216 ? 13.946  70.626  -16.534  1.00 40.00 ? 220 SER B C   1 
ATOM 5825  O O   . SER B 1 216 ? 13.211  69.814  -15.957  1.00 40.00 ? 220 SER B O   1 
ATOM 5826  C CB  . SER B 1 216 ? 12.172  72.279  -16.572  1.00 40.00 ? 220 SER B CB  1 
ATOM 5827  O OG  . SER B 1 216 ? 12.066  72.950  -17.804  1.00 40.00 ? 220 SER B OG  1 
ATOM 5828  N N   . LEU B 1 217 ? 14.849  70.245  -17.403  1.00 40.00 ? 221 LEU B N   1 
ATOM 5829  C CA  . LEU B 1 217 ? 14.948  68.826  -17.691  1.00 40.00 ? 221 LEU B CA  1 
ATOM 5830  C C   . LEU B 1 217 ? 16.186  68.198  -17.127  1.00 40.00 ? 221 LEU B C   1 
ATOM 5831  O O   . LEU B 1 217 ? 16.448  67.010  -17.380  1.00 40.00 ? 221 LEU B O   1 
ATOM 5832  C CB  . LEU B 1 217 ? 14.795  68.617  -19.193  1.00 40.00 ? 221 LEU B CB  1 
ATOM 5833  C CG  . LEU B 1 217 ? 14.141  69.689  -20.073  1.00 40.00 ? 221 LEU B CG  1 
ATOM 5834  C CD1 . LEU B 1 217 ? 14.215  69.158  -21.499  1.00 40.00 ? 221 LEU B CD1 1 
ATOM 5835  C CD2 . LEU B 1 217 ? 12.691  69.950  -19.716  1.00 40.00 ? 221 LEU B CD2 1 
ATOM 5836  N N   . PHE B 1 218 ? 16.947  68.976  -16.382  1.00 40.00 ? 222 PHE B N   1 
ATOM 5837  C CA  . PHE B 1 218 ? 18.162  68.395  -15.789  1.00 40.00 ? 222 PHE B CA  1 
ATOM 5838  C C   . PHE B 1 218 ? 18.513  69.206  -14.553  1.00 40.00 ? 222 PHE B C   1 
ATOM 5839  O O   . PHE B 1 218 ? 17.987  70.309  -14.362  1.00 40.00 ? 222 PHE B O   1 
ATOM 5840  C CB  . PHE B 1 218 ? 19.313  68.373  -16.770  1.00 40.00 ? 222 PHE B CB  1 
ATOM 5841  C CG  . PHE B 1 218 ? 19.825  69.762  -17.076  1.00 40.00 ? 222 PHE B CG  1 
ATOM 5842  C CD1 . PHE B 1 218 ? 19.041  70.608  -17.853  1.00 40.00 ? 222 PHE B CD1 1 
ATOM 5843  C CD2 . PHE B 1 218 ? 21.059  70.171  -16.575  1.00 40.00 ? 222 PHE B CD2 1 
ATOM 5844  C CE1 . PHE B 1 218 ? 19.508  71.872  -18.146  1.00 40.00 ? 222 PHE B CE1 1 
ATOM 5845  C CE2 . PHE B 1 218 ? 21.520  71.432  -16.876  1.00 40.00 ? 222 PHE B CE2 1 
ATOM 5846  C CZ  . PHE B 1 218 ? 20.746  72.277  -17.658  1.00 40.00 ? 222 PHE B CZ  1 
ATOM 5847  N N   . HIS B 1 219 ? 19.329  68.624  -13.678  1.00 40.00 ? 223 HIS B N   1 
ATOM 5848  C CA  . HIS B 1 219 ? 19.631  69.331  -12.423  1.00 40.00 ? 223 HIS B CA  1 
ATOM 5849  C C   . HIS B 1 219 ? 21.111  69.549  -12.210  1.00 40.00 ? 223 HIS B C   1 
ATOM 5850  O O   . HIS B 1 219 ? 21.538  70.589  -11.700  1.00 40.00 ? 223 HIS B O   1 
ATOM 5851  C CB  . HIS B 1 219 ? 18.945  68.542  -11.295  1.00 40.00 ? 223 HIS B CB  1 
ATOM 5852  C CG  . HIS B 1 219 ? 17.510  68.176  -11.587  1.00 40.00 ? 223 HIS B CG  1 
ATOM 5853  N ND1 . HIS B 1 219 ? 17.123  66.987  -12.177  1.00 40.00 ? 223 HIS B ND1 1 
ATOM 5854  C CD2 . HIS B 1 219 ? 16.377  68.908  -11.400  1.00 40.00 ? 223 HIS B CD2 1 
ATOM 5855  C CE1 . HIS B 1 219 ? 15.811  67.012  -12.327  1.00 40.00 ? 223 HIS B CE1 1 
ATOM 5856  N NE2 . HIS B 1 219 ? 15.323  68.146  -11.848  1.00 40.00 ? 223 HIS B NE2 1 
ATOM 5857  N N   . ARG B 1 220 ? 21.946  68.599  -12.605  1.00 40.00 ? 224 ARG B N   1 
ATOM 5858  C CA  . ARG B 1 220 ? 23.399  68.704  -12.522  1.00 40.00 ? 224 ARG B CA  1 
ATOM 5859  C C   . ARG B 1 220 ? 24.000  68.589  -13.917  1.00 40.00 ? 224 ARG B C   1 
ATOM 5860  O O   . ARG B 1 220 ? 23.293  68.147  -14.838  1.00 40.00 ? 224 ARG B O   1 
ATOM 5861  C CB  . ARG B 1 220 ? 23.920  67.699  -11.499  1.00 40.00 ? 224 ARG B CB  1 
ATOM 5862  C CG  . ARG B 1 220 ? 23.908  68.261  -10.088  1.00 40.00 ? 224 ARG B CG  1 
ATOM 5863  C CD  . ARG B 1 220 ? 24.302  67.277  -8.995   1.00 40.00 ? 224 ARG B CD  1 
ATOM 5864  N NE  . ARG B 1 220 ? 23.420  66.133  -8.930   1.00 40.00 ? 224 ARG B NE  1 
ATOM 5865  C CZ  . ARG B 1 220 ? 22.132  66.140  -8.612   1.00 40.00 ? 224 ARG B CZ  1 
ATOM 5866  N NH1 . ARG B 1 220 ? 21.482  67.249  -8.266   1.00 40.00 ? 224 ARG B NH1 1 
ATOM 5867  N NH2 . ARG B 1 220 ? 21.493  64.967  -8.659   1.00 40.00 ? 224 ARG B NH2 1 
ATOM 5868  N N   . ALA B 1 221 ? 25.239  68.992  -14.152  1.00 40.00 ? 225 ALA B N   1 
ATOM 5869  C CA  . ALA B 1 221 ? 25.868  68.962  -15.469  1.00 40.00 ? 225 ALA B CA  1 
ATOM 5870  C C   . ALA B 1 221 ? 27.371  68.707  -15.441  1.00 40.00 ? 225 ALA B C   1 
ATOM 5871  O O   . ALA B 1 221 ? 28.055  69.234  -14.548  1.00 40.00 ? 225 ALA B O   1 
ATOM 5872  C CB  . ALA B 1 221 ? 25.694  70.342  -16.140  1.00 40.00 ? 225 ALA B CB  1 
ATOM 5873  N N   . VAL B 1 222 ? 27.897  67.953  -16.379  1.00 40.00 ? 226 VAL B N   1 
ATOM 5874  C CA  . VAL B 1 222 ? 29.329  67.701  -16.458  1.00 40.00 ? 226 VAL B CA  1 
ATOM 5875  C C   . VAL B 1 222 ? 29.735  68.138  -17.871  1.00 40.00 ? 226 VAL B C   1 
ATOM 5876  O O   . VAL B 1 222 ? 28.896  68.034  -18.806  1.00 40.00 ? 226 VAL B O   1 
ATOM 5877  C CB  . VAL B 1 222 ? 29.671  66.220  -16.343  1.00 40.00 ? 226 VAL B CB  1 
ATOM 5878  C CG1 . VAL B 1 222 ? 31.164  65.936  -16.382  1.00 40.00 ? 226 VAL B CG1 1 
ATOM 5879  C CG2 . VAL B 1 222 ? 29.024  65.616  -15.118  1.00 40.00 ? 226 VAL B CG2 1 
ATOM 5880  N N   . LEU B 1 223 ? 30.917  68.703  -18.072  1.00 40.00 ? 227 LEU B N   1 
ATOM 5881  C CA  . LEU B 1 223 ? 31.314  69.140  -19.420  1.00 40.00 ? 227 LEU B CA  1 
ATOM 5882  C C   . LEU B 1 223 ? 32.755  68.698  -19.595  1.00 40.00 ? 227 LEU B C   1 
ATOM 5883  O O   . LEU B 1 223 ? 33.599  69.343  -18.969  1.00 40.00 ? 227 LEU B O   1 
ATOM 5884  C CB  . LEU B 1 223 ? 31.229  70.656  -19.501  1.00 40.00 ? 227 LEU B CB  1 
ATOM 5885  C CG  . LEU B 1 223 ? 29.866  71.313  -19.381  1.00 40.00 ? 227 LEU B CG  1 
ATOM 5886  C CD1 . LEU B 1 223 ? 29.393  71.498  -17.959  1.00 40.00 ? 227 LEU B CD1 1 
ATOM 5887  C CD2 . LEU B 1 223 ? 29.854  72.722  -19.990  1.00 40.00 ? 227 LEU B CD2 1 
ATOM 5888  N N   . GLN B 1 224 ? 33.035  67.651  -20.306  1.00 40.00 ? 228 GLN B N   1 
ATOM 5889  C CA  . GLN B 1 224 ? 34.394  67.178  -20.481  1.00 40.00 ? 228 GLN B CA  1 
ATOM 5890  C C   . GLN B 1 224 ? 35.014  67.657  -21.787  1.00 40.00 ? 228 GLN B C   1 
ATOM 5891  O O   . GLN B 1 224 ? 34.499  67.501  -22.899  1.00 40.00 ? 228 GLN B O   1 
ATOM 5892  C CB  . GLN B 1 224 ? 34.414  65.643  -20.435  1.00 40.00 ? 228 GLN B CB  1 
ATOM 5893  C CG  . GLN B 1 224 ? 33.441  65.073  -19.406  1.00 40.00 ? 228 GLN B CG  1 
ATOM 5894  C CD  . GLN B 1 224 ? 33.396  63.551  -19.437  1.00 40.00 ? 228 GLN B CD  1 
ATOM 5895  O OE1 . GLN B 1 224 ? 32.437  62.949  -18.950  1.00 40.00 ? 228 GLN B OE1 1 
ATOM 5896  N NE2 . GLN B 1 224 ? 34.439  62.945  -19.992  1.00 40.00 ? 228 GLN B NE2 1 
ATOM 5897  N N   . SER B 1 225 ? 36.200  68.278  -21.682  1.00 40.00 ? 229 SER B N   1 
ATOM 5898  C CA  . SER B 1 225 ? 36.939  68.757  -22.834  1.00 40.00 ? 229 SER B CA  1 
ATOM 5899  C C   . SER B 1 225 ? 36.077  69.604  -23.759  1.00 40.00 ? 229 SER B C   1 
ATOM 5900  O O   . SER B 1 225 ? 36.343  69.511  -24.981  1.00 40.00 ? 229 SER B O   1 
ATOM 5901  C CB  . SER B 1 225 ? 37.456  67.561  -23.651  1.00 40.00 ? 229 SER B CB  1 
ATOM 5902  O OG  . SER B 1 225 ? 38.573  66.920  -23.124  1.00 40.00 ? 229 SER B OG  1 
ATOM 5903  N N   . GLY B 1 226 ? 35.140  70.434  -23.304  1.00 40.00 ? 230 GLY B N   1 
ATOM 5904  C CA  . GLY B 1 226 ? 34.439  71.218  -24.324  1.00 40.00 ? 230 GLY B CA  1 
ATOM 5905  C C   . GLY B 1 226 ? 33.504  72.202  -23.751  1.00 40.00 ? 230 GLY B C   1 
ATOM 5906  O O   . GLY B 1 226 ? 33.038  71.905  -22.643  1.00 40.00 ? 230 GLY B O   1 
ATOM 5907  N N   . THR B 1 227 ? 33.170  73.351  -24.303  1.00 40.00 ? 231 THR B N   1 
ATOM 5908  C CA  . THR B 1 227 ? 32.215  74.284  -23.624  1.00 40.00 ? 231 THR B CA  1 
ATOM 5909  C C   . THR B 1 227 ? 31.334  74.969  -24.644  1.00 40.00 ? 231 THR B C   1 
ATOM 5910  O O   . THR B 1 227 ? 31.602  74.927  -25.854  1.00 40.00 ? 231 THR B O   1 
ATOM 5911  C CB  . THR B 1 227 ? 32.986  75.467  -23.037  1.00 40.00 ? 231 THR B CB  1 
ATOM 5912  O OG1 . THR B 1 227 ? 33.631  76.113  -24.189  1.00 40.00 ? 231 THR B OG1 1 
ATOM 5913  C CG2 . THR B 1 227 ? 34.016  75.047  -22.014  1.00 40.00 ? 231 THR B CG2 1 
ATOM 5914  N N   . PRO B 1 228 ? 30.334  75.708  -24.238  1.00 40.00 ? 232 PRO B N   1 
ATOM 5915  C CA  . PRO B 1 228 ? 29.502  76.364  -25.248  1.00 40.00 ? 232 PRO B CA  1 
ATOM 5916  C C   . PRO B 1 228 ? 30.131  77.667  -25.688  1.00 40.00 ? 232 PRO B C   1 
ATOM 5917  O O   . PRO B 1 228 ? 29.665  78.298  -26.624  1.00 40.00 ? 232 PRO B O   1 
ATOM 5918  C CB  . PRO B 1 228 ? 28.222  76.683  -24.478  1.00 40.00 ? 232 PRO B CB  1 
ATOM 5919  C CG  . PRO B 1 228 ? 28.724  76.938  -23.087  1.00 40.00 ? 232 PRO B CG  1 
ATOM 5920  C CD  . PRO B 1 228 ? 29.864  75.945  -22.879  1.00 40.00 ? 232 PRO B CD  1 
ATOM 5921  N N   . ASN B 1 229 ? 31.139  78.135  -24.957  1.00 40.00 ? 233 ASN B N   1 
ATOM 5922  C CA  . ASN B 1 229 ? 31.641  79.473  -25.209  1.00 40.00 ? 233 ASN B CA  1 
ATOM 5923  C C   . ASN B 1 229 ? 32.841  79.647  -26.059  1.00 40.00 ? 233 ASN B C   1 
ATOM 5924  O O   . ASN B 1 229 ? 33.059  80.797  -26.570  1.00 40.00 ? 233 ASN B O   1 
ATOM 5925  C CB  . ASN B 1 229 ? 31.717  80.155  -23.808  1.00 40.00 ? 233 ASN B CB  1 
ATOM 5926  C CG  . ASN B 1 229 ? 32.734  79.410  -22.938  1.00 40.00 ? 233 ASN B CG  1 
ATOM 5927  O OD1 . ASN B 1 229 ? 32.454  78.313  -22.472  1.00 40.00 ? 233 ASN B OD1 1 
ATOM 5928  N ND2 . ASN B 1 229 ? 33.903  79.993  -22.733  1.00 40.00 ? 233 ASN B ND2 1 
ATOM 5929  N N   . GLY B 1 230 ? 33.672  78.675  -26.389  1.00 40.00 ? 234 GLY B N   1 
ATOM 5930  C CA  . GLY B 1 230 ? 34.840  78.957  -27.239  1.00 40.00 ? 234 GLY B CA  1 
ATOM 5931  C C   . GLY B 1 230 ? 34.725  79.503  -28.632  1.00 40.00 ? 234 GLY B C   1 
ATOM 5932  O O   . GLY B 1 230 ? 33.750  80.099  -29.123  1.00 40.00 ? 234 GLY B O   1 
ATOM 5933  N N   . PRO B 1 231 ? 35.794  79.325  -29.437  1.00 40.00 ? 235 PRO B N   1 
ATOM 5934  C CA  . PRO B 1 231 ? 35.821  79.762  -30.821  1.00 40.00 ? 235 PRO B CA  1 
ATOM 5935  C C   . PRO B 1 231 ? 35.136  78.830  -31.814  1.00 40.00 ? 235 PRO B C   1 
ATOM 5936  O O   . PRO B 1 231 ? 34.850  79.216  -32.965  1.00 40.00 ? 235 PRO B O   1 
ATOM 5937  C CB  . PRO B 1 231 ? 37.311  79.780  -31.139  1.00 40.00 ? 235 PRO B CB  1 
ATOM 5938  C CG  . PRO B 1 231 ? 37.914  78.754  -30.261  1.00 40.00 ? 235 PRO B CG  1 
ATOM 5939  C CD  . PRO B 1 231 ? 37.057  78.646  -29.052  1.00 40.00 ? 235 PRO B CD  1 
ATOM 5940  N N   . TRP B 1 232 ? 34.836  77.578  -31.494  1.00 40.00 ? 236 TRP B N   1 
ATOM 5941  C CA  . TRP B 1 232 ? 34.287  76.692  -32.492  1.00 40.00 ? 236 TRP B CA  1 
ATOM 5942  C C   . TRP B 1 232 ? 32.903  76.111  -32.328  1.00 40.00 ? 236 TRP B C   1 
ATOM 5943  O O   . TRP B 1 232 ? 32.400  75.454  -33.263  1.00 40.00 ? 236 TRP B O   1 
ATOM 5944  C CB  . TRP B 1 232 ? 35.235  75.467  -32.559  1.00 40.00 ? 236 TRP B CB  1 
ATOM 5945  C CG  . TRP B 1 232 ? 35.357  74.770  -31.236  1.00 40.00 ? 236 TRP B CG  1 
ATOM 5946  C CD1 . TRP B 1 232 ? 36.346  74.975  -30.314  1.00 40.00 ? 236 TRP B CD1 1 
ATOM 5947  C CD2 . TRP B 1 232 ? 34.487  73.794  -30.657  1.00 40.00 ? 236 TRP B CD2 1 
ATOM 5948  N NE1 . TRP B 1 232 ? 36.160  74.180  -29.221  1.00 40.00 ? 236 TRP B NE1 1 
ATOM 5949  C CE2 . TRP B 1 232 ? 35.015  73.441  -29.400  1.00 40.00 ? 236 TRP B CE2 1 
ATOM 5950  C CE3 . TRP B 1 232 ? 33.303  73.176  -31.073  1.00 40.00 ? 236 TRP B CE3 1 
ATOM 5951  C CZ2 . TRP B 1 232 ? 34.430  72.491  -28.564  1.00 40.00 ? 236 TRP B CZ2 1 
ATOM 5952  C CZ3 . TRP B 1 232 ? 32.713  72.244  -30.245  1.00 40.00 ? 236 TRP B CZ3 1 
ATOM 5953  C CH2 . TRP B 1 232 ? 33.279  71.919  -28.997  1.00 40.00 ? 236 TRP B CH2 1 
ATOM 5954  N N   . ALA B 1 233 ? 32.274  76.244  -31.175  1.00 40.00 ? 237 ALA B N   1 
ATOM 5955  C CA  . ALA B 1 233 ? 30.979  75.624  -30.966  1.00 40.00 ? 237 ALA B CA  1 
ATOM 5956  C C   . ALA B 1 233 ? 29.836  76.513  -31.340  1.00 40.00 ? 237 ALA B C   1 
ATOM 5957  O O   . ALA B 1 233 ? 28.681  76.071  -31.138  1.00 40.00 ? 237 ALA B O   1 
ATOM 5958  C CB  . ALA B 1 233 ? 30.909  75.009  -29.591  1.00 40.00 ? 237 ALA B CB  1 
ATOM 5959  N N   . THR B 1 234 ? 30.014  77.708  -31.895  1.00 40.00 ? 238 THR B N   1 
ATOM 5960  C CA  . THR B 1 234 ? 28.791  78.404  -32.339  1.00 40.00 ? 238 THR B CA  1 
ATOM 5961  C C   . THR B 1 234 ? 29.207  79.299  -33.517  1.00 40.00 ? 238 THR B C   1 
ATOM 5962  O O   . THR B 1 234 ? 30.386  79.589  -33.631  1.00 40.00 ? 238 THR B O   1 
ATOM 5963  C CB  . THR B 1 234 ? 28.022  79.297  -31.407  1.00 40.00 ? 238 THR B CB  1 
ATOM 5964  O OG1 . THR B 1 234 ? 28.900  80.348  -30.895  1.00 40.00 ? 238 THR B OG1 1 
ATOM 5965  C CG2 . THR B 1 234 ? 27.348  78.587  -30.264  1.00 40.00 ? 238 THR B CG2 1 
ATOM 5966  N N   . VAL B 1 235 ? 28.294  79.707  -34.357  1.00 40.00 ? 239 VAL B N   1 
ATOM 5967  C CA  . VAL B 1 235 ? 28.569  80.600  -35.472  1.00 40.00 ? 239 VAL B CA  1 
ATOM 5968  C C   . VAL B 1 235 ? 27.477  81.688  -35.444  1.00 40.00 ? 239 VAL B C   1 
ATOM 5969  O O   . VAL B 1 235 ? 26.431  81.457  -34.810  1.00 40.00 ? 239 VAL B O   1 
ATOM 5970  C CB  . VAL B 1 235 ? 28.404  79.874  -36.819  1.00 40.00 ? 239 VAL B CB  1 
ATOM 5971  C CG1 . VAL B 1 235 ? 29.303  78.657  -36.880  1.00 40.00 ? 239 VAL B CG1 1 
ATOM 5972  C CG2 . VAL B 1 235 ? 26.946  79.447  -36.947  1.00 40.00 ? 239 VAL B CG2 1 
ATOM 5973  N N   . SER B 1 236 ? 27.641  82.789  -36.120  1.00 40.00 ? 240 SER B N   1 
ATOM 5974  C CA  . SER B 1 236 ? 26.545  83.757  -36.087  1.00 40.00 ? 240 SER B CA  1 
ATOM 5975  C C   . SER B 1 236 ? 25.545  83.344  -37.167  1.00 40.00 ? 240 SER B C   1 
ATOM 5976  O O   . SER B 1 236 ? 25.833  82.481  -37.968  1.00 40.00 ? 240 SER B O   1 
ATOM 5977  C CB  . SER B 1 236 ? 27.016  85.159  -36.485  1.00 40.00 ? 240 SER B CB  1 
ATOM 5978  O OG  . SER B 1 236 ? 27.780  85.130  -37.675  1.00 40.00 ? 240 SER B OG  1 
ATOM 5979  N N   . ALA B 1 237 ? 24.443  84.052  -37.203  1.00 40.00 ? 241 ALA B N   1 
ATOM 5980  C CA  . ALA B 1 237 ? 23.397  83.861  -38.192  1.00 40.00 ? 241 ALA B CA  1 
ATOM 5981  C C   . ALA B 1 237 ? 24.029  84.097  -39.561  1.00 40.00 ? 241 ALA B C   1 
ATOM 5982  O O   . ALA B 1 237 ? 24.050  83.211  -40.415  1.00 40.00 ? 241 ALA B O   1 
ATOM 5983  C CB  . ALA B 1 237 ? 22.297  84.882  -37.978  1.00 40.00 ? 241 ALA B CB  1 
ATOM 5984  N N   . GLY B 1 238 ? 24.597  85.285  -39.729  1.00 40.00 ? 242 GLY B N   1 
ATOM 5985  C CA  . GLY B 1 238 ? 25.242  85.644  -40.990  1.00 40.00 ? 242 GLY B CA  1 
ATOM 5986  C C   . GLY B 1 238 ? 26.142  84.550  -41.518  1.00 40.00 ? 242 GLY B C   1 
ATOM 5987  O O   . GLY B 1 238 ? 26.010  84.203  -42.712  1.00 40.00 ? 242 GLY B O   1 
ATOM 5988  N N   . GLU B 1 239 ? 27.016  83.965  -40.690  1.00 40.00 ? 243 GLU B N   1 
ATOM 5989  C CA  . GLU B 1 239 ? 27.894  82.943  -41.247  1.00 40.00 ? 243 GLU B CA  1 
ATOM 5990  C C   . GLU B 1 239 ? 27.138  81.657  -41.569  1.00 40.00 ? 243 GLU B C   1 
ATOM 5991  O O   . GLU B 1 239 ? 27.541  80.952  -42.481  1.00 40.00 ? 243 GLU B O   1 
ATOM 5992  C CB  . GLU B 1 239 ? 28.970  82.506  -40.259  1.00 40.00 ? 243 GLU B CB  1 
ATOM 5993  C CG  . GLU B 1 239 ? 30.317  82.947  -40.679  1.00 40.00 ? 243 GLU B CG  1 
ATOM 5994  C CD  . GLU B 1 239 ? 30.953  82.173  -41.784  1.00 40.00 ? 243 GLU B CD  1 
ATOM 5995  O OE1 . GLU B 1 239 ? 31.419  81.057  -41.474  1.00 40.00 ? 243 GLU B OE1 1 
ATOM 5996  O OE2 . GLU B 1 239 ? 31.001  82.707  -42.922  1.00 40.00 ? 243 GLU B OE2 1 
ATOM 5997  N N   . ALA B 1 240 ? 26.143  81.419  -40.714  1.00 40.00 ? 244 ALA B N   1 
ATOM 5998  C CA  . ALA B 1 240 ? 25.328  80.229  -40.883  1.00 40.00 ? 244 ALA B CA  1 
ATOM 5999  C C   . ALA B 1 240 ? 24.742  80.311  -42.298  1.00 40.00 ? 244 ALA B C   1 
ATOM 6000  O O   . ALA B 1 240 ? 24.893  79.495  -43.208  1.00 40.00 ? 244 ALA B O   1 
ATOM 6001  C CB  . ALA B 1 240 ? 24.221  80.269  -39.843  1.00 40.00 ? 244 ALA B CB  1 
ATOM 6002  N N   . ARG B 1 241 ? 24.052  81.454  -42.488  1.00 40.00 ? 245 ARG B N   1 
ATOM 6003  C CA  . ARG B 1 241 ? 23.457  81.638  -43.802  1.00 40.00 ? 245 ARG B CA  1 
ATOM 6004  C C   . ARG B 1 241 ? 24.507  81.447  -44.887  1.00 40.00 ? 245 ARG B C   1 
ATOM 6005  O O   . ARG B 1 241 ? 24.393  80.677  -45.850  1.00 40.00 ? 245 ARG B O   1 
ATOM 6006  C CB  . ARG B 1 241 ? 22.872  83.029  -43.856  1.00 40.00 ? 245 ARG B CB  1 
ATOM 6007  C CG  . ARG B 1 241 ? 22.346  83.436  -45.214  1.00 40.00 ? 245 ARG B CG  1 
ATOM 6008  C CD  . ARG B 1 241 ? 21.242  84.471  -45.018  1.00 40.00 ? 245 ARG B CD  1 
ATOM 6009  N NE  . ARG B 1 241 ? 20.525  84.756  -46.263  1.00 40.00 ? 245 ARG B NE  1 
ATOM 6010  C CZ  . ARG B 1 241 ? 19.788  83.857  -46.916  1.00 40.00 ? 245 ARG B CZ  1 
ATOM 6011  N NH1 . ARG B 1 241 ? 19.619  82.599  -46.509  1.00 40.00 ? 245 ARG B NH1 1 
ATOM 6012  N NH2 . ARG B 1 241 ? 19.190  84.244  -48.041  1.00 40.00 ? 245 ARG B NH2 1 
ATOM 6013  N N   . ARG B 1 242 ? 25.610  82.197  -44.728  1.00 40.00 ? 246 ARG B N   1 
ATOM 6014  C CA  . ARG B 1 242 ? 26.669  82.131  -45.733  1.00 40.00 ? 246 ARG B CA  1 
ATOM 6015  C C   . ARG B 1 242 ? 27.050  80.686  -45.986  1.00 40.00 ? 246 ARG B C   1 
ATOM 6016  O O   . ARG B 1 242 ? 27.244  80.330  -47.157  1.00 40.00 ? 246 ARG B O   1 
ATOM 6017  C CB  . ARG B 1 242 ? 27.832  82.995  -45.325  1.00 40.00 ? 246 ARG B CB  1 
ATOM 6018  C CG  . ARG B 1 242 ? 29.000  83.165  -46.247  1.00 40.00 ? 246 ARG B CG  1 
ATOM 6019  C CD  . ARG B 1 242 ? 30.371  82.964  -45.584  1.00 40.00 ? 246 ARG B CD  1 
ATOM 6020  N NE  . ARG B 1 242 ? 31.092  81.988  -46.382  1.00 40.00 ? 246 ARG B NE  1 
ATOM 6021  C CZ  . ARG B 1 242 ? 31.839  81.009  -45.888  1.00 40.00 ? 246 ARG B CZ  1 
ATOM 6022  N NH1 . ARG B 1 242 ? 31.984  80.885  -44.570  1.00 40.00 ? 246 ARG B NH1 1 
ATOM 6023  N NH2 . ARG B 1 242 ? 32.413  80.212  -46.805  1.00 40.00 ? 246 ARG B NH2 1 
ATOM 6024  N N   . ARG B 1 243 ? 27.108  79.829  -44.939  1.00 40.00 ? 247 ARG B N   1 
ATOM 6025  C CA  . ARG B 1 243 ? 27.515  78.466  -45.294  1.00 40.00 ? 247 ARG B CA  1 
ATOM 6026  C C   . ARG B 1 243 ? 26.362  77.611  -45.758  1.00 40.00 ? 247 ARG B C   1 
ATOM 6027  O O   . ARG B 1 243 ? 26.591  76.573  -46.402  1.00 40.00 ? 247 ARG B O   1 
ATOM 6028  C CB  . ARG B 1 243 ? 28.372  77.753  -44.297  1.00 40.00 ? 247 ARG B CB  1 
ATOM 6029  C CG  . ARG B 1 243 ? 29.374  78.628  -43.548  1.00 40.00 ? 247 ARG B CG  1 
ATOM 6030  C CD  . ARG B 1 243 ? 29.378  78.239  -42.064  1.00 40.00 ? 247 ARG B CD  1 
ATOM 6031  N NE  . ARG B 1 243 ? 30.551  78.709  -41.438  1.00 40.00 ? 247 ARG B NE  1 
ATOM 6032  C CZ  . ARG B 1 243 ? 31.377  78.269  -40.530  1.00 40.00 ? 247 ARG B CZ  1 
ATOM 6033  N NH1 . ARG B 1 243 ? 31.278  77.123  -39.887  1.00 40.00 ? 247 ARG B NH1 1 
ATOM 6034  N NH2 . ARG B 1 243 ? 32.385  79.117  -40.262  1.00 40.00 ? 247 ARG B NH2 1 
ATOM 6035  N N   . ALA B 1 244 ? 25.138  78.016  -45.463  1.00 40.00 ? 248 ALA B N   1 
ATOM 6036  C CA  . ALA B 1 244 ? 23.991  77.201  -45.912  1.00 40.00 ? 248 ALA B CA  1 
ATOM 6037  C C   . ALA B 1 244 ? 23.871  77.357  -47.425  1.00 40.00 ? 248 ALA B C   1 
ATOM 6038  O O   . ALA B 1 244 ? 24.091  76.468  -48.246  1.00 40.00 ? 248 ALA B O   1 
ATOM 6039  C CB  . ALA B 1 244 ? 22.740  77.711  -45.215  1.00 40.00 ? 248 ALA B CB  1 
ATOM 6040  N N   . THR B 1 245 ? 23.558  78.599  -47.818  1.00 40.00 ? 249 THR B N   1 
ATOM 6041  C CA  . THR B 1 245 ? 23.450  78.854  -49.229  1.00 40.00 ? 249 THR B CA  1 
ATOM 6042  C C   . THR B 1 245 ? 24.717  78.386  -49.951  1.00 40.00 ? 249 THR B C   1 
ATOM 6043  O O   . THR B 1 245 ? 24.682  77.740  -51.027  1.00 40.00 ? 249 THR B O   1 
ATOM 6044  C CB  . THR B 1 245 ? 23.356  80.372  -49.467  1.00 40.00 ? 249 THR B CB  1 
ATOM 6045  O OG1 . THR B 1 245 ? 24.690  80.790  -49.214  1.00 40.00 ? 249 THR B OG1 1 
ATOM 6046  C CG2 . THR B 1 245 ? 22.399  81.121  -48.605  1.00 40.00 ? 249 THR B CG2 1 
ATOM 6047  N N   . LEU B 1 246 ? 25.927  78.679  -49.444  1.00 40.00 ? 250 LEU B N   1 
ATOM 6048  C CA  . LEU B 1 246 ? 27.072  78.198  -50.249  1.00 40.00 ? 250 LEU B CA  1 
ATOM 6049  C C   . LEU B 1 246 ? 27.003  76.690  -50.422  1.00 40.00 ? 250 LEU B C   1 
ATOM 6050  O O   . LEU B 1 246 ? 27.102  76.151  -51.543  1.00 40.00 ? 250 LEU B O   1 
ATOM 6051  C CB  . LEU B 1 246 ? 28.395  78.714  -49.724  1.00 40.00 ? 250 LEU B CB  1 
ATOM 6052  C CG  . LEU B 1 246 ? 29.619  77.921  -50.207  1.00 40.00 ? 250 LEU B CG  1 
ATOM 6053  C CD1 . LEU B 1 246 ? 29.681  78.020  -51.704  1.00 40.00 ? 250 LEU B CD1 1 
ATOM 6054  C CD2 . LEU B 1 246 ? 30.896  78.318  -49.548  1.00 40.00 ? 250 LEU B CD2 1 
ATOM 6055  N N   . LEU B 1 247 ? 26.758  75.961  -49.321  1.00 40.00 ? 251 LEU B N   1 
ATOM 6056  C CA  . LEU B 1 247 ? 26.603  74.524  -49.472  1.00 40.00 ? 251 LEU B CA  1 
ATOM 6057  C C   . LEU B 1 247 ? 25.489  74.179  -50.482  1.00 40.00 ? 251 LEU B C   1 
ATOM 6058  O O   . LEU B 1 247 ? 25.640  73.340  -51.371  1.00 40.00 ? 251 LEU B O   1 
ATOM 6059  C CB  . LEU B 1 247 ? 26.235  73.811  -48.158  1.00 40.00 ? 251 LEU B CB  1 
ATOM 6060  C CG  . LEU B 1 247 ? 26.141  72.288  -48.552  1.00 40.00 ? 251 LEU B CG  1 
ATOM 6061  C CD1 . LEU B 1 247 ? 27.329  71.558  -47.994  1.00 40.00 ? 251 LEU B CD1 1 
ATOM 6062  C CD2 . LEU B 1 247 ? 24.762  71.847  -48.139  1.00 40.00 ? 251 LEU B CD2 1 
ATOM 6063  N N   . ALA B 1 248 ? 24.339  74.836  -50.293  1.00 40.00 ? 252 ALA B N   1 
ATOM 6064  C CA  . ALA B 1 248 ? 23.244  74.580  -51.230  1.00 40.00 ? 252 ALA B CA  1 
ATOM 6065  C C   . ALA B 1 248 ? 23.759  74.720  -52.660  1.00 40.00 ? 252 ALA B C   1 
ATOM 6066  O O   . ALA B 1 248 ? 23.639  73.820  -53.485  1.00 40.00 ? 252 ALA B O   1 
ATOM 6067  C CB  . ALA B 1 248 ? 22.092  75.533  -51.001  1.00 40.00 ? 252 ALA B CB  1 
ATOM 6068  N N   . ARG B 1 249 ? 24.274  75.909  -52.981  1.00 40.00 ? 253 ARG B N   1 
ATOM 6069  C CA  . ARG B 1 249 ? 24.788  76.222  -54.314  1.00 40.00 ? 253 ARG B CA  1 
ATOM 6070  C C   . ARG B 1 249 ? 25.704  75.124  -54.819  1.00 40.00 ? 253 ARG B C   1 
ATOM 6071  O O   . ARG B 1 249 ? 25.510  74.665  -55.938  1.00 40.00 ? 253 ARG B O   1 
ATOM 6072  C CB  . ARG B 1 249 ? 25.591  77.496  -54.303  1.00 40.00 ? 253 ARG B CB  1 
ATOM 6073  C CG  . ARG B 1 249 ? 25.555  78.488  -55.407  1.00 40.00 ? 253 ARG B CG  1 
ATOM 6074  C CD  . ARG B 1 249 ? 26.465  79.666  -55.129  1.00 40.00 ? 253 ARG B CD  1 
ATOM 6075  N NE  . ARG B 1 249 ? 25.910  80.683  -54.247  1.00 40.00 ? 253 ARG B NE  1 
ATOM 6076  C CZ  . ARG B 1 249 ? 26.569  81.095  -53.157  1.00 40.00 ? 253 ARG B CZ  1 
ATOM 6077  N NH1 . ARG B 1 249 ? 27.752  80.560  -52.846  1.00 40.00 ? 253 ARG B NH1 1 
ATOM 6078  N NH2 . ARG B 1 249 ? 25.998  82.018  -52.390  1.00 40.00 ? 253 ARG B NH2 1 
ATOM 6079  N N   . LEU B 1 250 ? 26.679  74.642  -54.038  1.00 40.00 ? 254 LEU B N   1 
ATOM 6080  C CA  . LEU B 1 250 ? 27.512  73.565  -54.560  1.00 40.00 ? 254 LEU B CA  1 
ATOM 6081  C C   . LEU B 1 250 ? 26.761  72.289  -54.915  1.00 40.00 ? 254 LEU B C   1 
ATOM 6082  O O   . LEU B 1 250 ? 27.263  71.362  -55.578  1.00 40.00 ? 254 LEU B O   1 
ATOM 6083  C CB  . LEU B 1 250 ? 28.545  73.131  -53.485  1.00 40.00 ? 254 LEU B CB  1 
ATOM 6084  C CG  . LEU B 1 250 ? 29.563  74.254  -53.260  1.00 40.00 ? 254 LEU B CG  1 
ATOM 6085  C CD1 . LEU B 1 250 ? 30.560  73.951  -52.198  1.00 40.00 ? 254 LEU B CD1 1 
ATOM 6086  C CD2 . LEU B 1 250 ? 30.253  74.463  -54.613  1.00 40.00 ? 254 LEU B CD2 1 
ATOM 6087  N N   . VAL B 1 251 ? 25.550  72.147  -54.436  1.00 40.00 ? 255 VAL B N   1 
ATOM 6088  C CA  . VAL B 1 251 ? 24.764  70.935  -54.608  1.00 40.00 ? 255 VAL B CA  1 
ATOM 6089  C C   . VAL B 1 251 ? 23.702  71.185  -55.632  1.00 40.00 ? 255 VAL B C   1 
ATOM 6090  O O   . VAL B 1 251 ? 22.860  70.351  -55.961  1.00 40.00 ? 255 VAL B O   1 
ATOM 6091  C CB  . VAL B 1 251 ? 24.282  70.562  -53.192  1.00 40.00 ? 255 VAL B CB  1 
ATOM 6092  C CG1 . VAL B 1 251 ? 22.819  70.792  -52.949  1.00 40.00 ? 255 VAL B CG1 1 
ATOM 6093  C CG2 . VAL B 1 251 ? 24.803  69.173  -52.865  1.00 40.00 ? 255 VAL B CG2 1 
ATOM 6094  N N   . GLY B 1 252 ? 23.760  72.391  -56.206  1.00 40.00 ? 256 GLY B N   1 
ATOM 6095  C CA  . GLY B 1 252 ? 22.834  72.723  -57.281  1.00 40.00 ? 256 GLY B CA  1 
ATOM 6096  C C   . GLY B 1 252 ? 21.563  73.297  -56.748  1.00 40.00 ? 256 GLY B C   1 
ATOM 6097  O O   . GLY B 1 252 ? 20.595  73.406  -57.483  1.00 40.00 ? 256 GLY B O   1 
ATOM 6098  N N   . CYS B 1 253 ? 21.574  73.663  -55.464  1.00 40.00 ? 257 CYS B N   1 
ATOM 6099  C CA  . CYS B 1 253 ? 20.376  74.279  -54.912  1.00 40.00 ? 257 CYS B CA  1 
ATOM 6100  C C   . CYS B 1 253 ? 20.523  75.744  -54.716  1.00 40.00 ? 257 CYS B C   1 
ATOM 6101  O O   . CYS B 1 253 ? 21.399  76.037  -53.931  1.00 40.00 ? 257 CYS B O   1 
ATOM 6102  C CB  . CYS B 1 253 ? 19.931  73.544  -53.655  1.00 40.00 ? 257 CYS B CB  1 
ATOM 6103  S SG  . CYS B 1 253 ? 19.155  71.971  -54.136  1.00 40.00 ? 257 CYS B SG  1 
ATOM 6104  N N   . PRO B 1 254 ? 19.728  76.571  -55.337  1.00 40.00 ? 258 PRO B N   1 
ATOM 6105  C CA  . PRO B 1 254 ? 18.777  76.320  -56.390  1.00 40.00 ? 258 PRO B CA  1 
ATOM 6106  C C   . PRO B 1 254 ? 19.587  76.279  -57.702  1.00 40.00 ? 258 PRO B C   1 
ATOM 6107  O O   . PRO B 1 254 ? 20.753  76.694  -57.696  1.00 40.00 ? 258 PRO B O   1 
ATOM 6108  C CB  . PRO B 1 254 ? 17.857  77.531  -56.427  1.00 40.00 ? 258 PRO B CB  1 
ATOM 6109  C CG  . PRO B 1 254 ? 18.865  78.629  -56.211  1.00 40.00 ? 258 PRO B CG  1 
ATOM 6110  C CD  . PRO B 1 254 ? 19.785  78.037  -55.189  1.00 40.00 ? 258 PRO B CD  1 
ATOM 6111  N N   . PRO B 1 255 ? 19.036  75.691  -58.740  1.00 40.00 ? 259 PRO B N   1 
ATOM 6112  C CA  . PRO B 1 255 ? 19.719  75.553  -60.042  1.00 40.00 ? 259 PRO B CA  1 
ATOM 6113  C C   . PRO B 1 255 ? 19.548  76.827  -60.854  1.00 40.00 ? 259 PRO B C   1 
ATOM 6114  O O   . PRO B 1 255 ? 18.493  77.501  -60.751  1.00 40.00 ? 259 PRO B O   1 
ATOM 6115  C CB  . PRO B 1 255 ? 19.013  74.361  -60.665  1.00 40.00 ? 259 PRO B CB  1 
ATOM 6116  C CG  . PRO B 1 255 ? 17.612  74.484  -60.173  1.00 40.00 ? 259 PRO B CG  1 
ATOM 6117  C CD  . PRO B 1 255 ? 17.673  75.118  -58.803  1.00 40.00 ? 259 PRO B CD  1 
ATOM 6118  N N   . GLY B 1 256 ? 20.575  77.214  -61.608  1.00 40.00 ? 260 GLY B N   1 
ATOM 6119  C CA  . GLY B 1 256 ? 20.444  78.453  -62.362  1.00 40.00 ? 260 GLY B CA  1 
ATOM 6120  C C   . GLY B 1 256 ? 20.733  79.690  -61.531  1.00 40.00 ? 260 GLY B C   1 
ATOM 6121  O O   . GLY B 1 256 ? 21.293  79.622  -60.445  1.00 40.00 ? 260 GLY B O   1 
ATOM 6122  N N   . GLY B 1 257 ? 20.361  80.855  -62.068  1.00 40.00 ? 261 GLY B N   1 
ATOM 6123  C CA  . GLY B 1 257 ? 20.557  82.155  -61.446  1.00 40.00 ? 261 GLY B CA  1 
ATOM 6124  C C   . GLY B 1 257 ? 19.295  82.676  -60.752  1.00 40.00 ? 261 GLY B C   1 
ATOM 6125  O O   . GLY B 1 257 ? 18.930  83.853  -60.854  1.00 40.00 ? 261 GLY B O   1 
ATOM 6126  N N   . ALA B 1 258 ? 18.651  81.793  -60.020  1.00 40.00 ? 262 ALA B N   1 
ATOM 6127  C CA  . ALA B 1 258 ? 17.423  81.897  -59.278  1.00 40.00 ? 262 ALA B CA  1 
ATOM 6128  C C   . ALA B 1 258 ? 17.547  82.593  -57.946  1.00 40.00 ? 262 ALA B C   1 
ATOM 6129  O O   . ALA B 1 258 ? 18.519  83.349  -57.825  1.00 40.00 ? 262 ALA B O   1 
ATOM 6130  C CB  . ALA B 1 258 ? 16.925  80.454  -59.046  1.00 40.00 ? 262 ALA B CB  1 
ATOM 6131  N N   . GLY B 1 259 ? 16.656  82.399  -56.977  1.00 40.00 ? 263 GLY B N   1 
ATOM 6132  C CA  . GLY B 1 259 ? 16.942  83.087  -55.752  1.00 40.00 ? 263 GLY B CA  1 
ATOM 6133  C C   . GLY B 1 259 ? 15.899  83.843  -55.029  1.00 40.00 ? 263 GLY B C   1 
ATOM 6134  O O   . GLY B 1 259 ? 14.753  83.987  -55.423  1.00 40.00 ? 263 GLY B O   1 
ATOM 6135  N N   . GLY B 1 260 ? 16.382  84.285  -53.857  1.00 40.00 ? 264 GLY B N   1 
ATOM 6136  C CA  . GLY B 1 260 ? 15.541  85.028  -52.957  1.00 40.00 ? 264 GLY B CA  1 
ATOM 6137  C C   . GLY B 1 260 ? 14.363  84.181  -52.520  1.00 40.00 ? 264 GLY B C   1 
ATOM 6138  O O   . GLY B 1 260 ? 13.326  84.827  -52.261  1.00 40.00 ? 264 GLY B O   1 
ATOM 6139  N N   . ASN B 1 261 ? 14.422  82.855  -52.458  1.00 40.00 ? 265 ASN B N   1 
ATOM 6140  C CA  . ASN B 1 261 ? 13.272  82.133  -51.895  1.00 40.00 ? 265 ASN B CA  1 
ATOM 6141  C C   . ASN B 1 261 ? 13.927  81.073  -51.003  1.00 40.00 ? 265 ASN B C   1 
ATOM 6142  O O   . ASN B 1 261 ? 14.453  80.062  -51.448  1.00 40.00 ? 265 ASN B O   1 
ATOM 6143  C CB  . ASN B 1 261 ? 12.116  81.712  -52.717  1.00 40.00 ? 265 ASN B CB  1 
ATOM 6144  C CG  . ASN B 1 261 ? 10.849  81.419  -51.915  1.00 40.00 ? 265 ASN B CG  1 
ATOM 6145  O OD1 . ASN B 1 261 ? 10.860  80.538  -51.038  1.00 40.00 ? 265 ASN B OD1 1 
ATOM 6146  N ND2 . ASN B 1 261 ? 9.754   82.124  -52.185  1.00 40.00 ? 265 ASN B ND2 1 
ATOM 6147  N N   . ASP B 1 262 ? 13.944  81.400  -49.689  1.00 40.00 ? 266 ASP B N   1 
ATOM 6148  C CA  . ASP B 1 262 ? 14.661  80.449  -48.807  1.00 40.00 ? 266 ASP B CA  1 
ATOM 6149  C C   . ASP B 1 262 ? 13.952  79.119  -48.851  1.00 40.00 ? 266 ASP B C   1 
ATOM 6150  O O   . ASP B 1 262 ? 14.524  78.026  -48.976  1.00 40.00 ? 266 ASP B O   1 
ATOM 6151  C CB  . ASP B 1 262 ? 14.982  81.072  -47.479  1.00 40.00 ? 266 ASP B CB  1 
ATOM 6152  C CG  . ASP B 1 262 ? 15.935  82.270  -47.526  1.00 40.00 ? 266 ASP B CG  1 
ATOM 6153  O OD1 . ASP B 1 262 ? 16.768  82.364  -48.474  1.00 40.00 ? 266 ASP B OD1 1 
ATOM 6154  O OD2 . ASP B 1 262 ? 15.901  83.167  -46.625  1.00 40.00 ? 266 ASP B OD2 1 
ATOM 6155  N N   . THR B 1 263 ? 12.620  79.200  -48.883  1.00 40.00 ? 267 THR B N   1 
ATOM 6156  C CA  . THR B 1 263 ? 11.786  78.016  -48.976  1.00 40.00 ? 267 THR B CA  1 
ATOM 6157  C C   . THR B 1 263 ? 12.091  77.130  -50.175  1.00 40.00 ? 267 THR B C   1 
ATOM 6158  O O   . THR B 1 263 ? 12.255  75.920  -50.039  1.00 40.00 ? 267 THR B O   1 
ATOM 6159  C CB  . THR B 1 263 ? 10.269  78.282  -48.987  1.00 40.00 ? 267 THR B CB  1 
ATOM 6160  O OG1 . THR B 1 263 ? 9.957   79.422  -48.169  1.00 40.00 ? 267 THR B OG1 1 
ATOM 6161  C CG2 . THR B 1 263 ? 9.593   77.033  -48.414  1.00 40.00 ? 267 THR B CG2 1 
ATOM 6162  N N   . GLU B 1 264 ? 12.187  77.758  -51.335  1.00 40.00 ? 268 GLU B N   1 
ATOM 6163  C CA  . GLU B 1 264 ? 12.527  76.965  -52.533  1.00 40.00 ? 268 GLU B CA  1 
ATOM 6164  C C   . GLU B 1 264 ? 13.895  76.329  -52.327  1.00 40.00 ? 268 GLU B C   1 
ATOM 6165  O O   . GLU B 1 264 ? 14.105  75.175  -52.636  1.00 40.00 ? 268 GLU B O   1 
ATOM 6166  C CB  . GLU B 1 264 ? 12.532  77.870  -53.750  1.00 40.00 ? 268 GLU B CB  1 
ATOM 6167  C CG  . GLU B 1 264 ? 11.156  78.534  -53.947  1.00 40.00 ? 268 GLU B CG  1 
ATOM 6168  C CD  . GLU B 1 264 ? 11.113  79.248  -55.289  1.00 40.00 ? 268 GLU B CD  1 
ATOM 6169  O OE1 . GLU B 1 264 ? 10.455  80.307  -55.409  1.00 40.00 ? 268 GLU B OE1 1 
ATOM 6170  O OE2 . GLU B 1 264 ? 11.759  78.730  -56.237  1.00 40.00 ? 268 GLU B OE2 1 
ATOM 6171  N N   . LEU B 1 265 ? 14.787  77.124  -51.724  1.00 40.00 ? 269 LEU B N   1 
ATOM 6172  C CA  . LEU B 1 265 ? 16.156  76.706  -51.461  1.00 40.00 ? 269 LEU B CA  1 
ATOM 6173  C C   . LEU B 1 265 ? 16.178  75.467  -50.590  1.00 40.00 ? 269 LEU B C   1 
ATOM 6174  O O   . LEU B 1 265 ? 16.799  74.445  -50.910  1.00 40.00 ? 269 LEU B O   1 
ATOM 6175  C CB  . LEU B 1 265 ? 16.928  77.847  -50.836  1.00 40.00 ? 269 LEU B CB  1 
ATOM 6176  C CG  . LEU B 1 265 ? 18.448  77.927  -50.946  1.00 40.00 ? 269 LEU B CG  1 
ATOM 6177  C CD1 . LEU B 1 265 ? 18.930  79.184  -50.195  1.00 40.00 ? 269 LEU B CD1 1 
ATOM 6178  C CD2 . LEU B 1 265 ? 19.147  76.717  -50.344  1.00 40.00 ? 269 LEU B CD2 1 
ATOM 6179  N N   . ILE B 1 266 ? 15.453  75.588  -49.466  1.00 40.00 ? 270 ILE B N   1 
ATOM 6180  C CA  . ILE B 1 266 ? 15.417  74.404  -48.589  1.00 40.00 ? 270 ILE B CA  1 
ATOM 6181  C C   . ILE B 1 266 ? 14.675  73.239  -49.283  1.00 40.00 ? 270 ILE B C   1 
ATOM 6182  O O   . ILE B 1 266 ? 15.038  72.048  -49.236  1.00 40.00 ? 270 ILE B O   1 
ATOM 6183  C CB  . ILE B 1 266 ? 14.791  74.695  -47.228  1.00 40.00 ? 270 ILE B CB  1 
ATOM 6184  C CG1 . ILE B 1 266 ? 14.997  76.116  -46.723  1.00 40.00 ? 270 ILE B CG1 1 
ATOM 6185  C CG2 . ILE B 1 266 ? 15.272  73.636  -46.237  1.00 40.00 ? 270 ILE B CG2 1 
ATOM 6186  C CD1 . ILE B 1 266 ? 16.177  76.386  -45.824  1.00 40.00 ? 270 ILE B CD1 1 
ATOM 6187  N N   . ALA B 1 267 ? 13.602  73.593  -50.013  1.00 40.00 ? 271 ALA B N   1 
ATOM 6188  C CA  . ALA B 1 267 ? 12.817  72.554  -50.692  1.00 40.00 ? 271 ALA B CA  1 
ATOM 6189  C C   . ALA B 1 267 ? 13.738  71.753  -51.594  1.00 40.00 ? 271 ALA B C   1 
ATOM 6190  O O   . ALA B 1 267 ? 13.789  70.532  -51.582  1.00 40.00 ? 271 ALA B O   1 
ATOM 6191  C CB  . ALA B 1 267 ? 11.658  73.126  -51.463  1.00 40.00 ? 271 ALA B CB  1 
ATOM 6192  N N   . CYS B 1 268 ? 14.501  72.530  -52.369  1.00 40.00 ? 272 CYS B N   1 
ATOM 6193  C CA  . CYS B 1 268 ? 15.486  71.945  -53.272  1.00 40.00 ? 272 CYS B CA  1 
ATOM 6194  C C   . CYS B 1 268 ? 16.463  71.084  -52.480  1.00 40.00 ? 272 CYS B C   1 
ATOM 6195  O O   . CYS B 1 268 ? 16.760  69.956  -52.872  1.00 40.00 ? 272 CYS B O   1 
ATOM 6196  C CB  . CYS B 1 268 ? 16.235  73.082  -53.949  1.00 40.00 ? 272 CYS B CB  1 
ATOM 6197  S SG  . CYS B 1 268 ? 17.486  72.605  -55.066  1.00 40.00 ? 272 CYS B SG  1 
ATOM 6198  N N   . LEU B 1 269 ? 17.010  71.626  -51.369  1.00 40.00 ? 273 LEU B N   1 
ATOM 6199  C CA  . LEU B 1 269 ? 17.989  70.900  -50.571  1.00 40.00 ? 273 LEU B CA  1 
ATOM 6200  C C   . LEU B 1 269 ? 17.435  69.590  -50.025  1.00 40.00 ? 273 LEU B C   1 
ATOM 6201  O O   . LEU B 1 269 ? 18.097  68.552  -49.877  1.00 40.00 ? 273 LEU B O   1 
ATOM 6202  C CB  . LEU B 1 269 ? 18.418  71.768  -49.382  1.00 40.00 ? 273 LEU B CB  1 
ATOM 6203  C CG  . LEU B 1 269 ? 19.733  72.535  -49.578  1.00 40.00 ? 273 LEU B CG  1 
ATOM 6204  C CD1 . LEU B 1 269 ? 19.806  73.662  -48.558  1.00 40.00 ? 273 LEU B CD1 1 
ATOM 6205  C CD2 . LEU B 1 269 ? 20.951  71.635  -49.493  1.00 40.00 ? 273 LEU B CD2 1 
ATOM 6206  N N   . ARG B 1 270 ? 16.133  69.663  -49.728  1.00 40.00 ? 274 ARG B N   1 
ATOM 6207  C CA  . ARG B 1 270 ? 15.428  68.521  -49.174  1.00 40.00 ? 274 ARG B CA  1 
ATOM 6208  C C   . ARG B 1 270 ? 15.330  67.361  -50.145  1.00 40.00 ? 274 ARG B C   1 
ATOM 6209  O O   . ARG B 1 270 ? 14.977  66.258  -49.721  1.00 40.00 ? 274 ARG B O   1 
ATOM 6210  C CB  . ARG B 1 270 ? 14.067  68.965  -48.645  1.00 40.00 ? 274 ARG B CB  1 
ATOM 6211  C CG  . ARG B 1 270 ? 13.827  68.495  -47.240  1.00 40.00 ? 274 ARG B CG  1 
ATOM 6212  C CD  . ARG B 1 270 ? 12.592  68.958  -46.571  1.00 40.00 ? 274 ARG B CD  1 
ATOM 6213  N NE  . ARG B 1 270 ? 11.991  70.211  -46.870  1.00 40.00 ? 274 ARG B NE  1 
ATOM 6214  C CZ  . ARG B 1 270 ? 11.974  71.239  -46.008  1.00 40.00 ? 274 ARG B CZ  1 
ATOM 6215  N NH1 . ARG B 1 270 ? 12.524  71.203  -44.801  1.00 40.00 ? 274 ARG B NH1 1 
ATOM 6216  N NH2 . ARG B 1 270 ? 11.345  72.331  -46.468  1.00 40.00 ? 274 ARG B NH2 1 
ATOM 6217  N N   . THR B 1 271 ? 15.672  67.518  -51.419  1.00 40.00 ? 275 THR B N   1 
ATOM 6218  C CA  . THR B 1 271 ? 15.614  66.426  -52.366  1.00 40.00 ? 275 THR B CA  1 
ATOM 6219  C C   . THR B 1 271 ? 16.966  65.761  -52.611  1.00 40.00 ? 275 THR B C   1 
ATOM 6220  O O   . THR B 1 271 ? 17.076  64.720  -53.262  1.00 40.00 ? 275 THR B O   1 
ATOM 6221  C CB  . THR B 1 271 ? 15.163  66.892  -53.780  1.00 40.00 ? 275 THR B CB  1 
ATOM 6222  O OG1 . THR B 1 271 ? 16.392  67.222  -54.452  1.00 40.00 ? 275 THR B OG1 1 
ATOM 6223  C CG2 . THR B 1 271 ? 14.247  68.084  -53.799  1.00 40.00 ? 275 THR B CG2 1 
ATOM 6224  N N   . ARG B 1 272 ? 18.051  66.401  -52.197  1.00 40.00 ? 276 ARG B N   1 
ATOM 6225  C CA  . ARG B 1 272 ? 19.372  65.822  -52.478  1.00 40.00 ? 276 ARG B CA  1 
ATOM 6226  C C   . ARG B 1 272 ? 19.683  64.652  -51.578  1.00 40.00 ? 276 ARG B C   1 
ATOM 6227  O O   . ARG B 1 272 ? 19.456  64.651  -50.347  1.00 40.00 ? 276 ARG B O   1 
ATOM 6228  C CB  . ARG B 1 272 ? 20.446  66.904  -52.289  1.00 40.00 ? 276 ARG B CB  1 
ATOM 6229  C CG  . ARG B 1 272 ? 20.008  68.221  -52.969  1.00 40.00 ? 276 ARG B CG  1 
ATOM 6230  C CD  . ARG B 1 272 ? 20.763  68.300  -54.297  1.00 40.00 ? 276 ARG B CD  1 
ATOM 6231  N NE  . ARG B 1 272 ? 20.313  69.315  -55.223  1.00 40.00 ? 276 ARG B NE  1 
ATOM 6232  C CZ  . ARG B 1 272 ? 19.520  69.091  -56.265  1.00 40.00 ? 276 ARG B CZ  1 
ATOM 6233  N NH1 . ARG B 1 272 ? 19.082  67.849  -56.474  1.00 40.00 ? 276 ARG B NH1 1 
ATOM 6234  N NH2 . ARG B 1 272 ? 19.159  70.080  -57.068  1.00 40.00 ? 276 ARG B NH2 1 
ATOM 6235  N N   . PRO B 1 273 ? 20.243  63.621  -52.192  1.00 40.00 ? 277 PRO B N   1 
ATOM 6236  C CA  . PRO B 1 273 ? 20.665  62.438  -51.434  1.00 40.00 ? 277 PRO B CA  1 
ATOM 6237  C C   . PRO B 1 273 ? 21.476  62.893  -50.225  1.00 40.00 ? 277 PRO B C   1 
ATOM 6238  O O   . PRO B 1 273 ? 22.367  63.755  -50.374  1.00 40.00 ? 277 PRO B O   1 
ATOM 6239  C CB  . PRO B 1 273 ? 21.611  61.724  -52.421  1.00 40.00 ? 277 PRO B CB  1 
ATOM 6240  C CG  . PRO B 1 273 ? 21.599  62.423  -53.721  1.00 40.00 ? 277 PRO B CG  1 
ATOM 6241  C CD  . PRO B 1 273 ? 20.611  63.544  -53.617  1.00 40.00 ? 277 PRO B CD  1 
ATOM 6242  N N   . ALA B 1 274 ? 21.271  62.315  -49.052  1.00 40.00 ? 278 ALA B N   1 
ATOM 6243  C CA  . ALA B 1 274 ? 22.045  62.696  -47.872  1.00 40.00 ? 278 ALA B CA  1 
ATOM 6244  C C   . ALA B 1 274 ? 23.527  62.837  -48.190  1.00 40.00 ? 278 ALA B C   1 
ATOM 6245  O O   . ALA B 1 274 ? 24.124  63.888  -47.884  1.00 40.00 ? 278 ALA B O   1 
ATOM 6246  C CB  . ALA B 1 274 ? 21.869  61.695  -46.743  1.00 40.00 ? 278 ALA B CB  1 
ATOM 6247  N N   . GLN B 1 275 ? 24.157  61.837  -48.799  1.00 40.00 ? 279 GLN B N   1 
ATOM 6248  C CA  . GLN B 1 275 ? 25.586  61.934  -49.065  1.00 40.00 ? 279 GLN B CA  1 
ATOM 6249  C C   . GLN B 1 275 ? 26.025  63.090  -49.940  1.00 40.00 ? 279 GLN B C   1 
ATOM 6250  O O   . GLN B 1 275 ? 27.208  63.474  -49.971  1.00 40.00 ? 279 GLN B O   1 
ATOM 6251  C CB  . GLN B 1 275 ? 26.062  60.641  -49.726  1.00 40.00 ? 279 GLN B CB  1 
ATOM 6252  C CG  . GLN B 1 275 ? 27.550  60.639  -50.030  1.00 40.00 ? 279 GLN B CG  1 
ATOM 6253  C CD  . GLN B 1 275 ? 28.326  60.633  -48.726  1.00 40.00 ? 279 GLN B CD  1 
ATOM 6254  O OE1 . GLN B 1 275 ? 27.826  60.114  -47.713  1.00 40.00 ? 279 GLN B OE1 1 
ATOM 6255  N NE2 . GLN B 1 275 ? 29.494  61.252  -48.818  1.00 40.00 ? 279 GLN B NE2 1 
ATOM 6256  N N   . ASP B 1 276 ? 25.085  63.649  -50.718  1.00 40.00 ? 280 ASP B N   1 
ATOM 6257  C CA  . ASP B 1 276 ? 25.459  64.794  -51.573  1.00 40.00 ? 280 ASP B CA  1 
ATOM 6258  C C   . ASP B 1 276 ? 25.838  65.940  -50.614  1.00 40.00 ? 280 ASP B C   1 
ATOM 6259  O O   . ASP B 1 276 ? 26.802  66.635  -50.878  1.00 40.00 ? 280 ASP B O   1 
ATOM 6260  C CB  . ASP B 1 276 ? 24.326  65.350  -52.405  1.00 40.00 ? 280 ASP B CB  1 
ATOM 6261  C CG  . ASP B 1 276 ? 24.158  64.625  -53.714  1.00 40.00 ? 280 ASP B CG  1 
ATOM 6262  O OD1 . ASP B 1 276 ? 24.503  63.416  -53.723  1.00 40.00 ? 280 ASP B OD1 1 
ATOM 6263  O OD2 . ASP B 1 276 ? 23.684  65.315  -54.656  1.00 40.00 ? 280 ASP B OD2 1 
ATOM 6264  N N   . LEU B 1 277 ? 25.040  66.110  -49.555  1.00 40.00 ? 281 LEU B N   1 
ATOM 6265  C CA  . LEU B 1 277 ? 25.348  67.177  -48.596  1.00 40.00 ? 281 LEU B CA  1 
ATOM 6266  C C   . LEU B 1 277 ? 26.653  66.928  -47.883  1.00 40.00 ? 281 LEU B C   1 
ATOM 6267  O O   . LEU B 1 277 ? 27.570  67.743  -47.845  1.00 40.00 ? 281 LEU B O   1 
ATOM 6268  C CB  . LEU B 1 277 ? 24.301  67.327  -47.509  1.00 40.00 ? 281 LEU B CB  1 
ATOM 6269  C CG  . LEU B 1 277 ? 23.006  68.059  -47.889  1.00 40.00 ? 281 LEU B CG  1 
ATOM 6270  C CD1 . LEU B 1 277 ? 23.122  68.803  -49.195  1.00 40.00 ? 281 LEU B CD1 1 
ATOM 6271  C CD2 . LEU B 1 277 ? 21.849  67.091  -47.858  1.00 40.00 ? 281 LEU B CD2 1 
ATOM 6272  N N   . VAL B 1 278 ? 26.783  65.734  -47.331  1.00 40.00 ? 282 VAL B N   1 
ATOM 6273  C CA  . VAL B 1 278 ? 28.030  65.380  -46.621  1.00 40.00 ? 282 VAL B CA  1 
ATOM 6274  C C   . VAL B 1 278 ? 29.209  65.629  -47.550  1.00 40.00 ? 282 VAL B C   1 
ATOM 6275  O O   . VAL B 1 278 ? 30.285  65.992  -47.101  1.00 40.00 ? 282 VAL B O   1 
ATOM 6276  C CB  . VAL B 1 278 ? 28.018  63.880  -46.272  1.00 40.00 ? 282 VAL B CB  1 
ATOM 6277  C CG1 . VAL B 1 278 ? 29.356  63.446  -45.746  1.00 40.00 ? 282 VAL B CG1 1 
ATOM 6278  C CG2 . VAL B 1 278 ? 26.857  63.554  -45.352  1.00 40.00 ? 282 VAL B CG2 1 
ATOM 6279  N N   . ASP B 1 279 ? 29.003  65.396  -48.856  1.00 40.00 ? 283 ASP B N   1 
ATOM 6280  C CA  . ASP B 1 279 ? 30.104  65.607  -49.779  1.00 40.00 ? 283 ASP B CA  1 
ATOM 6281  C C   . ASP B 1 279 ? 30.602  67.033  -49.753  1.00 40.00 ? 283 ASP B C   1 
ATOM 6282  O O   . ASP B 1 279 ? 31.820  67.238  -49.922  1.00 40.00 ? 283 ASP B O   1 
ATOM 6283  C CB  . ASP B 1 279 ? 29.715  65.177  -51.175  1.00 40.00 ? 283 ASP B CB  1 
ATOM 6284  C CG  . ASP B 1 279 ? 29.899  63.690  -51.391  1.00 40.00 ? 283 ASP B CG  1 
ATOM 6285  O OD1 . ASP B 1 279 ? 30.822  63.116  -50.804  1.00 40.00 ? 283 ASP B OD1 1 
ATOM 6286  O OD2 . ASP B 1 279 ? 29.127  63.091  -52.170  1.00 40.00 ? 283 ASP B OD2 1 
ATOM 6287  N N   . HIS B 1 280 ? 29.740  68.035  -49.557  1.00 40.00 ? 284 HIS B N   1 
ATOM 6288  C CA  . HIS B 1 280 ? 30.298  69.393  -49.607  1.00 40.00 ? 284 HIS B CA  1 
ATOM 6289  C C   . HIS B 1 280 ? 30.454  70.043  -48.270  1.00 40.00 ? 284 HIS B C   1 
ATOM 6290  O O   . HIS B 1 280 ? 30.825  71.219  -48.231  1.00 40.00 ? 284 HIS B O   1 
ATOM 6291  C CB  . HIS B 1 280 ? 29.394  70.236  -50.519  1.00 40.00 ? 284 HIS B CB  1 
ATOM 6292  C CG  . HIS B 1 280 ? 29.715  69.885  -51.955  1.00 40.00 ? 284 HIS B CG  1 
ATOM 6293  N ND1 . HIS B 1 280 ? 30.909  70.261  -52.538  1.00 40.00 ? 284 HIS B ND1 1 
ATOM 6294  C CD2 . HIS B 1 280 ? 29.037  69.195  -52.885  1.00 40.00 ? 284 HIS B CD2 1 
ATOM 6295  C CE1 . HIS B 1 280 ? 30.935  69.828  -53.778  1.00 40.00 ? 284 HIS B CE1 1 
ATOM 6296  N NE2 . HIS B 1 280 ? 29.814  69.187  -54.015  1.00 40.00 ? 284 HIS B NE2 1 
ATOM 6297  N N   . GLU B 1 281 ? 30.125  69.308  -47.206  1.00 40.00 ? 285 GLU B N   1 
ATOM 6298  C CA  . GLU B 1 281 ? 30.210  69.770  -45.840  1.00 40.00 ? 285 GLU B CA  1 
ATOM 6299  C C   . GLU B 1 281 ? 31.445  70.613  -45.547  1.00 40.00 ? 285 GLU B C   1 
ATOM 6300  O O   . GLU B 1 281 ? 31.360  71.728  -45.072  1.00 40.00 ? 285 GLU B O   1 
ATOM 6301  C CB  . GLU B 1 281 ? 30.317  68.562  -44.862  1.00 40.00 ? 285 GLU B CB  1 
ATOM 6302  C CG  . GLU B 1 281 ? 29.413  68.779  -43.675  1.00 40.00 ? 285 GLU B CG  1 
ATOM 6303  C CD  . GLU B 1 281 ? 29.607  67.787  -42.565  1.00 40.00 ? 285 GLU B CD  1 
ATOM 6304  O OE1 . GLU B 1 281 ? 29.468  68.294  -41.415  1.00 40.00 ? 285 GLU B OE1 1 
ATOM 6305  O OE2 . GLU B 1 281 ? 29.874  66.599  -42.808  1.00 40.00 ? 285 GLU B OE2 1 
ATOM 6306  N N   . TRP B 1 282 ? 32.599  70.007  -45.825  1.00 40.00 ? 286 TRP B N   1 
ATOM 6307  C CA  . TRP B 1 282 ? 33.863  70.654  -45.566  1.00 40.00 ? 286 TRP B CA  1 
ATOM 6308  C C   . TRP B 1 282 ? 34.263  71.748  -46.520  1.00 40.00 ? 286 TRP B C   1 
ATOM 6309  O O   . TRP B 1 282 ? 35.345  72.310  -46.290  1.00 40.00 ? 286 TRP B O   1 
ATOM 6310  C CB  . TRP B 1 282 ? 34.990  69.614  -45.459  1.00 40.00 ? 286 TRP B CB  1 
ATOM 6311  C CG  . TRP B 1 282 ? 34.649  68.679  -44.337  1.00 40.00 ? 286 TRP B CG  1 
ATOM 6312  C CD1 . TRP B 1 282 ? 34.353  67.358  -44.419  1.00 40.00 ? 286 TRP B CD1 1 
ATOM 6313  C CD2 . TRP B 1 282 ? 34.538  69.031  -42.954  1.00 40.00 ? 286 TRP B CD2 1 
ATOM 6314  N NE1 . TRP B 1 282 ? 34.076  66.848  -43.174  1.00 40.00 ? 286 TRP B NE1 1 
ATOM 6315  C CE2 . TRP B 1 282 ? 34.178  67.863  -42.257  1.00 40.00 ? 286 TRP B CE2 1 
ATOM 6316  C CE3 . TRP B 1 282 ? 34.702  70.221  -42.249  1.00 40.00 ? 286 TRP B CE3 1 
ATOM 6317  C CZ2 . TRP B 1 282 ? 33.991  67.835  -40.882  1.00 40.00 ? 286 TRP B CZ2 1 
ATOM 6318  C CZ3 . TRP B 1 282 ? 34.512  70.199  -40.883  1.00 40.00 ? 286 TRP B CZ3 1 
ATOM 6319  C CH2 . TRP B 1 282 ? 34.160  69.015  -40.215  1.00 40.00 ? 286 TRP B CH2 1 
ATOM 6320  N N   . HIS B 1 283 ? 33.502  72.117  -47.528  1.00 40.00 ? 287 HIS B N   1 
ATOM 6321  C CA  . HIS B 1 283 ? 33.906  73.196  -48.407  1.00 40.00 ? 287 HIS B CA  1 
ATOM 6322  C C   . HIS B 1 283 ? 33.287  74.511  -48.026  1.00 40.00 ? 287 HIS B C   1 
ATOM 6323  O O   . HIS B 1 283 ? 33.268  75.448  -48.845  1.00 40.00 ? 287 HIS B O   1 
ATOM 6324  C CB  . HIS B 1 283 ? 33.473  72.830  -49.837  1.00 40.00 ? 287 HIS B CB  1 
ATOM 6325  C CG  . HIS B 1 283 ? 34.106  71.543  -50.282  1.00 40.00 ? 287 HIS B CG  1 
ATOM 6326  N ND1 . HIS B 1 283 ? 33.721  70.920  -51.453  1.00 40.00 ? 287 HIS B ND1 1 
ATOM 6327  C CD2 . HIS B 1 283 ? 35.077  70.779  -49.727  1.00 40.00 ? 287 HIS B CD2 1 
ATOM 6328  C CE1 . HIS B 1 283 ? 34.435  69.812  -51.573  1.00 40.00 ? 287 HIS B CE1 1 
ATOM 6329  N NE2 . HIS B 1 283 ? 35.273  69.705  -50.541  1.00 40.00 ? 287 HIS B NE2 1 
ATOM 6330  N N   . VAL B 1 284 ? 32.700  74.679  -46.840  1.00 40.00 ? 288 VAL B N   1 
ATOM 6331  C CA  . VAL B 1 284 ? 32.098  76.010  -46.638  1.00 40.00 ? 288 VAL B CA  1 
ATOM 6332  C C   . VAL B 1 284 ? 32.835  76.768  -45.564  1.00 40.00 ? 288 VAL B C   1 
ATOM 6333  O O   . VAL B 1 284 ? 32.489  77.910  -45.252  1.00 40.00 ? 288 VAL B O   1 
ATOM 6334  C CB  . VAL B 1 284 ? 30.593  75.933  -46.419  1.00 40.00 ? 288 VAL B CB  1 
ATOM 6335  C CG1 . VAL B 1 284 ? 29.910  75.438  -47.681  1.00 40.00 ? 288 VAL B CG1 1 
ATOM 6336  C CG2 . VAL B 1 284 ? 30.198  75.065  -45.238  1.00 40.00 ? 288 VAL B CG2 1 
ATOM 6337  N N   . LEU B 1 285 ? 33.878  76.126  -45.008  1.00 40.00 ? 289 LEU B N   1 
ATOM 6338  C CA  . LEU B 1 285 ? 34.659  76.851  -43.967  1.00 40.00 ? 289 LEU B CA  1 
ATOM 6339  C C   . LEU B 1 285 ? 35.299  78.034  -44.650  1.00 40.00 ? 289 LEU B C   1 
ATOM 6340  O O   . LEU B 1 285 ? 35.589  77.914  -45.842  1.00 40.00 ? 289 LEU B O   1 
ATOM 6341  C CB  . LEU B 1 285 ? 35.644  75.937  -43.269  1.00 40.00 ? 289 LEU B CB  1 
ATOM 6342  C CG  . LEU B 1 285 ? 34.968  74.978  -42.255  1.00 40.00 ? 289 LEU B CG  1 
ATOM 6343  C CD1 . LEU B 1 285 ? 35.995  74.077  -41.593  1.00 40.00 ? 289 LEU B CD1 1 
ATOM 6344  C CD2 . LEU B 1 285 ? 34.152  75.758  -41.233  1.00 40.00 ? 289 LEU B CD2 1 
ATOM 6345  N N   . PRO B 1 286 ? 35.475  79.154  -43.994  1.00 40.00 ? 290 PRO B N   1 
ATOM 6346  C CA  . PRO B 1 286 ? 36.010  80.337  -44.642  1.00 40.00 ? 290 PRO B CA  1 
ATOM 6347  C C   . PRO B 1 286 ? 37.502  80.419  -44.736  1.00 40.00 ? 290 PRO B C   1 
ATOM 6348  O O   . PRO B 1 286 ? 37.978  81.302  -45.457  1.00 40.00 ? 290 PRO B O   1 
ATOM 6349  C CB  . PRO B 1 286 ? 35.388  81.475  -43.851  1.00 40.00 ? 290 PRO B CB  1 
ATOM 6350  C CG  . PRO B 1 286 ? 35.072  80.922  -42.514  1.00 40.00 ? 290 PRO B CG  1 
ATOM 6351  C CD  . PRO B 1 286 ? 35.149  79.420  -42.592  1.00 40.00 ? 290 PRO B CD  1 
ATOM 6352  N N   . GLN B 1 287 ? 38.266  79.590  -44.045  1.00 40.00 ? 291 GLN B N   1 
ATOM 6353  C CA  . GLN B 1 287 ? 39.709  79.597  -44.083  1.00 40.00 ? 291 GLN B CA  1 
ATOM 6354  C C   . GLN B 1 287 ? 40.270  78.189  -43.890  1.00 40.00 ? 291 GLN B C   1 
ATOM 6355  O O   . GLN B 1 287 ? 39.570  77.308  -43.378  1.00 40.00 ? 291 GLN B O   1 
ATOM 6356  C CB  . GLN B 1 287 ? 40.296  80.372  -42.890  1.00 40.00 ? 291 GLN B CB  1 
ATOM 6357  C CG  . GLN B 1 287 ? 39.809  81.772  -42.665  1.00 40.00 ? 291 GLN B CG  1 
ATOM 6358  C CD  . GLN B 1 287 ? 38.724  81.852  -41.622  1.00 40.00 ? 291 GLN B CD  1 
ATOM 6359  O OE1 . GLN B 1 287 ? 38.155  82.924  -41.413  1.00 40.00 ? 291 GLN B OE1 1 
ATOM 6360  N NE2 . GLN B 1 287 ? 38.413  80.735  -40.962  1.00 40.00 ? 291 GLN B NE2 1 
ATOM 6361  N N   . GLU B 1 288 ? 41.549  78.019  -44.213  1.00 40.00 ? 292 GLU B N   1 
ATOM 6362  C CA  . GLU B 1 288 ? 42.140  76.694  -43.944  1.00 40.00 ? 292 GLU B CA  1 
ATOM 6363  C C   . GLU B 1 288 ? 42.230  76.571  -42.415  1.00 40.00 ? 292 GLU B C   1 
ATOM 6364  O O   . GLU B 1 288 ? 42.499  77.613  -41.816  1.00 40.00 ? 292 GLU B O   1 
ATOM 6365  C CB  . GLU B 1 288 ? 43.445  76.500  -44.635  1.00 40.00 ? 292 GLU B CB  1 
ATOM 6366  C CG  . GLU B 1 288 ? 44.009  75.122  -44.426  1.00 40.00 ? 292 GLU B CG  1 
ATOM 6367  C CD  . GLU B 1 288 ? 45.459  74.958  -44.793  1.00 40.00 ? 292 GLU B CD  1 
ATOM 6368  O OE1 . GLU B 1 288 ? 46.063  75.907  -45.353  1.00 40.00 ? 292 GLU B OE1 1 
ATOM 6369  O OE2 . GLU B 1 288 ? 45.981  73.846  -44.494  1.00 40.00 ? 292 GLU B OE2 1 
ATOM 6370  N N   . SER B 1 289 ? 41.933  75.428  -41.804  1.00 40.00 ? 293 SER B N   1 
ATOM 6371  C CA  . SER B 1 289 ? 41.941  75.425  -40.351  1.00 40.00 ? 293 SER B CA  1 
ATOM 6372  C C   . SER B 1 289 ? 41.804  74.058  -39.718  1.00 40.00 ? 293 SER B C   1 
ATOM 6373  O O   . SER B 1 289 ? 41.727  73.051  -40.399  1.00 40.00 ? 293 SER B O   1 
ATOM 6374  C CB  . SER B 1 289 ? 40.719  76.285  -39.916  1.00 40.00 ? 293 SER B CB  1 
ATOM 6375  O OG  . SER B 1 289 ? 39.574  75.810  -40.595  1.00 40.00 ? 293 SER B OG  1 
ATOM 6376  N N   . ILE B 1 290 ? 41.822  74.019  -38.395  1.00 40.00 ? 294 ILE B N   1 
ATOM 6377  C CA  . ILE B 1 290 ? 41.648  72.826  -37.600  1.00 40.00 ? 294 ILE B CA  1 
ATOM 6378  C C   . ILE B 1 290 ? 40.782  73.189  -36.401  1.00 40.00 ? 294 ILE B C   1 
ATOM 6379  O O   . ILE B 1 290 ? 40.662  74.366  -36.045  1.00 40.00 ? 294 ILE B O   1 
ATOM 6380  C CB  . ILE B 1 290 ? 42.926  72.152  -37.156  1.00 40.00 ? 294 ILE B CB  1 
ATOM 6381  C CG1 . ILE B 1 290 ? 44.018  73.178  -36.820  1.00 40.00 ? 294 ILE B CG1 1 
ATOM 6382  C CG2 . ILE B 1 290 ? 43.425  71.208  -38.255  1.00 40.00 ? 294 ILE B CG2 1 
ATOM 6383  C CD1 . ILE B 1 290 ? 45.133  72.497  -36.036  1.00 40.00 ? 294 ILE B CD1 1 
ATOM 6384  N N   . PHE B 1 291 ? 40.076  72.231  -35.832  1.00 40.00 ? 295 PHE B N   1 
ATOM 6385  C CA  . PHE B 1 291 ? 39.232  72.580  -34.689  1.00 40.00 ? 295 PHE B CA  1 
ATOM 6386  C C   . PHE B 1 291 ? 38.280  73.723  -35.026  1.00 40.00 ? 295 PHE B C   1 
ATOM 6387  O O   . PHE B 1 291 ? 38.046  74.669  -34.275  1.00 40.00 ? 295 PHE B O   1 
ATOM 6388  C CB  . PHE B 1 291 ? 40.073  72.896  -33.453  1.00 40.00 ? 295 PHE B CB  1 
ATOM 6389  C CG  . PHE B 1 291 ? 39.460  72.322  -32.206  1.00 40.00 ? 295 PHE B CG  1 
ATOM 6390  C CD1 . PHE B 1 291 ? 38.106  72.543  -31.927  1.00 40.00 ? 295 PHE B CD1 1 
ATOM 6391  C CD2 . PHE B 1 291 ? 40.210  71.564  -31.341  1.00 40.00 ? 295 PHE B CD2 1 
ATOM 6392  C CE1 . PHE B 1 291 ? 37.496  72.005  -30.824  1.00 40.00 ? 295 PHE B CE1 1 
ATOM 6393  C CE2 . PHE B 1 291 ? 39.611  71.038  -30.200  1.00 40.00 ? 295 PHE B CE2 1 
ATOM 6394  C CZ  . PHE B 1 291 ? 38.266  71.249  -29.954  1.00 40.00 ? 295 PHE B CZ  1 
ATOM 6395  N N   . ARG B 1 292 ? 37.685  73.561  -36.193  1.00 40.00 ? 296 ARG B N   1 
ATOM 6396  C CA  . ARG B 1 292 ? 36.689  74.486  -36.742  1.00 40.00 ? 296 ARG B CA  1 
ATOM 6397  C C   . ARG B 1 292 ? 35.711  73.624  -37.508  1.00 40.00 ? 296 ARG B C   1 
ATOM 6398  O O   . ARG B 1 292 ? 36.177  72.643  -38.135  1.00 40.00 ? 296 ARG B O   1 
ATOM 6399  C CB  . ARG B 1 292 ? 37.415  75.517  -37.573  1.00 40.00 ? 296 ARG B CB  1 
ATOM 6400  C CG  . ARG B 1 292 ? 36.689  76.849  -37.470  1.00 40.00 ? 296 ARG B CG  1 
ATOM 6401  C CD  . ARG B 1 292 ? 37.278  77.835  -36.497  1.00 40.00 ? 296 ARG B CD  1 
ATOM 6402  N NE  . ARG B 1 292 ? 38.152  77.230  -35.521  1.00 40.00 ? 296 ARG B NE  1 
ATOM 6403  C CZ  . ARG B 1 292 ? 38.762  78.016  -34.615  1.00 40.00 ? 296 ARG B CZ  1 
ATOM 6404  N NH1 . ARG B 1 292 ? 38.531  79.327  -34.685  1.00 40.00 ? 296 ARG B NH1 1 
ATOM 6405  N NH2 . ARG B 1 292 ? 39.559  77.495  -33.702  1.00 40.00 ? 296 ARG B NH2 1 
ATOM 6406  N N   . PHE B 1 293 ? 34.403  73.771  -37.314  1.00 40.00 ? 297 PHE B N   1 
ATOM 6407  C CA  . PHE B 1 293 ? 33.466  72.861  -37.986  1.00 40.00 ? 297 PHE B CA  1 
ATOM 6408  C C   . PHE B 1 293 ? 32.403  73.606  -38.762  1.00 40.00 ? 297 PHE B C   1 
ATOM 6409  O O   . PHE B 1 293 ? 31.953  74.670  -38.328  1.00 40.00 ? 297 PHE B O   1 
ATOM 6410  C CB  . PHE B 1 293 ? 32.830  71.895  -36.992  1.00 40.00 ? 297 PHE B CB  1 
ATOM 6411  C CG  . PHE B 1 293 ? 33.868  71.312  -36.072  1.00 40.00 ? 297 PHE B CG  1 
ATOM 6412  C CD1 . PHE B 1 293 ? 34.776  70.393  -36.585  1.00 40.00 ? 297 PHE B CD1 1 
ATOM 6413  C CD2 . PHE B 1 293 ? 33.973  71.724  -34.759  1.00 40.00 ? 297 PHE B CD2 1 
ATOM 6414  C CE1 . PHE B 1 293 ? 35.772  69.873  -35.765  1.00 40.00 ? 297 PHE B CE1 1 
ATOM 6415  C CE2 . PHE B 1 293 ? 34.958  71.194  -33.959  1.00 40.00 ? 297 PHE B CE2 1 
ATOM 6416  C CZ  . PHE B 1 293 ? 35.861  70.281  -34.460  1.00 40.00 ? 297 PHE B CZ  1 
ATOM 6417  N N   . SER B 1 294 ? 31.981  73.052  -39.912  1.00 40.00 ? 298 SER B N   1 
ATOM 6418  C CA  . SER B 1 294 ? 31.053  73.772  -40.767  1.00 40.00 ? 298 SER B CA  1 
ATOM 6419  C C   . SER B 1 294 ? 29.658  74.028  -40.295  1.00 40.00 ? 298 SER B C   1 
ATOM 6420  O O   . SER B 1 294 ? 29.100  75.115  -40.516  1.00 40.00 ? 298 SER B O   1 
ATOM 6421  C CB  . SER B 1 294 ? 31.021  73.139  -42.163  1.00 40.00 ? 298 SER B CB  1 
ATOM 6422  O OG  . SER B 1 294 ? 32.353  72.915  -42.622  1.00 40.00 ? 298 SER B OG  1 
ATOM 6423  N N   . PHE B 1 295 ? 29.053  72.960  -39.764  1.00 40.00 ? 299 PHE B N   1 
ATOM 6424  C CA  . PHE B 1 295 ? 27.659  73.047  -39.286  1.00 40.00 ? 299 PHE B CA  1 
ATOM 6425  C C   . PHE B 1 295 ? 27.612  72.700  -37.813  1.00 40.00 ? 299 PHE B C   1 
ATOM 6426  O O   . PHE B 1 295 ? 28.037  71.624  -37.379  1.00 40.00 ? 299 PHE B O   1 
ATOM 6427  C CB  . PHE B 1 295 ? 26.752  72.202  -40.192  1.00 40.00 ? 299 PHE B CB  1 
ATOM 6428  C CG  . PHE B 1 295 ? 26.702  72.834  -41.574  1.00 40.00 ? 299 PHE B CG  1 
ATOM 6429  C CD1 . PHE B 1 295 ? 25.884  73.919  -41.805  1.00 40.00 ? 299 PHE B CD1 1 
ATOM 6430  C CD2 . PHE B 1 295 ? 27.531  72.383  -42.580  1.00 40.00 ? 299 PHE B CD2 1 
ATOM 6431  C CE1 . PHE B 1 295 ? 25.851  74.543  -43.027  1.00 40.00 ? 299 PHE B CE1 1 
ATOM 6432  C CE2 . PHE B 1 295 ? 27.506  73.005  -43.802  1.00 40.00 ? 299 PHE B CE2 1 
ATOM 6433  C CZ  . PHE B 1 295 ? 26.674  74.078  -44.020  1.00 40.00 ? 299 PHE B CZ  1 
ATOM 6434  N N   . VAL B 1 296 ? 27.221  73.688  -37.014  1.00 40.00 ? 300 VAL B N   1 
ATOM 6435  C CA  . VAL B 1 296 ? 27.183  73.684  -35.574  1.00 40.00 ? 300 VAL B CA  1 
ATOM 6436  C C   . VAL B 1 296 ? 26.143  74.701  -35.087  1.00 40.00 ? 300 VAL B C   1 
ATOM 6437  O O   . VAL B 1 296 ? 25.675  75.513  -35.865  1.00 40.00 ? 300 VAL B O   1 
ATOM 6438  C CB  . VAL B 1 296 ? 28.517  74.186  -34.958  1.00 40.00 ? 300 VAL B CB  1 
ATOM 6439  C CG1 . VAL B 1 296 ? 29.715  73.305  -35.242  1.00 40.00 ? 300 VAL B CG1 1 
ATOM 6440  C CG2 . VAL B 1 296 ? 28.728  75.629  -35.431  1.00 40.00 ? 300 VAL B CG2 1 
ATOM 6441  N N   . PRO B 1 297 ? 25.797  74.675  -33.816  1.00 40.00 ? 301 PRO B N   1 
ATOM 6442  C CA  . PRO B 1 297 ? 24.796  75.563  -33.262  1.00 40.00 ? 301 PRO B CA  1 
ATOM 6443  C C   . PRO B 1 297 ? 24.994  76.981  -33.719  1.00 40.00 ? 301 PRO B C   1 
ATOM 6444  O O   . PRO B 1 297 ? 26.136  77.433  -33.814  1.00 40.00 ? 301 PRO B O   1 
ATOM 6445  C CB  . PRO B 1 297 ? 24.954  75.481  -31.767  1.00 40.00 ? 301 PRO B CB  1 
ATOM 6446  C CG  . PRO B 1 297 ? 25.610  74.163  -31.524  1.00 40.00 ? 301 PRO B CG  1 
ATOM 6447  C CD  . PRO B 1 297 ? 26.301  73.734  -32.788  1.00 40.00 ? 301 PRO B CD  1 
ATOM 6448  N N   . VAL B 1 298 ? 23.888  77.633  -33.973  1.00 40.00 ? 302 VAL B N   1 
ATOM 6449  C CA  . VAL B 1 298 ? 23.929  79.030  -34.422  1.00 40.00 ? 302 VAL B CA  1 
ATOM 6450  C C   . VAL B 1 298 ? 23.269  79.929  -33.382  1.00 40.00 ? 302 VAL B C   1 
ATOM 6451  O O   . VAL B 1 298 ? 22.260  79.504  -32.783  1.00 40.00 ? 302 VAL B O   1 
ATOM 6452  C CB  . VAL B 1 298 ? 23.109  79.166  -35.734  1.00 40.00 ? 302 VAL B CB  1 
ATOM 6453  C CG1 . VAL B 1 298 ? 21.697  78.676  -35.508  1.00 40.00 ? 302 VAL B CG1 1 
ATOM 6454  C CG2 . VAL B 1 298 ? 23.094  80.607  -36.209  1.00 40.00 ? 302 VAL B CG2 1 
ATOM 6455  N N   . VAL B 1 299 ? 23.810  81.126  -33.260  1.00 40.00 ? 303 VAL B N   1 
ATOM 6456  C CA  . VAL B 1 299 ? 23.218  82.086  -32.287  1.00 40.00 ? 303 VAL B CA  1 
ATOM 6457  C C   . VAL B 1 299 ? 22.024  82.700  -32.978  1.00 40.00 ? 303 VAL B C   1 
ATOM 6458  O O   . VAL B 1 299 ? 22.165  83.674  -33.691  1.00 40.00 ? 303 VAL B O   1 
ATOM 6459  C CB  . VAL B 1 299 ? 24.286  83.121  -31.905  1.00 40.00 ? 303 VAL B CB  1 
ATOM 6460  C CG1 . VAL B 1 299 ? 23.715  84.294  -31.135  1.00 40.00 ? 303 VAL B CG1 1 
ATOM 6461  C CG2 . VAL B 1 299 ? 25.413  82.414  -31.161  1.00 40.00 ? 303 VAL B CG2 1 
ATOM 6462  N N   . ASP B 1 300 ? 20.864  82.090  -32.854  1.00 40.00 ? 304 ASP B N   1 
ATOM 6463  C CA  . ASP B 1 300 ? 19.632  82.493  -33.515  1.00 40.00 ? 304 ASP B CA  1 
ATOM 6464  C C   . ASP B 1 300 ? 18.867  83.555  -32.743  1.00 40.00 ? 304 ASP B C   1 
ATOM 6465  O O   . ASP B 1 300 ? 18.063  84.288  -33.285  1.00 40.00 ? 304 ASP B O   1 
ATOM 6466  C CB  . ASP B 1 300 ? 18.644  81.310  -33.603  1.00 40.00 ? 304 ASP B CB  1 
ATOM 6467  C CG  . ASP B 1 300 ? 18.705  80.388  -32.401  1.00 40.00 ? 304 ASP B CG  1 
ATOM 6468  O OD1 . ASP B 1 300 ? 19.197  80.761  -31.308  1.00 40.00 ? 304 ASP B OD1 1 
ATOM 6469  O OD2 . ASP B 1 300 ? 18.243  79.222  -32.568  1.00 40.00 ? 304 ASP B OD2 1 
ATOM 6470  N N   . GLY B 1 301 ? 19.079  83.562  -31.427  1.00 40.00 ? 305 GLY B N   1 
ATOM 6471  C CA  . GLY B 1 301 ? 18.312  84.522  -30.598  1.00 40.00 ? 305 GLY B CA  1 
ATOM 6472  C C   . GLY B 1 301 ? 16.992  83.815  -30.236  1.00 40.00 ? 305 GLY B C   1 
ATOM 6473  O O   . GLY B 1 301 ? 15.931  84.408  -30.093  1.00 40.00 ? 305 GLY B O   1 
ATOM 6474  N N   . ASP B 1 302 ? 17.086  82.501  -30.139  1.00 40.00 ? 306 ASP B N   1 
ATOM 6475  C CA  . ASP B 1 302 ? 15.978  81.649  -29.782  1.00 40.00 ? 306 ASP B CA  1 
ATOM 6476  C C   . ASP B 1 302 ? 16.606  80.609  -28.859  1.00 40.00 ? 306 ASP B C   1 
ATOM 6477  O O   . ASP B 1 302 ? 16.760  80.794  -27.655  1.00 40.00 ? 306 ASP B O   1 
ATOM 6478  C CB  . ASP B 1 302 ? 15.353  80.905  -30.938  1.00 40.00 ? 306 ASP B CB  1 
ATOM 6479  C CG  . ASP B 1 302 ? 14.152  80.065  -30.543  1.00 40.00 ? 306 ASP B CG  1 
ATOM 6480  O OD1 . ASP B 1 302 ? 13.079  80.677  -30.297  1.00 40.00 ? 306 ASP B OD1 1 
ATOM 6481  O OD2 . ASP B 1 302 ? 14.199  78.814  -30.466  1.00 40.00 ? 306 ASP B OD2 1 
ATOM 6482  N N   . PHE B 1 303 ? 17.088  79.536  -29.503  1.00 40.00 ? 307 PHE B N   1 
ATOM 6483  C CA  . PHE B 1 303 ? 17.669  78.524  -28.607  1.00 40.00 ? 307 PHE B CA  1 
ATOM 6484  C C   . PHE B 1 303 ? 18.745  79.162  -27.750  1.00 40.00 ? 307 PHE B C   1 
ATOM 6485  O O   . PHE B 1 303 ? 18.792  78.754  -26.592  1.00 40.00 ? 307 PHE B O   1 
ATOM 6486  C CB  . PHE B 1 303 ? 18.061  77.289  -29.289  1.00 40.00 ? 307 PHE B CB  1 
ATOM 6487  C CG  . PHE B 1 303 ? 18.415  76.110  -28.429  1.00 40.00 ? 307 PHE B CG  1 
ATOM 6488  C CD1 . PHE B 1 303 ? 19.577  76.039  -27.710  1.00 40.00 ? 307 PHE B CD1 1 
ATOM 6489  C CD2 . PHE B 1 303 ? 17.555  75.029  -28.399  1.00 40.00 ? 307 PHE B CD2 1 
ATOM 6490  C CE1 . PHE B 1 303 ? 19.899  74.923  -26.981  1.00 40.00 ? 307 PHE B CE1 1 
ATOM 6491  C CE2 . PHE B 1 303 ? 17.850  73.901  -27.667  1.00 40.00 ? 307 PHE B CE2 1 
ATOM 6492  C CZ  . PHE B 1 303 ? 19.028  73.846  -26.948  1.00 40.00 ? 307 PHE B CZ  1 
ATOM 6493  N N   . LEU B 1 304 ? 19.542  80.049  -28.276  1.00 40.00 ? 308 LEU B N   1 
ATOM 6494  C CA  . LEU B 1 304 ? 20.522  80.841  -27.536  1.00 40.00 ? 308 LEU B CA  1 
ATOM 6495  C C   . LEU B 1 304 ? 20.037  82.297  -27.715  1.00 40.00 ? 308 LEU B C   1 
ATOM 6496  O O   . LEU B 1 304 ? 19.850  82.810  -28.827  1.00 40.00 ? 308 LEU B O   1 
ATOM 6497  C CB  . LEU B 1 304 ? 21.930  80.622  -28.007  1.00 40.00 ? 308 LEU B CB  1 
ATOM 6498  C CG  . LEU B 1 304 ? 22.483  79.209  -28.127  1.00 40.00 ? 308 LEU B CG  1 
ATOM 6499  C CD1 . LEU B 1 304 ? 23.846  79.225  -28.807  1.00 40.00 ? 308 LEU B CD1 1 
ATOM 6500  C CD2 . LEU B 1 304 ? 22.681  78.533  -26.779  1.00 40.00 ? 308 LEU B CD2 1 
ATOM 6501  N N   . SER B 1 305 ? 19.723  83.009  -26.623  1.00 40.00 ? 309 SER B N   1 
ATOM 6502  C CA  . SER B 1 305 ? 19.169  84.368  -26.742  1.00 40.00 ? 309 SER B CA  1 
ATOM 6503  C C   . SER B 1 305 ? 20.210  85.378  -27.177  1.00 40.00 ? 309 SER B C   1 
ATOM 6504  O O   . SER B 1 305 ? 19.902  86.468  -27.650  1.00 40.00 ? 309 SER B O   1 
ATOM 6505  C CB  . SER B 1 305 ? 18.598  84.835  -25.393  1.00 40.00 ? 309 SER B CB  1 
ATOM 6506  O OG  . SER B 1 305 ? 19.168  83.986  -24.385  1.00 40.00 ? 309 SER B OG  1 
ATOM 6507  N N   . ASP B 1 306 ? 21.441  84.969  -26.956  1.00 40.00 ? 310 ASP B N   1 
ATOM 6508  C CA  . ASP B 1 306 ? 22.601  85.801  -27.269  1.00 40.00 ? 310 ASP B CA  1 
ATOM 6509  C C   . ASP B 1 306 ? 23.785  84.838  -27.281  1.00 40.00 ? 310 ASP B C   1 
ATOM 6510  O O   . ASP B 1 306 ? 23.570  83.658  -26.928  1.00 40.00 ? 310 ASP B O   1 
ATOM 6511  C CB  . ASP B 1 306 ? 22.784  86.752  -26.073  1.00 40.00 ? 310 ASP B CB  1 
ATOM 6512  C CG  . ASP B 1 306 ? 23.573  87.981  -26.454  1.00 40.00 ? 310 ASP B CG  1 
ATOM 6513  O OD1 . ASP B 1 306 ? 24.566  87.751  -27.176  1.00 40.00 ? 310 ASP B OD1 1 
ATOM 6514  O OD2 . ASP B 1 306 ? 23.207  89.110  -26.060  1.00 40.00 ? 310 ASP B OD2 1 
ATOM 6515  N N   . THR B 1 307 ? 24.958  85.298  -27.634  1.00 40.00 ? 311 THR B N   1 
ATOM 6516  C CA  . THR B 1 307 ? 26.103  84.424  -27.597  1.00 40.00 ? 311 THR B CA  1 
ATOM 6517  C C   . THR B 1 307 ? 26.317  83.765  -26.245  1.00 40.00 ? 311 THR B C   1 
ATOM 6518  O O   . THR B 1 307 ? 26.191  84.436  -25.210  1.00 40.00 ? 311 THR B O   1 
ATOM 6519  C CB  . THR B 1 307 ? 27.373  85.339  -27.648  1.00 40.00 ? 311 THR B CB  1 
ATOM 6520  O OG1 . THR B 1 307 ? 26.958  86.614  -28.111  1.00 40.00 ? 311 THR B OG1 1 
ATOM 6521  C CG2 . THR B 1 307 ? 28.329  84.678  -28.612  1.00 40.00 ? 311 THR B CG2 1 
ATOM 6522  N N   . PRO B 1 308 ? 26.830  82.546  -26.287  1.00 40.00 ? 312 PRO B N   1 
ATOM 6523  C CA  . PRO B 1 308 ? 27.242  81.869  -25.067  1.00 40.00 ? 312 PRO B CA  1 
ATOM 6524  C C   . PRO B 1 308 ? 28.150  82.815  -24.276  1.00 40.00 ? 312 PRO B C   1 
ATOM 6525  O O   . PRO B 1 308 ? 27.972  82.921  -23.054  1.00 40.00 ? 312 PRO B O   1 
ATOM 6526  C CB  . PRO B 1 308 ? 27.995  80.640  -25.518  1.00 40.00 ? 312 PRO B CB  1 
ATOM 6527  C CG  . PRO B 1 308 ? 27.826  80.556  -26.967  1.00 40.00 ? 312 PRO B CG  1 
ATOM 6528  C CD  . PRO B 1 308 ? 27.079  81.749  -27.482  1.00 40.00 ? 312 PRO B CD  1 
ATOM 6529  N N   . GLU B 1 309 ? 29.099  83.518  -24.915  1.00 40.00 ? 313 GLU B N   1 
ATOM 6530  C CA  . GLU B 1 309 ? 29.944  84.441  -24.128  1.00 40.00 ? 313 GLU B CA  1 
ATOM 6531  C C   . GLU B 1 309 ? 29.059  85.360  -23.299  1.00 40.00 ? 313 GLU B C   1 
ATOM 6532  O O   . GLU B 1 309 ? 29.049  85.245  -22.081  1.00 40.00 ? 313 GLU B O   1 
ATOM 6533  C CB  . GLU B 1 309 ? 30.840  85.341  -24.946  1.00 40.00 ? 313 GLU B CB  1 
ATOM 6534  C CG  . GLU B 1 309 ? 32.158  85.706  -24.284  1.00 40.00 ? 313 GLU B CG  1 
ATOM 6535  C CD  . GLU B 1 309 ? 33.151  84.555  -24.372  1.00 40.00 ? 313 GLU B CD  1 
ATOM 6536  O OE1 . GLU B 1 309 ? 33.043  83.687  -25.274  1.00 40.00 ? 313 GLU B OE1 1 
ATOM 6537  O OE2 . GLU B 1 309 ? 34.066  84.517  -23.520  1.00 40.00 ? 313 GLU B OE2 1 
ATOM 6538  N N   . ALA B 1 310 ? 28.268  86.200  -23.965  1.00 40.00 ? 314 ALA B N   1 
ATOM 6539  C CA  . ALA B 1 310 ? 27.362  87.075  -23.222  1.00 40.00 ? 314 ALA B CA  1 
ATOM 6540  C C   . ALA B 1 310 ? 26.571  86.287  -22.194  1.00 40.00 ? 314 ALA B C   1 
ATOM 6541  O O   . ALA B 1 310 ? 26.303  86.789  -21.109  1.00 40.00 ? 314 ALA B O   1 
ATOM 6542  C CB  . ALA B 1 310 ? 26.343  87.718  -24.171  1.00 40.00 ? 314 ALA B CB  1 
ATOM 6543  N N   . LEU B 1 311 ? 26.113  85.079  -22.525  1.00 40.00 ? 315 LEU B N   1 
ATOM 6544  C CA  . LEU B 1 311 ? 25.284  84.352  -21.569  1.00 40.00 ? 315 LEU B CA  1 
ATOM 6545  C C   . LEU B 1 311 ? 26.027  83.919  -20.333  1.00 40.00 ? 315 LEU B C   1 
ATOM 6546  O O   . LEU B 1 311 ? 25.592  84.295  -19.247  1.00 40.00 ? 315 LEU B O   1 
ATOM 6547  C CB  . LEU B 1 311 ? 24.541  83.171  -22.177  1.00 40.00 ? 315 LEU B CB  1 
ATOM 6548  C CG  . LEU B 1 311 ? 23.484  83.478  -23.230  1.00 40.00 ? 315 LEU B CG  1 
ATOM 6549  C CD1 . LEU B 1 311 ? 22.690  82.207  -23.515  1.00 40.00 ? 315 LEU B CD1 1 
ATOM 6550  C CD2 . LEU B 1 311 ? 22.573  84.629  -22.818  1.00 40.00 ? 315 LEU B CD2 1 
ATOM 6551  N N   . ILE B 1 312 ? 27.159  83.234  -20.435  1.00 40.00 ? 316 ILE B N   1 
ATOM 6552  C CA  . ILE B 1 312 ? 27.855  82.825  -19.223  1.00 40.00 ? 316 ILE B CA  1 
ATOM 6553  C C   . ILE B 1 312 ? 28.388  84.072  -18.512  1.00 40.00 ? 316 ILE B C   1 
ATOM 6554  O O   . ILE B 1 312 ? 28.877  84.056  -17.384  1.00 40.00 ? 316 ILE B O   1 
ATOM 6555  C CB  . ILE B 1 312 ? 29.109  81.969  -19.487  1.00 40.00 ? 316 ILE B CB  1 
ATOM 6556  C CG1 . ILE B 1 312 ? 30.099  82.797  -20.315  1.00 40.00 ? 316 ILE B CG1 1 
ATOM 6557  C CG2 . ILE B 1 312 ? 28.788  80.644  -20.132  1.00 40.00 ? 316 ILE B CG2 1 
ATOM 6558  C CD1 . ILE B 1 312 ? 31.537  82.319  -20.236  1.00 40.00 ? 316 ILE B CD1 1 
ATOM 6559  N N   . ASN B 1 313 ? 28.395  85.167  -19.257  1.00 40.00 ? 317 ASN B N   1 
ATOM 6560  C CA  . ASN B 1 313 ? 28.888  86.403  -18.662  1.00 40.00 ? 317 ASN B CA  1 
ATOM 6561  C C   . ASN B 1 313 ? 27.812  86.988  -17.790  1.00 40.00 ? 317 ASN B C   1 
ATOM 6562  O O   . ASN B 1 313 ? 28.192  87.511  -16.738  1.00 40.00 ? 317 ASN B O   1 
ATOM 6563  C CB  . ASN B 1 313 ? 29.418  87.307  -19.756  1.00 40.00 ? 317 ASN B CB  1 
ATOM 6564  C CG  . ASN B 1 313 ? 29.122  88.770  -19.536  1.00 40.00 ? 317 ASN B CG  1 
ATOM 6565  O OD1 . ASN B 1 313 ? 28.558  89.438  -20.419  1.00 40.00 ? 317 ASN B OD1 1 
ATOM 6566  N ND2 . ASN B 1 313 ? 29.495  89.265  -18.355  1.00 40.00 ? 317 ASN B ND2 1 
ATOM 6567  N N   . THR B 1 314 ? 26.532  86.962  -18.123  1.00 40.00 ? 318 THR B N   1 
ATOM 6568  C CA  . THR B 1 314 ? 25.538  87.580  -17.247  1.00 40.00 ? 318 THR B CA  1 
ATOM 6569  C C   . THR B 1 314 ? 24.430  86.660  -16.773  1.00 40.00 ? 318 THR B C   1 
ATOM 6570  O O   . THR B 1 314 ? 23.438  87.119  -16.203  1.00 40.00 ? 318 THR B O   1 
ATOM 6571  C CB  . THR B 1 314 ? 24.869  88.798  -17.918  1.00 40.00 ? 318 THR B CB  1 
ATOM 6572  O OG1 . THR B 1 314 ? 24.017  88.356  -18.988  1.00 40.00 ? 318 THR B OG1 1 
ATOM 6573  C CG2 . THR B 1 314 ? 25.902  89.788  -18.420  1.00 40.00 ? 318 THR B CG2 1 
ATOM 6574  N N   . GLY B 1 315 ? 24.570  85.364  -17.005  1.00 40.00 ? 319 GLY B N   1 
ATOM 6575  C CA  . GLY B 1 315 ? 23.530  84.419  -16.601  1.00 40.00 ? 319 GLY B CA  1 
ATOM 6576  C C   . GLY B 1 315 ? 23.531  84.270  -15.086  1.00 40.00 ? 319 GLY B C   1 
ATOM 6577  O O   . GLY B 1 315 ? 24.528  84.576  -14.453  1.00 40.00 ? 319 GLY B O   1 
ATOM 6578  N N   . ASP B 1 316 ? 22.420  83.811  -14.522  1.00 40.00 ? 320 ASP B N   1 
ATOM 6579  C CA  . ASP B 1 316 ? 22.355  83.562  -13.080  1.00 40.00 ? 320 ASP B CA  1 
ATOM 6580  C C   . ASP B 1 316 ? 22.510  82.042  -12.914  1.00 40.00 ? 320 ASP B C   1 
ATOM 6581  O O   . ASP B 1 316 ? 21.566  81.315  -13.238  1.00 40.00 ? 320 ASP B O   1 
ATOM 6582  C CB  . ASP B 1 316 ? 21.032  84.001  -12.472  1.00 40.00 ? 320 ASP B CB  1 
ATOM 6583  C CG  . ASP B 1 316 ? 21.007  83.896  -10.951  1.00 40.00 ? 320 ASP B CG  1 
ATOM 6584  O OD1 . ASP B 1 316 ? 21.245  82.791  -10.412  1.00 40.00 ? 320 ASP B OD1 1 
ATOM 6585  O OD2 . ASP B 1 316 ? 20.744  84.931  -10.290  1.00 40.00 ? 320 ASP B OD2 1 
ATOM 6586  N N   . PHE B 1 317 ? 23.681  81.589  -12.491  1.00 40.00 ? 321 PHE B N   1 
ATOM 6587  C CA  . PHE B 1 317 ? 23.891  80.140  -12.348  1.00 40.00 ? 321 PHE B CA  1 
ATOM 6588  C C   . PHE B 1 317 ? 24.049  79.808  -10.873  1.00 40.00 ? 321 PHE B C   1 
ATOM 6589  O O   . PHE B 1 317 ? 24.773  78.887  -10.499  1.00 40.00 ? 321 PHE B O   1 
ATOM 6590  C CB  . PHE B 1 317 ? 25.154  79.715  -13.116  1.00 40.00 ? 321 PHE B CB  1 
ATOM 6591  C CG  . PHE B 1 317 ? 25.187  80.328  -14.493  1.00 40.00 ? 321 PHE B CG  1 
ATOM 6592  C CD1 . PHE B 1 317 ? 24.300  79.876  -15.452  1.00 40.00 ? 321 PHE B CD1 1 
ATOM 6593  C CD2 . PHE B 1 317 ? 26.054  81.353  -14.807  1.00 40.00 ? 321 PHE B CD2 1 
ATOM 6594  C CE1 . PHE B 1 317 ? 24.292  80.437  -16.711  1.00 40.00 ? 321 PHE B CE1 1 
ATOM 6595  C CE2 . PHE B 1 317 ? 26.054  81.911  -16.071  1.00 40.00 ? 321 PHE B CE2 1 
ATOM 6596  C CZ  . PHE B 1 317 ? 25.172  81.456  -17.029  1.00 40.00 ? 321 PHE B CZ  1 
ATOM 6597  N N   . GLN B 1 318 ? 23.360  80.600  -10.058  1.00 40.00 ? 322 GLN B N   1 
ATOM 6598  C CA  . GLN B 1 318 ? 23.436  80.511  -8.616   1.00 40.00 ? 322 GLN B CA  1 
ATOM 6599  C C   . GLN B 1 318 ? 22.742  79.353  -7.960   1.00 40.00 ? 322 GLN B C   1 
ATOM 6600  O O   . GLN B 1 318 ? 21.723  79.557  -7.301   1.00 40.00 ? 322 GLN B O   1 
ATOM 6601  C CB  . GLN B 1 318 ? 22.887  81.827  -8.025   1.00 40.00 ? 322 GLN B CB  1 
ATOM 6602  C CG  . GLN B 1 318 ? 23.247  82.032  -6.560   1.00 40.00 ? 322 GLN B CG  1 
ATOM 6603  C CD  . GLN B 1 318 ? 22.142  82.811  -5.864   1.00 40.00 ? 322 GLN B CD  1 
ATOM 6604  O OE1 . GLN B 1 318 ? 21.486  83.649  -6.492   1.00 40.00 ? 322 GLN B OE1 1 
ATOM 6605  N NE2 . GLN B 1 318 ? 21.935  82.533  -4.583   1.00 40.00 ? 322 GLN B NE2 1 
ATOM 6606  N N   . ASP B 1 319 ? 23.229  78.138  -8.131   1.00 40.00 ? 323 ASP B N   1 
ATOM 6607  C CA  . ASP B 1 319 ? 22.657  76.923  -7.592   1.00 40.00 ? 323 ASP B CA  1 
ATOM 6608  C C   . ASP B 1 319 ? 23.145  75.710  -8.402   1.00 40.00 ? 323 ASP B C   1 
ATOM 6609  O O   . ASP B 1 319 ? 23.285  74.604  -7.870   1.00 40.00 ? 323 ASP B O   1 
ATOM 6610  C CB  . ASP B 1 319 ? 21.124  76.971  -7.651   1.00 40.00 ? 323 ASP B CB  1 
ATOM 6611  C CG  . ASP B 1 319 ? 20.627  76.893  -9.091   1.00 40.00 ? 323 ASP B CG  1 
ATOM 6612  O OD1 . ASP B 1 319 ? 20.744  77.895  -9.827   1.00 40.00 ? 323 ASP B OD1 1 
ATOM 6613  O OD2 . ASP B 1 319 ? 20.162  75.792  -9.431   1.00 40.00 ? 323 ASP B OD2 1 
ATOM 6614  N N   . LEU B 1 320 ? 23.391  75.950  -9.688   1.00 40.00 ? 324 LEU B N   1 
ATOM 6615  C CA  . LEU B 1 320 ? 23.855  74.918  -10.586  1.00 40.00 ? 324 LEU B CA  1 
ATOM 6616  C C   . LEU B 1 320 ? 25.094  74.192  -10.096  1.00 40.00 ? 324 LEU B C   1 
ATOM 6617  O O   . LEU B 1 320 ? 26.086  74.827  -9.744   1.00 40.00 ? 324 LEU B O   1 
ATOM 6618  C CB  . LEU B 1 320 ? 24.198  75.611  -11.900  1.00 40.00 ? 324 LEU B CB  1 
ATOM 6619  C CG  . LEU B 1 320 ? 23.876  75.013  -13.261  1.00 40.00 ? 324 LEU B CG  1 
ATOM 6620  C CD1 . LEU B 1 320 ? 24.576  75.877  -14.320  1.00 40.00 ? 324 LEU B CD1 1 
ATOM 6621  C CD2 . LEU B 1 320 ? 24.283  73.556  -13.401  1.00 40.00 ? 324 LEU B CD2 1 
ATOM 6622  N N   . GLN B 1 321 ? 25.088  72.869  -10.084  1.00 40.00 ? 325 GLN B N   1 
ATOM 6623  C CA  . GLN B 1 321 ? 26.321  72.165  -9.707   1.00 40.00 ? 325 GLN B CA  1 
ATOM 6624  C C   . GLN B 1 321 ? 26.908  71.776  -11.073  1.00 40.00 ? 325 GLN B C   1 
ATOM 6625  O O   . GLN B 1 321 ? 26.130  71.324  -11.916  1.00 40.00 ? 325 GLN B O   1 
ATOM 6626  C CB  . GLN B 1 321 ? 26.148  70.910  -8.908   1.00 40.00 ? 325 GLN B CB  1 
ATOM 6627  C CG  . GLN B 1 321 ? 26.025  71.073  -7.397   1.00 40.00 ? 325 GLN B CG  1 
ATOM 6628  C CD  . GLN B 1 321 ? 24.580  70.758  -6.996   1.00 40.00 ? 325 GLN B CD  1 
ATOM 6629  O OE1 . GLN B 1 321 ? 24.296  69.569  -6.842   1.00 40.00 ? 325 GLN B OE1 1 
ATOM 6630  N NE2 . GLN B 1 321 ? 23.769  71.802  -6.877   1.00 40.00 ? 325 GLN B NE2 1 
ATOM 6631  N N   . VAL B 1 322 ? 28.201  71.963  -11.269  1.00 40.00 ? 326 VAL B N   1 
ATOM 6632  C CA  . VAL B 1 322 ? 28.766  71.630  -12.563  1.00 40.00 ? 326 VAL B CA  1 
ATOM 6633  C C   . VAL B 1 322 ? 30.171  71.065  -12.388  1.00 40.00 ? 326 VAL B C   1 
ATOM 6634  O O   . VAL B 1 322 ? 31.019  71.721  -11.784  1.00 40.00 ? 326 VAL B O   1 
ATOM 6635  C CB  . VAL B 1 322 ? 29.003  72.924  -13.377  1.00 40.00 ? 326 VAL B CB  1 
ATOM 6636  C CG1 . VAL B 1 322 ? 29.740  72.503  -14.648  1.00 40.00 ? 326 VAL B CG1 1 
ATOM 6637  C CG2 . VAL B 1 322 ? 27.779  73.768  -13.647  1.00 40.00 ? 326 VAL B CG2 1 
ATOM 6638  N N   . LEU B 1 323 ? 30.411  69.915  -12.945  1.00 40.00 ? 327 LEU B N   1 
ATOM 6639  C CA  . LEU B 1 323 ? 31.778  69.356  -12.910  1.00 40.00 ? 327 LEU B CA  1 
ATOM 6640  C C   . LEU B 1 323 ? 32.350  69.727  -14.278  1.00 40.00 ? 327 LEU B C   1 
ATOM 6641  O O   . LEU B 1 323 ? 31.609  69.712  -15.290  1.00 40.00 ? 327 LEU B O   1 
ATOM 6642  C CB  . LEU B 1 323 ? 31.693  67.851  -12.704  1.00 40.00 ? 327 LEU B CB  1 
ATOM 6643  C CG  . LEU B 1 323 ? 32.979  67.069  -12.459  1.00 40.00 ? 327 LEU B CG  1 
ATOM 6644  C CD1 . LEU B 1 323 ? 32.753  65.558  -12.591  1.00 40.00 ? 327 LEU B CD1 1 
ATOM 6645  C CD2 . LEU B 1 323 ? 34.111  67.408  -13.413  1.00 40.00 ? 327 LEU B CD2 1 
ATOM 6646  N N   . VAL B 1 324 ? 33.603  70.100  -14.398  1.00 40.00 ? 328 VAL B N   1 
ATOM 6647  C CA  . VAL B 1 324 ? 34.208  70.502  -15.658  1.00 40.00 ? 328 VAL B CA  1 
ATOM 6648  C C   . VAL B 1 324 ? 35.644  70.015  -15.688  1.00 40.00 ? 328 VAL B C   1 
ATOM 6649  O O   . VAL B 1 324 ? 36.171  69.903  -14.571  1.00 40.00 ? 328 VAL B O   1 
ATOM 6650  C CB  . VAL B 1 324 ? 34.373  72.039  -15.671  1.00 40.00 ? 328 VAL B CB  1 
ATOM 6651  C CG1 . VAL B 1 324 ? 35.169  72.427  -16.914  1.00 40.00 ? 328 VAL B CG1 1 
ATOM 6652  C CG2 . VAL B 1 324 ? 33.048  72.768  -15.654  1.00 40.00 ? 328 VAL B CG2 1 
ATOM 6653  N N   . GLY B 1 325 ? 36.259  69.771  -16.830  1.00 40.00 ? 329 GLY B N   1 
ATOM 6654  C CA  . GLY B 1 325 ? 37.661  69.341  -16.740  1.00 40.00 ? 329 GLY B CA  1 
ATOM 6655  C C   . GLY B 1 325 ? 38.265  69.345  -18.125  1.00 40.00 ? 329 GLY B C   1 
ATOM 6656  O O   . GLY B 1 325 ? 37.658  69.906  -19.042  1.00 40.00 ? 329 GLY B O   1 
ATOM 6657  N N   . VAL B 1 326 ? 39.430  68.736  -18.260  1.00 40.00 ? 330 VAL B N   1 
ATOM 6658  C CA  . VAL B 1 326 ? 40.179  68.797  -19.524  1.00 40.00 ? 330 VAL B CA  1 
ATOM 6659  C C   . VAL B 1 326 ? 41.246  67.710  -19.512  1.00 40.00 ? 330 VAL B C   1 
ATOM 6660  O O   . VAL B 1 326 ? 41.549  67.192  -18.420  1.00 40.00 ? 330 VAL B O   1 
ATOM 6661  C CB  . VAL B 1 326 ? 40.890  70.178  -19.435  1.00 40.00 ? 330 VAL B CB  1 
ATOM 6662  C CG1 . VAL B 1 326 ? 42.319  70.144  -19.925  1.00 40.00 ? 330 VAL B CG1 1 
ATOM 6663  C CG2 . VAL B 1 326 ? 40.111  71.290  -20.100  1.00 40.00 ? 330 VAL B CG2 1 
ATOM 6664  N N   . VAL B 1 327 ? 41.832  67.358  -20.636  1.00 40.00 ? 331 VAL B N   1 
ATOM 6665  C CA  . VAL B 1 327 ? 42.862  66.330  -20.614  1.00 40.00 ? 331 VAL B CA  1 
ATOM 6666  C C   . VAL B 1 327 ? 44.236  66.936  -20.781  1.00 40.00 ? 331 VAL B C   1 
ATOM 6667  O O   . VAL B 1 327 ? 44.401  68.132  -21.062  1.00 40.00 ? 331 VAL B O   1 
ATOM 6668  C CB  . VAL B 1 327 ? 42.598  65.255  -21.675  1.00 40.00 ? 331 VAL B CB  1 
ATOM 6669  C CG1 . VAL B 1 327 ? 41.454  64.340  -21.193  1.00 40.00 ? 331 VAL B CG1 1 
ATOM 6670  C CG2 . VAL B 1 327 ? 42.210  65.866  -23.002  1.00 40.00 ? 331 VAL B CG2 1 
ATOM 6671  N N   . LYS B 1 328 ? 45.268  66.110  -20.588  1.00 40.00 ? 332 LYS B N   1 
ATOM 6672  C CA  . LYS B 1 328 ? 46.631  66.619  -20.695  1.00 40.00 ? 332 LYS B CA  1 
ATOM 6673  C C   . LYS B 1 328 ? 46.876  67.329  -22.019  1.00 40.00 ? 332 LYS B C   1 
ATOM 6674  O O   . LYS B 1 328 ? 47.264  68.502  -22.005  1.00 40.00 ? 332 LYS B O   1 
ATOM 6675  C CB  . LYS B 1 328 ? 47.672  65.541  -20.398  1.00 40.00 ? 332 LYS B CB  1 
ATOM 6676  C CG  . LYS B 1 328 ? 48.820  66.051  -19.557  1.00 40.00 ? 332 LYS B CG  1 
ATOM 6677  C CD  . LYS B 1 328 ? 50.102  65.305  -19.555  1.00 40.00 ? 332 LYS B CD  1 
ATOM 6678  C CE  . LYS B 1 328 ? 50.554  64.667  -20.843  1.00 40.00 ? 332 LYS B CE  1 
ATOM 6679  N NZ  . LYS B 1 328 ? 50.143  63.226  -20.925  1.00 40.00 ? 332 LYS B NZ  1 
ATOM 6680  N N   . ASP B 1 329 ? 46.675  66.671  -23.161  1.00 40.00 ? 333 ASP B N   1 
ATOM 6681  C CA  . ASP B 1 329 ? 46.933  67.327  -24.425  1.00 40.00 ? 333 ASP B CA  1 
ATOM 6682  C C   . ASP B 1 329 ? 45.778  67.453  -25.401  1.00 40.00 ? 333 ASP B C   1 
ATOM 6683  O O   . ASP B 1 329 ? 45.869  66.853  -26.472  1.00 40.00 ? 333 ASP B O   1 
ATOM 6684  C CB  . ASP B 1 329 ? 48.128  66.674  -25.147  1.00 40.00 ? 333 ASP B CB  1 
ATOM 6685  C CG  . ASP B 1 329 ? 49.163  66.073  -24.222  1.00 40.00 ? 333 ASP B CG  1 
ATOM 6686  O OD1 . ASP B 1 329 ? 48.763  65.200  -23.422  1.00 40.00 ? 333 ASP B OD1 1 
ATOM 6687  O OD2 . ASP B 1 329 ? 50.354  66.461  -24.290  1.00 40.00 ? 333 ASP B OD2 1 
ATOM 6688  N N   . GLU B 1 330 ? 44.753  68.259  -25.146  1.00 40.00 ? 334 GLU B N   1 
ATOM 6689  C CA  . GLU B 1 330 ? 43.649  68.448  -26.067  1.00 40.00 ? 334 GLU B CA  1 
ATOM 6690  C C   . GLU B 1 330 ? 44.095  68.579  -27.525  1.00 40.00 ? 334 GLU B C   1 
ATOM 6691  O O   . GLU B 1 330 ? 43.769  67.729  -28.374  1.00 40.00 ? 334 GLU B O   1 
ATOM 6692  C CB  . GLU B 1 330 ? 42.780  69.664  -25.756  1.00 40.00 ? 334 GLU B CB  1 
ATOM 6693  C CG  . GLU B 1 330 ? 42.303  69.779  -24.331  1.00 40.00 ? 334 GLU B CG  1 
ATOM 6694  C CD  . GLU B 1 330 ? 41.189  68.832  -23.962  1.00 40.00 ? 334 GLU B CD  1 
ATOM 6695  O OE1 . GLU B 1 330 ? 40.873  67.917  -24.760  1.00 40.00 ? 334 GLU B OE1 1 
ATOM 6696  O OE2 . GLU B 1 330 ? 40.602  68.960  -22.875  1.00 40.00 ? 334 GLU B OE2 1 
ATOM 6697  N N   . GLY B 1 331 ? 44.874  69.602  -27.865  1.00 40.00 ? 335 GLY B N   1 
ATOM 6698  C CA  . GLY B 1 331 ? 45.304  69.843  -29.189  1.00 40.00 ? 335 GLY B CA  1 
ATOM 6699  C C   . GLY B 1 331 ? 46.000  68.807  -29.993  1.00 40.00 ? 335 GLY B C   1 
ATOM 6700  O O   . GLY B 1 331 ? 45.957  68.918  -31.245  1.00 40.00 ? 335 GLY B O   1 
ATOM 6701  N N   . SER B 1 332 ? 46.684  67.823  -29.442  1.00 40.00 ? 336 SER B N   1 
ATOM 6702  C CA  . SER B 1 332 ? 47.453  66.854  -30.228  1.00 40.00 ? 336 SER B CA  1 
ATOM 6703  C C   . SER B 1 332 ? 46.733  66.199  -31.390  1.00 40.00 ? 336 SER B C   1 
ATOM 6704  O O   . SER B 1 332 ? 47.131  66.297  -32.554  1.00 40.00 ? 336 SER B O   1 
ATOM 6705  C CB  . SER B 1 332 ? 47.955  65.740  -29.287  1.00 40.00 ? 336 SER B CB  1 
ATOM 6706  O OG  . SER B 1 332 ? 46.909  65.510  -28.342  1.00 40.00 ? 336 SER B OG  1 
ATOM 6707  N N   . TYR B 1 333 ? 45.645  65.483  -31.095  1.00 40.00 ? 337 TYR B N   1 
ATOM 6708  C CA  . TYR B 1 333 ? 44.818  64.783  -32.093  1.00 40.00 ? 337 TYR B CA  1 
ATOM 6709  C C   . TYR B 1 333 ? 44.605  65.654  -33.309  1.00 40.00 ? 337 TYR B C   1 
ATOM 6710  O O   . TYR B 1 333 ? 44.999  65.277  -34.414  1.00 40.00 ? 337 TYR B O   1 
ATOM 6711  C CB  . TYR B 1 333 ? 43.500  64.414  -31.447  1.00 40.00 ? 337 TYR B CB  1 
ATOM 6712  C CG  . TYR B 1 333 ? 42.399  63.734  -32.180  1.00 40.00 ? 337 TYR B CG  1 
ATOM 6713  C CD1 . TYR B 1 333 ? 42.392  62.349  -32.282  1.00 40.00 ? 337 TYR B CD1 1 
ATOM 6714  C CD2 . TYR B 1 333 ? 41.334  64.425  -32.748  1.00 40.00 ? 337 TYR B CD2 1 
ATOM 6715  C CE1 . TYR B 1 333 ? 41.383  61.663  -32.949  1.00 40.00 ? 337 TYR B CE1 1 
ATOM 6716  C CE2 . TYR B 1 333 ? 40.323  63.755  -33.410  1.00 40.00 ? 337 TYR B CE2 1 
ATOM 6717  C CZ  . TYR B 1 333 ? 40.347  62.374  -33.515  1.00 40.00 ? 337 TYR B CZ  1 
ATOM 6718  O OH  . TYR B 1 333 ? 39.323  61.724  -34.181  1.00 40.00 ? 337 TYR B OH  1 
ATOM 6719  N N   . PHE B 1 334 ? 44.064  66.867  -33.152  1.00 40.00 ? 338 PHE B N   1 
ATOM 6720  C CA  . PHE B 1 334 ? 43.787  67.726  -34.281  1.00 40.00 ? 338 PHE B CA  1 
ATOM 6721  C C   . PHE B 1 334 ? 44.949  68.082  -35.154  1.00 40.00 ? 338 PHE B C   1 
ATOM 6722  O O   . PHE B 1 334 ? 44.706  68.635  -36.231  1.00 40.00 ? 338 PHE B O   1 
ATOM 6723  C CB  . PHE B 1 334 ? 43.212  69.090  -33.794  1.00 40.00 ? 338 PHE B CB  1 
ATOM 6724  C CG  . PHE B 1 334 ? 41.987  68.811  -32.972  1.00 40.00 ? 338 PHE B CG  1 
ATOM 6725  C CD1 . PHE B 1 334 ? 42.128  68.392  -31.665  1.00 40.00 ? 338 PHE B CD1 1 
ATOM 6726  C CD2 . PHE B 1 334 ? 40.725  68.925  -33.504  1.00 40.00 ? 338 PHE B CD2 1 
ATOM 6727  C CE1 . PHE B 1 334 ? 41.036  68.109  -30.871  1.00 40.00 ? 338 PHE B CE1 1 
ATOM 6728  C CE2 . PHE B 1 334 ? 39.616  68.639  -32.720  1.00 40.00 ? 338 PHE B CE2 1 
ATOM 6729  C CZ  . PHE B 1 334 ? 39.777  68.223  -31.407  1.00 40.00 ? 338 PHE B CZ  1 
ATOM 6730  N N   . LEU B 1 335 ? 46.182  67.891  -34.709  1.00 40.00 ? 339 LEU B N   1 
ATOM 6731  C CA  . LEU B 1 335 ? 47.282  68.358  -35.549  1.00 40.00 ? 339 LEU B CA  1 
ATOM 6732  C C   . LEU B 1 335 ? 47.476  67.498  -36.774  1.00 40.00 ? 339 LEU B C   1 
ATOM 6733  O O   . LEU B 1 335 ? 47.779  68.001  -37.859  1.00 40.00 ? 339 LEU B O   1 
ATOM 6734  C CB  . LEU B 1 335 ? 48.543  68.548  -34.737  1.00 40.00 ? 339 LEU B CB  1 
ATOM 6735  C CG  . LEU B 1 335 ? 48.448  69.536  -33.561  1.00 40.00 ? 339 LEU B CG  1 
ATOM 6736  C CD1 . LEU B 1 335 ? 49.778  69.556  -32.821  1.00 40.00 ? 339 LEU B CD1 1 
ATOM 6737  C CD2 . LEU B 1 335 ? 48.128  70.929  -34.078  1.00 40.00 ? 339 LEU B CD2 1 
ATOM 6738  N N   . VAL B 1 336 ? 47.245  66.193  -36.655  1.00 40.00 ? 340 VAL B N   1 
ATOM 6739  C CA  . VAL B 1 336 ? 47.410  65.238  -37.729  1.00 40.00 ? 340 VAL B CA  1 
ATOM 6740  C C   . VAL B 1 336 ? 46.484  65.552  -38.898  1.00 40.00 ? 340 VAL B C   1 
ATOM 6741  O O   . VAL B 1 336 ? 46.757  65.298  -40.077  1.00 40.00 ? 340 VAL B O   1 
ATOM 6742  C CB  . VAL B 1 336 ? 47.084  63.799  -37.289  1.00 40.00 ? 340 VAL B CB  1 
ATOM 6743  C CG1 . VAL B 1 336 ? 48.025  63.349  -36.193  1.00 40.00 ? 340 VAL B CG1 1 
ATOM 6744  C CG2 . VAL B 1 336 ? 45.648  63.657  -36.850  1.00 40.00 ? 340 VAL B CG2 1 
ATOM 6745  N N   . TYR B 1 337 ? 45.330  66.120  -38.573  1.00 40.00 ? 341 TYR B N   1 
ATOM 6746  C CA  . TYR B 1 337 ? 44.327  66.464  -39.557  1.00 40.00 ? 341 TYR B CA  1 
ATOM 6747  C C   . TYR B 1 337 ? 44.592  67.755  -40.286  1.00 40.00 ? 341 TYR B C   1 
ATOM 6748  O O   . TYR B 1 337 ? 43.633  68.526  -40.519  1.00 40.00 ? 341 TYR B O   1 
ATOM 6749  C CB  . TYR B 1 337 ? 42.949  66.540  -38.852  1.00 40.00 ? 341 TYR B CB  1 
ATOM 6750  C CG  . TYR B 1 337 ? 42.380  65.190  -38.502  1.00 40.00 ? 341 TYR B CG  1 
ATOM 6751  C CD1 . TYR B 1 337 ? 42.780  64.473  -37.397  1.00 40.00 ? 341 TYR B CD1 1 
ATOM 6752  C CD2 . TYR B 1 337 ? 41.412  64.613  -39.306  1.00 40.00 ? 341 TYR B CD2 1 
ATOM 6753  C CE1 . TYR B 1 337 ? 42.272  63.225  -37.101  1.00 40.00 ? 341 TYR B CE1 1 
ATOM 6754  C CE2 . TYR B 1 337 ? 40.878  63.379  -39.029  1.00 40.00 ? 341 TYR B CE2 1 
ATOM 6755  C CZ  . TYR B 1 337 ? 41.307  62.684  -37.925  1.00 40.00 ? 341 TYR B CZ  1 
ATOM 6756  O OH  . TYR B 1 337 ? 40.742  61.455  -37.666  1.00 40.00 ? 341 TYR B OH  1 
ATOM 6757  N N   . GLY B 1 338 ? 45.793  68.129  -40.709  1.00 40.00 ? 342 GLY B N   1 
ATOM 6758  C CA  . GLY B 1 338 ? 45.912  69.392  -41.426  1.00 40.00 ? 342 GLY B CA  1 
ATOM 6759  C C   . GLY B 1 338 ? 47.067  70.302  -41.100  1.00 40.00 ? 342 GLY B C   1 
ATOM 6760  O O   . GLY B 1 338 ? 47.154  71.398  -41.698  1.00 40.00 ? 342 GLY B O   1 
ATOM 6761  N N   . VAL B 1 339 ? 47.975  69.957  -40.185  1.00 40.00 ? 343 VAL B N   1 
ATOM 6762  C CA  . VAL B 1 339 ? 49.090  70.869  -39.918  1.00 40.00 ? 343 VAL B CA  1 
ATOM 6763  C C   . VAL B 1 339 ? 50.367  70.233  -40.462  1.00 40.00 ? 343 VAL B C   1 
ATOM 6764  O O   . VAL B 1 339 ? 50.894  69.255  -39.930  1.00 40.00 ? 343 VAL B O   1 
ATOM 6765  C CB  . VAL B 1 339 ? 49.218  71.251  -38.452  1.00 40.00 ? 343 VAL B CB  1 
ATOM 6766  C CG1 . VAL B 1 339 ? 50.407  72.186  -38.253  1.00 40.00 ? 343 VAL B CG1 1 
ATOM 6767  C CG2 . VAL B 1 339 ? 47.955  71.951  -37.960  1.00 40.00 ? 343 VAL B CG2 1 
ATOM 6768  N N   . PRO B 1 340 ? 50.849  70.794  -41.572  1.00 40.00 ? 344 PRO B N   1 
ATOM 6769  C CA  . PRO B 1 340 ? 52.016  70.266  -42.251  1.00 40.00 ? 344 PRO B CA  1 
ATOM 6770  C C   . PRO B 1 340 ? 53.138  70.005  -41.265  1.00 40.00 ? 344 PRO B C   1 
ATOM 6771  O O   . PRO B 1 340 ? 53.439  70.858  -40.443  1.00 40.00 ? 344 PRO B O   1 
ATOM 6772  C CB  . PRO B 1 340 ? 52.318  71.235  -43.336  1.00 40.00 ? 344 PRO B CB  1 
ATOM 6773  C CG  . PRO B 1 340 ? 51.213  72.209  -43.390  1.00 40.00 ? 344 PRO B CG  1 
ATOM 6774  C CD  . PRO B 1 340 ? 50.272  71.952  -42.266  1.00 40.00 ? 344 PRO B CD  1 
ATOM 6775  N N   . GLY B 1 341 ? 53.704  68.806  -41.333  1.00 40.00 ? 345 GLY B N   1 
ATOM 6776  C CA  . GLY B 1 341 ? 54.767  68.359  -40.460  1.00 40.00 ? 345 GLY B CA  1 
ATOM 6777  C C   . GLY B 1 341 ? 54.233  67.337  -39.463  1.00 40.00 ? 345 GLY B C   1 
ATOM 6778  O O   . GLY B 1 341 ? 55.013  66.561  -38.890  1.00 40.00 ? 345 GLY B O   1 
ATOM 6779  N N   . PHE B 1 342 ? 52.923  67.319  -39.215  1.00 40.00 ? 346 PHE B N   1 
ATOM 6780  C CA  . PHE B 1 342 ? 52.482  66.341  -38.220  1.00 40.00 ? 346 PHE B CA  1 
ATOM 6781  C C   . PHE B 1 342 ? 51.932  65.070  -38.833  1.00 40.00 ? 346 PHE B C   1 
ATOM 6782  O O   . PHE B 1 342 ? 51.262  65.083  -39.868  1.00 40.00 ? 346 PHE B O   1 
ATOM 6783  C CB  . PHE B 1 342 ? 51.458  67.008  -37.302  1.00 40.00 ? 346 PHE B CB  1 
ATOM 6784  C CG  . PHE B 1 342 ? 52.017  68.181  -36.542  1.00 40.00 ? 346 PHE B CG  1 
ATOM 6785  C CD1 . PHE B 1 342 ? 52.434  68.016  -35.235  1.00 40.00 ? 346 PHE B CD1 1 
ATOM 6786  C CD2 . PHE B 1 342 ? 52.115  69.440  -37.115  1.00 40.00 ? 346 PHE B CD2 1 
ATOM 6787  C CE1 . PHE B 1 342 ? 52.940  69.085  -34.524  1.00 40.00 ? 346 PHE B CE1 1 
ATOM 6788  C CE2 . PHE B 1 342 ? 52.626  70.516  -36.408  1.00 40.00 ? 346 PHE B CE2 1 
ATOM 6789  C CZ  . PHE B 1 342 ? 53.039  70.332  -35.115  1.00 40.00 ? 346 PHE B CZ  1 
ATOM 6790  N N   . SER B 1 343 ? 52.202  63.962  -38.152  1.00 40.00 ? 347 SER B N   1 
ATOM 6791  C CA  . SER B 1 343 ? 51.684  62.668  -38.549  1.00 40.00 ? 347 SER B CA  1 
ATOM 6792  C C   . SER B 1 343 ? 51.640  61.756  -37.317  1.00 40.00 ? 347 SER B C   1 
ATOM 6793  O O   . SER B 1 343 ? 52.416  61.934  -36.379  1.00 40.00 ? 347 SER B O   1 
ATOM 6794  C CB  . SER B 1 343 ? 52.573  62.006  -39.608  1.00 40.00 ? 347 SER B CB  1 
ATOM 6795  O OG  . SER B 1 343 ? 52.881  60.685  -39.129  1.00 40.00 ? 347 SER B OG  1 
ATOM 6796  N N   . LYS B 1 344 ? 50.812  60.723  -37.366  1.00 40.00 ? 348 LYS B N   1 
ATOM 6797  C CA  . LYS B 1 344 ? 50.783  59.793  -36.227  1.00 40.00 ? 348 LYS B CA  1 
ATOM 6798  C C   . LYS B 1 344 ? 51.938  58.803  -36.399  1.00 40.00 ? 348 LYS B C   1 
ATOM 6799  O O   . LYS B 1 344 ? 52.298  58.052  -35.491  1.00 40.00 ? 348 LYS B O   1 
ATOM 6800  C CB  . LYS B 1 344 ? 49.438  59.060  -36.212  1.00 40.00 ? 348 LYS B CB  1 
ATOM 6801  C CG  . LYS B 1 344 ? 49.300  57.867  -37.159  1.00 40.00 ? 348 LYS B CG  1 
ATOM 6802  C CD  . LYS B 1 344 ? 47.981  57.150  -36.865  1.00 40.00 ? 348 LYS B CD  1 
ATOM 6803  C CE  . LYS B 1 344 ? 48.032  55.670  -37.200  1.00 40.00 ? 348 LYS B CE  1 
ATOM 6804  N NZ  . LYS B 1 344 ? 48.575  54.884  -36.057  1.00 40.00 ? 348 LYS B NZ  1 
ATOM 6805  N N   . ASP B 1 345 ? 52.505  58.794  -37.604  1.00 40.00 ? 349 ASP B N   1 
ATOM 6806  C CA  . ASP B 1 345 ? 53.536  57.837  -37.922  1.00 40.00 ? 349 ASP B CA  1 
ATOM 6807  C C   . ASP B 1 345 ? 54.952  58.191  -37.606  1.00 40.00 ? 349 ASP B C   1 
ATOM 6808  O O   . ASP B 1 345 ? 55.764  57.241  -37.502  1.00 40.00 ? 349 ASP B O   1 
ATOM 6809  C CB  . ASP B 1 345 ? 53.314  57.316  -39.350  1.00 40.00 ? 349 ASP B CB  1 
ATOM 6810  C CG  . ASP B 1 345 ? 51.978  56.557  -39.420  1.00 40.00 ? 349 ASP B CG  1 
ATOM 6811  O OD1 . ASP B 1 345 ? 51.606  55.828  -38.472  1.00 40.00 ? 349 ASP B OD1 1 
ATOM 6812  O OD2 . ASP B 1 345 ? 51.291  56.717  -40.457  1.00 40.00 ? 349 ASP B OD2 1 
ATOM 6813  N N   . ASN B 1 346 ? 55.287  59.462  -37.397  1.00 40.00 ? 350 ASN B N   1 
ATOM 6814  C CA  . ASN B 1 346 ? 56.636  59.860  -36.979  1.00 40.00 ? 350 ASN B CA  1 
ATOM 6815  C C   . ASN B 1 346 ? 56.485  60.744  -35.743  1.00 40.00 ? 350 ASN B C   1 
ATOM 6816  O O   . ASN B 1 346 ? 55.358  61.048  -35.325  1.00 40.00 ? 350 ASN B O   1 
ATOM 6817  C CB  . ASN B 1 346 ? 57.401  60.586  -38.052  1.00 40.00 ? 350 ASN B CB  1 
ATOM 6818  C CG  . ASN B 1 346 ? 56.575  61.725  -38.637  1.00 40.00 ? 350 ASN B CG  1 
ATOM 6819  O OD1 . ASN B 1 346 ? 55.614  62.159  -37.994  1.00 40.00 ? 350 ASN B OD1 1 
ATOM 6820  N ND2 . ASN B 1 346 ? 56.989  62.131  -39.812  1.00 40.00 ? 350 ASN B ND2 1 
ATOM 6821  N N   . GLU B 1 347 ? 57.579  61.223  -35.187  1.00 40.00 ? 351 GLU B N   1 
ATOM 6822  C CA  . GLU B 1 347 ? 57.593  62.044  -33.984  1.00 40.00 ? 351 GLU B CA  1 
ATOM 6823  C C   . GLU B 1 347 ? 57.183  63.479  -34.233  1.00 40.00 ? 351 GLU B C   1 
ATOM 6824  O O   . GLU B 1 347 ? 57.101  64.313  -33.316  1.00 40.00 ? 351 GLU B O   1 
ATOM 6825  C CB  . GLU B 1 347 ? 59.001  61.995  -33.388  1.00 40.00 ? 351 GLU B CB  1 
ATOM 6826  C CG  . GLU B 1 347 ? 59.359  60.659  -32.751  1.00 40.00 ? 351 GLU B CG  1 
ATOM 6827  C CD  . GLU B 1 347 ? 60.369  60.868  -31.620  1.00 40.00 ? 351 GLU B CD  1 
ATOM 6828  O OE1 . GLU B 1 347 ? 59.942  61.030  -30.442  1.00 40.00 ? 351 GLU B OE1 1 
ATOM 6829  O OE2 . GLU B 1 347 ? 61.576  60.879  -31.942  1.00 40.00 ? 351 GLU B OE2 1 
ATOM 6830  N N   . SER B 1 348 ? 56.921  63.790  -35.504  1.00 40.00 ? 352 SER B N   1 
ATOM 6831  C CA  . SER B 1 348 ? 56.478  65.113  -35.893  1.00 40.00 ? 352 SER B CA  1 
ATOM 6832  C C   . SER B 1 348 ? 57.321  66.205  -35.240  1.00 40.00 ? 352 SER B C   1 
ATOM 6833  O O   . SER B 1 348 ? 56.819  67.138  -34.604  1.00 40.00 ? 352 SER B O   1 
ATOM 6834  C CB  . SER B 1 348 ? 54.991  65.304  -35.599  1.00 40.00 ? 352 SER B CB  1 
ATOM 6835  O OG  . SER B 1 348 ? 54.275  64.105  -35.415  1.00 40.00 ? 352 SER B OG  1 
ATOM 6836  N N   . LEU B 1 349 ? 58.647  66.083  -35.386  1.00 40.00 ? 353 LEU B N   1 
ATOM 6837  C CA  . LEU B 1 349 ? 59.541  67.121  -34.870  1.00 40.00 ? 353 LEU B CA  1 
ATOM 6838  C C   . LEU B 1 349 ? 59.557  68.193  -35.972  1.00 40.00 ? 353 LEU B C   1 
ATOM 6839  O O   . LEU B 1 349 ? 60.348  68.134  -36.911  1.00 40.00 ? 353 LEU B O   1 
ATOM 6840  C CB  . LEU B 1 349 ? 60.922  66.616  -34.571  1.00 40.00 ? 353 LEU B CB  1 
ATOM 6841  C CG  . LEU B 1 349 ? 61.259  65.922  -33.265  1.00 40.00 ? 353 LEU B CG  1 
ATOM 6842  C CD1 . LEU B 1 349 ? 60.132  65.901  -32.238  1.00 40.00 ? 353 LEU B CD1 1 
ATOM 6843  C CD2 . LEU B 1 349 ? 61.744  64.491  -33.530  1.00 40.00 ? 353 LEU B CD2 1 
ATOM 6844  N N   . ILE B 1 350 ? 58.660  69.150  -35.877  1.00 40.00 ? 354 ILE B N   1 
ATOM 6845  C CA  . ILE B 1 350 ? 58.533  70.201  -36.871  1.00 40.00 ? 354 ILE B CA  1 
ATOM 6846  C C   . ILE B 1 350 ? 59.591  71.295  -36.832  1.00 40.00 ? 354 ILE B C   1 
ATOM 6847  O O   . ILE B 1 350 ? 60.301  71.558  -35.868  1.00 40.00 ? 354 ILE B O   1 
ATOM 6848  C CB  . ILE B 1 350 ? 57.127  70.834  -36.714  1.00 40.00 ? 354 ILE B CB  1 
ATOM 6849  C CG1 . ILE B 1 350 ? 57.091  71.660  -35.418  1.00 40.00 ? 354 ILE B CG1 1 
ATOM 6850  C CG2 . ILE B 1 350 ? 56.091  69.714  -36.611  1.00 40.00 ? 354 ILE B CG2 1 
ATOM 6851  C CD1 . ILE B 1 350 ? 56.143  72.835  -35.445  1.00 40.00 ? 354 ILE B CD1 1 
ATOM 6852  N N   . SER B 1 351 ? 59.710  71.987  -37.952  1.00 40.00 ? 355 SER B N   1 
ATOM 6853  C CA  . SER B 1 351 ? 60.571  73.110  -38.213  1.00 40.00 ? 355 SER B CA  1 
ATOM 6854  C C   . SER B 1 351 ? 59.951  74.364  -37.597  1.00 40.00 ? 355 SER B C   1 
ATOM 6855  O O   . SER B 1 351 ? 58.772  74.288  -37.259  1.00 40.00 ? 355 SER B O   1 
ATOM 6856  C CB  . SER B 1 351 ? 60.575  73.406  -39.734  1.00 40.00 ? 355 SER B CB  1 
ATOM 6857  O OG  . SER B 1 351 ? 59.895  74.639  -40.001  1.00 40.00 ? 355 SER B OG  1 
ATOM 6858  N N   . ARG B 1 352 ? 60.673  75.479  -37.564  1.00 40.00 ? 356 ARG B N   1 
ATOM 6859  C CA  . ARG B 1 352 ? 60.044  76.685  -37.031  1.00 40.00 ? 356 ARG B CA  1 
ATOM 6860  C C   . ARG B 1 352 ? 58.983  77.192  -37.996  1.00 40.00 ? 356 ARG B C   1 
ATOM 6861  O O   . ARG B 1 352 ? 57.812  77.394  -37.663  1.00 40.00 ? 356 ARG B O   1 
ATOM 6862  C CB  . ARG B 1 352 ? 61.033  77.800  -36.741  1.00 40.00 ? 356 ARG B CB  1 
ATOM 6863  C CG  . ARG B 1 352 ? 60.649  78.557  -35.453  1.00 40.00 ? 356 ARG B CG  1 
ATOM 6864  C CD  . ARG B 1 352 ? 61.336  79.902  -35.391  1.00 40.00 ? 356 ARG B CD  1 
ATOM 6865  N NE  . ARG B 1 352 ? 60.491  80.982  -34.903  1.00 40.00 ? 356 ARG B NE  1 
ATOM 6866  C CZ  . ARG B 1 352 ? 60.004  80.996  -33.657  1.00 40.00 ? 356 ARG B CZ  1 
ATOM 6867  N NH1 . ARG B 1 352 ? 60.281  79.989  -32.842  1.00 40.00 ? 356 ARG B NH1 1 
ATOM 6868  N NH2 . ARG B 1 352 ? 59.239  82.008  -33.265  1.00 40.00 ? 356 ARG B NH2 1 
ATOM 6869  N N   . ALA B 1 353 ? 59.373  77.365  -39.253  1.00 40.00 ? 357 ALA B N   1 
ATOM 6870  C CA  . ALA B 1 353 ? 58.458  77.833  -40.291  1.00 40.00 ? 357 ALA B CA  1 
ATOM 6871  C C   . ALA B 1 353 ? 57.162  77.027  -40.303  1.00 40.00 ? 357 ALA B C   1 
ATOM 6872  O O   . ALA B 1 353 ? 56.066  77.558  -40.526  1.00 40.00 ? 357 ALA B O   1 
ATOM 6873  C CB  . ALA B 1 353 ? 59.108  77.787  -41.656  1.00 40.00 ? 357 ALA B CB  1 
ATOM 6874  N N   . GLN B 1 354 ? 57.285  75.721  -40.077  1.00 40.00 ? 358 GLN B N   1 
ATOM 6875  C CA  . GLN B 1 354 ? 56.091  74.880  -40.003  1.00 40.00 ? 358 GLN B CA  1 
ATOM 6876  C C   . GLN B 1 354 ? 55.253  75.417  -38.836  1.00 40.00 ? 358 GLN B C   1 
ATOM 6877  O O   . GLN B 1 354 ? 54.096  75.828  -38.972  1.00 40.00 ? 358 GLN B O   1 
ATOM 6878  C CB  . GLN B 1 354 ? 56.458  73.410  -39.794  1.00 40.00 ? 358 GLN B CB  1 
ATOM 6879  C CG  . GLN B 1 354 ? 57.052  72.775  -41.040  1.00 40.00 ? 358 GLN B CG  1 
ATOM 6880  C CD  . GLN B 1 354 ? 57.466  71.334  -40.889  1.00 40.00 ? 358 GLN B CD  1 
ATOM 6881  O OE1 . GLN B 1 354 ? 57.985  70.844  -39.879  1.00 40.00 ? 358 GLN B OE1 1 
ATOM 6882  N NE2 . GLN B 1 354 ? 57.232  70.578  -41.972  1.00 40.00 ? 358 GLN B NE2 1 
ATOM 6883  N N   . PHE B 1 355 ? 55.880  75.474  -37.657  1.00 40.00 ? 359 PHE B N   1 
ATOM 6884  C CA  . PHE B 1 355 ? 55.189  76.025  -36.490  1.00 40.00 ? 359 PHE B CA  1 
ATOM 6885  C C   . PHE B 1 355 ? 54.585  77.399  -36.781  1.00 40.00 ? 359 PHE B C   1 
ATOM 6886  O O   . PHE B 1 355 ? 53.445  77.684  -36.378  1.00 40.00 ? 359 PHE B O   1 
ATOM 6887  C CB  . PHE B 1 355 ? 56.138  76.097  -35.294  1.00 40.00 ? 359 PHE B CB  1 
ATOM 6888  C CG  . PHE B 1 355 ? 55.569  76.865  -34.131  1.00 40.00 ? 359 PHE B CG  1 
ATOM 6889  C CD1 . PHE B 1 355 ? 55.692  78.244  -34.074  1.00 40.00 ? 359 PHE B CD1 1 
ATOM 6890  C CD2 . PHE B 1 355 ? 54.917  76.206  -33.108  1.00 40.00 ? 359 PHE B CD2 1 
ATOM 6891  C CE1 . PHE B 1 355 ? 55.171  78.972  -33.015  1.00 40.00 ? 359 PHE B CE1 1 
ATOM 6892  C CE2 . PHE B 1 355 ? 54.392  76.930  -32.060  1.00 40.00 ? 359 PHE B CE2 1 
ATOM 6893  C CZ  . PHE B 1 355 ? 54.516  78.310  -32.009  1.00 40.00 ? 359 PHE B CZ  1 
ATOM 6894  N N   . LEU B 1 356 ? 55.320  78.297  -37.468  1.00 40.00 ? 360 LEU B N   1 
ATOM 6895  C CA  . LEU B 1 356 ? 54.724  79.590  -37.781  1.00 40.00 ? 360 LEU B CA  1 
ATOM 6896  C C   . LEU B 1 356 ? 53.433  79.421  -38.582  1.00 40.00 ? 360 LEU B C   1 
ATOM 6897  O O   . LEU B 1 356 ? 52.476  80.174  -38.390  1.00 40.00 ? 360 LEU B O   1 
ATOM 6898  C CB  . LEU B 1 356 ? 55.650  80.481  -38.580  1.00 40.00 ? 360 LEU B CB  1 
ATOM 6899  C CG  . LEU B 1 356 ? 56.711  81.307  -37.868  1.00 40.00 ? 360 LEU B CG  1 
ATOM 6900  C CD1 . LEU B 1 356 ? 56.401  81.487  -36.384  1.00 40.00 ? 360 LEU B CD1 1 
ATOM 6901  C CD2 . LEU B 1 356 ? 58.072  80.624  -38.018  1.00 40.00 ? 360 LEU B CD2 1 
ATOM 6902  N N   . ALA B 1 357 ? 53.427  78.470  -39.509  1.00 40.00 ? 361 ALA B N   1 
ATOM 6903  C CA  . ALA B 1 357 ? 52.240  78.246  -40.347  1.00 40.00 ? 361 ALA B CA  1 
ATOM 6904  C C   . ALA B 1 357 ? 51.111  77.604  -39.544  1.00 40.00 ? 361 ALA B C   1 
ATOM 6905  O O   . ALA B 1 357 ? 49.938  77.927  -39.662  1.00 40.00 ? 361 ALA B O   1 
ATOM 6906  C CB  . ALA B 1 357 ? 52.622  77.326  -41.475  1.00 40.00 ? 361 ALA B CB  1 
ATOM 6907  N N   . GLY B 1 358 ? 51.551  76.671  -38.685  1.00 40.00 ? 362 GLY B N   1 
ATOM 6908  C CA  . GLY B 1 358 ? 50.599  75.948  -37.849  1.00 40.00 ? 362 GLY B CA  1 
ATOM 6909  C C   . GLY B 1 358 ? 49.735  77.000  -37.167  1.00 40.00 ? 362 GLY B C   1 
ATOM 6910  O O   . GLY B 1 358 ? 48.508  77.024  -37.230  1.00 40.00 ? 362 GLY B O   1 
ATOM 6911  N N   . VAL B 1 359 ? 50.427  77.943  -36.526  1.00 40.00 ? 363 VAL B N   1 
ATOM 6912  C CA  . VAL B 1 359 ? 49.726  78.998  -35.803  1.00 40.00 ? 363 VAL B CA  1 
ATOM 6913  C C   . VAL B 1 359 ? 48.639  79.618  -36.649  1.00 40.00 ? 363 VAL B C   1 
ATOM 6914  O O   . VAL B 1 359 ? 47.541  79.905  -36.120  1.00 40.00 ? 363 VAL B O   1 
ATOM 6915  C CB  . VAL B 1 359 ? 50.676  80.035  -35.205  1.00 40.00 ? 363 VAL B CB  1 
ATOM 6916  C CG1 . VAL B 1 359 ? 49.911  81.256  -34.724  1.00 40.00 ? 363 VAL B CG1 1 
ATOM 6917  C CG2 . VAL B 1 359 ? 51.447  79.417  -34.029  1.00 40.00 ? 363 VAL B CG2 1 
ATOM 6918  N N   . ARG B 1 360 ? 48.836  79.816  -37.950  1.00 40.00 ? 364 ARG B N   1 
ATOM 6919  C CA  . ARG B 1 360 ? 47.741  80.421  -38.728  1.00 40.00 ? 364 ARG B CA  1 
ATOM 6920  C C   . ARG B 1 360 ? 46.630  79.445  -39.031  1.00 40.00 ? 364 ARG B C   1 
ATOM 6921  O O   . ARG B 1 360 ? 45.450  79.837  -39.198  1.00 40.00 ? 364 ARG B O   1 
ATOM 6922  C CB  . ARG B 1 360 ? 48.318  81.113  -39.948  1.00 40.00 ? 364 ARG B CB  1 
ATOM 6923  C CG  . ARG B 1 360 ? 49.707  81.682  -39.688  1.00 40.00 ? 364 ARG B CG  1 
ATOM 6924  C CD  . ARG B 1 360 ? 49.661  82.981  -38.946  1.00 40.00 ? 364 ARG B CD  1 
ATOM 6925  N NE  . ARG B 1 360 ? 48.456  83.796  -39.101  1.00 40.00 ? 364 ARG B NE  1 
ATOM 6926  C CZ  . ARG B 1 360 ? 48.487  84.979  -39.739  1.00 40.00 ? 364 ARG B CZ  1 
ATOM 6927  N NH1 . ARG B 1 360 ? 49.639  85.396  -40.260  1.00 40.00 ? 364 ARG B NH1 1 
ATOM 6928  N NH2 . ARG B 1 360 ? 47.387  85.704  -39.851  1.00 40.00 ? 364 ARG B NH2 1 
ATOM 6929  N N   . ILE B 1 361 ? 46.910  78.152  -39.088  1.00 40.00 ? 365 ILE B N   1 
ATOM 6930  C CA  . ILE B 1 361 ? 45.831  77.183  -39.354  1.00 40.00 ? 365 ILE B CA  1 
ATOM 6931  C C   . ILE B 1 361 ? 45.017  77.006  -38.069  1.00 40.00 ? 365 ILE B C   1 
ATOM 6932  O O   . ILE B 1 361 ? 43.796  77.060  -38.025  1.00 40.00 ? 365 ILE B O   1 
ATOM 6933  C CB  . ILE B 1 361 ? 46.475  75.847  -39.712  1.00 40.00 ? 365 ILE B CB  1 
ATOM 6934  C CG1 . ILE B 1 361 ? 46.926  75.845  -41.182  1.00 40.00 ? 365 ILE B CG1 1 
ATOM 6935  C CG2 . ILE B 1 361 ? 45.575  74.660  -39.435  1.00 40.00 ? 365 ILE B CG2 1 
ATOM 6936  C CD1 . ILE B 1 361 ? 47.817  74.654  -41.434  1.00 40.00 ? 365 ILE B CD1 1 
ATOM 6937  N N   . GLY B 1 362 ? 45.784  76.789  -36.999  1.00 40.00 ? 366 GLY B N   1 
ATOM 6938  C CA  . GLY B 1 362 ? 45.246  76.604  -35.665  1.00 40.00 ? 366 GLY B CA  1 
ATOM 6939  C C   . GLY B 1 362 ? 44.520  77.806  -35.107  1.00 40.00 ? 366 GLY B C   1 
ATOM 6940  O O   . GLY B 1 362 ? 43.664  77.601  -34.247  1.00 40.00 ? 366 GLY B O   1 
ATOM 6941  N N   . VAL B 1 363 ? 44.736  79.031  -35.570  1.00 40.00 ? 367 VAL B N   1 
ATOM 6942  C CA  . VAL B 1 363 ? 44.070  80.240  -35.079  1.00 40.00 ? 367 VAL B CA  1 
ATOM 6943  C C   . VAL B 1 363 ? 43.706  81.049  -36.313  1.00 40.00 ? 367 VAL B C   1 
ATOM 6944  O O   . VAL B 1 363 ? 44.191  82.150  -36.626  1.00 40.00 ? 367 VAL B O   1 
ATOM 6945  C CB  . VAL B 1 363 ? 45.097  81.076  -34.275  1.00 40.00 ? 367 VAL B CB  1 
ATOM 6946  C CG1 . VAL B 1 363 ? 44.370  82.156  -33.489  1.00 40.00 ? 367 VAL B CG1 1 
ATOM 6947  C CG2 . VAL B 1 363 ? 45.975  80.219  -33.387  1.00 40.00 ? 367 VAL B CG2 1 
ATOM 6948  N N   . PRO B 1 364 ? 42.826  80.442  -37.108  1.00 40.00 ? 368 PRO B N   1 
ATOM 6949  C CA  . PRO B 1 364 ? 42.417  80.987  -38.394  1.00 40.00 ? 368 PRO B CA  1 
ATOM 6950  C C   . PRO B 1 364 ? 41.828  82.363  -38.340  1.00 40.00 ? 368 PRO B C   1 
ATOM 6951  O O   . PRO B 1 364 ? 41.830  83.089  -39.345  1.00 40.00 ? 368 PRO B O   1 
ATOM 6952  C CB  . PRO B 1 364 ? 41.322  80.026  -38.873  1.00 40.00 ? 368 PRO B CB  1 
ATOM 6953  C CG  . PRO B 1 364 ? 40.819  79.429  -37.603  1.00 40.00 ? 368 PRO B CG  1 
ATOM 6954  C CD  . PRO B 1 364 ? 42.137  79.156  -36.878  1.00 40.00 ? 368 PRO B CD  1 
ATOM 6955  N N   . GLN B 1 365 ? 41.251  82.729  -37.210  1.00 40.00 ? 369 GLN B N   1 
ATOM 6956  C CA  . GLN B 1 365 ? 40.611  84.039  -37.124  1.00 40.00 ? 369 GLN B CA  1 
ATOM 6957  C C   . GLN B 1 365 ? 41.638  85.112  -36.804  1.00 40.00 ? 369 GLN B C   1 
ATOM 6958  O O   . GLN B 1 365 ? 41.298  86.301  -36.815  1.00 40.00 ? 369 GLN B O   1 
ATOM 6959  C CB  . GLN B 1 365 ? 39.557  84.045  -36.007  1.00 40.00 ? 369 GLN B CB  1 
ATOM 6960  C CG  . GLN B 1 365 ? 40.197  84.010  -34.621  1.00 40.00 ? 369 GLN B CG  1 
ATOM 6961  C CD  . GLN B 1 365 ? 40.466  82.619  -34.111  1.00 40.00 ? 369 GLN B CD  1 
ATOM 6962  O OE1 . GLN B 1 365 ? 41.065  81.778  -34.776  1.00 40.00 ? 369 GLN B OE1 1 
ATOM 6963  N NE2 . GLN B 1 365 ? 40.010  82.343  -32.879  1.00 40.00 ? 369 GLN B NE2 1 
ATOM 6964  N N   . ALA B 1 366 ? 42.862  84.671  -36.474  1.00 40.00 ? 370 ALA B N   1 
ATOM 6965  C CA  . ALA B 1 366 ? 43.837  85.650  -36.084  1.00 40.00 ? 370 ALA B CA  1 
ATOM 6966  C C   . ALA B 1 366 ? 44.378  86.500  -37.199  1.00 40.00 ? 370 ALA B C   1 
ATOM 6967  O O   . ALA B 1 366 ? 44.846  86.041  -38.232  1.00 40.00 ? 370 ALA B O   1 
ATOM 6968  C CB  . ALA B 1 366 ? 45.007  84.993  -35.346  1.00 40.00 ? 370 ALA B CB  1 
ATOM 6969  N N   . SER B 1 367 ? 44.404  87.800  -36.909  1.00 40.00 ? 371 SER B N   1 
ATOM 6970  C CA  . SER B 1 367 ? 45.098  88.735  -37.820  1.00 40.00 ? 371 SER B CA  1 
ATOM 6971  C C   . SER B 1 367 ? 46.599  88.441  -37.698  1.00 40.00 ? 371 SER B C   1 
ATOM 6972  O O   . SER B 1 367 ? 47.023  87.583  -36.908  1.00 40.00 ? 371 SER B O   1 
ATOM 6973  C CB  . SER B 1 367 ? 44.825  90.164  -37.355  1.00 40.00 ? 371 SER B CB  1 
ATOM 6974  O OG  . SER B 1 367 ? 45.594  90.542  -36.223  1.00 40.00 ? 371 SER B OG  1 
ATOM 6975  N N   . ASP B 1 368 ? 47.433  89.182  -38.428  1.00 40.00 ? 372 ASP B N   1 
ATOM 6976  C CA  . ASP B 1 368 ? 48.883  88.940  -38.325  1.00 40.00 ? 372 ASP B CA  1 
ATOM 6977  C C   . ASP B 1 368 ? 49.400  89.291  -36.931  1.00 40.00 ? 372 ASP B C   1 
ATOM 6978  O O   . ASP B 1 368 ? 50.008  88.466  -36.252  1.00 40.00 ? 372 ASP B O   1 
ATOM 6979  C CB  . ASP B 1 368 ? 49.697  89.731  -39.328  1.00 40.00 ? 372 ASP B CB  1 
ATOM 6980  C CG  . ASP B 1 368 ? 49.401  89.340  -40.757  1.00 40.00 ? 372 ASP B CG  1 
ATOM 6981  O OD1 . ASP B 1 368 ? 49.587  88.152  -41.069  1.00 40.00 ? 372 ASP B OD1 1 
ATOM 6982  O OD2 . ASP B 1 368 ? 48.976  90.238  -41.509  1.00 40.00 ? 372 ASP B OD2 1 
ATOM 6983  N N   . LEU B 1 369 ? 49.127  90.529  -36.521  1.00 40.00 ? 373 LEU B N   1 
ATOM 6984  C CA  . LEU B 1 369 ? 49.568  90.952  -35.200  1.00 40.00 ? 373 LEU B CA  1 
ATOM 6985  C C   . LEU B 1 369 ? 49.159  89.918  -34.158  1.00 40.00 ? 373 LEU B C   1 
ATOM 6986  O O   . LEU B 1 369 ? 49.991  89.481  -33.352  1.00 40.00 ? 373 LEU B O   1 
ATOM 6987  C CB  . LEU B 1 369 ? 48.960  92.298  -34.882  1.00 40.00 ? 373 LEU B CB  1 
ATOM 6988  C CG  . LEU B 1 369 ? 49.663  93.152  -33.836  1.00 40.00 ? 373 LEU B CG  1 
ATOM 6989  C CD1 . LEU B 1 369 ? 51.164  93.124  -33.983  1.00 40.00 ? 373 LEU B CD1 1 
ATOM 6990  C CD2 . LEU B 1 369 ? 49.128  94.584  -33.947  1.00 40.00 ? 373 LEU B CD2 1 
ATOM 6991  N N   . ALA B 1 370 ? 47.870  89.509  -34.194  1.00 40.00 ? 374 ALA B N   1 
ATOM 6992  C CA  . ALA B 1 370 ? 47.435  88.522  -33.192  1.00 40.00 ? 374 ALA B CA  1 
ATOM 6993  C C   . ALA B 1 370 ? 48.228  87.237  -33.331  1.00 40.00 ? 374 ALA B C   1 
ATOM 6994  O O   . ALA B 1 370 ? 48.672  86.642  -32.349  1.00 40.00 ? 374 ALA B O   1 
ATOM 6995  C CB  . ALA B 1 370 ? 45.955  88.296  -33.269  1.00 40.00 ? 374 ALA B CB  1 
ATOM 6996  N N   . ALA B 1 371 ? 48.462  86.812  -34.559  1.00 40.00 ? 375 ALA B N   1 
ATOM 6997  C CA  . ALA B 1 371 ? 49.289  85.609  -34.735  1.00 40.00 ? 375 ALA B CA  1 
ATOM 6998  C C   . ALA B 1 371 ? 50.648  85.844  -34.077  1.00 40.00 ? 375 ALA B C   1 
ATOM 6999  O O   . ALA B 1 371 ? 51.168  85.002  -33.352  1.00 40.00 ? 375 ALA B O   1 
ATOM 7000  C CB  . ALA B 1 371 ? 49.493  85.345  -36.220  1.00 40.00 ? 375 ALA B CB  1 
ATOM 7001  N N   . GLU B 1 372 ? 51.230  87.018  -34.342  1.00 40.00 ? 376 GLU B N   1 
ATOM 7002  C CA  . GLU B 1 372 ? 52.517  87.372  -33.758  1.00 40.00 ? 376 GLU B CA  1 
ATOM 7003  C C   . GLU B 1 372 ? 52.435  87.171  -32.245  1.00 40.00 ? 376 GLU B C   1 
ATOM 7004  O O   . GLU B 1 372 ? 53.229  86.457  -31.615  1.00 40.00 ? 376 GLU B O   1 
ATOM 7005  C CB  . GLU B 1 372 ? 52.868  88.808  -34.110  1.00 40.00 ? 376 GLU B CB  1 
ATOM 7006  C CG  . GLU B 1 372 ? 54.324  89.021  -34.565  1.00 40.00 ? 376 GLU B CG  1 
ATOM 7007  C CD  . GLU B 1 372 ? 54.353  89.340  -36.048  1.00 40.00 ? 376 GLU B CD  1 
ATOM 7008  O OE1 . GLU B 1 372 ? 53.833  90.430  -36.397  1.00 40.00 ? 376 GLU B OE1 1 
ATOM 7009  O OE2 . GLU B 1 372 ? 54.857  88.521  -36.856  1.00 40.00 ? 376 GLU B OE2 1 
ATOM 7010  N N   . ALA B 1 373 ? 51.412  87.782  -31.642  1.00 40.00 ? 377 ALA B N   1 
ATOM 7011  C CA  . ALA B 1 373 ? 51.185  87.628  -30.200  1.00 40.00 ? 377 ALA B CA  1 
ATOM 7012  C C   . ALA B 1 373 ? 51.254  86.153  -29.798  1.00 40.00 ? 377 ALA B C   1 
ATOM 7013  O O   . ALA B 1 373 ? 52.022  85.778  -28.891  1.00 40.00 ? 377 ALA B O   1 
ATOM 7014  C CB  . ALA B 1 373 ? 49.848  88.197  -29.771  1.00 40.00 ? 377 ALA B CB  1 
ATOM 7015  N N   . VAL B 1 374 ? 50.475  85.312  -30.505  1.00 40.00 ? 378 VAL B N   1 
ATOM 7016  C CA  . VAL B 1 374 ? 50.522  83.891  -30.172  1.00 40.00 ? 378 VAL B CA  1 
ATOM 7017  C C   . VAL B 1 374 ? 51.918  83.308  -30.331  1.00 40.00 ? 378 VAL B C   1 
ATOM 7018  O O   . VAL B 1 374 ? 52.398  82.514  -29.495  1.00 40.00 ? 378 VAL B O   1 
ATOM 7019  C CB  . VAL B 1 374 ? 49.537  83.115  -31.057  1.00 40.00 ? 378 VAL B CB  1 
ATOM 7020  C CG1 . VAL B 1 374 ? 49.500  81.653  -30.626  1.00 40.00 ? 378 VAL B CG1 1 
ATOM 7021  C CG2 . VAL B 1 374 ? 48.171  83.779  -30.950  1.00 40.00 ? 378 VAL B CG2 1 
ATOM 7022  N N   . VAL B 1 375 ? 52.624  83.684  -31.400  1.00 40.00 ? 379 VAL B N   1 
ATOM 7023  C CA  . VAL B 1 375 ? 53.952  83.102  -31.554  1.00 40.00 ? 379 VAL B CA  1 
ATOM 7024  C C   . VAL B 1 375 ? 54.884  83.515  -30.425  1.00 40.00 ? 379 VAL B C   1 
ATOM 7025  O O   . VAL B 1 375 ? 55.691  82.728  -29.932  1.00 40.00 ? 379 VAL B O   1 
ATOM 7026  C CB  . VAL B 1 375 ? 54.612  83.428  -32.894  1.00 40.00 ? 379 VAL B CB  1 
ATOM 7027  C CG1 . VAL B 1 375 ? 55.966  82.736  -32.927  1.00 40.00 ? 379 VAL B CG1 1 
ATOM 7028  C CG2 . VAL B 1 375 ? 53.726  82.948  -34.031  1.00 40.00 ? 379 VAL B CG2 1 
ATOM 7029  N N   . LEU B 1 376 ? 54.729  84.794  -30.049  1.00 40.00 ? 380 LEU B N   1 
ATOM 7030  C CA  . LEU B 1 376 ? 55.547  85.351  -28.965  1.00 40.00 ? 380 LEU B CA  1 
ATOM 7031  C C   . LEU B 1 376 ? 55.336  84.469  -27.733  1.00 40.00 ? 380 LEU B C   1 
ATOM 7032  O O   . LEU B 1 376 ? 56.233  83.973  -27.100  1.00 40.00 ? 380 LEU B O   1 
ATOM 7033  C CB  . LEU B 1 376 ? 55.030  86.721  -28.558  1.00 40.00 ? 380 LEU B CB  1 
ATOM 7034  C CG  . LEU B 1 376 ? 55.860  87.607  -27.662  1.00 40.00 ? 380 LEU B CG  1 
ATOM 7035  C CD1 . LEU B 1 376 ? 54.987  88.349  -26.662  1.00 40.00 ? 380 LEU B CD1 1 
ATOM 7036  C CD2 . LEU B 1 376 ? 57.002  86.907  -26.965  1.00 40.00 ? 380 LEU B CD2 1 
ATOM 7037  N N   . HIS B 1 377 ? 54.030  84.333  -27.456  1.00 40.00 ? 381 HIS B N   1 
ATOM 7038  C CA  . HIS B 1 377 ? 53.677  83.566  -26.280  1.00 40.00 ? 381 HIS B CA  1 
ATOM 7039  C C   . HIS B 1 377 ? 54.133  82.127  -26.280  1.00 40.00 ? 381 HIS B C   1 
ATOM 7040  O O   . HIS B 1 377 ? 54.532  81.672  -25.189  1.00 40.00 ? 381 HIS B O   1 
ATOM 7041  C CB  . HIS B 1 377 ? 52.181  83.618  -26.000  1.00 40.00 ? 381 HIS B CB  1 
ATOM 7042  C CG  . HIS B 1 377 ? 51.850  83.118  -24.631  1.00 40.00 ? 381 HIS B CG  1 
ATOM 7043  N ND1 . HIS B 1 377 ? 51.743  83.941  -23.533  1.00 40.00 ? 381 HIS B ND1 1 
ATOM 7044  C CD2 . HIS B 1 377 ? 51.594  81.863  -24.201  1.00 40.00 ? 381 HIS B CD2 1 
ATOM 7045  C CE1 . HIS B 1 377 ? 51.422  83.197  -22.472  1.00 40.00 ? 381 HIS B CE1 1 
ATOM 7046  N NE2 . HIS B 1 377 ? 51.324  81.931  -22.843  1.00 40.00 ? 381 HIS B NE2 1 
ATOM 7047  N N   . TYR B 1 378 ? 54.049  81.410  -27.411  1.00 40.00 ? 382 TYR B N   1 
ATOM 7048  C CA  . TYR B 1 378 ? 54.441  79.993  -27.316  1.00 40.00 ? 382 TYR B CA  1 
ATOM 7049  C C   . TYR B 1 378 ? 55.856  79.692  -27.733  1.00 40.00 ? 382 TYR B C   1 
ATOM 7050  O O   . TYR B 1 378 ? 56.339  78.549  -27.510  1.00 40.00 ? 382 TYR B O   1 
ATOM 7051  C CB  . TYR B 1 378 ? 53.403  79.164  -28.037  1.00 40.00 ? 382 TYR B CB  1 
ATOM 7052  C CG  . TYR B 1 378 ? 52.045  79.096  -27.384  1.00 40.00 ? 382 TYR B CG  1 
ATOM 7053  C CD1 . TYR B 1 378 ? 51.677  77.983  -26.618  1.00 40.00 ? 382 TYR B CD1 1 
ATOM 7054  C CD2 . TYR B 1 378 ? 51.117  80.123  -27.535  1.00 40.00 ? 382 TYR B CD2 1 
ATOM 7055  C CE1 . TYR B 1 378 ? 50.447  77.876  -26.038  1.00 40.00 ? 382 TYR B CE1 1 
ATOM 7056  C CE2 . TYR B 1 378 ? 49.870  80.025  -26.932  1.00 40.00 ? 382 TYR B CE2 1 
ATOM 7057  C CZ  . TYR B 1 378 ? 49.558  78.903  -26.201  1.00 40.00 ? 382 TYR B CZ  1 
ATOM 7058  O OH  . TYR B 1 378 ? 48.309  78.840  -25.594  1.00 40.00 ? 382 TYR B OH  1 
ATOM 7059  N N   . THR B 1 379 ? 56.582  80.646  -28.320  1.00 40.00 ? 383 THR B N   1 
ATOM 7060  C CA  . THR B 1 379 ? 57.976  80.373  -28.695  1.00 40.00 ? 383 THR B CA  1 
ATOM 7061  C C   . THR B 1 379 ? 58.875  80.273  -27.454  1.00 40.00 ? 383 THR B C   1 
ATOM 7062  O O   . THR B 1 379 ? 58.668  81.059  -26.526  1.00 40.00 ? 383 THR B O   1 
ATOM 7063  C CB  . THR B 1 379 ? 58.561  81.560  -29.499  1.00 40.00 ? 383 THR B CB  1 
ATOM 7064  O OG1 . THR B 1 379 ? 57.914  81.724  -30.762  1.00 40.00 ? 383 THR B OG1 1 
ATOM 7065  C CG2 . THR B 1 379 ? 60.057  81.366  -29.676  1.00 40.00 ? 383 THR B CG2 1 
ATOM 7066  N N   . ASP B 1 380 ? 59.857  79.370  -27.422  1.00 40.00 ? 384 ASP B N   1 
ATOM 7067  C CA  . ASP B 1 380 ? 60.766  79.398  -26.261  1.00 40.00 ? 384 ASP B CA  1 
ATOM 7068  C C   . ASP B 1 380 ? 62.010  80.169  -26.764  1.00 40.00 ? 384 ASP B C   1 
ATOM 7069  O O   . ASP B 1 380 ? 62.879  79.586  -27.405  1.00 40.00 ? 384 ASP B O   1 
ATOM 7070  C CB  . ASP B 1 380 ? 61.192  78.052  -25.740  1.00 40.00 ? 384 ASP B CB  1 
ATOM 7071  C CG  . ASP B 1 380 ? 62.458  78.160  -24.890  1.00 40.00 ? 384 ASP B CG  1 
ATOM 7072  O OD1 . ASP B 1 380 ? 62.685  79.255  -24.321  1.00 40.00 ? 384 ASP B OD1 1 
ATOM 7073  O OD2 . ASP B 1 380 ? 63.175  77.154  -24.843  1.00 40.00 ? 384 ASP B OD2 1 
ATOM 7074  N N   . TRP B 1 381 ? 62.135  81.449  -26.436  1.00 40.00 ? 385 TRP B N   1 
ATOM 7075  C CA  . TRP B 1 381 ? 63.220  82.277  -26.913  1.00 40.00 ? 385 TRP B CA  1 
ATOM 7076  C C   . TRP B 1 381 ? 64.622  81.874  -26.558  1.00 40.00 ? 385 TRP B C   1 
ATOM 7077  O O   . TRP B 1 381 ? 65.621  82.424  -27.093  1.00 40.00 ? 385 TRP B O   1 
ATOM 7078  C CB  . TRP B 1 381 ? 62.920  83.739  -26.628  1.00 40.00 ? 385 TRP B CB  1 
ATOM 7079  C CG  . TRP B 1 381 ? 61.581  84.121  -27.182  1.00 40.00 ? 385 TRP B CG  1 
ATOM 7080  C CD1 . TRP B 1 381 ? 60.395  84.184  -26.492  1.00 40.00 ? 385 TRP B CD1 1 
ATOM 7081  C CD2 . TRP B 1 381 ? 61.273  84.465  -28.528  1.00 40.00 ? 385 TRP B CD2 1 
ATOM 7082  N NE1 . TRP B 1 381 ? 59.369  84.556  -27.323  1.00 40.00 ? 385 TRP B NE1 1 
ATOM 7083  C CE2 . TRP B 1 381 ? 59.883  84.733  -28.580  1.00 40.00 ? 385 TRP B CE2 1 
ATOM 7084  C CE3 . TRP B 1 381 ? 62.030  84.568  -29.701  1.00 40.00 ? 385 TRP B CE3 1 
ATOM 7085  C CZ2 . TRP B 1 381 ? 59.245  85.105  -29.759  1.00 40.00 ? 385 TRP B CZ2 1 
ATOM 7086  C CZ3 . TRP B 1 381 ? 61.384  84.940  -30.867  1.00 40.00 ? 385 TRP B CZ3 1 
ATOM 7087  C CH2 . TRP B 1 381 ? 60.010  85.203  -30.890  1.00 40.00 ? 385 TRP B CH2 1 
ATOM 7088  N N   . LEU B 1 382 ? 64.796  80.863  -25.698  1.00 40.00 ? 386 LEU B N   1 
ATOM 7089  C CA  . LEU B 1 382 ? 66.159  80.386  -25.473  1.00 40.00 ? 386 LEU B CA  1 
ATOM 7090  C C   . LEU B 1 382 ? 66.399  79.321  -26.534  1.00 40.00 ? 386 LEU B C   1 
ATOM 7091  O O   . LEU B 1 382 ? 67.557  79.036  -26.836  1.00 40.00 ? 386 LEU B O   1 
ATOM 7092  C CB  . LEU B 1 382 ? 66.397  79.914  -24.086  1.00 40.00 ? 386 LEU B CB  1 
ATOM 7093  C CG  . LEU B 1 382 ? 67.753  80.060  -23.422  1.00 40.00 ? 386 LEU B CG  1 
ATOM 7094  C CD1 . LEU B 1 382 ? 68.418  78.692  -23.260  1.00 40.00 ? 386 LEU B CD1 1 
ATOM 7095  C CD2 . LEU B 1 382 ? 68.721  80.964  -24.188  1.00 40.00 ? 386 LEU B CD2 1 
ATOM 7096  N N   . HIS B 1 383 ? 65.368  78.721  -27.112  1.00 40.00 ? 387 HIS B N   1 
ATOM 7097  C CA  . HIS B 1 383 ? 65.537  77.696  -28.173  1.00 40.00 ? 387 HIS B CA  1 
ATOM 7098  C C   . HIS B 1 383 ? 64.428  77.790  -29.216  1.00 40.00 ? 387 HIS B C   1 
ATOM 7099  O O   . HIS B 1 383 ? 63.544  76.920  -29.326  1.00 40.00 ? 387 HIS B O   1 
ATOM 7100  C CB  . HIS B 1 383 ? 65.443  76.320  -27.505  1.00 40.00 ? 387 HIS B CB  1 
ATOM 7101  C CG  . HIS B 1 383 ? 66.340  76.066  -26.347  1.00 40.00 ? 387 HIS B CG  1 
ATOM 7102  N ND1 . HIS B 1 383 ? 65.938  76.152  -25.032  1.00 40.00 ? 387 HIS B ND1 1 
ATOM 7103  C CD2 . HIS B 1 383 ? 67.660  75.755  -26.308  1.00 40.00 ? 387 HIS B CD2 1 
ATOM 7104  C CE1 . HIS B 1 383 ? 66.946  75.874  -24.237  1.00 40.00 ? 387 HIS B CE1 1 
ATOM 7105  N NE2 . HIS B 1 383 ? 68.005  75.634  -24.980  1.00 40.00 ? 387 HIS B NE2 1 
ATOM 7106  N N   . PRO B 1 384 ? 64.365  78.869  -29.984  1.00 40.00 ? 388 PRO B N   1 
ATOM 7107  C CA  . PRO B 1 384 ? 63.289  79.131  -30.902  1.00 40.00 ? 388 PRO B CA  1 
ATOM 7108  C C   . PRO B 1 384 ? 63.192  78.227  -32.089  1.00 40.00 ? 388 PRO B C   1 
ATOM 7109  O O   . PRO B 1 384 ? 62.410  78.494  -33.033  1.00 40.00 ? 388 PRO B O   1 
ATOM 7110  C CB  . PRO B 1 384 ? 63.553  80.571  -31.365  1.00 40.00 ? 388 PRO B CB  1 
ATOM 7111  C CG  . PRO B 1 384 ? 65.043  80.670  -31.298  1.00 40.00 ? 388 PRO B CG  1 
ATOM 7112  C CD  . PRO B 1 384 ? 65.337  79.991  -29.960  1.00 40.00 ? 388 PRO B CD  1 
ATOM 7113  N N   . GLU B 1 385 ? 64.010  77.181  -32.147  1.00 40.00 ? 389 GLU B N   1 
ATOM 7114  C CA  . GLU B 1 385 ? 64.019  76.251  -33.246  1.00 40.00 ? 389 GLU B CA  1 
ATOM 7115  C C   . GLU B 1 385 ? 64.012  74.815  -32.727  1.00 40.00 ? 389 GLU B C   1 
ATOM 7116  O O   . GLU B 1 385 ? 64.004  73.895  -33.558  1.00 40.00 ? 389 GLU B O   1 
ATOM 7117  C CB  . GLU B 1 385 ? 65.203  76.391  -34.176  1.00 40.00 ? 389 GLU B CB  1 
ATOM 7118  C CG  . GLU B 1 385 ? 65.862  77.739  -34.246  1.00 40.00 ? 389 GLU B CG  1 
ATOM 7119  C CD  . GLU B 1 385 ? 65.532  78.490  -35.518  1.00 40.00 ? 389 GLU B CD  1 
ATOM 7120  O OE1 . GLU B 1 385 ? 65.260  77.837  -36.546  1.00 40.00 ? 389 GLU B OE1 1 
ATOM 7121  O OE2 . GLU B 1 385 ? 65.552  79.740  -35.470  1.00 40.00 ? 389 GLU B OE2 1 
ATOM 7122  N N   . ASP B 1 386 ? 64.027  74.642  -31.416  1.00 40.00 ? 390 ASP B N   1 
ATOM 7123  C CA  . ASP B 1 386 ? 63.998  73.231  -30.941  1.00 40.00 ? 390 ASP B CA  1 
ATOM 7124  C C   . ASP B 1 386 ? 62.707  72.634  -31.482  1.00 40.00 ? 390 ASP B C   1 
ATOM 7125  O O   . ASP B 1 386 ? 61.582  73.089  -31.200  1.00 40.00 ? 390 ASP B O   1 
ATOM 7126  C CB  . ASP B 1 386 ? 64.123  73.273  -29.443  1.00 40.00 ? 390 ASP B CB  1 
ATOM 7127  C CG  . ASP B 1 386 ? 63.725  71.966  -28.792  1.00 40.00 ? 390 ASP B CG  1 
ATOM 7128  O OD1 . ASP B 1 386 ? 64.172  70.909  -29.290  1.00 40.00 ? 390 ASP B OD1 1 
ATOM 7129  O OD2 . ASP B 1 386 ? 62.964  72.021  -27.800  1.00 40.00 ? 390 ASP B OD2 1 
ATOM 7130  N N   . PRO B 1 387 ? 62.825  71.641  -32.356  1.00 40.00 ? 391 PRO B N   1 
ATOM 7131  C CA  . PRO B 1 387 ? 61.673  70.998  -32.984  1.00 40.00 ? 391 PRO B CA  1 
ATOM 7132  C C   . PRO B 1 387 ? 60.764  70.409  -31.926  1.00 40.00 ? 391 PRO B C   1 
ATOM 7133  O O   . PRO B 1 387 ? 59.553  70.690  -31.876  1.00 40.00 ? 391 PRO B O   1 
ATOM 7134  C CB  . PRO B 1 387 ? 62.283  69.971  -33.910  1.00 40.00 ? 391 PRO B CB  1 
ATOM 7135  C CG  . PRO B 1 387 ? 63.607  69.656  -33.265  1.00 40.00 ? 391 PRO B CG  1 
ATOM 7136  C CD  . PRO B 1 387 ? 64.090  70.993  -32.753  1.00 40.00 ? 391 PRO B CD  1 
ATOM 7137  N N   . THR B 1 388 ? 61.315  69.637  -30.996  1.00 40.00 ? 392 THR B N   1 
ATOM 7138  C CA  . THR B 1 388 ? 60.487  69.087  -29.933  1.00 40.00 ? 392 THR B CA  1 
ATOM 7139  C C   . THR B 1 388 ? 59.638  70.144  -29.228  1.00 40.00 ? 392 THR B C   1 
ATOM 7140  O O   . THR B 1 388 ? 58.488  69.874  -28.840  1.00 40.00 ? 392 THR B O   1 
ATOM 7141  C CB  . THR B 1 388 ? 61.344  68.425  -28.829  1.00 40.00 ? 392 THR B CB  1 
ATOM 7142  O OG1 . THR B 1 388 ? 61.981  67.257  -29.347  1.00 40.00 ? 392 THR B OG1 1 
ATOM 7143  C CG2 . THR B 1 388 ? 60.454  68.037  -27.651  1.00 40.00 ? 392 THR B CG2 1 
ATOM 7144  N N   . HIS B 1 389 ? 60.235  71.320  -28.969  1.00 40.00 ? 393 HIS B N   1 
ATOM 7145  C CA  . HIS B 1 389 ? 59.459  72.340  -28.265  1.00 40.00 ? 393 HIS B CA  1 
ATOM 7146  C C   . HIS B 1 389 ? 58.340  72.857  -29.168  1.00 40.00 ? 393 HIS B C   1 
ATOM 7147  O O   . HIS B 1 389 ? 57.176  72.859  -28.802  1.00 40.00 ? 393 HIS B O   1 
ATOM 7148  C CB  . HIS B 1 389 ? 60.292  73.496  -27.736  1.00 40.00 ? 393 HIS B CB  1 
ATOM 7149  C CG  . HIS B 1 389 ? 59.411  74.435  -26.952  1.00 40.00 ? 393 HIS B CG  1 
ATOM 7150  N ND1 . HIS B 1 389 ? 59.176  74.264  -25.609  1.00 40.00 ? 393 HIS B ND1 1 
ATOM 7151  C CD2 . HIS B 1 389 ? 58.694  75.520  -27.328  1.00 40.00 ? 393 HIS B CD2 1 
ATOM 7152  C CE1 . HIS B 1 389 ? 58.357  75.217  -25.184  1.00 40.00 ? 393 HIS B CE1 1 
ATOM 7153  N NE2 . HIS B 1 389 ? 58.049  75.995  -26.211  1.00 40.00 ? 393 HIS B NE2 1 
ATOM 7154  N N   . LEU B 1 390 ? 58.736  73.260  -30.366  1.00 40.00 ? 394 LEU B N   1 
ATOM 7155  C CA  . LEU B 1 390 ? 57.816  73.726  -31.393  1.00 40.00 ? 394 LEU B CA  1 
ATOM 7156  C C   . LEU B 1 390 ? 56.622  72.779  -31.479  1.00 40.00 ? 394 LEU B C   1 
ATOM 7157  O O   . LEU B 1 390 ? 55.455  73.168  -31.362  1.00 40.00 ? 394 LEU B O   1 
ATOM 7158  C CB  . LEU B 1 390 ? 58.611  73.678  -32.712  1.00 40.00 ? 394 LEU B CB  1 
ATOM 7159  C CG  . LEU B 1 390 ? 59.616  74.835  -32.834  1.00 40.00 ? 394 LEU B CG  1 
ATOM 7160  C CD1 . LEU B 1 390 ? 60.566  74.605  -33.974  1.00 40.00 ? 394 LEU B CD1 1 
ATOM 7161  C CD2 . LEU B 1 390 ? 58.835  76.141  -32.991  1.00 40.00 ? 394 LEU B CD2 1 
ATOM 7162  N N   . ARG B 1 391 ? 56.940  71.493  -31.636  1.00 40.00 ? 395 ARG B N   1 
ATOM 7163  C CA  . ARG B 1 391 ? 55.926  70.460  -31.709  1.00 40.00 ? 395 ARG B CA  1 
ATOM 7164  C C   . ARG B 1 391 ? 54.909  70.576  -30.590  1.00 40.00 ? 395 ARG B C   1 
ATOM 7165  O O   . ARG B 1 391 ? 53.726  70.860  -30.782  1.00 40.00 ? 395 ARG B O   1 
ATOM 7166  C CB  . ARG B 1 391 ? 56.538  69.052  -31.617  1.00 40.00 ? 395 ARG B CB  1 
ATOM 7167  C CG  . ARG B 1 391 ? 55.466  67.969  -31.852  1.00 40.00 ? 395 ARG B CG  1 
ATOM 7168  C CD  . ARG B 1 391 ? 55.511  67.051  -30.637  1.00 40.00 ? 395 ARG B CD  1 
ATOM 7169  N NE  . ARG B 1 391 ? 56.507  66.004  -30.808  1.00 40.00 ? 395 ARG B NE  1 
ATOM 7170  C CZ  . ARG B 1 391 ? 57.179  65.427  -29.826  1.00 40.00 ? 395 ARG B CZ  1 
ATOM 7171  N NH1 . ARG B 1 391 ? 57.019  65.769  -28.554  1.00 40.00 ? 395 ARG B NH1 1 
ATOM 7172  N NH2 . ARG B 1 391 ? 58.053  64.472  -30.144  1.00 40.00 ? 395 ARG B NH2 1 
ATOM 7173  N N   . ASP B 1 392 ? 55.410  70.396  -29.376  1.00 40.00 ? 396 ASP B N   1 
ATOM 7174  C CA  . ASP B 1 392 ? 54.493  70.531  -28.237  1.00 40.00 ? 396 ASP B CA  1 
ATOM 7175  C C   . ASP B 1 392 ? 53.817  71.883  -28.191  1.00 40.00 ? 396 ASP B C   1 
ATOM 7176  O O   . ASP B 1 392 ? 52.681  71.996  -27.686  1.00 40.00 ? 396 ASP B O   1 
ATOM 7177  C CB  . ASP B 1 392 ? 55.228  70.203  -26.941  1.00 40.00 ? 396 ASP B CB  1 
ATOM 7178  C CG  . ASP B 1 392 ? 55.810  68.796  -27.022  1.00 40.00 ? 396 ASP B CG  1 
ATOM 7179  O OD1 . ASP B 1 392 ? 55.389  68.033  -27.918  1.00 40.00 ? 396 ASP B OD1 1 
ATOM 7180  O OD2 . ASP B 1 392 ? 56.684  68.442  -26.204  1.00 40.00 ? 396 ASP B OD2 1 
ATOM 7181  N N   . ALA B 1 393 ? 54.469  72.924  -28.704  1.00 40.00 ? 397 ALA B N   1 
ATOM 7182  C CA  . ALA B 1 393 ? 53.886  74.265  -28.637  1.00 40.00 ? 397 ALA B CA  1 
ATOM 7183  C C   . ALA B 1 393 ? 52.610  74.339  -29.463  1.00 40.00 ? 397 ALA B C   1 
ATOM 7184  O O   . ALA B 1 393 ? 51.572  74.839  -28.993  1.00 40.00 ? 397 ALA B O   1 
ATOM 7185  C CB  . ALA B 1 393 ? 54.903  75.293  -29.064  1.00 40.00 ? 397 ALA B CB  1 
ATOM 7186  N N   . MET B 1 394 ? 52.755  73.814  -30.692  1.00 40.00 ? 398 MET B N   1 
ATOM 7187  C CA  . MET B 1 394 ? 51.640  73.747  -31.642  1.00 40.00 ? 398 MET B CA  1 
ATOM 7188  C C   . MET B 1 394 ? 50.463  73.071  -30.943  1.00 40.00 ? 398 MET B C   1 
ATOM 7189  O O   . MET B 1 394 ? 49.380  73.635  -30.839  1.00 40.00 ? 398 MET B O   1 
ATOM 7190  C CB  . MET B 1 394 ? 52.020  72.887  -32.830  1.00 40.00 ? 398 MET B CB  1 
ATOM 7191  C CG  . MET B 1 394 ? 51.821  73.381  -34.230  1.00 40.00 ? 398 MET B CG  1 
ATOM 7192  S SD  . MET B 1 394 ? 50.616  74.712  -34.410  1.00 40.00 ? 398 MET B SD  1 
ATOM 7193  C CE  . MET B 1 394 ? 51.784  76.044  -34.655  1.00 40.00 ? 398 MET B CE  1 
ATOM 7194  N N   . SER B 1 395 ? 50.717  71.879  -30.385  1.00 40.00 ? 399 SER B N   1 
ATOM 7195  C CA  . SER B 1 395 ? 49.635  71.195  -29.689  1.00 40.00 ? 399 SER B CA  1 
ATOM 7196  C C   . SER B 1 395 ? 49.028  72.064  -28.603  1.00 40.00 ? 399 SER B C   1 
ATOM 7197  O O   . SER B 1 395 ? 47.805  72.064  -28.396  1.00 40.00 ? 399 SER B O   1 
ATOM 7198  C CB  . SER B 1 395 ? 50.131  69.845  -29.165  1.00 40.00 ? 399 SER B CB  1 
ATOM 7199  O OG  . SER B 1 395 ? 49.216  69.425  -28.158  1.00 40.00 ? 399 SER B OG  1 
ATOM 7200  N N   . ALA B 1 396 ? 49.845  72.852  -27.883  1.00 40.00 ? 400 ALA B N   1 
ATOM 7201  C CA  . ALA B 1 396 ? 49.277  73.704  -26.840  1.00 40.00 ? 400 ALA B CA  1 
ATOM 7202  C C   . ALA B 1 396 ? 48.464  74.840  -27.452  1.00 40.00 ? 400 ALA B C   1 
ATOM 7203  O O   . ALA B 1 396 ? 47.395  75.121  -26.883  1.00 40.00 ? 400 ALA B O   1 
ATOM 7204  C CB  . ALA B 1 396 ? 50.304  74.296  -25.897  1.00 40.00 ? 400 ALA B CB  1 
ATOM 7205  N N   . VAL B 1 397 ? 48.956  75.464  -28.530  1.00 40.00 ? 401 VAL B N   1 
ATOM 7206  C CA  . VAL B 1 397 ? 48.162  76.582  -29.071  1.00 40.00 ? 401 VAL B CA  1 
ATOM 7207  C C   . VAL B 1 397 ? 46.743  76.095  -29.358  1.00 40.00 ? 401 VAL B C   1 
ATOM 7208  O O   . VAL B 1 397 ? 45.742  76.714  -28.990  1.00 40.00 ? 401 VAL B O   1 
ATOM 7209  C CB  . VAL B 1 397 ? 48.768  77.146  -30.371  1.00 40.00 ? 401 VAL B CB  1 
ATOM 7210  C CG1 . VAL B 1 397 ? 47.932  78.237  -30.985  1.00 40.00 ? 401 VAL B CG1 1 
ATOM 7211  C CG2 . VAL B 1 397 ? 50.185  77.634  -30.065  1.00 40.00 ? 401 VAL B CG2 1 
ATOM 7212  N N   . VAL B 1 398 ? 46.707  74.940  -30.048  1.00 40.00 ? 402 VAL B N   1 
ATOM 7213  C CA  . VAL B 1 398 ? 45.412  74.395  -30.377  1.00 40.00 ? 402 VAL B CA  1 
ATOM 7214  C C   . VAL B 1 398 ? 44.598  74.007  -29.151  1.00 40.00 ? 402 VAL B C   1 
ATOM 7215  O O   . VAL B 1 398 ? 43.453  74.418  -29.025  1.00 40.00 ? 402 VAL B O   1 
ATOM 7216  C CB  . VAL B 1 398 ? 45.485  73.173  -31.298  1.00 40.00 ? 402 VAL B CB  1 
ATOM 7217  C CG1 . VAL B 1 398 ? 44.049  72.699  -31.554  1.00 40.00 ? 402 VAL B CG1 1 
ATOM 7218  C CG2 . VAL B 1 398 ? 46.192  73.564  -32.583  1.00 40.00 ? 402 VAL B CG2 1 
ATOM 7219  N N   . GLY B 1 399 ? 45.175  73.196  -28.286  1.00 40.00 ? 403 GLY B N   1 
ATOM 7220  C CA  . GLY B 1 399 ? 44.473  72.749  -27.101  1.00 40.00 ? 403 GLY B CA  1 
ATOM 7221  C C   . GLY B 1 399 ? 44.091  73.878  -26.168  1.00 40.00 ? 403 GLY B C   1 
ATOM 7222  O O   . GLY B 1 399 ? 43.001  73.842  -25.541  1.00 40.00 ? 403 GLY B O   1 
ATOM 7223  N N   . ASP B 1 400 ? 44.968  74.897  -26.017  1.00 40.00 ? 404 ASP B N   1 
ATOM 7224  C CA  . ASP B 1 400 ? 44.585  75.946  -25.086  1.00 40.00 ? 404 ASP B CA  1 
ATOM 7225  C C   . ASP B 1 400 ? 43.495  76.816  -25.700  1.00 40.00 ? 404 ASP B C   1 
ATOM 7226  O O   . ASP B 1 400 ? 42.585  77.207  -24.987  1.00 40.00 ? 404 ASP B O   1 
ATOM 7227  C CB  . ASP B 1 400 ? 45.727  76.881  -24.715  1.00 40.00 ? 404 ASP B CB  1 
ATOM 7228  C CG  . ASP B 1 400 ? 46.876  76.146  -24.052  1.00 40.00 ? 404 ASP B CG  1 
ATOM 7229  O OD1 . ASP B 1 400 ? 46.628  75.038  -23.507  1.00 40.00 ? 404 ASP B OD1 1 
ATOM 7230  O OD2 . ASP B 1 400 ? 47.987  76.723  -24.108  1.00 40.00 ? 404 ASP B OD2 1 
ATOM 7231  N N   . HIS B 1 401 ? 43.650  77.105  -26.974  1.00 40.00 ? 405 HIS B N   1 
ATOM 7232  C CA  . HIS B 1 401 ? 42.764  78.016  -27.637  1.00 40.00 ? 405 HIS B CA  1 
ATOM 7233  C C   . HIS B 1 401 ? 41.335  77.550  -27.712  1.00 40.00 ? 405 HIS B C   1 
ATOM 7234  O O   . HIS B 1 401 ? 40.459  78.391  -27.546  1.00 40.00 ? 405 HIS B O   1 
ATOM 7235  C CB  . HIS B 1 401 ? 43.284  78.300  -29.047  1.00 40.00 ? 405 HIS B CB  1 
ATOM 7236  C CG  . HIS B 1 401 ? 42.386  79.199  -29.844  1.00 40.00 ? 405 HIS B CG  1 
ATOM 7237  N ND1 . HIS B 1 401 ? 41.792  80.313  -29.280  1.00 40.00 ? 405 HIS B ND1 1 
ATOM 7238  C CD2 . HIS B 1 401 ? 42.002  79.158  -31.140  1.00 40.00 ? 405 HIS B CD2 1 
ATOM 7239  C CE1 . HIS B 1 401 ? 41.074  80.928  -30.204  1.00 40.00 ? 405 HIS B CE1 1 
ATOM 7240  N NE2 . HIS B 1 401 ? 41.189  80.249  -31.339  1.00 40.00 ? 405 HIS B NE2 1 
ATOM 7241  N N   . ASN B 1 402 ? 41.150  76.270  -27.995  1.00 40.00 ? 406 ASN B N   1 
ATOM 7242  C CA  . ASN B 1 402 ? 39.854  75.685  -28.196  1.00 40.00 ? 406 ASN B CA  1 
ATOM 7243  C C   . ASN B 1 402 ? 39.254  75.024  -26.974  1.00 40.00 ? 406 ASN B C   1 
ATOM 7244  O O   . ASN B 1 402 ? 38.031  75.031  -26.793  1.00 40.00 ? 406 ASN B O   1 
ATOM 7245  C CB  . ASN B 1 402 ? 39.963  74.569  -29.271  1.00 40.00 ? 406 ASN B CB  1 
ATOM 7246  C CG  . ASN B 1 402 ? 40.278  75.094  -30.640  1.00 40.00 ? 406 ASN B CG  1 
ATOM 7247  O OD1 . ASN B 1 402 ? 39.498  75.824  -31.247  1.00 40.00 ? 406 ASN B OD1 1 
ATOM 7248  N ND2 . ASN B 1 402 ? 41.461  74.689  -31.127  1.00 40.00 ? 406 ASN B ND2 1 
ATOM 7249  N N   . VAL B 1 403 ? 40.091  74.375  -26.153  1.00 40.00 ? 407 VAL B N   1 
ATOM 7250  C CA  . VAL B 1 403 ? 39.487  73.653  -25.034  1.00 40.00 ? 407 VAL B CA  1 
ATOM 7251  C C   . VAL B 1 403 ? 39.811  74.197  -23.678  1.00 40.00 ? 407 VAL B C   1 
ATOM 7252  O O   . VAL B 1 403 ? 38.924  74.720  -22.971  1.00 40.00 ? 407 VAL B O   1 
ATOM 7253  C CB  . VAL B 1 403 ? 39.822  72.155  -25.148  1.00 40.00 ? 407 VAL B CB  1 
ATOM 7254  C CG1 . VAL B 1 403 ? 38.938  71.376  -24.182  1.00 40.00 ? 407 VAL B CG1 1 
ATOM 7255  C CG2 . VAL B 1 403 ? 39.605  71.621  -26.565  1.00 40.00 ? 407 VAL B CG2 1 
ATOM 7256  N N   . VAL B 1 404 ? 41.099  74.173  -23.300  1.00 40.00 ? 408 VAL B N   1 
ATOM 7257  C CA  . VAL B 1 404 ? 41.467  74.629  -21.969  1.00 40.00 ? 408 VAL B CA  1 
ATOM 7258  C C   . VAL B 1 404 ? 41.057  76.009  -21.543  1.00 40.00 ? 408 VAL B C   1 
ATOM 7259  O O   . VAL B 1 404 ? 40.223  76.152  -20.643  1.00 40.00 ? 408 VAL B O   1 
ATOM 7260  C CB  . VAL B 1 404 ? 42.952  74.422  -21.651  1.00 40.00 ? 408 VAL B CB  1 
ATOM 7261  C CG1 . VAL B 1 404 ? 43.132  74.621  -20.151  1.00 40.00 ? 408 VAL B CG1 1 
ATOM 7262  C CG2 . VAL B 1 404 ? 43.370  73.020  -22.034  1.00 40.00 ? 408 VAL B CG2 1 
ATOM 7263  N N   . CYS B 1 405 ? 41.545  77.045  -22.231  1.00 40.00 ? 409 CYS B N   1 
ATOM 7264  C CA  . CYS B 1 405 ? 41.163  78.401  -21.789  1.00 40.00 ? 409 CYS B CA  1 
ATOM 7265  C C   . CYS B 1 405 ? 39.670  78.611  -21.772  1.00 40.00 ? 409 CYS B C   1 
ATOM 7266  O O   . CYS B 1 405 ? 39.107  79.167  -20.805  1.00 40.00 ? 409 CYS B O   1 
ATOM 7267  C CB  . CYS B 1 405 ? 41.960  79.498  -22.459  1.00 40.00 ? 409 CYS B CB  1 
ATOM 7268  S SG  . CYS B 1 405 ? 43.763  79.165  -22.255  1.00 40.00 ? 409 CYS B SG  1 
ATOM 7269  N N   . PRO B 1 406 ? 38.939  78.128  -22.761  1.00 40.00 ? 410 PRO B N   1 
ATOM 7270  C CA  . PRO B 1 406 ? 37.493  78.249  -22.769  1.00 40.00 ? 410 PRO B CA  1 
ATOM 7271  C C   . PRO B 1 406 ? 36.882  77.551  -21.554  1.00 40.00 ? 410 PRO B C   1 
ATOM 7272  O O   . PRO B 1 406 ? 35.938  78.087  -20.920  1.00 40.00 ? 410 PRO B O   1 
ATOM 7273  C CB  . PRO B 1 406 ? 37.087  77.629  -24.075  1.00 40.00 ? 410 PRO B CB  1 
ATOM 7274  C CG  . PRO B 1 406 ? 38.310  77.588  -24.931  1.00 40.00 ? 410 PRO B CG  1 
ATOM 7275  C CD  . PRO B 1 406 ? 39.472  77.483  -23.980  1.00 40.00 ? 410 PRO B CD  1 
ATOM 7276  N N   . VAL B 1 407 ? 37.439  76.387  -21.176  1.00 40.00 ? 411 VAL B N   1 
ATOM 7277  C CA  . VAL B 1 407 ? 36.948  75.689  -19.978  1.00 40.00 ? 411 VAL B CA  1 
ATOM 7278  C C   . VAL B 1 407 ? 37.131  76.598  -18.763  1.00 40.00 ? 411 VAL B C   1 
ATOM 7279  O O   . VAL B 1 407 ? 36.309  76.887  -17.911  1.00 40.00 ? 411 VAL B O   1 
ATOM 7280  C CB  . VAL B 1 407 ? 37.866  74.473  -19.698  1.00 40.00 ? 411 VAL B CB  1 
ATOM 7281  C CG1 . VAL B 1 407 ? 37.664  73.895  -18.318  1.00 40.00 ? 411 VAL B CG1 1 
ATOM 7282  C CG2 . VAL B 1 407 ? 37.645  73.407  -20.761  1.00 40.00 ? 411 VAL B CG2 1 
ATOM 7283  N N   . ALA B 1 408 ? 38.382  77.085  -18.699  1.00 40.00 ? 412 ALA B N   1 
ATOM 7284  C CA  . ALA B 1 408 ? 38.710  77.982  -17.573  1.00 40.00 ? 412 ALA B CA  1 
ATOM 7285  C C   . ALA B 1 408 ? 37.870  79.241  -17.627  1.00 40.00 ? 412 ALA B C   1 
ATOM 7286  O O   . ALA B 1 408 ? 37.367  79.703  -16.599  1.00 40.00 ? 412 ALA B O   1 
ATOM 7287  C CB  . ALA B 1 408 ? 40.170  78.269  -17.485  1.00 40.00 ? 412 ALA B CB  1 
ATOM 7288  N N   . GLN B 1 409 ? 37.625  79.794  -18.812  1.00 40.00 ? 413 GLN B N   1 
ATOM 7289  C CA  . GLN B 1 409 ? 36.786  80.995  -18.861  1.00 40.00 ? 413 GLN B CA  1 
ATOM 7290  C C   . GLN B 1 409 ? 35.384  80.676  -18.344  1.00 40.00 ? 413 GLN B C   1 
ATOM 7291  O O   . GLN B 1 409 ? 34.732  81.511  -17.687  1.00 40.00 ? 413 GLN B O   1 
ATOM 7292  C CB  . GLN B 1 409 ? 36.706  81.591  -20.254  1.00 40.00 ? 413 GLN B CB  1 
ATOM 7293  C CG  . GLN B 1 409 ? 35.625  82.637  -20.431  1.00 40.00 ? 413 GLN B CG  1 
ATOM 7294  C CD  . GLN B 1 409 ? 35.898  83.944  -19.742  1.00 40.00 ? 413 GLN B CD  1 
ATOM 7295  O OE1 . GLN B 1 409 ? 36.904  84.112  -19.024  1.00 40.00 ? 413 GLN B OE1 1 
ATOM 7296  N NE2 . GLN B 1 409 ? 35.005  84.915  -19.943  1.00 40.00 ? 413 GLN B NE2 1 
ATOM 7297  N N   . LEU B 1 410 ? 34.936  79.454  -18.652  1.00 40.00 ? 414 LEU B N   1 
ATOM 7298  C CA  . LEU B 1 410 ? 33.593  79.082  -18.181  1.00 40.00 ? 414 LEU B CA  1 
ATOM 7299  C C   . LEU B 1 410 ? 33.610  78.780  -16.694  1.00 40.00 ? 414 LEU B C   1 
ATOM 7300  O O   . LEU B 1 410 ? 32.716  79.264  -15.970  1.00 40.00 ? 414 LEU B O   1 
ATOM 7301  C CB  . LEU B 1 410 ? 33.029  77.913  -18.981  1.00 40.00 ? 414 LEU B CB  1 
ATOM 7302  C CG  . LEU B 1 410 ? 31.678  77.336  -18.628  1.00 40.00 ? 414 LEU B CG  1 
ATOM 7303  C CD1 . LEU B 1 410 ? 30.517  78.178  -19.116  1.00 40.00 ? 414 LEU B CD1 1 
ATOM 7304  C CD2 . LEU B 1 410 ? 31.545  75.899  -19.106  1.00 40.00 ? 414 LEU B CD2 1 
ATOM 7305  N N   . ALA B 1 411 ? 34.599  78.000  -16.237  1.00 40.00 ? 415 ALA B N   1 
ATOM 7306  C CA  . ALA B 1 411 ? 34.657  77.646  -14.808  1.00 40.00 ? 415 ALA B CA  1 
ATOM 7307  C C   . ALA B 1 411 ? 34.489  78.898  -13.948  1.00 40.00 ? 415 ALA B C   1 
ATOM 7308  O O   . ALA B 1 411 ? 33.566  79.077  -13.160  1.00 40.00 ? 415 ALA B O   1 
ATOM 7309  C CB  . ALA B 1 411 ? 35.965  76.980  -14.440  1.00 40.00 ? 415 ALA B CB  1 
ATOM 7310  N N   . GLY B 1 412 ? 35.427  79.817  -14.176  1.00 40.00 ? 416 GLY B N   1 
ATOM 7311  C CA  . GLY B 1 412 ? 35.441  81.079  -13.472  1.00 40.00 ? 416 GLY B CA  1 
ATOM 7312  C C   . GLY B 1 412 ? 34.172  81.872  -13.623  1.00 40.00 ? 416 GLY B C   1 
ATOM 7313  O O   . GLY B 1 412 ? 33.579  82.348  -12.666  1.00 40.00 ? 416 GLY B O   1 
ATOM 7314  N N   . ARG B 1 413 ? 33.658  82.025  -14.837  1.00 40.00 ? 417 ARG B N   1 
ATOM 7315  C CA  . ARG B 1 413 ? 32.424  82.792  -15.017  1.00 40.00 ? 417 ARG B CA  1 
ATOM 7316  C C   . ARG B 1 413 ? 31.272  82.171  -14.253  1.00 40.00 ? 417 ARG B C   1 
ATOM 7317  O O   . ARG B 1 413 ? 30.412  82.853  -13.689  1.00 40.00 ? 417 ARG B O   1 
ATOM 7318  C CB  . ARG B 1 413 ? 32.086  82.934  -16.514  1.00 40.00 ? 417 ARG B CB  1 
ATOM 7319  C CG  . ARG B 1 413 ? 32.408  84.373  -16.984  1.00 40.00 ? 417 ARG B CG  1 
ATOM 7320  C CD  . ARG B 1 413 ? 31.537  85.340  -16.182  1.00 40.00 ? 417 ARG B CD  1 
ATOM 7321  N NE  . ARG B 1 413 ? 32.207  86.610  -15.932  1.00 40.00 ? 417 ARG B NE  1 
ATOM 7322  C CZ  . ARG B 1 413 ? 32.258  87.545  -16.884  1.00 40.00 ? 417 ARG B CZ  1 
ATOM 7323  N NH1 . ARG B 1 413 ? 31.697  87.312  -18.065  1.00 40.00 ? 417 ARG B NH1 1 
ATOM 7324  N NH2 . ARG B 1 413 ? 32.872  88.701  -16.663  1.00 40.00 ? 417 ARG B NH2 1 
ATOM 7325  N N   . LEU B 1 414 ? 31.291  80.834  -14.253  1.00 40.00 ? 418 LEU B N   1 
ATOM 7326  C CA  . LEU B 1 414 ? 30.217  80.131  -13.548  1.00 40.00 ? 418 LEU B CA  1 
ATOM 7327  C C   . LEU B 1 414 ? 30.305  80.386  -12.051  1.00 40.00 ? 418 LEU B C   1 
ATOM 7328  O O   . LEU B 1 414 ? 29.388  80.873  -11.387  1.00 40.00 ? 418 LEU B O   1 
ATOM 7329  C CB  . LEU B 1 414 ? 30.286  78.662  -13.912  1.00 40.00 ? 418 LEU B CB  1 
ATOM 7330  C CG  . LEU B 1 414 ? 29.096  78.034  -14.631  1.00 40.00 ? 418 LEU B CG  1 
ATOM 7331  C CD1 . LEU B 1 414 ? 28.257  79.031  -15.415  1.00 40.00 ? 418 LEU B CD1 1 
ATOM 7332  C CD2 . LEU B 1 414 ? 29.615  76.879  -15.491  1.00 40.00 ? 418 LEU B CD2 1 
ATOM 7333  N N   . ALA B 1 415 ? 31.483  80.049  -11.525  1.00 40.00 ? 419 ALA B N   1 
ATOM 7334  C CA  . ALA B 1 415 ? 31.738  80.207  -10.091  1.00 40.00 ? 419 ALA B CA  1 
ATOM 7335  C C   . ALA B 1 415 ? 31.341  81.607  -9.669   1.00 40.00 ? 419 ALA B C   1 
ATOM 7336  O O   . ALA B 1 415 ? 30.464  81.819  -8.825   1.00 40.00 ? 419 ALA B O   1 
ATOM 7337  C CB  . ALA B 1 415 ? 33.166  79.871  -9.729   1.00 40.00 ? 419 ALA B CB  1 
ATOM 7338  N N   . ALA B 1 416 ? 31.911  82.609  -10.311  1.00 40.00 ? 420 ALA B N   1 
ATOM 7339  C CA  . ALA B 1 416 ? 31.599  83.995  -10.033  1.00 40.00 ? 420 ALA B CA  1 
ATOM 7340  C C   . ALA B 1 416 ? 30.105  84.287  -10.070  1.00 40.00 ? 420 ALA B C   1 
ATOM 7341  O O   . ALA B 1 416 ? 29.663  85.220  -9.392   1.00 40.00 ? 420 ALA B O   1 
ATOM 7342  C CB  . ALA B 1 416 ? 32.299  84.898  -11.030  1.00 40.00 ? 420 ALA B CB  1 
ATOM 7343  N N   . GLN B 1 417 ? 29.324  83.560  -10.860  1.00 40.00 ? 421 GLN B N   1 
ATOM 7344  C CA  . GLN B 1 417 ? 27.906  83.825  -10.897  1.00 40.00 ? 421 GLN B CA  1 
ATOM 7345  C C   . GLN B 1 417 ? 27.063  83.019  -9.932   1.00 40.00 ? 421 GLN B C   1 
ATOM 7346  O O   . GLN B 1 417 ? 25.839  83.222  -9.922   1.00 40.00 ? 421 GLN B O   1 
ATOM 7347  C CB  . GLN B 1 417 ? 27.382  83.627  -12.324  1.00 40.00 ? 421 GLN B CB  1 
ATOM 7348  C CG  . GLN B 1 417 ? 26.756  84.940  -12.814  1.00 40.00 ? 421 GLN B CG  1 
ATOM 7349  C CD  . GLN B 1 417 ? 27.811  85.796  -13.483  1.00 40.00 ? 421 GLN B CD  1 
ATOM 7350  O OE1 . GLN B 1 417 ? 27.590  86.991  -13.731  1.00 40.00 ? 421 GLN B OE1 1 
ATOM 7351  N NE2 . GLN B 1 417 ? 28.953  85.161  -13.755  1.00 40.00 ? 421 GLN B NE2 1 
ATOM 7352  N N   . GLY B 1 418 ? 27.620  82.112  -9.143   1.00 40.00 ? 422 GLY B N   1 
ATOM 7353  C CA  . GLY B 1 418 ? 26.779  81.373  -8.194   1.00 40.00 ? 422 GLY B CA  1 
ATOM 7354  C C   . GLY B 1 418 ? 27.021  79.885  -8.260   1.00 40.00 ? 422 GLY B C   1 
ATOM 7355  O O   . GLY B 1 418 ? 26.831  79.133  -7.307   1.00 40.00 ? 422 GLY B O   1 
ATOM 7356  N N   . ALA B 1 419 ? 27.419  79.410  -9.435   1.00 40.00 ? 423 ALA B N   1 
ATOM 7357  C CA  . ALA B 1 419 ? 27.611  77.976  -9.606   1.00 40.00 ? 423 ALA B CA  1 
ATOM 7358  C C   . ALA B 1 419 ? 28.529  77.381  -8.543   1.00 40.00 ? 423 ALA B C   1 
ATOM 7359  O O   . ALA B 1 419 ? 29.381  78.080  -8.032   1.00 40.00 ? 423 ALA B O   1 
ATOM 7360  C CB  . ALA B 1 419 ? 28.284  77.690  -10.963  1.00 40.00 ? 423 ALA B CB  1 
ATOM 7361  N N   . ARG B 1 420 ? 28.341  76.102  -8.310   1.00 40.00 ? 424 ARG B N   1 
ATOM 7362  C CA  . ARG B 1 420 ? 29.288  75.378  -7.463   1.00 40.00 ? 424 ARG B CA  1 
ATOM 7363  C C   . ARG B 1 420 ? 30.051  74.629  -8.581   1.00 40.00 ? 424 ARG B C   1 
ATOM 7364  O O   . ARG B 1 420 ? 29.392  73.860  -9.297   1.00 40.00 ? 424 ARG B O   1 
ATOM 7365  C CB  . ARG B 1 420 ? 28.697  74.424  -6.471   1.00 40.00 ? 424 ARG B CB  1 
ATOM 7366  C CG  . ARG B 1 420 ? 29.594  73.252  -6.077   1.00 40.00 ? 424 ARG B CG  1 
ATOM 7367  C CD  . ARG B 1 420 ? 28.854  72.297  -5.167   1.00 40.00 ? 424 ARG B CD  1 
ATOM 7368  N NE  . ARG B 1 420 ? 29.381  72.237  -3.827   1.00 40.00 ? 424 ARG B NE  1 
ATOM 7369  C CZ  . ARG B 1 420 ? 29.559  73.164  -2.904   1.00 40.00 ? 424 ARG B CZ  1 
ATOM 7370  N NH1 . ARG B 1 420 ? 29.254  74.444  -3.091   1.00 40.00 ? 424 ARG B NH1 1 
ATOM 7371  N NH2 . ARG B 1 420 ? 30.072  72.789  -1.724   1.00 40.00 ? 424 ARG B NH2 1 
ATOM 7372  N N   . VAL B 1 421 ? 31.297  74.947  -8.792   1.00 40.00 ? 425 VAL B N   1 
ATOM 7373  C CA  . VAL B 1 421 ? 32.008  74.306  -9.912   1.00 40.00 ? 425 VAL B CA  1 
ATOM 7374  C C   . VAL B 1 421 ? 33.075  73.385  -9.406   1.00 40.00 ? 425 VAL B C   1 
ATOM 7375  O O   . VAL B 1 421 ? 33.558  73.621  -8.295   1.00 40.00 ? 425 VAL B O   1 
ATOM 7376  C CB  . VAL B 1 421 ? 32.708  75.460  -10.696  1.00 40.00 ? 425 VAL B CB  1 
ATOM 7377  C CG1 . VAL B 1 421 ? 33.535  74.898  -11.834  1.00 40.00 ? 425 VAL B CG1 1 
ATOM 7378  C CG2 . VAL B 1 421 ? 31.690  76.519  -11.110  1.00 40.00 ? 425 VAL B CG2 1 
ATOM 7379  N N   . TYR B 1 422 ? 33.481  72.343  -10.086  1.00 40.00 ? 426 TYR B N   1 
ATOM 7380  C CA  . TYR B 1 422 ? 34.583  71.473  -9.659   1.00 40.00 ? 426 TYR B CA  1 
ATOM 7381  C C   . TYR B 1 422 ? 35.422  71.360  -10.937  1.00 40.00 ? 426 TYR B C   1 
ATOM 7382  O O   . TYR B 1 422 ? 34.761  71.471  -11.967  1.00 40.00 ? 426 TYR B O   1 
ATOM 7383  C CB  . TYR B 1 422 ? 34.191  70.068  -9.229   1.00 40.00 ? 426 TYR B CB  1 
ATOM 7384  C CG  . TYR B 1 422 ? 33.478  70.071  -7.891   1.00 40.00 ? 426 TYR B CG  1 
ATOM 7385  C CD1 . TYR B 1 422 ? 32.197  70.622  -7.808   1.00 40.00 ? 426 TYR B CD1 1 
ATOM 7386  C CD2 . TYR B 1 422 ? 34.043  69.564  -6.738   1.00 40.00 ? 426 TYR B CD2 1 
ATOM 7387  C CE1 . TYR B 1 422 ? 31.502  70.685  -6.619   1.00 40.00 ? 426 TYR B CE1 1 
ATOM 7388  C CE2 . TYR B 1 422 ? 33.356  69.609  -5.535   1.00 40.00 ? 426 TYR B CE2 1 
ATOM 7389  C CZ  . TYR B 1 422 ? 32.088  70.165  -5.485   1.00 40.00 ? 426 TYR B CZ  1 
ATOM 7390  O OH  . TYR B 1 422 ? 31.389  70.228  -4.312   1.00 40.00 ? 426 TYR B OH  1 
ATOM 7391  N N   . ALA B 1 423 ? 36.711  71.174  -10.895  1.00 40.00 ? 427 ALA B N   1 
ATOM 7392  C CA  . ALA B 1 423 ? 37.490  71.106  -12.133  1.00 40.00 ? 427 ALA B CA  1 
ATOM 7393  C C   . ALA B 1 423 ? 38.549  70.035  -12.069  1.00 40.00 ? 427 ALA B C   1 
ATOM 7394  O O   . ALA B 1 423 ? 38.884  69.578  -10.965  1.00 40.00 ? 427 ALA B O   1 
ATOM 7395  C CB  . ALA B 1 423 ? 38.117  72.476  -12.368  1.00 40.00 ? 427 ALA B CB  1 
ATOM 7396  N N   . TYR B 1 424 ? 39.112  69.632  -13.211  1.00 40.00 ? 428 TYR B N   1 
ATOM 7397  C CA  . TYR B 1 424 ? 40.097  68.540  -13.127  1.00 40.00 ? 428 TYR B CA  1 
ATOM 7398  C C   . TYR B 1 424 ? 41.025  68.494  -14.306  1.00 40.00 ? 428 TYR B C   1 
ATOM 7399  O O   . TYR B 1 424 ? 40.780  69.183  -15.324  1.00 40.00 ? 428 TYR B O   1 
ATOM 7400  C CB  . TYR B 1 424 ? 39.253  67.240  -13.113  1.00 40.00 ? 428 TYR B CB  1 
ATOM 7401  C CG  . TYR B 1 424 ? 38.553  66.870  -14.391  1.00 40.00 ? 428 TYR B CG  1 
ATOM 7402  C CD1 . TYR B 1 424 ? 37.184  67.016  -14.531  1.00 40.00 ? 428 TYR B CD1 1 
ATOM 7403  C CD2 . TYR B 1 424 ? 39.268  66.334  -15.474  1.00 40.00 ? 428 TYR B CD2 1 
ATOM 7404  C CE1 . TYR B 1 424 ? 36.512  66.659  -15.692  1.00 40.00 ? 428 TYR B CE1 1 
ATOM 7405  C CE2 . TYR B 1 424 ? 38.628  65.982  -16.650  1.00 40.00 ? 428 TYR B CE2 1 
ATOM 7406  C CZ  . TYR B 1 424 ? 37.246  66.148  -16.736  1.00 40.00 ? 428 TYR B CZ  1 
ATOM 7407  O OH  . TYR B 1 424 ? 36.622  65.807  -17.911  1.00 40.00 ? 428 TYR B OH  1 
ATOM 7408  N N   . ILE B 1 425 ? 42.070  67.671  -14.271  1.00 40.00 ? 429 ILE B N   1 
ATOM 7409  C CA  . ILE B 1 425 ? 42.928  67.598  -15.459  1.00 40.00 ? 429 ILE B CA  1 
ATOM 7410  C C   . ILE B 1 425 ? 43.212  66.117  -15.679  1.00 40.00 ? 429 ILE B C   1 
ATOM 7411  O O   . ILE B 1 425 ? 44.022  65.564  -14.940  1.00 40.00 ? 429 ILE B O   1 
ATOM 7412  C CB  . ILE B 1 425 ? 44.260  68.327  -15.307  1.00 40.00 ? 429 ILE B CB  1 
ATOM 7413  C CG1 . ILE B 1 425 ? 44.057  69.833  -15.142  1.00 40.00 ? 429 ILE B CG1 1 
ATOM 7414  C CG2 . ILE B 1 425 ? 45.205  68.095  -16.491  1.00 40.00 ? 429 ILE B CG2 1 
ATOM 7415  C CD1 . ILE B 1 425 ? 43.364  70.475  -16.328  1.00 40.00 ? 429 ILE B CD1 1 
ATOM 7416  N N   . PHE B 1 426 ? 42.550  65.487  -16.637  1.00 40.00 ? 430 PHE B N   1 
ATOM 7417  C CA  . PHE B 1 426 ? 42.833  64.030  -16.791  1.00 40.00 ? 430 PHE B CA  1 
ATOM 7418  C C   . PHE B 1 426 ? 44.253  63.894  -17.276  1.00 40.00 ? 430 PHE B C   1 
ATOM 7419  O O   . PHE B 1 426 ? 44.555  64.508  -18.310  1.00 40.00 ? 430 PHE B O   1 
ATOM 7420  C CB  . PHE B 1 426 ? 41.814  63.440  -17.720  1.00 40.00 ? 430 PHE B CB  1 
ATOM 7421  C CG  . PHE B 1 426 ? 41.779  61.946  -17.802  1.00 40.00 ? 430 PHE B CG  1 
ATOM 7422  C CD1 . PHE B 1 426 ? 40.876  61.201  -17.057  1.00 40.00 ? 430 PHE B CD1 1 
ATOM 7423  C CD2 . PHE B 1 426 ? 42.648  61.278  -18.663  1.00 40.00 ? 430 PHE B CD2 1 
ATOM 7424  C CE1 . PHE B 1 426 ? 40.843  59.825  -17.160  1.00 40.00 ? 430 PHE B CE1 1 
ATOM 7425  C CE2 . PHE B 1 426 ? 42.618  59.903  -18.769  1.00 40.00 ? 430 PHE B CE2 1 
ATOM 7426  C CZ  . PHE B 1 426 ? 41.715  59.181  -18.024  1.00 40.00 ? 430 PHE B CZ  1 
ATOM 7427  N N   . GLU B 1 427 ? 45.130  63.182  -16.583  1.00 40.00 ? 431 GLU B N   1 
ATOM 7428  C CA  . GLU B 1 427 ? 46.509  63.100  -17.061  1.00 40.00 ? 431 GLU B CA  1 
ATOM 7429  C C   . GLU B 1 427 ? 46.992  61.693  -17.329  1.00 40.00 ? 431 GLU B C   1 
ATOM 7430  O O   . GLU B 1 427 ? 48.163  61.514  -17.698  1.00 40.00 ? 431 GLU B O   1 
ATOM 7431  C CB  . GLU B 1 427 ? 47.464  63.812  -16.116  1.00 40.00 ? 431 GLU B CB  1 
ATOM 7432  C CG  . GLU B 1 427 ? 47.073  65.210  -15.683  1.00 40.00 ? 431 GLU B CG  1 
ATOM 7433  C CD  . GLU B 1 427 ? 48.051  65.832  -14.698  1.00 40.00 ? 431 GLU B CD  1 
ATOM 7434  O OE1 . GLU B 1 427 ? 48.613  66.912  -14.990  1.00 40.00 ? 431 GLU B OE1 1 
ATOM 7435  O OE2 . GLU B 1 427 ? 48.295  65.261  -13.612  1.00 40.00 ? 431 GLU B OE2 1 
ATOM 7436  N N   . HIS B 1 428 ? 46.137  60.684  -17.176  1.00 40.00 ? 432 HIS B N   1 
ATOM 7437  C CA  . HIS B 1 428 ? 46.567  59.308  -17.411  1.00 40.00 ? 432 HIS B CA  1 
ATOM 7438  C C   . HIS B 1 428 ? 46.369  58.838  -18.840  1.00 40.00 ? 432 HIS B C   1 
ATOM 7439  O O   . HIS B 1 428 ? 45.290  58.797  -19.440  1.00 40.00 ? 432 HIS B O   1 
ATOM 7440  C CB  . HIS B 1 428 ? 45.909  58.336  -16.425  1.00 40.00 ? 432 HIS B CB  1 
ATOM 7441  C CG  . HIS B 1 428 ? 46.170  56.903  -16.786  1.00 40.00 ? 432 HIS B CG  1 
ATOM 7442  N ND1 . HIS B 1 428 ? 47.449  56.450  -17.022  1.00 40.00 ? 432 HIS B ND1 1 
ATOM 7443  C CD2 . HIS B 1 428 ? 45.352  55.849  -16.991  1.00 40.00 ? 432 HIS B CD2 1 
ATOM 7444  C CE1 . HIS B 1 428 ? 47.410  55.161  -17.344  1.00 40.00 ? 432 HIS B CE1 1 
ATOM 7445  N NE2 . HIS B 1 428 ? 46.149  54.778  -17.339  1.00 40.00 ? 432 HIS B NE2 1 
ATOM 7446  N N   . ARG B 1 429 ? 47.492  58.461  -19.449  1.00 40.00 ? 433 ARG B N   1 
ATOM 7447  C CA  . ARG B 1 429 ? 47.478  57.981  -20.841  1.00 40.00 ? 433 ARG B CA  1 
ATOM 7448  C C   . ARG B 1 429 ? 47.157  56.497  -20.811  1.00 40.00 ? 433 ARG B C   1 
ATOM 7449  O O   . ARG B 1 429 ? 47.917  55.752  -20.184  1.00 40.00 ? 433 ARG B O   1 
ATOM 7450  C CB  . ARG B 1 429 ? 48.820  58.263  -21.481  1.00 40.00 ? 433 ARG B CB  1 
ATOM 7451  C CG  . ARG B 1 429 ? 49.109  57.487  -22.739  1.00 40.00 ? 433 ARG B CG  1 
ATOM 7452  C CD  . ARG B 1 429 ? 50.452  57.838  -23.340  1.00 40.00 ? 433 ARG B CD  1 
ATOM 7453  N NE  . ARG B 1 429 ? 50.411  58.266  -24.714  1.00 40.00 ? 433 ARG B NE  1 
ATOM 7454  C CZ  . ARG B 1 429 ? 50.644  57.476  -25.763  1.00 40.00 ? 433 ARG B CZ  1 
ATOM 7455  N NH1 . ARG B 1 429 ? 50.940  56.194  -25.546  1.00 40.00 ? 433 ARG B NH1 1 
ATOM 7456  N NH2 . ARG B 1 429 ? 50.585  57.943  -26.995  1.00 40.00 ? 433 ARG B NH2 1 
ATOM 7457  N N   . ALA B 1 430 ? 46.042  56.094  -21.424  1.00 40.00 ? 434 ALA B N   1 
ATOM 7458  C CA  . ALA B 1 430 ? 45.681  54.667  -21.373  1.00 40.00 ? 434 ALA B CA  1 
ATOM 7459  C C   . ALA B 1 430 ? 46.827  53.834  -21.935  1.00 40.00 ? 434 ALA B C   1 
ATOM 7460  O O   . ALA B 1 430 ? 47.513  54.280  -22.850  1.00 40.00 ? 434 ALA B O   1 
ATOM 7461  C CB  . ALA B 1 430 ? 44.374  54.411  -22.058  1.00 40.00 ? 434 ALA B CB  1 
ATOM 7462  N N   . SER B 1 431 ? 47.037  52.651  -21.344  1.00 40.00 ? 435 SER B N   1 
ATOM 7463  C CA  . SER B 1 431 ? 48.149  51.790  -21.748  1.00 40.00 ? 435 SER B CA  1 
ATOM 7464  C C   . SER B 1 431 ? 47.946  51.251  -23.162  1.00 40.00 ? 435 SER B C   1 
ATOM 7465  O O   . SER B 1 431 ? 48.873  51.058  -23.944  1.00 40.00 ? 435 SER B O   1 
ATOM 7466  C CB  . SER B 1 431 ? 48.358  50.629  -20.784  1.00 40.00 ? 435 SER B CB  1 
ATOM 7467  O OG  . SER B 1 431 ? 47.195  49.823  -20.676  1.00 40.00 ? 435 SER B OG  1 
ATOM 7468  N N   . THR B 1 432 ? 46.683  51.047  -23.454  1.00 40.00 ? 436 THR B N   1 
ATOM 7469  C CA  . THR B 1 432 ? 46.137  50.576  -24.703  1.00 40.00 ? 436 THR B CA  1 
ATOM 7470  C C   . THR B 1 432 ? 46.149  51.600  -25.835  1.00 40.00 ? 436 THR B C   1 
ATOM 7471  O O   . THR B 1 432 ? 46.031  51.225  -27.011  1.00 40.00 ? 436 THR B O   1 
ATOM 7472  C CB  . THR B 1 432 ? 44.644  50.234  -24.393  1.00 40.00 ? 436 THR B CB  1 
ATOM 7473  O OG1 . THR B 1 432 ? 43.995  51.464  -24.007  1.00 40.00 ? 436 THR B OG1 1 
ATOM 7474  C CG2 . THR B 1 432 ? 44.550  49.256  -23.232  1.00 40.00 ? 436 THR B CG2 1 
ATOM 7475  N N   . LEU B 1 433 ? 46.260  52.889  -25.533  1.00 40.00 ? 437 LEU B N   1 
ATOM 7476  C CA  . LEU B 1 433 ? 46.271  53.969  -26.524  1.00 40.00 ? 437 LEU B CA  1 
ATOM 7477  C C   . LEU B 1 433 ? 47.081  53.620  -27.762  1.00 40.00 ? 437 LEU B C   1 
ATOM 7478  O O   . LEU B 1 433 ? 48.250  53.249  -27.692  1.00 40.00 ? 437 LEU B O   1 
ATOM 7479  C CB  . LEU B 1 433 ? 46.772  55.234  -25.849  1.00 40.00 ? 437 LEU B CB  1 
ATOM 7480  C CG  . LEU B 1 433 ? 46.355  56.619  -26.287  1.00 40.00 ? 437 LEU B CG  1 
ATOM 7481  C CD1 . LEU B 1 433 ? 46.500  56.782  -27.797  1.00 40.00 ? 437 LEU B CD1 1 
ATOM 7482  C CD2 . LEU B 1 433 ? 44.941  56.968  -25.862  1.00 40.00 ? 437 LEU B CD2 1 
ATOM 7483  N N   . THR B 1 434 ? 46.487  53.725  -28.942  1.00 40.00 ? 438 THR B N   1 
ATOM 7484  C CA  . THR B 1 434 ? 47.127  53.388  -30.199  1.00 40.00 ? 438 THR B CA  1 
ATOM 7485  C C   . THR B 1 434 ? 47.770  54.551  -30.941  1.00 40.00 ? 438 THR B C   1 
ATOM 7486  O O   . THR B 1 434 ? 48.396  54.358  -32.006  1.00 40.00 ? 438 THR B O   1 
ATOM 7487  C CB  . THR B 1 434 ? 46.118  52.715  -31.171  1.00 40.00 ? 438 THR B CB  1 
ATOM 7488  O OG1 . THR B 1 434 ? 44.796  53.198  -30.908  1.00 40.00 ? 438 THR B OG1 1 
ATOM 7489  C CG2 . THR B 1 434 ? 46.160  51.216  -30.945  1.00 40.00 ? 438 THR B CG2 1 
ATOM 7490  N N   . TRP B 1 435 ? 47.591  55.756  -30.401  1.00 40.00 ? 439 TRP B N   1 
ATOM 7491  C CA  . TRP B 1 435 ? 48.208  56.950  -31.016  1.00 40.00 ? 439 TRP B CA  1 
ATOM 7492  C C   . TRP B 1 435 ? 49.660  56.977  -30.540  1.00 40.00 ? 439 TRP B C   1 
ATOM 7493  O O   . TRP B 1 435 ? 49.992  56.246  -29.593  1.00 40.00 ? 439 TRP B O   1 
ATOM 7494  C CB  . TRP B 1 435 ? 47.449  58.192  -30.652  1.00 40.00 ? 439 TRP B CB  1 
ATOM 7495  C CG  . TRP B 1 435 ? 46.065  58.382  -31.189  1.00 40.00 ? 439 TRP B CG  1 
ATOM 7496  C CD1 . TRP B 1 435 ? 44.896  58.106  -30.535  1.00 40.00 ? 439 TRP B CD1 1 
ATOM 7497  C CD2 . TRP B 1 435 ? 45.676  58.914  -32.462  1.00 40.00 ? 439 TRP B CD2 1 
ATOM 7498  N NE1 . TRP B 1 435 ? 43.814  58.430  -31.325  1.00 40.00 ? 439 TRP B NE1 1 
ATOM 7499  C CE2 . TRP B 1 435 ? 44.267  58.923  -32.507  1.00 40.00 ? 439 TRP B CE2 1 
ATOM 7500  C CE3 . TRP B 1 435 ? 46.388  59.386  -33.563  1.00 40.00 ? 439 TRP B CE3 1 
ATOM 7501  C CZ2 . TRP B 1 435 ? 43.548  59.382  -33.605  1.00 40.00 ? 439 TRP B CZ2 1 
ATOM 7502  C CZ3 . TRP B 1 435 ? 45.666  59.843  -34.667  1.00 40.00 ? 439 TRP B CZ3 1 
ATOM 7503  C CH2 . TRP B 1 435 ? 44.269  59.842  -34.676  1.00 40.00 ? 439 TRP B CH2 1 
ATOM 7504  N N   . PRO B 1 436 ? 50.512  57.744  -31.182  1.00 40.00 ? 440 PRO B N   1 
ATOM 7505  C CA  . PRO B 1 436 ? 51.924  57.807  -30.829  1.00 40.00 ? 440 PRO B CA  1 
ATOM 7506  C C   . PRO B 1 436 ? 52.104  58.494  -29.497  1.00 40.00 ? 440 PRO B C   1 
ATOM 7507  O O   . PRO B 1 436 ? 51.227  59.253  -29.040  1.00 40.00 ? 440 PRO B O   1 
ATOM 7508  C CB  . PRO B 1 436 ? 52.591  58.554  -31.951  1.00 40.00 ? 440 PRO B CB  1 
ATOM 7509  C CG  . PRO B 1 436 ? 51.521  59.180  -32.752  1.00 40.00 ? 440 PRO B CG  1 
ATOM 7510  C CD  . PRO B 1 436 ? 50.201  58.633  -32.305  1.00 40.00 ? 440 PRO B CD  1 
ATOM 7511  N N   . LEU B 1 437 ? 53.197  58.183  -28.806  1.00 40.00 ? 441 LEU B N   1 
ATOM 7512  C CA  . LEU B 1 437 ? 53.493  58.767  -27.508  1.00 40.00 ? 441 LEU B CA  1 
ATOM 7513  C C   . LEU B 1 437 ? 53.410  60.286  -27.532  1.00 40.00 ? 441 LEU B C   1 
ATOM 7514  O O   . LEU B 1 437 ? 52.823  60.917  -26.641  1.00 40.00 ? 441 LEU B O   1 
ATOM 7515  C CB  . LEU B 1 437 ? 54.918  58.371  -27.106  1.00 40.00 ? 441 LEU B CB  1 
ATOM 7516  C CG  . LEU B 1 437 ? 55.172  58.116  -25.617  1.00 40.00 ? 441 LEU B CG  1 
ATOM 7517  C CD1 . LEU B 1 437 ? 54.934  59.375  -24.795  1.00 40.00 ? 441 LEU B CD1 1 
ATOM 7518  C CD2 . LEU B 1 437 ? 54.323  56.961  -25.105  1.00 40.00 ? 441 LEU B CD2 1 
ATOM 7519  N N   . TRP B 1 438 ? 53.973  60.902  -28.582  1.00 40.00 ? 442 TRP B N   1 
ATOM 7520  C CA  . TRP B 1 438 ? 53.935  62.346  -28.690  1.00 40.00 ? 442 TRP B CA  1 
ATOM 7521  C C   . TRP B 1 438 ? 52.591  62.996  -28.495  1.00 40.00 ? 442 TRP B C   1 
ATOM 7522  O O   . TRP B 1 438 ? 52.576  64.191  -28.137  1.00 40.00 ? 442 TRP B O   1 
ATOM 7523  C CB  . TRP B 1 438 ? 54.624  62.802  -29.934  1.00 40.00 ? 442 TRP B CB  1 
ATOM 7524  C CG  . TRP B 1 438 ? 53.962  62.808  -31.254  1.00 40.00 ? 442 TRP B CG  1 
ATOM 7525  C CD1 . TRP B 1 438 ? 54.270  61.996  -32.323  1.00 40.00 ? 442 TRP B CD1 1 
ATOM 7526  C CD2 . TRP B 1 438 ? 52.933  63.683  -31.720  1.00 40.00 ? 442 TRP B CD2 1 
ATOM 7527  N NE1 . TRP B 1 438 ? 53.499  62.308  -33.405  1.00 40.00 ? 442 TRP B NE1 1 
ATOM 7528  C CE2 . TRP B 1 438 ? 52.666  63.339  -33.053  1.00 40.00 ? 442 TRP B CE2 1 
ATOM 7529  C CE3 . TRP B 1 438 ? 52.225  64.732  -31.131  1.00 40.00 ? 442 TRP B CE3 1 
ATOM 7530  C CZ2 . TRP B 1 438 ? 51.700  64.000  -33.810  1.00 40.00 ? 442 TRP B CZ2 1 
ATOM 7531  C CZ3 . TRP B 1 438 ? 51.264  65.375  -31.875  1.00 40.00 ? 442 TRP B CZ3 1 
ATOM 7532  C CH2 . TRP B 1 438 ? 51.004  65.007  -33.207  1.00 40.00 ? 442 TRP B CH2 1 
ATOM 7533  N N   . MET B 1 439 ? 51.453  62.380  -28.663  1.00 40.00 ? 443 MET B N   1 
ATOM 7534  C CA  . MET B 1 439 ? 50.150  63.019  -28.468  1.00 40.00 ? 443 MET B CA  1 
ATOM 7535  C C   . MET B 1 439 ? 49.719  62.922  -27.019  1.00 40.00 ? 443 MET B C   1 
ATOM 7536  O O   . MET B 1 439 ? 48.705  63.497  -26.546  1.00 40.00 ? 443 MET B O   1 
ATOM 7537  C CB  . MET B 1 439 ? 49.170  62.357  -29.454  1.00 40.00 ? 443 MET B CB  1 
ATOM 7538  C CG  . MET B 1 439 ? 49.779  62.266  -30.869  1.00 40.00 ? 443 MET B CG  1 
ATOM 7539  S SD  . MET B 1 439 ? 48.698  61.526  -32.087  1.00 40.00 ? 443 MET B SD  1 
ATOM 7540  C CE  . MET B 1 439 ? 47.843  62.922  -32.777  1.00 40.00 ? 443 MET B CE  1 
ATOM 7541  N N   . GLY B 1 440 ? 50.522  62.170  -26.227  1.00 40.00 ? 444 GLY B N   1 
ATOM 7542  C CA  . GLY B 1 440 ? 50.244  62.033  -24.812  1.00 40.00 ? 444 GLY B CA  1 
ATOM 7543  C C   . GLY B 1 440 ? 48.816  61.655  -24.519  1.00 40.00 ? 444 GLY B C   1 
ATOM 7544  O O   . GLY B 1 440 ? 48.426  60.539  -24.900  1.00 40.00 ? 444 GLY B O   1 
ATOM 7545  N N   . VAL B 1 441 ? 48.051  62.525  -23.890  1.00 40.00 ? 445 VAL B N   1 
ATOM 7546  C CA  . VAL B 1 441 ? 46.640  62.202  -23.583  1.00 40.00 ? 445 VAL B CA  1 
ATOM 7547  C C   . VAL B 1 441 ? 45.754  63.079  -24.450  1.00 40.00 ? 445 VAL B C   1 
ATOM 7548  O O   . VAL B 1 441 ? 45.448  64.209  -24.110  1.00 40.00 ? 445 VAL B O   1 
ATOM 7549  C CB  . VAL B 1 441 ? 46.367  62.423  -22.107  1.00 40.00 ? 445 VAL B CB  1 
ATOM 7550  C CG1 . VAL B 1 441 ? 44.899  62.682  -21.810  1.00 40.00 ? 445 VAL B CG1 1 
ATOM 7551  C CG2 . VAL B 1 441 ? 46.869  61.205  -21.350  1.00 40.00 ? 445 VAL B CG2 1 
ATOM 7552  N N   . PRO B 1 442 ? 45.393  62.562  -25.615  1.00 40.00 ? 446 PRO B N   1 
ATOM 7553  C CA  . PRO B 1 442 ? 44.629  63.250  -26.618  1.00 40.00 ? 446 PRO B CA  1 
ATOM 7554  C C   . PRO B 1 442 ? 43.191  63.536  -26.273  1.00 40.00 ? 446 PRO B C   1 
ATOM 7555  O O   . PRO B 1 442 ? 42.596  62.896  -25.422  1.00 40.00 ? 446 PRO B O   1 
ATOM 7556  C CB  . PRO B 1 442 ? 44.653  62.298  -27.821  1.00 40.00 ? 446 PRO B CB  1 
ATOM 7557  C CG  . PRO B 1 442 ? 45.862  61.452  -27.575  1.00 40.00 ? 446 PRO B CG  1 
ATOM 7558  C CD  . PRO B 1 442 ? 45.759  61.186  -26.096  1.00 40.00 ? 446 PRO B CD  1 
ATOM 7559  N N   . HIS B 1 443 ? 42.643  64.504  -26.986  1.00 40.00 ? 447 HIS B N   1 
ATOM 7560  C CA  . HIS B 1 443 ? 41.229  64.863  -26.798  1.00 40.00 ? 447 HIS B CA  1 
ATOM 7561  C C   . HIS B 1 443 ? 40.404  63.584  -26.856  1.00 40.00 ? 447 HIS B C   1 
ATOM 7562  O O   . HIS B 1 443 ? 40.583  62.781  -27.765  1.00 40.00 ? 447 HIS B O   1 
ATOM 7563  C CB  . HIS B 1 443 ? 40.865  65.836  -27.909  1.00 40.00 ? 447 HIS B CB  1 
ATOM 7564  C CG  . HIS B 1 443 ? 39.507  66.413  -27.880  1.00 40.00 ? 447 HIS B CG  1 
ATOM 7565  N ND1 . HIS B 1 443 ? 39.106  67.341  -26.929  1.00 40.00 ? 447 HIS B ND1 1 
ATOM 7566  C CD2 . HIS B 1 443 ? 38.432  66.209  -28.681  1.00 40.00 ? 447 HIS B CD2 1 
ATOM 7567  C CE1 . HIS B 1 443 ? 37.841  67.668  -27.151  1.00 40.00 ? 447 HIS B CE1 1 
ATOM 7568  N NE2 . HIS B 1 443 ? 37.399  66.993  -28.211  1.00 40.00 ? 447 HIS B NE2 1 
ATOM 7569  N N   . GLY B 1 444 ? 39.534  63.353  -25.872  1.00 40.00 ? 448 GLY B N   1 
ATOM 7570  C CA  . GLY B 1 444 ? 38.699  62.177  -25.866  1.00 40.00 ? 448 GLY B CA  1 
ATOM 7571  C C   . GLY B 1 444 ? 39.206  60.930  -25.223  1.00 40.00 ? 448 GLY B C   1 
ATOM 7572  O O   . GLY B 1 444 ? 38.471  59.924  -25.098  1.00 40.00 ? 448 GLY B O   1 
ATOM 7573  N N   . TYR B 1 445 ? 40.449  60.897  -24.727  1.00 40.00 ? 449 TYR B N   1 
ATOM 7574  C CA  . TYR B 1 445 ? 40.898  59.645  -24.104  1.00 40.00 ? 449 TYR B CA  1 
ATOM 7575  C C   . TYR B 1 445 ? 40.640  59.498  -22.638  1.00 40.00 ? 449 TYR B C   1 
ATOM 7576  O O   . TYR B 1 445 ? 41.317  58.707  -21.948  1.00 40.00 ? 449 TYR B O   1 
ATOM 7577  C CB  . TYR B 1 445 ? 42.293  59.369  -24.652  1.00 40.00 ? 449 TYR B CB  1 
ATOM 7578  C CG  . TYR B 1 445 ? 42.069  59.096  -26.147  1.00 40.00 ? 449 TYR B CG  1 
ATOM 7579  C CD1 . TYR B 1 445 ? 41.991  60.117  -27.077  1.00 40.00 ? 449 TYR B CD1 1 
ATOM 7580  C CD2 . TYR B 1 445 ? 41.892  57.786  -26.564  1.00 40.00 ? 449 TYR B CD2 1 
ATOM 7581  C CE1 . TYR B 1 445 ? 41.764  59.838  -28.413  1.00 40.00 ? 449 TYR B CE1 1 
ATOM 7582  C CE2 . TYR B 1 445 ? 41.688  57.497  -27.907  1.00 40.00 ? 449 TYR B CE2 1 
ATOM 7583  C CZ  . TYR B 1 445 ? 41.621  58.530  -28.827  1.00 40.00 ? 449 TYR B CZ  1 
ATOM 7584  O OH  . TYR B 1 445 ? 41.393  58.197  -30.145  1.00 40.00 ? 449 TYR B OH  1 
ATOM 7585  N N   . GLU B 1 446 ? 39.610  60.169  -22.095  1.00 40.00 ? 450 GLU B N   1 
ATOM 7586  C CA  . GLU B 1 446 ? 39.239  59.985  -20.699  1.00 40.00 ? 450 GLU B CA  1 
ATOM 7587  C C   . GLU B 1 446 ? 37.979  59.091  -20.694  1.00 40.00 ? 450 GLU B C   1 
ATOM 7588  O O   . GLU B 1 446 ? 37.639  58.441  -19.706  1.00 40.00 ? 450 GLU B O   1 
ATOM 7589  C CB  . GLU B 1 446 ? 38.838  61.298  -20.019  1.00 40.00 ? 450 GLU B CB  1 
ATOM 7590  C CG  . GLU B 1 446 ? 37.432  61.787  -20.414  1.00 40.00 ? 450 GLU B CG  1 
ATOM 7591  C CD  . GLU B 1 446 ? 37.486  62.888  -21.467  1.00 40.00 ? 450 GLU B CD  1 
ATOM 7592  O OE1 . GLU B 1 446 ? 38.332  62.761  -22.385  1.00 40.00 ? 450 GLU B OE1 1 
ATOM 7593  O OE2 . GLU B 1 446 ? 36.685  63.839  -21.295  1.00 40.00 ? 450 GLU B OE2 1 
ATOM 7594  N N   . ILE B 1 447 ? 37.230  59.136  -21.821  1.00 40.00 ? 451 ILE B N   1 
ATOM 7595  C CA  . ILE B 1 447 ? 35.960  58.442  -21.942  1.00 40.00 ? 451 ILE B CA  1 
ATOM 7596  C C   . ILE B 1 447 ? 36.014  56.975  -21.562  1.00 40.00 ? 451 ILE B C   1 
ATOM 7597  O O   . ILE B 1 447 ? 35.231  56.532  -20.694  1.00 40.00 ? 451 ILE B O   1 
ATOM 7598  C CB  . ILE B 1 447 ? 35.268  58.550  -23.304  1.00 40.00 ? 451 ILE B CB  1 
ATOM 7599  C CG1 . ILE B 1 447 ? 35.819  59.645  -24.191  1.00 40.00 ? 451 ILE B CG1 1 
ATOM 7600  C CG2 . ILE B 1 447 ? 33.749  58.701  -23.071  1.00 40.00 ? 451 ILE B CG2 1 
ATOM 7601  C CD1 . ILE B 1 447 ? 34.972  60.863  -24.469  1.00 40.00 ? 451 ILE B CD1 1 
ATOM 7602  N N   . GLU B 1 448 ? 36.966  56.260  -22.179  1.00 40.00 ? 452 GLU B N   1 
ATOM 7603  C CA  . GLU B 1 448 ? 37.186  54.854  -21.815  1.00 40.00 ? 452 GLU B CA  1 
ATOM 7604  C C   . GLU B 1 448 ? 37.101  54.735  -20.285  1.00 40.00 ? 452 GLU B C   1 
ATOM 7605  O O   . GLU B 1 448 ? 36.332  53.926  -19.727  1.00 40.00 ? 452 GLU B O   1 
ATOM 7606  C CB  . GLU B 1 448 ? 38.531  54.396  -22.328  1.00 40.00 ? 452 GLU B CB  1 
ATOM 7607  C CG  . GLU B 1 448 ? 39.141  55.157  -23.497  1.00 40.00 ? 452 GLU B CG  1 
ATOM 7608  C CD  . GLU B 1 448 ? 40.334  54.382  -24.047  1.00 40.00 ? 452 GLU B CD  1 
ATOM 7609  O OE1 . GLU B 1 448 ? 40.728  53.434  -23.318  1.00 40.00 ? 452 GLU B OE1 1 
ATOM 7610  O OE2 . GLU B 1 448 ? 40.933  54.597  -25.129  1.00 40.00 ? 452 GLU B OE2 1 
ATOM 7611  N N   . PHE B 1 449 ? 37.828  55.565  -19.534  1.00 40.00 ? 453 PHE B N   1 
ATOM 7612  C CA  . PHE B 1 449 ? 37.775  55.493  -18.077  1.00 40.00 ? 453 PHE B CA  1 
ATOM 7613  C C   . PHE B 1 449 ? 36.465  55.879  -17.465  1.00 40.00 ? 453 PHE B C   1 
ATOM 7614  O O   . PHE B 1 449 ? 35.851  55.038  -16.762  1.00 40.00 ? 453 PHE B O   1 
ATOM 7615  C CB  . PHE B 1 449 ? 38.984  56.249  -17.480  1.00 40.00 ? 453 PHE B CB  1 
ATOM 7616  C CG  . PHE B 1 449 ? 40.253  55.657  -18.060  1.00 40.00 ? 453 PHE B CG  1 
ATOM 7617  C CD1 . PHE B 1 449 ? 40.812  56.168  -19.211  1.00 40.00 ? 453 PHE B CD1 1 
ATOM 7618  C CD2 . PHE B 1 449 ? 40.861  54.568  -17.468  1.00 40.00 ? 453 PHE B CD2 1 
ATOM 7619  C CE1 . PHE B 1 449 ? 41.966  55.601  -19.741  1.00 40.00 ? 453 PHE B CE1 1 
ATOM 7620  C CE2 . PHE B 1 449 ? 42.010  54.001  -17.993  1.00 40.00 ? 453 PHE B CE2 1 
ATOM 7621  C CZ  . PHE B 1 449 ? 42.577  54.512  -19.140  1.00 40.00 ? 453 PHE B CZ  1 
ATOM 7622  N N   . ILE B 1 450 ? 35.954  57.087  -17.690  1.00 40.00 ? 454 ILE B N   1 
ATOM 7623  C CA  . ILE B 1 450 ? 34.653  57.430  -17.062  1.00 40.00 ? 454 ILE B CA  1 
ATOM 7624  C C   . ILE B 1 450 ? 33.636  56.330  -17.290  1.00 40.00 ? 454 ILE B C   1 
ATOM 7625  O O   . ILE B 1 450 ? 32.949  55.901  -16.373  1.00 40.00 ? 454 ILE B O   1 
ATOM 7626  C CB  . ILE B 1 450 ? 34.110  58.748  -17.635  1.00 40.00 ? 454 ILE B CB  1 
ATOM 7627  C CG1 . ILE B 1 450 ? 35.210  59.818  -17.607  1.00 40.00 ? 454 ILE B CG1 1 
ATOM 7628  C CG2 . ILE B 1 450 ? 32.880  59.252  -16.909  1.00 40.00 ? 454 ILE B CG2 1 
ATOM 7629  C CD1 . ILE B 1 450 ? 35.474  60.345  -16.218  1.00 40.00 ? 454 ILE B CD1 1 
ATOM 7630  N N   . PHE B 1 451 ? 33.512  55.819  -18.525  1.00 40.00 ? 455 PHE B N   1 
ATOM 7631  C CA  . PHE B 1 451 ? 32.533  54.760  -18.792  1.00 40.00 ? 455 PHE B CA  1 
ATOM 7632  C C   . PHE B 1 451 ? 32.854  53.455  -18.103  1.00 40.00 ? 455 PHE B C   1 
ATOM 7633  O O   . PHE B 1 451 ? 31.933  52.673  -17.829  1.00 40.00 ? 455 PHE B O   1 
ATOM 7634  C CB  . PHE B 1 451 ? 32.226  54.623  -20.305  1.00 40.00 ? 455 PHE B CB  1 
ATOM 7635  C CG  . PHE B 1 451 ? 31.140  55.626  -20.675  1.00 40.00 ? 455 PHE B CG  1 
ATOM 7636  C CD1 . PHE B 1 451 ? 31.496  56.903  -21.094  1.00 40.00 ? 455 PHE B CD1 1 
ATOM 7637  C CD2 . PHE B 1 451 ? 29.804  55.307  -20.554  1.00 40.00 ? 455 PHE B CD2 1 
ATOM 7638  C CE1 . PHE B 1 451 ? 30.513  57.833  -21.397  1.00 40.00 ? 455 PHE B CE1 1 
ATOM 7639  C CE2 . PHE B 1 451 ? 28.823  56.237  -20.859  1.00 40.00 ? 455 PHE B CE2 1 
ATOM 7640  C CZ  . PHE B 1 451 ? 29.168  57.499  -21.287  1.00 40.00 ? 455 PHE B CZ  1 
ATOM 7641  N N   . GLY B 1 452 ? 34.103  53.202  -17.744  1.00 40.00 ? 456 GLY B N   1 
ATOM 7642  C CA  . GLY B 1 452 ? 34.441  52.008  -16.993  1.00 40.00 ? 456 GLY B CA  1 
ATOM 7643  C C   . GLY B 1 452 ? 34.870  50.868  -17.863  1.00 40.00 ? 456 GLY B C   1 
ATOM 7644  O O   . GLY B 1 452 ? 34.926  49.712  -17.435  1.00 40.00 ? 456 GLY B O   1 
ATOM 7645  N N   . LEU B 1 453 ? 35.402  51.155  -19.057  1.00 40.00 ? 457 LEU B N   1 
ATOM 7646  C CA  . LEU B 1 453 ? 35.874  50.089  -19.933  1.00 40.00 ? 457 LEU B CA  1 
ATOM 7647  C C   . LEU B 1 453 ? 36.954  49.220  -19.375  1.00 40.00 ? 457 LEU B C   1 
ATOM 7648  O O   . LEU B 1 453 ? 37.037  48.020  -19.680  1.00 40.00 ? 457 LEU B O   1 
ATOM 7649  C CB  . LEU B 1 453 ? 36.179  50.609  -21.344  1.00 40.00 ? 457 LEU B CB  1 
ATOM 7650  C CG  . LEU B 1 453 ? 34.924  50.567  -22.246  1.00 40.00 ? 457 LEU B CG  1 
ATOM 7651  C CD1 . LEU B 1 453 ? 33.808  51.411  -21.640  1.00 40.00 ? 457 LEU B CD1 1 
ATOM 7652  C CD2 . LEU B 1 453 ? 35.237  50.989  -23.667  1.00 40.00 ? 457 LEU B CD2 1 
ATOM 7653  N N   . PRO B 1 454 ? 37.804  49.713  -18.506  1.00 40.00 ? 458 PRO B N   1 
ATOM 7654  C CA  . PRO B 1 454 ? 38.861  48.853  -17.934  1.00 40.00 ? 458 PRO B CA  1 
ATOM 7655  C C   . PRO B 1 454 ? 38.289  47.765  -17.060  1.00 40.00 ? 458 PRO B C   1 
ATOM 7656  O O   . PRO B 1 454 ? 38.910  46.680  -16.968  1.00 40.00 ? 458 PRO B O   1 
ATOM 7657  C CB  . PRO B 1 454 ? 39.848  49.825  -17.340  1.00 40.00 ? 458 PRO B CB  1 
ATOM 7658  C CG  . PRO B 1 454 ? 39.506  51.157  -17.952  1.00 40.00 ? 458 PRO B CG  1 
ATOM 7659  C CD  . PRO B 1 454 ? 37.980  51.103  -18.015  1.00 40.00 ? 458 PRO B CD  1 
ATOM 7660  N N   . LEU B 1 455 ? 37.096  47.907  -16.486  1.00 40.00 ? 459 LEU B N   1 
ATOM 7661  C CA  . LEU B 1 455 ? 36.460  46.847  -15.698  1.00 40.00 ? 459 LEU B CA  1 
ATOM 7662  C C   . LEU B 1 455 ? 36.271  45.580  -16.536  1.00 40.00 ? 459 LEU B C   1 
ATOM 7663  O O   . LEU B 1 455 ? 36.221  44.460  -16.002  1.00 40.00 ? 459 LEU B O   1 
ATOM 7664  C CB  . LEU B 1 455 ? 35.149  47.315  -15.055  1.00 40.00 ? 459 LEU B CB  1 
ATOM 7665  C CG  . LEU B 1 455 ? 35.231  48.310  -13.897  1.00 40.00 ? 459 LEU B CG  1 
ATOM 7666  C CD1 . LEU B 1 455 ? 35.173  49.771  -14.311  1.00 40.00 ? 459 LEU B CD1 1 
ATOM 7667  C CD2 . LEU B 1 455 ? 34.127  48.086  -12.873  1.00 40.00 ? 459 LEU B CD2 1 
ATOM 7668  N N   . ASP B 1 456 ? 36.185  45.662  -17.860  1.00 40.00 ? 460 ASP B N   1 
ATOM 7669  C CA  . ASP B 1 456 ? 36.083  44.479  -18.710  1.00 40.00 ? 460 ASP B CA  1 
ATOM 7670  C C   . ASP B 1 456 ? 37.480  43.858  -18.855  1.00 40.00 ? 460 ASP B C   1 
ATOM 7671  O O   . ASP B 1 456 ? 38.412  44.435  -19.426  1.00 40.00 ? 460 ASP B O   1 
ATOM 7672  C CB  . ASP B 1 456 ? 35.493  44.805  -20.073  1.00 40.00 ? 460 ASP B CB  1 
ATOM 7673  C CG  . ASP B 1 456 ? 35.367  43.631  -21.023  1.00 40.00 ? 460 ASP B CG  1 
ATOM 7674  O OD1 . ASP B 1 456 ? 35.975  42.555  -20.814  1.00 40.00 ? 460 ASP B OD1 1 
ATOM 7675  O OD2 . ASP B 1 456 ? 34.627  43.769  -22.034  1.00 40.00 ? 460 ASP B OD2 1 
ATOM 7676  N N   . PRO B 1 457 ? 37.616  42.639  -18.358  1.00 40.00 ? 461 PRO B N   1 
ATOM 7677  C CA  . PRO B 1 457 ? 38.855  41.895  -18.362  1.00 40.00 ? 461 PRO B CA  1 
ATOM 7678  C C   . PRO B 1 457 ? 39.388  41.533  -19.725  1.00 40.00 ? 461 PRO B C   1 
ATOM 7679  O O   . PRO B 1 457 ? 40.609  41.441  -19.926  1.00 40.00 ? 461 PRO B O   1 
ATOM 7680  C CB  . PRO B 1 457 ? 38.543  40.635  -17.557  1.00 40.00 ? 461 PRO B CB  1 
ATOM 7681  C CG  . PRO B 1 457 ? 37.366  41.033  -16.711  1.00 40.00 ? 461 PRO B CG  1 
ATOM 7682  C CD  . PRO B 1 457 ? 36.534  41.895  -17.649  1.00 40.00 ? 461 PRO B CD  1 
ATOM 7683  N N   . SER B 1 458 ? 38.486  41.313  -20.679  1.00 40.00 ? 462 SER B N   1 
ATOM 7684  C CA  . SER B 1 458 ? 38.930  40.953  -22.031  1.00 40.00 ? 462 SER B CA  1 
ATOM 7685  C C   . SER B 1 458 ? 39.750  42.088  -22.632  1.00 40.00 ? 462 SER B C   1 
ATOM 7686  O O   . SER B 1 458 ? 40.837  41.902  -23.175  1.00 40.00 ? 462 SER B O   1 
ATOM 7687  C CB  . SER B 1 458 ? 37.702  40.688  -22.901  1.00 40.00 ? 462 SER B CB  1 
ATOM 7688  O OG  . SER B 1 458 ? 37.121  41.936  -23.275  1.00 40.00 ? 462 SER B OG  1 
ATOM 7689  N N   . LEU B 1 459 ? 39.216  43.294  -22.493  1.00 40.00 ? 463 LEU B N   1 
ATOM 7690  C CA  . LEU B 1 459 ? 39.764  44.543  -22.959  1.00 40.00 ? 463 LEU B CA  1 
ATOM 7691  C C   . LEU B 1 459 ? 41.194  44.792  -22.560  1.00 40.00 ? 463 LEU B C   1 
ATOM 7692  O O   . LEU B 1 459 ? 41.962  45.442  -23.270  1.00 40.00 ? 463 LEU B O   1 
ATOM 7693  C CB  . LEU B 1 459 ? 38.904  45.692  -22.384  1.00 40.00 ? 463 LEU B CB  1 
ATOM 7694  C CG  . LEU B 1 459 ? 37.672  45.969  -23.253  1.00 40.00 ? 463 LEU B CG  1 
ATOM 7695  C CD1 . LEU B 1 459 ? 36.750  46.968  -22.594  1.00 40.00 ? 463 LEU B CD1 1 
ATOM 7696  C CD2 . LEU B 1 459 ? 38.137  46.451  -24.625  1.00 40.00 ? 463 LEU B CD2 1 
ATOM 7697  N N   . ASN B 1 460 ? 41.609  44.248  -21.438  1.00 40.00 ? 464 ASN B N   1 
ATOM 7698  C CA  . ASN B 1 460 ? 42.910  44.258  -20.875  1.00 40.00 ? 464 ASN B CA  1 
ATOM 7699  C C   . ASN B 1 460 ? 43.627  45.577  -20.700  1.00 40.00 ? 464 ASN B C   1 
ATOM 7700  O O   . ASN B 1 460 ? 44.549  45.982  -21.405  1.00 40.00 ? 464 ASN B O   1 
ATOM 7701  C CB  . ASN B 1 460 ? 43.800  43.204  -21.542  1.00 40.00 ? 464 ASN B CB  1 
ATOM 7702  C CG  . ASN B 1 460 ? 44.326  43.521  -22.909  1.00 40.00 ? 464 ASN B CG  1 
ATOM 7703  O OD1 . ASN B 1 460 ? 45.489  43.894  -23.087  1.00 40.00 ? 464 ASN B OD1 1 
ATOM 7704  N ND2 . ASN B 1 460 ? 43.531  43.393  -23.961  1.00 40.00 ? 464 ASN B ND2 1 
ATOM 7705  N N   . TYR B 1 461 ? 43.225  46.271  -19.633  1.00 40.00 ? 465 TYR B N   1 
ATOM 7706  C CA  . TYR B 1 461 ? 43.927  47.494  -19.230  1.00 40.00 ? 465 TYR B CA  1 
ATOM 7707  C C   . TYR B 1 461 ? 44.818  46.977  -18.074  1.00 40.00 ? 465 TYR B C   1 
ATOM 7708  O O   . TYR B 1 461 ? 45.034  45.763  -17.989  1.00 40.00 ? 465 TYR B O   1 
ATOM 7709  C CB  . TYR B 1 461 ? 42.999  48.540  -18.682  1.00 40.00 ? 465 TYR B CB  1 
ATOM 7710  C CG  . TYR B 1 461 ? 42.105  49.236  -19.670  1.00 40.00 ? 465 TYR B CG  1 
ATOM 7711  C CD1 . TYR B 1 461 ? 42.438  50.508  -20.124  1.00 40.00 ? 465 TYR B CD1 1 
ATOM 7712  C CD2 . TYR B 1 461 ? 40.948  48.651  -20.153  1.00 40.00 ? 465 TYR B CD2 1 
ATOM 7713  C CE1 . TYR B 1 461 ? 41.627  51.167  -21.030  1.00 40.00 ? 465 TYR B CE1 1 
ATOM 7714  C CE2 . TYR B 1 461 ? 40.126  49.310  -21.047  1.00 40.00 ? 465 TYR B CE2 1 
ATOM 7715  C CZ  . TYR B 1 461 ? 40.474  50.565  -21.482  1.00 40.00 ? 465 TYR B CZ  1 
ATOM 7716  O OH  . TYR B 1 461 ? 39.678  51.239  -22.374  1.00 40.00 ? 465 TYR B OH  1 
ATOM 7717  N N   . THR B 1 462 ? 45.259  47.859  -17.203  1.00 40.00 ? 466 THR B N   1 
ATOM 7718  C CA  . THR B 1 462 ? 46.044  47.395  -16.061  1.00 40.00 ? 466 THR B CA  1 
ATOM 7719  C C   . THR B 1 462 ? 45.106  47.463  -14.853  1.00 40.00 ? 466 THR B C   1 
ATOM 7720  O O   . THR B 1 462 ? 44.150  48.241  -14.837  1.00 40.00 ? 466 THR B O   1 
ATOM 7721  C CB  . THR B 1 462 ? 47.309  48.205  -15.795  1.00 40.00 ? 466 THR B CB  1 
ATOM 7722  O OG1 . THR B 1 462 ? 46.998  49.461  -15.160  1.00 40.00 ? 466 THR B OG1 1 
ATOM 7723  C CG2 . THR B 1 462 ? 48.079  48.443  -17.082  1.00 40.00 ? 466 THR B CG2 1 
ATOM 7724  N N   . THR B 1 463 ? 45.440  46.678  -13.838  1.00 40.00 ? 467 THR B N   1 
ATOM 7725  C CA  . THR B 1 463 ? 44.640  46.673  -12.610  1.00 40.00 ? 467 THR B CA  1 
ATOM 7726  C C   . THR B 1 463 ? 44.526  48.089  -12.073  1.00 40.00 ? 467 THR B C   1 
ATOM 7727  O O   . THR B 1 463 ? 43.459  48.523  -11.637  1.00 40.00 ? 467 THR B O   1 
ATOM 7728  C CB  . THR B 1 463 ? 45.280  45.717  -11.599  1.00 40.00 ? 467 THR B CB  1 
ATOM 7729  O OG1 . THR B 1 463 ? 45.984  44.694  -12.325  1.00 40.00 ? 467 THR B OG1 1 
ATOM 7730  C CG2 . THR B 1 463 ? 44.220  45.098  -10.708  1.00 40.00 ? 467 THR B CG2 1 
ATOM 7731  N N   . GLU B 1 464 ? 45.633  48.837  -12.148  1.00 40.00 ? 468 GLU B N   1 
ATOM 7732  C CA  . GLU B 1 464 ? 45.625  50.230  -11.704  1.00 40.00 ? 468 GLU B CA  1 
ATOM 7733  C C   . GLU B 1 464 ? 44.557  50.980  -12.495  1.00 40.00 ? 468 GLU B C   1 
ATOM 7734  O O   . GLU B 1 464 ? 43.657  51.610  -11.937  1.00 40.00 ? 468 GLU B O   1 
ATOM 7735  C CB  . GLU B 1 464 ? 47.007  50.850  -11.893  1.00 40.00 ? 468 GLU B CB  1 
ATOM 7736  C CG  . GLU B 1 464 ? 48.135  50.031  -11.266  1.00 40.00 ? 468 GLU B CG  1 
ATOM 7737  C CD  . GLU B 1 464 ? 48.745  49.053  -12.259  1.00 40.00 ? 468 GLU B CD  1 
ATOM 7738  O OE1 . GLU B 1 464 ? 49.563  49.493  -13.107  1.00 40.00 ? 468 GLU B OE1 1 
ATOM 7739  O OE2 . GLU B 1 464 ? 48.416  47.844  -12.203  1.00 40.00 ? 468 GLU B OE2 1 
ATOM 7740  N N   . GLU B 1 465 ? 44.637  50.811  -13.823  1.00 40.00 ? 469 GLU B N   1 
ATOM 7741  C CA  . GLU B 1 465 ? 43.667  51.425  -14.735  1.00 40.00 ? 469 GLU B CA  1 
ATOM 7742  C C   . GLU B 1 465 ? 42.248  51.057  -14.313  1.00 40.00 ? 469 GLU B C   1 
ATOM 7743  O O   . GLU B 1 465 ? 41.354  51.907  -14.257  1.00 40.00 ? 469 GLU B O   1 
ATOM 7744  C CB  . GLU B 1 465 ? 43.957  51.059  -16.192  1.00 40.00 ? 469 GLU B CB  1 
ATOM 7745  C CG  . GLU B 1 465 ? 45.361  51.440  -16.633  1.00 40.00 ? 469 GLU B CG  1 
ATOM 7746  C CD  . GLU B 1 465 ? 45.612  51.469  -18.118  1.00 40.00 ? 469 GLU B CD  1 
ATOM 7747  O OE1 . GLU B 1 465 ? 45.905  50.423  -18.748  1.00 40.00 ? 469 GLU B OE1 1 
ATOM 7748  O OE2 . GLU B 1 465 ? 45.534  52.572  -18.723  1.00 40.00 ? 469 GLU B OE2 1 
ATOM 7749  N N   . ARG B 1 466 ? 42.072  49.784  -13.964  1.00 40.00 ? 470 ARG B N   1 
ATOM 7750  C CA  . ARG B 1 466 ? 40.782  49.291  -13.508  1.00 40.00 ? 470 ARG B CA  1 
ATOM 7751  C C   . ARG B 1 466 ? 40.312  50.030  -12.255  1.00 40.00 ? 470 ARG B C   1 
ATOM 7752  O O   . ARG B 1 466 ? 39.230  50.608  -12.189  1.00 40.00 ? 470 ARG B O   1 
ATOM 7753  C CB  . ARG B 1 466 ? 40.868  47.788  -13.223  1.00 40.00 ? 470 ARG B CB  1 
ATOM 7754  C CG  . ARG B 1 466 ? 39.572  47.246  -12.622  1.00 40.00 ? 470 ARG B CG  1 
ATOM 7755  C CD  . ARG B 1 466 ? 39.802  45.871  -11.977  1.00 40.00 ? 470 ARG B CD  1 
ATOM 7756  N NE  . ARG B 1 466 ? 40.496  44.978  -12.903  1.00 40.00 ? 470 ARG B NE  1 
ATOM 7757  C CZ  . ARG B 1 466 ? 41.269  43.942  -12.620  1.00 40.00 ? 470 ARG B CZ  1 
ATOM 7758  N NH1 . ARG B 1 466 ? 41.504  43.565  -11.371  1.00 40.00 ? 470 ARG B NH1 1 
ATOM 7759  N NH2 . ARG B 1 466 ? 41.821  43.255  -13.628  1.00 40.00 ? 470 ARG B NH2 1 
ATOM 7760  N N   . ILE B 1 467 ? 41.204  49.993  -11.260  1.00 40.00 ? 471 ILE B N   1 
ATOM 7761  C CA  . ILE B 1 467 ? 40.932  50.661  -9.980   1.00 40.00 ? 471 ILE B CA  1 
ATOM 7762  C C   . ILE B 1 467 ? 40.650  52.141  -10.270  1.00 40.00 ? 471 ILE B C   1 
ATOM 7763  O O   . ILE B 1 467 ? 39.674  52.709  -9.792   1.00 40.00 ? 471 ILE B O   1 
ATOM 7764  C CB  . ILE B 1 467 ? 42.189  50.557  -9.090   1.00 40.00 ? 471 ILE B CB  1 
ATOM 7765  C CG1 . ILE B 1 467 ? 42.588  49.098  -8.875   1.00 40.00 ? 471 ILE B CG1 1 
ATOM 7766  C CG2 . ILE B 1 467 ? 41.976  51.253  -7.754   1.00 40.00 ? 471 ILE B CG2 1 
ATOM 7767  C CD1 . ILE B 1 467 ? 44.050  48.906  -8.523   1.00 40.00 ? 471 ILE B CD1 1 
ATOM 7768  N N   . PHE B 1 468 ? 41.568  52.686  -11.104  1.00 40.00 ? 472 PHE B N   1 
ATOM 7769  C CA  . PHE B 1 468 ? 41.468  54.077  -11.517  1.00 40.00 ? 472 PHE B CA  1 
ATOM 7770  C C   . PHE B 1 468 ? 40.040  54.348  -11.991  1.00 40.00 ? 472 PHE B C   1 
ATOM 7771  O O   . PHE B 1 468 ? 39.304  55.180  -11.467  1.00 40.00 ? 472 PHE B O   1 
ATOM 7772  C CB  . PHE B 1 468 ? 42.420  54.363  -12.670  1.00 40.00 ? 472 PHE B CB  1 
ATOM 7773  C CG  . PHE B 1 468 ? 42.513  55.785  -13.126  1.00 40.00 ? 472 PHE B CG  1 
ATOM 7774  C CD1 . PHE B 1 468 ? 41.992  56.844  -12.400  1.00 40.00 ? 472 PHE B CD1 1 
ATOM 7775  C CD2 . PHE B 1 468 ? 43.160  56.087  -14.330  1.00 40.00 ? 472 PHE B CD2 1 
ATOM 7776  C CE1 . PHE B 1 468 ? 42.106  58.153  -12.836  1.00 40.00 ? 472 PHE B CE1 1 
ATOM 7777  C CE2 . PHE B 1 468 ? 43.268  57.391  -14.773  1.00 40.00 ? 472 PHE B CE2 1 
ATOM 7778  C CZ  . PHE B 1 468 ? 42.743  58.429  -14.026  1.00 40.00 ? 472 PHE B CZ  1 
ATOM 7779  N N   . ALA B 1 469 ? 39.664  53.552  -12.999  1.00 40.00 ? 473 ALA B N   1 
ATOM 7780  C CA  . ALA B 1 469 ? 38.336  53.664  -13.585  1.00 40.00 ? 473 ALA B CA  1 
ATOM 7781  C C   . ALA B 1 469 ? 37.255  53.735  -12.515  1.00 40.00 ? 473 ALA B C   1 
ATOM 7782  O O   . ALA B 1 469 ? 36.423  54.648  -12.406  1.00 40.00 ? 473 ALA B O   1 
ATOM 7783  C CB  . ALA B 1 469 ? 38.141  52.450  -14.467  1.00 40.00 ? 473 ALA B CB  1 
ATOM 7784  N N   . GLN B 1 470 ? 37.295  52.729  -11.622  1.00 40.00 ? 474 GLN B N   1 
ATOM 7785  C CA  . GLN B 1 470 ? 36.323  52.637  -10.534  1.00 40.00 ? 474 GLN B CA  1 
ATOM 7786  C C   . GLN B 1 470 ? 36.263  53.942  -9.761   1.00 40.00 ? 474 GLN B C   1 
ATOM 7787  O O   . GLN B 1 470 ? 35.218  54.470  -9.365   1.00 40.00 ? 474 GLN B O   1 
ATOM 7788  C CB  . GLN B 1 470 ? 36.647  51.443  -9.644   1.00 40.00 ? 474 GLN B CB  1 
ATOM 7789  C CG  . GLN B 1 470 ? 37.013  50.158  -10.378  1.00 40.00 ? 474 GLN B CG  1 
ATOM 7790  C CD  . GLN B 1 470 ? 37.081  48.924  -9.493   1.00 40.00 ? 474 GLN B CD  1 
ATOM 7791  O OE1 . GLN B 1 470 ? 37.910  48.021  -9.707   1.00 40.00 ? 474 GLN B OE1 1 
ATOM 7792  N NE2 . GLN B 1 470 ? 36.205  48.849  -8.487   1.00 40.00 ? 474 GLN B NE2 1 
ATOM 7793  N N   . ARG B 1 471 ? 37.463  54.502  -9.549   1.00 40.00 ? 475 ARG B N   1 
ATOM 7794  C CA  . ARG B 1 471 ? 37.557  55.769  -8.813   1.00 40.00 ? 475 ARG B CA  1 
ATOM 7795  C C   . ARG B 1 471 ? 36.826  56.874  -9.564   1.00 40.00 ? 475 ARG B C   1 
ATOM 7796  O O   . ARG B 1 471 ? 35.969  57.581  -9.019   1.00 40.00 ? 475 ARG B O   1 
ATOM 7797  C CB  . ARG B 1 471 ? 39.022  56.085  -8.601   1.00 40.00 ? 475 ARG B CB  1 
ATOM 7798  C CG  . ARG B 1 471 ? 39.240  56.977  -7.376   1.00 40.00 ? 475 ARG B CG  1 
ATOM 7799  C CD  . ARG B 1 471 ? 40.738  57.116  -7.198   1.00 40.00 ? 475 ARG B CD  1 
ATOM 7800  N NE  . ARG B 1 471 ? 41.238  58.432  -7.589   1.00 40.00 ? 475 ARG B NE  1 
ATOM 7801  C CZ  . ARG B 1 471 ? 42.393  58.486  -8.268   1.00 40.00 ? 475 ARG B CZ  1 
ATOM 7802  N NH1 . ARG B 1 471 ? 43.041  57.362  -8.579   1.00 40.00 ? 475 ARG B NH1 1 
ATOM 7803  N NH2 . ARG B 1 471 ? 42.847  59.693  -8.595   1.00 40.00 ? 475 ARG B NH2 1 
ATOM 7804  N N   . LEU B 1 472 ? 37.173  56.959  -10.858  1.00 40.00 ? 476 LEU B N   1 
ATOM 7805  C CA  . LEU B 1 472 ? 36.543  57.927  -11.752  1.00 40.00 ? 476 LEU B CA  1 
ATOM 7806  C C   . LEU B 1 472 ? 35.030  57.746  -11.780  1.00 40.00 ? 476 LEU B C   1 
ATOM 7807  O O   . LEU B 1 472 ? 34.250  58.694  -11.572  1.00 40.00 ? 476 LEU B O   1 
ATOM 7808  C CB  . LEU B 1 472 ? 37.147  57.764  -13.149  1.00 40.00 ? 476 LEU B CB  1 
ATOM 7809  C CG  . LEU B 1 472 ? 38.567  58.326  -13.335  1.00 40.00 ? 476 LEU B CG  1 
ATOM 7810  C CD1 . LEU B 1 472 ? 39.401  57.471  -14.278  1.00 40.00 ? 476 LEU B CD1 1 
ATOM 7811  C CD2 . LEU B 1 472 ? 38.474  59.748  -13.882  1.00 40.00 ? 476 LEU B CD2 1 
ATOM 7812  N N   . MET B 1 473 ? 34.577  56.489  -11.944  1.00 40.00 ? 477 MET B N   1 
ATOM 7813  C CA  . MET B 1 473 ? 33.130  56.256  -11.994  1.00 40.00 ? 477 MET B CA  1 
ATOM 7814  C C   . MET B 1 473 ? 32.434  56.761  -10.734  1.00 40.00 ? 477 MET B C   1 
ATOM 7815  O O   . MET B 1 473 ? 31.326  57.282  -10.704  1.00 40.00 ? 477 MET B O   1 
ATOM 7816  C CB  . MET B 1 473 ? 32.773  54.799  -12.165  1.00 40.00 ? 477 MET B CB  1 
ATOM 7817  C CG  . MET B 1 473 ? 33.763  53.997  -12.980  1.00 40.00 ? 477 MET B CG  1 
ATOM 7818  S SD  . MET B 1 473 ? 33.076  52.383  -13.399  1.00 40.00 ? 477 MET B SD  1 
ATOM 7819  C CE  . MET B 1 473 ? 31.384  52.846  -13.750  1.00 40.00 ? 477 MET B CE  1 
ATOM 7820  N N   . LYS B 1 474 ? 33.162  56.537  -9.649   1.00 40.00 ? 478 LYS B N   1 
ATOM 7821  C CA  . LYS B 1 474 ? 32.728  56.933  -8.322   1.00 40.00 ? 478 LYS B CA  1 
ATOM 7822  C C   . LYS B 1 474 ? 32.545  58.443  -8.207   1.00 40.00 ? 478 LYS B C   1 
ATOM 7823  O O   . LYS B 1 474 ? 31.540  58.886  -7.636   1.00 40.00 ? 478 LYS B O   1 
ATOM 7824  C CB  . LYS B 1 474 ? 33.807  56.443  -7.345   1.00 40.00 ? 478 LYS B CB  1 
ATOM 7825  C CG  . LYS B 1 474 ? 33.414  55.210  -6.557   1.00 40.00 ? 478 LYS B CG  1 
ATOM 7826  C CD  . LYS B 1 474 ? 32.095  55.408  -5.820   1.00 40.00 ? 478 LYS B CD  1 
ATOM 7827  C CE  . LYS B 1 474 ? 32.218  56.419  -4.701   1.00 40.00 ? 478 LYS B CE  1 
ATOM 7828  N NZ  . LYS B 1 474 ? 33.593  56.987  -4.540   1.00 40.00 ? 478 LYS B NZ  1 
ATOM 7829  N N   . TYR B 1 475 ? 33.513  59.192  -8.777   1.00 40.00 ? 479 TYR B N   1 
ATOM 7830  C CA  . TYR B 1 475 ? 33.420  60.651  -8.695   1.00 40.00 ? 479 TYR B CA  1 
ATOM 7831  C C   . TYR B 1 475 ? 32.178  61.147  -9.444   1.00 40.00 ? 479 TYR B C   1 
ATOM 7832  O O   . TYR B 1 475 ? 31.373  61.946  -8.936   1.00 40.00 ? 479 TYR B O   1 
ATOM 7833  C CB  . TYR B 1 475 ? 34.682  61.301  -9.199   1.00 40.00 ? 479 TYR B CB  1 
ATOM 7834  C CG  . TYR B 1 475 ? 36.006  61.106  -8.510   1.00 40.00 ? 479 TYR B CG  1 
ATOM 7835  C CD1 . TYR B 1 475 ? 36.254  61.552  -7.208   1.00 40.00 ? 479 TYR B CD1 1 
ATOM 7836  C CD2 . TYR B 1 475 ? 37.052  60.481  -9.191   1.00 40.00 ? 479 TYR B CD2 1 
ATOM 7837  C CE1 . TYR B 1 475 ? 37.492  61.362  -6.607   1.00 40.00 ? 479 TYR B CE1 1 
ATOM 7838  C CE2 . TYR B 1 475 ? 38.287  60.295  -8.597   1.00 40.00 ? 479 TYR B CE2 1 
ATOM 7839  C CZ  . TYR B 1 475 ? 38.501  60.737  -7.301   1.00 40.00 ? 479 TYR B CZ  1 
ATOM 7840  O OH  . TYR B 1 475 ? 39.736  60.532  -6.754   1.00 40.00 ? 479 TYR B OH  1 
ATOM 7841  N N   . TRP B 1 476 ? 32.009  60.610  -10.664  1.00 40.00 ? 480 TRP B N   1 
ATOM 7842  C CA  . TRP B 1 476 ? 30.896  60.992  -11.534  1.00 40.00 ? 480 TRP B CA  1 
ATOM 7843  C C   . TRP B 1 476 ? 29.534  60.725  -10.931  1.00 40.00 ? 480 TRP B C   1 
ATOM 7844  O O   . TRP B 1 476 ? 28.736  61.641  -10.662  1.00 40.00 ? 480 TRP B O   1 
ATOM 7845  C CB  . TRP B 1 476 ? 31.095  60.406  -12.939  1.00 40.00 ? 480 TRP B CB  1 
ATOM 7846  C CG  . TRP B 1 476 ? 31.680  61.421  -13.891  1.00 40.00 ? 480 TRP B CG  1 
ATOM 7847  C CD1 . TRP B 1 476 ? 31.031  62.142  -14.849  1.00 40.00 ? 480 TRP B CD1 1 
ATOM 7848  C CD2 . TRP B 1 476 ? 33.056  61.829  -13.950  1.00 40.00 ? 480 TRP B CD2 1 
ATOM 7849  N NE1 . TRP B 1 476 ? 31.914  62.967  -15.502  1.00 40.00 ? 480 TRP B NE1 1 
ATOM 7850  C CE2 . TRP B 1 476 ? 33.167  62.791  -14.966  1.00 40.00 ? 480 TRP B CE2 1 
ATOM 7851  C CE3 . TRP B 1 476 ? 34.205  61.470  -13.241  1.00 40.00 ? 480 TRP B CE3 1 
ATOM 7852  C CZ2 . TRP B 1 476 ? 34.378  63.396  -15.270  1.00 40.00 ? 480 TRP B CZ2 1 
ATOM 7853  C CZ3 . TRP B 1 476 ? 35.410  62.074  -13.548  1.00 40.00 ? 480 TRP B CZ3 1 
ATOM 7854  C CH2 . TRP B 1 476 ? 35.489  63.036  -14.559  1.00 40.00 ? 480 TRP B CH2 1 
ATOM 7855  N N   . THR B 1 477 ? 29.259  59.469  -10.631  1.00 40.00 ? 481 THR B N   1 
ATOM 7856  C CA  . THR B 1 477 ? 28.026  59.024  -9.962   1.00 40.00 ? 481 THR B CA  1 
ATOM 7857  C C   . THR B 1 477 ? 27.805  59.780  -8.646   1.00 40.00 ? 481 THR B C   1 
ATOM 7858  O O   . THR B 1 477 ? 26.669  60.158  -8.321   1.00 40.00 ? 481 THR B O   1 
ATOM 7859  C CB  . THR B 1 477 ? 28.204  57.536  -9.556   1.00 40.00 ? 481 THR B CB  1 
ATOM 7860  O OG1 . THR B 1 477 ? 29.586  57.429  -9.128   1.00 40.00 ? 481 THR B OG1 1 
ATOM 7861  C CG2 . THR B 1 477 ? 27.949  56.636  -10.741  1.00 40.00 ? 481 THR B CG2 1 
ATOM 7862  N N   . ASN B 1 478 ? 28.892  60.031  -7.894   1.00 40.00 ? 482 ASN B N   1 
ATOM 7863  C CA  . ASN B 1 478 ? 28.788  60.813  -6.675   1.00 40.00 ? 482 ASN B CA  1 
ATOM 7864  C C   . ASN B 1 478 ? 28.389  62.261  -6.982   1.00 40.00 ? 482 ASN B C   1 
ATOM 7865  O O   . ASN B 1 478 ? 27.509  62.825  -6.326   1.00 40.00 ? 482 ASN B O   1 
ATOM 7866  C CB  . ASN B 1 478 ? 30.119  60.829  -5.942   1.00 40.00 ? 482 ASN B CB  1 
ATOM 7867  C CG  . ASN B 1 478 ? 30.186  59.934  -4.731   1.00 40.00 ? 482 ASN B CG  1 
ATOM 7868  O OD1 . ASN B 1 478 ? 29.216  59.713  -3.989   1.00 40.00 ? 482 ASN B OD1 1 
ATOM 7869  N ND2 . ASN B 1 478 ? 31.385  59.390  -4.513   1.00 40.00 ? 482 ASN B ND2 1 
ATOM 7870  N N   . PHE B 1 479 ? 29.043  62.850  -8.033   1.00 40.00 ? 483 PHE B N   1 
ATOM 7871  C CA  . PHE B 1 479 ? 28.634  64.232  -8.367   1.00 40.00 ? 483 PHE B CA  1 
ATOM 7872  C C   . PHE B 1 479 ? 27.168  64.143  -8.834   1.00 40.00 ? 483 PHE B C   1 
ATOM 7873  O O   . PHE B 1 479 ? 26.339  65.009  -8.566   1.00 40.00 ? 483 PHE B O   1 
ATOM 7874  C CB  . PHE B 1 479 ? 29.530  64.893  -9.406   1.00 40.00 ? 483 PHE B CB  1 
ATOM 7875  C CG  . PHE B 1 479 ? 28.936  66.173  -9.959   1.00 40.00 ? 483 PHE B CG  1 
ATOM 7876  C CD1 . PHE B 1 479 ? 28.994  67.345  -9.224   1.00 40.00 ? 483 PHE B CD1 1 
ATOM 7877  C CD2 . PHE B 1 479 ? 28.304  66.189  -11.191  1.00 40.00 ? 483 PHE B CD2 1 
ATOM 7878  C CE1 . PHE B 1 479 ? 28.448  68.527  -9.693   1.00 40.00 ? 483 PHE B CE1 1 
ATOM 7879  C CE2 . PHE B 1 479 ? 27.750  67.365  -11.669  1.00 40.00 ? 483 PHE B CE2 1 
ATOM 7880  C CZ  . PHE B 1 479 ? 27.824  68.518  -10.923  1.00 40.00 ? 483 PHE B CZ  1 
ATOM 7881  N N   . ALA B 1 480 ? 26.895  63.029  -9.531   1.00 40.00 ? 484 ALA B N   1 
ATOM 7882  C CA  . ALA B 1 480 ? 25.565  62.761  -10.016  1.00 40.00 ? 484 ALA B CA  1 
ATOM 7883  C C   . ALA B 1 480 ? 24.553  62.735  -8.882   1.00 40.00 ? 484 ALA B C   1 
ATOM 7884  O O   . ALA B 1 480 ? 23.568  63.482  -8.982   1.00 40.00 ? 484 ALA B O   1 
ATOM 7885  C CB  . ALA B 1 480 ? 25.501  61.459  -10.797  1.00 40.00 ? 484 ALA B CB  1 
ATOM 7886  N N   . ARG B 1 481 ? 24.770  61.924  -7.833   1.00 40.00 ? 485 ARG B N   1 
ATOM 7887  C CA  . ARG B 1 481 ? 23.733  61.899  -6.788   1.00 40.00 ? 485 ARG B CA  1 
ATOM 7888  C C   . ARG B 1 481 ? 23.703  63.099  -5.866   1.00 40.00 ? 485 ARG B C   1 
ATOM 7889  O O   . ARG B 1 481 ? 22.637  63.687  -5.662   1.00 40.00 ? 485 ARG B O   1 
ATOM 7890  C CB  . ARG B 1 481 ? 23.658  60.601  -6.008   1.00 40.00 ? 485 ARG B CB  1 
ATOM 7891  C CG  . ARG B 1 481 ? 24.970  59.948  -5.640   1.00 40.00 ? 485 ARG B CG  1 
ATOM 7892  C CD  . ARG B 1 481 ? 24.965  58.441  -5.898   1.00 40.00 ? 485 ARG B CD  1 
ATOM 7893  N NE  . ARG B 1 481 ? 26.312  57.889  -5.746   1.00 40.00 ? 485 ARG B NE  1 
ATOM 7894  C CZ  . ARG B 1 481 ? 26.786  56.791  -6.321   1.00 40.00 ? 485 ARG B CZ  1 
ATOM 7895  N NH1 . ARG B 1 481 ? 26.043  56.036  -7.128   1.00 40.00 ? 485 ARG B NH1 1 
ATOM 7896  N NH2 . ARG B 1 481 ? 28.046  56.409  -6.093   1.00 40.00 ? 485 ARG B NH2 1 
ATOM 7897  N N   . THR B 1 482 ? 24.831  63.480  -5.313   1.00 40.00 ? 486 THR B N   1 
ATOM 7898  C CA  . THR B 1 482 ? 25.024  64.544  -4.365   1.00 40.00 ? 486 THR B CA  1 
ATOM 7899  C C   . THR B 1 482 ? 25.212  65.939  -4.937   1.00 40.00 ? 486 THR B C   1 
ATOM 7900  O O   . THR B 1 482 ? 24.560  66.906  -4.536   1.00 40.00 ? 486 THR B O   1 
ATOM 7901  C CB  . THR B 1 482 ? 26.324  64.224  -3.560   1.00 40.00 ? 486 THR B CB  1 
ATOM 7902  O OG1 . THR B 1 482 ? 27.464  64.649  -4.320   1.00 40.00 ? 486 THR B OG1 1 
ATOM 7903  C CG2 . THR B 1 482 ? 26.484  62.730  -3.319   1.00 40.00 ? 486 THR B CG2 1 
ATOM 7904  N N   . GLY B 1 483 ? 26.151  66.047  -5.882   1.00 40.00 ? 487 GLY B N   1 
ATOM 7905  C CA  . GLY B 1 483 ? 26.537  67.328  -6.488   1.00 40.00 ? 487 GLY B CA  1 
ATOM 7906  C C   . GLY B 1 483 ? 27.918  67.663  -5.871   1.00 40.00 ? 487 GLY B C   1 
ATOM 7907  O O   . GLY B 1 483 ? 28.256  68.814  -5.607   1.00 40.00 ? 487 GLY B O   1 
ATOM 7908  N N   . ASP B 1 484 ? 28.688  66.614  -5.646   1.00 40.00 ? 488 ASP B N   1 
ATOM 7909  C CA  . ASP B 1 484 ? 30.024  66.700  -5.045   1.00 40.00 ? 488 ASP B CA  1 
ATOM 7910  C C   . ASP B 1 484 ? 30.647  65.357  -5.374   1.00 40.00 ? 488 ASP B C   1 
ATOM 7911  O O   . ASP B 1 484 ? 30.165  64.318  -4.933   1.00 40.00 ? 488 ASP B O   1 
ATOM 7912  C CB  . ASP B 1 484 ? 29.870  66.825  -3.550   1.00 40.00 ? 488 ASP B CB  1 
ATOM 7913  C CG  . ASP B 1 484 ? 31.051  67.025  -2.647   1.00 40.00 ? 488 ASP B CG  1 
ATOM 7914  O OD1 . ASP B 1 484 ? 32.212  66.639  -2.877   1.00 40.00 ? 488 ASP B OD1 1 
ATOM 7915  O OD2 . ASP B 1 484 ? 30.752  67.653  -1.577   1.00 40.00 ? 488 ASP B OD2 1 
ATOM 7916  N N   . PRO B 1 485 ? 31.709  65.339  -6.132   1.00 40.00 ? 489 PRO B N   1 
ATOM 7917  C CA  . PRO B 1 485 ? 32.348  64.099  -6.521   1.00 40.00 ? 489 PRO B CA  1 
ATOM 7918  C C   . PRO B 1 485 ? 32.959  63.378  -5.343   1.00 40.00 ? 489 PRO B C   1 
ATOM 7919  O O   . PRO B 1 485 ? 33.551  62.317  -5.528   1.00 40.00 ? 489 PRO B O   1 
ATOM 7920  C CB  . PRO B 1 485 ? 33.441  64.557  -7.486   1.00 40.00 ? 489 PRO B CB  1 
ATOM 7921  C CG  . PRO B 1 485 ? 33.729  65.973  -7.100   1.00 40.00 ? 489 PRO B CG  1 
ATOM 7922  C CD  . PRO B 1 485 ? 32.361  66.533  -6.720   1.00 40.00 ? 489 PRO B CD  1 
ATOM 7923  N N   . ASN B 1 486 ? 32.895  63.938  -4.148   1.00 40.00 ? 490 ASN B N   1 
ATOM 7924  C CA  . ASN B 1 486 ? 33.517  63.409  -2.979   1.00 40.00 ? 490 ASN B CA  1 
ATOM 7925  C C   . ASN B 1 486 ? 32.906  62.251  -2.223   1.00 40.00 ? 490 ASN B C   1 
ATOM 7926  O O   . ASN B 1 486 ? 31.706  62.107  -2.015   1.00 40.00 ? 490 ASN B O   1 
ATOM 7927  C CB  . ASN B 1 486 ? 33.781  64.543  -1.976   1.00 40.00 ? 490 ASN B CB  1 
ATOM 7928  C CG  . ASN B 1 486 ? 35.057  65.270  -2.366   1.00 40.00 ? 490 ASN B CG  1 
ATOM 7929  O OD1 . ASN B 1 486 ? 36.137  64.671  -2.341   1.00 40.00 ? 490 ASN B OD1 1 
ATOM 7930  N ND2 . ASN B 1 486 ? 34.867  66.537  -2.708   1.00 40.00 ? 490 ASN B ND2 1 
ATOM 7931  N N   . ASP B 1 487 ? 33.852  61.406  -1.761   1.00 40.00 ? 491 ASP B N   1 
ATOM 7932  C CA  . ASP B 1 487 ? 33.503  60.217  -0.944   1.00 40.00 ? 491 ASP B CA  1 
ATOM 7933  C C   . ASP B 1 487 ? 32.432  60.694  0.039    1.00 40.00 ? 491 ASP B C   1 
ATOM 7934  O O   . ASP B 1 487 ? 32.563  61.710  0.714    1.00 40.00 ? 491 ASP B O   1 
ATOM 7935  C CB  . ASP B 1 487 ? 34.726  59.616  -0.323   1.00 40.00 ? 491 ASP B CB  1 
ATOM 7936  N N   . PRO B 1 488 ? 31.306  60.021  0.016    1.00 40.00 ? 492 PRO B N   1 
ATOM 7937  C CA  . PRO B 1 488 ? 30.077  60.324  0.708    1.00 40.00 ? 492 PRO B CA  1 
ATOM 7938  C C   . PRO B 1 488 ? 30.174  61.311  1.834    1.00 40.00 ? 492 PRO B C   1 
ATOM 7939  O O   . PRO B 1 488 ? 30.281  62.525  1.740    1.00 40.00 ? 492 PRO B O   1 
ATOM 7940  C CB  . PRO B 1 488 ? 29.570  58.950  1.128    1.00 40.00 ? 492 PRO B CB  1 
ATOM 7941  C CG  . PRO B 1 488 ? 30.324  57.951  0.321    1.00 40.00 ? 492 PRO B CG  1 
ATOM 7942  C CD  . PRO B 1 488 ? 31.044  58.761  -0.759   1.00 40.00 ? 492 PRO B CD  1 
ATOM 7943  N N   . ARG B 1 489 ? 30.003  60.706  2.991    1.00 40.00 ? 493 ARG B N   1 
ATOM 7944  C CA  . ARG B 1 489 ? 30.176  61.280  4.304    1.00 40.00 ? 493 ARG B CA  1 
ATOM 7945  C C   . ARG B 1 489 ? 31.638  60.821  4.593    1.00 40.00 ? 493 ARG B C   1 
ATOM 7946  O O   . ARG B 1 489 ? 32.482  61.549  5.074    1.00 40.00 ? 493 ARG B O   1 
ATOM 7947  C CB  . ARG B 1 489 ? 29.237  60.665  5.309    1.00 40.00 ? 493 ARG B CB  1 
ATOM 7948  N N   . ASP B 1 490 ? 31.874  59.579  4.164    1.00 40.00 ? 494 ASP B N   1 
ATOM 7949  C CA  . ASP B 1 490 ? 33.150  58.910  4.290    1.00 40.00 ? 494 ASP B CA  1 
ATOM 7950  C C   . ASP B 1 490 ? 34.298  59.735  3.752    1.00 40.00 ? 494 ASP B C   1 
ATOM 7951  O O   . ASP B 1 490 ? 34.749  59.527  2.619    1.00 40.00 ? 494 ASP B O   1 
ATOM 7952  C CB  . ASP B 1 490 ? 33.086  57.544  3.592    1.00 40.00 ? 494 ASP B CB  1 
ATOM 7953  N N   . SER B 1 491 ? 34.842  60.641  4.560    1.00 40.00 ? 495 SER B N   1 
ATOM 7954  C CA  . SER B 1 491 ? 35.944  61.516  4.192    1.00 40.00 ? 495 SER B CA  1 
ATOM 7955  C C   . SER B 1 491 ? 37.244  60.739  4.010    1.00 40.00 ? 495 SER B C   1 
ATOM 7956  O O   . SER B 1 491 ? 38.244  60.919  4.712    1.00 40.00 ? 495 SER B O   1 
ATOM 7957  C CB  . SER B 1 491 ? 36.108  62.616  5.238    1.00 40.00 ? 495 SER B CB  1 
ATOM 7958  N N   . LYS B 1 492 ? 37.254  59.874  3.010    1.00 40.00 ? 496 LYS B N   1 
ATOM 7959  C CA  . LYS B 1 492 ? 38.314  58.990  2.637    1.00 40.00 ? 496 LYS B CA  1 
ATOM 7960  C C   . LYS B 1 492 ? 39.530  59.681  2.048    1.00 40.00 ? 496 LYS B C   1 
ATOM 7961  O O   . LYS B 1 492 ? 39.727  59.724  0.826    1.00 40.00 ? 496 LYS B O   1 
ATOM 7962  C CB  . LYS B 1 492 ? 37.738  57.950  1.650    1.00 40.00 ? 496 LYS B CB  1 
ATOM 7963  N N   . SER B 1 493 ? 40.385  60.226  2.908    1.00 40.00 ? 497 SER B N   1 
ATOM 7964  C CA  . SER B 1 493 ? 41.620  60.854  2.447    1.00 40.00 ? 497 SER B CA  1 
ATOM 7965  C C   . SER B 1 493 ? 41.510  62.022  1.515    1.00 40.00 ? 497 SER B C   1 
ATOM 7966  O O   . SER B 1 493 ? 40.921  63.052  1.947    1.00 40.00 ? 497 SER B O   1 
ATOM 7967  C CB  . SER B 1 493 ? 42.605  59.742  2.104    1.00 40.00 ? 497 SER B CB  1 
ATOM 7968  N N   . PRO B 1 494 ? 42.083  62.085  0.316    1.00 40.00 ? 498 PRO B N   1 
ATOM 7969  C CA  . PRO B 1 494 ? 42.098  63.287  -0.509   1.00 40.00 ? 498 PRO B CA  1 
ATOM 7970  C C   . PRO B 1 494 ? 40.766  63.873  -0.892   1.00 40.00 ? 498 PRO B C   1 
ATOM 7971  O O   . PRO B 1 494 ? 39.859  63.162  -1.315   1.00 40.00 ? 498 PRO B O   1 
ATOM 7972  C CB  . PRO B 1 494 ? 43.007  62.951  -1.672   1.00 40.00 ? 498 PRO B CB  1 
ATOM 7973  C CG  . PRO B 1 494 ? 43.795  61.764  -1.231   1.00 40.00 ? 498 PRO B CG  1 
ATOM 7974  C CD  . PRO B 1 494 ? 42.855  60.994  -0.329   1.00 40.00 ? 498 PRO B CD  1 
ATOM 7975  N N   . GLN B 1 495 ? 40.609  65.193  -0.747   1.00 40.00 ? 499 GLN B N   1 
ATOM 7976  C CA  . GLN B 1 495 ? 39.359  65.855  -1.058   1.00 40.00 ? 499 GLN B CA  1 
ATOM 7977  C C   . GLN B 1 495 ? 39.391  66.707  -2.321   1.00 40.00 ? 499 GLN B C   1 
ATOM 7978  O O   . GLN B 1 495 ? 40.448  67.205  -2.721   1.00 40.00 ? 499 GLN B O   1 
ATOM 7979  C CB  . GLN B 1 495 ? 38.890  66.705  0.117    1.00 40.00 ? 499 GLN B CB  1 
ATOM 7980  C CG  . GLN B 1 495 ? 37.423  66.556  0.453    1.00 40.00 ? 499 GLN B CG  1 
ATOM 7981  C CD  . GLN B 1 495 ? 37.011  65.211  0.993    1.00 40.00 ? 499 GLN B CD  1 
ATOM 7982  O OE1 . GLN B 1 495 ? 35.826  65.059  1.347    1.00 40.00 ? 499 GLN B OE1 1 
ATOM 7983  N NE2 . GLN B 1 495 ? 37.894  64.215  1.089    1.00 40.00 ? 499 GLN B NE2 1 
ATOM 7984  N N   . TRP B 1 496 ? 38.223  66.855  -2.964   1.00 40.00 ? 500 TRP B N   1 
ATOM 7985  C CA  . TRP B 1 496 ? 38.148  67.652  -4.190   1.00 40.00 ? 500 TRP B CA  1 
ATOM 7986  C C   . TRP B 1 496 ? 37.394  68.944  -3.873   1.00 40.00 ? 500 TRP B C   1 
ATOM 7987  O O   . TRP B 1 496 ? 36.199  68.933  -3.654   1.00 40.00 ? 500 TRP B O   1 
ATOM 7988  C CB  . TRP B 1 496 ? 37.532  66.888  -5.320   1.00 40.00 ? 500 TRP B CB  1 
ATOM 7989  C CG  . TRP B 1 496 ? 37.277  67.523  -6.647   1.00 40.00 ? 500 TRP B CG  1 
ATOM 7990  C CD1 . TRP B 1 496 ? 37.089  68.842  -6.934   1.00 40.00 ? 500 TRP B CD1 1 
ATOM 7991  C CD2 . TRP B 1 496 ? 37.172  66.846  -7.914   1.00 40.00 ? 500 TRP B CD2 1 
ATOM 7992  N NE1 . TRP B 1 496 ? 36.864  69.030  -8.269   1.00 40.00 ? 500 TRP B NE1 1 
ATOM 7993  C CE2 . TRP B 1 496 ? 36.911  67.819  -8.895   1.00 40.00 ? 500 TRP B CE2 1 
ATOM 7994  C CE3 . TRP B 1 496 ? 37.257  65.500  -8.302   1.00 40.00 ? 500 TRP B CE3 1 
ATOM 7995  C CZ2 . TRP B 1 496 ? 36.741  67.496  -10.239  1.00 40.00 ? 500 TRP B CZ2 1 
ATOM 7996  C CZ3 . TRP B 1 496 ? 37.090  65.178  -9.634   1.00 40.00 ? 500 TRP B CZ3 1 
ATOM 7997  C CH2 . TRP B 1 496 ? 36.835  66.175  -10.584  1.00 40.00 ? 500 TRP B CH2 1 
ATOM 7998  N N   . PRO B 1 497 ? 38.143  70.042  -3.875   1.00 40.00 ? 501 PRO B N   1 
ATOM 7999  C CA  . PRO B 1 497 ? 37.583  71.335  -3.559   1.00 40.00 ? 501 PRO B CA  1 
ATOM 8000  C C   . PRO B 1 497 ? 36.942  72.032  -4.727   1.00 40.00 ? 501 PRO B C   1 
ATOM 8001  O O   . PRO B 1 497 ? 37.461  71.959  -5.843   1.00 40.00 ? 501 PRO B O   1 
ATOM 8002  C CB  . PRO B 1 497 ? 38.836  72.127  -3.149   1.00 40.00 ? 501 PRO B CB  1 
ATOM 8003  C CG  . PRO B 1 497 ? 39.961  71.503  -3.904   1.00 40.00 ? 501 PRO B CG  1 
ATOM 8004  C CD  . PRO B 1 497 ? 39.596  70.075  -4.160   1.00 40.00 ? 501 PRO B CD  1 
ATOM 8005  N N   . PRO B 1 498 ? 35.874  72.776  -4.487   1.00 40.00 ? 502 PRO B N   1 
ATOM 8006  C CA  . PRO B 1 498 ? 35.252  73.551  -5.546   1.00 40.00 ? 502 PRO B CA  1 
ATOM 8007  C C   . PRO B 1 498 ? 36.200  74.547  -6.214   1.00 40.00 ? 502 PRO B C   1 
ATOM 8008  O O   . PRO B 1 498 ? 36.963  75.257  -5.556   1.00 40.00 ? 502 PRO B O   1 
ATOM 8009  C CB  . PRO B 1 498 ? 34.141  74.321  -4.856   1.00 40.00 ? 502 PRO B CB  1 
ATOM 8010  C CG  . PRO B 1 498 ? 33.951  73.684  -3.545   1.00 40.00 ? 502 PRO B CG  1 
ATOM 8011  C CD  . PRO B 1 498 ? 35.206  72.934  -3.197   1.00 40.00 ? 502 PRO B CD  1 
ATOM 8012  N N   . TYR B 1 499 ? 36.146  74.617  -7.545   1.00 40.00 ? 503 TYR B N   1 
ATOM 8013  C CA  . TYR B 1 499 ? 36.946  75.619  -8.256   1.00 40.00 ? 503 TYR B CA  1 
ATOM 8014  C C   . TYR B 1 499 ? 36.290  76.966  -7.856   1.00 40.00 ? 503 TYR B C   1 
ATOM 8015  O O   . TYR B 1 499 ? 35.074  77.078  -7.829   1.00 40.00 ? 503 TYR B O   1 
ATOM 8016  C CB  . TYR B 1 499 ? 36.954  75.443  -9.761   1.00 40.00 ? 503 TYR B CB  1 
ATOM 8017  C CG  . TYR B 1 499 ? 37.649  76.549  -10.526  1.00 40.00 ? 503 TYR B CG  1 
ATOM 8018  C CD1 . TYR B 1 499 ? 36.966  77.740  -10.735  1.00 40.00 ? 503 TYR B CD1 1 
ATOM 8019  C CD2 . TYR B 1 499 ? 38.939  76.418  -11.023  1.00 40.00 ? 503 TYR B CD2 1 
ATOM 8020  C CE1 . TYR B 1 499 ? 37.558  78.783  -11.417  1.00 40.00 ? 503 TYR B CE1 1 
ATOM 8021  C CE2 . TYR B 1 499 ? 39.555  77.449  -11.722  1.00 40.00 ? 503 TYR B CE2 1 
ATOM 8022  C CZ  . TYR B 1 499 ? 38.844  78.623  -11.908  1.00 40.00 ? 503 TYR B CZ  1 
ATOM 8023  O OH  . TYR B 1 499 ? 39.408  79.682  -12.591  1.00 40.00 ? 503 TYR B OH  1 
ATOM 8024  N N   . THR B 1 500 ? 37.113  77.927  -7.520   1.00 40.00 ? 504 THR B N   1 
ATOM 8025  C CA  . THR B 1 500 ? 36.749  79.239  -7.047   1.00 40.00 ? 504 THR B CA  1 
ATOM 8026  C C   . THR B 1 500 ? 37.507  80.351  -7.742   1.00 40.00 ? 504 THR B C   1 
ATOM 8027  O O   . THR B 1 500 ? 38.685  80.170  -8.091   1.00 40.00 ? 504 THR B O   1 
ATOM 8028  C CB  . THR B 1 500 ? 37.197  79.259  -5.540   1.00 40.00 ? 504 THR B CB  1 
ATOM 8029  O OG1 . THR B 1 500 ? 38.273  78.303  -5.357   1.00 40.00 ? 504 THR B OG1 1 
ATOM 8030  C CG2 . THR B 1 500 ? 35.942  78.878  -4.780   1.00 40.00 ? 504 THR B CG2 1 
ATOM 8031  N N   . THR B 1 501 ? 36.869  81.497  -7.913   1.00 40.00 ? 505 THR B N   1 
ATOM 8032  C CA  . THR B 1 501 ? 37.569  82.617  -8.546   1.00 40.00 ? 505 THR B CA  1 
ATOM 8033  C C   . THR B 1 501 ? 38.900  82.862  -7.850   1.00 40.00 ? 505 THR B C   1 
ATOM 8034  O O   . THR B 1 501 ? 39.966  82.785  -8.450   1.00 40.00 ? 505 THR B O   1 
ATOM 8035  C CB  . THR B 1 501 ? 36.691  83.872  -8.481   1.00 40.00 ? 505 THR B CB  1 
ATOM 8036  O OG1 . THR B 1 501 ? 35.481  83.485  -7.797   1.00 40.00 ? 505 THR B OG1 1 
ATOM 8037  C CG2 . THR B 1 501 ? 36.288  84.331  -9.874   1.00 40.00 ? 505 THR B CG2 1 
ATOM 8038  N N   . ALA B 1 502 ? 38.855  83.133  -6.555   1.00 40.00 ? 506 ALA B N   1 
ATOM 8039  C CA  . ALA B 1 502 ? 39.987  83.395  -5.705   1.00 40.00 ? 506 ALA B CA  1 
ATOM 8040  C C   . ALA B 1 502 ? 40.998  82.278  -5.607   1.00 40.00 ? 506 ALA B C   1 
ATOM 8041  O O   . ALA B 1 502 ? 42.190  82.493  -5.904   1.00 40.00 ? 506 ALA B O   1 
ATOM 8042  C CB  . ALA B 1 502 ? 39.527  83.726  -4.286   1.00 40.00 ? 506 ALA B CB  1 
ATOM 8043  N N   . ALA B 1 503 ? 40.604  81.091  -5.160   1.00 40.00 ? 507 ALA B N   1 
ATOM 8044  C CA  . ALA B 1 503 ? 41.683  80.094  -5.065   1.00 40.00 ? 507 ALA B CA  1 
ATOM 8045  C C   . ALA B 1 503 ? 41.968  79.398  -6.376   1.00 40.00 ? 507 ALA B C   1 
ATOM 8046  O O   . ALA B 1 503 ? 43.115  78.955  -6.514   1.00 40.00 ? 507 ALA B O   1 
ATOM 8047  C CB  . ALA B 1 503 ? 41.476  79.112  -3.948   1.00 40.00 ? 507 ALA B CB  1 
ATOM 8048  N N   . GLN B 1 504 ? 40.976  79.270  -7.263   1.00 40.00 ? 508 GLN B N   1 
ATOM 8049  C CA  . GLN B 1 504 ? 41.182  78.613  -8.541   1.00 40.00 ? 508 GLN B CA  1 
ATOM 8050  C C   . GLN B 1 504 ? 41.678  77.181  -8.410   1.00 40.00 ? 508 GLN B C   1 
ATOM 8051  O O   . GLN B 1 504 ? 42.685  76.774  -9.012   1.00 40.00 ? 508 GLN B O   1 
ATOM 8052  C CB  . GLN B 1 504 ? 42.246  79.420  -9.303   1.00 40.00 ? 508 GLN B CB  1 
ATOM 8053  C CG  . GLN B 1 504 ? 41.771  80.843  -9.571   1.00 40.00 ? 508 GLN B CG  1 
ATOM 8054  C CD  . GLN B 1 504 ? 42.683  81.527  -10.580  1.00 40.00 ? 508 GLN B CD  1 
ATOM 8055  O OE1 . GLN B 1 504 ? 43.381  80.883  -11.381  1.00 40.00 ? 508 GLN B OE1 1 
ATOM 8056  N NE2 . GLN B 1 504 ? 42.670  82.858  -10.533  1.00 40.00 ? 508 GLN B NE2 1 
ATOM 8057  N N   . GLN B 1 505 ? 40.952  76.400  -7.615   1.00 40.00 ? 509 GLN B N   1 
ATOM 8058  C CA  . GLN B 1 505 ? 41.365  75.017  -7.396   1.00 40.00 ? 509 GLN B CA  1 
ATOM 8059  C C   . GLN B 1 505 ? 40.784  73.986  -8.348   1.00 40.00 ? 509 GLN B C   1 
ATOM 8060  O O   . GLN B 1 505 ? 39.592  73.952  -8.650   1.00 40.00 ? 509 GLN B O   1 
ATOM 8061  C CB  . GLN B 1 505 ? 40.938  74.658  -5.951   1.00 40.00 ? 509 GLN B CB  1 
ATOM 8062  C CG  . GLN B 1 505 ? 41.232  75.814  -4.993   1.00 40.00 ? 509 GLN B CG  1 
ATOM 8063  C CD  . GLN B 1 505 ? 41.382  75.346  -3.557   1.00 40.00 ? 509 GLN B CD  1 
ATOM 8064  O OE1 . GLN B 1 505 ? 40.549  75.731  -2.732   1.00 40.00 ? 509 GLN B OE1 1 
ATOM 8065  N NE2 . GLN B 1 505 ? 42.409  74.548  -3.260   1.00 40.00 ? 509 GLN B NE2 1 
ATOM 8066  N N   . TYR B 1 506 ? 41.660  73.077  -8.750   1.00 40.00 ? 510 TYR B N   1 
ATOM 8067  C CA  . TYR B 1 506 ? 41.310  71.974  -9.645   1.00 40.00 ? 510 TYR B CA  1 
ATOM 8068  C C   . TYR B 1 506 ? 42.159  70.772  -9.249   1.00 40.00 ? 510 TYR B C   1 
ATOM 8069  O O   . TYR B 1 506 ? 43.148  70.970  -8.517   1.00 40.00 ? 510 TYR B O   1 
ATOM 8070  C CB  . TYR B 1 506 ? 41.530  72.414  -11.084  1.00 40.00 ? 510 TYR B CB  1 
ATOM 8071  C CG  . TYR B 1 506 ? 42.964  72.489  -11.549  1.00 40.00 ? 510 TYR B CG  1 
ATOM 8072  C CD1 . TYR B 1 506 ? 43.644  71.353  -11.962  1.00 40.00 ? 510 TYR B CD1 1 
ATOM 8073  C CD2 . TYR B 1 506 ? 43.648  73.692  -11.601  1.00 40.00 ? 510 TYR B CD2 1 
ATOM 8074  C CE1 . TYR B 1 506 ? 44.949  71.400  -12.397  1.00 40.00 ? 510 TYR B CE1 1 
ATOM 8075  C CE2 . TYR B 1 506 ? 44.954  73.755  -12.032  1.00 40.00 ? 510 TYR B CE2 1 
ATOM 8076  C CZ  . TYR B 1 506 ? 45.607  72.612  -12.430  1.00 40.00 ? 510 TYR B CZ  1 
ATOM 8077  O OH  . TYR B 1 506 ? 46.914  72.663  -12.860  1.00 40.00 ? 510 TYR B OH  1 
ATOM 8078  N N   . VAL B 1 507 ? 41.843  69.566  -9.689   1.00 40.00 ? 511 VAL B N   1 
ATOM 8079  C CA  . VAL B 1 507 ? 42.577  68.390  -9.238   1.00 40.00 ? 511 VAL B CA  1 
ATOM 8080  C C   . VAL B 1 507 ? 43.191  67.530  -10.304  1.00 40.00 ? 511 VAL B C   1 
ATOM 8081  O O   . VAL B 1 507 ? 42.655  67.452  -11.416  1.00 40.00 ? 511 VAL B O   1 
ATOM 8082  C CB  . VAL B 1 507 ? 41.533  67.479  -8.508   1.00 40.00 ? 511 VAL B CB  1 
ATOM 8083  C CG1 . VAL B 1 507 ? 41.085  68.098  -7.194   1.00 40.00 ? 511 VAL B CG1 1 
ATOM 8084  C CG2 . VAL B 1 507 ? 40.310  67.255  -9.396   1.00 40.00 ? 511 VAL B CG2 1 
ATOM 8085  N N   . SER B 1 508 ? 44.263  66.821  -9.979   1.00 40.00 ? 512 SER B N   1 
ATOM 8086  C CA  . SER B 1 508 ? 44.867  65.955  -10.983  1.00 40.00 ? 512 SER B CA  1 
ATOM 8087  C C   . SER B 1 508 ? 44.164  64.603  -10.978  1.00 40.00 ? 512 SER B C   1 
ATOM 8088  O O   . SER B 1 508 ? 44.295  63.814  -10.029  1.00 40.00 ? 512 SER B O   1 
ATOM 8089  C CB  . SER B 1 508 ? 46.361  65.839  -10.770  1.00 40.00 ? 512 SER B CB  1 
ATOM 8090  O OG  . SER B 1 508 ? 46.799  64.524  -11.073  1.00 40.00 ? 512 SER B OG  1 
ATOM 8091  N N   . LEU B 1 509 ? 43.381  64.339  -12.028  1.00 40.00 ? 513 LEU B N   1 
ATOM 8092  C CA  . LEU B 1 509 ? 42.699  63.054  -12.174  1.00 40.00 ? 513 LEU B CA  1 
ATOM 8093  C C   . LEU B 1 509 ? 43.716  62.109  -12.821  1.00 40.00 ? 513 LEU B C   1 
ATOM 8094  O O   . LEU B 1 509 ? 43.983  62.162  -14.019  1.00 40.00 ? 513 LEU B O   1 
ATOM 8095  C CB  . LEU B 1 509 ? 41.471  63.144  -13.054  1.00 40.00 ? 513 LEU B CB  1 
ATOM 8096  C CG  . LEU B 1 509 ? 40.107  63.203  -12.390  1.00 40.00 ? 513 LEU B CG  1 
ATOM 8097  C CD1 . LEU B 1 509 ? 39.771  61.870  -11.728  1.00 40.00 ? 513 LEU B CD1 1 
ATOM 8098  C CD2 . LEU B 1 509 ? 40.010  64.304  -11.336  1.00 40.00 ? 513 LEU B CD2 1 
ATOM 8099  N N   . ASN B 1 510 ? 44.338  61.273  -12.006  1.00 40.00 ? 514 ASN B N   1 
ATOM 8100  C CA  . ASN B 1 510 ? 45.318  60.327  -12.574  1.00 40.00 ? 514 ASN B CA  1 
ATOM 8101  C C   . ASN B 1 510 ? 45.578  59.224  -11.549  1.00 40.00 ? 514 ASN B C   1 
ATOM 8102  O O   . ASN B 1 510 ? 45.051  59.265  -10.429  1.00 40.00 ? 514 ASN B O   1 
ATOM 8103  C CB  . ASN B 1 510 ? 46.553  61.063  -13.039  1.00 40.00 ? 514 ASN B CB  1 
ATOM 8104  C CG  . ASN B 1 510 ? 47.828  60.592  -12.345  1.00 40.00 ? 514 ASN B CG  1 
ATOM 8105  O OD1 . ASN B 1 510 ? 48.413  59.600  -12.816  1.00 40.00 ? 514 ASN B OD1 1 
ATOM 8106  N ND2 . ASN B 1 510 ? 48.170  61.271  -11.263  1.00 40.00 ? 514 ASN B ND2 1 
ATOM 8107  N N   . LEU B 1 511 ? 46.371  58.238  -11.930  1.00 40.00 ? 515 LEU B N   1 
ATOM 8108  C CA  . LEU B 1 511 ? 46.789  57.113  -11.144  1.00 40.00 ? 515 LEU B CA  1 
ATOM 8109  C C   . LEU B 1 511 ? 47.143  57.406  -9.699   1.00 40.00 ? 515 LEU B C   1 
ATOM 8110  O O   . LEU B 1 511 ? 46.723  56.661  -8.805   1.00 40.00 ? 515 LEU B O   1 
ATOM 8111  C CB  . LEU B 1 511 ? 47.975  56.421  -11.854  1.00 40.00 ? 515 LEU B CB  1 
ATOM 8112  C CG  . LEU B 1 511 ? 47.567  55.649  -13.121  1.00 40.00 ? 515 LEU B CG  1 
ATOM 8113  C CD1 . LEU B 1 511 ? 48.499  54.490  -13.438  1.00 40.00 ? 515 LEU B CD1 1 
ATOM 8114  C CD2 . LEU B 1 511 ? 46.132  55.109  -13.025  1.00 40.00 ? 515 LEU B CD2 1 
ATOM 8115  N N   . LYS B 1 512 ? 47.911  58.448  -9.424   1.00 40.00 ? 516 LYS B N   1 
ATOM 8116  C CA  . LYS B 1 512 ? 48.245  58.869  -8.064   1.00 40.00 ? 516 LYS B CA  1 
ATOM 8117  C C   . LYS B 1 512 ? 47.005  59.586  -7.525   1.00 40.00 ? 516 LYS B C   1 
ATOM 8118  O O   . LYS B 1 512 ? 46.265  60.208  -8.287   1.00 40.00 ? 516 LYS B O   1 
ATOM 8119  C CB  . LYS B 1 512 ? 49.462  59.768  -8.036   1.00 40.00 ? 516 LYS B CB  1 
ATOM 8120  C CG  . LYS B 1 512 ? 50.799  59.069  -8.024   1.00 40.00 ? 516 LYS B CG  1 
ATOM 8121  C CD  . LYS B 1 512 ? 50.914  57.894  -8.968   1.00 40.00 ? 516 LYS B CD  1 
ATOM 8122  C CE  . LYS B 1 512 ? 50.661  56.559  -8.278   1.00 40.00 ? 516 LYS B CE  1 
ATOM 8123  N NZ  . LYS B 1 512 ? 50.445  55.424  -9.222   1.00 40.00 ? 516 LYS B NZ  1 
ATOM 8124  N N   . PRO B 1 513 ? 46.747  59.477  -6.241   1.00 40.00 ? 517 PRO B N   1 
ATOM 8125  C CA  . PRO B 1 513 ? 45.583  60.061  -5.616   1.00 40.00 ? 517 PRO B CA  1 
ATOM 8126  C C   . PRO B 1 513 ? 45.375  61.526  -5.925   1.00 40.00 ? 517 PRO B C   1 
ATOM 8127  O O   . PRO B 1 513 ? 46.304  62.217  -6.327   1.00 40.00 ? 517 PRO B O   1 
ATOM 8128  C CB  . PRO B 1 513 ? 45.820  59.895  -4.115   1.00 40.00 ? 517 PRO B CB  1 
ATOM 8129  C CG  . PRO B 1 513 ? 46.843  58.829  -3.986   1.00 40.00 ? 517 PRO B CG  1 
ATOM 8130  C CD  . PRO B 1 513 ? 47.601  58.736  -5.273   1.00 40.00 ? 517 PRO B CD  1 
ATOM 8131  N N   . LEU B 1 514 ? 44.151  62.000  -5.699   1.00 40.00 ? 518 LEU B N   1 
ATOM 8132  C CA  . LEU B 1 514 ? 43.861  63.403  -5.935   1.00 40.00 ? 518 LEU B CA  1 
ATOM 8133  C C   . LEU B 1 514 ? 45.014  64.287  -5.471   1.00 40.00 ? 518 LEU B C   1 
ATOM 8134  O O   . LEU B 1 514 ? 45.631  64.048  -4.441   1.00 40.00 ? 518 LEU B O   1 
ATOM 8135  C CB  . LEU B 1 514 ? 42.593  63.875  -5.238   1.00 40.00 ? 518 LEU B CB  1 
ATOM 8136  C CG  . LEU B 1 514 ? 41.317  63.849  -6.081   1.00 40.00 ? 518 LEU B CG  1 
ATOM 8137  C CD1 . LEU B 1 514 ? 40.258  64.756  -5.473   1.00 40.00 ? 518 LEU B CD1 1 
ATOM 8138  C CD2 . LEU B 1 514 ? 41.604  64.243  -7.523   1.00 40.00 ? 518 LEU B CD2 1 
ATOM 8139  N N   . GLU B 1 515 ? 45.285  65.326  -6.253   1.00 40.00 ? 519 GLU B N   1 
ATOM 8140  C CA  . GLU B 1 515 ? 46.372  66.255  -5.936   1.00 40.00 ? 519 GLU B CA  1 
ATOM 8141  C C   . GLU B 1 515 ? 46.001  67.685  -6.286   1.00 40.00 ? 519 GLU B C   1 
ATOM 8142  O O   . GLU B 1 515 ? 46.451  68.189  -7.318   1.00 40.00 ? 519 GLU B O   1 
ATOM 8143  C CB  . GLU B 1 515 ? 47.628  65.815  -6.689   1.00 40.00 ? 519 GLU B CB  1 
ATOM 8144  C CG  . GLU B 1 515 ? 48.856  66.631  -6.350   1.00 40.00 ? 519 GLU B CG  1 
ATOM 8145  C CD  . GLU B 1 515 ? 49.885  66.610  -7.467   1.00 40.00 ? 519 GLU B CD  1 
ATOM 8146  O OE1 . GLU B 1 515 ? 50.432  65.516  -7.741   1.00 40.00 ? 519 GLU B OE1 1 
ATOM 8147  O OE2 . GLU B 1 515 ? 50.123  67.688  -8.049   1.00 40.00 ? 519 GLU B OE2 1 
ATOM 8148  N N   . VAL B 1 516 ? 45.208  68.375  -5.473   1.00 40.00 ? 520 VAL B N   1 
ATOM 8149  C CA  . VAL B 1 516 ? 44.778  69.718  -5.761   1.00 40.00 ? 520 VAL B CA  1 
ATOM 8150  C C   . VAL B 1 516 ? 45.852  70.693  -6.252   1.00 40.00 ? 520 VAL B C   1 
ATOM 8151  O O   . VAL B 1 516 ? 46.970  70.740  -5.758   1.00 40.00 ? 520 VAL B O   1 
ATOM 8152  C CB  . VAL B 1 516 ? 44.026  70.422  -4.620   1.00 40.00 ? 520 VAL B CB  1 
ATOM 8153  C CG1 . VAL B 1 516 ? 43.423  71.734  -5.152   1.00 40.00 ? 520 VAL B CG1 1 
ATOM 8154  C CG2 . VAL B 1 516 ? 42.935  69.560  -4.036   1.00 40.00 ? 520 VAL B CG2 1 
ATOM 8155  N N   . ARG B 1 517 ? 45.451  71.484  -7.277   1.00 40.00 ? 521 ARG B N   1 
ATOM 8156  C CA  . ARG B 1 517 ? 46.304  72.494  -7.879   1.00 40.00 ? 521 ARG B CA  1 
ATOM 8157  C C   . ARG B 1 517 ? 45.576  73.823  -8.038   1.00 40.00 ? 521 ARG B C   1 
ATOM 8158  O O   . ARG B 1 517 ? 44.345  73.853  -7.869   1.00 40.00 ? 521 ARG B O   1 
ATOM 8159  C CB  . ARG B 1 517 ? 46.852  72.041  -9.215   1.00 40.00 ? 521 ARG B CB  1 
ATOM 8160  C CG  . ARG B 1 517 ? 47.762  70.825  -9.161   1.00 40.00 ? 521 ARG B CG  1 
ATOM 8161  C CD  . ARG B 1 517 ? 47.962  70.268  -10.545  1.00 40.00 ? 521 ARG B CD  1 
ATOM 8162  N NE  . ARG B 1 517 ? 48.406  68.885  -10.619  1.00 40.00 ? 521 ARG B NE  1 
ATOM 8163  C CZ  . ARG B 1 517 ? 48.753  68.270  -11.761  1.00 40.00 ? 521 ARG B CZ  1 
ATOM 8164  N NH1 . ARG B 1 517 ? 48.702  68.912  -12.938  1.00 40.00 ? 521 ARG B NH1 1 
ATOM 8165  N NH2 . ARG B 1 517 ? 49.150  67.002  -11.735  1.00 40.00 ? 521 ARG B NH2 1 
ATOM 8166  N N   . ARG B 1 518 ? 46.325  74.908  -8.282   1.00 40.00 ? 522 ARG B N   1 
ATOM 8167  C CA  . ARG B 1 518 ? 45.673  76.210  -8.437   1.00 40.00 ? 522 ARG B CA  1 
ATOM 8168  C C   . ARG B 1 518 ? 46.004  76.869  -9.779   1.00 40.00 ? 522 ARG B C   1 
ATOM 8169  O O   . ARG B 1 518 ? 47.140  76.858  -10.259  1.00 40.00 ? 522 ARG B O   1 
ATOM 8170  C CB  . ARG B 1 518 ? 45.938  77.193  -7.303   1.00 40.00 ? 522 ARG B CB  1 
ATOM 8171  C CG  . ARG B 1 518 ? 46.019  76.618  -5.922   1.00 40.00 ? 522 ARG B CG  1 
ATOM 8172  C CD  . ARG B 1 518 ? 46.090  77.595  -4.793   1.00 40.00 ? 522 ARG B CD  1 
ATOM 8173  N NE  . ARG B 1 518 ? 45.173  78.722  -4.909   1.00 40.00 ? 522 ARG B NE  1 
ATOM 8174  C CZ  . ARG B 1 518 ? 45.574  79.964  -4.609   1.00 40.00 ? 522 ARG B CZ  1 
ATOM 8175  N NH1 . ARG B 1 518 ? 46.832  80.155  -4.212   1.00 40.00 ? 522 ARG B NH1 1 
ATOM 8176  N NH2 . ARG B 1 518 ? 44.715  80.968  -4.724   1.00 40.00 ? 522 ARG B NH2 1 
ATOM 8177  N N   . GLY B 1 519 ? 44.971  77.459  -10.377  1.00 40.00 ? 523 GLY B N   1 
ATOM 8178  C CA  . GLY B 1 519 ? 45.104  78.129  -11.655  1.00 40.00 ? 523 GLY B CA  1 
ATOM 8179  C C   . GLY B 1 519 ? 45.234  77.187  -12.839  1.00 40.00 ? 523 GLY B C   1 
ATOM 8180  O O   . GLY B 1 519 ? 46.228  76.454  -12.990  1.00 40.00 ? 523 GLY B O   1 
ATOM 8181  N N   . LEU B 1 520 ? 44.206  77.200  -13.688  1.00 40.00 ? 524 LEU B N   1 
ATOM 8182  C CA  . LEU B 1 520 ? 44.257  76.337  -14.890  1.00 40.00 ? 524 LEU B CA  1 
ATOM 8183  C C   . LEU B 1 520 ? 44.948  77.185  -15.953  1.00 40.00 ? 524 LEU B C   1 
ATOM 8184  O O   . LEU B 1 520 ? 44.360  78.225  -16.306  1.00 40.00 ? 524 LEU B O   1 
ATOM 8185  C CB  . LEU B 1 520 ? 42.846  76.061  -15.335  1.00 40.00 ? 524 LEU B CB  1 
ATOM 8186  C CG  . LEU B 1 520 ? 42.360  74.631  -15.517  1.00 40.00 ? 524 LEU B CG  1 
ATOM 8187  C CD1 . LEU B 1 520 ? 41.046  74.697  -16.281  1.00 40.00 ? 524 LEU B CD1 1 
ATOM 8188  C CD2 . LEU B 1 520 ? 43.385  73.766  -16.224  1.00 40.00 ? 524 LEU B CD2 1 
ATOM 8189  N N   . ARG B 1 521 ? 46.165  76.850  -16.312  1.00 40.00 ? 525 ARG B N   1 
ATOM 8190  C CA  . ARG B 1 521 ? 46.935  77.652  -17.274  1.00 40.00 ? 525 ARG B CA  1 
ATOM 8191  C C   . ARG B 1 521 ? 46.719  79.140  -17.094  1.00 40.00 ? 525 ARG B C   1 
ATOM 8192  O O   . ARG B 1 521 ? 46.648  79.883  -18.080  1.00 40.00 ? 525 ARG B O   1 
ATOM 8193  C CB  . ARG B 1 521 ? 46.579  77.183  -18.698  1.00 40.00 ? 525 ARG B CB  1 
ATOM 8194  C CG  . ARG B 1 521 ? 46.975  75.726  -18.917  1.00 40.00 ? 525 ARG B CG  1 
ATOM 8195  C CD  . ARG B 1 521 ? 48.209  75.675  -19.777  1.00 40.00 ? 525 ARG B CD  1 
ATOM 8196  N NE  . ARG B 1 521 ? 48.323  74.600  -20.731  1.00 40.00 ? 525 ARG B NE  1 
ATOM 8197  C CZ  . ARG B 1 521 ? 48.102  73.299  -20.588  1.00 40.00 ? 525 ARG B CZ  1 
ATOM 8198  N NH1 . ARG B 1 521 ? 47.689  72.779  -19.433  1.00 40.00 ? 525 ARG B NH1 1 
ATOM 8199  N NH2 . ARG B 1 521 ? 48.301  72.465  -21.612  1.00 40.00 ? 525 ARG B NH2 1 
ATOM 8200  N N   . ALA B 1 522 ? 46.649  79.660  -15.888  1.00 40.00 ? 526 ALA B N   1 
ATOM 8201  C CA  . ALA B 1 522 ? 46.361  81.018  -15.527  1.00 40.00 ? 526 ALA B CA  1 
ATOM 8202  C C   . ALA B 1 522 ? 46.942  82.123  -16.382  1.00 40.00 ? 526 ALA B C   1 
ATOM 8203  O O   . ALA B 1 522 ? 46.184  83.024  -16.797  1.00 40.00 ? 526 ALA B O   1 
ATOM 8204  C CB  . ALA B 1 522 ? 46.670  81.247  -14.067  1.00 40.00 ? 526 ALA B CB  1 
ATOM 8205  N N   . GLN B 1 523 ? 48.234  82.131  -16.664  1.00 40.00 ? 527 GLN B N   1 
ATOM 8206  C CA  . GLN B 1 523 ? 48.800  83.175  -17.496  1.00 40.00 ? 527 GLN B CA  1 
ATOM 8207  C C   . GLN B 1 523 ? 48.253  83.061  -18.917  1.00 40.00 ? 527 GLN B C   1 
ATOM 8208  O O   . GLN B 1 523 ? 47.578  83.924  -19.442  1.00 40.00 ? 527 GLN B O   1 
ATOM 8209  C CB  . GLN B 1 523 ? 50.329  82.974  -17.621  1.00 40.00 ? 527 GLN B CB  1 
ATOM 8210  C CG  . GLN B 1 523 ? 51.067  83.872  -16.610  1.00 40.00 ? 527 GLN B CG  1 
ATOM 8211  C CD  . GLN B 1 523 ? 50.919  83.252  -15.224  1.00 40.00 ? 527 GLN B CD  1 
ATOM 8212  O OE1 . GLN B 1 523 ? 50.566  82.063  -15.106  1.00 40.00 ? 527 GLN B OE1 1 
ATOM 8213  N NE2 . GLN B 1 523 ? 51.181  84.013  -14.184  1.00 40.00 ? 527 GLN B NE2 1 
ATOM 8214  N N   . THR B 1 524 ? 48.597  81.879  -19.464  1.00 40.00 ? 528 THR B N   1 
ATOM 8215  C CA  . THR B 1 524 ? 48.220  81.512  -20.806  1.00 40.00 ? 528 THR B CA  1 
ATOM 8216  C C   . THR B 1 524 ? 46.759  81.821  -21.090  1.00 40.00 ? 528 THR B C   1 
ATOM 8217  O O   . THR B 1 524 ? 46.449  82.444  -22.106  1.00 40.00 ? 528 THR B O   1 
ATOM 8218  C CB  . THR B 1 524 ? 48.464  80.020  -21.076  1.00 40.00 ? 528 THR B CB  1 
ATOM 8219  O OG1 . THR B 1 524 ? 49.877  79.800  -20.920  1.00 40.00 ? 528 THR B OG1 1 
ATOM 8220  C CG2 . THR B 1 524 ? 48.085  79.691  -22.530  1.00 40.00 ? 528 THR B CG2 1 
ATOM 8221  N N   . CYS B 1 525 ? 45.889  81.418  -20.158  1.00 40.00 ? 529 CYS B N   1 
ATOM 8222  C CA  . CYS B 1 525 ? 44.483  81.668  -20.368  1.00 40.00 ? 529 CYS B CA  1 
ATOM 8223  C C   . CYS B 1 525 ? 44.155  83.117  -20.162  1.00 40.00 ? 529 CYS B C   1 
ATOM 8224  O O   . CYS B 1 525 ? 43.117  83.597  -20.676  1.00 40.00 ? 529 CYS B O   1 
ATOM 8225  C CB  . CYS B 1 525 ? 43.606  80.681  -19.629  1.00 40.00 ? 529 CYS B CB  1 
ATOM 8226  S SG  . CYS B 1 525 ? 43.852  78.962  -20.199  1.00 40.00 ? 529 CYS B SG  1 
ATOM 8227  N N   . ALA B 1 526 ? 45.054  83.851  -19.493  1.00 40.00 ? 530 ALA B N   1 
ATOM 8228  C CA  . ALA B 1 526 ? 44.739  85.301  -19.362  1.00 40.00 ? 530 ALA B CA  1 
ATOM 8229  C C   . ALA B 1 526 ? 45.005  85.895  -20.746  1.00 40.00 ? 530 ALA B C   1 
ATOM 8230  O O   . ALA B 1 526 ? 44.281  86.749  -21.233  1.00 40.00 ? 530 ALA B O   1 
ATOM 8231  C CB  . ALA B 1 526 ? 45.577  85.962  -18.313  1.00 40.00 ? 530 ALA B CB  1 
ATOM 8232  N N   . PHE B 1 527 ? 46.058  85.349  -21.370  1.00 40.00 ? 531 PHE B N   1 
ATOM 8233  C CA  . PHE B 1 527 ? 46.426  85.769  -22.695  1.00 40.00 ? 531 PHE B CA  1 
ATOM 8234  C C   . PHE B 1 527 ? 45.228  85.689  -23.655  1.00 40.00 ? 531 PHE B C   1 
ATOM 8235  O O   . PHE B 1 527 ? 44.855  86.688  -24.280  1.00 40.00 ? 531 PHE B O   1 
ATOM 8236  C CB  . PHE B 1 527 ? 47.554  84.857  -23.195  1.00 40.00 ? 531 PHE B CB  1 
ATOM 8237  C CG  . PHE B 1 527 ? 47.898  85.074  -24.639  1.00 40.00 ? 531 PHE B CG  1 
ATOM 8238  C CD1 . PHE B 1 527 ? 48.076  86.344  -25.153  1.00 40.00 ? 531 PHE B CD1 1 
ATOM 8239  C CD2 . PHE B 1 527 ? 48.012  84.000  -25.490  1.00 40.00 ? 531 PHE B CD2 1 
ATOM 8240  C CE1 . PHE B 1 527 ? 48.365  86.533  -26.491  1.00 40.00 ? 531 PHE B CE1 1 
ATOM 8241  C CE2 . PHE B 1 527 ? 48.308  84.188  -26.823  1.00 40.00 ? 531 PHE B CE2 1 
ATOM 8242  C CZ  . PHE B 1 527 ? 48.490  85.461  -27.331  1.00 40.00 ? 531 PHE B CZ  1 
ATOM 8243  N N   . TRP B 1 528 ? 44.709  84.461  -23.736  1.00 40.00 ? 532 TRP B N   1 
ATOM 8244  C CA  . TRP B 1 528 ? 43.616  84.099  -24.597  1.00 40.00 ? 532 TRP B CA  1 
ATOM 8245  C C   . TRP B 1 528 ? 42.293  84.721  -24.172  1.00 40.00 ? 532 TRP B C   1 
ATOM 8246  O O   . TRP B 1 528 ? 41.616  85.383  -24.983  1.00 40.00 ? 532 TRP B O   1 
ATOM 8247  C CB  . TRP B 1 528 ? 43.440  82.595  -24.656  1.00 40.00 ? 532 TRP B CB  1 
ATOM 8248  C CG  . TRP B 1 528 ? 44.522  81.817  -25.313  1.00 40.00 ? 532 TRP B CG  1 
ATOM 8249  C CD1 . TRP B 1 528 ? 45.469  81.026  -24.699  1.00 40.00 ? 532 TRP B CD1 1 
ATOM 8250  C CD2 . TRP B 1 528 ? 44.786  81.695  -26.714  1.00 40.00 ? 532 TRP B CD2 1 
ATOM 8251  N NE1 . TRP B 1 528 ? 46.298  80.445  -25.636  1.00 40.00 ? 532 TRP B NE1 1 
ATOM 8252  C CE2 . TRP B 1 528 ? 45.892  80.838  -26.874  1.00 40.00 ? 532 TRP B CE2 1 
ATOM 8253  C CE3 . TRP B 1 528 ? 44.183  82.235  -27.860  1.00 40.00 ? 532 TRP B CE3 1 
ATOM 8254  C CZ2 . TRP B 1 528 ? 46.403  80.517  -28.122  1.00 40.00 ? 532 TRP B CZ2 1 
ATOM 8255  C CZ3 . TRP B 1 528 ? 44.697  81.918  -29.097  1.00 40.00 ? 532 TRP B CZ3 1 
ATOM 8256  C CH2 . TRP B 1 528 ? 45.808  81.068  -29.231  1.00 40.00 ? 532 TRP B CH2 1 
ATOM 8257  N N   . ASN B 1 529 ? 41.912  84.512  -22.905  1.00 40.00 ? 533 ASN B N   1 
ATOM 8258  C CA  . ASN B 1 529 ? 40.607  85.042  -22.511  1.00 40.00 ? 533 ASN B CA  1 
ATOM 8259  C C   . ASN B 1 529 ? 40.576  86.525  -22.292  1.00 40.00 ? 533 ASN B C   1 
ATOM 8260  O O   . ASN B 1 529 ? 39.495  87.111  -22.498  1.00 40.00 ? 533 ASN B O   1 
ATOM 8261  C CB  . ASN B 1 529 ? 40.026  84.315  -21.303  1.00 40.00 ? 533 ASN B CB  1 
ATOM 8262  C CG  . ASN B 1 529 ? 40.255  82.814  -21.385  1.00 40.00 ? 533 ASN B CG  1 
ATOM 8263  O OD1 . ASN B 1 529 ? 40.378  82.209  -22.458  1.00 40.00 ? 533 ASN B OD1 1 
ATOM 8264  N ND2 . ASN B 1 529 ? 40.331  82.222  -20.194  1.00 40.00 ? 533 ASN B ND2 1 
ATOM 8265  N N   . ARG B 1 530 ? 41.674  87.170  -21.892  1.00 40.00 ? 534 ARG B N   1 
ATOM 8266  C CA  . ARG B 1 530 ? 41.577  88.613  -21.644  1.00 40.00 ? 534 ARG B CA  1 
ATOM 8267  C C   . ARG B 1 530 ? 42.154  89.506  -22.738  1.00 40.00 ? 534 ARG B C   1 
ATOM 8268  O O   . ARG B 1 530 ? 41.463  90.432  -23.186  1.00 40.00 ? 534 ARG B O   1 
ATOM 8269  C CB  . ARG B 1 530 ? 42.274  89.036  -20.364  1.00 40.00 ? 534 ARG B CB  1 
ATOM 8270  C CG  . ARG B 1 530 ? 41.890  88.432  -19.051  1.00 40.00 ? 534 ARG B CG  1 
ATOM 8271  C CD  . ARG B 1 530 ? 41.970  89.455  -17.920  1.00 40.00 ? 534 ARG B CD  1 
ATOM 8272  N NE  . ARG B 1 530 ? 41.321  89.067  -16.687  1.00 40.00 ? 534 ARG B NE  1 
ATOM 8273  C CZ  . ARG B 1 530 ? 41.400  87.852  -16.141  1.00 40.00 ? 534 ARG B CZ  1 
ATOM 8274  N NH1 . ARG B 1 530 ? 42.072  86.835  -16.670  1.00 40.00 ? 534 ARG B NH1 1 
ATOM 8275  N NH2 . ARG B 1 530 ? 40.746  87.686  -14.994  1.00 40.00 ? 534 ARG B NH2 1 
ATOM 8276  N N   . PHE B 1 531 ? 43.394  89.319  -23.118  1.00 40.00 ? 535 PHE B N   1 
ATOM 8277  C CA  . PHE B 1 531 ? 44.068  90.188  -24.056  1.00 40.00 ? 535 PHE B CA  1 
ATOM 8278  C C   . PHE B 1 531 ? 43.830  89.952  -25.525  1.00 40.00 ? 535 PHE B C   1 
ATOM 8279  O O   . PHE B 1 531 ? 43.374  90.797  -26.323  1.00 40.00 ? 535 PHE B O   1 
ATOM 8280  C CB  . PHE B 1 531 ? 45.592  90.008  -23.772  1.00 40.00 ? 535 PHE B CB  1 
ATOM 8281  C CG  . PHE B 1 531 ? 46.430  90.809  -24.721  1.00 40.00 ? 535 PHE B CG  1 
ATOM 8282  C CD1 . PHE B 1 531 ? 46.192  92.169  -24.885  1.00 40.00 ? 535 PHE B CD1 1 
ATOM 8283  C CD2 . PHE B 1 531 ? 47.439  90.199  -25.450  1.00 40.00 ? 535 PHE B CD2 1 
ATOM 8284  C CE1 . PHE B 1 531 ? 46.918  92.932  -25.744  1.00 40.00 ? 535 PHE B CE1 1 
ATOM 8285  C CE2 . PHE B 1 531 ? 48.205  90.956  -26.333  1.00 40.00 ? 535 PHE B CE2 1 
ATOM 8286  C CZ  . PHE B 1 531 ? 47.927  92.309  -26.472  1.00 40.00 ? 535 PHE B CZ  1 
ATOM 8287  N N   . LEU B 1 532 ? 44.092  88.698  -25.957  1.00 40.00 ? 536 LEU B N   1 
ATOM 8288  C CA  . LEU B 1 532 ? 43.945  88.296  -27.350  1.00 40.00 ? 536 LEU B CA  1 
ATOM 8289  C C   . LEU B 1 532 ? 42.732  88.835  -28.058  1.00 40.00 ? 536 LEU B C   1 
ATOM 8290  O O   . LEU B 1 532 ? 42.841  89.395  -29.143  1.00 40.00 ? 536 LEU B O   1 
ATOM 8291  C CB  . LEU B 1 532 ? 44.065  86.822  -27.578  1.00 40.00 ? 536 LEU B CB  1 
ATOM 8292  C CG  . LEU B 1 532 ? 44.934  86.376  -28.753  1.00 40.00 ? 536 LEU B CG  1 
ATOM 8293  C CD1 . LEU B 1 532 ? 44.135  85.383  -29.595  1.00 40.00 ? 536 LEU B CD1 1 
ATOM 8294  C CD2 . LEU B 1 532 ? 45.480  87.531  -29.540  1.00 40.00 ? 536 LEU B CD2 1 
ATOM 8295  N N   . PRO B 1 533 ? 41.566  88.689  -27.458  1.00 40.00 ? 537 PRO B N   1 
ATOM 8296  C CA  . PRO B 1 533 ? 40.332  89.237  -27.978  1.00 40.00 ? 537 PRO B CA  1 
ATOM 8297  C C   . PRO B 1 533 ? 40.471  90.722  -28.248  1.00 40.00 ? 537 PRO B C   1 
ATOM 8298  O O   . PRO B 1 533 ? 40.253  91.118  -29.404  1.00 40.00 ? 537 PRO B O   1 
ATOM 8299  C CB  . PRO B 1 533 ? 39.317  89.033  -26.858  1.00 40.00 ? 537 PRO B CB  1 
ATOM 8300  C CG  . PRO B 1 533 ? 39.824  87.783  -26.205  1.00 40.00 ? 537 PRO B CG  1 
ATOM 8301  C CD  . PRO B 1 533 ? 41.320  87.989  -26.173  1.00 40.00 ? 537 PRO B CD  1 
ATOM 8302  N N   . LYS B 1 534 ? 40.896  91.555  -27.282  1.00 40.00 ? 538 LYS B N   1 
ATOM 8303  C CA  . LYS B 1 534 ? 41.016  92.975  -27.613  1.00 40.00 ? 538 LYS B CA  1 
ATOM 8304  C C   . LYS B 1 534 ? 41.986  93.187  -28.767  1.00 40.00 ? 538 LYS B C   1 
ATOM 8305  O O   . LYS B 1 534 ? 41.840  94.166  -29.494  1.00 40.00 ? 538 LYS B O   1 
ATOM 8306  C CB  . LYS B 1 534 ? 41.414  93.877  -26.477  1.00 40.00 ? 538 LYS B CB  1 
ATOM 8307  C CG  . LYS B 1 534 ? 41.965  93.200  -25.247  1.00 40.00 ? 538 LYS B CG  1 
ATOM 8308  C CD  . LYS B 1 534 ? 40.905  93.198  -24.154  1.00 40.00 ? 538 LYS B CD  1 
ATOM 8309  C CE  . LYS B 1 534 ? 40.437  94.613  -23.833  1.00 40.00 ? 538 LYS B CE  1 
ATOM 8310  N NZ  . LYS B 1 534 ? 40.423  94.767  -22.338  1.00 40.00 ? 538 LYS B NZ  1 
ATOM 8311  N N   . LEU B 1 535 ? 42.986  92.303  -28.885  1.00 40.00 ? 539 LEU B N   1 
ATOM 8312  C CA  . LEU B 1 535 ? 43.934  92.486  -29.981  1.00 40.00 ? 539 LEU B CA  1 
ATOM 8313  C C   . LEU B 1 535 ? 43.152  92.282  -31.284  1.00 40.00 ? 539 LEU B C   1 
ATOM 8314  O O   . LEU B 1 535 ? 43.285  93.031  -32.226  1.00 40.00 ? 539 LEU B O   1 
ATOM 8315  C CB  . LEU B 1 535 ? 45.060  91.462  -30.061  1.00 40.00 ? 539 LEU B CB  1 
ATOM 8316  C CG  . LEU B 1 535 ? 46.483  91.995  -30.042  1.00 40.00 ? 539 LEU B CG  1 
ATOM 8317  C CD1 . LEU B 1 535 ? 47.492  90.932  -30.421  1.00 40.00 ? 539 LEU B CD1 1 
ATOM 8318  C CD2 . LEU B 1 535 ? 46.645  93.216  -30.929  1.00 40.00 ? 539 LEU B CD2 1 
ATOM 8319  N N   . LEU B 1 536 ? 42.389  91.186  -31.264  1.00 40.00 ? 540 LEU B N   1 
ATOM 8320  C CA  . LEU B 1 536 ? 41.623  90.825  -32.448  1.00 40.00 ? 540 LEU B CA  1 
ATOM 8321  C C   . LEU B 1 536 ? 40.589  91.852  -32.802  1.00 40.00 ? 540 LEU B C   1 
ATOM 8322  O O   . LEU B 1 536 ? 40.455  92.224  -33.967  1.00 40.00 ? 540 LEU B O   1 
ATOM 8323  C CB  . LEU B 1 536 ? 41.030  89.434  -32.252  1.00 40.00 ? 540 LEU B CB  1 
ATOM 8324  C CG  . LEU B 1 536 ? 42.109  88.338  -32.337  1.00 40.00 ? 540 LEU B CG  1 
ATOM 8325  C CD1 . LEU B 1 536 ? 41.552  86.961  -32.035  1.00 40.00 ? 540 LEU B CD1 1 
ATOM 8326  C CD2 . LEU B 1 536 ? 42.761  88.406  -33.726  1.00 40.00 ? 540 LEU B CD2 1 
ATOM 8327  N N   . SER B 1 537 ? 39.901  92.415  -31.819  1.00 40.00 ? 541 SER B N   1 
ATOM 8328  C CA  . SER B 1 537 ? 38.892  93.431  -32.064  1.00 40.00 ? 541 SER B CA  1 
ATOM 8329  C C   . SER B 1 537 ? 39.516  94.777  -32.390  1.00 40.00 ? 541 SER B C   1 
ATOM 8330  O O   . SER B 1 537 ? 38.800  95.766  -32.582  1.00 40.00 ? 541 SER B O   1 
ATOM 8331  C CB  . SER B 1 537 ? 37.929  93.584  -30.889  1.00 40.00 ? 541 SER B CB  1 
ATOM 8332  O OG  . SER B 1 537 ? 38.571  93.582  -29.636  1.00 40.00 ? 541 SER B OG  1 
ATOM 8333  N N   . ALA B 1 538 ? 40.831  94.864  -32.415  1.00 40.00 ? 542 ALA B N   1 
ATOM 8334  C CA  . ALA B 1 538 ? 41.485  96.119  -32.770  1.00 40.00 ? 542 ALA B CA  1 
ATOM 8335  C C   . ALA B 1 538 ? 41.891  95.971  -34.248  1.00 40.00 ? 542 ALA B C   1 
ATOM 8336  O O   . ALA B 1 538 ? 41.753  96.897  -35.029  1.00 40.00 ? 542 ALA B O   1 
ATOM 8337  C CB  . ALA B 1 538 ? 42.708  96.376  -31.933  1.00 40.00 ? 542 ALA B CB  1 
ATOM 8338  N N   . THR B 1 539 ? 42.340  94.757  -34.536  1.00 40.00 ? 543 THR B N   1 
ATOM 8339  C CA  . THR B 1 539 ? 42.811  94.412  -35.883  1.00 40.00 ? 543 THR B CA  1 
ATOM 8340  C C   . THR B 1 539 ? 41.741  94.003  -36.826  1.00 40.00 ? 543 THR B C   1 
ATOM 8341  O O   . THR B 1 539 ? 40.872  93.145  -36.866  1.00 40.00 ? 543 THR B O   1 
ATOM 8342  C CB  . THR B 1 539 ? 44.068  93.535  -35.673  1.00 40.00 ? 543 THR B CB  1 
ATOM 8343  O OG1 . THR B 1 539 ? 43.776  92.375  -34.896  1.00 40.00 ? 543 THR B OG1 1 
ATOM 8344  C CG2 . THR B 1 539 ? 45.088  94.333  -34.820  1.00 40.00 ? 543 THR B CG2 1 
ATOM 8345  N N   . ASP C 1 1   ? 110.499 113.480 -4.686   1.00 40.00 ? 5   ASP C N   1 
ATOM 8346  C CA  . ASP C 1 1   ? 110.341 112.066 -5.078   1.00 40.00 ? 5   ASP C CA  1 
ATOM 8347  C C   . ASP C 1 1   ? 109.942 112.074 -6.540   1.00 40.00 ? 5   ASP C C   1 
ATOM 8348  O O   . ASP C 1 1   ? 108.917 112.666 -6.904   1.00 40.00 ? 5   ASP C O   1 
ATOM 8349  C CB  . ASP C 1 1   ? 109.293 111.425 -4.179   1.00 40.00 ? 5   ASP C CB  1 
ATOM 8350  C CG  . ASP C 1 1   ? 109.089 109.955 -4.489   1.00 40.00 ? 5   ASP C CG  1 
ATOM 8351  O OD1 . ASP C 1 1   ? 108.216 109.333 -3.839   1.00 40.00 ? 5   ASP C OD1 1 
ATOM 8352  O OD2 . ASP C 1 1   ? 109.808 109.437 -5.373   1.00 40.00 ? 5   ASP C OD2 1 
ATOM 8353  N N   . PRO C 1 2   ? 110.716 111.456 -7.420   1.00 40.00 ? 6   PRO C N   1 
ATOM 8354  C CA  . PRO C 1 2   ? 110.423 111.459 -8.853   1.00 40.00 ? 6   PRO C CA  1 
ATOM 8355  C C   . PRO C 1 2   ? 109.190 110.634 -9.156   1.00 40.00 ? 6   PRO C C   1 
ATOM 8356  O O   . PRO C 1 2   ? 108.583 110.700 -10.222  1.00 40.00 ? 6   PRO C O   1 
ATOM 8357  C CB  . PRO C 1 2   ? 111.660 110.846 -9.489   1.00 40.00 ? 6   PRO C CB  1 
ATOM 8358  C CG  . PRO C 1 2   ? 112.204 109.951 -8.427   1.00 40.00 ? 6   PRO C CG  1 
ATOM 8359  C CD  . PRO C 1 2   ? 111.950 110.697 -7.129   1.00 40.00 ? 6   PRO C CD  1 
ATOM 8360  N N   . GLN C 1 3   ? 108.839 109.807 -8.158   1.00 40.00 ? 7   GLN C N   1 
ATOM 8361  C CA  . GLN C 1 3   ? 107.650 108.973 -8.278   1.00 40.00 ? 7   GLN C CA  1 
ATOM 8362  C C   . GLN C 1 3   ? 106.467 109.939 -8.343   1.00 40.00 ? 7   GLN C C   1 
ATOM 8363  O O   . GLN C 1 3   ? 105.644 109.861 -9.241   1.00 40.00 ? 7   GLN C O   1 
ATOM 8364  C CB  . GLN C 1 3   ? 107.536 108.017 -7.110   1.00 40.00 ? 7   GLN C CB  1 
ATOM 8365  C CG  . GLN C 1 3   ? 108.516 106.860 -7.099   1.00 40.00 ? 7   GLN C CG  1 
ATOM 8366  C CD  . GLN C 1 3   ? 108.492 106.009 -8.343   1.00 40.00 ? 7   GLN C CD  1 
ATOM 8367  O OE1 . GLN C 1 3   ? 107.460 105.459 -8.734   1.00 40.00 ? 7   GLN C OE1 1 
ATOM 8368  N NE2 . GLN C 1 3   ? 109.632 105.869 -9.014   1.00 40.00 ? 7   GLN C NE2 1 
ATOM 8369  N N   . LEU C 1 4   ? 106.429 110.899 -7.425   1.00 40.00 ? 8   LEU C N   1 
ATOM 8370  C CA  . LEU C 1 4   ? 105.350 111.863 -7.400   1.00 40.00 ? 8   LEU C CA  1 
ATOM 8371  C C   . LEU C 1 4   ? 105.597 113.047 -8.301   1.00 40.00 ? 8   LEU C C   1 
ATOM 8372  O O   . LEU C 1 4   ? 104.790 113.999 -8.301   1.00 40.00 ? 8   LEU C O   1 
ATOM 8373  C CB  . LEU C 1 4   ? 105.128 112.264 -5.934   1.00 40.00 ? 8   LEU C CB  1 
ATOM 8374  C CG  . LEU C 1 4   ? 105.146 111.163 -4.891   1.00 40.00 ? 8   LEU C CG  1 
ATOM 8375  C CD1 . LEU C 1 4   ? 104.361 111.585 -3.650   1.00 40.00 ? 8   LEU C CD1 1 
ATOM 8376  C CD2 . LEU C 1 4   ? 104.592 109.838 -5.397   1.00 40.00 ? 8   LEU C CD2 1 
ATOM 8377  N N   . LEU C 1 5   ? 106.630 113.070 -9.119   1.00 40.00 ? 9   LEU C N   1 
ATOM 8378  C CA  . LEU C 1 5   ? 106.827 114.293 -9.950   1.00 40.00 ? 9   LEU C CA  1 
ATOM 8379  C C   . LEU C 1 5   ? 106.741 113.929 -11.407  1.00 40.00 ? 9   LEU C C   1 
ATOM 8380  O O   . LEU C 1 5   ? 107.630 113.164 -11.827  1.00 40.00 ? 9   LEU C O   1 
ATOM 8381  C CB  . LEU C 1 5   ? 108.217 114.839 -9.647   1.00 40.00 ? 9   LEU C CB  1 
ATOM 8382  C CG  . LEU C 1 5   ? 108.511 116.294 -9.392   1.00 40.00 ? 9   LEU C CG  1 
ATOM 8383  C CD1 . LEU C 1 5   ? 107.965 117.196 -10.496  1.00 40.00 ? 9   LEU C CD1 1 
ATOM 8384  C CD2 . LEU C 1 5   ? 108.025 116.729 -8.012   1.00 40.00 ? 9   LEU C CD2 1 
ATOM 8385  N N   . VAL C 1 6   ? 105.747 114.367 -12.174  1.00 40.00 ? 10  VAL C N   1 
ATOM 8386  C CA  . VAL C 1 6   ? 105.752 113.874 -13.564  1.00 40.00 ? 10  VAL C CA  1 
ATOM 8387  C C   . VAL C 1 6   ? 105.609 114.978 -14.582  1.00 40.00 ? 10  VAL C C   1 
ATOM 8388  O O   . VAL C 1 6   ? 104.764 115.875 -14.376  1.00 40.00 ? 10  VAL C O   1 
ATOM 8389  C CB  . VAL C 1 6   ? 104.620 112.856 -13.849  1.00 40.00 ? 10  VAL C CB  1 
ATOM 8390  C CG1 . VAL C 1 6   ? 104.747 112.310 -15.270  1.00 40.00 ? 10  VAL C CG1 1 
ATOM 8391  C CG2 . VAL C 1 6   ? 104.506 111.727 -12.854  1.00 40.00 ? 10  VAL C CG2 1 
ATOM 8392  N N   . ARG C 1 7   ? 106.352 114.870 -15.678  1.00 40.00 ? 11  ARG C N   1 
ATOM 8393  C CA  . ARG C 1 7   ? 106.169 115.929 -16.692  1.00 40.00 ? 11  ARG C CA  1 
ATOM 8394  C C   . ARG C 1 7   ? 105.159 115.374 -17.707  1.00 40.00 ? 11  ARG C C   1 
ATOM 8395  O O   . ARG C 1 7   ? 105.298 114.257 -18.196  1.00 40.00 ? 11  ARG C O   1 
ATOM 8396  C CB  . ARG C 1 7   ? 107.421 116.448 -17.329  1.00 40.00 ? 11  ARG C CB  1 
ATOM 8397  C CG  . ARG C 1 7   ? 107.320 116.949 -18.757  1.00 40.00 ? 11  ARG C CG  1 
ATOM 8398  C CD  . ARG C 1 7   ? 106.744 118.352 -18.796  1.00 40.00 ? 11  ARG C CD  1 
ATOM 8399  N NE  . ARG C 1 7   ? 107.714 119.422 -18.818  1.00 40.00 ? 11  ARG C NE  1 
ATOM 8400  C CZ  . ARG C 1 7   ? 108.757 119.692 -18.059  1.00 40.00 ? 11  ARG C CZ  1 
ATOM 8401  N NH1 . ARG C 1 7   ? 109.159 118.946 -17.036  1.00 40.00 ? 11  ARG C NH1 1 
ATOM 8402  N NH2 . ARG C 1 7   ? 109.479 120.786 -18.333  1.00 40.00 ? 11  ARG C NH2 1 
ATOM 8403  N N   . VAL C 1 8   ? 104.149 116.212 -17.934  1.00 40.00 ? 12  VAL C N   1 
ATOM 8404  C CA  . VAL C 1 8   ? 103.088 115.847 -18.895  1.00 40.00 ? 12  VAL C CA  1 
ATOM 8405  C C   . VAL C 1 8   ? 103.266 116.690 -20.129  1.00 40.00 ? 12  VAL C C   1 
ATOM 8406  O O   . VAL C 1 8   ? 103.973 117.707 -20.074  1.00 40.00 ? 12  VAL C O   1 
ATOM 8407  C CB  . VAL C 1 8   ? 101.739 116.018 -18.200  1.00 40.00 ? 12  VAL C CB  1 
ATOM 8408  C CG1 . VAL C 1 8   ? 100.600 116.419 -19.104  1.00 40.00 ? 12  VAL C CG1 1 
ATOM 8409  C CG2 . VAL C 1 8   ? 101.465 114.669 -17.511  1.00 40.00 ? 12  VAL C CG2 1 
ATOM 8410  N N   . ARG C 1 9   ? 102.626 116.362 -21.226  1.00 40.00 ? 13  ARG C N   1 
ATOM 8411  C CA  . ARG C 1 9   ? 102.739 117.081 -22.474  1.00 40.00 ? 13  ARG C CA  1 
ATOM 8412  C C   . ARG C 1 9   ? 102.529 118.564 -22.357  1.00 40.00 ? 13  ARG C C   1 
ATOM 8413  O O   . ARG C 1 9   ? 102.890 119.285 -23.307  1.00 40.00 ? 13  ARG C O   1 
ATOM 8414  C CB  . ARG C 1 9   ? 101.771 116.521 -23.516  1.00 40.00 ? 13  ARG C CB  1 
ATOM 8415  C CG  . ARG C 1 9   ? 102.093 116.856 -24.965  1.00 40.00 ? 13  ARG C CG  1 
ATOM 8416  C CD  . ARG C 1 9   ? 101.521 115.793 -25.904  1.00 40.00 ? 13  ARG C CD  1 
ATOM 8417  N NE  . ARG C 1 9   ? 101.479 116.162 -27.300  1.00 40.00 ? 13  ARG C NE  1 
ATOM 8418  C CZ  . ARG C 1 9   ? 100.795 117.102 -27.938  1.00 40.00 ? 13  ARG C CZ  1 
ATOM 8419  N NH1 . ARG C 1 9   ? 99.964  117.935 -27.318  1.00 40.00 ? 13  ARG C NH1 1 
ATOM 8420  N NH2 . ARG C 1 9   ? 100.941 117.224 -29.264  1.00 40.00 ? 13  ARG C NH2 1 
ATOM 8421  N N   . GLY C 1 10  ? 101.942 119.067 -21.264  1.00 40.00 ? 14  GLY C N   1 
ATOM 8422  C CA  . GLY C 1 10  ? 101.714 120.476 -21.060  1.00 40.00 ? 14  GLY C CA  1 
ATOM 8423  C C   . GLY C 1 10  ? 102.287 121.047 -19.771  1.00 40.00 ? 14  GLY C C   1 
ATOM 8424  O O   . GLY C 1 10  ? 101.946 122.210 -19.405  1.00 40.00 ? 14  GLY C O   1 
ATOM 8425  N N   . GLY C 1 11  ? 103.136 120.263 -19.073  1.00 40.00 ? 15  GLY C N   1 
ATOM 8426  C CA  . GLY C 1 11  ? 103.681 120.838 -17.829  1.00 40.00 ? 15  GLY C CA  1 
ATOM 8427  C C   . GLY C 1 11  ? 103.967 119.798 -16.773  1.00 40.00 ? 15  GLY C C   1 
ATOM 8428  O O   . GLY C 1 11  ? 103.751 118.604 -16.992  1.00 40.00 ? 15  GLY C O   1 
ATOM 8429  N N   . GLN C 1 12  ? 104.463 120.241 -15.637  1.00 40.00 ? 16  GLN C N   1 
ATOM 8430  C CA  . GLN C 1 12  ? 104.826 119.360 -14.547  1.00 40.00 ? 16  GLN C CA  1 
ATOM 8431  C C   . GLN C 1 12  ? 103.718 119.162 -13.539  1.00 40.00 ? 16  GLN C C   1 
ATOM 8432  O O   . GLN C 1 12  ? 102.858 120.029 -13.323  1.00 40.00 ? 16  GLN C O   1 
ATOM 8433  C CB  . GLN C 1 12  ? 106.062 119.953 -13.840  1.00 40.00 ? 16  GLN C CB  1 
ATOM 8434  C CG  . GLN C 1 12  ? 107.365 119.716 -14.599  1.00 40.00 ? 16  GLN C CG  1 
ATOM 8435  C CD  . GLN C 1 12  ? 108.548 119.550 -13.653  1.00 40.00 ? 16  GLN C CD  1 
ATOM 8436  O OE1 . GLN C 1 12  ? 109.140 120.564 -13.252  1.00 40.00 ? 16  GLN C OE1 1 
ATOM 8437  N NE2 . GLN C 1 12  ? 108.888 118.323 -13.296  1.00 40.00 ? 16  GLN C NE2 1 
ATOM 8438  N N   . LEU C 1 13  ? 103.729 118.009 -12.889  1.00 40.00 ? 17  LEU C N   1 
ATOM 8439  C CA  . LEU C 1 13  ? 102.688 117.723 -11.922  1.00 40.00 ? 17  LEU C CA  1 
ATOM 8440  C C   . LEU C 1 13  ? 103.243 117.099 -10.660  1.00 40.00 ? 17  LEU C C   1 
ATOM 8441  O O   . LEU C 1 13  ? 104.197 116.303 -10.752  1.00 40.00 ? 17  LEU C O   1 
ATOM 8442  C CB  . LEU C 1 13  ? 101.735 116.628 -12.531  1.00 40.00 ? 17  LEU C CB  1 
ATOM 8443  C CG  . LEU C 1 13  ? 101.046 116.970 -13.855  1.00 40.00 ? 17  LEU C CG  1 
ATOM 8444  C CD1 . LEU C 1 13  ? 100.513 115.725 -14.542  1.00 40.00 ? 17  LEU C CD1 1 
ATOM 8445  C CD2 . LEU C 1 13  ? 99.930  118.003 -13.644  1.00 40.00 ? 17  LEU C CD2 1 
ATOM 8446  N N   . ARG C 1 14  ? 102.585 117.340 -9.539   1.00 40.00 ? 18  ARG C N   1 
ATOM 8447  C CA  . ARG C 1 14  ? 103.062 116.638 -8.346   1.00 40.00 ? 18  ARG C CA  1 
ATOM 8448  C C   . ARG C 1 14  ? 101.917 115.790 -7.795   1.00 40.00 ? 18  ARG C C   1 
ATOM 8449  O O   . ARG C 1 14  ? 100.899 116.353 -7.378   1.00 40.00 ? 18  ARG C O   1 
ATOM 8450  C CB  . ARG C 1 14  ? 103.619 117.547 -7.303   1.00 40.00 ? 18  ARG C CB  1 
ATOM 8451  C CG  . ARG C 1 14  ? 103.202 117.305 -5.867   1.00 40.00 ? 18  ARG C CG  1 
ATOM 8452  C CD  . ARG C 1 14  ? 104.280 117.702 -4.895   1.00 40.00 ? 18  ARG C CD  1 
ATOM 8453  N NE  . ARG C 1 14  ? 104.614 119.117 -4.891   1.00 40.00 ? 18  ARG C NE  1 
ATOM 8454  C CZ  . ARG C 1 14  ? 105.397 119.769 -5.740   1.00 40.00 ? 18  ARG C CZ  1 
ATOM 8455  N NH1 . ARG C 1 14  ? 105.609 121.076 -5.591   1.00 40.00 ? 18  ARG C NH1 1 
ATOM 8456  N NH2 . ARG C 1 14  ? 105.980 119.147 -6.755   1.00 40.00 ? 18  ARG C NH2 1 
ATOM 8457  N N   . GLY C 1 15  ? 102.143 114.480 -7.804   1.00 40.00 ? 19  GLY C N   1 
ATOM 8458  C CA  . GLY C 1 15  ? 101.135 113.565 -7.274   1.00 40.00 ? 19  GLY C CA  1 
ATOM 8459  C C   . GLY C 1 15  ? 101.227 113.533 -5.745   1.00 40.00 ? 19  GLY C C   1 
ATOM 8460  O O   . GLY C 1 15  ? 101.850 114.401 -5.132   1.00 40.00 ? 19  GLY C O   1 
ATOM 8461  N N   . ILE C 1 16  ? 100.586 112.548 -5.145   1.00 40.00 ? 20  ILE C N   1 
ATOM 8462  C CA  . ILE C 1 16  ? 100.596 112.336 -3.704   1.00 40.00 ? 20  ILE C CA  1 
ATOM 8463  C C   . ILE C 1 16  ? 100.652 110.809 -3.541   1.00 40.00 ? 20  ILE C C   1 
ATOM 8464  O O   . ILE C 1 16  ? 100.163 110.097 -4.411   1.00 40.00 ? 20  ILE C O   1 
ATOM 8465  C CB  . ILE C 1 16  ? 99.444  112.945 -2.926   1.00 40.00 ? 20  ILE C CB  1 
ATOM 8466  C CG1 . ILE C 1 16  ? 99.174  112.214 -1.590   1.00 40.00 ? 20  ILE C CG1 1 
ATOM 8467  C CG2 . ILE C 1 16  ? 98.159  112.919 -3.743   1.00 40.00 ? 20  ILE C CG2 1 
ATOM 8468  C CD1 . ILE C 1 16  ? 98.520  113.099 -0.541   1.00 40.00 ? 20  ILE C CD1 1 
ATOM 8469  N N   . ARG C 1 17  ? 101.269 110.354 -2.472   1.00 40.00 ? 21  ARG C N   1 
ATOM 8470  C CA  . ARG C 1 17  ? 101.430 108.933 -2.201   1.00 40.00 ? 21  ARG C CA  1 
ATOM 8471  C C   . ARG C 1 17  ? 100.382 108.421 -1.215   1.00 40.00 ? 21  ARG C C   1 
ATOM 8472  O O   . ARG C 1 17  ? 100.377 108.708 -0.020   1.00 40.00 ? 21  ARG C O   1 
ATOM 8473  C CB  . ARG C 1 17  ? 102.853 108.672 -1.728   1.00 40.00 ? 21  ARG C CB  1 
ATOM 8474  C CG  . ARG C 1 17  ? 103.312 107.233 -1.880   1.00 40.00 ? 21  ARG C CG  1 
ATOM 8475  C CD  . ARG C 1 17  ? 104.474 106.962 -0.941   1.00 40.00 ? 21  ARG C CD  1 
ATOM 8476  N NE  . ARG C 1 17  ? 103.959 106.695 0.415    1.00 40.00 ? 21  ARG C NE  1 
ATOM 8477  C CZ  . ARG C 1 17  ? 104.686 105.909 1.222    1.00 40.00 ? 21  ARG C CZ  1 
ATOM 8478  N NH1 . ARG C 1 17  ? 105.833 105.405 0.762    1.00 40.00 ? 21  ARG C NH1 1 
ATOM 8479  N NH2 . ARG C 1 17  ? 104.256 105.645 2.442    1.00 40.00 ? 21  ARG C NH2 1 
ATOM 8480  N N   . LEU C 1 18  ? 99.465  107.644 -1.791   1.00 40.00 ? 22  LEU C N   1 
ATOM 8481  C CA  . LEU C 1 18  ? 98.354  107.074 -1.066   1.00 40.00 ? 22  LEU C CA  1 
ATOM 8482  C C   . LEU C 1 18  ? 98.685  105.702 -0.499   1.00 40.00 ? 22  LEU C C   1 
ATOM 8483  O O   . LEU C 1 18  ? 99.457  104.940 -1.082   1.00 40.00 ? 22  LEU C O   1 
ATOM 8484  C CB  . LEU C 1 18  ? 97.163  106.938 -2.020   1.00 40.00 ? 22  LEU C CB  1 
ATOM 8485  C CG  . LEU C 1 18  ? 96.194  108.084 -2.205   1.00 40.00 ? 22  LEU C CG  1 
ATOM 8486  C CD1 . LEU C 1 18  ? 96.900  109.410 -2.460   1.00 40.00 ? 22  LEU C CD1 1 
ATOM 8487  C CD2 . LEU C 1 18  ? 95.236  107.786 -3.355   1.00 40.00 ? 22  LEU C CD2 1 
ATOM 8488  N N   . LYS C 1 19  ? 98.027  105.391 0.621    1.00 40.00 ? 23  LYS C N   1 
ATOM 8489  C CA  . LYS C 1 19  ? 98.288  104.083 1.192    1.00 40.00 ? 23  LYS C CA  1 
ATOM 8490  C C   . LYS C 1 19  ? 97.125  103.120 1.145    1.00 40.00 ? 23  LYS C C   1 
ATOM 8491  O O   . LYS C 1 19  ? 96.160  103.163 1.902    1.00 40.00 ? 23  LYS C O   1 
ATOM 8492  C CB  . LYS C 1 19  ? 98.911  104.226 2.578    1.00 40.00 ? 23  LYS C CB  1 
ATOM 8493  C CG  . LYS C 1 19  ? 100.445 104.250 2.498    1.00 40.00 ? 23  LYS C CG  1 
ATOM 8494  C CD  . LYS C 1 19  ? 101.052 104.778 3.787    1.00 40.00 ? 23  LYS C CD  1 
ATOM 8495  C CE  . LYS C 1 19  ? 101.211 106.291 3.766    1.00 40.00 ? 23  LYS C CE  1 
ATOM 8496  N NZ  . LYS C 1 19  ? 101.813 106.784 2.498    1.00 40.00 ? 23  LYS C NZ  1 
ATOM 8497  N N   . ALA C 1 20  ? 97.241  102.157 0.218    1.00 40.00 ? 24  ALA C N   1 
ATOM 8498  C CA  . ALA C 1 20  ? 96.243  101.092 0.109    1.00 40.00 ? 24  ALA C CA  1 
ATOM 8499  C C   . ALA C 1 20  ? 96.660  99.971  1.063    1.00 40.00 ? 24  ALA C C   1 
ATOM 8500  O O   . ALA C 1 20  ? 97.863  99.836  1.337    1.00 40.00 ? 24  ALA C O   1 
ATOM 8501  C CB  . ALA C 1 20  ? 96.272  100.537 -1.316   1.00 40.00 ? 24  ALA C CB  1 
ATOM 8502  N N   . PRO C 1 21  ? 95.734  99.145  1.519    1.00 40.00 ? 25  PRO C N   1 
ATOM 8503  C CA  . PRO C 1 21  ? 96.028  98.019  2.389    1.00 40.00 ? 25  PRO C CA  1 
ATOM 8504  C C   . PRO C 1 21  ? 97.216  97.189  1.944    1.00 40.00 ? 25  PRO C C   1 
ATOM 8505  O O   . PRO C 1 21  ? 98.050  96.830  2.798    1.00 40.00 ? 25  PRO C O   1 
ATOM 8506  C CB  . PRO C 1 21  ? 94.735  97.210  2.378    1.00 40.00 ? 25  PRO C CB  1 
ATOM 8507  C CG  . PRO C 1 21  ? 93.660  98.210  2.131    1.00 40.00 ? 25  PRO C CG  1 
ATOM 8508  C CD  . PRO C 1 21  ? 94.279  99.261  1.247    1.00 40.00 ? 25  PRO C CD  1 
ATOM 8509  N N   . GLY C 1 22  ? 97.370  96.869  0.653    1.00 40.00 ? 26  GLY C N   1 
ATOM 8510  C CA  . GLY C 1 22  ? 98.511  96.082  0.216    1.00 40.00 ? 26  GLY C CA  1 
ATOM 8511  C C   . GLY C 1 22  ? 99.745  96.888  -0.116   1.00 40.00 ? 26  GLY C C   1 
ATOM 8512  O O   . GLY C 1 22  ? 100.689 96.352  -0.714   1.00 40.00 ? 26  GLY C O   1 
ATOM 8513  N N   . GLY C 1 23  ? 99.764  98.186  0.162    1.00 40.00 ? 27  GLY C N   1 
ATOM 8514  C CA  . GLY C 1 23  ? 100.904 99.004  -0.153   1.00 40.00 ? 27  GLY C CA  1 
ATOM 8515  C C   . GLY C 1 23  ? 100.610 100.402 -0.647   1.00 40.00 ? 27  GLY C C   1 
ATOM 8516  O O   . GLY C 1 23  ? 99.506  100.948 -0.634   1.00 40.00 ? 27  GLY C O   1 
ATOM 8517  N N   . PRO C 1 24  ? 101.683 101.043 -1.107   1.00 40.00 ? 28  PRO C N   1 
ATOM 8518  C CA  . PRO C 1 24  ? 101.641 102.402 -1.590   1.00 40.00 ? 28  PRO C CA  1 
ATOM 8519  C C   . PRO C 1 24  ? 101.202 102.513 -3.033   1.00 40.00 ? 28  PRO C C   1 
ATOM 8520  O O   . PRO C 1 24  ? 101.403 101.632 -3.870   1.00 40.00 ? 28  PRO C O   1 
ATOM 8521  C CB  . PRO C 1 24  ? 103.090 102.865 -1.410   1.00 40.00 ? 28  PRO C CB  1 
ATOM 8522  C CG  . PRO C 1 24  ? 103.878 101.629 -1.710   1.00 40.00 ? 28  PRO C CG  1 
ATOM 8523  C CD  . PRO C 1 24  ? 103.055 100.475 -1.190   1.00 40.00 ? 28  PRO C CD  1 
ATOM 8524  N N   . VAL C 1 25  ? 100.582 103.685 -3.294   1.00 40.00 ? 29  VAL C N   1 
ATOM 8525  C CA  . VAL C 1 25  ? 100.099 104.029 -4.599   1.00 40.00 ? 29  VAL C CA  1 
ATOM 8526  C C   . VAL C 1 25  ? 100.412 105.487 -4.957   1.00 40.00 ? 29  VAL C C   1 
ATOM 8527  O O   . VAL C 1 25  ? 100.222 106.353 -4.110   1.00 40.00 ? 29  VAL C O   1 
ATOM 8528  C CB  . VAL C 1 25  ? 98.566  103.966 -4.756   1.00 40.00 ? 29  VAL C CB  1 
ATOM 8529  C CG1 . VAL C 1 25  ? 98.285  103.563 -6.203   1.00 40.00 ? 29  VAL C CG1 1 
ATOM 8530  C CG2 . VAL C 1 25  ? 97.866  103.085 -3.753   1.00 40.00 ? 29  VAL C CG2 1 
ATOM 8531  N N   . SER C 1 26  ? 100.794 105.686 -6.203   1.00 40.00 ? 30  SER C N   1 
ATOM 8532  C CA  . SER C 1 26  ? 101.014 107.073 -6.676   1.00 40.00 ? 30  SER C CA  1 
ATOM 8533  C C   . SER C 1 26  ? 99.622  107.562 -7.134   1.00 40.00 ? 30  SER C C   1 
ATOM 8534  O O   . SER C 1 26  ? 98.874  106.734 -7.695   1.00 40.00 ? 30  SER C O   1 
ATOM 8535  C CB  . SER C 1 26  ? 102.002 107.052 -7.832   1.00 40.00 ? 30  SER C CB  1 
ATOM 8536  O OG  . SER C 1 26  ? 103.364 107.162 -7.429   1.00 40.00 ? 30  SER C OG  1 
ATOM 8537  N N   . ALA C 1 27  ? 99.245  108.796 -6.900   1.00 40.00 ? 31  ALA C N   1 
ATOM 8538  C CA  . ALA C 1 27  ? 97.925  109.303 -7.257   1.00 40.00 ? 31  ALA C CA  1 
ATOM 8539  C C   . ALA C 1 27  ? 98.020  110.735 -7.753   1.00 40.00 ? 31  ALA C C   1 
ATOM 8540  O O   . ALA C 1 27  ? 98.497  111.592 -7.006   1.00 40.00 ? 31  ALA C O   1 
ATOM 8541  C CB  . ALA C 1 27  ? 97.052  109.286 -6.004   1.00 40.00 ? 31  ALA C CB  1 
ATOM 8542  N N   . PHE C 1 28  ? 97.617  110.971 -8.999   1.00 40.00 ? 32  PHE C N   1 
ATOM 8543  C CA  . PHE C 1 28  ? 97.724  112.323 -9.579   1.00 40.00 ? 32  PHE C CA  1 
ATOM 8544  C C   . PHE C 1 28  ? 96.346  112.910 -9.859   1.00 40.00 ? 32  PHE C C   1 
ATOM 8545  O O   . PHE C 1 28  ? 95.865  112.899 -10.987  1.00 40.00 ? 32  PHE C O   1 
ATOM 8546  C CB  . PHE C 1 28  ? 98.527  112.266 -10.892  1.00 40.00 ? 32  PHE C CB  1 
ATOM 8547  C CG  . PHE C 1 28  ? 99.944  111.842 -10.649  1.00 40.00 ? 32  PHE C CG  1 
ATOM 8548  C CD1 . PHE C 1 28  ? 100.276 110.554 -10.290  1.00 40.00 ? 32  PHE C CD1 1 
ATOM 8549  C CD2 . PHE C 1 28  ? 100.967 112.769 -10.779  1.00 40.00 ? 32  PHE C CD2 1 
ATOM 8550  C CE1 . PHE C 1 28  ? 101.590 110.184 -10.060  1.00 40.00 ? 32  PHE C CE1 1 
ATOM 8551  C CE2 . PHE C 1 28  ? 102.287 112.405 -10.557  1.00 40.00 ? 32  PHE C CE2 1 
ATOM 8552  C CZ  . PHE C 1 28  ? 102.604 111.106 -10.198  1.00 40.00 ? 32  PHE C CZ  1 
ATOM 8553  N N   . LEU C 1 29  ? 95.728  113.402 -8.823   1.00 40.00 ? 33  LEU C N   1 
ATOM 8554  C CA  . LEU C 1 29  ? 94.401  113.970 -8.779   1.00 40.00 ? 33  LEU C CA  1 
ATOM 8555  C C   . LEU C 1 29  ? 94.225  115.389 -9.240   1.00 40.00 ? 33  LEU C C   1 
ATOM 8556  O O   . LEU C 1 29  ? 94.920  116.328 -8.782   1.00 40.00 ? 33  LEU C O   1 
ATOM 8557  C CB  . LEU C 1 29  ? 94.073  113.834 -7.246   1.00 40.00 ? 33  LEU C CB  1 
ATOM 8558  C CG  . LEU C 1 29  ? 93.600  112.445 -6.843   1.00 40.00 ? 33  LEU C CG  1 
ATOM 8559  C CD1 . LEU C 1 29  ? 94.324  111.315 -7.552   1.00 40.00 ? 33  LEU C CD1 1 
ATOM 8560  C CD2 . LEU C 1 29  ? 93.614  112.194 -5.345   1.00 40.00 ? 33  LEU C CD2 1 
ATOM 8561  N N   . GLY C 1 30  ? 93.284  115.722 -10.129  1.00 40.00 ? 34  GLY C N   1 
ATOM 8562  C CA  . GLY C 1 30  ? 93.103  117.130 -10.493  1.00 40.00 ? 34  GLY C CA  1 
ATOM 8563  C C   . GLY C 1 30  ? 93.817  117.549 -11.753  1.00 40.00 ? 34  GLY C C   1 
ATOM 8564  O O   . GLY C 1 30  ? 94.013  118.754 -11.973  1.00 40.00 ? 34  GLY C O   1 
ATOM 8565  N N   . ILE C 1 31  ? 94.191  116.623 -12.632  1.00 40.00 ? 35  ILE C N   1 
ATOM 8566  C CA  . ILE C 1 31  ? 94.872  117.135 -13.827  1.00 40.00 ? 35  ILE C CA  1 
ATOM 8567  C C   . ILE C 1 31  ? 93.987  117.825 -14.842  1.00 40.00 ? 35  ILE C C   1 
ATOM 8568  O O   . ILE C 1 31  ? 93.160  117.238 -15.546  1.00 40.00 ? 35  ILE C O   1 
ATOM 8569  C CB  . ILE C 1 31  ? 95.659  116.024 -14.561  1.00 40.00 ? 35  ILE C CB  1 
ATOM 8570  C CG1 . ILE C 1 31  ? 96.512  115.211 -13.607  1.00 40.00 ? 35  ILE C CG1 1 
ATOM 8571  C CG2 . ILE C 1 31  ? 96.473  116.744 -15.655  1.00 40.00 ? 35  ILE C CG2 1 
ATOM 8572  C CD1 . ILE C 1 31  ? 96.823  113.780 -13.987  1.00 40.00 ? 35  ILE C CD1 1 
ATOM 8573  N N   . PRO C 1 32  ? 94.175  119.118 -15.031  1.00 40.00 ? 36  PRO C N   1 
ATOM 8574  C CA  . PRO C 1 32  ? 93.385  119.832 -16.037  1.00 40.00 ? 36  PRO C CA  1 
ATOM 8575  C C   . PRO C 1 32  ? 93.530  119.076 -17.355  1.00 40.00 ? 36  PRO C C   1 
ATOM 8576  O O   . PRO C 1 32  ? 94.702  118.764 -17.648  1.00 40.00 ? 36  PRO C O   1 
ATOM 8577  C CB  . PRO C 1 32  ? 94.057  121.192 -16.167  1.00 40.00 ? 36  PRO C CB  1 
ATOM 8578  C CG  . PRO C 1 32  ? 95.251  121.170 -15.308  1.00 40.00 ? 36  PRO C CG  1 
ATOM 8579  C CD  . PRO C 1 32  ? 95.118  120.016 -14.338  1.00 40.00 ? 36  PRO C CD  1 
ATOM 8580  N N   . PHE C 1 33  ? 92.434  118.797 -18.036  1.00 40.00 ? 37  PHE C N   1 
ATOM 8581  C CA  . PHE C 1 33  ? 92.633  118.119 -19.335  1.00 40.00 ? 37  PHE C CA  1 
ATOM 8582  C C   . PHE C 1 33  ? 92.139  119.094 -20.397  1.00 40.00 ? 37  PHE C C   1 
ATOM 8583  O O   . PHE C 1 33  ? 92.473  118.990 -21.561  1.00 40.00 ? 37  PHE C O   1 
ATOM 8584  C CB  . PHE C 1 33  ? 92.051  116.785 -19.467  1.00 40.00 ? 37  PHE C CB  1 
ATOM 8585  C CG  . PHE C 1 33  ? 90.589  116.574 -19.384  1.00 40.00 ? 37  PHE C CG  1 
ATOM 8586  C CD1 . PHE C 1 33  ? 89.798  116.635 -20.523  1.00 40.00 ? 37  PHE C CD1 1 
ATOM 8587  C CD2 . PHE C 1 33  ? 90.018  116.252 -18.152  1.00 40.00 ? 37  PHE C CD2 1 
ATOM 8588  C CE1 . PHE C 1 33  ? 88.437  116.380 -20.439  1.00 40.00 ? 37  PHE C CE1 1 
ATOM 8589  C CE2 . PHE C 1 33  ? 88.662  116.018 -18.053  1.00 40.00 ? 37  PHE C CE2 1 
ATOM 8590  C CZ  . PHE C 1 33  ? 87.891  116.088 -19.203  1.00 40.00 ? 37  PHE C CZ  1 
ATOM 8591  N N   . ALA C 1 34  ? 91.409  120.099 -19.897  1.00 40.00 ? 38  ALA C N   1 
ATOM 8592  C CA  . ALA C 1 34  ? 90.884  121.109 -20.808  1.00 40.00 ? 38  ALA C CA  1 
ATOM 8593  C C   . ALA C 1 34  ? 90.720  122.480 -20.158  1.00 40.00 ? 38  ALA C C   1 
ATOM 8594  O O   . ALA C 1 34  ? 90.647  122.591 -18.926  1.00 40.00 ? 38  ALA C O   1 
ATOM 8595  C CB  . ALA C 1 34  ? 89.458  120.691 -21.230  1.00 40.00 ? 38  ALA C CB  1 
ATOM 8596  N N   . GLU C 1 35  ? 90.604  123.460 -21.053  1.00 40.00 ? 39  GLU C N   1 
ATOM 8597  C CA  . GLU C 1 35  ? 90.332  124.830 -20.611  1.00 40.00 ? 39  GLU C CA  1 
ATOM 8598  C C   . GLU C 1 35  ? 88.901  124.847 -20.051  1.00 40.00 ? 39  GLU C C   1 
ATOM 8599  O O   . GLU C 1 35  ? 87.945  124.381 -20.706  1.00 40.00 ? 39  GLU C O   1 
ATOM 8600  C CB  . GLU C 1 35  ? 90.404  125.836 -21.753  1.00 40.00 ? 39  GLU C CB  1 
ATOM 8601  C CG  . GLU C 1 35  ? 91.808  126.215 -22.232  1.00 40.00 ? 39  GLU C CG  1 
ATOM 8602  C CD  . GLU C 1 35  ? 92.618  126.962 -21.190  1.00 40.00 ? 39  GLU C CD  1 
ATOM 8603  O OE1 . GLU C 1 35  ? 92.704  128.196 -21.326  1.00 40.00 ? 39  GLU C OE1 1 
ATOM 8604  O OE2 . GLU C 1 35  ? 93.172  126.368 -20.236  1.00 40.00 ? 39  GLU C OE2 1 
ATOM 8605  N N   . PRO C 1 36  ? 88.742  125.344 -18.827  1.00 40.00 ? 40  PRO C N   1 
ATOM 8606  C CA  . PRO C 1 36  ? 87.449  125.459 -18.162  1.00 40.00 ? 40  PRO C CA  1 
ATOM 8607  C C   . PRO C 1 36  ? 86.447  125.972 -19.192  1.00 40.00 ? 40  PRO C C   1 
ATOM 8608  O O   . PRO C 1 36  ? 86.687  126.973 -19.883  1.00 40.00 ? 40  PRO C O   1 
ATOM 8609  C CB  . PRO C 1 36  ? 87.691  126.465 -17.044  1.00 40.00 ? 40  PRO C CB  1 
ATOM 8610  C CG  . PRO C 1 36  ? 89.105  126.273 -16.690  1.00 40.00 ? 40  PRO C CG  1 
ATOM 8611  C CD  . PRO C 1 36  ? 89.796  125.958 -17.996  1.00 40.00 ? 40  PRO C CD  1 
ATOM 8612  N N   . PRO C 1 37  ? 85.326  125.279 -19.302  1.00 40.00 ? 41  PRO C N   1 
ATOM 8613  C CA  . PRO C 1 37  ? 84.285  125.574 -20.278  1.00 40.00 ? 41  PRO C CA  1 
ATOM 8614  C C   . PRO C 1 37  ? 83.263  126.562 -19.750  1.00 40.00 ? 41  PRO C C   1 
ATOM 8615  O O   . PRO C 1 37  ? 82.033  126.452 -19.920  1.00 40.00 ? 41  PRO C O   1 
ATOM 8616  C CB  . PRO C 1 37  ? 83.684  124.187 -20.469  1.00 40.00 ? 41  PRO C CB  1 
ATOM 8617  C CG  . PRO C 1 37  ? 83.680  123.644 -19.063  1.00 40.00 ? 41  PRO C CG  1 
ATOM 8618  C CD  . PRO C 1 37  ? 84.953  124.120 -18.450  1.00 40.00 ? 41  PRO C CD  1 
ATOM 8619  N N   . VAL C 1 38  ? 83.815  127.611 -19.118  1.00 40.00 ? 42  VAL C N   1 
ATOM 8620  C CA  . VAL C 1 38  ? 82.989  128.627 -18.518  1.00 40.00 ? 42  VAL C CA  1 
ATOM 8621  C C   . VAL C 1 38  ? 82.774  129.835 -19.402  1.00 40.00 ? 42  VAL C C   1 
ATOM 8622  O O   . VAL C 1 38  ? 83.354  130.026 -20.479  1.00 40.00 ? 42  VAL C O   1 
ATOM 8623  C CB  . VAL C 1 38  ? 83.635  129.073 -17.191  1.00 40.00 ? 42  VAL C CB  1 
ATOM 8624  C CG1 . VAL C 1 38  ? 83.823  127.843 -16.327  1.00 40.00 ? 42  VAL C CG1 1 
ATOM 8625  C CG2 . VAL C 1 38  ? 84.937  129.805 -17.487  1.00 40.00 ? 42  VAL C CG2 1 
ATOM 8626  N N   . GLY C 1 39  ? 81.870  130.688 -18.859  1.00 40.00 ? 43  GLY C N   1 
ATOM 8627  C CA  . GLY C 1 39  ? 81.590  131.920 -19.541  1.00 40.00 ? 43  GLY C CA  1 
ATOM 8628  C C   . GLY C 1 39  ? 81.076  131.746 -20.943  1.00 40.00 ? 43  GLY C C   1 
ATOM 8629  O O   . GLY C 1 39  ? 80.001  131.167 -21.101  1.00 40.00 ? 43  GLY C O   1 
ATOM 8630  N N   . SER C 1 40  ? 81.793  132.177 -21.967  1.00 40.00 ? 44  SER C N   1 
ATOM 8631  C CA  . SER C 1 40  ? 81.314  132.111 -23.334  1.00 40.00 ? 44  SER C CA  1 
ATOM 8632  C C   . SER C 1 40  ? 81.603  130.748 -23.941  1.00 40.00 ? 44  SER C C   1 
ATOM 8633  O O   . SER C 1 40  ? 81.396  130.538 -25.144  1.00 40.00 ? 44  SER C O   1 
ATOM 8634  C CB  . SER C 1 40  ? 82.015  133.169 -24.198  1.00 40.00 ? 44  SER C CB  1 
ATOM 8635  O OG  . SER C 1 40  ? 83.421  132.926 -24.180  1.00 40.00 ? 44  SER C OG  1 
ATOM 8636  N N   . ARG C 1 41  ? 82.120  129.914 -23.052  1.00 40.00 ? 45  ARG C N   1 
ATOM 8637  C CA  . ARG C 1 41  ? 82.466  128.563 -23.405  1.00 40.00 ? 45  ARG C CA  1 
ATOM 8638  C C   . ARG C 1 41  ? 81.348  127.615 -23.034  1.00 40.00 ? 45  ARG C C   1 
ATOM 8639  O O   . ARG C 1 41  ? 81.358  126.471 -23.495  1.00 40.00 ? 45  ARG C O   1 
ATOM 8640  C CB  . ARG C 1 41  ? 83.785  128.160 -22.721  1.00 40.00 ? 45  ARG C CB  1 
ATOM 8641  C CG  . ARG C 1 41  ? 85.029  128.352 -23.556  1.00 40.00 ? 45  ARG C CG  1 
ATOM 8642  C CD  . ARG C 1 41  ? 84.751  129.065 -24.878  1.00 40.00 ? 45  ARG C CD  1 
ATOM 8643  N NE  . ARG C 1 41  ? 84.489  128.146 -25.983  1.00 40.00 ? 45  ARG C NE  1 
ATOM 8644  C CZ  . ARG C 1 41  ? 85.336  127.185 -26.351  1.00 40.00 ? 45  ARG C CZ  1 
ATOM 8645  N NH1 . ARG C 1 41  ? 86.492  127.004 -25.708  1.00 40.00 ? 45  ARG C NH1 1 
ATOM 8646  N NH2 . ARG C 1 41  ? 85.062  126.383 -27.365  1.00 40.00 ? 45  ARG C NH2 1 
ATOM 8647  N N   . ARG C 1 42  ? 80.424  128.060 -22.195  1.00 40.00 ? 46  ARG C N   1 
ATOM 8648  C CA  . ARG C 1 42  ? 79.339  127.143 -21.816  1.00 40.00 ? 46  ARG C CA  1 
ATOM 8649  C C   . ARG C 1 42  ? 78.624  126.569 -23.038  1.00 40.00 ? 46  ARG C C   1 
ATOM 8650  O O   . ARG C 1 42  ? 78.340  127.340 -23.982  1.00 40.00 ? 46  ARG C O   1 
ATOM 8651  C CB  . ARG C 1 42  ? 78.324  127.920 -20.987  1.00 40.00 ? 46  ARG C CB  1 
ATOM 8652  C CG  . ARG C 1 42  ? 77.309  126.981 -20.331  1.00 40.00 ? 46  ARG C CG  1 
ATOM 8653  C CD  . ARG C 1 42  ? 76.330  127.828 -19.603  1.00 40.00 ? 46  ARG C CD  1 
ATOM 8654  N NE  . ARG C 1 42  ? 76.500  127.971 -18.170  1.00 40.00 ? 46  ARG C NE  1 
ATOM 8655  C CZ  . ARG C 1 42  ? 75.748  128.905 -17.534  1.00 40.00 ? 46  ARG C CZ  1 
ATOM 8656  N NH1 . ARG C 1 42  ? 74.899  129.657 -18.267  1.00 40.00 ? 46  ARG C NH1 1 
ATOM 8657  N NH2 . ARG C 1 42  ? 75.830  129.045 -16.212  1.00 40.00 ? 46  ARG C NH2 1 
ATOM 8658  N N   . PHE C 1 43  ? 78.304  125.269 -23.016  1.00 40.00 ? 47  PHE C N   1 
ATOM 8659  C CA  . PHE C 1 43  ? 77.626  124.603 -24.103  1.00 40.00 ? 47  PHE C CA  1 
ATOM 8660  C C   . PHE C 1 43  ? 78.556  124.301 -25.278  1.00 40.00 ? 47  PHE C C   1 
ATOM 8661  O O   . PHE C 1 43  ? 78.120  123.740 -26.299  1.00 40.00 ? 47  PHE C O   1 
ATOM 8662  C CB  . PHE C 1 43  ? 76.382  125.312 -24.696  1.00 40.00 ? 47  PHE C CB  1 
ATOM 8663  C CG  . PHE C 1 43  ? 75.440  125.799 -23.614  1.00 40.00 ? 47  PHE C CG  1 
ATOM 8664  C CD1 . PHE C 1 43  ? 75.090  124.946 -22.581  1.00 40.00 ? 47  PHE C CD1 1 
ATOM 8665  C CD2 . PHE C 1 43  ? 74.985  127.098 -23.588  1.00 40.00 ? 47  PHE C CD2 1 
ATOM 8666  C CE1 . PHE C 1 43  ? 74.287  125.363 -21.560  1.00 40.00 ? 47  PHE C CE1 1 
ATOM 8667  C CE2 . PHE C 1 43  ? 74.164  127.506 -22.581  1.00 40.00 ? 47  PHE C CE2 1 
ATOM 8668  C CZ  . PHE C 1 43  ? 73.816  126.650 -21.562  1.00 40.00 ? 47  PHE C CZ  1 
ATOM 8669  N N   . MET C 1 44  ? 79.826  124.643 -25.169  1.00 40.00 ? 48  MET C N   1 
ATOM 8670  C CA  . MET C 1 44  ? 80.789  124.457 -26.227  1.00 40.00 ? 48  MET C CA  1 
ATOM 8671  C C   . MET C 1 44  ? 81.625  123.194 -26.079  1.00 40.00 ? 48  MET C C   1 
ATOM 8672  O O   . MET C 1 44  ? 81.943  122.665 -25.017  1.00 40.00 ? 48  MET C O   1 
ATOM 8673  C CB  . MET C 1 44  ? 81.759  125.635 -26.274  1.00 40.00 ? 48  MET C CB  1 
ATOM 8674  C CG  . MET C 1 44  ? 81.247  126.937 -26.863  1.00 40.00 ? 48  MET C CG  1 
ATOM 8675  S SD  . MET C 1 44  ? 80.582  126.682 -28.507  1.00 40.00 ? 48  MET C SD  1 
ATOM 8676  C CE  . MET C 1 44  ? 81.525  127.756 -29.551  1.00 40.00 ? 48  MET C CE  1 
ATOM 8677  N N   . PRO C 1 45  ? 82.023  122.687 -27.243  1.00 40.00 ? 49  PRO C N   1 
ATOM 8678  C CA  . PRO C 1 45  ? 82.896  121.488 -27.275  1.00 40.00 ? 49  PRO C CA  1 
ATOM 8679  C C   . PRO C 1 45  ? 84.103  121.857 -26.429  1.00 40.00 ? 49  PRO C C   1 
ATOM 8680  O O   . PRO C 1 45  ? 84.435  123.053 -26.413  1.00 40.00 ? 49  PRO C O   1 
ATOM 8681  C CB  . PRO C 1 45  ? 83.164  121.300 -28.732  1.00 40.00 ? 49  PRO C CB  1 
ATOM 8682  C CG  . PRO C 1 45  ? 82.602  122.438 -29.485  1.00 40.00 ? 49  PRO C CG  1 
ATOM 8683  C CD  . PRO C 1 45  ? 81.688  123.217 -28.578  1.00 40.00 ? 49  PRO C CD  1 
ATOM 8684  N N   . PRO C 1 46  ? 84.741  120.951 -25.731  1.00 40.00 ? 50  PRO C N   1 
ATOM 8685  C CA  . PRO C 1 46  ? 85.853  121.291 -24.862  1.00 40.00 ? 50  PRO C CA  1 
ATOM 8686  C C   . PRO C 1 46  ? 87.098  121.648 -25.638  1.00 40.00 ? 50  PRO C C   1 
ATOM 8687  O O   . PRO C 1 46  ? 87.192  121.266 -26.797  1.00 40.00 ? 50  PRO C O   1 
ATOM 8688  C CB  . PRO C 1 46  ? 86.086  120.047 -24.032  1.00 40.00 ? 50  PRO C CB  1 
ATOM 8689  C CG  . PRO C 1 46  ? 85.614  118.948 -24.922  1.00 40.00 ? 50  PRO C CG  1 
ATOM 8690  C CD  . PRO C 1 46  ? 84.472  119.509 -25.742  1.00 40.00 ? 50  PRO C CD  1 
ATOM 8691  N N   . GLU C 1 47  ? 87.999  122.384 -24.995  1.00 40.00 ? 51  GLU C N   1 
ATOM 8692  C CA  . GLU C 1 47  ? 89.271  122.766 -25.608  1.00 40.00 ? 51  GLU C CA  1 
ATOM 8693  C C   . GLU C 1 47  ? 90.423  122.294 -24.715  1.00 40.00 ? 51  GLU C C   1 
ATOM 8694  O O   . GLU C 1 47  ? 90.383  122.253 -23.480  1.00 40.00 ? 51  GLU C O   1 
ATOM 8695  C CB  . GLU C 1 47  ? 89.384  124.236 -25.895  1.00 40.00 ? 51  GLU C CB  1 
ATOM 8696  C CG  . GLU C 1 47  ? 89.213  124.614 -27.345  1.00 40.00 ? 51  GLU C CG  1 
ATOM 8697  C CD  . GLU C 1 47  ? 88.975  126.096 -27.589  1.00 40.00 ? 51  GLU C CD  1 
ATOM 8698  O OE1 . GLU C 1 47  ? 88.650  126.386 -28.778  1.00 40.00 ? 51  GLU C OE1 1 
ATOM 8699  O OE2 . GLU C 1 47  ? 89.095  126.969 -26.693  1.00 40.00 ? 51  GLU C OE2 1 
ATOM 8700  N N   . PRO C 1 48  ? 91.479  121.900 -25.396  1.00 40.00 ? 52  PRO C N   1 
ATOM 8701  C CA  . PRO C 1 48  ? 92.654  121.361 -24.733  1.00 40.00 ? 52  PRO C CA  1 
ATOM 8702  C C   . PRO C 1 48  ? 93.277  122.382 -23.786  1.00 40.00 ? 52  PRO C C   1 
ATOM 8703  O O   . PRO C 1 48  ? 93.540  123.539 -24.150  1.00 40.00 ? 52  PRO C O   1 
ATOM 8704  C CB  . PRO C 1 48  ? 93.563  120.949 -25.851  1.00 40.00 ? 52  PRO C CB  1 
ATOM 8705  C CG  . PRO C 1 48  ? 92.940  121.291 -27.141  1.00 40.00 ? 52  PRO C CG  1 
ATOM 8706  C CD  . PRO C 1 48  ? 91.612  121.956 -26.865  1.00 40.00 ? 52  PRO C CD  1 
ATOM 8707  N N   . LYS C 1 49  ? 93.458  121.932 -22.545  1.00 40.00 ? 53  LYS C N   1 
ATOM 8708  C CA  . LYS C 1 49  ? 94.060  122.751 -21.490  1.00 40.00 ? 53  LYS C CA  1 
ATOM 8709  C C   . LYS C 1 49  ? 95.362  123.349 -22.008  1.00 40.00 ? 53  LYS C C   1 
ATOM 8710  O O   . LYS C 1 49  ? 96.160  122.614 -22.610  1.00 40.00 ? 53  LYS C O   1 
ATOM 8711  C CB  . LYS C 1 49  ? 94.366  121.819 -20.312  1.00 40.00 ? 53  LYS C CB  1 
ATOM 8712  C CG  . LYS C 1 49  ? 94.701  122.379 -18.972  1.00 40.00 ? 53  LYS C CG  1 
ATOM 8713  C CD  . LYS C 1 49  ? 95.090  123.839 -18.984  1.00 40.00 ? 53  LYS C CD  1 
ATOM 8714  C CE  . LYS C 1 49  ? 94.928  124.533 -17.657  1.00 40.00 ? 53  LYS C CE  1 
ATOM 8715  N NZ  . LYS C 1 49  ? 94.046  125.730 -17.789  1.00 40.00 ? 53  LYS C NZ  1 
ATOM 8716  N N   . ARG C 1 50  ? 95.590  124.641 -21.791  1.00 40.00 ? 54  ARG C N   1 
ATOM 8717  C CA  . ARG C 1 50  ? 96.847  125.283 -22.249  1.00 40.00 ? 54  ARG C CA  1 
ATOM 8718  C C   . ARG C 1 50  ? 97.964  124.787 -21.353  1.00 40.00 ? 54  ARG C C   1 
ATOM 8719  O O   . ARG C 1 50  ? 97.691  124.307 -20.236  1.00 40.00 ? 54  ARG C O   1 
ATOM 8720  C CB  . ARG C 1 50  ? 96.686  126.793 -22.238  1.00 40.00 ? 54  ARG C CB  1 
ATOM 8721  C CG  . ARG C 1 50  ? 96.187  127.325 -23.583  1.00 40.00 ? 54  ARG C CG  1 
ATOM 8722  C CD  . ARG C 1 50  ? 95.320  128.569 -23.458  1.00 40.00 ? 54  ARG C CD  1 
ATOM 8723  N NE  . ARG C 1 50  ? 96.087  129.708 -22.974  1.00 40.00 ? 54  ARG C NE  1 
ATOM 8724  C CZ  . ARG C 1 50  ? 95.993  130.263 -21.773  1.00 40.00 ? 54  ARG C CZ  1 
ATOM 8725  N NH1 . ARG C 1 50  ? 95.138  129.823 -20.853  1.00 40.00 ? 54  ARG C NH1 1 
ATOM 8726  N NH2 . ARG C 1 50  ? 96.784  131.301 -21.459  1.00 40.00 ? 54  ARG C NH2 1 
ATOM 8727  N N   . PRO C 1 51  ? 99.211  124.833 -21.817  1.00 40.00 ? 55  PRO C N   1 
ATOM 8728  C CA  . PRO C 1 51  ? 100.347 124.349 -21.045  1.00 40.00 ? 55  PRO C CA  1 
ATOM 8729  C C   . PRO C 1 51  ? 100.646 125.321 -19.910  1.00 40.00 ? 55  PRO C C   1 
ATOM 8730  O O   . PRO C 1 51  ? 100.522 126.523 -20.085  1.00 40.00 ? 55  PRO C O   1 
ATOM 8731  C CB  . PRO C 1 51  ? 101.444 124.237 -22.055  1.00 40.00 ? 55  PRO C CB  1 
ATOM 8732  C CG  . PRO C 1 51  ? 100.951 124.759 -23.349  1.00 40.00 ? 55  PRO C CG  1 
ATOM 8733  C CD  . PRO C 1 51  ? 99.636  125.427 -23.101  1.00 40.00 ? 55  PRO C CD  1 
ATOM 8734  N N   . TRP C 1 52  ? 101.013 124.785 -18.743  1.00 40.00 ? 56  TRP C N   1 
ATOM 8735  C CA  . TRP C 1 52  ? 101.304 125.635 -17.616  1.00 40.00 ? 56  TRP C CA  1 
ATOM 8736  C C   . TRP C 1 52  ? 102.758 125.679 -17.182  1.00 40.00 ? 56  TRP C C   1 
ATOM 8737  O O   . TRP C 1 52  ? 103.602 124.799 -17.390  1.00 40.00 ? 56  TRP C O   1 
ATOM 8738  C CB  . TRP C 1 52  ? 100.511 125.159 -16.404  1.00 40.00 ? 56  TRP C CB  1 
ATOM 8739  C CG  . TRP C 1 52  ? 100.768 123.737 -16.038  1.00 40.00 ? 56  TRP C CG  1 
ATOM 8740  C CD1 . TRP C 1 52  ? 101.578 123.284 -15.041  1.00 40.00 ? 56  TRP C CD1 1 
ATOM 8741  C CD2 . TRP C 1 52  ? 100.178 122.583 -16.651  1.00 40.00 ? 56  TRP C CD2 1 
ATOM 8742  N NE1 . TRP C 1 52  ? 101.544 121.906 -15.003  1.00 40.00 ? 56  TRP C NE1 1 
ATOM 8743  C CE2 . TRP C 1 52  ? 100.694 121.452 -15.981  1.00 40.00 ? 56  TRP C CE2 1 
ATOM 8744  C CE3 . TRP C 1 52  ? 99.275  122.396 -17.708  1.00 40.00 ? 56  TRP C CE3 1 
ATOM 8745  C CZ2 . TRP C 1 52  ? 100.331 120.148 -16.325  1.00 40.00 ? 56  TRP C CZ2 1 
ATOM 8746  C CZ3 . TRP C 1 52  ? 98.925  121.096 -18.046  1.00 40.00 ? 56  TRP C CZ3 1 
ATOM 8747  C CH2 . TRP C 1 52  ? 99.456  119.993 -17.359  1.00 40.00 ? 56  TRP C CH2 1 
ATOM 8748  N N   . SER C 1 53  ? 103.076 126.762 -16.472  1.00 40.00 ? 57  SER C N   1 
ATOM 8749  C CA  . SER C 1 53  ? 104.411 126.950 -15.924  1.00 40.00 ? 57  SER C CA  1 
ATOM 8750  C C   . SER C 1 53  ? 104.491 126.220 -14.579  1.00 40.00 ? 57  SER C C   1 
ATOM 8751  O O   . SER C 1 53  ? 103.493 125.790 -14.000  1.00 40.00 ? 57  SER C O   1 
ATOM 8752  C CB  . SER C 1 53  ? 104.626 128.450 -15.657  1.00 40.00 ? 57  SER C CB  1 
ATOM 8753  O OG  . SER C 1 53  ? 104.364 128.759 -14.284  1.00 40.00 ? 57  SER C OG  1 
ATOM 8754  N N   . GLY C 1 54  ? 105.701 126.147 -14.058  1.00 40.00 ? 58  GLY C N   1 
ATOM 8755  C CA  . GLY C 1 54  ? 105.957 125.549 -12.773  1.00 40.00 ? 58  GLY C CA  1 
ATOM 8756  C C   . GLY C 1 54  ? 105.405 124.139 -12.624  1.00 40.00 ? 58  GLY C C   1 
ATOM 8757  O O   . GLY C 1 54  ? 105.201 123.363 -13.570  1.00 40.00 ? 58  GLY C O   1 
ATOM 8758  N N   . VAL C 1 55  ? 105.186 123.827 -11.343  1.00 40.00 ? 59  VAL C N   1 
ATOM 8759  C CA  . VAL C 1 55  ? 104.720 122.489 -11.010  1.00 40.00 ? 59  VAL C CA  1 
ATOM 8760  C C   . VAL C 1 55  ? 103.276 122.510 -10.573  1.00 40.00 ? 59  VAL C C   1 
ATOM 8761  O O   . VAL C 1 55  ? 102.950 122.951 -9.468   1.00 40.00 ? 59  VAL C O   1 
ATOM 8762  C CB  . VAL C 1 55  ? 105.638 121.881 -9.936   1.00 40.00 ? 59  VAL C CB  1 
ATOM 8763  C CG1 . VAL C 1 55  ? 104.934 120.883 -9.035   1.00 40.00 ? 59  VAL C CG1 1 
ATOM 8764  C CG2 . VAL C 1 55  ? 106.826 121.245 -10.663  1.00 40.00 ? 59  VAL C CG2 1 
ATOM 8765  N N   . LEU C 1 56  ? 102.430 122.006 -11.483  1.00 40.00 ? 60  LEU C N   1 
ATOM 8766  C CA  . LEU C 1 56  ? 100.999 121.925 -11.180  1.00 40.00 ? 60  LEU C CA  1 
ATOM 8767  C C   . LEU C 1 56  ? 100.768 120.981 -10.003  1.00 40.00 ? 60  LEU C C   1 
ATOM 8768  O O   . LEU C 1 56  ? 101.212 119.826 -10.043  1.00 40.00 ? 60  LEU C O   1 
ATOM 8769  C CB  . LEU C 1 56  ? 100.280 121.384 -12.405  1.00 40.00 ? 60  LEU C CB  1 
ATOM 8770  C CG  . LEU C 1 56  ? 98.758  121.327 -12.453  1.00 40.00 ? 60  LEU C CG  1 
ATOM 8771  C CD1 . LEU C 1 56  ? 98.094  122.008 -11.288  1.00 40.00 ? 60  LEU C CD1 1 
ATOM 8772  C CD2 . LEU C 1 56  ? 98.321  121.951 -13.789  1.00 40.00 ? 60  LEU C CD2 1 
ATOM 8773  N N   . ASP C 1 57  ? 100.083 121.455 -8.978   1.00 40.00 ? 61  ASP C N   1 
ATOM 8774  C CA  . ASP C 1 57  ? 99.819  120.572 -7.839   1.00 40.00 ? 61  ASP C CA  1 
ATOM 8775  C C   . ASP C 1 57  ? 98.724  119.610 -8.303   1.00 40.00 ? 61  ASP C C   1 
ATOM 8776  O O   . ASP C 1 57  ? 97.796  120.058 -8.974   1.00 40.00 ? 61  ASP C O   1 
ATOM 8777  C CB  . ASP C 1 57  ? 99.378  121.340 -6.615   1.00 40.00 ? 61  ASP C CB  1 
ATOM 8778  C CG  . ASP C 1 57  ? 98.813  120.416 -5.542   1.00 40.00 ? 61  ASP C CG  1 
ATOM 8779  O OD1 . ASP C 1 57  ? 99.410  120.421 -4.438   1.00 40.00 ? 61  ASP C OD1 1 
ATOM 8780  O OD2 . ASP C 1 57  ? 97.819  119.706 -5.810   1.00 40.00 ? 61  ASP C OD2 1 
ATOM 8781  N N   . ALA C 1 58  ? 98.840  118.350 -7.936   1.00 40.00 ? 62  ALA C N   1 
ATOM 8782  C CA  . ALA C 1 58  ? 97.812  117.387 -8.397   1.00 40.00 ? 62  ALA C CA  1 
ATOM 8783  C C   . ALA C 1 58  ? 97.602  116.385 -7.279   1.00 40.00 ? 62  ALA C C   1 
ATOM 8784  O O   . ALA C 1 58  ? 97.363  115.211 -7.511   1.00 40.00 ? 62  ALA C O   1 
ATOM 8785  C CB  . ALA C 1 58  ? 98.340  116.765 -9.674   1.00 40.00 ? 62  ALA C CB  1 
ATOM 8786  N N   . THR C 1 59  ? 97.679  116.922 -6.067   1.00 40.00 ? 63  THR C N   1 
ATOM 8787  C CA  . THR C 1 59  ? 97.585  116.084 -4.879   1.00 40.00 ? 63  THR C CA  1 
ATOM 8788  C C   . THR C 1 59  ? 96.189  115.963 -4.345   1.00 40.00 ? 63  THR C C   1 
ATOM 8789  O O   . THR C 1 59  ? 95.960  115.383 -3.276   1.00 40.00 ? 63  THR C O   1 
ATOM 8790  C CB  . THR C 1 59  ? 98.490  116.729 -3.797   1.00 40.00 ? 63  THR C CB  1 
ATOM 8791  O OG1 . THR C 1 59  ? 97.822  117.762 -3.082   1.00 40.00 ? 63  THR C OG1 1 
ATOM 8792  C CG2 . THR C 1 59  ? 99.724  117.310 -4.496   1.00 40.00 ? 63  THR C CG2 1 
ATOM 8793  N N   . THR C 1 60  ? 95.257  116.580 -5.097   1.00 40.00 ? 64  THR C N   1 
ATOM 8794  C CA  . THR C 1 60  ? 93.882  116.582 -4.623   1.00 40.00 ? 64  THR C CA  1 
ATOM 8795  C C   . THR C 1 60  ? 92.774  116.576 -5.652   1.00 40.00 ? 64  THR C C   1 
ATOM 8796  O O   . THR C 1 60  ? 92.938  116.922 -6.822   1.00 40.00 ? 64  THR C O   1 
ATOM 8797  C CB  . THR C 1 60  ? 93.665  117.840 -3.731   1.00 40.00 ? 64  THR C CB  1 
ATOM 8798  O OG1 . THR C 1 60  ? 92.416  117.601 -3.073   1.00 40.00 ? 64  THR C OG1 1 
ATOM 8799  C CG2 . THR C 1 60  ? 93.609  119.069 -4.608   1.00 40.00 ? 64  THR C CG2 1 
ATOM 8800  N N   . PHE C 1 61  ? 91.598  116.154 -5.161   1.00 40.00 ? 65  PHE C N   1 
ATOM 8801  C CA  . PHE C 1 61  ? 90.420  116.055 -6.017   1.00 40.00 ? 65  PHE C CA  1 
ATOM 8802  C C   . PHE C 1 61  ? 89.809  117.404 -6.359   1.00 40.00 ? 65  PHE C C   1 
ATOM 8803  O O   . PHE C 1 61  ? 89.521  118.159 -5.440   1.00 40.00 ? 65  PHE C O   1 
ATOM 8804  C CB  . PHE C 1 61  ? 89.368  115.204 -5.300   1.00 40.00 ? 65  PHE C CB  1 
ATOM 8805  C CG  . PHE C 1 61  ? 89.389  113.749 -5.662   1.00 40.00 ? 65  PHE C CG  1 
ATOM 8806  C CD1 . PHE C 1 61  ? 89.756  113.311 -6.930   1.00 40.00 ? 65  PHE C CD1 1 
ATOM 8807  C CD2 . PHE C 1 61  ? 89.027  112.790 -4.710   1.00 40.00 ? 65  PHE C CD2 1 
ATOM 8808  C CE1 . PHE C 1 61  ? 89.762  111.972 -7.261   1.00 40.00 ? 65  PHE C CE1 1 
ATOM 8809  C CE2 . PHE C 1 61  ? 89.029  111.437 -5.011   1.00 40.00 ? 65  PHE C CE2 1 
ATOM 8810  C CZ  . PHE C 1 61  ? 89.396  111.056 -6.285   1.00 40.00 ? 65  PHE C CZ  1 
ATOM 8811  N N   . GLN C 1 62  ? 89.573  117.665 -7.620   1.00 40.00 ? 66  GLN C N   1 
ATOM 8812  C CA  . GLN C 1 62  ? 88.956  118.886 -8.080   1.00 40.00 ? 66  GLN C CA  1 
ATOM 8813  C C   . GLN C 1 62  ? 87.438  118.931 -7.929   1.00 40.00 ? 66  GLN C C   1 
ATOM 8814  O O   . GLN C 1 62  ? 86.745  118.032 -7.424   1.00 40.00 ? 66  GLN C O   1 
ATOM 8815  C CB  . GLN C 1 62  ? 89.354  119.040 -9.542   1.00 40.00 ? 66  GLN C CB  1 
ATOM 8816  C CG  . GLN C 1 62  ? 90.686  119.811 -9.598   1.00 40.00 ? 66  GLN C CG  1 
ATOM 8817  C CD  . GLN C 1 62  ? 90.470  121.229 -9.079   1.00 40.00 ? 66  GLN C CD  1 
ATOM 8818  O OE1 . GLN C 1 62  ? 89.937  122.172 -9.634   1.00 40.00 ? 66  GLN C OE1 1 
ATOM 8819  N NE2 . GLN C 1 62  ? 90.935  121.407 -7.834   1.00 40.00 ? 66  GLN C NE2 1 
ATOM 8820  N N   . ASN C 1 63  ? 86.878  120.069 -8.370   1.00 40.00 ? 67  ASN C N   1 
ATOM 8821  C CA  . ASN C 1 63  ? 85.472  120.359 -8.303   1.00 40.00 ? 67  ASN C CA  1 
ATOM 8822  C C   . ASN C 1 63  ? 84.605  119.492 -9.232   1.00 40.00 ? 67  ASN C C   1 
ATOM 8823  O O   . ASN C 1 63  ? 84.926  119.302 -10.407  1.00 40.00 ? 67  ASN C O   1 
ATOM 8824  C CB  . ASN C 1 63  ? 85.153  121.805 -8.711   1.00 40.00 ? 67  ASN C CB  1 
ATOM 8825  C CG  . ASN C 1 63  ? 85.823  122.845 -7.847   1.00 40.00 ? 67  ASN C CG  1 
ATOM 8826  O OD1 . ASN C 1 63  ? 85.763  122.795 -6.618   1.00 40.00 ? 67  ASN C OD1 1 
ATOM 8827  N ND2 . ASN C 1 63  ? 86.457  123.782 -8.540   1.00 40.00 ? 67  ASN C ND2 1 
ATOM 8828  N N   . VAL C 1 64  ? 83.516  119.046 -8.641   1.00 40.00 ? 68  VAL C N   1 
ATOM 8829  C CA  . VAL C 1 64  ? 82.502  118.270 -9.319   1.00 40.00 ? 68  VAL C CA  1 
ATOM 8830  C C   . VAL C 1 64  ? 81.820  119.160 -10.356  1.00 40.00 ? 68  VAL C C   1 
ATOM 8831  O O   . VAL C 1 64  ? 81.429  120.298 -9.974   1.00 40.00 ? 68  VAL C O   1 
ATOM 8832  C CB  . VAL C 1 64  ? 81.402  117.999 -8.251   1.00 40.00 ? 68  VAL C CB  1 
ATOM 8833  C CG1 . VAL C 1 64  ? 80.048  117.662 -8.868   1.00 40.00 ? 68  VAL C CG1 1 
ATOM 8834  C CG2 . VAL C 1 64  ? 81.766  116.926 -7.255   1.00 40.00 ? 68  VAL C CG2 1 
ATOM 8835  N N   . CYS C 1 65  ? 81.528  118.737 -11.569  1.00 40.00 ? 69  CYS C N   1 
ATOM 8836  C CA  . CYS C 1 65  ? 80.771  119.597 -12.486  1.00 40.00 ? 69  CYS C CA  1 
ATOM 8837  C C   . CYS C 1 65  ? 79.409  120.053 -11.930  1.00 40.00 ? 69  CYS C C   1 
ATOM 8838  O O   . CYS C 1 65  ? 78.833  119.423 -11.030  1.00 40.00 ? 69  CYS C O   1 
ATOM 8839  C CB  . CYS C 1 65  ? 80.517  118.834 -13.774  1.00 40.00 ? 69  CYS C CB  1 
ATOM 8840  S SG  . CYS C 1 65  ? 81.998  118.578 -14.725  1.00 40.00 ? 69  CYS C SG  1 
ATOM 8841  N N   . TYR C 1 66  ? 78.847  121.146 -12.484  1.00 40.00 ? 70  TYR C N   1 
ATOM 8842  C CA  . TYR C 1 66  ? 77.597  121.693 -12.006  1.00 40.00 ? 70  TYR C CA  1 
ATOM 8843  C C   . TYR C 1 66  ? 76.432  120.755 -12.158  1.00 40.00 ? 70  TYR C C   1 
ATOM 8844  O O   . TYR C 1 66  ? 76.043  120.308 -13.245  1.00 40.00 ? 70  TYR C O   1 
ATOM 8845  C CB  . TYR C 1 66  ? 77.311  123.127 -12.540  1.00 40.00 ? 70  TYR C CB  1 
ATOM 8846  C CG  . TYR C 1 66  ? 76.589  123.865 -11.397  1.00 40.00 ? 70  TYR C CG  1 
ATOM 8847  C CD1 . TYR C 1 66  ? 77.269  124.382 -10.308  1.00 40.00 ? 70  TYR C CD1 1 
ATOM 8848  C CD2 . TYR C 1 66  ? 75.215  123.973 -11.402  1.00 40.00 ? 70  TYR C CD2 1 
ATOM 8849  C CE1 . TYR C 1 66  ? 76.608  124.993 -9.273   1.00 40.00 ? 70  TYR C CE1 1 
ATOM 8850  C CE2 . TYR C 1 66  ? 74.544  124.594 -10.368  1.00 40.00 ? 70  TYR C CE2 1 
ATOM 8851  C CZ  . TYR C 1 66  ? 75.243  125.102 -9.295   1.00 40.00 ? 70  TYR C CZ  1 
ATOM 8852  O OH  . TYR C 1 66  ? 74.514  125.698 -8.280   1.00 40.00 ? 70  TYR C OH  1 
ATOM 8853  N N   . GLN C 1 67  ? 75.798  120.390 -11.025  1.00 40.00 ? 71  GLN C N   1 
ATOM 8854  C CA  . GLN C 1 67  ? 74.710  119.416 -11.162  1.00 40.00 ? 71  GLN C CA  1 
ATOM 8855  C C   . GLN C 1 67  ? 73.671  119.397 -10.073  1.00 40.00 ? 71  GLN C C   1 
ATOM 8856  O O   . GLN C 1 67  ? 73.854  119.761 -8.916   1.00 40.00 ? 71  GLN C O   1 
ATOM 8857  C CB  . GLN C 1 67  ? 75.459  118.049 -11.178  1.00 40.00 ? 71  GLN C CB  1 
ATOM 8858  C CG  . GLN C 1 67  ? 76.153  117.765 -9.866   1.00 40.00 ? 71  GLN C CG  1 
ATOM 8859  C CD  . GLN C 1 67  ? 76.643  116.328 -9.796   1.00 40.00 ? 71  GLN C CD  1 
ATOM 8860  O OE1 . GLN C 1 67  ? 76.089  115.476 -9.079   1.00 40.00 ? 71  GLN C OE1 1 
ATOM 8861  N NE2 . GLN C 1 67  ? 77.702  116.110 -10.574  1.00 40.00 ? 71  GLN C NE2 1 
ATOM 8862  N N   . TYR C 1 68  ? 72.487  118.865 -10.443  1.00 40.00 ? 72  TYR C N   1 
ATOM 8863  C CA  . TYR C 1 68  ? 71.416  118.750 -9.435   1.00 40.00 ? 72  TYR C CA  1 
ATOM 8864  C C   . TYR C 1 68  ? 71.965  117.941 -8.276   1.00 40.00 ? 72  TYR C C   1 
ATOM 8865  O O   . TYR C 1 68  ? 72.816  117.067 -8.450   1.00 40.00 ? 72  TYR C O   1 
ATOM 8866  C CB  . TYR C 1 68  ? 70.210  118.078 -10.090  1.00 40.00 ? 72  TYR C CB  1 
ATOM 8867  C CG  . TYR C 1 68  ? 69.150  117.586 -9.140   1.00 40.00 ? 72  TYR C CG  1 
ATOM 8868  C CD1 . TYR C 1 68  ? 67.947  118.257 -9.018   1.00 40.00 ? 72  TYR C CD1 1 
ATOM 8869  C CD2 . TYR C 1 68  ? 69.338  116.445 -8.376   1.00 40.00 ? 72  TYR C CD2 1 
ATOM 8870  C CE1 . TYR C 1 68  ? 66.967  117.828 -8.151   1.00 40.00 ? 72  TYR C CE1 1 
ATOM 8871  C CE2 . TYR C 1 68  ? 68.359  116.006 -7.508   1.00 40.00 ? 72  TYR C CE2 1 
ATOM 8872  C CZ  . TYR C 1 68  ? 67.182  116.707 -7.395   1.00 40.00 ? 72  TYR C CZ  1 
ATOM 8873  O OH  . TYR C 1 68  ? 66.213  116.262 -6.527   1.00 40.00 ? 72  TYR C OH  1 
ATOM 8874  N N   . VAL C 1 69  ? 71.482  118.167 -7.075   1.00 40.00 ? 73  VAL C N   1 
ATOM 8875  C CA  . VAL C 1 69  ? 71.934  117.402 -5.907   1.00 40.00 ? 73  VAL C CA  1 
ATOM 8876  C C   . VAL C 1 69  ? 70.779  116.653 -5.282   1.00 40.00 ? 73  VAL C C   1 
ATOM 8877  O O   . VAL C 1 69  ? 69.656  117.165 -5.118   1.00 40.00 ? 73  VAL C O   1 
ATOM 8878  C CB  . VAL C 1 69  ? 72.605  118.310 -4.874   1.00 40.00 ? 73  VAL C CB  1 
ATOM 8879  C CG1 . VAL C 1 69  ? 72.690  117.658 -3.508   1.00 40.00 ? 73  VAL C CG1 1 
ATOM 8880  C CG2 . VAL C 1 69  ? 73.979  118.692 -5.363   1.00 40.00 ? 73  VAL C CG2 1 
ATOM 8881  N N   . ASP C 1 70  ? 70.981  115.386 -4.962   1.00 40.00 ? 74  ASP C N   1 
ATOM 8882  C CA  . ASP C 1 70  ? 69.812  114.669 -4.471   1.00 40.00 ? 74  ASP C CA  1 
ATOM 8883  C C   . ASP C 1 70  ? 69.381  114.980 -3.064   1.00 40.00 ? 74  ASP C C   1 
ATOM 8884  O O   . ASP C 1 70  ? 70.176  114.835 -2.144   1.00 40.00 ? 74  ASP C O   1 
ATOM 8885  C CB  . ASP C 1 70  ? 69.987  113.160 -4.672   1.00 40.00 ? 74  ASP C CB  1 
ATOM 8886  C CG  . ASP C 1 70  ? 68.632  112.468 -4.636   1.00 40.00 ? 74  ASP C CG  1 
ATOM 8887  O OD1 . ASP C 1 70  ? 68.052  112.328 -5.728   1.00 40.00 ? 74  ASP C OD1 1 
ATOM 8888  O OD2 . ASP C 1 70  ? 68.214  112.101 -3.525   1.00 40.00 ? 74  ASP C OD2 1 
ATOM 8889  N N   . THR C 1 71  ? 68.115  115.346 -2.943   1.00 40.00 ? 75  THR C N   1 
ATOM 8890  C CA  . THR C 1 71  ? 67.515  115.590 -1.628   1.00 40.00 ? 75  THR C CA  1 
ATOM 8891  C C   . THR C 1 71  ? 66.867  114.264 -1.220   1.00 40.00 ? 75  THR C C   1 
ATOM 8892  O O   . THR C 1 71  ? 67.559  113.382 -0.688   1.00 40.00 ? 75  THR C O   1 
ATOM 8893  C CB  . THR C 1 71  ? 66.463  116.693 -1.614   1.00 40.00 ? 75  THR C CB  1 
ATOM 8894  O OG1 . THR C 1 71  ? 66.383  117.388 -2.879   1.00 40.00 ? 75  THR C OG1 1 
ATOM 8895  C CG2 . THR C 1 71  ? 66.819  117.740 -0.555   1.00 40.00 ? 75  THR C CG2 1 
ATOM 8896  N N   . LEU C 1 72  ? 65.609  114.061 -1.542   1.00 40.00 ? 76  LEU C N   1 
ATOM 8897  C CA  . LEU C 1 72  ? 64.853  112.861 -1.267   1.00 40.00 ? 76  LEU C CA  1 
ATOM 8898  C C   . LEU C 1 72  ? 65.059  112.289 0.121    1.00 40.00 ? 76  LEU C C   1 
ATOM 8899  O O   . LEU C 1 72  ? 64.156  112.392 0.965    1.00 40.00 ? 76  LEU C O   1 
ATOM 8900  C CB  . LEU C 1 72  ? 65.058  111.766 -2.320   1.00 40.00 ? 76  LEU C CB  1 
ATOM 8901  C CG  . LEU C 1 72  ? 64.212  110.492 -2.111   1.00 40.00 ? 76  LEU C CG  1 
ATOM 8902  C CD1 . LEU C 1 72  ? 62.735  110.812 -1.975   1.00 40.00 ? 76  LEU C CD1 1 
ATOM 8903  C CD2 . LEU C 1 72  ? 64.431  109.461 -3.209   1.00 40.00 ? 76  LEU C CD2 1 
ATOM 8904  N N   . TYR C 1 73  ? 66.173  111.656 0.398    1.00 40.00 ? 77  TYR C N   1 
ATOM 8905  C CA  . TYR C 1 73  ? 66.479  111.068 1.699    1.00 40.00 ? 77  TYR C CA  1 
ATOM 8906  C C   . TYR C 1 73  ? 67.773  111.699 2.210    1.00 40.00 ? 77  TYR C C   1 
ATOM 8907  O O   . TYR C 1 73  ? 68.876  111.181 2.017    1.00 40.00 ? 77  TYR C O   1 
ATOM 8908  C CB  . TYR C 1 73  ? 66.628  109.560 1.536    1.00 40.00 ? 77  TYR C CB  1 
ATOM 8909  C CG  . TYR C 1 73  ? 65.359  108.814 1.171    1.00 40.00 ? 77  TYR C CG  1 
ATOM 8910  C CD1 . TYR C 1 73  ? 64.223  108.933 1.962    1.00 40.00 ? 77  TYR C CD1 1 
ATOM 8911  C CD2 . TYR C 1 73  ? 65.283  107.993 0.058    1.00 40.00 ? 77  TYR C CD2 1 
ATOM 8912  C CE1 . TYR C 1 73  ? 63.059  108.263 1.652    1.00 40.00 ? 77  TYR C CE1 1 
ATOM 8913  C CE2 . TYR C 1 73  ? 64.121  107.317 -0.260   1.00 40.00 ? 77  TYR C CE2 1 
ATOM 8914  C CZ  . TYR C 1 73  ? 63.008  107.453 0.541    1.00 40.00 ? 77  TYR C CZ  1 
ATOM 8915  O OH  . TYR C 1 73  ? 61.844  106.775 0.229    1.00 40.00 ? 77  TYR C OH  1 
ATOM 8916  N N   . PRO C 1 74  ? 67.646  112.866 2.832    1.00 40.00 ? 78  PRO C N   1 
ATOM 8917  C CA  . PRO C 1 74  ? 68.774  113.631 3.332    1.00 40.00 ? 78  PRO C CA  1 
ATOM 8918  C C   . PRO C 1 74  ? 69.470  112.979 4.503    1.00 40.00 ? 78  PRO C C   1 
ATOM 8919  O O   . PRO C 1 74  ? 68.834  112.577 5.479    1.00 40.00 ? 78  PRO C O   1 
ATOM 8920  C CB  . PRO C 1 74  ? 68.184  114.969 3.691    1.00 40.00 ? 78  PRO C CB  1 
ATOM 8921  C CG  . PRO C 1 74  ? 66.727  114.771 3.858    1.00 40.00 ? 78  PRO C CG  1 
ATOM 8922  C CD  . PRO C 1 74  ? 66.360  113.533 3.130    1.00 40.00 ? 78  PRO C CD  1 
ATOM 8923  N N   . GLY C 1 75  ? 70.790  112.833 4.359    1.00 40.00 ? 79  GLY C N   1 
ATOM 8924  C CA  . GLY C 1 75  ? 71.572  112.189 5.392    1.00 40.00 ? 79  GLY C CA  1 
ATOM 8925  C C   . GLY C 1 75  ? 71.589  110.680 5.203    1.00 40.00 ? 79  GLY C C   1 
ATOM 8926  O O   . GLY C 1 75  ? 72.296  110.013 5.979    1.00 40.00 ? 79  GLY C O   1 
ATOM 8927  N N   . PHE C 1 76  ? 70.876  110.142 4.218    1.00 40.00 ? 80  PHE C N   1 
ATOM 8928  C CA  . PHE C 1 76  ? 70.852  108.699 3.964    1.00 40.00 ? 80  PHE C CA  1 
ATOM 8929  C C   . PHE C 1 76  ? 72.030  108.286 3.087    1.00 40.00 ? 80  PHE C C   1 
ATOM 8930  O O   . PHE C 1 76  ? 72.160  108.747 1.945    1.00 40.00 ? 80  PHE C O   1 
ATOM 8931  C CB  . PHE C 1 76  ? 69.539  108.282 3.294    1.00 40.00 ? 80  PHE C CB  1 
ATOM 8932  C CG  . PHE C 1 76  ? 69.509  106.861 2.794    1.00 40.00 ? 80  PHE C CG  1 
ATOM 8933  C CD1 . PHE C 1 76  ? 69.632  105.806 3.671    1.00 40.00 ? 80  PHE C CD1 1 
ATOM 8934  C CD2 . PHE C 1 76  ? 69.354  106.588 1.445    1.00 40.00 ? 80  PHE C CD2 1 
ATOM 8935  C CE1 . PHE C 1 76  ? 69.602  104.499 3.232    1.00 40.00 ? 80  PHE C CE1 1 
ATOM 8936  C CE2 . PHE C 1 76  ? 69.301  105.289 0.997    1.00 40.00 ? 80  PHE C CE2 1 
ATOM 8937  C CZ  . PHE C 1 76  ? 69.434  104.247 1.891    1.00 40.00 ? 80  PHE C CZ  1 
ATOM 8938  N N   . GLU C 1 77  ? 72.856  107.387 3.590    1.00 40.00 ? 81  GLU C N   1 
ATOM 8939  C CA  . GLU C 1 77  ? 74.021  106.923 2.838    1.00 40.00 ? 81  GLU C CA  1 
ATOM 8940  C C   . GLU C 1 77  ? 73.701  106.426 1.442    1.00 40.00 ? 81  GLU C C   1 
ATOM 8941  O O   . GLU C 1 77  ? 74.434  106.690 0.472    1.00 40.00 ? 81  GLU C O   1 
ATOM 8942  C CB  . GLU C 1 77  ? 74.742  105.807 3.625    1.00 40.00 ? 81  GLU C CB  1 
ATOM 8943  C CG  . GLU C 1 77  ? 76.076  105.405 3.028    1.00 40.00 ? 81  GLU C CG  1 
ATOM 8944  C CD  . GLU C 1 77  ? 76.496  103.988 3.375    1.00 40.00 ? 81  GLU C CD  1 
ATOM 8945  O OE1 . GLU C 1 77  ? 77.236  103.799 4.376    1.00 40.00 ? 81  GLU C OE1 1 
ATOM 8946  O OE2 . GLU C 1 77  ? 76.111  103.018 2.663    1.00 40.00 ? 81  GLU C OE2 1 
ATOM 8947  N N   . GLY C 1 78  ? 72.601  105.691 1.287    1.00 40.00 ? 82  GLY C N   1 
ATOM 8948  C CA  . GLY C 1 78  ? 72.244  105.131 -0.005   1.00 40.00 ? 82  GLY C CA  1 
ATOM 8949  C C   . GLY C 1 78  ? 72.136  106.146 -1.130   1.00 40.00 ? 82  GLY C C   1 
ATOM 8950  O O   . GLY C 1 78  ? 72.450  105.828 -2.292   1.00 40.00 ? 82  GLY C O   1 
ATOM 8951  N N   . THR C 1 79  ? 71.640  107.340 -0.805   1.00 40.00 ? 83  THR C N   1 
ATOM 8952  C CA  . THR C 1 79  ? 71.528  108.372 -1.831   1.00 40.00 ? 83  THR C CA  1 
ATOM 8953  C C   . THR C 1 79  ? 72.745  109.296 -1.766   1.00 40.00 ? 83  THR C C   1 
ATOM 8954  O O   . THR C 1 79  ? 73.356  109.626 -2.785   1.00 40.00 ? 83  THR C O   1 
ATOM 8955  C CB  . THR C 1 79  ? 70.287  109.242 -1.578   1.00 40.00 ? 83  THR C CB  1 
ATOM 8956  O OG1 . THR C 1 79  ? 70.122  109.409 -0.158   1.00 40.00 ? 83  THR C OG1 1 
ATOM 8957  C CG2 . THR C 1 79  ? 69.032  108.602 -2.131   1.00 40.00 ? 83  THR C CG2 1 
ATOM 8958  N N   . GLU C 1 80  ? 73.088  109.706 -0.544   1.00 40.00 ? 84  GLU C N   1 
ATOM 8959  C CA  . GLU C 1 80  ? 74.195  110.630 -0.376   1.00 40.00 ? 84  GLU C CA  1 
ATOM 8960  C C   . GLU C 1 80  ? 75.442  110.150 -1.072   1.00 40.00 ? 84  GLU C C   1 
ATOM 8961  O O   . GLU C 1 80  ? 76.036  110.899 -1.860   1.00 40.00 ? 84  GLU C O   1 
ATOM 8962  C CB  . GLU C 1 80  ? 74.475  110.923 1.077    1.00 40.00 ? 84  GLU C CB  1 
ATOM 8963  C CG  . GLU C 1 80  ? 73.398  111.600 1.886    1.00 40.00 ? 84  GLU C CG  1 
ATOM 8964  C CD  . GLU C 1 80  ? 72.953  112.955 1.407    1.00 40.00 ? 84  GLU C CD  1 
ATOM 8965  O OE1 . GLU C 1 80  ? 71.934  113.463 1.956    1.00 40.00 ? 84  GLU C OE1 1 
ATOM 8966  O OE2 . GLU C 1 80  ? 73.600  113.522 0.489    1.00 40.00 ? 84  GLU C OE2 1 
ATOM 8967  N N   . MET C 1 81  ? 75.824  108.891 -0.902   1.00 40.00 ? 85  MET C N   1 
ATOM 8968  C CA  . MET C 1 81  ? 77.022  108.320 -1.523   1.00 40.00 ? 85  MET C CA  1 
ATOM 8969  C C   . MET C 1 81  ? 77.171  108.618 -3.000   1.00 40.00 ? 85  MET C C   1 
ATOM 8970  O O   . MET C 1 81  ? 78.241  108.457 -3.591   1.00 40.00 ? 85  MET C O   1 
ATOM 8971  C CB  . MET C 1 81  ? 77.023  106.797 -1.322   1.00 40.00 ? 85  MET C CB  1 
ATOM 8972  C CG  . MET C 1 81  ? 75.885  106.132 -2.097   1.00 40.00 ? 85  MET C CG  1 
ATOM 8973  S SD  . MET C 1 81  ? 75.978  104.336 -2.040   1.00 40.00 ? 85  MET C SD  1 
ATOM 8974  C CE  . MET C 1 81  ? 77.399  104.046 -3.083   1.00 40.00 ? 85  MET C CE  1 
ATOM 8975  N N   . TRP C 1 82  ? 76.101  109.036 -3.662   1.00 40.00 ? 86  TRP C N   1 
ATOM 8976  C CA  . TRP C 1 82  ? 76.104  109.357 -5.066   1.00 40.00 ? 86  TRP C CA  1 
ATOM 8977  C C   . TRP C 1 82  ? 76.291  110.837 -5.363   1.00 40.00 ? 86  TRP C C   1 
ATOM 8978  O O   . TRP C 1 82  ? 76.681  111.170 -6.478   1.00 40.00 ? 86  TRP C O   1 
ATOM 8979  C CB  . TRP C 1 82  ? 74.770  108.841 -5.668   1.00 40.00 ? 86  TRP C CB  1 
ATOM 8980  C CG  . TRP C 1 82  ? 74.674  107.346 -5.543   1.00 40.00 ? 86  TRP C CG  1 
ATOM 8981  C CD1 . TRP C 1 82  ? 73.710  106.673 -4.862   1.00 40.00 ? 86  TRP C CD1 1 
ATOM 8982  C CD2 . TRP C 1 82  ? 75.566  106.366 -6.075   1.00 40.00 ? 86  TRP C CD2 1 
ATOM 8983  N NE1 . TRP C 1 82  ? 73.946  105.312 -4.937   1.00 40.00 ? 86  TRP C NE1 1 
ATOM 8984  C CE2 . TRP C 1 82  ? 75.076  105.103 -5.672   1.00 40.00 ? 86  TRP C CE2 1 
ATOM 8985  C CE3 . TRP C 1 82  ? 76.726  106.419 -6.851   1.00 40.00 ? 86  TRP C CE3 1 
ATOM 8986  C CZ2 . TRP C 1 82  ? 75.694  103.909 -6.031   1.00 40.00 ? 86  TRP C CZ2 1 
ATOM 8987  C CZ3 . TRP C 1 82  ? 77.358  105.240 -7.201   1.00 40.00 ? 86  TRP C CZ3 1 
ATOM 8988  C CH2 . TRP C 1 82  ? 76.837  103.997 -6.792   1.00 40.00 ? 86  TRP C CH2 1 
ATOM 8989  N N   . ASN C 1 83  ? 76.017  111.658 -4.378   1.00 40.00 ? 87  ASN C N   1 
ATOM 8990  C CA  . ASN C 1 83  ? 76.099  113.096 -4.372   1.00 40.00 ? 87  ASN C CA  1 
ATOM 8991  C C   . ASN C 1 83  ? 77.506  113.647 -4.480   1.00 40.00 ? 87  ASN C C   1 
ATOM 8992  O O   . ASN C 1 83  ? 78.512  112.974 -4.231   1.00 40.00 ? 87  ASN C O   1 
ATOM 8993  C CB  . ASN C 1 83  ? 75.402  113.571 -3.083   1.00 40.00 ? 87  ASN C CB  1 
ATOM 8994  C CG  . ASN C 1 83  ? 73.968  113.961 -3.361   1.00 40.00 ? 87  ASN C CG  1 
ATOM 8995  O OD1 . ASN C 1 83  ? 73.702  114.323 -4.525   1.00 40.00 ? 87  ASN C OD1 1 
ATOM 8996  N ND2 . ASN C 1 83  ? 73.071  113.917 -2.382   1.00 40.00 ? 87  ASN C ND2 1 
ATOM 8997  N N   . PRO C 1 84  ? 77.637  114.911 -4.866   1.00 40.00 ? 88  PRO C N   1 
ATOM 8998  C CA  . PRO C 1 84  ? 78.938  115.544 -5.051   1.00 40.00 ? 88  PRO C CA  1 
ATOM 8999  C C   . PRO C 1 84  ? 79.660  115.578 -3.718   1.00 40.00 ? 88  PRO C C   1 
ATOM 9000  O O   . PRO C 1 84  ? 78.980  115.710 -2.691   1.00 40.00 ? 88  PRO C O   1 
ATOM 9001  C CB  . PRO C 1 84  ? 78.655  116.857 -5.706   1.00 40.00 ? 88  PRO C CB  1 
ATOM 9002  C CG  . PRO C 1 84  ? 77.187  117.004 -5.822   1.00 40.00 ? 88  PRO C CG  1 
ATOM 9003  C CD  . PRO C 1 84  ? 76.525  115.842 -5.157   1.00 40.00 ? 88  PRO C CD  1 
ATOM 9004  N N   . ASN C 1 85  ? 80.989  115.368 -3.733   1.00 40.00 ? 89  ASN C N   1 
ATOM 9005  C CA  . ASN C 1 85  ? 81.718  115.353 -2.456   1.00 40.00 ? 89  ASN C CA  1 
ATOM 9006  C C   . ASN C 1 85  ? 82.806  116.434 -2.496   1.00 40.00 ? 89  ASN C C   1 
ATOM 9007  O O   . ASN C 1 85  ? 83.720  116.557 -1.681   1.00 40.00 ? 89  ASN C O   1 
ATOM 9008  C CB  . ASN C 1 85  ? 82.340  114.007 -2.144   1.00 40.00 ? 89  ASN C CB  1 
ATOM 9009  C CG  . ASN C 1 85  ? 83.344  113.567 -3.197   1.00 40.00 ? 89  ASN C CG  1 
ATOM 9010  O OD1 . ASN C 1 85  ? 83.497  114.133 -4.288   1.00 40.00 ? 89  ASN C OD1 1 
ATOM 9011  N ND2 . ASN C 1 85  ? 84.067  112.480 -2.891   1.00 40.00 ? 89  ASN C ND2 1 
ATOM 9012  N N   . ARG C 1 86  ? 82.700  117.219 -3.554   1.00 40.00 ? 90  ARG C N   1 
ATOM 9013  C CA  . ARG C 1 86  ? 83.583  118.336 -3.801   1.00 40.00 ? 90  ARG C CA  1 
ATOM 9014  C C   . ARG C 1 86  ? 82.704  119.544 -4.128   1.00 40.00 ? 90  ARG C C   1 
ATOM 9015  O O   . ARG C 1 86  ? 81.452  119.464 -4.171   1.00 40.00 ? 90  ARG C O   1 
ATOM 9016  C CB  . ARG C 1 86  ? 84.522  117.945 -4.912   1.00 40.00 ? 90  ARG C CB  1 
ATOM 9017  C CG  . ARG C 1 86  ? 85.851  117.358 -4.535   1.00 40.00 ? 90  ARG C CG  1 
ATOM 9018  C CD  . ARG C 1 86  ? 86.171  117.362 -3.047   1.00 40.00 ? 90  ARG C CD  1 
ATOM 9019  N NE  . ARG C 1 86  ? 87.354  116.572 -2.779   1.00 40.00 ? 90  ARG C NE  1 
ATOM 9020  C CZ  . ARG C 1 86  ? 87.510  115.604 -1.880   1.00 40.00 ? 90  ARG C CZ  1 
ATOM 9021  N NH1 . ARG C 1 86  ? 86.530  115.238 -1.061   1.00 40.00 ? 90  ARG C NH1 1 
ATOM 9022  N NH2 . ARG C 1 86  ? 88.707  114.993 -1.828   1.00 40.00 ? 90  ARG C NH2 1 
ATOM 9023  N N   . GLU C 1 87  ? 83.304  120.717 -4.320   1.00 40.00 ? 91  GLU C N   1 
ATOM 9024  C CA  . GLU C 1 87  ? 82.441  121.850 -4.620   1.00 40.00 ? 91  GLU C CA  1 
ATOM 9025  C C   . GLU C 1 87  ? 81.938  121.793 -6.047   1.00 40.00 ? 91  GLU C C   1 
ATOM 9026  O O   . GLU C 1 87  ? 82.621  121.301 -6.945   1.00 40.00 ? 91  GLU C O   1 
ATOM 9027  C CB  . GLU C 1 87  ? 83.158  123.164 -4.301   1.00 40.00 ? 91  GLU C CB  1 
ATOM 9028  C CG  . GLU C 1 87  ? 82.905  123.506 -2.816   1.00 40.00 ? 91  GLU C CG  1 
ATOM 9029  C CD  . GLU C 1 87  ? 83.163  124.975 -2.569   1.00 40.00 ? 91  GLU C CD  1 
ATOM 9030  O OE1 . GLU C 1 87  ? 83.710  125.292 -1.485   1.00 40.00 ? 91  GLU C OE1 1 
ATOM 9031  O OE2 . GLU C 1 87  ? 82.826  125.789 -3.462   1.00 40.00 ? 91  GLU C OE2 1 
ATOM 9032  N N   . LEU C 1 88  ? 80.703  122.324 -6.182   1.00 40.00 ? 92  LEU C N   1 
ATOM 9033  C CA  . LEU C 1 88  ? 80.151  122.349 -7.536   1.00 40.00 ? 92  LEU C CA  1 
ATOM 9034  C C   . LEU C 1 88  ? 80.846  123.422 -8.342   1.00 40.00 ? 92  LEU C C   1 
ATOM 9035  O O   . LEU C 1 88  ? 81.206  124.421 -7.727   1.00 40.00 ? 92  LEU C O   1 
ATOM 9036  C CB  . LEU C 1 88  ? 78.650  122.699 -7.424   1.00 40.00 ? 92  LEU C CB  1 
ATOM 9037  C CG  . LEU C 1 88  ? 77.894  121.432 -6.931   1.00 40.00 ? 92  LEU C CG  1 
ATOM 9038  C CD1 . LEU C 1 88  ? 76.454  121.756 -6.644   1.00 40.00 ? 92  LEU C CD1 1 
ATOM 9039  C CD2 . LEU C 1 88  ? 78.087  120.327 -7.961   1.00 40.00 ? 92  LEU C CD2 1 
ATOM 9040  N N   . SER C 1 89  ? 81.015  123.274 -9.634   1.00 40.00 ? 93  SER C N   1 
ATOM 9041  C CA  . SER C 1 89  ? 81.557  124.391 -10.382  1.00 40.00 ? 93  SER C CA  1 
ATOM 9042  C C   . SER C 1 89  ? 81.551  124.128 -11.872  1.00 40.00 ? 93  SER C C   1 
ATOM 9043  O O   . SER C 1 89  ? 81.878  122.994 -12.281  1.00 40.00 ? 93  SER C O   1 
ATOM 9044  C CB  . SER C 1 89  ? 82.978  124.732 -9.960   1.00 40.00 ? 93  SER C CB  1 
ATOM 9045  O OG  . SER C 1 89  ? 83.677  125.126 -11.162  1.00 40.00 ? 93  SER C OG  1 
ATOM 9046  N N   . GLU C 1 90  ? 81.356  125.147 -12.713  1.00 40.00 ? 94  GLU C N   1 
ATOM 9047  C CA  . GLU C 1 90  ? 81.441  124.858 -14.152  1.00 40.00 ? 94  GLU C CA  1 
ATOM 9048  C C   . GLU C 1 90  ? 82.896  124.556 -14.474  1.00 40.00 ? 94  GLU C C   1 
ATOM 9049  O O   . GLU C 1 90  ? 83.231  123.999 -15.534  1.00 40.00 ? 94  GLU C O   1 
ATOM 9050  C CB  . GLU C 1 90  ? 80.872  125.998 -14.966  1.00 40.00 ? 94  GLU C CB  1 
ATOM 9051  C CG  . GLU C 1 90  ? 79.364  126.230 -14.775  1.00 40.00 ? 94  GLU C CG  1 
ATOM 9052  C CD  . GLU C 1 90  ? 78.813  127.081 -15.921  1.00 40.00 ? 94  GLU C CD  1 
ATOM 9053  O OE1 . GLU C 1 90  ? 78.888  126.596 -17.092  1.00 40.00 ? 94  GLU C OE1 1 
ATOM 9054  O OE2 . GLU C 1 90  ? 78.334  128.209 -15.672  1.00 40.00 ? 94  GLU C OE2 1 
ATOM 9055  N N   . ASP C 1 91  ? 83.837  124.923 -13.604  1.00 40.00 ? 95  ASP C N   1 
ATOM 9056  C CA  . ASP C 1 91  ? 85.241  124.620 -13.860  1.00 40.00 ? 95  ASP C CA  1 
ATOM 9057  C C   . ASP C 1 91  ? 85.570  123.274 -13.178  1.00 40.00 ? 95  ASP C C   1 
ATOM 9058  O O   . ASP C 1 91  ? 85.932  123.303 -11.989  1.00 40.00 ? 95  ASP C O   1 
ATOM 9059  C CB  . ASP C 1 91  ? 86.146  125.716 -13.347  1.00 40.00 ? 95  ASP C CB  1 
ATOM 9060  C CG  . ASP C 1 91  ? 87.583  125.437 -13.774  1.00 40.00 ? 95  ASP C CG  1 
ATOM 9061  O OD1 . ASP C 1 91  ? 87.732  124.516 -14.632  1.00 40.00 ? 95  ASP C OD1 1 
ATOM 9062  O OD2 . ASP C 1 91  ? 88.514  126.099 -13.284  1.00 40.00 ? 95  ASP C OD2 1 
ATOM 9063  N N   . CYS C 1 92  ? 85.395  122.196 -13.969  1.00 40.00 ? 96  CYS C N   1 
ATOM 9064  C CA  . CYS C 1 92  ? 85.502  120.838 -13.478  1.00 40.00 ? 96  CYS C CA  1 
ATOM 9065  C C   . CYS C 1 92  ? 86.132  119.823 -14.397  1.00 40.00 ? 96  CYS C C   1 
ATOM 9066  O O   . CYS C 1 92  ? 86.178  118.628 -14.044  1.00 40.00 ? 96  CYS C O   1 
ATOM 9067  C CB  . CYS C 1 92  ? 84.043  120.312 -13.198  1.00 40.00 ? 96  CYS C CB  1 
ATOM 9068  S SG  . CYS C 1 92  ? 83.007  120.318 -14.677  1.00 40.00 ? 96  CYS C SG  1 
ATOM 9069  N N   . LEU C 1 93  ? 86.617  120.225 -15.558  1.00 40.00 ? 97  LEU C N   1 
ATOM 9070  C CA  . LEU C 1 93  ? 87.252  119.317 -16.496  1.00 40.00 ? 97  LEU C CA  1 
ATOM 9071  C C   . LEU C 1 93  ? 88.639  118.886 -16.125  1.00 40.00 ? 97  LEU C C   1 
ATOM 9072  O O   . LEU C 1 93  ? 89.666  119.350 -16.659  1.00 40.00 ? 97  LEU C O   1 
ATOM 9073  C CB  . LEU C 1 93  ? 87.259  119.942 -17.915  1.00 40.00 ? 97  LEU C CB  1 
ATOM 9074  C CG  . LEU C 1 93  ? 85.828  120.114 -18.430  1.00 40.00 ? 97  LEU C CG  1 
ATOM 9075  C CD1 . LEU C 1 93  ? 85.748  120.316 -19.933  1.00 40.00 ? 97  LEU C CD1 1 
ATOM 9076  C CD2 . LEU C 1 93  ? 84.975  118.938 -17.985  1.00 40.00 ? 97  LEU C CD2 1 
ATOM 9077  N N   . TYR C 1 94  ? 88.740  117.986 -15.156  1.00 40.00 ? 98  TYR C N   1 
ATOM 9078  C CA  . TYR C 1 94  ? 89.985  117.418 -14.677  1.00 40.00 ? 98  TYR C CA  1 
ATOM 9079  C C   . TYR C 1 94  ? 89.868  115.902 -14.724  1.00 40.00 ? 98  TYR C C   1 
ATOM 9080  O O   . TYR C 1 94  ? 88.738  115.436 -14.937  1.00 40.00 ? 98  TYR C O   1 
ATOM 9081  C CB  . TYR C 1 94  ? 90.201  117.851 -13.211  1.00 40.00 ? 98  TYR C CB  1 
ATOM 9082  C CG  . TYR C 1 94  ? 90.182  119.369 -13.157  1.00 40.00 ? 98  TYR C CG  1 
ATOM 9083  C CD1 . TYR C 1 94  ? 90.845  120.105 -14.134  1.00 40.00 ? 98  TYR C CD1 1 
ATOM 9084  C CD2 . TYR C 1 94  ? 89.513  120.094 -12.235  1.00 40.00 ? 98  TYR C CD2 1 
ATOM 9085  C CE1 . TYR C 1 94  ? 90.834  121.481 -14.175  1.00 40.00 ? 98  TYR C CE1 1 
ATOM 9086  C CE2 . TYR C 1 94  ? 89.511  121.465 -12.197  1.00 40.00 ? 98  TYR C CE2 1 
ATOM 9087  C CZ  . TYR C 1 94  ? 90.170  122.170 -13.169  1.00 40.00 ? 98  TYR C CZ  1 
ATOM 9088  O OH  . TYR C 1 94  ? 90.160  123.534 -13.170  1.00 40.00 ? 98  TYR C OH  1 
ATOM 9089  N N   . LEU C 1 95  ? 90.980  115.201 -14.598  1.00 40.00 ? 99  LEU C N   1 
ATOM 9090  C CA  . LEU C 1 95  ? 90.881  113.728 -14.564  1.00 40.00 ? 99  LEU C CA  1 
ATOM 9091  C C   . LEU C 1 95  ? 91.752  113.261 -13.427  1.00 40.00 ? 99  LEU C C   1 
ATOM 9092  O O   . LEU C 1 95  ? 92.331  114.065 -12.678  1.00 40.00 ? 99  LEU C O   1 
ATOM 9093  C CB  . LEU C 1 95  ? 91.245  113.168 -15.907  1.00 40.00 ? 99  LEU C CB  1 
ATOM 9094  C CG  . LEU C 1 95  ? 92.641  113.488 -16.403  1.00 40.00 ? 99  LEU C CG  1 
ATOM 9095  C CD1 . LEU C 1 95  ? 93.602  112.531 -15.679  1.00 40.00 ? 99  LEU C CD1 1 
ATOM 9096  C CD2 . LEU C 1 95  ? 92.782  113.298 -17.915  1.00 40.00 ? 99  LEU C CD2 1 
ATOM 9097  N N   . ASN C 1 96  ? 91.825  111.978 -13.174  1.00 40.00 ? 100 ASN C N   1 
ATOM 9098  C CA  . ASN C 1 96  ? 92.692  111.480 -12.115  1.00 40.00 ? 100 ASN C CA  1 
ATOM 9099  C C   . ASN C 1 96  ? 93.516  110.313 -12.658  1.00 40.00 ? 100 ASN C C   1 
ATOM 9100  O O   . ASN C 1 96  ? 93.192  109.680 -13.672  1.00 40.00 ? 100 ASN C O   1 
ATOM 9101  C CB  . ASN C 1 96  ? 91.926  111.004 -10.881  1.00 40.00 ? 100 ASN C CB  1 
ATOM 9102  C CG  . ASN C 1 96  ? 90.943  112.109 -10.478  1.00 40.00 ? 100 ASN C CG  1 
ATOM 9103  O OD1 . ASN C 1 96  ? 91.360  113.169 -10.075  1.00 40.00 ? 100 ASN C OD1 1 
ATOM 9104  N ND2 . ASN C 1 96  ? 89.687  111.799 -10.693  1.00 40.00 ? 100 ASN C ND2 1 
ATOM 9105  N N   . VAL C 1 97  ? 94.626  110.048 -11.961  1.00 40.00 ? 101 VAL C N   1 
ATOM 9106  C CA  . VAL C 1 97  ? 95.448  108.908 -12.308  1.00 40.00 ? 101 VAL C CA  1 
ATOM 9107  C C   . VAL C 1 97  ? 95.932  108.220 -11.017  1.00 40.00 ? 101 VAL C C   1 
ATOM 9108  O O   . VAL C 1 97  ? 96.374  108.909 -10.088  1.00 40.00 ? 101 VAL C O   1 
ATOM 9109  C CB  . VAL C 1 97  ? 96.679  109.215 -13.160  1.00 40.00 ? 101 VAL C CB  1 
ATOM 9110  C CG1 . VAL C 1 97  ? 97.494  107.923 -13.330  1.00 40.00 ? 101 VAL C CG1 1 
ATOM 9111  C CG2 . VAL C 1 97  ? 96.335  109.760 -14.547  1.00 40.00 ? 101 VAL C CG2 1 
ATOM 9112  N N   . TRP C 1 98  ? 95.822  106.902 -11.012  1.00 40.00 ? 102 TRP C N   1 
ATOM 9113  C CA  . TRP C 1 98  ? 96.386  106.126 -9.920   1.00 40.00 ? 102 TRP C CA  1 
ATOM 9114  C C   . TRP C 1 98  ? 97.376  105.169 -10.642  1.00 40.00 ? 102 TRP C C   1 
ATOM 9115  O O   . TRP C 1 98  ? 97.038  104.646 -11.695  1.00 40.00 ? 102 TRP C O   1 
ATOM 9116  C CB  . TRP C 1 98  ? 95.507  105.395 -8.999   1.00 40.00 ? 102 TRP C CB  1 
ATOM 9117  C CG  . TRP C 1 98  ? 94.399  106.010 -8.232   1.00 40.00 ? 102 TRP C CG  1 
ATOM 9118  C CD1 . TRP C 1 98  ? 94.243  106.017 -6.860   1.00 40.00 ? 102 TRP C CD1 1 
ATOM 9119  C CD2 . TRP C 1 98  ? 93.223  106.659 -8.737   1.00 40.00 ? 102 TRP C CD2 1 
ATOM 9120  N NE1 . TRP C 1 98  ? 93.062  106.631 -6.486   1.00 40.00 ? 102 TRP C NE1 1 
ATOM 9121  C CE2 . TRP C 1 98  ? 92.423  107.024 -7.633   1.00 40.00 ? 102 TRP C CE2 1 
ATOM 9122  C CE3 . TRP C 1 98  ? 92.778  106.956 -10.029  1.00 40.00 ? 102 TRP C CE3 1 
ATOM 9123  C CZ2 . TRP C 1 98  ? 91.220  107.696 -7.781   1.00 40.00 ? 102 TRP C CZ2 1 
ATOM 9124  C CZ3 . TRP C 1 98  ? 91.576  107.621 -10.170  1.00 40.00 ? 102 TRP C CZ3 1 
ATOM 9125  C CH2 . TRP C 1 98  ? 90.820  107.981 -9.052   1.00 40.00 ? 102 TRP C CH2 1 
ATOM 9126  N N   . THR C 1 99  ? 98.562  105.048 -10.097  1.00 40.00 ? 103 THR C N   1 
ATOM 9127  C CA  . THR C 1 99  ? 99.633  104.181 -10.601  1.00 40.00 ? 103 THR C CA  1 
ATOM 9128  C C   . THR C 1 99  ? 100.190 103.549 -9.313   1.00 40.00 ? 103 THR C C   1 
ATOM 9129  O O   . THR C 1 99  ? 100.171 104.239 -8.280   1.00 40.00 ? 103 THR C O   1 
ATOM 9130  C CB  . THR C 1 99  ? 100.768 104.938 -11.284  1.00 40.00 ? 103 THR C CB  1 
ATOM 9131  O OG1 . THR C 1 99  ? 100.348 105.446 -12.563  1.00 40.00 ? 103 THR C OG1 1 
ATOM 9132  C CG2 . THR C 1 99  ? 102.023 104.112 -11.555  1.00 40.00 ? 103 THR C CG2 1 
ATOM 9133  N N   . PRO C 1 100 ? 100.647 102.318 -9.408   1.00 40.00 ? 104 PRO C N   1 
ATOM 9134  C CA  . PRO C 1 100 ? 101.257 101.634 -8.265   1.00 40.00 ? 104 PRO C CA  1 
ATOM 9135  C C   . PRO C 1 100 ? 102.576 102.299 -7.870   1.00 40.00 ? 104 PRO C C   1 
ATOM 9136  O O   . PRO C 1 100 ? 103.254 102.780 -8.790   1.00 40.00 ? 104 PRO C O   1 
ATOM 9137  C CB  . PRO C 1 100 ? 101.509 100.238 -8.806   1.00 40.00 ? 104 PRO C CB  1 
ATOM 9138  C CG  . PRO C 1 100 ? 101.666 100.415 -10.285  1.00 40.00 ? 104 PRO C CG  1 
ATOM 9139  C CD  . PRO C 1 100 ? 100.676 101.497 -10.637  1.00 40.00 ? 104 PRO C CD  1 
ATOM 9140  N N   . TYR C 1 101 ? 102.907 102.367 -6.594   1.00 40.00 ? 105 TYR C N   1 
ATOM 9141  C CA  . TYR C 1 101 ? 104.155 102.976 -6.099   1.00 40.00 ? 105 TYR C CA  1 
ATOM 9142  C C   . TYR C 1 101 ? 105.115 101.813 -5.828   1.00 40.00 ? 105 TYR C C   1 
ATOM 9143  O O   . TYR C 1 101 ? 104.851 100.988 -4.950   1.00 40.00 ? 105 TYR C O   1 
ATOM 9144  C CB  . TYR C 1 101 ? 103.921 103.729 -4.796   1.00 40.00 ? 105 TYR C CB  1 
ATOM 9145  C CG  . TYR C 1 101 ? 105.079 104.554 -4.299   1.00 40.00 ? 105 TYR C CG  1 
ATOM 9146  C CD1 . TYR C 1 101 ? 105.508 105.656 -5.039   1.00 40.00 ? 105 TYR C CD1 1 
ATOM 9147  C CD2 . TYR C 1 101 ? 105.743 104.259 -3.112   1.00 40.00 ? 105 TYR C CD2 1 
ATOM 9148  C CE1 . TYR C 1 101 ? 106.559 106.423 -4.587   1.00 40.00 ? 105 TYR C CE1 1 
ATOM 9149  C CE2 . TYR C 1 101 ? 106.801 105.026 -2.662   1.00 40.00 ? 105 TYR C CE2 1 
ATOM 9150  C CZ  . TYR C 1 101 ? 107.210 106.112 -3.415   1.00 40.00 ? 105 TYR C CZ  1 
ATOM 9151  O OH  . TYR C 1 101 ? 108.265 106.910 -3.018   1.00 40.00 ? 105 TYR C OH  1 
ATOM 9152  N N   . PRO C 1 102 ? 106.164 101.732 -6.615   1.00 40.00 ? 106 PRO C N   1 
ATOM 9153  C CA  . PRO C 1 102 ? 106.536 102.699 -7.615   1.00 40.00 ? 106 PRO C CA  1 
ATOM 9154  C C   . PRO C 1 102 ? 106.123 102.418 -9.039   1.00 40.00 ? 106 PRO C C   1 
ATOM 9155  O O   . PRO C 1 102 ? 105.724 101.285 -9.330   1.00 40.00 ? 106 PRO C O   1 
ATOM 9156  C CB  . PRO C 1 102 ? 108.082 102.535 -7.592   1.00 40.00 ? 106 PRO C CB  1 
ATOM 9157  C CG  . PRO C 1 102 ? 108.210 101.040 -7.511   1.00 40.00 ? 106 PRO C CG  1 
ATOM 9158  C CD  . PRO C 1 102 ? 107.169 100.626 -6.498   1.00 40.00 ? 106 PRO C CD  1 
ATOM 9159  N N   . ARG C 1 103 ? 106.140 103.464 -9.861   1.00 40.00 ? 107 ARG C N   1 
ATOM 9160  C CA  . ARG C 1 103 ? 105.738 103.325 -11.260  1.00 40.00 ? 107 ARG C CA  1 
ATOM 9161  C C   . ARG C 1 103 ? 106.068 101.933 -11.761  1.00 40.00 ? 107 ARG C C   1 
ATOM 9162  O O   . ARG C 1 103 ? 107.078 101.341 -11.395  1.00 40.00 ? 107 ARG C O   1 
ATOM 9163  C CB  . ARG C 1 103 ? 106.383 104.399 -12.131  1.00 40.00 ? 107 ARG C CB  1 
ATOM 9164  C CG  . ARG C 1 103 ? 105.560 105.686 -12.104  1.00 40.00 ? 107 ARG C CG  1 
ATOM 9165  C CD  . ARG C 1 103 ? 105.646 106.426 -13.430  1.00 40.00 ? 107 ARG C CD  1 
ATOM 9166  N NE  . ARG C 1 103 ? 106.725 107.405 -13.440  1.00 40.00 ? 107 ARG C NE  1 
ATOM 9167  C CZ  . ARG C 1 103 ? 106.876 108.355 -12.527  1.00 40.00 ? 107 ARG C CZ  1 
ATOM 9168  N NH1 . ARG C 1 103 ? 106.020 108.482 -11.515  1.00 40.00 ? 107 ARG C NH1 1 
ATOM 9169  N NH2 . ARG C 1 103 ? 107.896 109.200 -12.611  1.00 40.00 ? 107 ARG C NH2 1 
ATOM 9170  N N   . PRO C 1 104 ? 105.181 101.382 -12.579  1.00 40.00 ? 108 PRO C N   1 
ATOM 9171  C CA  . PRO C 1 104 ? 105.365 100.046 -13.109  1.00 40.00 ? 108 PRO C CA  1 
ATOM 9172  C C   . PRO C 1 104 ? 106.708 99.973  -13.822  1.00 40.00 ? 108 PRO C C   1 
ATOM 9173  O O   . PRO C 1 104 ? 107.365 100.988 -14.013  1.00 40.00 ? 108 PRO C O   1 
ATOM 9174  C CB  . PRO C 1 104 ? 104.238 99.838  -14.095  1.00 40.00 ? 108 PRO C CB  1 
ATOM 9175  C CG  . PRO C 1 104 ? 103.590 101.158 -14.300  1.00 40.00 ? 108 PRO C CG  1 
ATOM 9176  C CD  . PRO C 1 104 ? 103.950 102.007 -13.109  1.00 40.00 ? 108 PRO C CD  1 
ATOM 9177  N N   . ALA C 1 105 ? 107.045 98.761  -14.221  1.00 40.00 ? 109 ALA C N   1 
ATOM 9178  C CA  . ALA C 1 105 ? 108.320 98.536  -14.892  1.00 40.00 ? 109 ALA C CA  1 
ATOM 9179  C C   . ALA C 1 105 ? 108.237 98.841  -16.385  1.00 40.00 ? 109 ALA C C   1 
ATOM 9180  O O   . ALA C 1 105 ? 109.014 99.547  -17.008  1.00 40.00 ? 109 ALA C O   1 
ATOM 9181  C CB  . ALA C 1 105 ? 108.718 97.071  -14.682  1.00 40.00 ? 109 ALA C CB  1 
ATOM 9182  N N   . SER C 1 106 ? 107.208 98.235  -16.954  1.00 40.00 ? 110 SER C N   1 
ATOM 9183  C CA  . SER C 1 106 ? 106.821 98.237  -18.346  1.00 40.00 ? 110 SER C CA  1 
ATOM 9184  C C   . SER C 1 106 ? 105.387 98.723  -18.524  1.00 40.00 ? 110 SER C C   1 
ATOM 9185  O O   . SER C 1 106 ? 104.600 98.723  -17.563  1.00 40.00 ? 110 SER C O   1 
ATOM 9186  C CB  . SER C 1 106 ? 106.951 96.765  -18.793  1.00 40.00 ? 110 SER C CB  1 
ATOM 9187  O OG  . SER C 1 106 ? 106.336 96.533  -20.031  1.00 40.00 ? 110 SER C OG  1 
ATOM 9188  N N   . PRO C 1 107 ? 105.016 99.123  -19.735  1.00 40.00 ? 111 PRO C N   1 
ATOM 9189  C CA  . PRO C 1 107 ? 103.707 99.610  -20.068  1.00 40.00 ? 111 PRO C CA  1 
ATOM 9190  C C   . PRO C 1 107 ? 102.520 98.815  -19.579  1.00 40.00 ? 111 PRO C C   1 
ATOM 9191  O O   . PRO C 1 107 ? 102.062 97.929  -20.320  1.00 40.00 ? 111 PRO C O   1 
ATOM 9192  C CB  . PRO C 1 107 ? 103.709 99.593  -21.615  1.00 40.00 ? 111 PRO C CB  1 
ATOM 9193  C CG  . PRO C 1 107 ? 105.128 99.915  -21.948  1.00 40.00 ? 111 PRO C CG  1 
ATOM 9194  C CD  . PRO C 1 107 ? 105.919 99.152  -20.921  1.00 40.00 ? 111 PRO C CD  1 
ATOM 9195  N N   . THR C 1 108 ? 102.007 99.137  -18.399  1.00 40.00 ? 112 THR C N   1 
ATOM 9196  C CA  . THR C 1 108 ? 100.835 98.446  -17.847  1.00 40.00 ? 112 THR C CA  1 
ATOM 9197  C C   . THR C 1 108 ? 99.604  98.865  -18.636  1.00 40.00 ? 112 THR C C   1 
ATOM 9198  O O   . THR C 1 108 ? 99.575  99.954  -19.205  1.00 40.00 ? 112 THR C O   1 
ATOM 9199  C CB  . THR C 1 108 ? 100.662 98.845  -16.367  1.00 40.00 ? 112 THR C CB  1 
ATOM 9200  O OG1 . THR C 1 108 ? 101.739 98.215  -15.641  1.00 40.00 ? 112 THR C OG1 1 
ATOM 9201  C CG2 . THR C 1 108 ? 99.380  98.457  -15.688  1.00 40.00 ? 112 THR C CG2 1 
ATOM 9202  N N   . PRO C 1 109 ? 98.605  97.996  -18.662  1.00 40.00 ? 113 PRO C N   1 
ATOM 9203  C CA  . PRO C 1 109 ? 97.326  98.290  -19.293  1.00 40.00 ? 113 PRO C CA  1 
ATOM 9204  C C   . PRO C 1 109 ? 96.557  99.327  -18.466  1.00 40.00 ? 113 PRO C C   1 
ATOM 9205  O O   . PRO C 1 109 ? 96.612  99.369  -17.219  1.00 40.00 ? 113 PRO C O   1 
ATOM 9206  C CB  . PRO C 1 109 ? 96.624  96.932  -19.262  1.00 40.00 ? 113 PRO C CB  1 
ATOM 9207  C CG  . PRO C 1 109 ? 97.124  96.306  -17.994  1.00 40.00 ? 113 PRO C CG  1 
ATOM 9208  C CD  . PRO C 1 109 ? 98.593  96.655  -18.010  1.00 40.00 ? 113 PRO C CD  1 
ATOM 9209  N N   . VAL C 1 110 ? 95.818  100.198 -19.168  1.00 40.00 ? 114 VAL C N   1 
ATOM 9210  C CA  . VAL C 1 110 ? 95.038  101.218 -18.485  1.00 40.00 ? 114 VAL C CA  1 
ATOM 9211  C C   . VAL C 1 110 ? 93.528  100.992 -18.545  1.00 40.00 ? 114 VAL C C   1 
ATOM 9212  O O   . VAL C 1 110 ? 92.926  100.678 -19.572  1.00 40.00 ? 114 VAL C O   1 
ATOM 9213  C CB  . VAL C 1 110 ? 95.263  102.638 -19.037  1.00 40.00 ? 114 VAL C CB  1 
ATOM 9214  C CG1 . VAL C 1 110 ? 96.649  103.116 -18.661  1.00 40.00 ? 114 VAL C CG1 1 
ATOM 9215  C CG2 . VAL C 1 110 ? 95.043  102.642 -20.547  1.00 40.00 ? 114 VAL C CG2 1 
ATOM 9216  N N   . LEU C 1 111 ? 92.939  101.232 -17.386  1.00 40.00 ? 115 LEU C N   1 
ATOM 9217  C CA  . LEU C 1 111 ? 91.515  101.180 -17.146  1.00 40.00 ? 115 LEU C CA  1 
ATOM 9218  C C   . LEU C 1 111 ? 90.949  102.597 -16.953  1.00 40.00 ? 115 LEU C C   1 
ATOM 9219  O O   . LEU C 1 111 ? 91.045  103.126 -15.833  1.00 40.00 ? 115 LEU C O   1 
ATOM 9220  C CB  . LEU C 1 111 ? 91.241  100.406 -15.846  1.00 40.00 ? 115 LEU C CB  1 
ATOM 9221  C CG  . LEU C 1 111 ? 90.603  99.028  -15.980  1.00 40.00 ? 115 LEU C CG  1 
ATOM 9222  C CD1 . LEU C 1 111 ? 91.129  98.319  -17.219  1.00 40.00 ? 115 LEU C CD1 1 
ATOM 9223  C CD2 . LEU C 1 111 ? 90.826  98.214  -14.711  1.00 40.00 ? 115 LEU C CD2 1 
ATOM 9224  N N   . ILE C 1 112 ? 90.392  103.206 -17.978  1.00 40.00 ? 116 ILE C N   1 
ATOM 9225  C CA  . ILE C 1 112 ? 89.771  104.539 -17.930  1.00 40.00 ? 116 ILE C CA  1 
ATOM 9226  C C   . ILE C 1 112 ? 88.322  104.400 -17.461  1.00 40.00 ? 116 ILE C C   1 
ATOM 9227  O O   . ILE C 1 112 ? 87.530  103.762 -18.185  1.00 40.00 ? 116 ILE C O   1 
ATOM 9228  C CB  . ILE C 1 112 ? 89.782  105.097 -19.363  1.00 40.00 ? 116 ILE C CB  1 
ATOM 9229  C CG1 . ILE C 1 112 ? 91.144  105.739 -19.667  1.00 40.00 ? 116 ILE C CG1 1 
ATOM 9230  C CG2 . ILE C 1 112 ? 88.716  106.103 -19.677  1.00 40.00 ? 116 ILE C CG2 1 
ATOM 9231  C CD1 . ILE C 1 112 ? 91.436  105.821 -21.170  1.00 40.00 ? 116 ILE C CD1 1 
ATOM 9232  N N   . TRP C 1 113 ? 87.950  104.946 -16.312  1.00 40.00 ? 117 TRP C N   1 
ATOM 9233  C CA  . TRP C 1 113 ? 86.579  104.800 -15.820  1.00 40.00 ? 117 TRP C CA  1 
ATOM 9234  C C   . TRP C 1 113 ? 85.664  105.960 -16.153  1.00 40.00 ? 117 TRP C C   1 
ATOM 9235  O O   . TRP C 1 113 ? 86.021  107.133 -16.019  1.00 40.00 ? 117 TRP C O   1 
ATOM 9236  C CB  . TRP C 1 113 ? 86.601  104.611 -14.308  1.00 40.00 ? 117 TRP C CB  1 
ATOM 9237  C CG  . TRP C 1 113 ? 85.322  104.892 -13.598  1.00 40.00 ? 117 TRP C CG  1 
ATOM 9238  C CD1 . TRP C 1 113 ? 84.930  106.035 -12.980  1.00 40.00 ? 117 TRP C CD1 1 
ATOM 9239  C CD2 . TRP C 1 113 ? 84.243  103.965 -13.429  1.00 40.00 ? 117 TRP C CD2 1 
ATOM 9240  N NE1 . TRP C 1 113 ? 83.673  105.875 -12.421  1.00 40.00 ? 117 TRP C NE1 1 
ATOM 9241  C CE2 . TRP C 1 113 ? 83.230  104.617 -12.683  1.00 40.00 ? 117 TRP C CE2 1 
ATOM 9242  C CE3 . TRP C 1 113 ? 84.042  102.635 -13.822  1.00 40.00 ? 117 TRP C CE3 1 
ATOM 9243  C CZ2 . TRP C 1 113 ? 82.042  103.988 -12.337  1.00 40.00 ? 117 TRP C CZ2 1 
ATOM 9244  C CZ3 . TRP C 1 113 ? 82.867  102.023 -13.487  1.00 40.00 ? 117 TRP C CZ3 1 
ATOM 9245  C CH2 . TRP C 1 113 ? 81.882  102.685 -12.749  1.00 40.00 ? 117 TRP C CH2 1 
ATOM 9246  N N   . ILE C 1 114 ? 84.414  105.639 -16.541  1.00 40.00 ? 118 ILE C N   1 
ATOM 9247  C CA  . ILE C 1 114 ? 83.467  106.724 -16.842  1.00 40.00 ? 118 ILE C CA  1 
ATOM 9248  C C   . ILE C 1 114 ? 82.287  106.691 -15.902  1.00 40.00 ? 118 ILE C C   1 
ATOM 9249  O O   . ILE C 1 114 ? 81.453  105.826 -16.055  1.00 40.00 ? 118 ILE C O   1 
ATOM 9250  C CB  . ILE C 1 114 ? 83.009  106.682 -18.297  1.00 40.00 ? 118 ILE C CB  1 
ATOM 9251  C CG1 . ILE C 1 114 ? 84.213  106.701 -19.243  1.00 40.00 ? 118 ILE C CG1 1 
ATOM 9252  C CG2 . ILE C 1 114 ? 82.160  107.914 -18.524  1.00 40.00 ? 118 ILE C CG2 1 
ATOM 9253  C CD1 . ILE C 1 114 ? 83.871  106.854 -20.724  1.00 40.00 ? 118 ILE C CD1 1 
ATOM 9254  N N   . TYR C 1 115 ? 82.183  107.581 -14.930  1.00 40.00 ? 119 TYR C N   1 
ATOM 9255  C CA  . TYR C 1 115 ? 81.081  107.582 -13.978  1.00 40.00 ? 119 TYR C CA  1 
ATOM 9256  C C   . TYR C 1 115 ? 79.714  107.754 -14.657  1.00 40.00 ? 119 TYR C C   1 
ATOM 9257  O O   . TYR C 1 115 ? 79.629  108.309 -15.769  1.00 40.00 ? 119 TYR C O   1 
ATOM 9258  C CB  . TYR C 1 115 ? 81.248  108.666 -12.922  1.00 40.00 ? 119 TYR C CB  1 
ATOM 9259  C CG  . TYR C 1 115 ? 81.201  110.110 -13.362  1.00 40.00 ? 119 TYR C CG  1 
ATOM 9260  C CD1 . TYR C 1 115 ? 80.045  110.760 -13.760  1.00 40.00 ? 119 TYR C CD1 1 
ATOM 9261  C CD2 . TYR C 1 115 ? 82.371  110.869 -13.352  1.00 40.00 ? 119 TYR C CD2 1 
ATOM 9262  C CE1 . TYR C 1 115 ? 80.051  112.083 -14.136  1.00 40.00 ? 119 TYR C CE1 1 
ATOM 9263  C CE2 . TYR C 1 115 ? 82.402  112.193 -13.728  1.00 40.00 ? 119 TYR C CE2 1 
ATOM 9264  C CZ  . TYR C 1 115 ? 81.229  112.807 -14.128  1.00 40.00 ? 119 TYR C CZ  1 
ATOM 9265  O OH  . TYR C 1 115 ? 81.250  114.133 -14.525  1.00 40.00 ? 119 TYR C OH  1 
ATOM 9266  N N   . GLY C 1 116 ? 78.655  107.312 -13.962  1.00 40.00 ? 120 GLY C N   1 
ATOM 9267  C CA  . GLY C 1 116 ? 77.331  107.481 -14.545  1.00 40.00 ? 120 GLY C CA  1 
ATOM 9268  C C   . GLY C 1 116 ? 76.335  108.067 -13.548  1.00 40.00 ? 120 GLY C C   1 
ATOM 9269  O O   . GLY C 1 116 ? 76.372  107.800 -12.342  1.00 40.00 ? 120 GLY C O   1 
ATOM 9270  N N   . GLY C 1 117 ? 75.372  108.863 -14.040  1.00 40.00 ? 121 GLY C N   1 
ATOM 9271  C CA  . GLY C 1 117 ? 74.348  109.428 -13.147  1.00 40.00 ? 121 GLY C CA  1 
ATOM 9272  C C   . GLY C 1 117 ? 73.248  110.062 -13.993  1.00 40.00 ? 121 GLY C C   1 
ATOM 9273  O O   . GLY C 1 117 ? 72.947  111.266 -13.916  1.00 40.00 ? 121 GLY C O   1 
ATOM 9274  N N   . GLY C 1 118 ? 72.689  109.251 -14.897  1.00 40.00 ? 122 GLY C N   1 
ATOM 9275  C CA  . GLY C 1 118 ? 71.624  109.710 -15.778  1.00 40.00 ? 122 GLY C CA  1 
ATOM 9276  C C   . GLY C 1 118 ? 72.075  110.742 -16.770  1.00 40.00 ? 122 GLY C C   1 
ATOM 9277  O O   . GLY C 1 118 ? 71.226  111.398 -17.397  1.00 40.00 ? 122 GLY C O   1 
ATOM 9278  N N   . PHE C 1 119 ? 73.356  111.008 -16.919  1.00 40.00 ? 123 PHE C N   1 
ATOM 9279  C CA  . PHE C 1 119 ? 73.861  112.071 -17.765  1.00 40.00 ? 123 PHE C CA  1 
ATOM 9280  C C   . PHE C 1 119 ? 73.592  113.430 -17.109  1.00 40.00 ? 123 PHE C C   1 
ATOM 9281  O O   . PHE C 1 119 ? 73.859  114.460 -17.723  1.00 40.00 ? 123 PHE C O   1 
ATOM 9282  C CB  . PHE C 1 119 ? 73.198  112.062 -19.156  1.00 40.00 ? 123 PHE C CB  1 
ATOM 9283  C CG  . PHE C 1 119 ? 73.792  111.034 -20.054  1.00 40.00 ? 123 PHE C CG  1 
ATOM 9284  C CD1 . PHE C 1 119 ? 75.146  111.037 -20.340  1.00 40.00 ? 123 PHE C CD1 1 
ATOM 9285  C CD2 . PHE C 1 119 ? 73.004  110.034 -20.600  1.00 40.00 ? 123 PHE C CD2 1 
ATOM 9286  C CE1 . PHE C 1 119 ? 75.713  110.076 -21.148  1.00 40.00 ? 123 PHE C CE1 1 
ATOM 9287  C CE2 . PHE C 1 119 ? 73.568  109.066 -21.422  1.00 40.00 ? 123 PHE C CE2 1 
ATOM 9288  C CZ  . PHE C 1 119 ? 74.928  109.094 -21.688  1.00 40.00 ? 123 PHE C CZ  1 
ATOM 9289  N N   . TYR C 1 120 ? 73.050  113.460 -15.911  1.00 40.00 ? 124 TYR C N   1 
ATOM 9290  C CA  . TYR C 1 120 ? 72.667  114.667 -15.218  1.00 40.00 ? 124 TYR C CA  1 
ATOM 9291  C C   . TYR C 1 120 ? 73.433  114.825 -13.916  1.00 40.00 ? 124 TYR C C   1 
ATOM 9292  O O   . TYR C 1 120 ? 73.249  115.859 -13.273  1.00 40.00 ? 124 TYR C O   1 
ATOM 9293  C CB  . TYR C 1 120 ? 71.155  114.725 -14.868  1.00 40.00 ? 124 TYR C CB  1 
ATOM 9294  C CG  . TYR C 1 120 ? 70.771  113.865 -13.687  1.00 40.00 ? 124 TYR C CG  1 
ATOM 9295  C CD1 . TYR C 1 120 ? 70.945  114.291 -12.395  1.00 40.00 ? 124 TYR C CD1 1 
ATOM 9296  C CD2 . TYR C 1 120 ? 70.207  112.585 -13.859  1.00 40.00 ? 124 TYR C CD2 1 
ATOM 9297  C CE1 . TYR C 1 120 ? 70.603  113.507 -11.314  1.00 40.00 ? 124 TYR C CE1 1 
ATOM 9298  C CE2 . TYR C 1 120 ? 69.854  111.770 -12.793  1.00 40.00 ? 124 TYR C CE2 1 
ATOM 9299  C CZ  . TYR C 1 120 ? 70.056  112.243 -11.511  1.00 40.00 ? 124 TYR C CZ  1 
ATOM 9300  O OH  . TYR C 1 120 ? 69.733  111.453 -10.433  1.00 40.00 ? 124 TYR C OH  1 
ATOM 9301  N N   . SER C 1 121 ? 74.196  113.819 -13.509  1.00 40.00 ? 125 SER C N   1 
ATOM 9302  C CA  . SER C 1 121 ? 74.889  113.952 -12.211  1.00 40.00 ? 125 SER C CA  1 
ATOM 9303  C C   . SER C 1 121 ? 76.130  113.096 -12.209  1.00 40.00 ? 125 SER C C   1 
ATOM 9304  O O   . SER C 1 121 ? 76.372  112.505 -13.251  1.00 40.00 ? 125 SER C O   1 
ATOM 9305  C CB  . SER C 1 121 ? 73.946  113.451 -11.114  1.00 40.00 ? 125 SER C CB  1 
ATOM 9306  O OG  . SER C 1 121 ? 74.029  112.037 -11.025  1.00 40.00 ? 125 SER C OG  1 
ATOM 9307  N N   . GLY C 1 122 ? 76.882  113.028 -11.120  1.00 40.00 ? 126 GLY C N   1 
ATOM 9308  C CA  . GLY C 1 122 ? 78.078  112.187 -11.105  1.00 40.00 ? 126 GLY C CA  1 
ATOM 9309  C C   . GLY C 1 122 ? 79.432  112.837 -10.985  1.00 40.00 ? 126 GLY C C   1 
ATOM 9310  O O   . GLY C 1 122 ? 79.685  113.949 -11.466  1.00 40.00 ? 126 GLY C O   1 
ATOM 9311  N N   . ALA C 1 123 ? 80.416  112.076 -10.469  1.00 40.00 ? 127 ALA C N   1 
ATOM 9312  C CA  . ALA C 1 123 ? 81.764  112.565 -10.298  1.00 40.00 ? 127 ALA C CA  1 
ATOM 9313  C C   . ALA C 1 123 ? 82.820  111.514 -9.983   1.00 40.00 ? 127 ALA C C   1 
ATOM 9314  O O   . ALA C 1 123 ? 82.630  110.675 -9.089   1.00 40.00 ? 127 ALA C O   1 
ATOM 9315  C CB  . ALA C 1 123 ? 81.764  113.516 -9.074   1.00 40.00 ? 127 ALA C CB  1 
ATOM 9316  N N   . ALA C 1 124 ? 83.954  111.652 -10.669  1.00 40.00 ? 128 ALA C N   1 
ATOM 9317  C CA  . ALA C 1 124 ? 85.079  110.757 -10.398  1.00 40.00 ? 128 ALA C CA  1 
ATOM 9318  C C   . ALA C 1 124 ? 85.525  110.895 -8.958   1.00 40.00 ? 128 ALA C C   1 
ATOM 9319  O O   . ALA C 1 124 ? 85.906  109.924 -8.276   1.00 40.00 ? 128 ALA C O   1 
ATOM 9320  C CB  . ALA C 1 124 ? 86.167  111.018 -11.429  1.00 40.00 ? 128 ALA C CB  1 
ATOM 9321  N N   . SER C 1 125 ? 85.437  112.036 -8.322   1.00 40.00 ? 129 SER C N   1 
ATOM 9322  C CA  . SER C 1 125 ? 85.738  112.323 -6.936   1.00 40.00 ? 129 SER C CA  1 
ATOM 9323  C C   . SER C 1 125 ? 85.078  111.353 -5.949   1.00 40.00 ? 129 SER C C   1 
ATOM 9324  O O   . SER C 1 125 ? 85.425  111.290 -4.757   1.00 40.00 ? 129 SER C O   1 
ATOM 9325  C CB  . SER C 1 125 ? 85.180  113.733 -6.569   1.00 40.00 ? 129 SER C CB  1 
ATOM 9326  O OG  . SER C 1 125 ? 85.087  114.607 -7.690   1.00 40.00 ? 129 SER C OG  1 
ATOM 9327  N N   . LEU C 1 126 ? 84.069  110.608 -6.373   1.00 40.00 ? 130 LEU C N   1 
ATOM 9328  C CA  . LEU C 1 126 ? 83.358  109.721 -5.479   1.00 40.00 ? 130 LEU C CA  1 
ATOM 9329  C C   . LEU C 1 126 ? 84.159  108.615 -4.844   1.00 40.00 ? 130 LEU C C   1 
ATOM 9330  O O   . LEU C 1 126 ? 85.122  108.098 -5.421   1.00 40.00 ? 130 LEU C O   1 
ATOM 9331  C CB  . LEU C 1 126 ? 82.125  109.146 -6.199   1.00 40.00 ? 130 LEU C CB  1 
ATOM 9332  C CG  . LEU C 1 126 ? 81.033  110.212 -6.415   1.00 40.00 ? 130 LEU C CG  1 
ATOM 9333  C CD1 . LEU C 1 126 ? 79.761  109.560 -6.897   1.00 40.00 ? 130 LEU C CD1 1 
ATOM 9334  C CD2 . LEU C 1 126 ? 80.753  110.958 -5.109   1.00 40.00 ? 130 LEU C CD2 1 
ATOM 9335  N N   . ASP C 1 127 ? 83.729  108.228 -3.644   1.00 40.00 ? 131 ASP C N   1 
ATOM 9336  C CA  . ASP C 1 127 ? 84.400  107.186 -2.884   1.00 40.00 ? 131 ASP C CA  1 
ATOM 9337  C C   . ASP C 1 127 ? 84.438  105.838 -3.554   1.00 40.00 ? 131 ASP C C   1 
ATOM 9338  O O   . ASP C 1 127 ? 85.522  105.260 -3.735   1.00 40.00 ? 131 ASP C O   1 
ATOM 9339  C CB  . ASP C 1 127 ? 83.771  107.036 -1.491   1.00 40.00 ? 131 ASP C CB  1 
ATOM 9340  C CG  . ASP C 1 127 ? 84.243  108.110 -0.521   1.00 40.00 ? 131 ASP C CG  1 
ATOM 9341  O OD1 . ASP C 1 127 ? 84.928  109.064 -0.977   1.00 40.00 ? 131 ASP C OD1 1 
ATOM 9342  O OD2 . ASP C 1 127 ? 83.930  107.983 0.678    1.00 40.00 ? 131 ASP C OD2 1 
ATOM 9343  N N   . VAL C 1 128 ? 83.295  105.316 -3.988   1.00 40.00 ? 132 VAL C N   1 
ATOM 9344  C CA  . VAL C 1 128 ? 83.280  104.033 -4.684   1.00 40.00 ? 132 VAL C CA  1 
ATOM 9345  C C   . VAL C 1 128 ? 84.068  104.075 -5.982   1.00 40.00 ? 132 VAL C C   1 
ATOM 9346  O O   . VAL C 1 128 ? 84.173  102.995 -6.602   1.00 40.00 ? 132 VAL C O   1 
ATOM 9347  C CB  . VAL C 1 128 ? 81.880  103.500 -4.990   1.00 40.00 ? 132 VAL C CB  1 
ATOM 9348  C CG1 . VAL C 1 128 ? 81.022  103.466 -3.735   1.00 40.00 ? 132 VAL C CG1 1 
ATOM 9349  C CG2 . VAL C 1 128 ? 81.223  104.352 -6.057   1.00 40.00 ? 132 VAL C CG2 1 
ATOM 9350  N N   . TYR C 1 129 ? 84.600  105.193 -6.481   1.00 40.00 ? 133 TYR C N   1 
ATOM 9351  C CA  . TYR C 1 129 ? 85.354  105.080 -7.734   1.00 40.00 ? 133 TYR C CA  1 
ATOM 9352  C C   . TYR C 1 129 ? 86.843  105.267 -7.425   1.00 40.00 ? 133 TYR C C   1 
ATOM 9353  O O   . TYR C 1 129 ? 87.632  105.739 -8.255   1.00 40.00 ? 133 TYR C O   1 
ATOM 9354  C CB  . TYR C 1 129 ? 84.900  105.941 -8.880   1.00 40.00 ? 133 TYR C CB  1 
ATOM 9355  C CG  . TYR C 1 129 ? 83.437  106.102 -9.199   1.00 40.00 ? 133 TYR C CG  1 
ATOM 9356  C CD1 . TYR C 1 129 ? 82.534  105.080 -8.948   1.00 40.00 ? 133 TYR C CD1 1 
ATOM 9357  C CD2 . TYR C 1 129 ? 82.913  107.262 -9.760   1.00 40.00 ? 133 TYR C CD2 1 
ATOM 9358  C CE1 . TYR C 1 129 ? 81.194  105.181 -9.202   1.00 40.00 ? 133 TYR C CE1 1 
ATOM 9359  C CE2 . TYR C 1 129 ? 81.561  107.387 -10.023  1.00 40.00 ? 133 TYR C CE2 1 
ATOM 9360  C CZ  . TYR C 1 129 ? 80.701  106.346 -9.745   1.00 40.00 ? 133 TYR C CZ  1 
ATOM 9361  O OH  . TYR C 1 129 ? 79.355  106.448 -10.010  1.00 40.00 ? 133 TYR C OH  1 
ATOM 9362  N N   . ASP C 1 130 ? 87.216  104.893 -6.207   1.00 40.00 ? 134 ASP C N   1 
ATOM 9363  C CA  . ASP C 1 130 ? 88.594  104.986 -5.739   1.00 40.00 ? 134 ASP C CA  1 
ATOM 9364  C C   . ASP C 1 130 ? 89.476  103.983 -6.461   1.00 40.00 ? 134 ASP C C   1 
ATOM 9365  O O   . ASP C 1 130 ? 89.521  102.814 -6.047   1.00 40.00 ? 134 ASP C O   1 
ATOM 9366  C CB  . ASP C 1 130 ? 88.618  104.688 -4.234   1.00 40.00 ? 134 ASP C CB  1 
ATOM 9367  C CG  . ASP C 1 130 ? 89.935  105.026 -3.569   1.00 40.00 ? 134 ASP C CG  1 
ATOM 9368  O OD1 . ASP C 1 130 ? 89.913  105.136 -2.311   1.00 40.00 ? 134 ASP C OD1 1 
ATOM 9369  O OD2 . ASP C 1 130 ? 90.951  105.185 -4.282   1.00 40.00 ? 134 ASP C OD2 1 
ATOM 9370  N N   . GLY C 1 131 ? 90.202  104.425 -7.486   1.00 40.00 ? 135 GLY C N   1 
ATOM 9371  C CA  . GLY C 1 131 ? 91.066  103.541 -8.233   1.00 40.00 ? 135 GLY C CA  1 
ATOM 9372  C C   . GLY C 1 131 ? 92.314  103.059 -7.529   1.00 40.00 ? 135 GLY C C   1 
ATOM 9373  O O   . GLY C 1 131 ? 93.182  102.466 -8.206   1.00 40.00 ? 135 GLY C O   1 
ATOM 9374  N N   . ARG C 1 132 ? 92.516  103.261 -6.235   1.00 40.00 ? 136 ARG C N   1 
ATOM 9375  C CA  . ARG C 1 132 ? 93.738  102.832 -5.572   1.00 40.00 ? 136 ARG C CA  1 
ATOM 9376  C C   . ARG C 1 132 ? 93.896  101.325 -5.494   1.00 40.00 ? 136 ARG C C   1 
ATOM 9377  O O   . ARG C 1 132 ? 94.971  100.796 -5.870   1.00 40.00 ? 136 ARG C O   1 
ATOM 9378  C CB  . ARG C 1 132 ? 93.906  103.548 -4.249   1.00 40.00 ? 136 ARG C CB  1 
ATOM 9379  C CG  . ARG C 1 132 ? 93.675  102.758 -2.989   1.00 40.00 ? 136 ARG C CG  1 
ATOM 9380  C CD  . ARG C 1 132 ? 92.520  103.215 -2.170   1.00 40.00 ? 136 ARG C CD  1 
ATOM 9381  N NE  . ARG C 1 132 ? 92.717  103.767 -0.854   1.00 40.00 ? 136 ARG C NE  1 
ATOM 9382  C CZ  . ARG C 1 132 ? 93.010  105.009 -0.508   1.00 40.00 ? 136 ARG C CZ  1 
ATOM 9383  N NH1 . ARG C 1 132 ? 93.199  105.947 -1.426   1.00 40.00 ? 136 ARG C NH1 1 
ATOM 9384  N NH2 . ARG C 1 132 ? 93.126  105.348 0.773    1.00 40.00 ? 136 ARG C NH2 1 
ATOM 9385  N N   . PHE C 1 133 ? 92.884  100.583 -5.066   1.00 40.00 ? 137 PHE C N   1 
ATOM 9386  C CA  . PHE C 1 133 ? 92.973  99.126  -4.990   1.00 40.00 ? 137 PHE C CA  1 
ATOM 9387  C C   . PHE C 1 133 ? 93.306  98.485  -6.323   1.00 40.00 ? 137 PHE C C   1 
ATOM 9388  O O   . PHE C 1 133 ? 94.303  97.766  -6.457   1.00 40.00 ? 137 PHE C O   1 
ATOM 9389  C CB  . PHE C 1 133 ? 91.673  98.544  -4.408   1.00 40.00 ? 137 PHE C CB  1 
ATOM 9390  C CG  . PHE C 1 133 ? 91.210  99.311  -3.199   1.00 40.00 ? 137 PHE C CG  1 
ATOM 9391  C CD1 . PHE C 1 133 ? 90.225  100.282 -3.313   1.00 40.00 ? 137 PHE C CD1 1 
ATOM 9392  C CD2 . PHE C 1 133 ? 91.776  99.087  -1.952   1.00 40.00 ? 137 PHE C CD2 1 
ATOM 9393  C CE1 . PHE C 1 133 ? 89.815  100.991 -2.191   1.00 40.00 ? 137 PHE C CE1 1 
ATOM 9394  C CE2 . PHE C 1 133 ? 91.371  99.794  -0.831   1.00 40.00 ? 137 PHE C CE2 1 
ATOM 9395  C CZ  . PHE C 1 133 ? 90.376  100.744 -0.944   1.00 40.00 ? 137 PHE C CZ  1 
ATOM 9396  N N   . LEU C 1 134 ? 92.566  98.761  -7.399   1.00 40.00 ? 138 LEU C N   1 
ATOM 9397  C CA  . LEU C 1 134 ? 92.880  98.189  -8.706   1.00 40.00 ? 138 LEU C CA  1 
ATOM 9398  C C   . LEU C 1 134 ? 94.270  98.542  -9.195   1.00 40.00 ? 138 LEU C C   1 
ATOM 9399  O O   . LEU C 1 134 ? 94.804  97.850  -10.091  1.00 40.00 ? 138 LEU C O   1 
ATOM 9400  C CB  . LEU C 1 134 ? 91.831  98.591  -9.754   1.00 40.00 ? 138 LEU C CB  1 
ATOM 9401  C CG  . LEU C 1 134 ? 90.450  97.960  -9.536   1.00 40.00 ? 138 LEU C CG  1 
ATOM 9402  C CD1 . LEU C 1 134 ? 89.330  98.967  -9.645   1.00 40.00 ? 138 LEU C CD1 1 
ATOM 9403  C CD2 . LEU C 1 134 ? 90.260  96.803  -10.512  1.00 40.00 ? 138 LEU C CD2 1 
ATOM 9404  N N   . ALA C 1 135 ? 94.894  99.611  -8.683   1.00 40.00 ? 139 ALA C N   1 
ATOM 9405  C CA  . ALA C 1 135 ? 96.256  99.894  -9.152   1.00 40.00 ? 139 ALA C CA  1 
ATOM 9406  C C   . ALA C 1 135 ? 97.194  99.139  -8.196   1.00 40.00 ? 139 ALA C C   1 
ATOM 9407  O O   . ALA C 1 135 ? 98.111  98.435  -8.575   1.00 40.00 ? 139 ALA C O   1 
ATOM 9408  C CB  . ALA C 1 135 ? 96.562  101.365 -9.106   1.00 40.00 ? 139 ALA C CB  1 
ATOM 9409  N N   . GLN C 1 136 ? 96.868  99.351  -6.904   1.00 40.00 ? 140 GLN C N   1 
ATOM 9410  C CA  . GLN C 1 136 ? 97.703  98.749  -5.876   1.00 40.00 ? 140 GLN C CA  1 
ATOM 9411  C C   . GLN C 1 136 ? 97.840  97.250  -6.104   1.00 40.00 ? 140 GLN C C   1 
ATOM 9412  O O   . GLN C 1 136 ? 98.911  96.728  -6.378   1.00 40.00 ? 140 GLN C O   1 
ATOM 9413  C CB  . GLN C 1 136 ? 97.149  99.034  -4.483   1.00 40.00 ? 140 GLN C CB  1 
ATOM 9414  C CG  . GLN C 1 136 ? 98.175  98.746  -3.382   1.00 40.00 ? 140 GLN C CG  1 
ATOM 9415  C CD  . GLN C 1 136 ? 98.217  97.241  -3.122   1.00 40.00 ? 140 GLN C CD  1 
ATOM 9416  O OE1 . GLN C 1 136 ? 97.230  96.694  -2.624   1.00 40.00 ? 140 GLN C OE1 1 
ATOM 9417  N NE2 . GLN C 1 136 ? 99.347  96.644  -3.473   1.00 40.00 ? 140 GLN C NE2 1 
ATOM 9418  N N   . VAL C 1 137 ? 96.718  96.577  -5.928   1.00 40.00 ? 141 VAL C N   1 
ATOM 9419  C CA  . VAL C 1 137 ? 96.592  95.153  -6.049   1.00 40.00 ? 141 VAL C CA  1 
ATOM 9420  C C   . VAL C 1 137 ? 96.805  94.626  -7.448   1.00 40.00 ? 141 VAL C C   1 
ATOM 9421  O O   . VAL C 1 137 ? 97.701  93.795  -7.652   1.00 40.00 ? 141 VAL C O   1 
ATOM 9422  C CB  . VAL C 1 137 ? 95.191  94.644  -5.610   1.00 40.00 ? 141 VAL C CB  1 
ATOM 9423  C CG1 . VAL C 1 137 ? 95.027  93.182  -5.978   1.00 40.00 ? 141 VAL C CG1 1 
ATOM 9424  C CG2 . VAL C 1 137 ? 94.946  94.898  -4.140   1.00 40.00 ? 141 VAL C CG2 1 
ATOM 9425  N N   . GLU C 1 138 ? 96.007  95.002  -8.439   1.00 40.00 ? 142 GLU C N   1 
ATOM 9426  C CA  . GLU C 1 138 ? 96.231  94.393  -9.763   1.00 40.00 ? 142 GLU C CA  1 
ATOM 9427  C C   . GLU C 1 138 ? 97.271  95.098  -10.601  1.00 40.00 ? 142 GLU C C   1 
ATOM 9428  O O   . GLU C 1 138 ? 97.461  94.788  -11.785  1.00 40.00 ? 142 GLU C O   1 
ATOM 9429  C CB  . GLU C 1 138 ? 94.900  94.194  -10.467  1.00 40.00 ? 142 GLU C CB  1 
ATOM 9430  C CG  . GLU C 1 138 ? 93.911  93.339  -9.680   1.00 40.00 ? 142 GLU C CG  1 
ATOM 9431  C CD  . GLU C 1 138 ? 94.335  91.875  -9.683   1.00 40.00 ? 142 GLU C CD  1 
ATOM 9432  O OE1 . GLU C 1 138 ? 94.919  91.426  -10.697  1.00 40.00 ? 142 GLU C OE1 1 
ATOM 9433  O OE2 . GLU C 1 138 ? 94.053  91.219  -8.657   1.00 40.00 ? 142 GLU C OE2 1 
ATOM 9434  N N   . GLY C 1 139 ? 97.979  96.056  -10.004  1.00 40.00 ? 143 GLY C N   1 
ATOM 9435  C CA  . GLY C 1 139 ? 99.045  96.805  -10.633  1.00 40.00 ? 143 GLY C CA  1 
ATOM 9436  C C   . GLY C 1 139 ? 98.632  97.479  -11.924  1.00 40.00 ? 143 GLY C C   1 
ATOM 9437  O O   . GLY C 1 139 ? 99.360  97.465  -12.918  1.00 40.00 ? 143 GLY C O   1 
ATOM 9438  N N   . ALA C 1 140 ? 97.427  98.080  -11.897  1.00 40.00 ? 144 ALA C N   1 
ATOM 9439  C CA  . ALA C 1 140 ? 96.904  98.697  -13.104  1.00 40.00 ? 144 ALA C CA  1 
ATOM 9440  C C   . ALA C 1 140 ? 96.999  100.209 -13.065  1.00 40.00 ? 144 ALA C C   1 
ATOM 9441  O O   . ALA C 1 140 ? 96.840  100.747 -11.974  1.00 40.00 ? 144 ALA C O   1 
ATOM 9442  C CB  . ALA C 1 140 ? 95.417  98.354  -13.247  1.00 40.00 ? 144 ALA C CB  1 
ATOM 9443  N N   . VAL C 1 141 ? 97.209  100.806 -14.237  1.00 40.00 ? 145 VAL C N   1 
ATOM 9444  C CA  . VAL C 1 141 ? 97.170  102.267 -14.281  1.00 40.00 ? 145 VAL C CA  1 
ATOM 9445  C C   . VAL C 1 141 ? 95.689  102.650 -14.562  1.00 40.00 ? 145 VAL C C   1 
ATOM 9446  O O   . VAL C 1 141 ? 95.198  102.423 -15.675  1.00 40.00 ? 145 VAL C O   1 
ATOM 9447  C CB  . VAL C 1 141 ? 97.995  102.904 -15.387  1.00 40.00 ? 145 VAL C CB  1 
ATOM 9448  C CG1 . VAL C 1 141 ? 97.820  104.425 -15.395  1.00 40.00 ? 145 VAL C CG1 1 
ATOM 9449  C CG2 . VAL C 1 141 ? 99.474  102.557 -15.265  1.00 40.00 ? 145 VAL C CG2 1 
ATOM 9450  N N   . LEU C 1 142 ? 95.047  103.209 -13.565  1.00 40.00 ? 146 LEU C N   1 
ATOM 9451  C CA  . LEU C 1 142 ? 93.656  103.618 -13.620  1.00 40.00 ? 146 LEU C CA  1 
ATOM 9452  C C   . LEU C 1 142 ? 93.436  105.110 -13.779  1.00 40.00 ? 146 LEU C C   1 
ATOM 9453  O O   . LEU C 1 142 ? 94.060  105.979 -13.144  1.00 40.00 ? 146 LEU C O   1 
ATOM 9454  C CB  . LEU C 1 142 ? 93.038  103.120 -12.282  1.00 40.00 ? 146 LEU C CB  1 
ATOM 9455  C CG  . LEU C 1 142 ? 91.513  103.116 -12.275  1.00 40.00 ? 146 LEU C CG  1 
ATOM 9456  C CD1 . LEU C 1 142 ? 90.972  102.099 -11.295  1.00 40.00 ? 146 LEU C CD1 1 
ATOM 9457  C CD2 . LEU C 1 142 ? 90.998  104.526 -11.989  1.00 40.00 ? 146 LEU C CD2 1 
ATOM 9458  N N   . VAL C 1 143 ? 92.493  105.511 -14.639  1.00 40.00 ? 147 VAL C N   1 
ATOM 9459  C CA  . VAL C 1 143 ? 92.207  106.926 -14.862  1.00 40.00 ? 147 VAL C CA  1 
ATOM 9460  C C   . VAL C 1 143 ? 90.715  107.203 -14.760  1.00 40.00 ? 147 VAL C C   1 
ATOM 9461  O O   . VAL C 1 143 ? 89.938  106.454 -15.383  1.00 40.00 ? 147 VAL C O   1 
ATOM 9462  C CB  . VAL C 1 143 ? 92.637  107.346 -16.291  1.00 40.00 ? 147 VAL C CB  1 
ATOM 9463  C CG1 . VAL C 1 143 ? 92.335  108.817 -16.515  1.00 40.00 ? 147 VAL C CG1 1 
ATOM 9464  C CG2 . VAL C 1 143 ? 94.104  107.048 -16.586  1.00 40.00 ? 147 VAL C CG2 1 
ATOM 9465  N N   . SER C 1 144 ? 90.305  108.255 -14.060  1.00 40.00 ? 148 SER C N   1 
ATOM 9466  C CA  . SER C 1 144 ? 88.864  108.576 -13.987  1.00 40.00 ? 148 SER C CA  1 
ATOM 9467  C C   . SER C 1 144 ? 88.702  110.074 -14.218  1.00 40.00 ? 148 SER C C   1 
ATOM 9468  O O   . SER C 1 144 ? 89.252  110.850 -13.416  1.00 40.00 ? 148 SER C O   1 
ATOM 9469  C CB  . SER C 1 144 ? 88.250  108.075 -12.704  1.00 40.00 ? 148 SER C CB  1 
ATOM 9470  O OG  . SER C 1 144 ? 88.495  108.849 -11.555  1.00 40.00 ? 148 SER C OG  1 
ATOM 9471  N N   . MET C 1 145 ? 88.014  110.496 -15.288  1.00 40.00 ? 149 MET C N   1 
ATOM 9472  C CA  . MET C 1 145 ? 87.804  111.915 -15.552  1.00 40.00 ? 149 MET C CA  1 
ATOM 9473  C C   . MET C 1 145 ? 86.407  112.427 -15.161  1.00 40.00 ? 149 MET C C   1 
ATOM 9474  O O   . MET C 1 145 ? 85.491  111.661 -14.875  1.00 40.00 ? 149 MET C O   1 
ATOM 9475  C CB  . MET C 1 145 ? 87.964  112.271 -17.034  1.00 40.00 ? 149 MET C CB  1 
ATOM 9476  C CG  . MET C 1 145 ? 86.672  112.109 -17.841  1.00 40.00 ? 149 MET C CG  1 
ATOM 9477  S SD  . MET C 1 145 ? 86.268  110.332 -17.963  1.00 40.00 ? 149 MET C SD  1 
ATOM 9478  C CE  . MET C 1 145 ? 86.491  110.153 -19.743  1.00 40.00 ? 149 MET C CE  1 
ATOM 9479  N N   . ASN C 1 146 ? 86.243  113.747 -15.192  1.00 40.00 ? 150 ASN C N   1 
ATOM 9480  C CA  . ASN C 1 146 ? 84.977  114.413 -14.944  1.00 40.00 ? 150 ASN C CA  1 
ATOM 9481  C C   . ASN C 1 146 ? 84.512  114.908 -16.333  1.00 40.00 ? 150 ASN C C   1 
ATOM 9482  O O   . ASN C 1 146 ? 85.376  115.310 -17.129  1.00 40.00 ? 150 ASN C O   1 
ATOM 9483  C CB  . ASN C 1 146 ? 85.097  115.640 -14.034  1.00 40.00 ? 150 ASN C CB  1 
ATOM 9484  C CG  . ASN C 1 146 ? 85.121  115.193 -12.579  1.00 40.00 ? 150 ASN C CG  1 
ATOM 9485  O OD1 . ASN C 1 146 ? 85.076  113.971 -12.357  1.00 40.00 ? 150 ASN C OD1 1 
ATOM 9486  N ND2 . ASN C 1 146 ? 85.184  116.129 -11.636  1.00 40.00 ? 150 ASN C ND2 1 
ATOM 9487  N N   . TYR C 1 147 ? 83.229  114.798 -16.616  1.00 40.00 ? 151 TYR C N   1 
ATOM 9488  C CA  . TYR C 1 147 ? 82.669  115.281 -17.879  1.00 40.00 ? 151 TYR C CA  1 
ATOM 9489  C C   . TYR C 1 147 ? 81.395  116.054 -17.450  1.00 40.00 ? 151 TYR C C   1 
ATOM 9490  O O   . TYR C 1 147 ? 80.747  115.716 -16.447  1.00 40.00 ? 151 TYR C O   1 
ATOM 9491  C CB  . TYR C 1 147 ? 82.336  114.220 -18.922  1.00 40.00 ? 151 TYR C CB  1 
ATOM 9492  C CG  . TYR C 1 147 ? 81.367  113.173 -18.411  1.00 40.00 ? 151 TYR C CG  1 
ATOM 9493  C CD1 . TYR C 1 147 ? 81.757  112.307 -17.397  1.00 40.00 ? 151 TYR C CD1 1 
ATOM 9494  C CD2 . TYR C 1 147 ? 80.071  113.063 -18.894  1.00 40.00 ? 151 TYR C CD2 1 
ATOM 9495  C CE1 . TYR C 1 147 ? 80.891  111.347 -16.925  1.00 40.00 ? 151 TYR C CE1 1 
ATOM 9496  C CE2 . TYR C 1 147 ? 79.187  112.101 -18.395  1.00 40.00 ? 151 TYR C CE2 1 
ATOM 9497  C CZ  . TYR C 1 147 ? 79.609  111.258 -17.401  1.00 40.00 ? 151 TYR C CZ  1 
ATOM 9498  O OH  . TYR C 1 147 ? 78.806  110.300 -16.857  1.00 40.00 ? 151 TYR C OH  1 
ATOM 9499  N N   . ARG C 1 148 ? 81.100  117.129 -18.164  1.00 40.00 ? 152 ARG C N   1 
ATOM 9500  C CA  . ARG C 1 148 ? 79.940  117.941 -17.932  1.00 40.00 ? 152 ARG C CA  1 
ATOM 9501  C C   . ARG C 1 148 ? 78.646  117.147 -18.105  1.00 40.00 ? 152 ARG C C   1 
ATOM 9502  O O   . ARG C 1 148 ? 78.379  116.679 -19.210  1.00 40.00 ? 152 ARG C O   1 
ATOM 9503  C CB  . ARG C 1 148 ? 79.908  119.073 -19.005  1.00 40.00 ? 152 ARG C CB  1 
ATOM 9504  C CG  . ARG C 1 148 ? 80.956  120.138 -18.822  1.00 40.00 ? 152 ARG C CG  1 
ATOM 9505  C CD  . ARG C 1 148 ? 80.968  121.249 -19.878  1.00 40.00 ? 152 ARG C CD  1 
ATOM 9506  N NE  . ARG C 1 148 ? 81.683  120.814 -21.069  1.00 40.00 ? 152 ARG C NE  1 
ATOM 9507  C CZ  . ARG C 1 148 ? 81.810  121.479 -22.194  1.00 40.00 ? 152 ARG C CZ  1 
ATOM 9508  N NH1 . ARG C 1 148 ? 81.257  122.681 -22.274  1.00 40.00 ? 152 ARG C NH1 1 
ATOM 9509  N NH2 . ARG C 1 148 ? 82.481  121.005 -23.265  1.00 40.00 ? 152 ARG C NH2 1 
ATOM 9510  N N   . VAL C 1 149 ? 77.832  117.047 -17.094  1.00 40.00 ? 153 VAL C N   1 
ATOM 9511  C CA  . VAL C 1 149 ? 76.505  116.476 -17.113  1.00 40.00 ? 153 VAL C CA  1 
ATOM 9512  C C   . VAL C 1 149 ? 75.461  117.595 -17.283  1.00 40.00 ? 153 VAL C C   1 
ATOM 9513  O O   . VAL C 1 149 ? 75.792  118.786 -17.389  1.00 40.00 ? 153 VAL C O   1 
ATOM 9514  C CB  . VAL C 1 149 ? 76.184  115.866 -15.725  1.00 40.00 ? 153 VAL C CB  1 
ATOM 9515  C CG1 . VAL C 1 149 ? 77.009  114.623 -15.477  1.00 40.00 ? 153 VAL C CG1 1 
ATOM 9516  C CG2 . VAL C 1 149 ? 76.453  116.888 -14.625  1.00 40.00 ? 153 VAL C CG2 1 
ATOM 9517  N N   . GLY C 1 150 ? 74.177  117.240 -17.208  1.00 40.00 ? 154 GLY C N   1 
ATOM 9518  C CA  . GLY C 1 150 ? 73.054  118.164 -17.325  1.00 40.00 ? 154 GLY C CA  1 
ATOM 9519  C C   . GLY C 1 150 ? 73.060  119.033 -18.565  1.00 40.00 ? 154 GLY C C   1 
ATOM 9520  O O   . GLY C 1 150 ? 73.573  118.781 -19.651  1.00 40.00 ? 154 GLY C O   1 
ATOM 9521  N N   . THR C 1 151 ? 72.466  120.207 -18.494  1.00 40.00 ? 155 THR C N   1 
ATOM 9522  C CA  . THR C 1 151 ? 72.362  121.196 -19.543  1.00 40.00 ? 155 THR C CA  1 
ATOM 9523  C C   . THR C 1 151 ? 73.750  121.562 -20.050  1.00 40.00 ? 155 THR C C   1 
ATOM 9524  O O   . THR C 1 151 ? 73.995  121.761 -21.232  1.00 40.00 ? 155 THR C O   1 
ATOM 9525  C CB  . THR C 1 151 ? 71.784  122.531 -18.942  1.00 40.00 ? 155 THR C CB  1 
ATOM 9526  O OG1 . THR C 1 151 ? 71.929  122.455 -17.517  1.00 40.00 ? 155 THR C OG1 1 
ATOM 9527  C CG2 . THR C 1 151 ? 70.309  122.591 -19.312  1.00 40.00 ? 155 THR C CG2 1 
ATOM 9528  N N   . PHE C 1 152 ? 74.659  121.701 -19.084  1.00 40.00 ? 156 PHE C N   1 
ATOM 9529  C CA  . PHE C 1 152 ? 76.041  122.085 -19.413  1.00 40.00 ? 156 PHE C CA  1 
ATOM 9530  C C   . PHE C 1 152 ? 76.674  121.021 -20.314  1.00 40.00 ? 156 PHE C C   1 
ATOM 9531  O O   . PHE C 1 152 ? 77.393  121.363 -21.257  1.00 40.00 ? 156 PHE C O   1 
ATOM 9532  C CB  . PHE C 1 152 ? 76.851  122.286 -18.140  1.00 40.00 ? 156 PHE C CB  1 
ATOM 9533  C CG  . PHE C 1 152 ? 76.108  122.981 -17.042  1.00 40.00 ? 156 PHE C CG  1 
ATOM 9534  C CD1 . PHE C 1 152 ? 76.017  124.368 -17.044  1.00 40.00 ? 156 PHE C CD1 1 
ATOM 9535  C CD2 . PHE C 1 152 ? 75.497  122.289 -16.017  1.00 40.00 ? 156 PHE C CD2 1 
ATOM 9536  C CE1 . PHE C 1 152 ? 75.320  125.029 -16.058  1.00 40.00 ? 156 PHE C CE1 1 
ATOM 9537  C CE2 . PHE C 1 152 ? 74.816  122.944 -15.012  1.00 40.00 ? 156 PHE C CE2 1 
ATOM 9538  C CZ  . PHE C 1 152 ? 74.715  124.313 -15.031  1.00 40.00 ? 156 PHE C CZ  1 
ATOM 9539  N N   . GLY C 1 153 ? 76.414  119.737 -20.035  1.00 40.00 ? 157 GLY C N   1 
ATOM 9540  C CA  . GLY C 1 153 ? 76.964  118.707 -20.853  1.00 40.00 ? 157 GLY C CA  1 
ATOM 9541  C C   . GLY C 1 153 ? 76.219  118.431 -22.135  1.00 40.00 ? 157 GLY C C   1 
ATOM 9542  O O   . GLY C 1 153 ? 76.779  118.021 -23.170  1.00 40.00 ? 157 GLY C O   1 
ATOM 9543  N N   . PHE C 1 154 ? 74.864  118.487 -22.036  1.00 40.00 ? 158 PHE C N   1 
ATOM 9544  C CA  . PHE C 1 154 ? 74.033  118.085 -23.171  1.00 40.00 ? 158 PHE C CA  1 
ATOM 9545  C C   . PHE C 1 154 ? 72.993  119.033 -23.678  1.00 40.00 ? 158 PHE C C   1 
ATOM 9546  O O   . PHE C 1 154 ? 72.417  118.754 -24.758  1.00 40.00 ? 158 PHE C O   1 
ATOM 9547  C CB  . PHE C 1 154 ? 73.440  116.722 -22.800  1.00 40.00 ? 158 PHE C CB  1 
ATOM 9548  C CG  . PHE C 1 154 ? 74.519  115.695 -22.515  1.00 40.00 ? 158 PHE C CG  1 
ATOM 9549  C CD1 . PHE C 1 154 ? 75.115  114.987 -23.539  1.00 40.00 ? 158 PHE C CD1 1 
ATOM 9550  C CD2 . PHE C 1 154 ? 74.964  115.469 -21.214  1.00 40.00 ? 158 PHE C CD2 1 
ATOM 9551  C CE1 . PHE C 1 154 ? 76.097  114.052 -23.255  1.00 40.00 ? 158 PHE C CE1 1 
ATOM 9552  C CE2 . PHE C 1 154 ? 75.965  114.555 -20.928  1.00 40.00 ? 158 PHE C CE2 1 
ATOM 9553  C CZ  . PHE C 1 154 ? 76.524  113.852 -21.948  1.00 40.00 ? 158 PHE C CZ  1 
ATOM 9554  N N   . LEU C 1 155 ? 72.742  120.174 -23.061  1.00 40.00 ? 159 LEU C N   1 
ATOM 9555  C CA  . LEU C 1 155 ? 71.721  121.062 -23.642  1.00 40.00 ? 159 LEU C CA  1 
ATOM 9556  C C   . LEU C 1 155 ? 72.035  121.222 -25.115  1.00 40.00 ? 159 LEU C C   1 
ATOM 9557  O O   . LEU C 1 155 ? 73.155  121.625 -25.397  1.00 40.00 ? 159 LEU C O   1 
ATOM 9558  C CB  . LEU C 1 155 ? 71.691  122.451 -22.980  1.00 40.00 ? 159 LEU C CB  1 
ATOM 9559  C CG  . LEU C 1 155 ? 70.585  123.396 -23.482  1.00 40.00 ? 159 LEU C CG  1 
ATOM 9560  C CD1 . LEU C 1 155 ? 70.149  124.365 -22.417  1.00 40.00 ? 159 LEU C CD1 1 
ATOM 9561  C CD2 . LEU C 1 155 ? 71.032  124.149 -24.728  1.00 40.00 ? 159 LEU C CD2 1 
ATOM 9562  N N   . ALA C 1 156 ? 71.122  120.965 -26.035  1.00 40.00 ? 160 ALA C N   1 
ATOM 9563  C CA  . ALA C 1 156 ? 71.599  121.200 -27.425  1.00 40.00 ? 160 ALA C CA  1 
ATOM 9564  C C   . ALA C 1 156 ? 70.567  121.857 -28.296  1.00 40.00 ? 160 ALA C C   1 
ATOM 9565  O O   . ALA C 1 156 ? 69.353  121.584 -28.200  1.00 40.00 ? 160 ALA C O   1 
ATOM 9566  C CB  . ALA C 1 156 ? 71.926  119.800 -27.989  1.00 40.00 ? 160 ALA C CB  1 
ATOM 9567  N N   . LEU C 1 157 ? 70.968  122.660 -29.246  1.00 40.00 ? 161 LEU C N   1 
ATOM 9568  C CA  . LEU C 1 157 ? 70.053  123.209 -30.239  1.00 40.00 ? 161 LEU C CA  1 
ATOM 9569  C C   . LEU C 1 157 ? 70.715  122.675 -31.524  1.00 40.00 ? 161 LEU C C   1 
ATOM 9570  O O   . LEU C 1 157 ? 71.596  123.304 -32.082  1.00 40.00 ? 161 LEU C O   1 
ATOM 9571  C CB  . LEU C 1 157 ? 70.036  124.696 -30.315  1.00 40.00 ? 161 LEU C CB  1 
ATOM 9572  C CG  . LEU C 1 157 ? 68.974  125.452 -29.525  1.00 40.00 ? 161 LEU C CG  1 
ATOM 9573  C CD1 . LEU C 1 157 ? 69.432  125.585 -28.082  1.00 40.00 ? 161 LEU C CD1 1 
ATOM 9574  C CD2 . LEU C 1 157 ? 68.796  126.837 -30.128  1.00 40.00 ? 161 LEU C CD2 1 
ATOM 9575  N N   . PRO C 1 158 ? 70.393  121.456 -31.865  1.00 40.00 ? 162 PRO C N   1 
ATOM 9576  C CA  . PRO C 1 158 ? 70.979  120.793 -33.017  1.00 40.00 ? 162 PRO C CA  1 
ATOM 9577  C C   . PRO C 1 158 ? 71.138  121.737 -34.192  1.00 40.00 ? 162 PRO C C   1 
ATOM 9578  O O   . PRO C 1 158 ? 70.251  122.487 -34.548  1.00 40.00 ? 162 PRO C O   1 
ATOM 9579  C CB  . PRO C 1 158 ? 70.040  119.667 -33.341  1.00 40.00 ? 162 PRO C CB  1 
ATOM 9580  C CG  . PRO C 1 158 ? 68.922  119.745 -32.371  1.00 40.00 ? 162 PRO C CG  1 
ATOM 9581  C CD  . PRO C 1 158 ? 69.403  120.562 -31.203  1.00 40.00 ? 162 PRO C CD  1 
ATOM 9582  N N   . GLY C 1 159 ? 72.327  121.666 -34.800  1.00 40.00 ? 163 GLY C N   1 
ATOM 9583  C CA  . GLY C 1 159 ? 72.688  122.462 -35.953  1.00 40.00 ? 163 GLY C CA  1 
ATOM 9584  C C   . GLY C 1 159 ? 73.393  123.771 -35.600  1.00 40.00 ? 163 GLY C C   1 
ATOM 9585  O O   . GLY C 1 159 ? 74.010  124.441 -36.429  1.00 40.00 ? 163 GLY C O   1 
ATOM 9586  N N   . SER C 1 160 ? 73.254  124.209 -34.355  1.00 40.00 ? 164 SER C N   1 
ATOM 9587  C CA  . SER C 1 160 ? 73.832  125.401 -33.841  1.00 40.00 ? 164 SER C CA  1 
ATOM 9588  C C   . SER C 1 160 ? 75.353  125.206 -33.692  1.00 40.00 ? 164 SER C C   1 
ATOM 9589  O O   . SER C 1 160 ? 75.792  124.096 -33.416  1.00 40.00 ? 164 SER C O   1 
ATOM 9590  C CB  . SER C 1 160 ? 73.309  125.697 -32.414  1.00 40.00 ? 164 SER C CB  1 
ATOM 9591  O OG  . SER C 1 160 ? 74.154  125.098 -31.442  1.00 40.00 ? 164 SER C OG  1 
ATOM 9592  N N   . ARG C 1 161 ? 76.021  126.345 -33.793  1.00 40.00 ? 165 ARG C N   1 
ATOM 9593  C CA  . ARG C 1 161 ? 77.437  126.439 -33.598  1.00 40.00 ? 165 ARG C CA  1 
ATOM 9594  C C   . ARG C 1 161 ? 77.776  126.483 -32.104  1.00 40.00 ? 165 ARG C C   1 
ATOM 9595  O O   . ARG C 1 161 ? 78.811  125.966 -31.695  1.00 40.00 ? 165 ARG C O   1 
ATOM 9596  C CB  . ARG C 1 161 ? 77.913  127.793 -34.185  1.00 40.00 ? 165 ARG C CB  1 
ATOM 9597  C CG  . ARG C 1 161 ? 79.264  127.678 -34.857  1.00 40.00 ? 165 ARG C CG  1 
ATOM 9598  C CD  . ARG C 1 161 ? 80.035  128.987 -34.924  1.00 40.00 ? 165 ARG C CD  1 
ATOM 9599  N NE  . ARG C 1 161 ? 80.619  129.309 -33.617  1.00 40.00 ? 165 ARG C NE  1 
ATOM 9600  C CZ  . ARG C 1 161 ? 80.281  130.379 -32.907  1.00 40.00 ? 165 ARG C CZ  1 
ATOM 9601  N NH1 . ARG C 1 161 ? 79.376  131.253 -33.351  1.00 40.00 ? 165 ARG C NH1 1 
ATOM 9602  N NH2 . ARG C 1 161 ? 80.849  130.593 -31.724  1.00 40.00 ? 165 ARG C NH2 1 
ATOM 9603  N N   . GLU C 1 162 ? 76.916  127.119 -31.315  1.00 40.00 ? 166 GLU C N   1 
ATOM 9604  C CA  . GLU C 1 162 ? 77.215  127.334 -29.914  1.00 40.00 ? 166 GLU C CA  1 
ATOM 9605  C C   . GLU C 1 162 ? 76.623  126.445 -28.857  1.00 40.00 ? 166 GLU C C   1 
ATOM 9606  O O   . GLU C 1 162 ? 76.864  126.650 -27.645  1.00 40.00 ? 166 GLU C O   1 
ATOM 9607  C CB  . GLU C 1 162 ? 76.789  128.791 -29.576  1.00 40.00 ? 166 GLU C CB  1 
ATOM 9608  C CG  . GLU C 1 162 ? 75.621  129.207 -30.460  1.00 40.00 ? 166 GLU C CG  1 
ATOM 9609  C CD  . GLU C 1 162 ? 76.043  130.055 -31.645  1.00 40.00 ? 166 GLU C CD  1 
ATOM 9610  O OE1 . GLU C 1 162 ? 77.054  130.789 -31.535  1.00 40.00 ? 166 GLU C OE1 1 
ATOM 9611  O OE2 . GLU C 1 162 ? 75.369  130.013 -32.702  1.00 40.00 ? 166 GLU C OE2 1 
ATOM 9612  N N   . ALA C 1 163 ? 75.829  125.470 -29.255  1.00 40.00 ? 167 ALA C N   1 
ATOM 9613  C CA  . ALA C 1 163 ? 75.250  124.514 -28.277  1.00 40.00 ? 167 ALA C CA  1 
ATOM 9614  C C   . ALA C 1 163 ? 74.836  123.347 -29.164  1.00 40.00 ? 167 ALA C C   1 
ATOM 9615  O O   . ALA C 1 163 ? 73.681  123.146 -29.544  1.00 40.00 ? 167 ALA C O   1 
ATOM 9616  C CB  . ALA C 1 163 ? 74.172  125.153 -27.504  1.00 40.00 ? 167 ALA C CB  1 
ATOM 9617  N N   . PRO C 1 164 ? 75.858  122.663 -29.673  1.00 40.00 ? 168 PRO C N   1 
ATOM 9618  C CA  . PRO C 1 164 ? 75.639  121.632 -30.679  1.00 40.00 ? 168 PRO C CA  1 
ATOM 9619  C C   . PRO C 1 164 ? 75.367  120.266 -30.142  1.00 40.00 ? 168 PRO C C   1 
ATOM 9620  O O   . PRO C 1 164 ? 75.006  119.328 -30.894  1.00 40.00 ? 168 PRO C O   1 
ATOM 9621  C CB  . PRO C 1 164 ? 76.928  121.805 -31.508  1.00 40.00 ? 168 PRO C CB  1 
ATOM 9622  C CG  . PRO C 1 164 ? 77.951  121.968 -30.435  1.00 40.00 ? 168 PRO C CG  1 
ATOM 9623  C CD  . PRO C 1 164 ? 77.304  122.829 -29.380  1.00 40.00 ? 168 PRO C CD  1 
ATOM 9624  N N   . GLY C 1 165 ? 75.521  120.107 -28.827  1.00 40.00 ? 169 GLY C N   1 
ATOM 9625  C CA  . GLY C 1 165 ? 75.268  118.873 -28.155  1.00 40.00 ? 169 GLY C CA  1 
ATOM 9626  C C   . GLY C 1 165 ? 76.371  117.874 -28.007  1.00 40.00 ? 169 GLY C C   1 
ATOM 9627  O O   . GLY C 1 165 ? 77.399  117.862 -28.689  1.00 40.00 ? 169 GLY C O   1 
ATOM 9628  N N   . ASN C 1 166 ? 76.149  116.967 -27.033  1.00 40.00 ? 170 ASN C N   1 
ATOM 9629  C CA  . ASN C 1 166 ? 77.086  115.880 -26.770  1.00 40.00 ? 170 ASN C CA  1 
ATOM 9630  C C   . ASN C 1 166 ? 78.417  116.371 -26.267  1.00 40.00 ? 170 ASN C C   1 
ATOM 9631  O O   . ASN C 1 166 ? 79.414  115.627 -26.154  1.00 40.00 ? 170 ASN C O   1 
ATOM 9632  C CB  . ASN C 1 166 ? 77.218  115.097 -28.080  1.00 40.00 ? 170 ASN C CB  1 
ATOM 9633  C CG  . ASN C 1 166 ? 75.958  114.433 -28.570  1.00 40.00 ? 170 ASN C CG  1 
ATOM 9634  O OD1 . ASN C 1 166 ? 75.168  113.880 -27.788  1.00 40.00 ? 170 ASN C OD1 1 
ATOM 9635  N ND2 . ASN C 1 166 ? 75.709  114.451 -29.882  1.00 40.00 ? 170 ASN C ND2 1 
ATOM 9636  N N   . VAL C 1 167 ? 78.485  117.654 -25.858  1.00 40.00 ? 171 VAL C N   1 
ATOM 9637  C CA  . VAL C 1 167 ? 79.781  118.142 -25.394  1.00 40.00 ? 171 VAL C CA  1 
ATOM 9638  C C   . VAL C 1 167 ? 80.245  117.400 -24.157  1.00 40.00 ? 171 VAL C C   1 
ATOM 9639  O O   . VAL C 1 167 ? 81.459  117.283 -23.926  1.00 40.00 ? 171 VAL C O   1 
ATOM 9640  C CB  . VAL C 1 167 ? 79.865  119.648 -25.213  1.00 40.00 ? 171 VAL C CB  1 
ATOM 9641  C CG1 . VAL C 1 167 ? 79.487  120.366 -26.513  1.00 40.00 ? 171 VAL C CG1 1 
ATOM 9642  C CG2 . VAL C 1 167 ? 79.021  120.124 -24.033  1.00 40.00 ? 171 VAL C CG2 1 
ATOM 9643  N N   . GLY C 1 168 ? 79.366  116.813 -23.355  1.00 40.00 ? 172 GLY C N   1 
ATOM 9644  C CA  . GLY C 1 168 ? 79.850  116.059 -22.186  1.00 40.00 ? 172 GLY C CA  1 
ATOM 9645  C C   . GLY C 1 168 ? 80.591  114.814 -22.716  1.00 40.00 ? 172 GLY C C   1 
ATOM 9646  O O   . GLY C 1 168 ? 81.472  114.230 -22.044  1.00 40.00 ? 172 GLY C O   1 
ATOM 9647  N N   . LEU C 1 169 ? 80.213  114.358 -23.923  1.00 40.00 ? 173 LEU C N   1 
ATOM 9648  C CA  . LEU C 1 169 ? 80.870  113.161 -24.451  1.00 40.00 ? 173 LEU C CA  1 
ATOM 9649  C C   . LEU C 1 169 ? 82.232  113.566 -24.994  1.00 40.00 ? 173 LEU C C   1 
ATOM 9650  O O   . LEU C 1 169 ? 83.212  112.863 -24.767  1.00 40.00 ? 173 LEU C O   1 
ATOM 9651  C CB  . LEU C 1 169 ? 80.065  112.497 -25.561  1.00 40.00 ? 173 LEU C CB  1 
ATOM 9652  C CG  . LEU C 1 169 ? 78.802  111.753 -25.117  1.00 40.00 ? 173 LEU C CG  1 
ATOM 9653  C CD1 . LEU C 1 169 ? 78.178  111.063 -26.315  1.00 40.00 ? 173 LEU C CD1 1 
ATOM 9654  C CD2 . LEU C 1 169 ? 79.102  110.737 -24.030  1.00 40.00 ? 173 LEU C CD2 1 
ATOM 9655  N N   . LEU C 1 170 ? 82.217  114.725 -25.663  1.00 40.00 ? 174 LEU C N   1 
ATOM 9656  C CA  . LEU C 1 170 ? 83.496  115.252 -26.172  1.00 40.00 ? 174 LEU C CA  1 
ATOM 9657  C C   . LEU C 1 170 ? 84.440  115.481 -25.006  1.00 40.00 ? 174 LEU C C   1 
ATOM 9658  O O   . LEU C 1 170 ? 85.657  115.342 -25.151  1.00 40.00 ? 174 LEU C O   1 
ATOM 9659  C CB  . LEU C 1 170 ? 83.243  116.595 -26.852  1.00 40.00 ? 174 LEU C CB  1 
ATOM 9660  C CG  . LEU C 1 170 ? 82.409  116.425 -28.114  1.00 40.00 ? 174 LEU C CG  1 
ATOM 9661  C CD1 . LEU C 1 170 ? 82.646  117.602 -29.036  1.00 40.00 ? 174 LEU C CD1 1 
ATOM 9662  C CD2 . LEU C 1 170 ? 82.785  115.161 -28.866  1.00 40.00 ? 174 LEU C CD2 1 
ATOM 9663  N N   . ASP C 1 171 ? 83.868  115.858 -23.849  1.00 40.00 ? 175 ASP C N   1 
ATOM 9664  C CA  . ASP C 1 171 ? 84.743  115.986 -22.684  1.00 40.00 ? 175 ASP C CA  1 
ATOM 9665  C C   . ASP C 1 171 ? 85.448  114.627 -22.501  1.00 40.00 ? 175 ASP C C   1 
ATOM 9666  O O   . ASP C 1 171 ? 86.682  114.566 -22.519  1.00 40.00 ? 175 ASP C O   1 
ATOM 9667  C CB  . ASP C 1 171 ? 83.985  116.350 -21.412  1.00 40.00 ? 175 ASP C CB  1 
ATOM 9668  C CG  . ASP C 1 171 ? 83.457  117.779 -21.398  1.00 40.00 ? 175 ASP C CG  1 
ATOM 9669  O OD1 . ASP C 1 171 ? 83.702  118.535 -22.376  1.00 40.00 ? 175 ASP C OD1 1 
ATOM 9670  O OD2 . ASP C 1 171 ? 82.798  118.117 -20.382  1.00 40.00 ? 175 ASP C OD2 1 
ATOM 9671  N N   . GLN C 1 172 ? 84.681  113.554 -22.369  1.00 40.00 ? 176 GLN C N   1 
ATOM 9672  C CA  . GLN C 1 172 ? 85.289  112.236 -22.170  1.00 40.00 ? 176 GLN C CA  1 
ATOM 9673  C C   . GLN C 1 172 ? 86.243  111.911 -23.321  1.00 40.00 ? 176 GLN C C   1 
ATOM 9674  O O   . GLN C 1 172 ? 87.371  111.410 -23.121  1.00 40.00 ? 176 GLN C O   1 
ATOM 9675  C CB  . GLN C 1 172 ? 84.243  111.151 -22.008  1.00 40.00 ? 176 GLN C CB  1 
ATOM 9676  C CG  . GLN C 1 172 ? 82.993  111.501 -21.204  1.00 40.00 ? 176 GLN C CG  1 
ATOM 9677  C CD  . GLN C 1 172 ? 81.845  110.532 -21.495  1.00 40.00 ? 176 GLN C CD  1 
ATOM 9678  O OE1 . GLN C 1 172 ? 81.590  110.215 -22.664  1.00 40.00 ? 176 GLN C OE1 1 
ATOM 9679  N NE2 . GLN C 1 172 ? 81.147  110.056 -20.467  1.00 40.00 ? 176 GLN C NE2 1 
ATOM 9680  N N   . ARG C 1 173 ? 85.846  112.221 -24.573  1.00 40.00 ? 177 ARG C N   1 
ATOM 9681  C CA  . ARG C 1 173 ? 86.766  111.868 -25.663  1.00 40.00 ? 177 ARG C CA  1 
ATOM 9682  C C   . ARG C 1 173 ? 88.090  112.598 -25.458  1.00 40.00 ? 177 ARG C C   1 
ATOM 9683  O O   . ARG C 1 173 ? 89.194  112.059 -25.619  1.00 40.00 ? 177 ARG C O   1 
ATOM 9684  C CB  . ARG C 1 173 ? 86.185  112.083 -27.018  1.00 40.00 ? 177 ARG C CB  1 
ATOM 9685  C CG  . ARG C 1 173 ? 87.106  112.445 -28.168  1.00 40.00 ? 177 ARG C CG  1 
ATOM 9686  C CD  . ARG C 1 173 ? 86.229  112.823 -29.396  1.00 40.00 ? 177 ARG C CD  1 
ATOM 9687  N NE  . ARG C 1 173 ? 85.492  111.664 -29.823  1.00 40.00 ? 177 ARG C NE  1 
ATOM 9688  C CZ  . ARG C 1 173 ? 84.607  111.555 -30.815  1.00 40.00 ? 177 ARG C CZ  1 
ATOM 9689  N NH1 . ARG C 1 173 ? 84.291  112.598 -31.585  1.00 40.00 ? 177 ARG C NH1 1 
ATOM 9690  N NH2 . ARG C 1 173 ? 84.042  110.344 -31.054  1.00 40.00 ? 177 ARG C NH2 1 
ATOM 9691  N N   . LEU C 1 174 ? 88.003  113.862 -25.046  1.00 40.00 ? 178 LEU C N   1 
ATOM 9692  C CA  . LEU C 1 174 ? 89.204  114.659 -24.823  1.00 40.00 ? 178 LEU C CA  1 
ATOM 9693  C C   . LEU C 1 174 ? 90.046  114.008 -23.737  1.00 40.00 ? 178 LEU C C   1 
ATOM 9694  O O   . LEU C 1 174 ? 91.261  113.839 -23.919  1.00 40.00 ? 178 LEU C O   1 
ATOM 9695  C CB  . LEU C 1 174 ? 88.805  116.072 -24.449  1.00 40.00 ? 178 LEU C CB  1 
ATOM 9696  C CG  . LEU C 1 174 ? 89.769  117.233 -24.733  1.00 40.00 ? 178 LEU C CG  1 
ATOM 9697  C CD1 . LEU C 1 174 ? 89.976  118.021 -23.445  1.00 40.00 ? 178 LEU C CD1 1 
ATOM 9698  C CD2 . LEU C 1 174 ? 91.066  116.796 -25.363  1.00 40.00 ? 178 LEU C CD2 1 
ATOM 9699  N N   . ALA C 1 175 ? 89.382  113.552 -22.660  1.00 40.00 ? 179 ALA C N   1 
ATOM 9700  C CA  . ALA C 1 175 ? 90.184  112.903 -21.604  1.00 40.00 ? 179 ALA C CA  1 
ATOM 9701  C C   . ALA C 1 175 ? 90.885  111.692 -22.204  1.00 40.00 ? 179 ALA C C   1 
ATOM 9702  O O   . ALA C 1 175 ? 92.012  111.342 -21.883  1.00 40.00 ? 179 ALA C O   1 
ATOM 9703  C CB  . ALA C 1 175 ? 89.308  112.493 -20.447  1.00 40.00 ? 179 ALA C CB  1 
ATOM 9704  N N   . LEU C 1 176 ? 90.162  111.033 -23.116  1.00 40.00 ? 180 LEU C N   1 
ATOM 9705  C CA  . LEU C 1 176 ? 90.743  109.870 -23.779  1.00 40.00 ? 180 LEU C CA  1 
ATOM 9706  C C   . LEU C 1 176 ? 91.961  110.291 -24.585  1.00 40.00 ? 180 LEU C C   1 
ATOM 9707  O O   . LEU C 1 176 ? 93.050  109.709 -24.407  1.00 40.00 ? 180 LEU C O   1 
ATOM 9708  C CB  . LEU C 1 176 ? 89.657  109.262 -24.642  1.00 40.00 ? 180 LEU C CB  1 
ATOM 9709  C CG  . LEU C 1 176 ? 88.960  107.987 -24.194  1.00 40.00 ? 180 LEU C CG  1 
ATOM 9710  C CD1 . LEU C 1 176 ? 88.808  107.789 -22.698  1.00 40.00 ? 180 LEU C CD1 1 
ATOM 9711  C CD2 . LEU C 1 176 ? 87.597  107.966 -24.890  1.00 40.00 ? 180 LEU C CD2 1 
ATOM 9712  N N   . GLN C 1 177 ? 91.869  111.337 -25.431  1.00 40.00 ? 181 GLN C N   1 
ATOM 9713  C CA  . GLN C 1 177 ? 93.043  111.710 -26.229  1.00 40.00 ? 181 GLN C CA  1 
ATOM 9714  C C   . GLN C 1 177 ? 94.198  112.114 -25.322  1.00 40.00 ? 181 GLN C C   1 
ATOM 9715  O O   . GLN C 1 177 ? 95.358  112.008 -25.726  1.00 40.00 ? 181 GLN C O   1 
ATOM 9716  C CB  . GLN C 1 177 ? 92.784  112.801 -27.250  1.00 40.00 ? 181 GLN C CB  1 
ATOM 9717  C CG  . GLN C 1 177 ? 91.428  112.687 -27.900  1.00 40.00 ? 181 GLN C CG  1 
ATOM 9718  C CD  . GLN C 1 177 ? 91.092  113.844 -28.821  1.00 40.00 ? 181 GLN C CD  1 
ATOM 9719  O OE1 . GLN C 1 177 ? 90.207  114.669 -28.527  1.00 40.00 ? 181 GLN C OE1 1 
ATOM 9720  N NE2 . GLN C 1 177 ? 91.790  113.905 -29.965  1.00 40.00 ? 181 GLN C NE2 1 
ATOM 9721  N N   . TRP C 1 178 ? 93.832  112.570 -24.125  1.00 40.00 ? 182 TRP C N   1 
ATOM 9722  C CA  . TRP C 1 178 ? 94.933  112.945 -23.232  1.00 40.00 ? 182 TRP C CA  1 
ATOM 9723  C C   . TRP C 1 178 ? 95.581  111.660 -22.739  1.00 40.00 ? 182 TRP C C   1 
ATOM 9724  O O   . TRP C 1 178 ? 96.799  111.472 -22.937  1.00 40.00 ? 182 TRP C O   1 
ATOM 9725  C CB  . TRP C 1 178 ? 94.451  113.807 -22.153  1.00 40.00 ? 182 TRP C CB  1 
ATOM 9726  C CG  . TRP C 1 178 ? 95.377  114.248 -21.102  1.00 40.00 ? 182 TRP C CG  1 
ATOM 9727  C CD1 . TRP C 1 178 ? 95.890  115.506 -21.022  1.00 40.00 ? 182 TRP C CD1 1 
ATOM 9728  C CD2 . TRP C 1 178 ? 95.882  113.522 -19.980  1.00 40.00 ? 182 TRP C CD2 1 
ATOM 9729  N NE1 . TRP C 1 178 ? 96.695  115.618 -19.906  1.00 40.00 ? 182 TRP C NE1 1 
ATOM 9730  C CE2 . TRP C 1 178 ? 96.706  114.409 -19.253  1.00 40.00 ? 182 TRP C CE2 1 
ATOM 9731  C CE3 . TRP C 1 178 ? 95.728  112.220 -19.502  1.00 40.00 ? 182 TRP C CE3 1 
ATOM 9732  C CZ2 . TRP C 1 178 ? 97.368  114.059 -18.080  1.00 40.00 ? 182 TRP C CZ2 1 
ATOM 9733  C CZ3 . TRP C 1 178 ? 96.383  111.881 -18.328  1.00 40.00 ? 182 TRP C CZ3 1 
ATOM 9734  C CH2 . TRP C 1 178 ? 97.199  112.786 -17.620  1.00 40.00 ? 182 TRP C CH2 1 
ATOM 9735  N N   . VAL C 1 179 ? 94.781  110.734 -22.223  1.00 40.00 ? 183 VAL C N   1 
ATOM 9736  C CA  . VAL C 1 179 ? 95.376  109.458 -21.778  1.00 40.00 ? 183 VAL C CA  1 
ATOM 9737  C C   . VAL C 1 179 ? 96.306  108.924 -22.866  1.00 40.00 ? 183 VAL C C   1 
ATOM 9738  O O   . VAL C 1 179 ? 97.451  108.556 -22.597  1.00 40.00 ? 183 VAL C O   1 
ATOM 9739  C CB  . VAL C 1 179 ? 94.293  108.487 -21.345  1.00 40.00 ? 183 VAL C CB  1 
ATOM 9740  C CG1 . VAL C 1 179 ? 93.875  107.568 -22.484  1.00 40.00 ? 183 VAL C CG1 1 
ATOM 9741  C CG2 . VAL C 1 179 ? 94.725  107.670 -20.126  1.00 40.00 ? 183 VAL C CG2 1 
ATOM 9742  N N   . GLN C 1 180 ? 95.853  108.958 -24.114  1.00 40.00 ? 184 GLN C N   1 
ATOM 9743  C CA  . GLN C 1 180 ? 96.644  108.558 -25.244  1.00 40.00 ? 184 GLN C CA  1 
ATOM 9744  C C   . GLN C 1 180 ? 98.027  109.189 -25.210  1.00 40.00 ? 184 GLN C C   1 
ATOM 9745  O O   . GLN C 1 180 ? 99.053  108.522 -25.095  1.00 40.00 ? 184 GLN C O   1 
ATOM 9746  C CB  . GLN C 1 180 ? 96.005  109.017 -26.561  1.00 40.00 ? 184 GLN C CB  1 
ATOM 9747  C CG  . GLN C 1 180 ? 96.183  108.090 -27.732  1.00 40.00 ? 184 GLN C CG  1 
ATOM 9748  C CD  . GLN C 1 180 ? 95.854  106.641 -27.443  1.00 40.00 ? 184 GLN C CD  1 
ATOM 9749  O OE1 . GLN C 1 180 ? 95.371  106.253 -26.369  1.00 40.00 ? 184 GLN C OE1 1 
ATOM 9750  N NE2 . GLN C 1 180 ? 96.117  105.770 -28.423  1.00 40.00 ? 184 GLN C NE2 1 
ATOM 9751  N N   . GLU C 1 181 ? 98.037  110.527 -25.310  1.00 40.00 ? 185 GLU C N   1 
ATOM 9752  C CA  . GLU C 1 181 ? 99.339  111.185 -25.381  1.00 40.00 ? 185 GLU C CA  1 
ATOM 9753  C C   . GLU C 1 181 ? 100.010 111.480 -24.087  1.00 40.00 ? 185 GLU C C   1 
ATOM 9754  O O   . GLU C 1 181 ? 100.867 112.397 -24.094  1.00 40.00 ? 185 GLU C O   1 
ATOM 9755  C CB  . GLU C 1 181 ? 99.204  112.430 -26.274  1.00 40.00 ? 185 GLU C CB  1 
ATOM 9756  C CG  . GLU C 1 181 ? 98.060  113.330 -25.836  1.00 40.00 ? 185 GLU C CG  1 
ATOM 9757  C CD  . GLU C 1 181 ? 98.021  114.602 -26.670  1.00 40.00 ? 185 GLU C CD  1 
ATOM 9758  O OE1 . GLU C 1 181 ? 98.004  114.497 -27.918  1.00 40.00 ? 185 GLU C OE1 1 
ATOM 9759  O OE2 . GLU C 1 181 ? 98.012  115.693 -26.038  1.00 40.00 ? 185 GLU C OE2 1 
ATOM 9760  N N   . ASN C 1 182 ? 99.723  110.858 -22.958  1.00 40.00 ? 186 ASN C N   1 
ATOM 9761  C CA  . ASN C 1 182 ? 100.413 111.213 -21.725  1.00 40.00 ? 186 ASN C CA  1 
ATOM 9762  C C   . ASN C 1 182 ? 100.361 110.100 -20.706  1.00 40.00 ? 186 ASN C C   1 
ATOM 9763  O O   . ASN C 1 182 ? 100.971 110.197 -19.639  1.00 40.00 ? 186 ASN C O   1 
ATOM 9764  C CB  . ASN C 1 182 ? 99.631  112.363 -21.028  1.00 40.00 ? 186 ASN C CB  1 
ATOM 9765  C CG  . ASN C 1 182 ? 99.920  113.700 -21.668  1.00 40.00 ? 186 ASN C CG  1 
ATOM 9766  O OD1 . ASN C 1 182 ? 100.974 114.273 -21.345  1.00 40.00 ? 186 ASN C OD1 1 
ATOM 9767  N ND2 . ASN C 1 182 ? 99.046  114.146 -22.577  1.00 40.00 ? 186 ASN C ND2 1 
ATOM 9768  N N   . ILE C 1 183 ? 99.549  109.056 -20.961  1.00 40.00 ? 187 ILE C N   1 
ATOM 9769  C CA  . ILE C 1 183 ? 99.456  108.071 -19.856  1.00 40.00 ? 187 ILE C CA  1 
ATOM 9770  C C   . ILE C 1 183 ? 100.772 107.331 -19.726  1.00 40.00 ? 187 ILE C C   1 
ATOM 9771  O O   . ILE C 1 183 ? 101.175 106.808 -18.678  1.00 40.00 ? 187 ILE C O   1 
ATOM 9772  C CB  . ILE C 1 183 ? 98.250  107.177 -20.073  1.00 40.00 ? 187 ILE C CB  1 
ATOM 9773  C CG1 . ILE C 1 183 ? 97.889  106.360 -18.832  1.00 40.00 ? 187 ILE C CG1 1 
ATOM 9774  C CG2 . ILE C 1 183 ? 98.547  106.259 -21.253  1.00 40.00 ? 187 ILE C CG2 1 
ATOM 9775  C CD1 . ILE C 1 183 ? 97.713  107.188 -17.564  1.00 40.00 ? 187 ILE C CD1 1 
ATOM 9776  N N   . ALA C 1 184 ? 101.473 107.312 -20.868  1.00 40.00 ? 188 ALA C N   1 
ATOM 9777  C CA  . ALA C 1 184 ? 102.787 106.717 -21.034  1.00 40.00 ? 188 ALA C CA  1 
ATOM 9778  C C   . ALA C 1 184 ? 103.652 107.074 -19.831  1.00 40.00 ? 188 ALA C C   1 
ATOM 9779  O O   . ALA C 1 184 ? 104.125 106.210 -19.094  1.00 40.00 ? 188 ALA C O   1 
ATOM 9780  C CB  . ALA C 1 184 ? 103.431 107.253 -22.311  1.00 40.00 ? 188 ALA C CB  1 
ATOM 9781  N N   . ALA C 1 185 ? 103.757 108.375 -19.550  1.00 40.00 ? 189 ALA C N   1 
ATOM 9782  C CA  . ALA C 1 185 ? 104.519 108.932 -18.456  1.00 40.00 ? 189 ALA C CA  1 
ATOM 9783  C C   . ALA C 1 185 ? 104.112 108.464 -17.076  1.00 40.00 ? 189 ALA C C   1 
ATOM 9784  O O   . ALA C 1 185 ? 104.742 108.814 -16.065  1.00 40.00 ? 189 ALA C O   1 
ATOM 9785  C CB  . ALA C 1 185 ? 104.525 110.459 -18.535  1.00 40.00 ? 189 ALA C CB  1 
ATOM 9786  N N   . PHE C 1 186 ? 103.057 107.685 -16.940  1.00 40.00 ? 190 PHE C N   1 
ATOM 9787  C CA  . PHE C 1 186 ? 102.637 107.209 -15.617  1.00 40.00 ? 190 PHE C CA  1 
ATOM 9788  C C   . PHE C 1 186 ? 102.862 105.690 -15.574  1.00 40.00 ? 190 PHE C C   1 
ATOM 9789  O O   . PHE C 1 186 ? 102.446 105.039 -14.623  1.00 40.00 ? 190 PHE C O   1 
ATOM 9790  C CB  . PHE C 1 186 ? 101.154 107.501 -15.336  1.00 40.00 ? 190 PHE C CB  1 
ATOM 9791  C CG  . PHE C 1 186 ? 100.896 108.984 -15.289  1.00 40.00 ? 190 PHE C CG  1 
ATOM 9792  C CD1 . PHE C 1 186 ? 100.815 109.715 -16.472  1.00 40.00 ? 190 PHE C CD1 1 
ATOM 9793  C CD2 . PHE C 1 186 ? 100.749 109.619 -14.064  1.00 40.00 ? 190 PHE C CD2 1 
ATOM 9794  C CE1 . PHE C 1 186 ? 100.594 111.079 -16.410  1.00 40.00 ? 190 PHE C CE1 1 
ATOM 9795  C CE2 . PHE C 1 186 ? 100.526 110.980 -13.993  1.00 40.00 ? 190 PHE C CE2 1 
ATOM 9796  C CZ  . PHE C 1 186 ? 100.448 111.708 -15.170  1.00 40.00 ? 190 PHE C CZ  1 
ATOM 9797  N N   . GLY C 1 187 ? 103.517 105.237 -16.645  1.00 40.00 ? 191 GLY C N   1 
ATOM 9798  C CA  . GLY C 1 187 ? 103.785 103.814 -16.785  1.00 40.00 ? 191 GLY C CA  1 
ATOM 9799  C C   . GLY C 1 187 ? 102.616 103.107 -17.462  1.00 40.00 ? 191 GLY C C   1 
ATOM 9800  O O   . GLY C 1 187 ? 102.549 101.879 -17.408  1.00 40.00 ? 191 GLY C O   1 
ATOM 9801  N N   . GLY C 1 188 ? 101.703 103.871 -18.075  1.00 40.00 ? 192 GLY C N   1 
ATOM 9802  C CA  . GLY C 1 188 ? 100.558 103.206 -18.715  1.00 40.00 ? 192 GLY C CA  1 
ATOM 9803  C C   . GLY C 1 188 ? 100.852 102.952 -20.195  1.00 40.00 ? 192 GLY C C   1 
ATOM 9804  O O   . GLY C 1 188 ? 101.613 103.671 -20.827  1.00 40.00 ? 192 GLY C O   1 
ATOM 9805  N N   . ASP C 1 189 ? 100.202 101.919 -20.709  1.00 40.00 ? 193 ASP C N   1 
ATOM 9806  C CA  . ASP C 1 189 ? 100.332 101.561 -22.108  1.00 40.00 ? 193 ASP C CA  1 
ATOM 9807  C C   . ASP C 1 189 ? 99.242  102.207 -22.921  1.00 40.00 ? 193 ASP C C   1 
ATOM 9808  O O   . ASP C 1 189 ? 98.073  101.749 -22.929  1.00 40.00 ? 193 ASP C O   1 
ATOM 9809  C CB  . ASP C 1 189 ? 100.158 100.028 -22.223  1.00 40.00 ? 193 ASP C CB  1 
ATOM 9810  C CG  . ASP C 1 189 ? 100.510 99.537  -23.622  1.00 40.00 ? 193 ASP C CG  1 
ATOM 9811  O OD1 . ASP C 1 189 ? 100.938 100.362 -24.469  1.00 40.00 ? 193 ASP C OD1 1 
ATOM 9812  O OD2 . ASP C 1 189 ? 100.353 98.320  -23.880  1.00 40.00 ? 193 ASP C OD2 1 
ATOM 9813  N N   . PRO C 1 190 ? 99.563  103.202 -23.736  1.00 40.00 ? 194 PRO C N   1 
ATOM 9814  C CA  . PRO C 1 190 ? 98.595  103.846 -24.619  1.00 40.00 ? 194 PRO C CA  1 
ATOM 9815  C C   . PRO C 1 190 ? 98.021  102.857 -25.631  1.00 40.00 ? 194 PRO C C   1 
ATOM 9816  O O   . PRO C 1 190 ? 97.164  103.198 -26.451  1.00 40.00 ? 194 PRO C O   1 
ATOM 9817  C CB  . PRO C 1 190 ? 99.425  104.886 -25.383  1.00 40.00 ? 194 PRO C CB  1 
ATOM 9818  C CG  . PRO C 1 190 ? 100.802 104.339 -25.329  1.00 40.00 ? 194 PRO C CG  1 
ATOM 9819  C CD  . PRO C 1 190 ? 100.908 103.779 -23.907  1.00 40.00 ? 194 PRO C CD  1 
ATOM 9820  N N   . MET C 1 191 ? 98.498  101.638 -25.656  1.00 40.00 ? 195 MET C N   1 
ATOM 9821  C CA  . MET C 1 191 ? 98.100  100.591 -26.542  1.00 40.00 ? 195 MET C CA  1 
ATOM 9822  C C   . MET C 1 191 ? 97.132  99.597  -25.924  1.00 40.00 ? 195 MET C C   1 
ATOM 9823  O O   . MET C 1 191 ? 96.562  98.787  -26.672  1.00 40.00 ? 195 MET C O   1 
ATOM 9824  C CB  . MET C 1 191 ? 99.332  99.853  -27.081  1.00 40.00 ? 195 MET C CB  1 
ATOM 9825  C CG  . MET C 1 191 ? 99.848  100.425 -28.389  1.00 40.00 ? 195 MET C CG  1 
ATOM 9826  S SD  . MET C 1 191 ? 98.687  101.612 -29.121  1.00 40.00 ? 195 MET C SD  1 
ATOM 9827  C CE  . MET C 1 191 ? 99.651  102.133 -30.549  1.00 40.00 ? 195 MET C CE  1 
ATOM 9828  N N   . SER C 1 192 ? 96.883  99.727  -24.630  1.00 40.00 ? 196 SER C N   1 
ATOM 9829  C CA  . SER C 1 192 ? 95.896  98.844  -23.996  1.00 40.00 ? 196 SER C CA  1 
ATOM 9830  C C   . SER C 1 192 ? 95.003  99.666  -23.064  1.00 40.00 ? 196 SER C C   1 
ATOM 9831  O O   . SER C 1 192 ? 95.012  99.663  -21.833  1.00 40.00 ? 196 SER C O   1 
ATOM 9832  C CB  . SER C 1 192 ? 96.527  97.594  -23.485  1.00 40.00 ? 196 SER C CB  1 
ATOM 9833  O OG  . SER C 1 192 ? 96.397  97.347  -22.109  1.00 40.00 ? 196 SER C OG  1 
ATOM 9834  N N   . VAL C 1 193 ? 94.162  100.457 -23.762  1.00 40.00 ? 197 VAL C N   1 
ATOM 9835  C CA  . VAL C 1 193 ? 93.159  101.313 -23.140  1.00 40.00 ? 197 VAL C CA  1 
ATOM 9836  C C   . VAL C 1 193 ? 91.838  100.527 -23.110  1.00 40.00 ? 197 VAL C C   1 
ATOM 9837  O O   . VAL C 1 193 ? 91.285  100.140 -24.144  1.00 40.00 ? 197 VAL C O   1 
ATOM 9838  C CB  . VAL C 1 193 ? 92.953  102.597 -23.967  1.00 40.00 ? 197 VAL C CB  1 
ATOM 9839  C CG1 . VAL C 1 193 ? 91.666  103.312 -23.642  1.00 40.00 ? 197 VAL C CG1 1 
ATOM 9840  C CG2 . VAL C 1 193 ? 94.146  103.532 -23.767  1.00 40.00 ? 197 VAL C CG2 1 
ATOM 9841  N N   . THR C 1 194 ? 91.359  100.282 -21.904  1.00 40.00 ? 198 THR C N   1 
ATOM 9842  C CA  . THR C 1 194 ? 90.091  99.579  -21.713  1.00 40.00 ? 198 THR C CA  1 
ATOM 9843  C C   . THR C 1 194 ? 89.094  100.512 -21.035  1.00 40.00 ? 198 THR C C   1 
ATOM 9844  O O   . THR C 1 194 ? 89.240  100.784 -19.825  1.00 40.00 ? 198 THR C O   1 
ATOM 9845  C CB  . THR C 1 194 ? 90.314  98.295  -20.902  1.00 40.00 ? 198 THR C CB  1 
ATOM 9846  O OG1 . THR C 1 194 ? 90.666  97.263  -21.834  1.00 40.00 ? 198 THR C OG1 1 
ATOM 9847  C CG2 . THR C 1 194 ? 89.107  97.834  -20.104  1.00 40.00 ? 198 THR C CG2 1 
ATOM 9848  N N   . LEU C 1 195 ? 88.105  101.032 -21.771  1.00 40.00 ? 199 LEU C N   1 
ATOM 9849  C CA  . LEU C 1 195 ? 87.124  101.925 -21.132  1.00 40.00 ? 199 LEU C CA  1 
ATOM 9850  C C   . LEU C 1 195 ? 86.201  101.121 -20.222  1.00 40.00 ? 199 LEU C C   1 
ATOM 9851  O O   . LEU C 1 195 ? 85.858  99.992  -20.579  1.00 40.00 ? 199 LEU C O   1 
ATOM 9852  C CB  . LEU C 1 195 ? 86.214  102.618 -22.174  1.00 40.00 ? 199 LEU C CB  1 
ATOM 9853  C CG  . LEU C 1 195 ? 86.910  103.423 -23.264  1.00 40.00 ? 199 LEU C CG  1 
ATOM 9854  C CD1 . LEU C 1 195 ? 85.952  103.947 -24.324  1.00 40.00 ? 199 LEU C CD1 1 
ATOM 9855  C CD2 . LEU C 1 195 ? 87.694  104.584 -22.633  1.00 40.00 ? 199 LEU C CD2 1 
ATOM 9856  N N   . PHE C 1 196 ? 85.733  101.680 -19.119  1.00 40.00 ? 200 PHE C N   1 
ATOM 9857  C CA  . PHE C 1 196 ? 84.752  100.930 -18.328  1.00 40.00 ? 200 PHE C CA  1 
ATOM 9858  C C   . PHE C 1 196 ? 83.888  101.847 -17.467  1.00 40.00 ? 200 PHE C C   1 
ATOM 9859  O O   . PHE C 1 196 ? 84.385  102.646 -16.665  1.00 40.00 ? 200 PHE C O   1 
ATOM 9860  C CB  . PHE C 1 196 ? 85.355  99.807  -17.548  1.00 40.00 ? 200 PHE C CB  1 
ATOM 9861  C CG  . PHE C 1 196 ? 85.957  100.132 -16.219  1.00 40.00 ? 200 PHE C CG  1 
ATOM 9862  C CD1 . PHE C 1 196 ? 87.008  101.045 -16.118  1.00 40.00 ? 200 PHE C CD1 1 
ATOM 9863  C CD2 . PHE C 1 196 ? 85.475  99.511  -15.065  1.00 40.00 ? 200 PHE C CD2 1 
ATOM 9864  C CE1 . PHE C 1 196 ? 87.561  101.325 -14.873  1.00 40.00 ? 200 PHE C CE1 1 
ATOM 9865  C CE2 . PHE C 1 196 ? 86.027  99.793  -13.820  1.00 40.00 ? 200 PHE C CE2 1 
ATOM 9866  C CZ  . PHE C 1 196 ? 87.068  100.703 -13.713  1.00 40.00 ? 200 PHE C CZ  1 
ATOM 9867  N N   . GLY C 1 197 ? 82.566  101.733 -17.628  1.00 40.00 ? 201 GLY C N   1 
ATOM 9868  C CA  . GLY C 1 197 ? 81.651  102.530 -16.833  1.00 40.00 ? 201 GLY C CA  1 
ATOM 9869  C C   . GLY C 1 197 ? 80.314  101.886 -16.542  1.00 40.00 ? 201 GLY C C   1 
ATOM 9870  O O   . GLY C 1 197 ? 79.849  100.921 -17.147  1.00 40.00 ? 201 GLY C O   1 
ATOM 9871  N N   . GLU C 1 198 ? 79.590  102.454 -15.605  1.00 40.00 ? 202 GLU C N   1 
ATOM 9872  C CA  . GLU C 1 198 ? 78.267  102.017 -15.189  1.00 40.00 ? 202 GLU C CA  1 
ATOM 9873  C C   . GLU C 1 198 ? 77.186  102.976 -15.656  1.00 40.00 ? 202 GLU C C   1 
ATOM 9874  O O   . GLU C 1 198 ? 77.485  103.984 -16.293  1.00 40.00 ? 202 GLU C O   1 
ATOM 9875  C CB  . GLU C 1 198 ? 78.320  101.845 -13.673  1.00 40.00 ? 202 GLU C CB  1 
ATOM 9876  C CG  . GLU C 1 198 ? 77.201  100.942 -13.185  1.00 40.00 ? 202 GLU C CG  1 
ATOM 9877  C CD  . GLU C 1 198 ? 76.111  101.854 -12.621  1.00 40.00 ? 202 GLU C CD  1 
ATOM 9878  O OE1 . GLU C 1 198 ? 76.222  103.060 -12.946  1.00 40.00 ? 202 GLU C OE1 1 
ATOM 9879  O OE2 . GLU C 1 198 ? 75.208  101.362 -11.910  1.00 40.00 ? 202 GLU C OE2 1 
ATOM 9880  N N   . SER C 1 199 ? 75.921  102.705 -15.448  1.00 40.00 ? 203 SER C N   1 
ATOM 9881  C CA  . SER C 1 199 ? 74.779  103.505 -15.885  1.00 40.00 ? 203 SER C CA  1 
ATOM 9882  C C   . SER C 1 199 ? 75.078  104.316 -17.134  1.00 40.00 ? 203 SER C C   1 
ATOM 9883  O O   . SER C 1 199 ? 75.482  103.757 -18.185  1.00 40.00 ? 203 SER C O   1 
ATOM 9884  C CB  . SER C 1 199 ? 74.236  104.340 -14.744  1.00 40.00 ? 203 SER C CB  1 
ATOM 9885  O OG  . SER C 1 199 ? 72.894  104.754 -14.838  1.00 40.00 ? 203 SER C OG  1 
ATOM 9886  N N   . ALA C 1 200 ? 74.959  105.661 -17.082  1.00 40.00 ? 204 ALA C N   1 
ATOM 9887  C CA  . ALA C 1 200 ? 75.242  106.415 -18.311  1.00 40.00 ? 204 ALA C CA  1 
ATOM 9888  C C   . ALA C 1 200 ? 76.707  106.393 -18.691  1.00 40.00 ? 204 ALA C C   1 
ATOM 9889  O O   . ALA C 1 200 ? 77.076  106.603 -19.864  1.00 40.00 ? 204 ALA C O   1 
ATOM 9890  C CB  . ALA C 1 200 ? 74.600  107.761 -18.361  1.00 40.00 ? 204 ALA C CB  1 
ATOM 9891  N N   . GLY C 1 201 ? 77.613  106.092 -17.765  1.00 40.00 ? 205 GLY C N   1 
ATOM 9892  C CA  . GLY C 1 201 ? 79.042  105.938 -18.156  1.00 40.00 ? 205 GLY C CA  1 
ATOM 9893  C C   . GLY C 1 201 ? 79.131  104.725 -19.109  1.00 40.00 ? 205 GLY C C   1 
ATOM 9894  O O   . GLY C 1 201 ? 79.741  104.817 -20.175  1.00 40.00 ? 205 GLY C O   1 
ATOM 9895  N N   . ALA C 1 202 ? 78.464  103.628 -18.749  1.00 40.00 ? 206 ALA C N   1 
ATOM 9896  C CA  . ALA C 1 202 ? 78.381  102.463 -19.631  1.00 40.00 ? 206 ALA C CA  1 
ATOM 9897  C C   . ALA C 1 202 ? 77.792  102.899 -20.979  1.00 40.00 ? 206 ALA C C   1 
ATOM 9898  O O   . ALA C 1 202 ? 78.391  102.708 -22.043  1.00 40.00 ? 206 ALA C O   1 
ATOM 9899  C CB  . ALA C 1 202 ? 77.425  101.461 -18.999  1.00 40.00 ? 206 ALA C CB  1 
ATOM 9900  N N   . ALA C 1 203 ? 76.656  103.631 -20.889  1.00 40.00 ? 207 ALA C N   1 
ATOM 9901  C CA  . ALA C 1 203 ? 76.016  104.147 -22.072  1.00 40.00 ? 207 ALA C CA  1 
ATOM 9902  C C   . ALA C 1 203 ? 77.008  104.929 -22.914  1.00 40.00 ? 207 ALA C C   1 
ATOM 9903  O O   . ALA C 1 203 ? 76.965  104.946 -24.140  1.00 40.00 ? 207 ALA C O   1 
ATOM 9904  C CB  . ALA C 1 203 ? 74.897  105.119 -21.742  1.00 40.00 ? 207 ALA C CB  1 
ATOM 9905  N N   . SER C 1 204 ? 77.866  105.644 -22.190  1.00 40.00 ? 208 SER C N   1 
ATOM 9906  C CA  . SER C 1 204 ? 78.885  106.481 -22.807  1.00 40.00 ? 208 SER C CA  1 
ATOM 9907  C C   . SER C 1 204 ? 79.912  105.635 -23.525  1.00 40.00 ? 208 SER C C   1 
ATOM 9908  O O   . SER C 1 204 ? 80.175  105.757 -24.742  1.00 40.00 ? 208 SER C O   1 
ATOM 9909  C CB  . SER C 1 204 ? 79.551  107.312 -21.705  1.00 40.00 ? 208 SER C CB  1 
ATOM 9910  O OG  . SER C 1 204 ? 78.641  108.228 -21.154  1.00 40.00 ? 208 SER C OG  1 
ATOM 9911  N N   . VAL C 1 205 ? 80.460  104.688 -22.723  1.00 40.00 ? 209 VAL C N   1 
ATOM 9912  C CA  . VAL C 1 205 ? 81.443  103.774 -23.321  1.00 40.00 ? 209 VAL C CA  1 
ATOM 9913  C C   . VAL C 1 205 ? 80.810  103.271 -24.642  1.00 40.00 ? 209 VAL C C   1 
ATOM 9914  O O   . VAL C 1 205 ? 81.496  103.206 -25.674  1.00 40.00 ? 209 VAL C O   1 
ATOM 9915  C CB  . VAL C 1 205 ? 81.635  102.508 -22.469  1.00 40.00 ? 209 VAL C CB  1 
ATOM 9916  C CG1 . VAL C 1 205 ? 82.401  101.485 -23.291  1.00 40.00 ? 209 VAL C CG1 1 
ATOM 9917  C CG2 . VAL C 1 205 ? 82.357  102.767 -21.160  1.00 40.00 ? 209 VAL C CG2 1 
ATOM 9918  N N   . GLY C 1 206 ? 79.491  102.939 -24.539  1.00 40.00 ? 210 GLY C N   1 
ATOM 9919  C CA  . GLY C 1 206 ? 78.826  102.462 -25.735  1.00 40.00 ? 210 GLY C CA  1 
ATOM 9920  C C   . GLY C 1 206 ? 78.946  103.429 -26.902  1.00 40.00 ? 210 GLY C C   1 
ATOM 9921  O O   . GLY C 1 206 ? 79.167  103.090 -28.077  1.00 40.00 ? 210 GLY C O   1 
ATOM 9922  N N   . MET C 1 207 ? 78.773  104.718 -26.561  1.00 40.00 ? 211 MET C N   1 
ATOM 9923  C CA  . MET C 1 207 ? 78.818  105.734 -27.634  1.00 40.00 ? 211 MET C CA  1 
ATOM 9924  C C   . MET C 1 207 ? 80.195  105.909 -28.200  1.00 40.00 ? 211 MET C C   1 
ATOM 9925  O O   . MET C 1 207 ? 80.464  106.169 -29.396  1.00 40.00 ? 211 MET C O   1 
ATOM 9926  C CB  . MET C 1 207 ? 78.102  106.984 -27.149  1.00 40.00 ? 211 MET C CB  1 
ATOM 9927  C CG  . MET C 1 207 ? 76.604  106.754 -27.368  1.00 40.00 ? 211 MET C CG  1 
ATOM 9928  S SD  . MET C 1 207 ? 75.565  108.016 -26.720  1.00 40.00 ? 211 MET C SD  1 
ATOM 9929  C CE  . MET C 1 207 ? 75.099  107.346 -25.110  1.00 40.00 ? 211 MET C CE  1 
ATOM 9930  N N   . HIS C 1 208 ? 81.184  105.640 -27.306  1.00 40.00 ? 212 HIS C N   1 
ATOM 9931  C CA  . HIS C 1 208 ? 82.528  105.738 -27.912  1.00 40.00 ? 212 HIS C CA  1 
ATOM 9932  C C   . HIS C 1 208 ? 82.647  104.655 -28.955  1.00 40.00 ? 212 HIS C C   1 
ATOM 9933  O O   . HIS C 1 208 ? 83.048  105.015 -30.076  1.00 40.00 ? 212 HIS C O   1 
ATOM 9934  C CB  . HIS C 1 208 ? 83.616  105.802 -26.865  1.00 40.00 ? 212 HIS C CB  1 
ATOM 9935  C CG  . HIS C 1 208 ? 83.580  107.162 -26.179  1.00 40.00 ? 212 HIS C CG  1 
ATOM 9936  N ND1 . HIS C 1 208 ? 83.582  107.292 -24.817  1.00 40.00 ? 212 HIS C ND1 1 
ATOM 9937  C CD2 . HIS C 1 208 ? 83.495  108.398 -26.692  1.00 40.00 ? 212 HIS C CD2 1 
ATOM 9938  C CE1 . HIS C 1 208 ? 83.512  108.572 -24.501  1.00 40.00 ? 212 HIS C CE1 1 
ATOM 9939  N NE2 . HIS C 1 208 ? 83.459  109.266 -25.633  1.00 40.00 ? 212 HIS C NE2 1 
ATOM 9940  N N   . ILE C 1 209 ? 82.241  103.421 -28.658  1.00 40.00 ? 213 ILE C N   1 
ATOM 9941  C CA  . ILE C 1 209 ? 82.315  102.344 -29.646  1.00 40.00 ? 213 ILE C CA  1 
ATOM 9942  C C   . ILE C 1 209 ? 81.529  102.712 -30.908  1.00 40.00 ? 213 ILE C C   1 
ATOM 9943  O O   . ILE C 1 209 ? 81.889  102.381 -32.032  1.00 40.00 ? 213 ILE C O   1 
ATOM 9944  C CB  . ILE C 1 209 ? 81.678  101.065 -29.099  1.00 40.00 ? 213 ILE C CB  1 
ATOM 9945  C CG1 . ILE C 1 209 ? 82.508  100.405 -28.012  1.00 40.00 ? 213 ILE C CG1 1 
ATOM 9946  C CG2 . ILE C 1 209 ? 81.396  100.089 -30.216  1.00 40.00 ? 213 ILE C CG2 1 
ATOM 9947  C CD1 . ILE C 1 209 ? 81.725  99.284  -27.304  1.00 40.00 ? 213 ILE C CD1 1 
ATOM 9948  N N   . LEU C 1 210 ? 80.399  103.397 -30.728  1.00 40.00 ? 214 LEU C N   1 
ATOM 9949  C CA  . LEU C 1 210 ? 79.545  103.750 -31.843  1.00 40.00 ? 214 LEU C CA  1 
ATOM 9950  C C   . LEU C 1 210 ? 80.055  104.958 -32.605  1.00 40.00 ? 214 LEU C C   1 
ATOM 9951  O O   . LEU C 1 210 ? 79.556  105.282 -33.689  1.00 40.00 ? 214 LEU C O   1 
ATOM 9952  C CB  . LEU C 1 210 ? 78.154  104.032 -31.253  1.00 40.00 ? 214 LEU C CB  1 
ATOM 9953  C CG  . LEU C 1 210 ? 77.086  102.960 -31.317  1.00 40.00 ? 214 LEU C CG  1 
ATOM 9954  C CD1 . LEU C 1 210 ? 77.484  101.813 -32.248  1.00 40.00 ? 214 LEU C CD1 1 
ATOM 9955  C CD2 . LEU C 1 210 ? 76.777  102.437 -29.915  1.00 40.00 ? 214 LEU C CD2 1 
ATOM 9956  N N   . SER C 1 211 ? 81.003  105.668 -31.991  1.00 40.00 ? 215 SER C N   1 
ATOM 9957  C CA  . SER C 1 211 ? 81.516  106.896 -32.625  1.00 40.00 ? 215 SER C CA  1 
ATOM 9958  C C   . SER C 1 211 ? 82.876  106.698 -33.253  1.00 40.00 ? 215 SER C C   1 
ATOM 9959  O O   . SER C 1 211 ? 83.829  106.286 -32.557  1.00 40.00 ? 215 SER C O   1 
ATOM 9960  C CB  . SER C 1 211 ? 81.540  107.976 -31.536  1.00 40.00 ? 215 SER C CB  1 
ATOM 9961  O OG  . SER C 1 211 ? 81.493  109.258 -32.116  1.00 40.00 ? 215 SER C OG  1 
ATOM 9962  N N   . LEU C 1 212 ? 83.009  106.987 -34.562  1.00 40.00 ? 216 LEU C N   1 
ATOM 9963  C CA  . LEU C 1 212 ? 84.324  106.708 -35.151  1.00 40.00 ? 216 LEU C CA  1 
ATOM 9964  C C   . LEU C 1 212 ? 85.491  107.286 -34.422  1.00 40.00 ? 216 LEU C C   1 
ATOM 9965  O O   . LEU C 1 212 ? 86.280  106.579 -33.778  1.00 40.00 ? 216 LEU C O   1 
ATOM 9966  C CB  . LEU C 1 212 ? 84.388  106.908 -36.652  1.00 40.00 ? 216 LEU C CB  1 
ATOM 9967  C CG  . LEU C 1 212 ? 84.285  105.574 -37.424  1.00 40.00 ? 216 LEU C CG  1 
ATOM 9968  C CD1 . LEU C 1 212 ? 83.720  104.419 -36.590  1.00 40.00 ? 216 LEU C CD1 1 
ATOM 9969  C CD2 . LEU C 1 212 ? 83.406  105.748 -38.666  1.00 40.00 ? 216 LEU C CD2 1 
ATOM 9970  N N   . PRO C 1 213 ? 85.625  108.594 -34.432  1.00 40.00 ? 217 PRO C N   1 
ATOM 9971  C CA  . PRO C 1 213 ? 86.708  109.265 -33.728  1.00 40.00 ? 217 PRO C CA  1 
ATOM 9972  C C   . PRO C 1 213 ? 86.947  108.682 -32.371  1.00 40.00 ? 217 PRO C C   1 
ATOM 9973  O O   . PRO C 1 213 ? 88.145  108.508 -32.013  1.00 40.00 ? 217 PRO C O   1 
ATOM 9974  C CB  . PRO C 1 213 ? 86.308  110.709 -33.725  1.00 40.00 ? 217 PRO C CB  1 
ATOM 9975  C CG  . PRO C 1 213 ? 85.480  110.853 -34.971  1.00 40.00 ? 217 PRO C CG  1 
ATOM 9976  C CD  . PRO C 1 213 ? 84.747  109.544 -35.151  1.00 40.00 ? 217 PRO C CD  1 
ATOM 9977  N N   . SER C 1 214 ? 86.004  108.240 -31.556  1.00 40.00 ? 218 SER C N   1 
ATOM 9978  C CA  . SER C 1 214 ? 86.495  107.662 -30.278  1.00 40.00 ? 218 SER C CA  1 
ATOM 9979  C C   . SER C 1 214 ? 87.244  106.363 -30.444  1.00 40.00 ? 218 SER C C   1 
ATOM 9980  O O   . SER C 1 214 ? 87.924  105.866 -29.522  1.00 40.00 ? 218 SER C O   1 
ATOM 9981  C CB  . SER C 1 214 ? 85.306  107.555 -29.308  1.00 40.00 ? 218 SER C CB  1 
ATOM 9982  O OG  . SER C 1 214 ? 84.892  108.913 -28.998  1.00 40.00 ? 218 SER C OG  1 
ATOM 9983  N N   . ARG C 1 215 ? 87.166  105.696 -31.581  1.00 40.00 ? 219 ARG C N   1 
ATOM 9984  C CA  . ARG C 1 215 ? 87.723  104.386 -31.815  1.00 40.00 ? 219 ARG C CA  1 
ATOM 9985  C C   . ARG C 1 215 ? 89.184  104.190 -31.538  1.00 40.00 ? 219 ARG C C   1 
ATOM 9986  O O   . ARG C 1 215 ? 89.622  103.307 -30.774  1.00 40.00 ? 219 ARG C O   1 
ATOM 9987  C CB  . ARG C 1 215 ? 87.411  103.948 -33.262  1.00 40.00 ? 219 ARG C CB  1 
ATOM 9988  C CG  . ARG C 1 215 ? 85.926  103.693 -33.492  1.00 40.00 ? 219 ARG C CG  1 
ATOM 9989  C CD  . ARG C 1 215 ? 85.357  102.640 -32.560  1.00 40.00 ? 219 ARG C CD  1 
ATOM 9990  N NE  . ARG C 1 215 ? 85.815  101.294 -32.908  1.00 40.00 ? 219 ARG C NE  1 
ATOM 9991  C CZ  . ARG C 1 215 ? 85.261  100.183 -32.442  1.00 40.00 ? 219 ARG C CZ  1 
ATOM 9992  N NH1 . ARG C 1 215 ? 84.228  100.292 -31.616  1.00 40.00 ? 219 ARG C NH1 1 
ATOM 9993  N NH2 . ARG C 1 215 ? 85.694  98.968  -32.765  1.00 40.00 ? 219 ARG C NH2 1 
ATOM 9994  N N   . SER C 1 216 ? 90.007  105.050 -32.159  1.00 40.00 ? 220 SER C N   1 
ATOM 9995  C CA  . SER C 1 216 ? 91.442  104.970 -31.974  1.00 40.00 ? 220 SER C CA  1 
ATOM 9996  C C   . SER C 1 216 ? 91.872  105.231 -30.554  1.00 40.00 ? 220 SER C C   1 
ATOM 9997  O O   . SER C 1 216 ? 93.095  105.251 -30.362  1.00 40.00 ? 220 SER C O   1 
ATOM 9998  C CB  . SER C 1 216 ? 92.165  106.027 -32.825  1.00 40.00 ? 220 SER C CB  1 
ATOM 9999  O OG  . SER C 1 216 ? 91.241  107.027 -33.184  1.00 40.00 ? 220 SER C OG  1 
ATOM 10000 N N   . LEU C 1 217 ? 91.020  105.507 -29.598  1.00 40.00 ? 221 LEU C N   1 
ATOM 10001 C CA  . LEU C 1 217 ? 91.556  105.866 -28.298  1.00 40.00 ? 221 LEU C CA  1 
ATOM 10002 C C   . LEU C 1 217 ? 91.353  104.800 -27.265  1.00 40.00 ? 221 LEU C C   1 
ATOM 10003 O O   . LEU C 1 217 ? 91.676  105.012 -26.086  1.00 40.00 ? 221 LEU C O   1 
ATOM 10004 C CB  . LEU C 1 217 ? 90.994  107.222 -27.889  1.00 40.00 ? 221 LEU C CB  1 
ATOM 10005 C CG  . LEU C 1 217 ? 90.409  108.177 -28.934  1.00 40.00 ? 221 LEU C CG  1 
ATOM 10006 C CD1 . LEU C 1 217 ? 89.904  109.386 -28.155  1.00 40.00 ? 221 LEU C CD1 1 
ATOM 10007 C CD2 . LEU C 1 217 ? 91.428  108.638 -29.958  1.00 40.00 ? 221 LEU C CD2 1 
ATOM 10008 N N   . PHE C 1 218 ? 90.812  103.673 -27.689  1.00 40.00 ? 222 PHE C N   1 
ATOM 10009 C CA  . PHE C 1 218 ? 90.613  102.590 -26.713  1.00 40.00 ? 222 PHE C CA  1 
ATOM 10010 C C   . PHE C 1 218 ? 90.585  101.275 -27.472  1.00 40.00 ? 222 PHE C C   1 
ATOM 10011 O O   . PHE C 1 218 ? 90.450  101.270 -28.700  1.00 40.00 ? 222 PHE C O   1 
ATOM 10012 C CB  . PHE C 1 218 ? 89.347  102.781 -25.913  1.00 40.00 ? 222 PHE C CB  1 
ATOM 10013 C CG  . PHE C 1 218 ? 88.105  102.590 -26.754  1.00 40.00 ? 222 PHE C CG  1 
ATOM 10014 C CD1 . PHE C 1 218 ? 87.780  103.558 -27.696  1.00 40.00 ? 222 PHE C CD1 1 
ATOM 10015 C CD2 . PHE C 1 218 ? 87.319  101.451 -26.579  1.00 40.00 ? 222 PHE C CD2 1 
ATOM 10016 C CE1 . PHE C 1 218 ? 86.644  103.394 -28.461  1.00 40.00 ? 222 PHE C CE1 1 
ATOM 10017 C CE2 . PHE C 1 218 ? 86.183  101.298 -27.342  1.00 40.00 ? 222 PHE C CE2 1 
ATOM 10018 C CZ  . PHE C 1 218 ? 85.851  102.267 -28.279  1.00 40.00 ? 222 PHE C CZ  1 
ATOM 10019 N N   . HIS C 1 219 ? 90.798  100.175 -26.754  1.00 40.00 ? 223 HIS C N   1 
ATOM 10020 C CA  . HIS C 1 219 ? 90.870  98.882  -27.457  1.00 40.00 ? 223 HIS C CA  1 
ATOM 10021 C C   . HIS C 1 219 ? 89.870  97.876  -26.938  1.00 40.00 ? 223 HIS C C   1 
ATOM 10022 O O   . HIS C 1 219 ? 89.295  97.091  -27.700  1.00 40.00 ? 223 HIS C O   1 
ATOM 10023 C CB  . HIS C 1 219 ? 92.333  98.415  -27.375  1.00 40.00 ? 223 HIS C CB  1 
ATOM 10024 C CG  . HIS C 1 219 ? 93.340  99.484  -27.729  1.00 40.00 ? 223 HIS C CG  1 
ATOM 10025 N ND1 . HIS C 1 219 ? 93.927  100.327 -26.806  1.00 40.00 ? 223 HIS C ND1 1 
ATOM 10026 C CD2 . HIS C 1 219 ? 93.808  99.855  -28.952  1.00 40.00 ? 223 HIS C CD2 1 
ATOM 10027 C CE1 . HIS C 1 219 ? 94.715  101.161 -27.457  1.00 40.00 ? 223 HIS C CE1 1 
ATOM 10028 N NE2 . HIS C 1 219 ? 94.687  100.894 -28.753  1.00 40.00 ? 223 HIS C NE2 1 
ATOM 10029 N N   . ARG C 1 220 ? 89.610  97.866  -25.638  1.00 40.00 ? 224 ARG C N   1 
ATOM 10030 C CA  . ARG C 1 220 ? 88.625  96.991  -25.010  1.00 40.00 ? 224 ARG C CA  1 
ATOM 10031 C C   . ARG C 1 220 ? 87.559  97.837  -24.323  1.00 40.00 ? 224 ARG C C   1 
ATOM 10032 O O   . ARG C 1 220 ? 87.795  99.041  -24.117  1.00 40.00 ? 224 ARG C O   1 
ATOM 10033 C CB  . ARG C 1 220 ? 89.337  95.982  -24.119  1.00 40.00 ? 224 ARG C CB  1 
ATOM 10034 C CG  . ARG C 1 220 ? 89.776  94.747  -24.889  1.00 40.00 ? 224 ARG C CG  1 
ATOM 10035 C CD  . ARG C 1 220 ? 90.601  93.745  -24.094  1.00 40.00 ? 224 ARG C CD  1 
ATOM 10036 N NE  . ARG C 1 220 ? 91.832  94.309  -23.589  1.00 40.00 ? 224 ARG C NE  1 
ATOM 10037 C CZ  . ARG C 1 220 ? 92.859  94.746  -24.312  1.00 40.00 ? 224 ARG C CZ  1 
ATOM 10038 N NH1 . ARG C 1 220 ? 92.884  94.678  -25.640  1.00 40.00 ? 224 ARG C NH1 1 
ATOM 10039 N NH2 . ARG C 1 220 ? 93.887  95.274  -23.642  1.00 40.00 ? 224 ARG C NH2 1 
ATOM 10040 N N   . ALA C 1 221 ? 86.395  97.310  -23.987  1.00 40.00 ? 225 ALA C N   1 
ATOM 10041 C CA  . ALA C 1 221 ? 85.306  98.066  -23.373  1.00 40.00 ? 225 ALA C CA  1 
ATOM 10042 C C   . ALA C 1 221 ? 84.446  97.255  -22.406  1.00 40.00 ? 225 ALA C C   1 
ATOM 10043 O O   . ALA C 1 221 ? 84.169  96.076  -22.690  1.00 40.00 ? 225 ALA C O   1 
ATOM 10044 C CB  . ALA C 1 221 ? 84.344  98.548  -24.478  1.00 40.00 ? 225 ALA C CB  1 
ATOM 10045 N N   . VAL C 1 222 ? 84.010  97.839  -21.315  1.00 40.00 ? 226 VAL C N   1 
ATOM 10046 C CA  . VAL C 1 222 ? 83.142  97.157  -20.367  1.00 40.00 ? 226 VAL C CA  1 
ATOM 10047 C C   . VAL C 1 222 ? 81.907  98.055  -20.234  1.00 40.00 ? 226 VAL C C   1 
ATOM 10048 O O   . VAL C 1 222 ? 82.040  99.301  -20.375  1.00 40.00 ? 226 VAL C O   1 
ATOM 10049 C CB  . VAL C 1 222 ? 83.759  97.055  -18.976  1.00 40.00 ? 226 VAL C CB  1 
ATOM 10050 C CG1 . VAL C 1 222 ? 82.887  96.310  -17.979  1.00 40.00 ? 226 VAL C CG1 1 
ATOM 10051 C CG2 . VAL C 1 222 ? 85.146  96.463  -19.050  1.00 40.00 ? 226 VAL C CG2 1 
ATOM 10052 N N   . LEU C 1 223 ? 80.709  97.508  -20.070  1.00 40.00 ? 227 LEU C N   1 
ATOM 10053 C CA  . LEU C 1 223 ? 79.514  98.361  -19.957  1.00 40.00 ? 227 LEU C CA  1 
ATOM 10054 C C   . LEU C 1 223 ? 78.691  97.775  -18.826  1.00 40.00 ? 227 LEU C C   1 
ATOM 10055 O O   . LEU C 1 223 ? 78.105  96.720  -19.071  1.00 40.00 ? 227 LEU C O   1 
ATOM 10056 C CB  . LEU C 1 223 ? 78.723  98.291  -21.254  1.00 40.00 ? 227 LEU C CB  1 
ATOM 10057 C CG  . LEU C 1 223 ? 79.352  98.853  -22.518  1.00 40.00 ? 227 LEU C CG  1 
ATOM 10058 C CD1 . LEU C 1 223 ? 80.306  97.907  -23.206  1.00 40.00 ? 227 LEU C CD1 1 
ATOM 10059 C CD2 . LEU C 1 223 ? 78.295  99.195  -23.577  1.00 40.00 ? 227 LEU C CD2 1 
ATOM 10060 N N   . GLN C 1 224 ? 78.691  98.341  -17.659  1.00 40.00 ? 228 GLN C N   1 
ATOM 10061 C CA  . GLN C 1 224 ? 77.939  97.804  -16.540  1.00 40.00 ? 228 GLN C CA  1 
ATOM 10062 C C   . GLN C 1 224 ? 76.594  98.496  -16.359  1.00 40.00 ? 228 GLN C C   1 
ATOM 10063 O O   . GLN C 1 224 ? 76.446  99.715  -16.254  1.00 40.00 ? 228 GLN C O   1 
ATOM 10064 C CB  . GLN C 1 224 ? 78.767  97.943  -15.254  1.00 40.00 ? 228 GLN C CB  1 
ATOM 10065 C CG  . GLN C 1 224 ? 80.257  97.687  -15.477  1.00 40.00 ? 228 GLN C CG  1 
ATOM 10066 C CD  . GLN C 1 224 ? 81.076  97.921  -14.218  1.00 40.00 ? 228 GLN C CD  1 
ATOM 10067 O OE1 . GLN C 1 224 ? 82.292  98.111  -14.296  1.00 40.00 ? 228 GLN C OE1 1 
ATOM 10068 N NE2 . GLN C 1 224 ? 80.411  97.889  -13.070  1.00 40.00 ? 228 GLN C NE2 1 
ATOM 10069 N N   . SER C 1 225 ? 75.522  97.686  -16.305  1.00 40.00 ? 229 SER C N   1 
ATOM 10070 C CA  . SER C 1 225 ? 74.176  98.184  -16.094  1.00 40.00 ? 229 SER C CA  1 
ATOM 10071 C C   . SER C 1 225 ? 73.827  99.317  -17.048  1.00 40.00 ? 229 SER C C   1 
ATOM 10072 O O   . SER C 1 225 ? 73.066  100.199 -16.580  1.00 40.00 ? 229 SER C O   1 
ATOM 10073 C CB  . SER C 1 225 ? 74.046  98.726  -14.660  1.00 40.00 ? 229 SER C CB  1 
ATOM 10074 O OG  . SER C 1 225 ? 73.905  97.758  -13.669  1.00 40.00 ? 229 SER C OG  1 
ATOM 10075 N N   . GLY C 1 226 ? 74.250  99.350  -18.309  1.00 40.00 ? 230 GLY C N   1 
ATOM 10076 C CA  . GLY C 1 226 ? 73.776  100.482 -19.109  1.00 40.00 ? 230 GLY C CA  1 
ATOM 10077 C C   . GLY C 1 226 ? 74.179  100.396 -20.522  1.00 40.00 ? 230 GLY C C   1 
ATOM 10078 O O   . GLY C 1 226 ? 75.221  99.766  -20.740  1.00 40.00 ? 230 GLY C O   1 
ATOM 10079 N N   . THR C 1 227 ? 73.506  100.897 -21.540  1.00 40.00 ? 231 THR C N   1 
ATOM 10080 C CA  . THR C 1 227 ? 74.004  100.738 -22.944  1.00 40.00 ? 231 THR C CA  1 
ATOM 10081 C C   . THR C 1 227 ? 73.701  101.982 -23.750  1.00 40.00 ? 231 THR C C   1 
ATOM 10082 O O   . THR C 1 227 ? 72.918  102.847 -23.330  1.00 40.00 ? 231 THR C O   1 
ATOM 10083 C CB  . THR C 1 227 ? 73.161  99.689  -23.667  1.00 40.00 ? 231 THR C CB  1 
ATOM 10084 O OG1 . THR C 1 227 ? 71.787  100.215 -23.645  1.00 40.00 ? 231 THR C OG1 1 
ATOM 10085 C CG2 . THR C 1 227 ? 73.224  98.331  -23.013  1.00 40.00 ? 231 THR C CG2 1 
ATOM 10086 N N   . PRO C 1 228 ? 74.190  102.098 -24.958  1.00 40.00 ? 232 PRO C N   1 
ATOM 10087 C CA  . PRO C 1 228 ? 73.878  103.310 -25.717  1.00 40.00 ? 232 PRO C CA  1 
ATOM 10088 C C   . PRO C 1 228 ? 72.534  103.176 -26.401  1.00 40.00 ? 232 PRO C C   1 
ATOM 10089 O O   . PRO C 1 228 ? 72.029  104.131 -26.972  1.00 40.00 ? 232 PRO C O   1 
ATOM 10090 C CB  . PRO C 1 228 ? 74.965  103.328 -26.791  1.00 40.00 ? 232 PRO C CB  1 
ATOM 10091 C CG  . PRO C 1 228 ? 75.214  101.870 -27.039  1.00 40.00 ? 232 PRO C CG  1 
ATOM 10092 C CD  . PRO C 1 228 ? 75.084  101.197 -25.676  1.00 40.00 ? 232 PRO C CD  1 
ATOM 10093 N N   . ASN C 1 229 ? 71.989  101.964 -26.438  1.00 40.00 ? 233 ASN C N   1 
ATOM 10094 C CA  . ASN C 1 229 ? 70.812  101.737 -27.254  1.00 40.00 ? 233 ASN C CA  1 
ATOM 10095 C C   . ASN C 1 229 ? 69.474  101.770 -26.622  1.00 40.00 ? 233 ASN C C   1 
ATOM 10096 O O   . ASN C 1 229 ? 68.452  101.937 -27.368  1.00 40.00 ? 233 ASN C O   1 
ATOM 10097 C CB  . ASN C 1 229 ? 71.121  100.451 -28.080  1.00 40.00 ? 233 ASN C CB  1 
ATOM 10098 C CG  . ASN C 1 229 ? 71.285  99.265  -27.125  1.00 40.00 ? 233 ASN C CG  1 
ATOM 10099 O OD1 . ASN C 1 229 ? 72.296  99.164  -26.440  1.00 40.00 ? 233 ASN C OD1 1 
ATOM 10100 N ND2 . ASN C 1 229 ? 70.298  98.389  -27.067  1.00 40.00 ? 233 ASN C ND2 1 
ATOM 10101 N N   . GLY C 1 230 ? 69.261  101.711 -25.319  1.00 40.00 ? 234 GLY C N   1 
ATOM 10102 C CA  . GLY C 1 230 ? 67.888  101.748 -24.789  1.00 40.00 ? 234 GLY C CA  1 
ATOM 10103 C C   . GLY C 1 230 ? 66.956  102.899 -25.015  1.00 40.00 ? 234 GLY C C   1 
ATOM 10104 O O   . GLY C 1 230 ? 67.038  103.764 -25.904  1.00 40.00 ? 234 GLY C O   1 
ATOM 10105 N N   . PRO C 1 231 ? 65.917  103.007 -24.160  1.00 40.00 ? 235 PRO C N   1 
ATOM 10106 C CA  . PRO C 1 231 ? 64.950  104.090 -24.226  1.00 40.00 ? 235 PRO C CA  1 
ATOM 10107 C C   . PRO C 1 231 ? 65.392  105.400 -23.584  1.00 40.00 ? 235 PRO C C   1 
ATOM 10108 O O   . PRO C 1 231 ? 64.783  106.463 -23.812  1.00 40.00 ? 235 PRO C O   1 
ATOM 10109 C CB  . PRO C 1 231 ? 63.774  103.540 -23.424  1.00 40.00 ? 235 PRO C CB  1 
ATOM 10110 C CG  . PRO C 1 231 ? 64.370  102.608 -22.443  1.00 40.00 ? 235 PRO C CG  1 
ATOM 10111 C CD  . PRO C 1 231 ? 65.628  102.084 -23.035  1.00 40.00 ? 235 PRO C CD  1 
ATOM 10112 N N   . TRP C 1 232 ? 66.423  105.449 -22.751  1.00 40.00 ? 236 TRP C N   1 
ATOM 10113 C CA  . TRP C 1 232 ? 66.747  106.682 -22.079  1.00 40.00 ? 236 TRP C CA  1 
ATOM 10114 C C   . TRP C 1 232 ? 68.069  107.371 -22.323  1.00 40.00 ? 236 TRP C C   1 
ATOM 10115 O O   . TRP C 1 232 ? 68.272  108.500 -21.829  1.00 40.00 ? 236 TRP C O   1 
ATOM 10116 C CB  . TRP C 1 232 ? 66.726  106.372 -20.561  1.00 40.00 ? 236 TRP C CB  1 
ATOM 10117 C CG  . TRP C 1 232 ? 67.699  105.291 -20.189  1.00 40.00 ? 236 TRP C CG  1 
ATOM 10118 C CD1 . TRP C 1 232 ? 67.404  103.963 -20.055  1.00 40.00 ? 236 TRP C CD1 1 
ATOM 10119 C CD2 . TRP C 1 232 ? 69.100  105.402 -19.930  1.00 40.00 ? 236 TRP C CD2 1 
ATOM 10120 N NE1 . TRP C 1 232 ? 68.516  103.252 -19.708  1.00 40.00 ? 236 TRP C NE1 1 
ATOM 10121 C CE2 . TRP C 1 232 ? 69.584  104.114 -19.627  1.00 40.00 ? 236 TRP C CE2 1 
ATOM 10122 C CE3 . TRP C 1 232 ? 70.007  106.466 -19.920  1.00 40.00 ? 236 TRP C CE3 1 
ATOM 10123 C CZ2 . TRP C 1 232 ? 70.913  103.853 -19.300  1.00 40.00 ? 236 TRP C CZ2 1 
ATOM 10124 C CZ3 . TRP C 1 232 ? 71.326  106.212 -19.608  1.00 40.00 ? 236 TRP C CZ3 1 
ATOM 10125 C CH2 . TRP C 1 232 ? 71.768  104.908 -19.310  1.00 40.00 ? 236 TRP C CH2 1 
ATOM 10126 N N   . ALA C 1 233 ? 69.017  106.741 -22.990  1.00 40.00 ? 237 ALA C N   1 
ATOM 10127 C CA  . ALA C 1 233 ? 70.322  107.345 -23.164  1.00 40.00 ? 237 ALA C CA  1 
ATOM 10128 C C   . ALA C 1 233 ? 70.423  108.170 -24.408  1.00 40.00 ? 237 ALA C C   1 
ATOM 10129 O O   . ALA C 1 233 ? 71.537  108.682 -24.662  1.00 40.00 ? 237 ALA C O   1 
ATOM 10130 C CB  . ALA C 1 233 ? 71.407  106.316 -22.971  1.00 40.00 ? 237 ALA C CB  1 
ATOM 10131 N N   . THR C 1 234 ? 69.383  108.389 -25.206  1.00 40.00 ? 238 THR C N   1 
ATOM 10132 C CA  . THR C 1 234 ? 69.604  109.338 -26.315  1.00 40.00 ? 238 THR C CA  1 
ATOM 10133 C C   . THR C 1 234 ? 68.242  109.982 -26.611  1.00 40.00 ? 238 THR C C   1 
ATOM 10134 O O   . THR C 1 234 ? 67.237  109.398 -26.236  1.00 40.00 ? 238 THR C O   1 
ATOM 10135 C CB  . THR C 1 234 ? 70.126  108.873 -27.643  1.00 40.00 ? 238 THR C CB  1 
ATOM 10136 O OG1 . THR C 1 234 ? 69.245  107.841 -28.187  1.00 40.00 ? 238 THR C OG1 1 
ATOM 10137 C CG2 . THR C 1 234 ? 71.547  108.379 -27.627  1.00 40.00 ? 238 THR C CG2 1 
ATOM 10138 N N   . VAL C 1 235 ? 68.202  111.127 -27.237  1.00 40.00 ? 239 VAL C N   1 
ATOM 10139 C CA  . VAL C 1 235 ? 66.966  111.794 -27.618  1.00 40.00 ? 239 VAL C CA  1 
ATOM 10140 C C   . VAL C 1 235 ? 67.135  112.232 -29.084  1.00 40.00 ? 239 VAL C C   1 
ATOM 10141 O O   . VAL C 1 235 ? 68.287  112.301 -29.551  1.00 40.00 ? 239 VAL C O   1 
ATOM 10142 C CB  . VAL C 1 235 ? 66.766  113.091 -26.811  1.00 40.00 ? 239 VAL C CB  1 
ATOM 10143 C CG1 . VAL C 1 235 ? 66.778  112.798 -25.326  1.00 40.00 ? 239 VAL C CG1 1 
ATOM 10144 C CG2 . VAL C 1 235 ? 67.905  114.041 -27.163  1.00 40.00 ? 239 VAL C CG2 1 
ATOM 10145 N N   . SER C 1 236 ? 66.091  112.571 -29.785  1.00 40.00 ? 240 SER C N   1 
ATOM 10146 C CA  . SER C 1 236 ? 66.330  113.022 -31.158  1.00 40.00 ? 240 SER C CA  1 
ATOM 10147 C C   . SER C 1 236 ? 66.659  114.513 -31.090  1.00 40.00 ? 240 SER C C   1 
ATOM 10148 O O   . SER C 1 236 ? 66.511  115.126 -30.055  1.00 40.00 ? 240 SER C O   1 
ATOM 10149 C CB  . SER C 1 236 ? 65.061  112.925 -32.011  1.00 40.00 ? 240 SER C CB  1 
ATOM 10150 O OG  . SER C 1 236 ? 63.951  113.504 -31.356  1.00 40.00 ? 240 SER C OG  1 
ATOM 10151 N N   . ALA C 1 237 ? 67.007  115.057 -32.230  1.00 40.00 ? 241 ALA C N   1 
ATOM 10152 C CA  . ALA C 1 237 ? 67.298  116.470 -32.394  1.00 40.00 ? 241 ALA C CA  1 
ATOM 10153 C C   . ALA C 1 237 ? 66.039  117.233 -31.988  1.00 40.00 ? 241 ALA C C   1 
ATOM 10154 O O   . ALA C 1 237 ? 66.054  118.040 -31.056  1.00 40.00 ? 241 ALA C O   1 
ATOM 10155 C CB  . ALA C 1 237 ? 67.606  116.767 -33.848  1.00 40.00 ? 241 ALA C CB  1 
ATOM 10156 N N   . GLY C 1 238 ? 64.940  116.922 -32.664  1.00 40.00 ? 242 GLY C N   1 
ATOM 10157 C CA  . GLY C 1 238 ? 63.665  117.573 -32.378  1.00 40.00 ? 242 GLY C CA  1 
ATOM 10158 C C   . GLY C 1 238 ? 63.371  117.655 -30.894  1.00 40.00 ? 242 GLY C C   1 
ATOM 10159 O O   . GLY C 1 238 ? 63.025  118.760 -30.424  1.00 40.00 ? 242 GLY C O   1 
ATOM 10160 N N   . GLU C 1 239 ? 63.523  116.563 -30.139  1.00 40.00 ? 243 GLU C N   1 
ATOM 10161 C CA  . GLU C 1 239 ? 63.188  116.672 -28.723  1.00 40.00 ? 243 GLU C CA  1 
ATOM 10162 C C   . GLU C 1 239 ? 64.211  117.506 -27.959  1.00 40.00 ? 243 GLU C C   1 
ATOM 10163 O O   . GLU C 1 239 ? 63.844  118.129 -26.975  1.00 40.00 ? 243 GLU C O   1 
ATOM 10164 C CB  . GLU C 1 239 ? 63.209  115.320 -28.019  1.00 40.00 ? 243 GLU C CB  1 
ATOM 10165 C CG  . GLU C 1 239 ? 61.852  114.882 -27.625  1.00 40.00 ? 243 GLU C CG  1 
ATOM 10166 C CD  . GLU C 1 239 ? 61.266  115.547 -26.424  1.00 40.00 ? 243 GLU C CD  1 
ATOM 10167 O OE1 . GLU C 1 239 ? 61.706  115.171 -25.317  1.00 40.00 ? 243 GLU C OE1 1 
ATOM 10168 O OE2 . GLU C 1 239 ? 60.363  116.401 -26.613  1.00 40.00 ? 243 GLU C OE2 1 
ATOM 10169 N N   . ALA C 1 240 ? 65.448  117.366 -28.437  1.00 40.00 ? 244 ALA C N   1 
ATOM 10170 C CA  . ALA C 1 240 ? 66.541  118.094 -27.816  1.00 40.00 ? 244 ALA C CA  1 
ATOM 10171 C C   . ALA C 1 240 ? 66.159  119.580 -27.887  1.00 40.00 ? 244 ALA C C   1 
ATOM 10172 O O   . ALA C 1 240 ? 66.019  120.351 -26.936  1.00 40.00 ? 244 ALA C O   1 
ATOM 10173 C CB  . ALA C 1 240 ? 67.799  117.829 -28.623  1.00 40.00 ? 244 ALA C CB  1 
ATOM 10174 N N   . ARG C 1 241 ? 65.914  119.972 -29.153  1.00 40.00 ? 245 ARG C N   1 
ATOM 10175 C CA  . ARG C 1 241 ? 65.537  121.365 -29.334  1.00 40.00 ? 245 ARG C CA  1 
ATOM 10176 C C   . ARG C 1 241 ? 64.372  121.718 -28.419  1.00 40.00 ? 245 ARG C C   1 
ATOM 10177 O O   . ARG C 1 241 ? 64.360  122.673 -27.632  1.00 40.00 ? 245 ARG C O   1 
ATOM 10178 C CB  . ARG C 1 241 ? 65.163  121.560 -30.785  1.00 40.00 ? 245 ARG C CB  1 
ATOM 10179 C CG  . ARG C 1 241 ? 64.599  122.923 -31.108  1.00 40.00 ? 245 ARG C CG  1 
ATOM 10180 C CD  . ARG C 1 241 ? 64.890  123.238 -32.570  1.00 40.00 ? 245 ARG C CD  1 
ATOM 10181 N NE  . ARG C 1 241 ? 64.576  124.624 -32.914  1.00 40.00 ? 245 ARG C NE  1 
ATOM 10182 C CZ  . ARG C 1 241 ? 65.210  125.678 -32.395  1.00 40.00 ? 245 ARG C CZ  1 
ATOM 10183 N NH1 . ARG C 1 241 ? 66.202  125.584 -31.512  1.00 40.00 ? 245 ARG C NH1 1 
ATOM 10184 N NH2 . ARG C 1 241 ? 64.824  126.891 -32.789  1.00 40.00 ? 245 ARG C NH2 1 
ATOM 10185 N N   . ARG C 1 242 ? 63.316  120.894 -28.525  1.00 40.00 ? 246 ARG C N   1 
ATOM 10186 C CA  . ARG C 1 242 ? 62.122  121.160 -27.727  1.00 40.00 ? 246 ARG C CA  1 
ATOM 10187 C C   . ARG C 1 242 ? 62.503  121.340 -26.272  1.00 40.00 ? 246 ARG C C   1 
ATOM 10188 O O   . ARG C 1 242 ? 61.954  122.249 -25.633  1.00 40.00 ? 246 ARG C O   1 
ATOM 10189 C CB  . ARG C 1 242 ? 61.092  120.084 -27.952  1.00 40.00 ? 246 ARG C CB  1 
ATOM 10190 C CG  . ARG C 1 242 ? 59.741  120.194 -27.314  1.00 40.00 ? 246 ARG C CG  1 
ATOM 10191 C CD  . ARG C 1 242 ? 59.271  118.923 -26.593  1.00 40.00 ? 246 ARG C CD  1 
ATOM 10192 N NE  . ARG C 1 242 ? 58.893  119.312 -25.245  1.00 40.00 ? 246 ARG C NE  1 
ATOM 10193 C CZ  . ARG C 1 242 ? 59.169  118.615 -24.149  1.00 40.00 ? 246 ARG C CZ  1 
ATOM 10194 N NH1 . ARG C 1 242 ? 59.818  117.457 -24.248  1.00 40.00 ? 246 ARG C NH1 1 
ATOM 10195 N NH2 . ARG C 1 242 ? 58.732  119.160 -23.003  1.00 40.00 ? 246 ARG C NH2 1 
ATOM 10196 N N   . ARG C 1 243 ? 63.460  120.542 -25.740  1.00 40.00 ? 247 ARG C N   1 
ATOM 10197 C CA  . ARG C 1 243 ? 63.728  120.782 -24.319  1.00 40.00 ? 247 ARG C CA  1 
ATOM 10198 C C   . ARG C 1 243 ? 64.714  121.896 -24.087  1.00 40.00 ? 247 ARG C C   1 
ATOM 10199 O O   . ARG C 1 243 ? 64.780  122.432 -22.967  1.00 40.00 ? 247 ARG C O   1 
ATOM 10200 C CB  . ARG C 1 243 ? 64.047  119.575 -23.498  1.00 40.00 ? 247 ARG C CB  1 
ATOM 10201 C CG  . ARG C 1 243 ? 63.298  118.300 -23.882  1.00 40.00 ? 247 ARG C CG  1 
ATOM 10202 C CD  . ARG C 1 243 ? 64.268  117.115 -23.862  1.00 40.00 ? 247 ARG C CD  1 
ATOM 10203 N NE  . ARG C 1 243 ? 63.555  115.899 -23.794  1.00 40.00 ? 247 ARG C NE  1 
ATOM 10204 C CZ  . ARG C 1 243 ? 63.704  114.749 -23.200  1.00 40.00 ? 247 ARG C CZ  1 
ATOM 10205 N NH1 . ARG C 1 243 ? 64.713  114.408 -22.420  1.00 40.00 ? 247 ARG C NH1 1 
ATOM 10206 N NH2 . ARG C 1 243 ? 62.717  113.875 -23.458  1.00 40.00 ? 247 ARG C NH2 1 
ATOM 10207 N N   . ALA C 1 244 ? 65.474  122.268 -25.105  1.00 40.00 ? 248 ALA C N   1 
ATOM 10208 C CA  . ALA C 1 244 ? 66.446  123.364 -24.906  1.00 40.00 ? 248 ALA C CA  1 
ATOM 10209 C C   . ALA C 1 244 ? 65.659  124.667 -24.785  1.00 40.00 ? 248 ALA C C   1 
ATOM 10210 O O   . ALA C 1 244 ? 65.560  125.338 -23.757  1.00 40.00 ? 248 ALA C O   1 
ATOM 10211 C CB  . ALA C 1 244 ? 67.374  123.404 -26.109  1.00 40.00 ? 248 ALA C CB  1 
ATOM 10212 N N   . THR C 1 245 ? 65.007  125.013 -25.902  1.00 40.00 ? 249 THR C N   1 
ATOM 10213 C CA  . THR C 1 245 ? 64.214  126.212 -25.877  1.00 40.00 ? 249 THR C CA  1 
ATOM 10214 C C   . THR C 1 245 ? 63.239  126.181 -24.696  1.00 40.00 ? 249 THR C C   1 
ATOM 10215 O O   . THR C 1 245 ? 63.048  127.172 -23.948  1.00 40.00 ? 249 THR C O   1 
ATOM 10216 C CB  . THR C 1 245 ? 63.348  126.277 -27.147  1.00 40.00 ? 249 THR C CB  1 
ATOM 10217 O OG1 . THR C 1 245 ? 62.360  125.291 -26.877  1.00 40.00 ? 249 THR C OG1 1 
ATOM 10218 C CG2 . THR C 1 245 ? 64.038  125.992 -28.435  1.00 40.00 ? 249 THR C CG2 1 
ATOM 10219 N N   . LEU C 1 246 ? 62.533  125.063 -24.437  1.00 40.00 ? 250 LEU C N   1 
ATOM 10220 C CA  . LEU C 1 246 ? 61.606  125.169 -23.289  1.00 40.00 ? 250 LEU C CA  1 
ATOM 10221 C C   . LEU C 1 246 ? 62.362  125.534 -22.023  1.00 40.00 ? 250 LEU C C   1 
ATOM 10222 O O   . LEU C 1 246 ? 62.003  126.474 -21.290  1.00 40.00 ? 250 LEU C O   1 
ATOM 10223 C CB  . LEU C 1 246 ? 60.716  123.951 -23.165  1.00 40.00 ? 250 LEU C CB  1 
ATOM 10224 C CG  . LEU C 1 246 ? 60.065  123.782 -21.785  1.00 40.00 ? 250 LEU C CG  1 
ATOM 10225 C CD1 . LEU C 1 246 ? 59.196  124.979 -21.524  1.00 40.00 ? 250 LEU C CD1 1 
ATOM 10226 C CD2 . LEU C 1 246 ? 59.338  122.493 -21.609  1.00 40.00 ? 250 LEU C CD2 1 
ATOM 10227 N N   . LEU C 1 247 ? 63.482  124.839 -21.763  1.00 40.00 ? 251 LEU C N   1 
ATOM 10228 C CA  . LEU C 1 247 ? 64.273  125.224 -20.605  1.00 40.00 ? 251 LEU C CA  1 
ATOM 10229 C C   . LEU C 1 247 ? 64.683  126.712 -20.669  1.00 40.00 ? 251 LEU C C   1 
ATOM 10230 O O   . LEU C 1 247 ? 64.568  127.469 -19.706  1.00 40.00 ? 251 LEU C O   1 
ATOM 10231 C CB  . LEU C 1 247 ? 65.577  124.419 -20.468  1.00 40.00 ? 251 LEU C CB  1 
ATOM 10232 C CG  . LEU C 1 247 ? 66.248  124.983 -19.158  1.00 40.00 ? 251 LEU C CG  1 
ATOM 10233 C CD1 . LEU C 1 247 ? 66.127  123.962 -18.062  1.00 40.00 ? 251 LEU C CD1 1 
ATOM 10234 C CD2 . LEU C 1 247 ? 67.621  125.442 -19.566  1.00 40.00 ? 251 LEU C CD2 1 
ATOM 10235 N N   . ALA C 1 248 ? 65.203  127.101 -21.840  1.00 40.00 ? 252 ALA C N   1 
ATOM 10236 C CA  . ALA C 1 248 ? 65.589  128.505 -21.982  1.00 40.00 ? 252 ALA C CA  1 
ATOM 10237 C C   . ALA C 1 248 ? 64.428  129.392 -21.543  1.00 40.00 ? 252 ALA C C   1 
ATOM 10238 O O   . ALA C 1 248 ? 64.559  130.253 -20.677  1.00 40.00 ? 252 ALA C O   1 
ATOM 10239 C CB  . ALA C 1 248 ? 65.974  128.825 -23.409  1.00 40.00 ? 252 ALA C CB  1 
ATOM 10240 N N   . ARG C 1 249 ? 63.288  129.237 -22.214  1.00 40.00 ? 253 ARG C N   1 
ATOM 10241 C CA  . ARG C 1 249 ? 62.084  130.026 -21.938  1.00 40.00 ? 253 ARG C CA  1 
ATOM 10242 C C   . ARG C 1 249 ? 61.792  130.081 -20.452  1.00 40.00 ? 253 ARG C C   1 
ATOM 10243 O O   . ARG C 1 249 ? 61.586  131.169 -19.933  1.00 40.00 ? 253 ARG C O   1 
ATOM 10244 C CB  . ARG C 1 249 ? 60.873  129.425 -22.605  1.00 40.00 ? 253 ARG C CB  1 
ATOM 10245 C CG  . ARG C 1 249 ? 59.800  130.241 -23.226  1.00 40.00 ? 253 ARG C CG  1 
ATOM 10246 C CD  . ARG C 1 249 ? 58.707  129.375 -23.812  1.00 40.00 ? 253 ARG C CD  1 
ATOM 10247 N NE  . ARG C 1 249 ? 58.996  128.819 -25.130  1.00 40.00 ? 253 ARG C NE  1 
ATOM 10248 C CZ  . ARG C 1 249 ? 58.898  127.506 -25.367  1.00 40.00 ? 253 ARG C CZ  1 
ATOM 10249 N NH1 . ARG C 1 249 ? 58.551  126.670 -24.389  1.00 40.00 ? 253 ARG C NH1 1 
ATOM 10250 N NH2 . ARG C 1 249 ? 59.188  127.068 -26.588  1.00 40.00 ? 253 ARG C NH2 1 
ATOM 10251 N N   . LEU C 1 250 ? 61.797  128.961 -19.722  1.00 40.00 ? 254 LEU C N   1 
ATOM 10252 C CA  . LEU C 1 250 ? 61.541  129.072 -18.289  1.00 40.00 ? 254 LEU C CA  1 
ATOM 10253 C C   . LEU C 1 250 ? 62.539  129.931 -17.525  1.00 40.00 ? 254 LEU C C   1 
ATOM 10254 O O   . LEU C 1 250 ? 62.352  130.320 -16.356  1.00 40.00 ? 254 LEU C O   1 
ATOM 10255 C CB  . LEU C 1 250 ? 61.634  127.669 -17.628  1.00 40.00 ? 254 LEU C CB  1 
ATOM 10256 C CG  . LEU C 1 250 ? 60.470  126.793 -18.103  1.00 40.00 ? 254 LEU C CG  1 
ATOM 10257 C CD1 . LEU C 1 250 ? 60.512  125.407 -17.568  1.00 40.00 ? 254 LEU C CD1 1 
ATOM 10258 C CD2 . LEU C 1 250 ? 59.197  127.514 -17.647  1.00 40.00 ? 254 LEU C CD2 1 
ATOM 10259 N N   . VAL C 1 251 ? 63.676  130.207 -18.114  1.00 40.00 ? 255 VAL C N   1 
ATOM 10260 C CA  . VAL C 1 251 ? 64.757  130.925 -17.456  1.00 40.00 ? 255 VAL C CA  1 
ATOM 10261 C C   . VAL C 1 251 ? 64.807  132.323 -17.990  1.00 40.00 ? 255 VAL C C   1 
ATOM 10262 O O   . VAL C 1 251 ? 65.647  133.154 -17.646  1.00 40.00 ? 255 VAL C O   1 
ATOM 10263 C CB  . VAL C 1 251 ? 66.012  130.056 -17.681  1.00 40.00 ? 255 VAL C CB  1 
ATOM 10264 C CG1 . VAL C 1 251 ? 66.997  130.623 -18.661  1.00 40.00 ? 255 VAL C CG1 1 
ATOM 10265 C CG2 . VAL C 1 251 ? 66.569  129.668 -16.323  1.00 40.00 ? 255 VAL C CG2 1 
ATOM 10266 N N   . GLY C 1 252 ? 63.831  132.622 -18.853  1.00 40.00 ? 256 GLY C N   1 
ATOM 10267 C CA  . GLY C 1 252 ? 63.720  133.976 -19.375  1.00 40.00 ? 256 GLY C CA  1 
ATOM 10268 C C   . GLY C 1 252 ? 64.544  134.157 -20.606  1.00 40.00 ? 256 GLY C C   1 
ATOM 10269 O O   . GLY C 1 252 ? 64.755  135.280 -21.035  1.00 40.00 ? 256 GLY C O   1 
ATOM 10270 N N   . CYS C 1 253 ? 65.007  133.040 -21.173  1.00 40.00 ? 257 CYS C N   1 
ATOM 10271 C CA  . CYS C 1 253 ? 65.767  133.159 -22.409  1.00 40.00 ? 257 CYS C CA  1 
ATOM 10272 C C   . CYS C 1 253 ? 64.993  132.739 -23.606  1.00 40.00 ? 257 CYS C C   1 
ATOM 10273 O O   . CYS C 1 253 ? 64.656  131.574 -23.572  1.00 40.00 ? 257 CYS C O   1 
ATOM 10274 C CB  . CYS C 1 253 ? 67.108  132.445 -22.278  1.00 40.00 ? 257 CYS C CB  1 
ATOM 10275 S SG  . CYS C 1 253 ? 68.216  133.458 -21.250  1.00 40.00 ? 257 CYS C SG  1 
ATOM 10276 N N   . PRO C 1 254 ? 64.767  133.587 -24.571  1.00 40.00 ? 258 PRO C N   1 
ATOM 10277 C CA  . PRO C 1 254 ? 64.994  135.008 -24.621  1.00 40.00 ? 258 PRO C CA  1 
ATOM 10278 C C   . PRO C 1 254 ? 63.793  135.662 -23.903  1.00 40.00 ? 258 PRO C C   1 
ATOM 10279 O O   . PRO C 1 254 ? 62.792  134.972 -23.666  1.00 40.00 ? 258 PRO C O   1 
ATOM 10280 C CB  . PRO C 1 254 ? 64.948  135.392 -26.088  1.00 40.00 ? 258 PRO C CB  1 
ATOM 10281 C CG  . PRO C 1 254 ? 63.800  134.534 -26.549  1.00 40.00 ? 258 PRO C CG  1 
ATOM 10282 C CD  . PRO C 1 254 ? 64.026  133.255 -25.801  1.00 40.00 ? 258 PRO C CD  1 
ATOM 10283 N N   . PRO C 1 255 ? 63.938  136.894 -23.474  1.00 40.00 ? 259 PRO C N   1 
ATOM 10284 C CA  . PRO C 1 255 ? 62.879  137.621 -22.743  1.00 40.00 ? 259 PRO C CA  1 
ATOM 10285 C C   . PRO C 1 255 ? 61.896  138.236 -23.730  1.00 40.00 ? 259 PRO C C   1 
ATOM 10286 O O   . PRO C 1 255 ? 62.302  138.641 -24.848  1.00 40.00 ? 259 PRO C O   1 
ATOM 10287 C CB  . PRO C 1 255 ? 63.662  138.668 -21.970  1.00 40.00 ? 259 PRO C CB  1 
ATOM 10288 C CG  . PRO C 1 255 ? 64.794  139.005 -22.883  1.00 40.00 ? 259 PRO C CG  1 
ATOM 10289 C CD  . PRO C 1 255 ? 65.123  137.758 -23.667  1.00 40.00 ? 259 PRO C CD  1 
ATOM 10290 N N   . GLY C 1 256 ? 60.613  138.255 -23.381  1.00 40.00 ? 260 GLY C N   1 
ATOM 10291 C CA  . GLY C 1 256 ? 59.653  138.803 -24.330  1.00 40.00 ? 260 GLY C CA  1 
ATOM 10292 C C   . GLY C 1 256 ? 59.230  137.804 -25.394  1.00 40.00 ? 260 GLY C C   1 
ATOM 10293 O O   . GLY C 1 256 ? 59.452  136.605 -25.278  1.00 40.00 ? 260 GLY C O   1 
ATOM 10294 N N   . GLY C 1 257 ? 58.582  138.310 -26.445  1.00 40.00 ? 261 GLY C N   1 
ATOM 10295 C CA  . GLY C 1 257 ? 58.084  137.530 -27.566  1.00 40.00 ? 261 GLY C CA  1 
ATOM 10296 C C   . GLY C 1 257 ? 59.012  137.577 -28.783  1.00 40.00 ? 261 GLY C C   1 
ATOM 10297 O O   . GLY C 1 257 ? 58.580  137.718 -29.930  1.00 40.00 ? 261 GLY C O   1 
ATOM 10298 N N   . ALA C 1 258 ? 60.292  137.427 -28.518  1.00 40.00 ? 262 ALA C N   1 
ATOM 10299 C CA  . ALA C 1 258 ? 61.443  137.466 -29.376  1.00 40.00 ? 262 ALA C CA  1 
ATOM 10300 C C   . ALA C 1 258 ? 61.681  136.209 -30.176  1.00 40.00 ? 262 ALA C C   1 
ATOM 10301 O O   . ALA C 1 258 ? 60.688  135.489 -30.344  1.00 40.00 ? 262 ALA C O   1 
ATOM 10302 C CB  . ALA C 1 258 ? 62.666  137.720 -28.468  1.00 40.00 ? 262 ALA C CB  1 
ATOM 10303 N N   . GLY C 1 259 ? 62.883  135.913 -30.663  1.00 40.00 ? 263 GLY C N   1 
ATOM 10304 C CA  . GLY C 1 259 ? 62.958  134.655 -31.351  1.00 40.00 ? 263 GLY C CA  1 
ATOM 10305 C C   . GLY C 1 259 ? 63.630  134.532 -32.661  1.00 40.00 ? 263 GLY C C   1 
ATOM 10306 O O   . GLY C 1 259 ? 64.120  135.464 -33.277  1.00 40.00 ? 263 GLY C O   1 
ATOM 10307 N N   . GLY C 1 260 ? 63.678  133.242 -33.031  1.00 40.00 ? 264 GLY C N   1 
ATOM 10308 C CA  . GLY C 1 260 ? 64.314  132.863 -34.264  1.00 40.00 ? 264 GLY C CA  1 
ATOM 10309 C C   . GLY C 1 260 ? 65.780  133.243 -34.239  1.00 40.00 ? 264 GLY C C   1 
ATOM 10310 O O   . GLY C 1 260 ? 66.267  133.512 -35.356  1.00 40.00 ? 264 GLY C O   1 
ATOM 10311 N N   . ASN C 1 261 ? 66.477  133.320 -33.111  1.00 40.00 ? 265 ASN C N   1 
ATOM 10312 C CA  . ASN C 1 261 ? 67.924  133.565 -33.201  1.00 40.00 ? 265 ASN C CA  1 
ATOM 10313 C C   . ASN C 1 261 ? 68.507  132.596 -32.166  1.00 40.00 ? 265 ASN C C   1 
ATOM 10314 O O   . ASN C 1 261 ? 68.462  132.802 -30.960  1.00 40.00 ? 265 ASN C O   1 
ATOM 10315 C CB  . ASN C 1 261 ? 68.497  134.928 -33.259  1.00 40.00 ? 265 ASN C CB  1 
ATOM 10316 C CG  . ASN C 1 261 ? 69.918  134.987 -33.819  1.00 40.00 ? 265 ASN C CG  1 
ATOM 10317 O OD1 . ASN C 1 261 ? 70.832  134.361 -33.257  1.00 40.00 ? 265 ASN C OD1 1 
ATOM 10318 N ND2 . ASN C 1 261 ? 70.139  135.720 -34.905  1.00 40.00 ? 265 ASN C ND2 1 
ATOM 10319 N N   . ASP C 1 262 ? 69.002  131.457 -32.705  1.00 40.00 ? 266 ASP C N   1 
ATOM 10320 C CA  . ASP C 1 262 ? 69.483  130.449 -31.729  1.00 40.00 ? 266 ASP C CA  1 
ATOM 10321 C C   . ASP C 1 262 ? 70.643  131.032 -30.962  1.00 40.00 ? 266 ASP C C   1 
ATOM 10322 O O   . ASP C 1 262 ? 70.775  130.959 -29.731  1.00 40.00 ? 266 ASP C O   1 
ATOM 10323 C CB  . ASP C 1 262 ? 69.622  129.097 -32.364  1.00 40.00 ? 266 ASP C CB  1 
ATOM 10324 C CG  . ASP C 1 262 ? 68.323  128.472 -32.880  1.00 40.00 ? 266 ASP C CG  1 
ATOM 10325 O OD1 . ASP C 1 262 ? 67.224  128.795 -32.344  1.00 40.00 ? 266 ASP C OD1 1 
ATOM 10326 O OD2 . ASP C 1 262 ? 68.337  127.633 -33.837  1.00 40.00 ? 266 ASP C OD2 1 
ATOM 10327 N N   . THR C 1 263 ? 71.476  131.774 -31.694  1.00 40.00 ? 267 THR C N   1 
ATOM 10328 C CA  . THR C 1 263 ? 72.616  132.449 -31.101  1.00 40.00 ? 267 THR C CA  1 
ATOM 10329 C C   . THR C 1 263 ? 72.262  133.385 -29.956  1.00 40.00 ? 267 THR C C   1 
ATOM 10330 O O   . THR C 1 263 ? 72.867  133.331 -28.887  1.00 40.00 ? 267 THR C O   1 
ATOM 10331 C CB  . THR C 1 263 ? 73.490  133.250 -32.089  1.00 40.00 ? 267 THR C CB  1 
ATOM 10332 O OG1 . THR C 1 263 ? 73.517  132.603 -33.372  1.00 40.00 ? 267 THR C OG1 1 
ATOM 10333 C CG2 . THR C 1 263 ? 74.902  133.294 -31.501  1.00 40.00 ? 267 THR C CG2 1 
ATOM 10334 N N   . GLU C 1 264 ? 71.266  134.221 -30.196  1.00 40.00 ? 268 GLU C N   1 
ATOM 10335 C CA  . GLU C 1 264 ? 70.840  135.126 -29.109  1.00 40.00 ? 268 GLU C CA  1 
ATOM 10336 C C   . GLU C 1 264 ? 70.364  134.289 -27.930  1.00 40.00 ? 268 GLU C C   1 
ATOM 10337 O O   . GLU C 1 264 ? 70.677  134.571 -26.791  1.00 40.00 ? 268 GLU C O   1 
ATOM 10338 C CB  . GLU C 1 264 ? 69.726  136.024 -29.612  1.00 40.00 ? 268 GLU C CB  1 
ATOM 10339 C CG  . GLU C 1 264 ? 70.193  136.855 -30.822  1.00 40.00 ? 268 GLU C CG  1 
ATOM 10340 C CD  . GLU C 1 264 ? 69.149  137.907 -31.163  1.00 40.00 ? 268 GLU C CD  1 
ATOM 10341 O OE1 . GLU C 1 264 ? 68.965  138.238 -32.358  1.00 40.00 ? 268 GLU C OE1 1 
ATOM 10342 O OE2 . GLU C 1 264 ? 68.502  138.407 -30.208  1.00 40.00 ? 268 GLU C OE2 1 
ATOM 10343 N N   . LEU C 1 265 ? 69.656  133.208 -28.271  1.00 40.00 ? 269 LEU C N   1 
ATOM 10344 C CA  . LEU C 1 265 ? 69.095  132.293 -27.286  1.00 40.00 ? 269 LEU C CA  1 
ATOM 10345 C C   . LEU C 1 265 ? 70.188  131.709 -26.417  1.00 40.00 ? 269 LEU C C   1 
ATOM 10346 O O   . LEU C 1 265 ? 70.148  131.761 -25.181  1.00 40.00 ? 269 LEU C O   1 
ATOM 10347 C CB  . LEU C 1 265 ? 68.295  131.217 -27.984  1.00 40.00 ? 269 LEU C CB  1 
ATOM 10348 C CG  . LEU C 1 265 ? 67.175  130.470 -27.263  1.00 40.00 ? 269 LEU C CG  1 
ATOM 10349 C CD1 . LEU C 1 265 ? 66.572  129.433 -28.229  1.00 40.00 ? 269 LEU C CD1 1 
ATOM 10350 C CD2 . LEU C 1 265 ? 67.659  129.737 -26.022  1.00 40.00 ? 269 LEU C CD2 1 
ATOM 10351 N N   . ILE C 1 266 ? 71.193  131.156 -27.118  1.00 40.00 ? 270 ILE C N   1 
ATOM 10352 C CA  . ILE C 1 266 ? 72.298  130.590 -26.324  1.00 40.00 ? 270 ILE C CA  1 
ATOM 10353 C C   . ILE C 1 266 ? 73.058  131.710 -25.578  1.00 40.00 ? 270 ILE C C   1 
ATOM 10354 O O   . ILE C 1 266 ? 73.471  131.618 -24.405  1.00 40.00 ? 270 ILE C O   1 
ATOM 10355 C CB  . ILE C 1 266 ? 73.270  129.762 -27.166  1.00 40.00 ? 270 ILE C CB  1 
ATOM 10356 C CG1 . ILE C 1 266 ? 72.636  129.063 -28.359  1.00 40.00 ? 270 ILE C CG1 1 
ATOM 10357 C CG2 . ILE C 1 266 ? 74.021  128.808 -26.242  1.00 40.00 ? 270 ILE C CG2 1 
ATOM 10358 C CD1 . ILE C 1 266 ? 72.166  127.640 -28.180  1.00 40.00 ? 270 ILE C CD1 1 
ATOM 10359 N N   . ALA C 1 267 ? 73.214  132.859 -26.265  1.00 40.00 ? 271 ALA C N   1 
ATOM 10360 C CA  . ALA C 1 267 ? 73.941  133.975 -25.647  1.00 40.00 ? 271 ALA C CA  1 
ATOM 10361 C C   . ALA C 1 267 ? 73.280  134.319 -24.326  1.00 40.00 ? 271 ALA C C   1 
ATOM 10362 O O   . ALA C 1 267 ? 73.899  134.431 -23.278  1.00 40.00 ? 271 ALA C O   1 
ATOM 10363 C CB  . ALA C 1 267 ? 74.013  135.176 -26.550  1.00 40.00 ? 271 ALA C CB  1 
ATOM 10364 N N   . CYS C 1 268 ? 71.956  134.455 -24.430  1.00 40.00 ? 272 CYS C N   1 
ATOM 10365 C CA  . CYS C 1 268 ? 71.139  134.740 -23.256  1.00 40.00 ? 272 CYS C CA  1 
ATOM 10366 C C   . CYS C 1 268 ? 71.350  133.655 -22.208  1.00 40.00 ? 272 CYS C C   1 
ATOM 10367 O O   . CYS C 1 268 ? 71.546  133.954 -21.029  1.00 40.00 ? 272 CYS C O   1 
ATOM 10368 C CB  . CYS C 1 268 ? 69.681  134.756 -23.693  1.00 40.00 ? 272 CYS C CB  1 
ATOM 10369 S SG  . CYS C 1 268 ? 68.517  135.059 -22.431  1.00 40.00 ? 272 CYS C SG  1 
ATOM 10370 N N   . LEU C 1 269 ? 71.269  132.370 -22.616  1.00 40.00 ? 273 LEU C N   1 
ATOM 10371 C CA  . LEU C 1 269 ? 71.409  131.262 -21.680  1.00 40.00 ? 273 LEU C CA  1 
ATOM 10372 C C   . LEU C 1 269 ? 72.759  131.267 -20.974  1.00 40.00 ? 273 LEU C C   1 
ATOM 10373 O O   . LEU C 1 269 ? 72.947  130.912 -19.800  1.00 40.00 ? 273 LEU C O   1 
ATOM 10374 C CB  . LEU C 1 269 ? 71.275  129.934 -22.437  1.00 40.00 ? 273 LEU C CB  1 
ATOM 10375 C CG  . LEU C 1 269 ? 69.885  129.291 -22.377  1.00 40.00 ? 273 LEU C CG  1 
ATOM 10376 C CD1 . LEU C 1 269 ? 69.764  128.268 -23.498  1.00 40.00 ? 273 LEU C CD1 1 
ATOM 10377 C CD2 . LEU C 1 269 ? 69.588  128.666 -21.027  1.00 40.00 ? 273 LEU C CD2 1 
ATOM 10378 N N   . ARG C 1 270 ? 73.750  131.721 -21.753  1.00 40.00 ? 274 ARG C N   1 
ATOM 10379 C CA  . ARG C 1 270 ? 75.115  131.783 -21.266  1.00 40.00 ? 274 ARG C CA  1 
ATOM 10380 C C   . ARG C 1 270 ? 75.294  132.784 -20.140  1.00 40.00 ? 274 ARG C C   1 
ATOM 10381 O O   . ARG C 1 270 ? 76.338  132.759 -19.482  1.00 40.00 ? 274 ARG C O   1 
ATOM 10382 C CB  . ARG C 1 270 ? 76.067  132.031 -22.434  1.00 40.00 ? 274 ARG C CB  1 
ATOM 10383 C CG  . ARG C 1 270 ? 77.203  131.050 -22.453  1.00 40.00 ? 274 ARG C CG  1 
ATOM 10384 C CD  . ARG C 1 270 ? 78.132  131.111 -23.601  1.00 40.00 ? 274 ARG C CD  1 
ATOM 10385 N NE  . ARG C 1 270 ? 77.715  131.535 -24.892  1.00 40.00 ? 274 ARG C NE  1 
ATOM 10386 C CZ  . ARG C 1 270 ? 77.626  130.703 -25.942  1.00 40.00 ? 274 ARG C CZ  1 
ATOM 10387 N NH1 . ARG C 1 270 ? 77.900  129.406 -25.887  1.00 40.00 ? 274 ARG C NH1 1 
ATOM 10388 N NH2 . ARG C 1 270 ? 77.229  131.295 -27.079  1.00 40.00 ? 274 ARG C NH2 1 
ATOM 10389 N N   . THR C 1 271 ? 74.324  133.637 -19.834  1.00 40.00 ? 275 THR C N   1 
ATOM 10390 C CA  . THR C 1 271 ? 74.453  134.586 -18.751  1.00 40.00 ? 275 THR C CA  1 
ATOM 10391 C C   . THR C 1 271 ? 73.772  134.136 -17.464  1.00 40.00 ? 275 THR C C   1 
ATOM 10392 O O   . THR C 1 271 ? 73.915  134.743 -16.395  1.00 40.00 ? 275 THR C O   1 
ATOM 10393 C CB  . THR C 1 271 ? 73.775  135.951 -19.078  1.00 40.00 ? 275 THR C CB  1 
ATOM 10394 O OG1 . THR C 1 271 ? 72.427  135.799 -18.595  1.00 40.00 ? 275 THR C OG1 1 
ATOM 10395 C CG2 . THR C 1 271 ? 73.746  136.319 -20.534  1.00 40.00 ? 275 THR C CG2 1 
ATOM 10396 N N   . ARG C 1 272 ? 72.918  133.125 -17.539  1.00 40.00 ? 276 ARG C N   1 
ATOM 10397 C CA  . ARG C 1 272 ? 72.194  132.709 -16.332  1.00 40.00 ? 276 ARG C CA  1 
ATOM 10398 C C   . ARG C 1 272 ? 73.072  131.933 -15.375  1.00 40.00 ? 276 ARG C C   1 
ATOM 10399 O O   . ARG C 1 272 ? 73.861  131.037 -15.744  1.00 40.00 ? 276 ARG C O   1 
ATOM 10400 C CB  . ARG C 1 272 ? 70.994  131.837 -16.735  1.00 40.00 ? 276 ARG C CB  1 
ATOM 10401 C CG  . ARG C 1 272 ? 70.238  132.479 -17.919  1.00 40.00 ? 276 ARG C CG  1 
ATOM 10402 C CD  . ARG C 1 272 ? 69.002  133.163 -17.327  1.00 40.00 ? 276 ARG C CD  1 
ATOM 10403 N NE  . ARG C 1 272 ? 68.287  134.053 -18.214  1.00 40.00 ? 276 ARG C NE  1 
ATOM 10404 C CZ  . ARG C 1 272 ? 68.398  135.375 -18.211  1.00 40.00 ? 276 ARG C CZ  1 
ATOM 10405 N NH1 . ARG C 1 272 ? 69.245  135.939 -17.346  1.00 40.00 ? 276 ARG C NH1 1 
ATOM 10406 N NH2 . ARG C 1 272 ? 67.701  136.120 -19.055  1.00 40.00 ? 276 ARG C NH2 1 
ATOM 10407 N N   . PRO C 1 273 ? 72.927  132.265 -14.101  1.00 40.00 ? 277 PRO C N   1 
ATOM 10408 C CA  . PRO C 1 273 ? 73.665  131.547 -13.056  1.00 40.00 ? 277 PRO C CA  1 
ATOM 10409 C C   . PRO C 1 273 ? 73.505  130.050 -13.280  1.00 40.00 ? 277 PRO C C   1 
ATOM 10410 O O   . PRO C 1 273 ? 72.370  129.582 -13.524  1.00 40.00 ? 277 PRO C O   1 
ATOM 10411 C CB  . PRO C 1 273 ? 72.899  131.941 -11.776  1.00 40.00 ? 277 PRO C CB  1 
ATOM 10412 C CG  . PRO C 1 273 ? 71.862  132.941 -12.098  1.00 40.00 ? 277 PRO C CG  1 
ATOM 10413 C CD  . PRO C 1 273 ? 71.983  133.258 -13.556  1.00 40.00 ? 277 PRO C CD  1 
ATOM 10414 N N   . ALA C 1 274 ? 74.554  129.257 -13.144  1.00 40.00 ? 278 ALA C N   1 
ATOM 10415 C CA  . ALA C 1 274 ? 74.441  127.810 -13.317  1.00 40.00 ? 278 ALA C CA  1 
ATOM 10416 C C   . ALA C 1 274 ? 73.211  127.251 -12.622  1.00 40.00 ? 278 ALA C C   1 
ATOM 10417 O O   . ALA C 1 274 ? 72.409  126.544 -13.267  1.00 40.00 ? 278 ALA C O   1 
ATOM 10418 C CB  . ALA C 1 274 ? 75.677  127.089 -12.802  1.00 40.00 ? 278 ALA C CB  1 
ATOM 10419 N N   . GLN C 1 275 ? 73.003  127.534 -11.341  1.00 40.00 ? 279 GLN C N   1 
ATOM 10420 C CA  . GLN C 1 275 ? 71.856  126.966 -10.647  1.00 40.00 ? 279 GLN C CA  1 
ATOM 10421 C C   . GLN C 1 275 ? 70.493  127.314 -11.212  1.00 40.00 ? 279 GLN C C   1 
ATOM 10422 O O   . GLN C 1 275 ? 69.480  126.650 -10.932  1.00 40.00 ? 279 GLN C O   1 
ATOM 10423 C CB  . GLN C 1 275 ? 71.881  127.413 -9.184   1.00 40.00 ? 279 GLN C CB  1 
ATOM 10424 C CG  . GLN C 1 275 ? 70.727  126.856 -8.372   1.00 40.00 ? 279 GLN C CG  1 
ATOM 10425 C CD  . GLN C 1 275 ? 70.882  125.352 -8.244   1.00 40.00 ? 279 GLN C CD  1 
ATOM 10426 O OE1 . GLN C 1 275 ? 72.016  124.846 -8.271   1.00 40.00 ? 279 GLN C OE1 1 
ATOM 10427 N NE2 . GLN C 1 275 ? 69.721  124.718 -8.155   1.00 40.00 ? 279 GLN C NE2 1 
ATOM 10428 N N   . ASP C 1 276 ? 70.425  128.403 -11.994  1.00 40.00 ? 280 ASP C N   1 
ATOM 10429 C CA  . ASP C 1 276 ? 69.124  128.771 -12.587  1.00 40.00 ? 280 ASP C CA  1 
ATOM 10430 C C   . ASP C 1 276 ? 68.756  127.630 -13.556  1.00 40.00 ? 280 ASP C C   1 
ATOM 10431 O O   . ASP C 1 276 ? 67.604  127.242 -13.601  1.00 40.00 ? 280 ASP C O   1 
ATOM 10432 C CB  . ASP C 1 276 ? 69.158  130.010 -13.453  1.00 40.00 ? 280 ASP C CB  1 
ATOM 10433 C CG  . ASP C 1 276 ? 68.979  131.277 -12.657  1.00 40.00 ? 280 ASP C CG  1 
ATOM 10434 O OD1 . ASP C 1 276 ? 69.386  131.242 -11.469  1.00 40.00 ? 280 ASP C OD1 1 
ATOM 10435 O OD2 . ASP C 1 276 ? 68.442  132.233 -13.280  1.00 40.00 ? 280 ASP C OD2 1 
ATOM 10436 N N   . LEU C 1 277 ? 69.749  127.165 -14.320  1.00 40.00 ? 281 LEU C N   1 
ATOM 10437 C CA  . LEU C 1 277 ? 69.473  126.071 -15.259  1.00 40.00 ? 281 LEU C CA  1 
ATOM 10438 C C   . LEU C 1 277 ? 69.096  124.798 -14.542  1.00 40.00 ? 281 LEU C C   1 
ATOM 10439 O O   . LEU C 1 277 ? 68.066  124.172 -14.773  1.00 40.00 ? 281 LEU C O   1 
ATOM 10440 C CB  . LEU C 1 277 ? 70.656  125.719 -16.141  1.00 40.00 ? 281 LEU C CB  1 
ATOM 10441 C CG  . LEU C 1 277 ? 70.941  126.650 -17.327  1.00 40.00 ? 281 LEU C CG  1 
ATOM 10442 C CD1 . LEU C 1 277 ? 69.790  127.581 -17.622  1.00 40.00 ? 281 LEU C CD1 1 
ATOM 10443 C CD2 . LEU C 1 277 ? 72.245  127.371 -17.105  1.00 40.00 ? 281 LEU C CD2 1 
ATOM 10444 N N   . VAL C 1 278 ? 69.928  124.416 -13.590  1.00 40.00 ? 282 VAL C N   1 
ATOM 10445 C CA  . VAL C 1 278 ? 69.646  123.189 -12.813  1.00 40.00 ? 282 VAL C CA  1 
ATOM 10446 C C   . VAL C 1 278 ? 68.243  123.290 -12.233  1.00 40.00 ? 282 VAL C C   1 
ATOM 10447 O O   . VAL C 1 278 ? 67.560  122.287 -12.091  1.00 40.00 ? 282 VAL C O   1 
ATOM 10448 C CB  . VAL C 1 278 ? 70.634  123.090 -11.630  1.00 40.00 ? 282 VAL C CB  1 
ATOM 10449 C CG1 . VAL C 1 278 ? 70.238  121.978 -10.704  1.00 40.00 ? 282 VAL C CG1 1 
ATOM 10450 C CG2 . VAL C 1 278 ? 72.062  122.994 -12.134  1.00 40.00 ? 282 VAL C CG2 1 
ATOM 10451 N N   . ASP C 1 279 ? 67.830  124.514 -11.872  1.00 40.00 ? 283 ASP C N   1 
ATOM 10452 C CA  . ASP C 1 279 ? 66.501  124.657 -11.302  1.00 40.00 ? 283 ASP C CA  1 
ATOM 10453 C C   . ASP C 1 279 ? 65.423  124.192 -12.253  1.00 40.00 ? 283 ASP C C   1 
ATOM 10454 O O   . ASP C 1 279 ? 64.411  123.645 -11.776  1.00 40.00 ? 283 ASP C O   1 
ATOM 10455 C CB  . ASP C 1 279 ? 66.271  126.080 -10.848  1.00 40.00 ? 283 ASP C CB  1 
ATOM 10456 C CG  . ASP C 1 279 ? 66.825  126.340 -9.463   1.00 40.00 ? 283 ASP C CG  1 
ATOM 10457 O OD1 . ASP C 1 279 ? 66.813  125.419 -8.638   1.00 40.00 ? 283 ASP C OD1 1 
ATOM 10458 O OD2 . ASP C 1 279 ? 67.257  127.479 -9.187   1.00 40.00 ? 283 ASP C OD2 1 
ATOM 10459 N N   . HIS C 1 280 ? 65.572  124.375 -13.568  1.00 40.00 ? 284 HIS C N   1 
ATOM 10460 C CA  . HIS C 1 280 ? 64.451  123.949 -14.413  1.00 40.00 ? 284 HIS C CA  1 
ATOM 10461 C C   . HIS C 1 280 ? 64.691  122.677 -15.157  1.00 40.00 ? 284 HIS C C   1 
ATOM 10462 O O   . HIS C 1 280 ? 63.839  122.298 -15.965  1.00 40.00 ? 284 HIS C O   1 
ATOM 10463 C CB  . HIS C 1 280 ? 64.137  125.096 -15.388  1.00 40.00 ? 284 HIS C CB  1 
ATOM 10464 C CG  . HIS C 1 280 ? 63.364  126.159 -14.633  1.00 40.00 ? 284 HIS C CG  1 
ATOM 10465 N ND1 . HIS C 1 280 ? 62.063  125.947 -14.226  1.00 40.00 ? 284 HIS C ND1 1 
ATOM 10466 C CD2 . HIS C 1 280 ? 63.705  127.382 -14.204  1.00 40.00 ? 284 HIS C CD2 1 
ATOM 10467 C CE1 . HIS C 1 280 ? 61.633  127.012 -13.592  1.00 40.00 ? 284 HIS C CE1 1 
ATOM 10468 N NE2 . HIS C 1 280 ? 62.603  127.897 -13.570  1.00 40.00 ? 284 HIS C NE2 1 
ATOM 10469 N N   . GLU C 1 281 ? 65.853  122.061 -14.930  1.00 40.00 ? 285 GLU C N   1 
ATOM 10470 C CA  . GLU C 1 281 ? 66.257  120.825 -15.556  1.00 40.00 ? 285 GLU C CA  1 
ATOM 10471 C C   . GLU C 1 281 ? 65.131  119.805 -15.703  1.00 40.00 ? 285 GLU C C   1 
ATOM 10472 O O   . GLU C 1 281 ? 64.843  119.322 -16.781  1.00 40.00 ? 285 GLU C O   1 
ATOM 10473 C CB  . GLU C 1 281 ? 67.334  120.099 -14.692  1.00 40.00 ? 285 GLU C CB  1 
ATOM 10474 C CG  . GLU C 1 281 ? 68.438  119.580 -15.578  1.00 40.00 ? 285 GLU C CG  1 
ATOM 10475 C CD  . GLU C 1 281 ? 69.409  118.673 -14.880  1.00 40.00 ? 285 GLU C CD  1 
ATOM 10476 O OE1 . GLU C 1 281 ? 69.826  117.731 -15.612  1.00 40.00 ? 285 GLU C OE1 1 
ATOM 10477 O OE2 . GLU C 1 281 ? 69.734  118.874 -13.695  1.00 40.00 ? 285 GLU C OE2 1 
ATOM 10478 N N   . TRP C 1 282 ? 64.535  119.483 -14.556  1.00 40.00 ? 286 TRP C N   1 
ATOM 10479 C CA  . TRP C 1 282 ? 63.476  118.503 -14.515  1.00 40.00 ? 286 TRP C CA  1 
ATOM 10480 C C   . TRP C 1 282 ? 62.135  118.944 -15.032  1.00 40.00 ? 286 TRP C C   1 
ATOM 10481 O O   . TRP C 1 282 ? 61.227  118.096 -15.007  1.00 40.00 ? 286 TRP C O   1 
ATOM 10482 C CB  . TRP C 1 282 ? 63.329  117.926 -13.096  1.00 40.00 ? 286 TRP C CB  1 
ATOM 10483 C CG  . TRP C 1 282 ? 64.634  117.294 -12.718  1.00 40.00 ? 286 TRP C CG  1 
ATOM 10484 C CD1 . TRP C 1 282 ? 65.491  117.682 -11.743  1.00 40.00 ? 286 TRP C CD1 1 
ATOM 10485 C CD2 . TRP C 1 282 ? 65.237  116.162 -13.359  1.00 40.00 ? 286 TRP C CD2 1 
ATOM 10486 N NE1 . TRP C 1 282 ? 66.593  116.862 -11.711  1.00 40.00 ? 286 TRP C NE1 1 
ATOM 10487 C CE2 . TRP C 1 282 ? 66.459  115.921 -12.703  1.00 40.00 ? 286 TRP C CE2 1 
ATOM 10488 C CE3 . TRP C 1 282 ? 64.860  115.343 -14.417  1.00 40.00 ? 286 TRP C CE3 1 
ATOM 10489 C CZ2 . TRP C 1 282 ? 67.312  114.885 -13.061  1.00 40.00 ? 286 TRP C CZ2 1 
ATOM 10490 C CZ3 . TRP C 1 282 ? 65.707  114.316 -14.779  1.00 40.00 ? 286 TRP C CZ3 1 
ATOM 10491 C CH2 . TRP C 1 282 ? 66.915  114.095 -14.102  1.00 40.00 ? 286 TRP C CH2 1 
ATOM 10492 N N   . HIS C 1 283 ? 61.927  120.148 -15.516  1.00 40.00 ? 287 HIS C N   1 
ATOM 10493 C CA  . HIS C 1 283 ? 60.628  120.529 -16.035  1.00 40.00 ? 287 HIS C CA  1 
ATOM 10494 C C   . HIS C 1 283 ? 60.543  120.390 -17.530  1.00 40.00 ? 287 HIS C C   1 
ATOM 10495 O O   . HIS C 1 283 ? 59.634  120.967 -18.154  1.00 40.00 ? 287 HIS C O   1 
ATOM 10496 C CB  . HIS C 1 283 ? 60.375  121.997 -15.649  1.00 40.00 ? 287 HIS C CB  1 
ATOM 10497 C CG  . HIS C 1 283 ? 60.404  122.179 -14.158  1.00 40.00 ? 287 HIS C CG  1 
ATOM 10498 N ND1 . HIS C 1 283 ? 60.387  123.436 -13.588  1.00 40.00 ? 287 HIS C ND1 1 
ATOM 10499 C CD2 . HIS C 1 283 ? 60.445  121.282 -13.144  1.00 40.00 ? 287 HIS C CD2 1 
ATOM 10500 C CE1 . HIS C 1 283 ? 60.434  123.283 -12.273  1.00 40.00 ? 287 HIS C CE1 1 
ATOM 10501 N NE2 . HIS C 1 283 ? 60.462  121.981 -11.976  1.00 40.00 ? 287 HIS C NE2 1 
ATOM 10502 N N   . VAL C 1 284 ? 61.460  119.703 -18.212  1.00 40.00 ? 288 VAL C N   1 
ATOM 10503 C CA  . VAL C 1 284 ? 61.262  119.702 -19.674  1.00 40.00 ? 288 VAL C CA  1 
ATOM 10504 C C   . VAL C 1 284 ? 60.920  118.317 -20.160  1.00 40.00 ? 288 VAL C C   1 
ATOM 10505 O O   . VAL C 1 284 ? 60.706  118.109 -21.356  1.00 40.00 ? 288 VAL C O   1 
ATOM 10506 C CB  . VAL C 1 284 ? 62.426  120.349 -20.413  1.00 40.00 ? 288 VAL C CB  1 
ATOM 10507 C CG1 . VAL C 1 284 ? 62.495  121.827 -20.079  1.00 40.00 ? 288 VAL C CG1 1 
ATOM 10508 C CG2 . VAL C 1 284 ? 63.762  119.688 -20.128  1.00 40.00 ? 288 VAL C CG2 1 
ATOM 10509 N N   . LEU C 1 285 ? 60.850  117.367 -19.211  1.00 40.00 ? 289 LEU C N   1 
ATOM 10510 C CA  . LEU C 1 285 ? 60.477  115.989 -19.640  1.00 40.00 ? 289 LEU C CA  1 
ATOM 10511 C C   . LEU C 1 285 ? 59.067  116.066 -20.171  1.00 40.00 ? 289 LEU C C   1 
ATOM 10512 O O   . LEU C 1 285 ? 58.318  116.912 -19.675  1.00 40.00 ? 289 LEU C O   1 
ATOM 10513 C CB  . LEU C 1 285 ? 60.662  114.986 -18.524  1.00 40.00 ? 289 LEU C CB  1 
ATOM 10514 C CG  . LEU C 1 285 ? 62.151  114.628 -18.272  1.00 40.00 ? 289 LEU C CG  1 
ATOM 10515 C CD1 . LEU C 1 285 ? 62.281  113.628 -17.134  1.00 40.00 ? 289 LEU C CD1 1 
ATOM 10516 C CD2 . LEU C 1 285 ? 62.813  114.129 -19.550  1.00 40.00 ? 289 LEU C CD2 1 
ATOM 10517 N N   . PRO C 1 286 ? 58.693  115.288 -21.156  1.00 40.00 ? 290 PRO C N   1 
ATOM 10518 C CA  . PRO C 1 286 ? 57.370  115.393 -21.744  1.00 40.00 ? 290 PRO C CA  1 
ATOM 10519 C C   . PRO C 1 286 ? 56.276  114.649 -21.041  1.00 40.00 ? 290 PRO C C   1 
ATOM 10520 O O   . PRO C 1 286 ? 55.115  114.882 -21.394  1.00 40.00 ? 290 PRO C O   1 
ATOM 10521 C CB  . PRO C 1 286 ? 57.592  114.936 -23.176  1.00 40.00 ? 290 PRO C CB  1 
ATOM 10522 C CG  . PRO C 1 286 ? 58.789  114.066 -23.149  1.00 40.00 ? 290 PRO C CG  1 
ATOM 10523 C CD  . PRO C 1 286 ? 59.495  114.270 -21.836  1.00 40.00 ? 290 PRO C CD  1 
ATOM 10524 N N   . GLN C 1 287 ? 56.563  113.759 -20.105  1.00 40.00 ? 291 GLN C N   1 
ATOM 10525 C CA  . GLN C 1 287 ? 55.569  113.005 -19.376  1.00 40.00 ? 291 GLN C CA  1 
ATOM 10526 C C   . GLN C 1 287 ? 56.041  112.711 -17.952  1.00 40.00 ? 291 GLN C C   1 
ATOM 10527 O O   . GLN C 1 287 ? 57.244  112.775 -17.674  1.00 40.00 ? 291 GLN C O   1 
ATOM 10528 C CB  . GLN C 1 287 ? 55.381  111.603 -19.978  1.00 40.00 ? 291 GLN C CB  1 
ATOM 10529 C CG  . GLN C 1 287 ? 55.082  111.511 -21.445  1.00 40.00 ? 291 GLN C CG  1 
ATOM 10530 C CD  . GLN C 1 287 ? 56.305  111.227 -22.275  1.00 40.00 ? 291 GLN C CD  1 
ATOM 10531 O OE1 . GLN C 1 287 ? 56.227  111.231 -23.504  1.00 40.00 ? 291 GLN C OE1 1 
ATOM 10532 N NE2 . GLN C 1 287 ? 57.449  110.981 -21.632  1.00 40.00 ? 291 GLN C NE2 1 
ATOM 10533 N N   . GLU C 1 288 ? 55.106  112.305 -17.101  1.00 40.00 ? 292 GLU C N   1 
ATOM 10534 C CA  . GLU C 1 288 ? 55.552  111.920 -15.745  1.00 40.00 ? 292 GLU C CA  1 
ATOM 10535 C C   . GLU C 1 288 ? 56.349  110.619 -15.915  1.00 40.00 ? 292 GLU C C   1 
ATOM 10536 O O   . GLU C 1 288 ? 55.924  109.847 -16.776  1.00 40.00 ? 292 GLU C O   1 
ATOM 10537 C CB  . GLU C 1 288 ? 54.421  111.807 -14.782  1.00 40.00 ? 292 GLU C CB  1 
ATOM 10538 C CG  . GLU C 1 288 ? 54.884  111.494 -13.388  1.00 40.00 ? 292 GLU C CG  1 
ATOM 10539 C CD  . GLU C 1 288 ? 53.809  111.031 -12.442  1.00 40.00 ? 292 GLU C CD  1 
ATOM 10540 O OE1 . GLU C 1 288 ? 52.610  111.053 -12.816  1.00 40.00 ? 292 GLU C OE1 1 
ATOM 10541 O OE2 . GLU C 1 288 ? 54.204  110.634 -11.310  1.00 40.00 ? 292 GLU C OE2 1 
ATOM 10542 N N   . SER C 1 289 ? 57.473  110.410 -15.233  1.00 40.00 ? 293 SER C N   1 
ATOM 10543 C CA  . SER C 1 289 ? 58.221  109.200 -15.529  1.00 40.00 ? 293 SER C CA  1 
ATOM 10544 C C   . SER C 1 289 ? 59.364  108.913 -14.583  1.00 40.00 ? 293 SER C C   1 
ATOM 10545 O O   . SER C 1 289 ? 59.598  109.642 -13.635  1.00 40.00 ? 293 SER C O   1 
ATOM 10546 C CB  . SER C 1 289 ? 58.809  109.398 -16.957  1.00 40.00 ? 293 SER C CB  1 
ATOM 10547 O OG  . SER C 1 289 ? 59.476  110.642 -16.994  1.00 40.00 ? 293 SER C OG  1 
ATOM 10548 N N   . ILE C 1 290 ? 60.057  107.811 -14.816  1.00 40.00 ? 294 ILE C N   1 
ATOM 10549 C CA  . ILE C 1 290 ? 61.218  107.389 -14.068  1.00 40.00 ? 294 ILE C CA  1 
ATOM 10550 C C   . ILE C 1 290 ? 62.229  106.822 -15.058  1.00 40.00 ? 294 ILE C C   1 
ATOM 10551 O O   . ILE C 1 290 ? 61.868  106.448 -16.177  1.00 40.00 ? 294 ILE C O   1 
ATOM 10552 C CB  . ILE C 1 290 ? 60.949  106.408 -12.949  1.00 40.00 ? 294 ILE C CB  1 
ATOM 10553 C CG1 . ILE C 1 290 ? 59.845  105.411 -13.330  1.00 40.00 ? 294 ILE C CG1 1 
ATOM 10554 C CG2 . ILE C 1 290 ? 60.547  107.162 -11.677  1.00 40.00 ? 294 ILE C CG2 1 
ATOM 10555 C CD1 . ILE C 1 290 ? 59.863  104.235 -12.360  1.00 40.00 ? 294 ILE C CD1 1 
ATOM 10556 N N   . PHE C 1 291 ? 63.503  106.849 -14.728  1.00 40.00 ? 295 PHE C N   1 
ATOM 10557 C CA  . PHE C 1 291 ? 64.477  106.317 -15.682  1.00 40.00 ? 295 PHE C CA  1 
ATOM 10558 C C   . PHE C 1 291 ? 64.334  106.975 -17.050  1.00 40.00 ? 295 PHE C C   1 
ATOM 10559 O O   . PHE C 1 291 ? 64.378  106.365 -18.118  1.00 40.00 ? 295 PHE C O   1 
ATOM 10560 C CB  . PHE C 1 291 ? 64.383  104.794 -15.779  1.00 40.00 ? 295 PHE C CB  1 
ATOM 10561 C CG  . PHE C 1 291 ? 65.743  104.165 -15.866  1.00 40.00 ? 295 PHE C CG  1 
ATOM 10562 C CD1 . PHE C 1 291 ? 66.680  104.640 -16.792  1.00 40.00 ? 295 PHE C CD1 1 
ATOM 10563 C CD2 . PHE C 1 291 ? 66.091  103.128 -15.033  1.00 40.00 ? 295 PHE C CD2 1 
ATOM 10564 C CE1 . PHE C 1 291 ? 67.946  104.122 -16.877  1.00 40.00 ? 295 PHE C CE1 1 
ATOM 10565 C CE2 . PHE C 1 291 ? 67.362  102.569 -15.131  1.00 40.00 ? 295 PHE C CE2 1 
ATOM 10566 C CZ  . PHE C 1 291 ? 68.280  103.071 -16.037  1.00 40.00 ? 295 PHE C CZ  1 
ATOM 10567 N N   . ARG C 1 292 ? 64.217  108.288 -16.973  1.00 40.00 ? 296 ARG C N   1 
ATOM 10568 C CA  . ARG C 1 292 ? 64.109  109.173 -18.135  1.00 40.00 ? 296 ARG C CA  1 
ATOM 10569 C C   . ARG C 1 292 ? 64.827  110.446 -17.748  1.00 40.00 ? 296 ARG C C   1 
ATOM 10570 O O   . ARG C 1 292 ? 64.711  110.830 -16.561  1.00 40.00 ? 296 ARG C O   1 
ATOM 10571 C CB  . ARG C 1 292 ? 62.643  109.343 -18.463  1.00 40.00 ? 296 ARG C CB  1 
ATOM 10572 C CG  . ARG C 1 292 ? 62.477  109.491 -19.967  1.00 40.00 ? 296 ARG C CG  1 
ATOM 10573 C CD  . ARG C 1 292 ? 62.060  108.243 -20.699  1.00 40.00 ? 296 ARG C CD  1 
ATOM 10574 N NE  . ARG C 1 292 ? 62.301  107.031 -19.954  1.00 40.00 ? 296 ARG C NE  1 
ATOM 10575 C CZ  . ARG C 1 292 ? 61.942  105.851 -20.492  1.00 40.00 ? 296 ARG C CZ  1 
ATOM 10576 N NH1 . ARG C 1 292 ? 61.364  105.877 -21.694  1.00 40.00 ? 296 ARG C NH1 1 
ATOM 10577 N NH2 . ARG C 1 292 ? 62.156  104.722 -19.846  1.00 40.00 ? 296 ARG C NH2 1 
ATOM 10578 N N   . PHE C 1 293 ? 65.727  110.980 -18.570  1.00 40.00 ? 297 PHE C N   1 
ATOM 10579 C CA  . PHE C 1 293 ? 66.492  112.157 -18.140  1.00 40.00 ? 297 PHE C CA  1 
ATOM 10580 C C   . PHE C 1 293 ? 66.407  113.290 -19.138  1.00 40.00 ? 297 PHE C C   1 
ATOM 10581 O O   . PHE C 1 293 ? 66.368  113.043 -20.347  1.00 40.00 ? 297 PHE C O   1 
ATOM 10582 C CB  . PHE C 1 293 ? 67.947  111.794 -17.856  1.00 40.00 ? 297 PHE C CB  1 
ATOM 10583 C CG  . PHE C 1 293 ? 68.033  110.536 -17.036  1.00 40.00 ? 297 PHE C CG  1 
ATOM 10584 C CD1 . PHE C 1 293 ? 67.646  110.579 -15.701  1.00 40.00 ? 297 PHE C CD1 1 
ATOM 10585 C CD2 . PHE C 1 293 ? 68.422  109.339 -17.600  1.00 40.00 ? 297 PHE C CD2 1 
ATOM 10586 C CE1 . PHE C 1 293 ? 67.681  109.420 -14.933  1.00 40.00 ? 297 PHE C CE1 1 
ATOM 10587 C CE2 . PHE C 1 293 ? 68.457  108.203 -16.827  1.00 40.00 ? 297 PHE C CE2 1 
ATOM 10588 C CZ  . PHE C 1 293 ? 68.077  108.239 -15.500  1.00 40.00 ? 297 PHE C CZ  1 
ATOM 10589 N N   . SER C 1 294 ? 66.390  114.541 -18.649  1.00 40.00 ? 298 SER C N   1 
ATOM 10590 C CA  . SER C 1 294 ? 66.188  115.667 -19.542  1.00 40.00 ? 298 SER C CA  1 
ATOM 10591 C C   . SER C 1 294 ? 67.233  116.003 -20.557  1.00 40.00 ? 298 SER C C   1 
ATOM 10592 O O   . SER C 1 294 ? 66.916  116.360 -21.702  1.00 40.00 ? 298 SER C O   1 
ATOM 10593 C CB  . SER C 1 294 ? 65.823  116.919 -18.738  1.00 40.00 ? 298 SER C CB  1 
ATOM 10594 O OG  . SER C 1 294 ? 64.810  116.604 -17.784  1.00 40.00 ? 298 SER C OG  1 
ATOM 10595 N N   . PHE C 1 295 ? 68.481  116.021 -20.077  1.00 40.00 ? 299 PHE C N   1 
ATOM 10596 C CA  . PHE C 1 295 ? 69.616  116.371 -20.951  1.00 40.00 ? 299 PHE C CA  1 
ATOM 10597 C C   . PHE C 1 295 ? 70.593  115.216 -20.989  1.00 40.00 ? 299 PHE C C   1 
ATOM 10598 O O   . PHE C 1 295 ? 71.106  114.754 -19.962  1.00 40.00 ? 299 PHE C O   1 
ATOM 10599 C CB  . PHE C 1 295 ? 70.207  117.719 -20.513  1.00 40.00 ? 299 PHE C CB  1 
ATOM 10600 C CG  . PHE C 1 295 ? 69.188  118.817 -20.780  1.00 40.00 ? 299 PHE C CG  1 
ATOM 10601 C CD1 . PHE C 1 295 ? 69.044  119.323 -22.053  1.00 40.00 ? 299 PHE C CD1 1 
ATOM 10602 C CD2 . PHE C 1 295 ? 68.352  119.256 -19.774  1.00 40.00 ? 299 PHE C CD2 1 
ATOM 10603 C CE1 . PHE C 1 295 ? 68.101  120.280 -22.340  1.00 40.00 ? 299 PHE C CE1 1 
ATOM 10604 C CE2 . PHE C 1 295 ? 67.408  120.208 -20.055  1.00 40.00 ? 299 PHE C CE2 1 
ATOM 10605 C CZ  . PHE C 1 295 ? 67.282  120.712 -21.328  1.00 40.00 ? 299 PHE C CZ  1 
ATOM 10606 N N   . VAL C 1 296 ? 70.746  114.646 -22.181  1.00 40.00 ? 300 VAL C N   1 
ATOM 10607 C CA  . VAL C 1 296 ? 71.518  113.472 -22.496  1.00 40.00 ? 300 VAL C CA  1 
ATOM 10608 C C   . VAL C 1 296 ? 71.927  113.509 -23.974  1.00 40.00 ? 300 VAL C C   1 
ATOM 10609 O O   . VAL C 1 296 ? 71.407  114.311 -24.728  1.00 40.00 ? 300 VAL C O   1 
ATOM 10610 C CB  . VAL C 1 296 ? 70.673  112.172 -22.372  1.00 40.00 ? 300 VAL C CB  1 
ATOM 10611 C CG1 . VAL C 1 296 ? 70.192  111.864 -20.970  1.00 40.00 ? 300 VAL C CG1 1 
ATOM 10612 C CG2 . VAL C 1 296 ? 69.522  112.276 -23.378  1.00 40.00 ? 300 VAL C CG2 1 
ATOM 10613 N N   . PRO C 1 297 ? 72.828  112.645 -24.389  1.00 40.00 ? 301 PRO C N   1 
ATOM 10614 C CA  . PRO C 1 297 ? 73.316  112.622 -25.752  1.00 40.00 ? 301 PRO C CA  1 
ATOM 10615 C C   . PRO C 1 297 ? 72.195  112.721 -26.747  1.00 40.00 ? 301 PRO C C   1 
ATOM 10616 O O   . PRO C 1 297 ? 71.140  112.125 -26.531  1.00 40.00 ? 301 PRO C O   1 
ATOM 10617 C CB  . PRO C 1 297 ? 74.029  111.304 -25.917  1.00 40.00 ? 301 PRO C CB  1 
ATOM 10618 C CG  . PRO C 1 297 ? 74.412  110.906 -24.530  1.00 40.00 ? 301 PRO C CG  1 
ATOM 10619 C CD  . PRO C 1 297 ? 73.523  111.632 -23.561  1.00 40.00 ? 301 PRO C CD  1 
ATOM 10620 N N   . VAL C 1 298 ? 72.460  113.455 -27.800  1.00 40.00 ? 302 VAL C N   1 
ATOM 10621 C CA  . VAL C 1 298 ? 71.457  113.637 -28.855  1.00 40.00 ? 302 VAL C CA  1 
ATOM 10622 C C   . VAL C 1 298 ? 71.959  113.023 -30.158  1.00 40.00 ? 302 VAL C C   1 
ATOM 10623 O O   . VAL C 1 298 ? 73.174  113.126 -30.435  1.00 40.00 ? 302 VAL C O   1 
ATOM 10624 C CB  . VAL C 1 298 ? 71.257  115.155 -29.110  1.00 40.00 ? 302 VAL C CB  1 
ATOM 10625 C CG1 . VAL C 1 298 ? 72.581  115.795 -29.459  1.00 40.00 ? 302 VAL C CG1 1 
ATOM 10626 C CG2 . VAL C 1 298 ? 70.256  115.382 -30.228  1.00 40.00 ? 302 VAL C CG2 1 
ATOM 10627 N N   . VAL C 1 299 ? 71.024  112.480 -30.915  1.00 40.00 ? 303 VAL C N   1 
ATOM 10628 C CA  . VAL C 1 299 ? 71.415  111.880 -32.221  1.00 40.00 ? 303 VAL C CA  1 
ATOM 10629 C C   . VAL C 1 299 ? 71.533  113.030 -33.195  1.00 40.00 ? 303 VAL C C   1 
ATOM 10630 O O   . VAL C 1 299 ? 70.552  113.425 -33.792  1.00 40.00 ? 303 VAL C O   1 
ATOM 10631 C CB  . VAL C 1 299 ? 70.345  110.856 -32.630  1.00 40.00 ? 303 VAL C CB  1 
ATOM 10632 C CG1 . VAL C 1 299 ? 70.505  110.384 -34.060  1.00 40.00 ? 303 VAL C CG1 1 
ATOM 10633 C CG2 . VAL C 1 299 ? 70.348  109.710 -31.622  1.00 40.00 ? 303 VAL C CG2 1 
ATOM 10634 N N   . ASP C 1 300 ? 72.698  113.630 -33.291  1.00 40.00 ? 304 ASP C N   1 
ATOM 10635 C CA  . ASP C 1 300 ? 72.970  114.801 -34.114  1.00 40.00 ? 304 ASP C CA  1 
ATOM 10636 C C   . ASP C 1 300 ? 73.318  114.448 -35.549  1.00 40.00 ? 304 ASP C C   1 
ATOM 10637 O O   . ASP C 1 300 ? 73.189  115.244 -36.457  1.00 40.00 ? 304 ASP C O   1 
ATOM 10638 C CB  . ASP C 1 300 ? 74.215  115.554 -33.601  1.00 40.00 ? 304 ASP C CB  1 
ATOM 10639 C CG  . ASP C 1 300 ? 75.286  114.635 -33.048  1.00 40.00 ? 304 ASP C CG  1 
ATOM 10640 O OD1 . ASP C 1 300 ? 75.323  113.414 -33.339  1.00 40.00 ? 304 ASP C OD1 1 
ATOM 10641 O OD2 . ASP C 1 300 ? 76.131  115.167 -32.268  1.00 40.00 ? 304 ASP C OD2 1 
ATOM 10642 N N   . GLY C 1 301 ? 73.854  113.237 -35.722  1.00 40.00 ? 305 GLY C N   1 
ATOM 10643 C CA  . GLY C 1 301 ? 74.286  112.850 -37.086  1.00 40.00 ? 305 GLY C CA  1 
ATOM 10644 C C   . GLY C 1 301 ? 75.733  113.353 -37.232  1.00 40.00 ? 305 GLY C C   1 
ATOM 10645 O O   . GLY C 1 301 ? 76.205  113.740 -38.293  1.00 40.00 ? 305 GLY C O   1 
ATOM 10646 N N   . ASP C 1 302 ? 76.421  113.382 -36.105  1.00 40.00 ? 306 ASP C N   1 
ATOM 10647 C CA  . ASP C 1 302 ? 77.800  113.789 -36.022  1.00 40.00 ? 306 ASP C CA  1 
ATOM 10648 C C   . ASP C 1 302 ? 78.409  112.809 -35.025  1.00 40.00 ? 306 ASP C C   1 
ATOM 10649 O O   . ASP C 1 302 ? 78.830  111.702 -35.354  1.00 40.00 ? 306 ASP C O   1 
ATOM 10650 C CB  . ASP C 1 302 ? 78.016  115.181 -35.473  1.00 40.00 ? 306 ASP C CB  1 
ATOM 10651 C CG  . ASP C 1 302 ? 79.475  115.609 -35.456  1.00 40.00 ? 306 ASP C CG  1 
ATOM 10652 O OD1 . ASP C 1 302 ? 79.996  115.914 -36.559  1.00 40.00 ? 306 ASP C OD1 1 
ATOM 10653 O OD2 . ASP C 1 302 ? 80.147  115.670 -34.399  1.00 40.00 ? 306 ASP C OD2 1 
ATOM 10654 N N   . PHE C 1 303 ? 78.323  113.212 -33.750  1.00 40.00 ? 307 PHE C N   1 
ATOM 10655 C CA  . PHE C 1 303 ? 78.934  112.273 -32.793  1.00 40.00 ? 307 PHE C CA  1 
ATOM 10656 C C   . PHE C 1 303 ? 78.316  110.899 -32.964  1.00 40.00 ? 307 PHE C C   1 
ATOM 10657 O O   . PHE C 1 303 ? 79.099  109.963 -32.837  1.00 40.00 ? 307 PHE C O   1 
ATOM 10658 C CB  . PHE C 1 303 ? 78.975  112.776 -31.418  1.00 40.00 ? 307 PHE C CB  1 
ATOM 10659 C CG  . PHE C 1 303 ? 79.808  112.013 -30.430  1.00 40.00 ? 307 PHE C CG  1 
ATOM 10660 C CD1 . PHE C 1 303 ? 79.436  110.793 -29.935  1.00 40.00 ? 307 PHE C CD1 1 
ATOM 10661 C CD2 . PHE C 1 303 ? 80.974  112.587 -29.962  1.00 40.00 ? 307 PHE C CD2 1 
ATOM 10662 C CE1 . PHE C 1 303 ? 80.192  110.146 -28.987  1.00 40.00 ? 307 PHE C CE1 1 
ATOM 10663 C CE2 . PHE C 1 303 ? 81.756  111.956 -29.021  1.00 40.00 ? 307 PHE C CE2 1 
ATOM 10664 C CZ  . PHE C 1 303 ? 81.365  110.725 -28.530  1.00 40.00 ? 307 PHE C CZ  1 
ATOM 10665 N N   . LEU C 1 304 ? 77.037  110.796 -33.196  1.00 40.00 ? 308 LEU C N   1 
ATOM 10666 C CA  . LEU C 1 304 ? 76.341  109.551 -33.519  1.00 40.00 ? 308 LEU C CA  1 
ATOM 10667 C C   . LEU C 1 304 ? 75.801  109.787 -34.949  1.00 40.00 ? 308 LEU C C   1 
ATOM 10668 O O   . LEU C 1 304 ? 75.077  110.751 -35.244  1.00 40.00 ? 308 LEU C O   1 
ATOM 10669 C CB  . LEU C 1 304 ? 75.270  109.203 -32.532  1.00 40.00 ? 308 LEU C CB  1 
ATOM 10670 C CG  . LEU C 1 304 ? 75.588  109.174 -31.042  1.00 40.00 ? 308 LEU C CG  1 
ATOM 10671 C CD1 . LEU C 1 304 ? 74.312  108.995 -30.226  1.00 40.00 ? 308 LEU C CD1 1 
ATOM 10672 C CD2 . LEU C 1 304 ? 76.510  108.027 -30.653  1.00 40.00 ? 308 LEU C CD2 1 
ATOM 10673 N N   . SER C 1 305 ? 76.199  108.965 -35.931  1.00 40.00 ? 309 SER C N   1 
ATOM 10674 C CA  . SER C 1 305 ? 75.788  109.201 -37.325  1.00 40.00 ? 309 SER C CA  1 
ATOM 10675 C C   . SER C 1 305 ? 74.326  108.874 -37.558  1.00 40.00 ? 309 SER C C   1 
ATOM 10676 O O   . SER C 1 305 ? 73.709  109.301 -38.528  1.00 40.00 ? 309 SER C O   1 
ATOM 10677 C CB  . SER C 1 305 ? 76.621  108.334 -38.284  1.00 40.00 ? 309 SER C CB  1 
ATOM 10678 O OG  . SER C 1 305 ? 77.211  107.290 -37.495  1.00 40.00 ? 309 SER C OG  1 
ATOM 10679 N N   . ASP C 1 306 ? 73.831  108.070 -36.638  1.00 40.00 ? 310 ASP C N   1 
ATOM 10680 C CA  . ASP C 1 306 ? 72.449  107.599 -36.688  1.00 40.00 ? 310 ASP C CA  1 
ATOM 10681 C C   . ASP C 1 306 ? 72.160  107.082 -35.280  1.00 40.00 ? 310 ASP C C   1 
ATOM 10682 O O   . ASP C 1 306 ? 73.116  107.048 -34.473  1.00 40.00 ? 310 ASP C O   1 
ATOM 10683 C CB  . ASP C 1 306 ? 72.439  106.389 -37.643  1.00 40.00 ? 310 ASP C CB  1 
ATOM 10684 C CG  . ASP C 1 306 ? 71.062  106.130 -38.195  1.00 40.00 ? 310 ASP C CG  1 
ATOM 10685 O OD1 . ASP C 1 306 ? 70.142  106.215 -37.352  1.00 40.00 ? 310 ASP C OD1 1 
ATOM 10686 O OD2 . ASP C 1 306 ? 70.911  105.864 -39.408  1.00 40.00 ? 310 ASP C OD2 1 
ATOM 10687 N N   . THR C 1 307 ? 70.947  106.681 -35.003  1.00 40.00 ? 311 THR C N   1 
ATOM 10688 C CA  . THR C 1 307 ? 70.663  106.133 -33.701  1.00 40.00 ? 311 THR C CA  1 
ATOM 10689 C C   . THR C 1 307 ? 71.567  104.974 -33.322  1.00 40.00 ? 311 THR C C   1 
ATOM 10690 O O   . THR C 1 307 ? 71.831  104.100 -34.163  1.00 40.00 ? 311 THR C O   1 
ATOM 10691 C CB  . THR C 1 307 ? 69.296  105.371 -33.817  1.00 40.00 ? 311 THR C CB  1 
ATOM 10692 O OG1 . THR C 1 307 ? 68.659  105.829 -35.001  1.00 40.00 ? 311 THR C OG1 1 
ATOM 10693 C CG2 . THR C 1 307 ? 68.507  105.734 -32.582  1.00 40.00 ? 311 THR C CG2 1 
ATOM 10694 N N   . PRO C 1 308 ? 71.849  104.879 -32.029  1.00 40.00 ? 312 PRO C N   1 
ATOM 10695 C CA  . PRO C 1 308 ? 72.564  103.722 -31.509  1.00 40.00 ? 312 PRO C CA  1 
ATOM 10696 C C   . PRO C 1 308 ? 71.860  102.457 -32.011  1.00 40.00 ? 312 PRO C C   1 
ATOM 10697 O O   . PRO C 1 308 ? 72.556  101.526 -32.442  1.00 40.00 ? 312 PRO C O   1 
ATOM 10698 C CB  . PRO C 1 308 ? 72.478  103.838 -30.006  1.00 40.00 ? 312 PRO C CB  1 
ATOM 10699 C CG  . PRO C 1 308 ? 71.886  105.142 -29.719  1.00 40.00 ? 312 PRO C CG  1 
ATOM 10700 C CD  . PRO C 1 308 ? 71.488  105.829 -30.988  1.00 40.00 ? 312 PRO C CD  1 
ATOM 10701 N N   . GLU C 1 309 ? 70.519  102.387 -31.988  1.00 40.00 ? 313 GLU C N   1 
ATOM 10702 C CA  . GLU C 1 309 ? 69.870  101.160 -32.500  1.00 40.00 ? 313 GLU C CA  1 
ATOM 10703 C C   . GLU C 1 309 ? 70.405  100.842 -33.887  1.00 40.00 ? 313 GLU C C   1 
ATOM 10704 O O   . GLU C 1 309 ? 71.102  99.851  -34.050  1.00 40.00 ? 313 GLU C O   1 
ATOM 10705 C CB  . GLU C 1 309 ? 68.367  101.243 -32.633  1.00 40.00 ? 313 GLU C CB  1 
ATOM 10706 C CG  . GLU C 1 309 ? 67.630  99.933  -32.411  1.00 40.00 ? 313 GLU C CG  1 
ATOM 10707 C CD  . GLU C 1 309 ? 67.531  99.606  -30.931  1.00 40.00 ? 313 GLU C CD  1 
ATOM 10708 O OE1 . GLU C 1 309 ? 67.599  100.518 -30.069  1.00 40.00 ? 313 GLU C OE1 1 
ATOM 10709 O OE2 . GLU C 1 309 ? 67.377  98.404  -30.613  1.00 40.00 ? 313 GLU C OE2 1 
ATOM 10710 N N   . ALA C 1 310 ? 70.142  101.723 -34.853  1.00 40.00 ? 314 ALA C N   1 
ATOM 10711 C CA  . ALA C 1 310 ? 70.672  101.493 -36.198  1.00 40.00 ? 314 ALA C CA  1 
ATOM 10712 C C   . ALA C 1 310 ? 72.153  101.165 -36.148  1.00 40.00 ? 314 ALA C C   1 
ATOM 10713 O O   . ALA C 1 310 ? 72.627  100.350 -36.931  1.00 40.00 ? 314 ALA C O   1 
ATOM 10714 C CB  . ALA C 1 310 ? 70.523  102.758 -37.054  1.00 40.00 ? 314 ALA C CB  1 
ATOM 10715 N N   . LEU C 1 311 ? 72.932  101.836 -35.299  1.00 40.00 ? 315 LEU C N   1 
ATOM 10716 C CA  . LEU C 1 311 ? 74.368  101.580 -35.305  1.00 40.00 ? 315 LEU C CA  1 
ATOM 10717 C C   . LEU C 1 311 ? 74.738  100.203 -34.824  1.00 40.00 ? 315 LEU C C   1 
ATOM 10718 O O   . LEU C 1 311 ? 75.393  99.493  -35.585  1.00 40.00 ? 315 LEU C O   1 
ATOM 10719 C CB  . LEU C 1 311 ? 75.179  102.633 -34.562  1.00 40.00 ? 315 LEU C CB  1 
ATOM 10720 C CG  . LEU C 1 311 ? 75.179  104.046 -35.135  1.00 40.00 ? 315 LEU C CG  1 
ATOM 10721 C CD1 . LEU C 1 311 ? 76.241  104.868 -34.408  1.00 40.00 ? 315 LEU C CD1 1 
ATOM 10722 C CD2 . LEU C 1 311 ? 75.395  104.059 -36.645  1.00 40.00 ? 315 LEU C CD2 1 
ATOM 10723 N N   . ILE C 1 312 ? 74.290  99.755  -33.657  1.00 40.00 ? 316 ILE C N   1 
ATOM 10724 C CA  . ILE C 1 312 ? 74.664  98.419  -33.214  1.00 40.00 ? 316 ILE C CA  1 
ATOM 10725 C C   . ILE C 1 312 ? 74.015  97.387  -34.139  1.00 40.00 ? 316 ILE C C   1 
ATOM 10726 O O   . ILE C 1 312 ? 74.278  96.187  -34.115  1.00 40.00 ? 316 ILE C O   1 
ATOM 10727 C CB  . ILE C 1 312 ? 74.144  98.061  -31.811  1.00 40.00 ? 316 ILE C CB  1 
ATOM 10728 C CG1 . ILE C 1 312 ? 72.610  98.110  -31.836  1.00 40.00 ? 316 ILE C CG1 1 
ATOM 10729 C CG2 . ILE C 1 312 ? 74.729  98.932  -30.730  1.00 40.00 ? 316 ILE C CG2 1 
ATOM 10730 C CD1 . ILE C 1 312 ? 71.940  97.320  -30.726  1.00 40.00 ? 316 ILE C CD1 1 
ATOM 10731 N N   . ASN C 1 313 ? 73.044  97.870  -34.900  1.00 40.00 ? 317 ASN C N   1 
ATOM 10732 C CA  . ASN C 1 313 ? 72.364  96.960  -35.811  1.00 40.00 ? 317 ASN C CA  1 
ATOM 10733 C C   . ASN C 1 313 ? 73.224  96.748  -37.025  1.00 40.00 ? 317 ASN C C   1 
ATOM 10734 O O   . ASN C 1 313 ? 73.235  95.605  -37.491  1.00 40.00 ? 317 ASN C O   1 
ATOM 10735 C CB  . ASN C 1 313 ? 70.962  97.466  -36.076  1.00 40.00 ? 317 ASN C CB  1 
ATOM 10736 C CG  . ASN C 1 313 ? 70.496  97.268  -37.496  1.00 40.00 ? 317 ASN C CG  1 
ATOM 10737 O OD1 . ASN C 1 313 ? 70.063  98.229  -38.157  1.00 40.00 ? 317 ASN C OD1 1 
ATOM 10738 N ND2 . ASN C 1 313 ? 70.594  96.026  -37.969  1.00 40.00 ? 317 ASN C ND2 1 
ATOM 10739 N N   . THR C 1 314 ? 73.925  97.725  -37.579  1.00 40.00 ? 318 THR C N   1 
ATOM 10740 C CA  . THR C 1 314 ? 74.718  97.464  -38.781  1.00 40.00 ? 318 THR C CA  1 
ATOM 10741 C C   . THR C 1 314 ? 76.194  97.784  -38.666  1.00 40.00 ? 318 THR C C   1 
ATOM 10742 O O   . THR C 1 314 ? 76.913  97.794  -39.668  1.00 40.00 ? 318 THR C O   1 
ATOM 10743 C CB  . THR C 1 314 ? 74.174  98.236  -39.999  1.00 40.00 ? 318 THR C CB  1 
ATOM 10744 O OG1 . THR C 1 314 ? 74.427  99.643  -39.836  1.00 40.00 ? 318 THR C OG1 1 
ATOM 10745 C CG2 . THR C 1 314 ? 72.694  97.972  -40.203  1.00 40.00 ? 318 THR C CG2 1 
ATOM 10746 N N   . GLY C 1 315 ? 76.670  98.058  -37.460  1.00 40.00 ? 319 GLY C N   1 
ATOM 10747 C CA  . GLY C 1 315 ? 78.078  98.401  -37.275  1.00 40.00 ? 319 GLY C CA  1 
ATOM 10748 C C   . GLY C 1 315 ? 78.941  97.160  -37.466  1.00 40.00 ? 319 GLY C C   1 
ATOM 10749 O O   . GLY C 1 315 ? 78.435  96.056  -37.349  1.00 40.00 ? 319 GLY C O   1 
ATOM 10750 N N   . ASP C 1 316 ? 80.220  97.354  -37.757  1.00 40.00 ? 320 ASP C N   1 
ATOM 10751 C CA  . ASP C 1 316 ? 81.142  96.222  -37.880  1.00 40.00 ? 320 ASP C CA  1 
ATOM 10752 C C   . ASP C 1 316 ? 81.930  96.185  -36.561  1.00 40.00 ? 320 ASP C C   1 
ATOM 10753 O O   . ASP C 1 316 ? 82.783  97.054  -36.359  1.00 40.00 ? 320 ASP C O   1 
ATOM 10754 C CB  . ASP C 1 316 ? 82.113  96.384  -39.039  1.00 40.00 ? 320 ASP C CB  1 
ATOM 10755 C CG  . ASP C 1 316 ? 82.972  95.147  -39.281  1.00 40.00 ? 320 ASP C CG  1 
ATOM 10756 O OD1 . ASP C 1 316 ? 83.676  94.702  -38.348  1.00 40.00 ? 320 ASP C OD1 1 
ATOM 10757 O OD2 . ASP C 1 316 ? 82.941  94.616  -40.419  1.00 40.00 ? 320 ASP C OD2 1 
ATOM 10758 N N   . PHE C 1 317 ? 81.604  95.253  -35.679  1.00 40.00 ? 321 PHE C N   1 
ATOM 10759 C CA  . PHE C 1 317 ? 82.309  95.195  -34.389  1.00 40.00 ? 321 PHE C CA  1 
ATOM 10760 C C   . PHE C 1 317 ? 83.142  93.923  -34.337  1.00 40.00 ? 321 PHE C C   1 
ATOM 10761 O O   . PHE C 1 317 ? 83.339  93.330  -33.279  1.00 40.00 ? 321 PHE C O   1 
ATOM 10762 C CB  . PHE C 1 317 ? 81.289  95.196  -33.238  1.00 40.00 ? 321 PHE C CB  1 
ATOM 10763 C CG  . PHE C 1 317 ? 80.231  96.246  -33.448  1.00 40.00 ? 321 PHE C CG  1 
ATOM 10764 C CD1 . PHE C 1 317 ? 80.569  97.582  -33.318  1.00 40.00 ? 321 PHE C CD1 1 
ATOM 10765 C CD2 . PHE C 1 317 ? 78.942  95.912  -33.807  1.00 40.00 ? 321 PHE C CD2 1 
ATOM 10766 C CE1 . PHE C 1 317 ? 79.625  98.563  -33.531  1.00 40.00 ? 321 PHE C CE1 1 
ATOM 10767 C CE2 . PHE C 1 317 ? 77.993  96.891  -34.011  1.00 40.00 ? 321 PHE C CE2 1 
ATOM 10768 C CZ  . PHE C 1 317 ? 78.328  98.223  -33.876  1.00 40.00 ? 321 PHE C CZ  1 
ATOM 10769 N N   . GLN C 1 318 ? 83.604  93.524  -35.517  1.00 40.00 ? 322 GLN C N   1 
ATOM 10770 C CA  . GLN C 1 318 ? 84.347  92.297  -35.704  1.00 40.00 ? 322 GLN C CA  1 
ATOM 10771 C C   . GLN C 1 318 ? 85.769  92.270  -35.218  1.00 40.00 ? 322 GLN C C   1 
ATOM 10772 O O   . GLN C 1 318 ? 86.684  92.252  -36.039  1.00 40.00 ? 322 GLN C O   1 
ATOM 10773 C CB  . GLN C 1 318 ? 84.321  91.947  -37.207  1.00 40.00 ? 322 GLN C CB  1 
ATOM 10774 C CG  . GLN C 1 318 ? 84.729  90.509  -37.502  1.00 40.00 ? 322 GLN C CG  1 
ATOM 10775 C CD  . GLN C 1 318 ? 85.415  90.437  -38.857  1.00 40.00 ? 322 GLN C CD  1 
ATOM 10776 O OE1 . GLN C 1 318 ? 85.086  91.214  -39.757  1.00 40.00 ? 322 GLN C OE1 1 
ATOM 10777 N NE2 . GLN C 1 318 ? 86.368  89.520  -38.993  1.00 40.00 ? 322 GLN C NE2 1 
ATOM 10778 N N   . ASP C 1 319 ? 85.996  92.294  -33.918  1.00 40.00 ? 323 ASP C N   1 
ATOM 10779 C CA  . ASP C 1 319 ? 87.306  92.305  -33.300  1.00 40.00 ? 323 ASP C CA  1 
ATOM 10780 C C   . ASP C 1 319 ? 87.202  92.860  -31.870  1.00 40.00 ? 323 ASP C C   1 
ATOM 10781 O O   . ASP C 1 319 ? 87.972  92.475  -30.981  1.00 40.00 ? 323 ASP C O   1 
ATOM 10782 C CB  . ASP C 1 319 ? 88.277  93.184  -34.100  1.00 40.00 ? 323 ASP C CB  1 
ATOM 10783 C CG  . ASP C 1 319 ? 87.907  94.658  -33.987  1.00 40.00 ? 323 ASP C CG  1 
ATOM 10784 O OD1 . ASP C 1 319 ? 86.916  95.084  -34.615  1.00 40.00 ? 323 ASP C OD1 1 
ATOM 10785 O OD2 . ASP C 1 319 ? 88.629  95.326  -33.226  1.00 40.00 ? 323 ASP C OD2 1 
ATOM 10786 N N   . LEU C 1 320 ? 86.246  93.765  -31.679  1.00 40.00 ? 324 LEU C N   1 
ATOM 10787 C CA  . LEU C 1 320 ? 86.018  94.382  -30.392  1.00 40.00 ? 324 LEU C CA  1 
ATOM 10788 C C   . LEU C 1 320 ? 85.825  93.391  -29.260  1.00 40.00 ? 324 LEU C C   1 
ATOM 10789 O O   . LEU C 1 320 ? 85.005  92.481  -29.368  1.00 40.00 ? 324 LEU C O   1 
ATOM 10790 C CB  . LEU C 1 320 ? 84.741  95.204  -30.529  1.00 40.00 ? 324 LEU C CB  1 
ATOM 10791 C CG  . LEU C 1 320 ? 84.570  96.581  -29.908  1.00 40.00 ? 324 LEU C CG  1 
ATOM 10792 C CD1 . LEU C 1 320 ? 83.093  96.974  -30.058  1.00 40.00 ? 324 LEU C CD1 1 
ATOM 10793 C CD2 . LEU C 1 320 ? 85.000  96.653  -28.452  1.00 40.00 ? 324 LEU C CD2 1 
ATOM 10794 N N   . GLN C 1 321 ? 86.537  93.545  -28.158  1.00 40.00 ? 325 GLN C N   1 
ATOM 10795 C CA  . GLN C 1 321 ? 86.279  92.645  -27.026  1.00 40.00 ? 325 GLN C CA  1 
ATOM 10796 C C   . GLN C 1 321 ? 85.388  93.507  -26.120  1.00 40.00 ? 325 GLN C C   1 
ATOM 10797 O O   . GLN C 1 321 ? 85.714  94.685  -25.958  1.00 40.00 ? 325 GLN C O   1 
ATOM 10798 C CB  . GLN C 1 321 ? 87.478  92.229  -26.226  1.00 40.00 ? 325 GLN C CB  1 
ATOM 10799 C CG  . GLN C 1 321 ? 88.254  91.022  -26.738  1.00 40.00 ? 325 GLN C CG  1 
ATOM 10800 C CD  . GLN C 1 321 ? 89.598  91.512  -27.286  1.00 40.00 ? 325 GLN C CD  1 
ATOM 10801 O OE1 . GLN C 1 321 ? 90.500  91.683  -26.463  1.00 40.00 ? 325 GLN C OE1 1 
ATOM 10802 N NE2 . GLN C 1 321 ? 89.649  91.728  -28.595  1.00 40.00 ? 325 GLN C NE2 1 
ATOM 10803 N N   . VAL C 1 322 ? 84.317  92.943  -25.583  1.00 40.00 ? 326 VAL C N   1 
ATOM 10804 C CA  . VAL C 1 322 ? 83.447  93.753  -24.753  1.00 40.00 ? 326 VAL C CA  1 
ATOM 10805 C C   . VAL C 1 322 ? 82.896  92.911  -23.607  1.00 40.00 ? 326 VAL C C   1 
ATOM 10806 O O   . VAL C 1 322 ? 82.289  91.868  -23.855  1.00 40.00 ? 326 VAL C O   1 
ATOM 10807 C CB  . VAL C 1 322 ? 82.178  94.144  -25.549  1.00 40.00 ? 326 VAL C CB  1 
ATOM 10808 C CG1 . VAL C 1 322 ? 81.250  94.846  -24.562  1.00 40.00 ? 326 VAL C CG1 1 
ATOM 10809 C CG2 . VAL C 1 322 ? 82.413  94.930  -26.817  1.00 40.00 ? 326 VAL C CG2 1 
ATOM 10810 N N   . LEU C 1 323 ? 83.056  93.382  -22.407  1.00 40.00 ? 327 LEU C N   1 
ATOM 10811 C CA  . LEU C 1 323 ? 82.455  92.680  -21.255  1.00 40.00 ? 327 LEU C CA  1 
ATOM 10812 C C   . LEU C 1 323 ? 81.166  93.459  -20.994  1.00 40.00 ? 327 LEU C C   1 
ATOM 10813 O O   . LEU C 1 323 ? 81.147  94.702  -21.146  1.00 40.00 ? 327 LEU C O   1 
ATOM 10814 C CB  . LEU C 1 323 ? 83.416  92.736  -20.081  1.00 40.00 ? 327 LEU C CB  1 
ATOM 10815 C CG  . LEU C 1 323 ? 83.097  91.929  -18.828  1.00 40.00 ? 327 LEU C CG  1 
ATOM 10816 C CD1 . LEU C 1 323 ? 83.982  92.343  -17.648  1.00 40.00 ? 327 LEU C CD1 1 
ATOM 10817 C CD2 . LEU C 1 323 ? 81.663  92.063  -18.344  1.00 40.00 ? 327 LEU C CD2 1 
ATOM 10818 N N   . VAL C 1 324 ? 80.065  92.830  -20.652  1.00 40.00 ? 328 VAL C N   1 
ATOM 10819 C CA  . VAL C 1 324 ? 78.794  93.498  -20.424  1.00 40.00 ? 328 VAL C CA  1 
ATOM 10820 C C   . VAL C 1 324 ? 78.075  92.801  -19.284  1.00 40.00 ? 328 VAL C C   1 
ATOM 10821 O O   . VAL C 1 324 ? 78.357  91.602  -19.158  1.00 40.00 ? 328 VAL C O   1 
ATOM 10822 C CB  . VAL C 1 324 ? 77.859  93.233  -21.626  1.00 40.00 ? 328 VAL C CB  1 
ATOM 10823 C CG1 . VAL C 1 324 ? 76.478  93.784  -21.292  1.00 40.00 ? 328 VAL C CG1 1 
ATOM 10824 C CG2 . VAL C 1 324 ? 78.370  93.853  -22.908  1.00 40.00 ? 328 VAL C CG2 1 
ATOM 10825 N N   . GLY C 1 325 ? 77.200  93.445  -18.535  1.00 40.00 ? 329 GLY C N   1 
ATOM 10826 C CA  . GLY C 1 325 ? 76.534  92.661  -17.485  1.00 40.00 ? 329 GLY C CA  1 
ATOM 10827 C C   . GLY C 1 325 ? 75.412  93.481  -16.896  1.00 40.00 ? 329 GLY C C   1 
ATOM 10828 O O   . GLY C 1 325 ? 75.046  94.504  -17.480  1.00 40.00 ? 329 GLY C O   1 
ATOM 10829 N N   . VAL C 1 326 ? 74.882  93.033  -15.771  1.00 40.00 ? 330 VAL C N   1 
ATOM 10830 C CA  . VAL C 1 326 ? 73.693  93.668  -15.181  1.00 40.00 ? 330 VAL C CA  1 
ATOM 10831 C C   . VAL C 1 326 ? 73.563  93.211  -13.737  1.00 40.00 ? 330 VAL C C   1 
ATOM 10832 O O   . VAL C 1 326 ? 74.198  92.201  -13.377  1.00 40.00 ? 330 VAL C O   1 
ATOM 10833 C CB  . VAL C 1 326 ? 72.530  93.039  -15.999  1.00 40.00 ? 330 VAL C CB  1 
ATOM 10834 C CG1 . VAL C 1 326 ? 71.333  92.673  -15.150  1.00 40.00 ? 330 VAL C CG1 1 
ATOM 10835 C CG2 . VAL C 1 326 ? 72.116  93.881  -17.186  1.00 40.00 ? 330 VAL C CG2 1 
ATOM 10836 N N   . VAL C 1 327 ? 72.772  93.866  -12.912  1.00 40.00 ? 331 VAL C N   1 
ATOM 10837 C CA  . VAL C 1 327 ? 72.641  93.412  -11.536  1.00 40.00 ? 331 VAL C CA  1 
ATOM 10838 C C   . VAL C 1 327 ? 71.309  92.731  -11.316  1.00 40.00 ? 331 VAL C C   1 
ATOM 10839 O O   . VAL C 1 327 ? 70.416  92.729  -12.178  1.00 40.00 ? 331 VAL C O   1 
ATOM 10840 C CB  . VAL C 1 327 ? 72.841  94.568  -10.547  1.00 40.00 ? 331 VAL C CB  1 
ATOM 10841 C CG1 . VAL C 1 327 ? 74.343  94.901  -10.455  1.00 40.00 ? 331 VAL C CG1 1 
ATOM 10842 C CG2 . VAL C 1 327 ? 72.090  95.807  -10.980  1.00 40.00 ? 331 VAL C CG2 1 
ATOM 10843 N N   . LYS C 1 328 ? 71.154  92.109  -10.142  1.00 40.00 ? 332 LYS C N   1 
ATOM 10844 C CA  . LYS C 1 328 ? 69.916  91.394  -9.864   1.00 40.00 ? 332 LYS C CA  1 
ATOM 10845 C C   . LYS C 1 328 ? 68.689  92.275  -10.060  1.00 40.00 ? 332 LYS C C   1 
ATOM 10846 O O   . LYS C 1 328 ? 67.812  91.909  -10.850  1.00 40.00 ? 332 LYS C O   1 
ATOM 10847 C CB  . LYS C 1 328 ? 69.941  90.713  -8.495   1.00 40.00 ? 332 LYS C CB  1 
ATOM 10848 C CG  . LYS C 1 328 ? 69.336  89.329  -8.521   1.00 40.00 ? 332 LYS C CG  1 
ATOM 10849 C CD  . LYS C 1 328 ? 68.872  88.720  -7.247   1.00 40.00 ? 332 LYS C CD  1 
ATOM 10850 C CE  . LYS C 1 328 ? 68.243  89.620  -6.219   1.00 40.00 ? 332 LYS C CE  1 
ATOM 10851 N NZ  . LYS C 1 328 ? 69.241  90.088  -5.199   1.00 40.00 ? 332 LYS C NZ  1 
ATOM 10852 N N   . ASP C 1 329 ? 68.584  93.412  -9.372   1.00 40.00 ? 333 ASP C N   1 
ATOM 10853 C CA  . ASP C 1 329 ? 67.407  94.242  -9.529   1.00 40.00 ? 333 ASP C CA  1 
ATOM 10854 C C   . ASP C 1 329 ? 67.610  95.666  -10.015  1.00 40.00 ? 333 ASP C C   1 
ATOM 10855 O O   . ASP C 1 329 ? 67.313  96.577  -9.243   1.00 40.00 ? 333 ASP C O   1 
ATOM 10856 C CB  . ASP C 1 329 ? 66.578  94.272  -8.230   1.00 40.00 ? 333 ASP C CB  1 
ATOM 10857 C CG  . ASP C 1 329 ? 66.680  93.013  -7.396   1.00 40.00 ? 333 ASP C CG  1 
ATOM 10858 O OD1 . ASP C 1 329 ? 67.827  92.671  -7.031   1.00 40.00 ? 333 ASP C OD1 1 
ATOM 10859 O OD2 . ASP C 1 329 ? 65.641  92.375  -7.108   1.00 40.00 ? 333 ASP C OD2 1 
ATOM 10860 N N   . GLU C 1 330 ? 68.003  95.913  -11.260  1.00 40.00 ? 334 GLU C N   1 
ATOM 10861 C CA  . GLU C 1 330 ? 68.164  97.256  -11.782  1.00 40.00 ? 334 GLU C CA  1 
ATOM 10862 C C   . GLU C 1 330 ? 67.041  98.208  -11.366  1.00 40.00 ? 334 GLU C C   1 
ATOM 10863 O O   . GLU C 1 330 ? 67.274  99.192  -10.640  1.00 40.00 ? 334 GLU C O   1 
ATOM 10864 C CB  . GLU C 1 330 ? 68.264  97.323  -13.304  1.00 40.00 ? 334 GLU C CB  1 
ATOM 10865 C CG  . GLU C 1 330 ? 69.261  96.384  -13.938  1.00 40.00 ? 334 GLU C CG  1 
ATOM 10866 C CD  . GLU C 1 330 ? 70.702  96.798  -13.779  1.00 40.00 ? 334 GLU C CD  1 
ATOM 10867 O OE1 . GLU C 1 330 ? 70.987  97.745  -13.008  1.00 40.00 ? 334 GLU C OE1 1 
ATOM 10868 O OE2 . GLU C 1 330 ? 71.590  96.202  -14.409  1.00 40.00 ? 334 GLU C OE2 1 
ATOM 10869 N N   . GLY C 1 331 ? 65.803  97.943  -11.758  1.00 40.00 ? 335 GLY C N   1 
ATOM 10870 C CA  . GLY C 1 331 ? 64.699  98.780  -11.472  1.00 40.00 ? 335 GLY C CA  1 
ATOM 10871 C C   . GLY C 1 331 ? 64.368  99.192  -10.085  1.00 40.00 ? 335 GLY C C   1 
ATOM 10872 O O   . GLY C 1 331 ? 63.691  100.242 -9.939   1.00 40.00 ? 335 GLY C O   1 
ATOM 10873 N N   . SER C 1 332 ? 64.716  98.483  -9.031   1.00 40.00 ? 336 SER C N   1 
ATOM 10874 C CA  . SER C 1 332 ? 64.307  98.835  -7.665   1.00 40.00 ? 336 SER C CA  1 
ATOM 10875 C C   . SER C 1 332 ? 64.538  100.272 -7.238   1.00 40.00 ? 336 SER C C   1 
ATOM 10876 O O   . SER C 1 332 ? 63.619  101.009 -6.877   1.00 40.00 ? 336 SER C O   1 
ATOM 10877 C CB  . SER C 1 332 ? 65.050  97.916  -6.675   1.00 40.00 ? 336 SER C CB  1 
ATOM 10878 O OG  . SER C 1 332 ? 66.365  97.728  -7.204   1.00 40.00 ? 336 SER C OG  1 
ATOM 10879 N N   . TYR C 1 333 ? 65.800  100.704 -7.247   1.00 40.00 ? 337 TYR C N   1 
ATOM 10880 C CA  . TYR C 1 333 ? 66.211  102.068 -6.868   1.00 40.00 ? 337 TYR C CA  1 
ATOM 10881 C C   . TYR C 1 333 ? 65.263  103.088 -7.455   1.00 40.00 ? 337 TYR C C   1 
ATOM 10882 O O   . TYR C 1 333 ? 64.629  103.836 -6.710   1.00 40.00 ? 337 TYR C O   1 
ATOM 10883 C CB  . TYR C 1 333 ? 67.626  102.293 -7.358   1.00 40.00 ? 337 TYR C CB  1 
ATOM 10884 C CG  . TYR C 1 333 ? 68.348  103.581 -7.189   1.00 40.00 ? 337 TYR C CG  1 
ATOM 10885 C CD1 . TYR C 1 333 ? 69.036  103.839 -6.010   1.00 40.00 ? 337 TYR C CD1 1 
ATOM 10886 C CD2 . TYR C 1 333 ? 68.403  104.550 -8.188   1.00 40.00 ? 337 TYR C CD2 1 
ATOM 10887 C CE1 . TYR C 1 333 ? 69.731  105.026 -5.806   1.00 40.00 ? 337 TYR C CE1 1 
ATOM 10888 C CE2 . TYR C 1 333 ? 69.095  105.731 -7.999   1.00 40.00 ? 337 TYR C CE2 1 
ATOM 10889 C CZ  . TYR C 1 333 ? 69.757  105.972 -6.806   1.00 40.00 ? 337 TYR C CZ  1 
ATOM 10890 O OH  . TYR C 1 333 ? 70.445  107.160 -6.639   1.00 40.00 ? 337 TYR C OH  1 
ATOM 10891 N N   . PHE C 1 334 ? 65.063  103.104 -8.778   1.00 40.00 ? 338 PHE C N   1 
ATOM 10892 C CA  . PHE C 1 334 ? 64.210  104.090 -9.404   1.00 40.00 ? 338 PHE C CA  1 
ATOM 10893 C C   . PHE C 1 334 ? 62.788  104.137 -8.936   1.00 40.00 ? 338 PHE C C   1 
ATOM 10894 O O   . PHE C 1 334 ? 62.102  105.098 -9.298   1.00 40.00 ? 338 PHE C O   1 
ATOM 10895 C CB  . PHE C 1 334 ? 64.124  103.833 -10.938  1.00 40.00 ? 338 PHE C CB  1 
ATOM 10896 C CG  . PHE C 1 334 ? 65.517  103.850 -11.490  1.00 40.00 ? 338 PHE C CG  1 
ATOM 10897 C CD1 . PHE C 1 334 ? 66.321  102.738 -11.341  1.00 40.00 ? 338 PHE C CD1 1 
ATOM 10898 C CD2 . PHE C 1 334 ? 66.030  104.963 -12.114  1.00 40.00 ? 338 PHE C CD2 1 
ATOM 10899 C CE1 . PHE C 1 334 ? 67.616  102.709 -11.820  1.00 40.00 ? 338 PHE C CE1 1 
ATOM 10900 C CE2 . PHE C 1 334 ? 67.329  104.950 -12.593  1.00 40.00 ? 338 PHE C CE2 1 
ATOM 10901 C CZ  . PHE C 1 334 ? 68.122  103.823 -12.437  1.00 40.00 ? 338 PHE C CZ  1 
ATOM 10902 N N   . LEU C 1 335 ? 62.293  103.120 -8.247   1.00 40.00 ? 339 LEU C N   1 
ATOM 10903 C CA  . LEU C 1 335 ? 60.871  103.164 -7.908   1.00 40.00 ? 339 LEU C CA  1 
ATOM 10904 C C   . LEU C 1 335 ? 60.566  104.180 -6.834   1.00 40.00 ? 339 LEU C C   1 
ATOM 10905 O O   . LEU C 1 335 ? 59.533  104.854 -6.879   1.00 40.00 ? 339 LEU C O   1 
ATOM 10906 C CB  . LEU C 1 335 ? 60.346  101.781 -7.602   1.00 40.00 ? 339 LEU C CB  1 
ATOM 10907 C CG  . LEU C 1 335 ? 60.491  100.736 -8.722   1.00 40.00 ? 339 LEU C CG  1 
ATOM 10908 C CD1 . LEU C 1 335 ? 59.972  99.396  -8.221   1.00 40.00 ? 339 LEU C CD1 1 
ATOM 10909 C CD2 . LEU C 1 335 ? 59.700  101.169 -9.944   1.00 40.00 ? 339 LEU C CD2 1 
ATOM 10910 N N   . VAL C 1 336 ? 61.475  104.365 -5.882   1.00 40.00 ? 340 VAL C N   1 
ATOM 10911 C CA  . VAL C 1 336 ? 61.316  105.282 -4.777   1.00 40.00 ? 340 VAL C CA  1 
ATOM 10912 C C   . VAL C 1 336 ? 61.167  106.719 -5.261   1.00 40.00 ? 340 VAL C C   1 
ATOM 10913 O O   . VAL C 1 336 ? 60.509  107.578 -4.667   1.00 40.00 ? 340 VAL C O   1 
ATOM 10914 C CB  . VAL C 1 336 ? 62.529  105.269 -3.824   1.00 40.00 ? 340 VAL C CB  1 
ATOM 10915 C CG1 . VAL C 1 336 ? 62.703  103.903 -3.201   1.00 40.00 ? 340 VAL C CG1 1 
ATOM 10916 C CG2 . VAL C 1 336 ? 63.794  105.702 -4.517   1.00 40.00 ? 340 VAL C CG2 1 
ATOM 10917 N N   . TYR C 1 337 ? 61.806  107.007 -6.387   1.00 40.00 ? 341 TYR C N   1 
ATOM 10918 C CA  . TYR C 1 337 ? 61.790  108.328 -6.978   1.00 40.00 ? 341 TYR C CA  1 
ATOM 10919 C C   . TYR C 1 337 ? 60.547  108.633 -7.774   1.00 40.00 ? 341 TYR C C   1 
ATOM 10920 O O   . TYR C 1 337 ? 60.661  109.255 -8.856   1.00 40.00 ? 341 TYR C O   1 
ATOM 10921 C CB  . TYR C 1 337 ? 63.038  108.484 -7.882   1.00 40.00 ? 341 TYR C CB  1 
ATOM 10922 C CG  . TYR C 1 337 ? 64.319  108.667 -7.108   1.00 40.00 ? 341 TYR C CG  1 
ATOM 10923 C CD1 . TYR C 1 337 ? 65.003  107.618 -6.533   1.00 40.00 ? 341 TYR C CD1 1 
ATOM 10924 C CD2 . TYR C 1 337 ? 64.858  109.930 -6.946   1.00 40.00 ? 341 TYR C CD2 1 
ATOM 10925 C CE1 . TYR C 1 337 ? 66.159  107.800 -5.804   1.00 40.00 ? 341 TYR C CE1 1 
ATOM 10926 C CE2 . TYR C 1 337 ? 66.015  110.140 -6.236   1.00 40.00 ? 341 TYR C CE2 1 
ATOM 10927 C CZ  . TYR C 1 337 ? 66.668  109.074 -5.668   1.00 40.00 ? 341 TYR C CZ  1 
ATOM 10928 O OH  . TYR C 1 337 ? 67.835  109.317 -4.975   1.00 40.00 ? 341 TYR C OH  1 
ATOM 10929 N N   . GLY C 1 338 ? 59.324  108.286 -7.395   1.00 40.00 ? 342 GLY C N   1 
ATOM 10930 C CA  . GLY C 1 338 ? 58.203  108.662 -8.247   1.00 40.00 ? 342 GLY C CA  1 
ATOM 10931 C C   . GLY C 1 338 ? 57.114  107.653 -8.495   1.00 40.00 ? 342 GLY C C   1 
ATOM 10932 O O   . GLY C 1 338 ? 56.163  107.972 -9.246   1.00 40.00 ? 342 GLY C O   1 
ATOM 10933 N N   . VAL C 1 339 ? 57.159  106.441 -7.939   1.00 40.00 ? 343 VAL C N   1 
ATOM 10934 C CA  . VAL C 1 339 ? 56.067  105.503 -8.197   1.00 40.00 ? 343 VAL C CA  1 
ATOM 10935 C C   . VAL C 1 339 ? 55.266  105.338 -6.906   1.00 40.00 ? 343 VAL C C   1 
ATOM 10936 O O   . VAL C 1 339 ? 55.705  104.728 -5.932   1.00 40.00 ? 343 VAL C O   1 
ATOM 10937 C CB  . VAL C 1 339 ? 56.535  104.170 -8.757   1.00 40.00 ? 343 VAL C CB  1 
ATOM 10938 C CG1 . VAL C 1 339 ? 55.344  103.245 -8.984   1.00 40.00 ? 343 VAL C CG1 1 
ATOM 10939 C CG2 . VAL C 1 339 ? 57.263  104.364 -10.081  1.00 40.00 ? 343 VAL C CG2 1 
ATOM 10940 N N   . PRO C 1 340 ? 54.071  105.930 -6.904   1.00 40.00 ? 344 PRO C N   1 
ATOM 10941 C CA  . PRO C 1 340 ? 53.216  105.923 -5.731   1.00 40.00 ? 344 PRO C CA  1 
ATOM 10942 C C   . PRO C 1 340 ? 53.112  104.524 -5.153   1.00 40.00 ? 344 PRO C C   1 
ATOM 10943 O O   . PRO C 1 340 ? 52.883  103.575 -5.886   1.00 40.00 ? 344 PRO C O   1 
ATOM 10944 C CB  . PRO C 1 340 ? 51.936  106.542 -6.168   1.00 40.00 ? 344 PRO C CB  1 
ATOM 10945 C CG  . PRO C 1 340 ? 52.134  107.068 -7.529   1.00 40.00 ? 344 PRO C CG  1 
ATOM 10946 C CD  . PRO C 1 340 ? 53.483  106.678 -8.021   1.00 40.00 ? 344 PRO C CD  1 
ATOM 10947 N N   . GLY C 1 341 ? 53.334  104.419 -3.849   1.00 40.00 ? 345 GLY C N   1 
ATOM 10948 C CA  . GLY C 1 341 ? 53.311  103.170 -3.120   1.00 40.00 ? 345 GLY C CA  1 
ATOM 10949 C C   . GLY C 1 341 ? 54.725  102.756 -2.736   1.00 40.00 ? 345 GLY C C   1 
ATOM 10950 O O   . GLY C 1 341 ? 54.911  101.951 -1.812   1.00 40.00 ? 345 GLY C O   1 
ATOM 10951 N N   . PHE C 1 342 ? 55.741  103.267 -3.434   1.00 40.00 ? 346 PHE C N   1 
ATOM 10952 C CA  . PHE C 1 342 ? 57.073  102.797 -3.043   1.00 40.00 ? 346 PHE C CA  1 
ATOM 10953 C C   . PHE C 1 342 ? 57.801  103.759 -2.126   1.00 40.00 ? 346 PHE C C   1 
ATOM 10954 O O   . PHE C 1 342 ? 57.709  104.981 -2.261   1.00 40.00 ? 346 PHE C O   1 
ATOM 10955 C CB  . PHE C 1 342 ? 57.881  102.511 -4.310   1.00 40.00 ? 346 PHE C CB  1 
ATOM 10956 C CG  . PHE C 1 342 ? 57.276  101.434 -5.169   1.00 40.00 ? 346 PHE C CG  1 
ATOM 10957 C CD1 . PHE C 1 342 ? 57.761  100.143 -5.091   1.00 40.00 ? 346 PHE C CD1 1 
ATOM 10958 C CD2 . PHE C 1 342 ? 56.244  101.703 -6.057   1.00 40.00 ? 346 PHE C CD2 1 
ATOM 10959 C CE1 . PHE C 1 342 ? 57.218  99.148  -5.880   1.00 40.00 ? 346 PHE C CE1 1 
ATOM 10960 C CE2 . PHE C 1 342 ? 55.696  100.709 -6.847   1.00 40.00 ? 346 PHE C CE2 1 
ATOM 10961 C CZ  . PHE C 1 342 ? 56.184  99.431  -6.752   1.00 40.00 ? 346 PHE C CZ  1 
ATOM 10962 N N   . SER C 1 343 ? 58.560  103.182 -1.202   1.00 40.00 ? 347 SER C N   1 
ATOM 10963 C CA  . SER C 1 343 ? 59.391  103.950 -0.296   1.00 40.00 ? 347 SER C CA  1 
ATOM 10964 C C   . SER C 1 343 ? 60.540  103.063 0.188    1.00 40.00 ? 347 SER C C   1 
ATOM 10965 O O   . SER C 1 343 ? 60.412  101.839 0.239    1.00 40.00 ? 347 SER C O   1 
ATOM 10966 C CB  . SER C 1 343 ? 58.598  104.425 0.924    1.00 40.00 ? 347 SER C CB  1 
ATOM 10967 O OG  . SER C 1 343 ? 59.339  104.021 2.088    1.00 40.00 ? 347 SER C OG  1 
ATOM 10968 N N   . LYS C 1 344 ? 61.621  103.678 0.648    1.00 40.00 ? 348 LYS C N   1 
ATOM 10969 C CA  . LYS C 1 344 ? 62.724  102.862 1.177    1.00 40.00 ? 348 LYS C CA  1 
ATOM 10970 C C   . LYS C 1 344 ? 62.385  102.495 2.624    1.00 40.00 ? 348 LYS C C   1 
ATOM 10971 O O   . LYS C 1 344 ? 63.012  101.636 3.247    1.00 40.00 ? 348 LYS C O   1 
ATOM 10972 C CB  . LYS C 1 344 ? 64.022  103.670 1.111    1.00 40.00 ? 348 LYS C CB  1 
ATOM 10973 C CG  . LYS C 1 344 ? 64.259  104.675 2.237    1.00 40.00 ? 348 LYS C CG  1 
ATOM 10974 C CD  . LYS C 1 344 ? 65.677  105.235 2.112    1.00 40.00 ? 348 LYS C CD  1 
ATOM 10975 C CE  . LYS C 1 344 ? 66.257  105.665 3.450    1.00 40.00 ? 348 LYS C CE  1 
ATOM 10976 N NZ  . LYS C 1 344 ? 66.901  104.516 4.145    1.00 40.00 ? 348 LYS C NZ  1 
ATOM 10977 N N   . ASP C 1 345 ? 61.386  103.187 3.168    1.00 40.00 ? 349 ASP C N   1 
ATOM 10978 C CA  . ASP C 1 345 ? 61.038  103.008 4.555    1.00 40.00 ? 349 ASP C CA  1 
ATOM 10979 C C   . ASP C 1 345 ? 60.063  101.933 4.906    1.00 40.00 ? 349 ASP C C   1 
ATOM 10980 O O   . ASP C 1 345 ? 60.075  101.519 6.091    1.00 40.00 ? 349 ASP C O   1 
ATOM 10981 C CB  . ASP C 1 345 ? 60.726  104.379 5.176    1.00 40.00 ? 349 ASP C CB  1 
ATOM 10982 C CG  . ASP C 1 345 ? 61.989  105.255 5.155    1.00 40.00 ? 349 ASP C CG  1 
ATOM 10983 O OD1 . ASP C 1 345 ? 63.115  104.759 5.382    1.00 40.00 ? 349 ASP C OD1 1 
ATOM 10984 O OD2 . ASP C 1 345 ? 61.827  106.470 4.890    1.00 40.00 ? 349 ASP C OD2 1 
ATOM 10985 N N   . ASN C 1 346 ? 59.272  101.423 3.967    1.00 40.00 ? 350 ASN C N   1 
ATOM 10986 C CA  . ASN C 1 346 ? 58.371  100.293 4.225    1.00 40.00 ? 350 ASN C CA  1 
ATOM 10987 C C   . ASN C 1 346 ? 58.642  99.242  3.149    1.00 40.00 ? 350 ASN C C   1 
ATOM 10988 O O   . ASN C 1 346 ? 59.453  99.472  2.242    1.00 40.00 ? 350 ASN C O   1 
ATOM 10989 C CB  . ASN C 1 346 ? 56.916  100.681 4.224    1.00 40.00 ? 350 ASN C CB  1 
ATOM 10990 C CG  . ASN C 1 346 ? 56.566  101.478 2.975    1.00 40.00 ? 350 ASN C CG  1 
ATOM 10991 O OD1 . ASN C 1 346 ? 57.309  101.413 1.994    1.00 40.00 ? 350 ASN C OD1 1 
ATOM 10992 N ND2 . ASN C 1 346 ? 55.463  102.178 3.089    1.00 40.00 ? 350 ASN C ND2 1 
ATOM 10993 N N   . GLU C 1 347 ? 57.941  98.128  3.185    1.00 40.00 ? 351 GLU C N   1 
ATOM 10994 C CA  . GLU C 1 347 ? 58.116  97.019  2.255    1.00 40.00 ? 351 GLU C CA  1 
ATOM 10995 C C   . GLU C 1 347 ? 57.500  97.277  0.895    1.00 40.00 ? 351 GLU C C   1 
ATOM 10996 O O   . GLU C 1 347 ? 57.587  96.460  -0.033   1.00 40.00 ? 351 GLU C O   1 
ATOM 10997 C CB  . GLU C 1 347 ? 57.505  95.765  2.882    1.00 40.00 ? 351 GLU C CB  1 
ATOM 10998 C CG  . GLU C 1 347 ? 58.305  95.205  4.047    1.00 40.00 ? 351 GLU C CG  1 
ATOM 10999 C CD  . GLU C 1 347 ? 58.101  93.692  4.148    1.00 40.00 ? 351 GLU C CD  1 
ATOM 11000 O OE1 . GLU C 1 347 ? 58.911  92.927  3.554    1.00 40.00 ? 351 GLU C OE1 1 
ATOM 11001 O OE2 . GLU C 1 347 ? 57.119  93.302  4.816    1.00 40.00 ? 351 GLU C OE2 1 
ATOM 11002 N N   . SER C 1 348 ? 56.853  98.436  0.769    1.00 40.00 ? 352 SER C N   1 
ATOM 11003 C CA  . SER C 1 348 ? 56.246  98.840  -0.482   1.00 40.00 ? 352 SER C CA  1 
ATOM 11004 C C   . SER C 1 348 ? 55.439  97.706  -1.110   1.00 40.00 ? 352 SER C C   1 
ATOM 11005 O O   . SER C 1 348 ? 55.608  97.339  -2.278   1.00 40.00 ? 352 SER C O   1 
ATOM 11006 C CB  . SER C 1 348 ? 57.295  99.382  -1.454   1.00 40.00 ? 352 SER C CB  1 
ATOM 11007 O OG  . SER C 1 348 ? 58.510  99.764  -0.846   1.00 40.00 ? 352 SER C OG  1 
ATOM 11008 N N   . LEU C 1 349 ? 54.540  97.119  -0.309   1.00 40.00 ? 353 LEU C N   1 
ATOM 11009 C CA  . LEU C 1 349 ? 53.654  96.082  -0.836   1.00 40.00 ? 353 LEU C CA  1 
ATOM 11010 C C   . LEU C 1 349 ? 52.505  96.857  -1.500   1.00 40.00 ? 353 LEU C C   1 
ATOM 11011 O O   . LEU C 1 349 ? 51.521  97.215  -0.855   1.00 40.00 ? 353 LEU C O   1 
ATOM 11012 C CB  . LEU C 1 349 ? 53.150  95.144  0.219    1.00 40.00 ? 353 LEU C CB  1 
ATOM 11013 C CG  . LEU C 1 349 ? 53.969  93.960  0.698    1.00 40.00 ? 353 LEU C CG  1 
ATOM 11014 C CD1 . LEU C 1 349 ? 55.267  93.723  -0.063   1.00 40.00 ? 353 LEU C CD1 1 
ATOM 11015 C CD2 . LEU C 1 349 ? 54.268  94.089  2.199    1.00 40.00 ? 353 LEU C CD2 1 
ATOM 11016 N N   . ILE C 1 350 ? 52.647  97.151  -2.773   1.00 40.00 ? 354 ILE C N   1 
ATOM 11017 C CA  . ILE C 1 350 ? 51.658  97.917  -3.511   1.00 40.00 ? 354 ILE C CA  1 
ATOM 11018 C C   . ILE C 1 350 ? 50.388  97.176  -3.903   1.00 40.00 ? 354 ILE C C   1 
ATOM 11019 O O   . ILE C 1 350 ? 50.271  95.958  -3.967   1.00 40.00 ? 354 ILE C O   1 
ATOM 11020 C CB  . ILE C 1 350 ? 52.348  98.475  -4.783   1.00 40.00 ? 354 ILE C CB  1 
ATOM 11021 C CG1 . ILE C 1 350 ? 52.603  97.318  -5.761   1.00 40.00 ? 354 ILE C CG1 1 
ATOM 11022 C CG2 . ILE C 1 350 ? 53.692  99.091  -4.388   1.00 40.00 ? 354 ILE C CG2 1 
ATOM 11023 C CD1 . ILE C 1 350 ? 52.601  97.715  -7.220   1.00 40.00 ? 354 ILE C CD1 1 
ATOM 11024 N N   . SER C 1 351 ? 49.363  97.960  -4.191   1.00 40.00 ? 355 SER C N   1 
ATOM 11025 C CA  . SER C 1 351 ? 48.052  97.570  -4.644   1.00 40.00 ? 355 SER C CA  1 
ATOM 11026 C C   . SER C 1 351 ? 48.120  97.244  -6.136   1.00 40.00 ? 355 SER C C   1 
ATOM 11027 O O   . SER C 1 351 ? 49.128  97.611  -6.738   1.00 40.00 ? 355 SER C O   1 
ATOM 11028 C CB  . SER C 1 351 ? 47.104  98.796  -4.575   1.00 40.00 ? 355 SER C CB  1 
ATOM 11029 O OG  . SER C 1 351 ? 46.771  99.237  -5.895   1.00 40.00 ? 355 SER C OG  1 
ATOM 11030 N N   . ARG C 1 352 ? 47.061  96.689  -6.714   1.00 40.00 ? 356 ARG C N   1 
ATOM 11031 C CA  . ARG C 1 352 ? 47.118  96.443  -8.154   1.00 40.00 ? 356 ARG C CA  1 
ATOM 11032 C C   . ARG C 1 352 ? 47.061  97.758  -8.913   1.00 40.00 ? 356 ARG C C   1 
ATOM 11033 O O   . ARG C 1 352 ? 47.915  98.097  -9.741   1.00 40.00 ? 356 ARG C O   1 
ATOM 11034 C CB  . ARG C 1 352 ? 46.012  95.529  -8.652   1.00 40.00 ? 356 ARG C CB  1 
ATOM 11035 C CG  . ARG C 1 352 ? 46.536  94.576  -9.745   1.00 40.00 ? 356 ARG C CG  1 
ATOM 11036 C CD  . ARG C 1 352 ? 45.391  93.989  -10.541  1.00 40.00 ? 356 ARG C CD  1 
ATOM 11037 N NE  . ARG C 1 352 ? 45.636  93.911  -11.973  1.00 40.00 ? 356 ARG C NE  1 
ATOM 11038 C CZ  . ARG C 1 352 ? 46.601  93.141  -12.490  1.00 40.00 ? 356 ARG C CZ  1 
ATOM 11039 N NH1 . ARG C 1 352 ? 47.371  92.436  -11.674  1.00 40.00 ? 356 ARG C NH1 1 
ATOM 11040 N NH2 . ARG C 1 352 ? 46.777  93.108  -13.804  1.00 40.00 ? 356 ARG C NH2 1 
ATOM 11041 N N   . ALA C 1 353 ? 46.059  98.570  -8.599   1.00 40.00 ? 357 ALA C N   1 
ATOM 11042 C CA  . ALA C 1 353 ? 45.887  99.874  -9.238   1.00 40.00 ? 357 ALA C CA  1 
ATOM 11043 C C   . ALA C 1 353 ? 47.178  100.686 -9.211   1.00 40.00 ? 357 ALA C C   1 
ATOM 11044 O O   . ALA C 1 353 ? 47.517  101.401 -10.163  1.00 40.00 ? 357 ALA C O   1 
ATOM 11045 C CB  . ALA C 1 353 ? 44.771  100.658 -8.588   1.00 40.00 ? 357 ALA C CB  1 
ATOM 11046 N N   . GLN C 1 354 ? 47.907  100.590 -8.101   1.00 40.00 ? 358 GLN C N   1 
ATOM 11047 C CA  . GLN C 1 354 ? 49.193  101.280 -8.015   1.00 40.00 ? 358 GLN C CA  1 
ATOM 11048 C C   . GLN C 1 354 ? 50.075  100.701 -9.128   1.00 40.00 ? 358 GLN C C   1 
ATOM 11049 O O   . GLN C 1 354 ? 50.561  101.395 -10.028  1.00 40.00 ? 358 GLN C O   1 
ATOM 11050 C CB  . GLN C 1 354 ? 49.836  101.086 -6.640   1.00 40.00 ? 358 GLN C CB  1 
ATOM 11051 C CG  . GLN C 1 354 ? 49.129  101.874 -5.551   1.00 40.00 ? 358 GLN C CG  1 
ATOM 11052 C CD  . GLN C 1 354 ? 49.697  101.697 -4.164   1.00 40.00 ? 358 GLN C CD  1 
ATOM 11053 O OE1 . GLN C 1 354 ? 50.129  100.635 -3.703   1.00 40.00 ? 358 GLN C OE1 1 
ATOM 11054 N NE2 . GLN C 1 354 ? 49.695  102.816 -3.421   1.00 40.00 ? 358 GLN C NE2 1 
ATOM 11055 N N   . PHE C 1 355 ? 50.232  99.373  -9.106   1.00 40.00 ? 359 PHE C N   1 
ATOM 11056 C CA  . PHE C 1 355 ? 51.009  98.715  -10.157  1.00 40.00 ? 359 PHE C CA  1 
ATOM 11057 C C   . PHE C 1 355 ? 50.533  99.117  -11.555  1.00 40.00 ? 359 PHE C C   1 
ATOM 11058 O O   . PHE C 1 355 ? 51.354  99.369  -12.450  1.00 40.00 ? 359 PHE C O   1 
ATOM 11059 C CB  . PHE C 1 355 ? 50.951  97.196  -9.987   1.00 40.00 ? 359 PHE C CB  1 
ATOM 11060 C CG  . PHE C 1 355 ? 51.528  96.447  -11.161  1.00 40.00 ? 359 PHE C CG  1 
ATOM 11061 C CD1 . PHE C 1 355 ? 50.740  96.166  -12.268  1.00 40.00 ? 359 PHE C CD1 1 
ATOM 11062 C CD2 . PHE C 1 355 ? 52.841  96.033  -11.150  1.00 40.00 ? 359 PHE C CD2 1 
ATOM 11063 C CE1 . PHE C 1 355 ? 51.249  95.479  -13.360  1.00 40.00 ? 359 PHE C CE1 1 
ATOM 11064 C CE2 . PHE C 1 355 ? 53.351  95.360  -12.237  1.00 40.00 ? 359 PHE C CE2 1 
ATOM 11065 C CZ  . PHE C 1 355 ? 52.563  95.084  -13.343  1.00 40.00 ? 359 PHE C CZ  1 
ATOM 11066 N N   . LEU C 1 356 ? 49.206  99.179  -11.794  1.00 40.00 ? 360 LEU C N   1 
ATOM 11067 C CA  . LEU C 1 356 ? 48.758  99.606  -13.113  1.00 40.00 ? 360 LEU C CA  1 
ATOM 11068 C C   . LEU C 1 356 ? 49.298  100.994 -13.455  1.00 40.00 ? 360 LEU C C   1 
ATOM 11069 O O   . LEU C 1 356 ? 49.642  101.264 -14.608  1.00 40.00 ? 360 LEU C O   1 
ATOM 11070 C CB  . LEU C 1 356 ? 47.251  99.660  -13.230  1.00 40.00 ? 360 LEU C CB  1 
ATOM 11071 C CG  . LEU C 1 356 ? 46.466  98.390  -13.535  1.00 40.00 ? 360 LEU C CG  1 
ATOM 11072 C CD1 . LEU C 1 356 ? 47.345  97.304  -14.149  1.00 40.00 ? 360 LEU C CD1 1 
ATOM 11073 C CD2 . LEU C 1 356 ? 45.837  97.857  -12.244  1.00 40.00 ? 360 LEU C CD2 1 
ATOM 11074 N N   . ALA C 1 357 ? 49.330  101.884 -12.470  1.00 40.00 ? 361 ALA C N   1 
ATOM 11075 C CA  . ALA C 1 357 ? 49.809  103.251 -12.704  1.00 40.00 ? 361 ALA C CA  1 
ATOM 11076 C C   . ALA C 1 357 ? 51.325  103.277 -12.903  1.00 40.00 ? 361 ALA C C   1 
ATOM 11077 O O   . ALA C 1 357 ? 51.879  103.974 -13.741  1.00 40.00 ? 361 ALA C O   1 
ATOM 11078 C CB  . ALA C 1 357 ? 49.459  104.090 -11.507  1.00 40.00 ? 361 ALA C CB  1 
ATOM 11079 N N   . GLY C 1 358 ? 51.970  102.436 -12.076  1.00 40.00 ? 362 GLY C N   1 
ATOM 11080 C CA  . GLY C 1 358 ? 53.426  102.349 -12.125  1.00 40.00 ? 362 GLY C CA  1 
ATOM 11081 C C   . GLY C 1 358 ? 53.800  102.126 -13.584  1.00 40.00 ? 362 GLY C C   1 
ATOM 11082 O O   . GLY C 1 358 ? 54.578  102.842 -14.209  1.00 40.00 ? 362 GLY C O   1 
ATOM 11083 N N   . VAL C 1 359 ? 53.164  101.102 -14.158  1.00 40.00 ? 363 VAL C N   1 
ATOM 11084 C CA  . VAL C 1 359 ? 53.448  100.755 -15.547  1.00 40.00 ? 363 VAL C CA  1 
ATOM 11085 C C   . VAL C 1 359 ? 53.410  101.974 -16.438  1.00 40.00 ? 363 VAL C C   1 
ATOM 11086 O O   . VAL C 1 359 ? 54.268  102.097 -17.343  1.00 40.00 ? 363 VAL C O   1 
ATOM 11087 C CB  . VAL C 1 359 ? 52.568  99.616  -16.061  1.00 40.00 ? 363 VAL C CB  1 
ATOM 11088 C CG1 . VAL C 1 359 ? 52.682  99.485  -17.571  1.00 40.00 ? 363 VAL C CG1 1 
ATOM 11089 C CG2 . VAL C 1 359 ? 52.989  98.297  -15.398  1.00 40.00 ? 363 VAL C CG2 1 
ATOM 11090 N N   . ARG C 1 360 ? 52.500  102.922 -16.235  1.00 40.00 ? 364 ARG C N   1 
ATOM 11091 C CA  . ARG C 1 360 ? 52.510  104.092 -17.131  1.00 40.00 ? 364 ARG C CA  1 
ATOM 11092 C C   . ARG C 1 360 ? 53.620  105.064 -16.811  1.00 40.00 ? 364 ARG C C   1 
ATOM 11093 O O   . ARG C 1 360 ? 54.115  105.798 -17.699  1.00 40.00 ? 364 ARG C O   1 
ATOM 11094 C CB  . ARG C 1 360 ? 51.127  104.707 -17.170  1.00 40.00 ? 364 ARG C CB  1 
ATOM 11095 C CG  . ARG C 1 360 ? 50.026  103.665 -17.000  1.00 40.00 ? 364 ARG C CG  1 
ATOM 11096 C CD  . ARG C 1 360 ? 49.752  102.918 -18.266  1.00 40.00 ? 364 ARG C CD  1 
ATOM 11097 N NE  . ARG C 1 360 ? 50.048  103.604 -19.524  1.00 40.00 ? 364 ARG C NE  1 
ATOM 11098 C CZ  . ARG C 1 360 ? 49.068  103.972 -20.368  1.00 40.00 ? 364 ARG C CZ  1 
ATOM 11099 N NH1 . ARG C 1 360 ? 47.803  103.728 -20.027  1.00 40.00 ? 364 ARG C NH1 1 
ATOM 11100 N NH2 . ARG C 1 360 ? 49.363  104.575 -21.507  1.00 40.00 ? 364 ARG C NH2 1 
ATOM 11101 N N   . ILE C 1 361 ? 54.088  105.117 -15.573  1.00 40.00 ? 365 ILE C N   1 
ATOM 11102 C CA  . ILE C 1 361 ? 55.191  106.043 -15.249  1.00 40.00 ? 365 ILE C CA  1 
ATOM 11103 C C   . ILE C 1 361 ? 56.494  105.438 -15.778  1.00 40.00 ? 365 ILE C C   1 
ATOM 11104 O O   . ILE C 1 361 ? 57.309  106.060 -16.449  1.00 40.00 ? 365 ILE C O   1 
ATOM 11105 C CB  . ILE C 1 361 ? 55.281  106.151 -13.729  1.00 40.00 ? 365 ILE C CB  1 
ATOM 11106 C CG1 . ILE C 1 361 ? 54.221  107.128 -13.197  1.00 40.00 ? 365 ILE C CG1 1 
ATOM 11107 C CG2 . ILE C 1 361 ? 56.661  106.555 -13.246  1.00 40.00 ? 365 ILE C CG2 1 
ATOM 11108 C CD1 . ILE C 1 361 ? 54.124  106.998 -11.695  1.00 40.00 ? 365 ILE C CD1 1 
ATOM 11109 N N   . GLY C 1 362 ? 56.650  104.161 -15.431  1.00 40.00 ? 366 GLY C N   1 
ATOM 11110 C CA  . GLY C 1 362 ? 57.798  103.368 -15.824  1.00 40.00 ? 366 GLY C CA  1 
ATOM 11111 C C   . GLY C 1 362 ? 57.934  103.154 -17.315  1.00 40.00 ? 366 GLY C C   1 
ATOM 11112 O O   . GLY C 1 362 ? 59.063  102.931 -17.753  1.00 40.00 ? 366 GLY C O   1 
ATOM 11113 N N   . VAL C 1 363 ? 56.900  103.273 -18.137  1.00 40.00 ? 367 VAL C N   1 
ATOM 11114 C CA  . VAL C 1 363 ? 56.957  103.078 -19.587  1.00 40.00 ? 367 VAL C CA  1 
ATOM 11115 C C   . VAL C 1 363 ? 56.135  104.204 -20.193  1.00 40.00 ? 367 VAL C C   1 
ATOM 11116 O O   . VAL C 1 363 ? 55.063  104.066 -20.807  1.00 40.00 ? 367 VAL C O   1 
ATOM 11117 C CB  . VAL C 1 363 ? 56.242  101.753 -19.940  1.00 40.00 ? 367 VAL C CB  1 
ATOM 11118 C CG1 . VAL C 1 363 ? 56.564  101.365 -21.374  1.00 40.00 ? 367 VAL C CG1 1 
ATOM 11119 C CG2 . VAL C 1 363 ? 56.567  100.641 -18.961  1.00 40.00 ? 367 VAL C CG2 1 
ATOM 11120 N N   . PRO C 1 364 ? 56.638  105.417 -19.964  1.00 40.00 ? 368 PRO C N   1 
ATOM 11121 C CA  . PRO C 1 364 ? 55.958  106.641 -20.359  1.00 40.00 ? 368 PRO C CA  1 
ATOM 11122 C C   . PRO C 1 364 ? 55.650  106.750 -21.822  1.00 40.00 ? 368 PRO C C   1 
ATOM 11123 O O   . PRO C 1 364 ? 54.741  107.496 -22.218  1.00 40.00 ? 368 PRO C O   1 
ATOM 11124 C CB  . PRO C 1 364 ? 56.954  107.751 -20.006  1.00 40.00 ? 368 PRO C CB  1 
ATOM 11125 C CG  . PRO C 1 364 ? 58.264  107.041 -20.022  1.00 40.00 ? 368 PRO C CG  1 
ATOM 11126 C CD  . PRO C 1 364 ? 57.901  105.756 -19.279  1.00 40.00 ? 368 PRO C CD  1 
ATOM 11127 N N   . GLN C 1 365 ? 56.427  106.082 -22.652  1.00 40.00 ? 369 GLN C N   1 
ATOM 11128 C CA  . GLN C 1 365 ? 56.205  106.199 -24.091  1.00 40.00 ? 369 GLN C CA  1 
ATOM 11129 C C   . GLN C 1 365 ? 55.110  105.244 -24.539  1.00 40.00 ? 369 GLN C C   1 
ATOM 11130 O O   . GLN C 1 365 ? 54.699  105.293 -25.706  1.00 40.00 ? 369 GLN C O   1 
ATOM 11131 C CB  . GLN C 1 365 ? 57.486  105.842 -24.860  1.00 40.00 ? 369 GLN C CB  1 
ATOM 11132 C CG  . GLN C 1 365 ? 57.792  104.349 -24.794  1.00 40.00 ? 369 GLN C CG  1 
ATOM 11133 C CD  . GLN C 1 365 ? 58.614  103.949 -23.600  1.00 40.00 ? 369 GLN C CD  1 
ATOM 11134 O OE1 . GLN C 1 365 ? 58.316  104.277 -22.455  1.00 40.00 ? 369 GLN C OE1 1 
ATOM 11135 N NE2 . GLN C 1 365 ? 59.703  103.206 -23.852  1.00 40.00 ? 369 GLN C NE2 1 
ATOM 11136 N N   . ALA C 1 366 ? 54.695  104.359 -23.621  1.00 40.00 ? 370 ALA C N   1 
ATOM 11137 C CA  . ALA C 1 366 ? 53.722  103.385 -24.033  1.00 40.00 ? 370 ALA C CA  1 
ATOM 11138 C C   . ALA C 1 366 ? 52.330  103.914 -24.242  1.00 40.00 ? 370 ALA C C   1 
ATOM 11139 O O   . ALA C 1 366 ? 51.725  104.573 -23.405  1.00 40.00 ? 370 ALA C O   1 
ATOM 11140 C CB  . ALA C 1 366 ? 53.668  102.215 -23.046  1.00 40.00 ? 370 ALA C CB  1 
ATOM 11141 N N   . SER C 1 367 ? 51.772  103.501 -25.380  1.00 40.00 ? 371 SER C N   1 
ATOM 11142 C CA  . SER C 1 367 ? 50.338  103.766 -25.624  1.00 40.00 ? 371 SER C CA  1 
ATOM 11143 C C   . SER C 1 367 ? 49.550  102.885 -24.646  1.00 40.00 ? 371 SER C C   1 
ATOM 11144 O O   . SER C 1 367 ? 50.129  102.103 -23.878  1.00 40.00 ? 371 SER C O   1 
ATOM 11145 C CB  . SER C 1 367 ? 50.005  103.356 -27.056  1.00 40.00 ? 371 SER C CB  1 
ATOM 11146 O OG  . SER C 1 367 ? 49.872  101.951 -27.220  1.00 40.00 ? 371 SER C OG  1 
ATOM 11147 N N   . ASP C 1 368 ? 48.219  102.946 -24.696  1.00 40.00 ? 372 ASP C N   1 
ATOM 11148 C CA  . ASP C 1 368 ? 47.429  102.102 -23.783  1.00 40.00 ? 372 ASP C CA  1 
ATOM 11149 C C   . ASP C 1 368 ? 47.616  100.623 -24.106  1.00 40.00 ? 372 ASP C C   1 
ATOM 11150 O O   . ASP C 1 368 ? 47.999  99.827  -23.250  1.00 40.00 ? 372 ASP C O   1 
ATOM 11151 C CB  . ASP C 1 368 ? 45.942  102.397 -23.828  1.00 40.00 ? 372 ASP C CB  1 
ATOM 11152 C CG  . ASP C 1 368 ? 45.610  103.792 -23.355  1.00 40.00 ? 372 ASP C CG  1 
ATOM 11153 O OD1 . ASP C 1 368 ? 45.956  104.092 -22.199  1.00 40.00 ? 372 ASP C OD1 1 
ATOM 11154 O OD2 . ASP C 1 368 ? 45.029  104.539 -24.162  1.00 40.00 ? 372 ASP C OD2 1 
ATOM 11155 N N   . LEU C 1 369 ? 47.352  100.278 -25.367  1.00 40.00 ? 373 LEU C N   1 
ATOM 11156 C CA  . LEU C 1 369 ? 47.517  98.891  -25.774  1.00 40.00 ? 373 LEU C CA  1 
ATOM 11157 C C   . LEU C 1 369 ? 48.878  98.373  -25.329  1.00 40.00 ? 373 LEU C C   1 
ATOM 11158 O O   . LEU C 1 369 ? 48.969  97.301  -24.710  1.00 40.00 ? 373 LEU C O   1 
ATOM 11159 C CB  . LEU C 1 369 ? 47.371  98.793  -27.275  1.00 40.00 ? 373 LEU C CB  1 
ATOM 11160 C CG  . LEU C 1 369 ? 46.988  97.441  -27.854  1.00 40.00 ? 373 LEU C CG  1 
ATOM 11161 C CD1 . LEU C 1 369 ? 45.920  96.749  -27.043  1.00 40.00 ? 373 LEU C CD1 1 
ATOM 11162 C CD2 . LEU C 1 369 ? 46.528  97.651  -29.303  1.00 40.00 ? 373 LEU C CD2 1 
ATOM 11163 N N   . ALA C 1 370 ? 49.943  99.153  -25.628  1.00 40.00 ? 374 ALA C N   1 
ATOM 11164 C CA  . ALA C 1 370 ? 51.276  98.679  -25.228  1.00 40.00 ? 374 ALA C CA  1 
ATOM 11165 C C   . ALA C 1 370 ? 51.356  98.518  -23.722  1.00 40.00 ? 374 ALA C C   1 
ATOM 11166 O O   . ALA C 1 370 ? 51.882  97.534  -23.202  1.00 40.00 ? 374 ALA C O   1 
ATOM 11167 C CB  . ALA C 1 370 ? 52.350  99.575  -25.769  1.00 40.00 ? 374 ALA C CB  1 
ATOM 11168 N N   . ALA C 1 371 ? 50.790  99.463  -22.992  1.00 40.00 ? 375 ALA C N   1 
ATOM 11169 C CA  . ALA C 1 371 ? 50.783  99.304  -21.531  1.00 40.00 ? 375 ALA C CA  1 
ATOM 11170 C C   . ALA C 1 371 ? 50.086  97.991  -21.178  1.00 40.00 ? 375 ALA C C   1 
ATOM 11171 O O   . ALA C 1 371 ? 50.558  97.208  -20.362  1.00 40.00 ? 375 ALA C O   1 
ATOM 11172 C CB  . ALA C 1 371 ? 50.017  100.457 -20.898  1.00 40.00 ? 375 ALA C CB  1 
ATOM 11173 N N   . GLU C 1 372 ? 48.934  97.752  -21.817  1.00 40.00 ? 376 GLU C N   1 
ATOM 11174 C CA  . GLU C 1 372 ? 48.184  96.522  -21.587  1.00 40.00 ? 376 GLU C CA  1 
ATOM 11175 C C   . GLU C 1 372 ? 49.130  95.338  -21.770  1.00 40.00 ? 376 GLU C C   1 
ATOM 11176 O O   . GLU C 1 372 ? 49.301  94.469  -20.904  1.00 40.00 ? 376 GLU C O   1 
ATOM 11177 C CB  . GLU C 1 372 ? 47.006  96.452  -22.542  1.00 40.00 ? 376 GLU C CB  1 
ATOM 11178 C CG  . GLU C 1 372 ? 45.681  96.012  -21.891  1.00 40.00 ? 376 GLU C CG  1 
ATOM 11179 C CD  . GLU C 1 372 ? 44.723  97.186  -21.835  1.00 40.00 ? 376 GLU C CD  1 
ATOM 11180 O OE1 . GLU C 1 372 ? 44.312  97.629  -22.939  1.00 40.00 ? 376 GLU C OE1 1 
ATOM 11181 O OE2 . GLU C 1 372 ? 44.403  97.683  -20.725  1.00 40.00 ? 376 GLU C OE2 1 
ATOM 11182 N N   . ALA C 1 373 ? 49.802  95.318  -22.925  1.00 40.00 ? 377 ALA C N   1 
ATOM 11183 C CA  . ALA C 1 373 ? 50.781  94.264  -23.209  1.00 40.00 ? 377 ALA C CA  1 
ATOM 11184 C C   . ALA C 1 373 ? 51.728  94.070  -22.021  1.00 40.00 ? 377 ALA C C   1 
ATOM 11185 O O   . ALA C 1 373 ? 51.879  92.945  -21.510  1.00 40.00 ? 377 ALA C O   1 
ATOM 11186 C CB  . ALA C 1 373 ? 51.598  94.565  -24.448  1.00 40.00 ? 377 ALA C CB  1 
ATOM 11187 N N   . VAL C 1 374 ? 52.332  95.183  -21.561  1.00 40.00 ? 378 VAL C N   1 
ATOM 11188 C CA  . VAL C 1 374 ? 53.227  95.053  -20.416  1.00 40.00 ? 378 VAL C CA  1 
ATOM 11189 C C   . VAL C 1 374 ? 52.518  94.497  -19.192  1.00 40.00 ? 378 VAL C C   1 
ATOM 11190 O O   . VAL C 1 374 ? 53.051  93.636  -18.457  1.00 40.00 ? 378 VAL C O   1 
ATOM 11191 C CB  . VAL C 1 374 ? 53.842  96.419  -20.079  1.00 40.00 ? 378 VAL C CB  1 
ATOM 11192 C CG1 . VAL C 1 374 ? 54.865  96.257  -18.961  1.00 40.00 ? 378 VAL C CG1 1 
ATOM 11193 C CG2 . VAL C 1 374 ? 54.462  96.990  -21.345  1.00 40.00 ? 378 VAL C CG2 1 
ATOM 11194 N N   . VAL C 1 375 ? 51.291  94.955  -18.929  1.00 40.00 ? 379 VAL C N   1 
ATOM 11195 C CA  . VAL C 1 375 ? 50.629  94.431  -17.740  1.00 40.00 ? 379 VAL C CA  1 
ATOM 11196 C C   . VAL C 1 375 ? 50.367  92.937  -17.851  1.00 40.00 ? 379 VAL C C   1 
ATOM 11197 O O   . VAL C 1 375 ? 50.500  92.183  -16.888  1.00 40.00 ? 379 VAL C O   1 
ATOM 11198 C CB  . VAL C 1 375 ? 49.321  95.146  -17.403  1.00 40.00 ? 379 VAL C CB  1 
ATOM 11199 C CG1 . VAL C 1 375 ? 48.761  94.521  -16.134  1.00 40.00 ? 379 VAL C CG1 1 
ATOM 11200 C CG2 . VAL C 1 375 ? 49.582  96.629  -17.211  1.00 40.00 ? 379 VAL C CG2 1 
ATOM 11201 N N   . LEU C 1 376 ? 49.987  92.552  -19.080  1.00 40.00 ? 380 LEU C N   1 
ATOM 11202 C CA  . LEU C 1 376 ? 49.704  91.142  -19.360  1.00 40.00 ? 380 LEU C CA  1 
ATOM 11203 C C   . LEU C 1 376 ? 50.950  90.341  -18.982  1.00 40.00 ? 380 LEU C C   1 
ATOM 11204 O O   . LEU C 1 376 ? 50.941  89.387  -18.246  1.00 40.00 ? 380 LEU C O   1 
ATOM 11205 C CB  . LEU C 1 376 ? 49.535  90.919  -20.854  1.00 40.00 ? 380 LEU C CB  1 
ATOM 11206 C CG  . LEU C 1 376 ? 48.969  89.615  -21.365  1.00 40.00 ? 380 LEU C CG  1 
ATOM 11207 C CD1 . LEU C 1 376 ? 49.678  89.171  -22.633  1.00 40.00 ? 380 LEU C CD1 1 
ATOM 11208 C CD2 . LEU C 1 376 ? 48.934  88.502  -20.346  1.00 40.00 ? 380 LEU C CD2 1 
ATOM 11209 N N   . HIS C 1 377 ? 52.044  90.838  -19.585  1.00 40.00 ? 381 HIS C N   1 
ATOM 11210 C CA  . HIS C 1 377 ? 53.296  90.146  -19.363  1.00 40.00 ? 381 HIS C CA  1 
ATOM 11211 C C   . HIS C 1 377 ? 53.754  90.071  -17.925  1.00 40.00 ? 381 HIS C C   1 
ATOM 11212 O O   . HIS C 1 377 ? 54.292  89.003  -17.570  1.00 40.00 ? 381 HIS C O   1 
ATOM 11213 C CB  . HIS C 1 377 ? 54.415  90.719  -20.218  1.00 40.00 ? 381 HIS C CB  1 
ATOM 11214 C CG  . HIS C 1 377 ? 55.613  89.824  -20.252  1.00 40.00 ? 381 HIS C CG  1 
ATOM 11215 N ND1 . HIS C 1 377 ? 55.815  88.872  -21.220  1.00 40.00 ? 381 HIS C ND1 1 
ATOM 11216 C CD2 . HIS C 1 377 ? 56.672  89.759  -19.415  1.00 40.00 ? 381 HIS C CD2 1 
ATOM 11217 C CE1 . HIS C 1 377 ? 56.974  88.257  -20.980  1.00 40.00 ? 381 HIS C CE1 1 
ATOM 11218 N NE2 . HIS C 1 377 ? 57.521  88.770  -19.890  1.00 40.00 ? 381 HIS C NE2 1 
ATOM 11219 N N   . TYR C 1 378 ? 53.607  91.143  -17.132  1.00 40.00 ? 382 TYR C N   1 
ATOM 11220 C CA  . TYR C 1 378 ? 54.145  91.023  -15.767  1.00 40.00 ? 382 TYR C CA  1 
ATOM 11221 C C   . TYR C 1 378 ? 53.141  90.636  -14.713  1.00 40.00 ? 382 TYR C C   1 
ATOM 11222 O O   . TYR C 1 378 ? 53.538  90.326  -13.560  1.00 40.00 ? 382 TYR C O   1 
ATOM 11223 C CB  . TYR C 1 378 ? 54.908  92.284  -15.446  1.00 40.00 ? 382 TYR C CB  1 
ATOM 11224 C CG  . TYR C 1 378 ? 56.195  92.490  -16.208  1.00 40.00 ? 382 TYR C CG  1 
ATOM 11225 C CD1 . TYR C 1 378 ? 57.428  92.190  -15.620  1.00 40.00 ? 382 TYR C CD1 1 
ATOM 11226 C CD2 . TYR C 1 378 ? 56.193  92.997  -17.505  1.00 40.00 ? 382 TYR C CD2 1 
ATOM 11227 C CE1 . TYR C 1 378 ? 58.610  92.390  -16.269  1.00 40.00 ? 382 TYR C CE1 1 
ATOM 11228 C CE2 . TYR C 1 378 ? 57.393  93.187  -18.176  1.00 40.00 ? 382 TYR C CE2 1 
ATOM 11229 C CZ  . TYR C 1 378 ? 58.578  92.885  -17.545  1.00 40.00 ? 382 TYR C CZ  1 
ATOM 11230 O OH  . TYR C 1 378 ? 59.763  93.069  -18.248  1.00 40.00 ? 382 TYR C OH  1 
ATOM 11231 N N   . THR C 1 379 ? 51.843  90.613  -15.026  1.00 40.00 ? 383 THR C N   1 
ATOM 11232 C CA  . THR C 1 379 ? 50.858  90.200  -14.018  1.00 40.00 ? 383 THR C CA  1 
ATOM 11233 C C   . THR C 1 379 ? 50.950  88.693  -13.737  1.00 40.00 ? 383 THR C C   1 
ATOM 11234 O O   . THR C 1 379 ? 51.150  87.938  -14.696  1.00 40.00 ? 383 THR C O   1 
ATOM 11235 C CB  . THR C 1 379 ? 49.421  90.404  -14.551  1.00 40.00 ? 383 THR C CB  1 
ATOM 11236 O OG1 . THR C 1 379 ? 49.114  91.784  -14.752  1.00 40.00 ? 383 THR C OG1 1 
ATOM 11237 C CG2 . THR C 1 379 ? 48.425  89.762  -13.600  1.00 40.00 ? 383 THR C CG2 1 
ATOM 11238 N N   . ASP C 1 380 ? 50.785  88.241  -12.494  1.00 40.00 ? 384 ASP C N   1 
ATOM 11239 C CA  . ASP C 1 380 ? 50.761  86.778  -12.299  1.00 40.00 ? 384 ASP C CA  1 
ATOM 11240 C C   . ASP C 1 380 ? 49.259  86.427  -12.215  1.00 40.00 ? 384 ASP C C   1 
ATOM 11241 O O   . ASP C 1 380 ? 48.655  86.558  -11.155  1.00 40.00 ? 384 ASP C O   1 
ATOM 11242 C CB  . ASP C 1 380 ? 51.461  86.279  -11.066  1.00 40.00 ? 384 ASP C CB  1 
ATOM 11243 C CG  . ASP C 1 380 ? 50.996  84.870  -10.696  1.00 40.00 ? 384 ASP C CG  1 
ATOM 11244 O OD1 . ASP C 1 380 ? 50.553  84.141  -11.615  1.00 40.00 ? 384 ASP C OD1 1 
ATOM 11245 O OD2 . ASP C 1 380 ? 51.072  84.564  -9.498   1.00 40.00 ? 384 ASP C OD2 1 
ATOM 11246 N N   . TRP C 1 381 ? 48.665  85.930  -13.295  1.00 40.00 ? 385 TRP C N   1 
ATOM 11247 C CA  . TRP C 1 381 ? 47.249  85.637  -13.343  1.00 40.00 ? 385 TRP C CA  1 
ATOM 11248 C C   . TRP C 1 381 ? 46.706  84.628  -12.372  1.00 40.00 ? 385 TRP C C   1 
ATOM 11249 O O   . TRP C 1 381 ? 45.466  84.462  -12.220  1.00 40.00 ? 385 TRP C O   1 
ATOM 11250 C CB  . TRP C 1 381 ? 46.822  85.386  -14.779  1.00 40.00 ? 385 TRP C CB  1 
ATOM 11251 C CG  . TRP C 1 381 ? 47.230  86.528  -15.657  1.00 40.00 ? 385 TRP C CG  1 
ATOM 11252 C CD1 . TRP C 1 381 ? 48.350  86.590  -16.451  1.00 40.00 ? 385 TRP C CD1 1 
ATOM 11253 C CD2 . TRP C 1 381 ? 46.558  87.772  -15.823  1.00 40.00 ? 385 TRP C CD2 1 
ATOM 11254 N NE1 . TRP C 1 381 ? 48.412  87.794  -17.107  1.00 40.00 ? 385 TRP C NE1 1 
ATOM 11255 C CE2 . TRP C 1 381 ? 47.321  88.538  -16.735  1.00 40.00 ? 385 TRP C CE2 1 
ATOM 11256 C CE3 . TRP C 1 381 ? 45.389  88.323  -15.286  1.00 40.00 ? 385 TRP C CE3 1 
ATOM 11257 C CZ2 . TRP C 1 381 ? 46.940  89.819  -17.127  1.00 40.00 ? 385 TRP C CZ2 1 
ATOM 11258 C CZ3 . TRP C 1 381 ? 45.020  89.594  -15.679  1.00 40.00 ? 385 TRP C CZ3 1 
ATOM 11259 C CH2 . TRP C 1 381 ? 45.793  90.328  -16.587  1.00 40.00 ? 385 TRP C CH2 1 
ATOM 11260 N N   . LEU C 1 382 ? 47.571  83.941  -11.614  1.00 40.00 ? 386 LEU C N   1 
ATOM 11261 C CA  . LEU C 1 382 ? 47.025  83.070  -10.576  1.00 40.00 ? 386 LEU C CA  1 
ATOM 11262 C C   . LEU C 1 382 ? 46.880  83.951  -9.340   1.00 40.00 ? 386 LEU C C   1 
ATOM 11263 O O   . LEU C 1 382 ? 46.101  83.607  -8.457   1.00 40.00 ? 386 LEU C O   1 
ATOM 11264 C CB  . LEU C 1 382 ? 47.835  81.847  -10.348  1.00 40.00 ? 386 LEU C CB  1 
ATOM 11265 C CG  . LEU C 1 382 ? 47.190  80.540  -9.923   1.00 40.00 ? 386 LEU C CG  1 
ATOM 11266 C CD1 . LEU C 1 382 ? 47.557  80.210  -8.476   1.00 40.00 ? 386 LEU C CD1 1 
ATOM 11267 C CD2 . LEU C 1 382 ? 45.663  80.541  -10.037  1.00 40.00 ? 386 LEU C CD2 1 
ATOM 11268 N N   . HIS C 1 383 ? 47.594  85.065  -9.238   1.00 40.00 ? 387 HIS C N   1 
ATOM 11269 C CA  . HIS C 1 383 ? 47.476  85.978  -8.072   1.00 40.00 ? 387 HIS C CA  1 
ATOM 11270 C C   . HIS C 1 383 ? 47.630  87.435  -8.495   1.00 40.00 ? 387 HIS C C   1 
ATOM 11271 O O   . HIS C 1 383 ? 48.630  88.114  -8.187   1.00 40.00 ? 387 HIS C O   1 
ATOM 11272 C CB  . HIS C 1 383 ? 48.616  85.641  -7.105   1.00 40.00 ? 387 HIS C CB  1 
ATOM 11273 C CG  . HIS C 1 383 ? 48.747  84.222  -6.678   1.00 40.00 ? 387 HIS C CG  1 
ATOM 11274 N ND1 . HIS C 1 383 ? 49.650  83.340  -7.229   1.00 40.00 ? 387 HIS C ND1 1 
ATOM 11275 C CD2 . HIS C 1 383 ? 48.048  83.510  -5.761   1.00 40.00 ? 387 HIS C CD2 1 
ATOM 11276 C CE1 . HIS C 1 383 ? 49.535  82.162  -6.652   1.00 40.00 ? 387 HIS C CE1 1 
ATOM 11277 N NE2 . HIS C 1 383 ? 48.565  82.231  -5.761   1.00 40.00 ? 387 HIS C NE2 1 
ATOM 11278 N N   . PRO C 1 384 ? 46.703  87.975  -9.270   1.00 40.00 ? 388 PRO C N   1 
ATOM 11279 C CA  . PRO C 1 384 ? 46.810  89.294  -9.841   1.00 40.00 ? 388 PRO C CA  1 
ATOM 11280 C C   . PRO C 1 384 ? 46.741  90.439  -8.886   1.00 40.00 ? 388 PRO C C   1 
ATOM 11281 O O   . PRO C 1 384 ? 46.638  91.616  -9.306   1.00 40.00 ? 388 PRO C O   1 
ATOM 11282 C CB  . PRO C 1 384 ? 45.632  89.359  -10.821  1.00 40.00 ? 388 PRO C CB  1 
ATOM 11283 C CG  . PRO C 1 384 ? 44.612  88.482  -10.165  1.00 40.00 ? 388 PRO C CG  1 
ATOM 11284 C CD  . PRO C 1 384 ? 45.468  87.291  -9.726   1.00 40.00 ? 388 PRO C CD  1 
ATOM 11285 N N   . GLU C 1 385 ? 46.719  90.171  -7.585   1.00 40.00 ? 389 GLU C N   1 
ATOM 11286 C CA  . GLU C 1 385 ? 46.640  91.189  -6.572   1.00 40.00 ? 389 GLU C CA  1 
ATOM 11287 C C   . GLU C 1 385 ? 47.675  90.939  -5.479   1.00 40.00 ? 389 GLU C C   1 
ATOM 11288 O O   . GLU C 1 385 ? 47.739  91.744  -4.541   1.00 40.00 ? 389 GLU C O   1 
ATOM 11289 C CB  . GLU C 1 385 ? 45.289  91.301  -5.901   1.00 40.00 ? 389 GLU C CB  1 
ATOM 11290 C CG  . GLU C 1 385 ? 44.096  90.839  -6.685   1.00 40.00 ? 389 GLU C CG  1 
ATOM 11291 C CD  . GLU C 1 385 ? 43.260  91.983  -7.217   1.00 40.00 ? 389 GLU C CD  1 
ATOM 11292 O OE1 . GLU C 1 385 ? 43.258  93.065  -6.592   1.00 40.00 ? 389 GLU C OE1 1 
ATOM 11293 O OE2 . GLU C 1 385 ? 42.607  91.782  -8.265   1.00 40.00 ? 389 GLU C OE2 1 
ATOM 11294 N N   . ASP C 1 386 ? 48.435  89.865  -5.600   1.00 40.00 ? 390 ASP C N   1 
ATOM 11295 C CA  . ASP C 1 386 ? 49.449  89.654  -4.529   1.00 40.00 ? 390 ASP C CA  1 
ATOM 11296 C C   . ASP C 1 386 ? 50.353  90.881  -4.567   1.00 40.00 ? 390 ASP C C   1 
ATOM 11297 O O   . ASP C 1 386 ? 51.011  91.201  -5.575   1.00 40.00 ? 390 ASP C O   1 
ATOM 11298 C CB  . ASP C 1 386 ? 50.118  88.338  -4.811   1.00 40.00 ? 390 ASP C CB  1 
ATOM 11299 C CG  . ASP C 1 386 ? 51.416  88.172  -4.053   1.00 40.00 ? 390 ASP C CG  1 
ATOM 11300 O OD1 . ASP C 1 386 ? 51.419  88.471  -2.838   1.00 40.00 ? 390 ASP C OD1 1 
ATOM 11301 O OD2 . ASP C 1 386 ? 52.412  87.757  -4.689   1.00 40.00 ? 390 ASP C OD2 1 
ATOM 11302 N N   . PRO C 1 387 ? 50.349  91.659  -3.492   1.00 40.00 ? 391 PRO C N   1 
ATOM 11303 C CA  . PRO C 1 387 ? 51.141  92.886  -3.405   1.00 40.00 ? 391 PRO C CA  1 
ATOM 11304 C C   . PRO C 1 387 ? 52.610  92.575  -3.589   1.00 40.00 ? 391 PRO C C   1 
ATOM 11305 O O   . PRO C 1 387 ? 53.300  93.156  -4.444   1.00 40.00 ? 391 PRO C O   1 
ATOM 11306 C CB  . PRO C 1 387 ? 50.796  93.448  -2.043   1.00 40.00 ? 391 PRO C CB  1 
ATOM 11307 C CG  . PRO C 1 387 ? 50.410  92.231  -1.247   1.00 40.00 ? 391 PRO C CG  1 
ATOM 11308 C CD  . PRO C 1 387 ? 49.640  91.381  -2.231   1.00 40.00 ? 391 PRO C CD  1 
ATOM 11309 N N   . THR C 1 388 ? 53.131  91.594  -2.856   1.00 40.00 ? 392 THR C N   1 
ATOM 11310 C CA  . THR C 1 388 ? 54.528  91.230  -3.033   1.00 40.00 ? 392 THR C CA  1 
ATOM 11311 C C   . THR C 1 388 ? 54.903  90.979  -4.495   1.00 40.00 ? 392 THR C C   1 
ATOM 11312 O O   . THR C 1 388 ? 56.016  91.314  -4.927   1.00 40.00 ? 392 THR C O   1 
ATOM 11313 C CB  . THR C 1 388 ? 54.876  89.927  -2.276   1.00 40.00 ? 392 THR C CB  1 
ATOM 11314 O OG1 . THR C 1 388 ? 54.801  90.153  -0.866   1.00 40.00 ? 392 THR C OG1 1 
ATOM 11315 C CG2 . THR C 1 388 ? 56.288  89.480  -2.645   1.00 40.00 ? 392 THR C CG2 1 
ATOM 11316 N N   . HIS C 1 389 ? 54.009  90.296  -5.233   1.00 40.00 ? 393 HIS C N   1 
ATOM 11317 C CA  . HIS C 1 389 ? 54.353  90.009  -6.626   1.00 40.00 ? 393 HIS C CA  1 
ATOM 11318 C C   . HIS C 1 389 ? 54.362  91.306  -7.434   1.00 40.00 ? 393 HIS C C   1 
ATOM 11319 O O   . HIS C 1 389 ? 55.331  91.633  -8.100   1.00 40.00 ? 393 HIS C O   1 
ATOM 11320 C CB  . HIS C 1 389 ? 53.454  88.977  -7.284   1.00 40.00 ? 393 HIS C CB  1 
ATOM 11321 C CG  . HIS C 1 389 ? 53.950  88.691  -8.679   1.00 40.00 ? 393 HIS C CG  1 
ATOM 11322 N ND1 . HIS C 1 389 ? 54.893  87.723  -8.931   1.00 40.00 ? 393 HIS C ND1 1 
ATOM 11323 C CD2 . HIS C 1 389 ? 53.663  89.263  -9.871   1.00 40.00 ? 393 HIS C CD2 1 
ATOM 11324 C CE1 . HIS C 1 389 ? 55.158  87.701  -10.233  1.00 40.00 ? 393 HIS C CE1 1 
ATOM 11325 N NE2 . HIS C 1 389 ? 54.418  88.628  -10.825  1.00 40.00 ? 393 HIS C NE2 1 
ATOM 11326 N N   . LEU C 1 390 ? 53.261  92.037  -7.322   1.00 40.00 ? 394 LEU C N   1 
ATOM 11327 C CA  . LEU C 1 390 ? 53.101  93.333  -7.965   1.00 40.00 ? 394 LEU C CA  1 
ATOM 11328 C C   . LEU C 1 390 ? 54.360  94.167  -7.756   1.00 40.00 ? 394 LEU C C   1 
ATOM 11329 O O   . LEU C 1 390 ? 54.997  94.659  -8.692   1.00 40.00 ? 394 LEU C O   1 
ATOM 11330 C CB  . LEU C 1 390 ? 51.912  94.000  -7.250   1.00 40.00 ? 394 LEU C CB  1 
ATOM 11331 C CG  . LEU C 1 390 ? 50.559  93.416  -7.690   1.00 40.00 ? 394 LEU C CG  1 
ATOM 11332 C CD1 . LEU C 1 390 ? 49.455  93.873  -6.780   1.00 40.00 ? 394 LEU C CD1 1 
ATOM 11333 C CD2 . LEU C 1 390 ? 50.309  93.811  -9.145   1.00 40.00 ? 394 LEU C CD2 1 
ATOM 11334 N N   . ARG C 1 391 ? 54.748  94.283  -6.482   1.00 40.00 ? 395 ARG C N   1 
ATOM 11335 C CA  . ARG C 1 391 ? 55.941  95.019  -6.112   1.00 40.00 ? 395 ARG C CA  1 
ATOM 11336 C C   . ARG C 1 391 ? 57.141  94.629  -6.954   1.00 40.00 ? 395 ARG C C   1 
ATOM 11337 O O   . ARG C 1 391 ? 57.685  95.397  -7.748   1.00 40.00 ? 395 ARG C O   1 
ATOM 11338 C CB  . ARG C 1 391 ? 56.328  94.781  -4.644   1.00 40.00 ? 395 ARG C CB  1 
ATOM 11339 C CG  . ARG C 1 391 ? 57.499