data_1C72
# 
_entry.id   1C72 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1C72         
RCSB  RCSB001416   
WWPDB D_1000001416 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1C72 
_pdbx_database_status.recvd_initial_deposition_date   2000-02-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chern, M.K.' 1 
'Wu, T.C.'    2 
'Hsieh, C.H.' 3 
'Chou, C.C.'  4 
'Liu, L.F.'   5 
'Kuan, I.C.'  6 
'Yeh, Y.H.'   7 
'Hsiao, C.D.' 8 
'Tam, M.F.'   9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Tyr115, gln165 and trp209 contribute to the 1, 2-epoxy-3-(p-nitrophenoxy)propane-conjugating activity of glutathione S-transferase cGSTM1-1.
;
J.Mol.Biol. 300 1257 1269 2000 JMOBAK UK 0022-2836 0070 ? 10903867 10.1006/jmbi.2000.3904 
1       'The Three-Dimensional Structure of an Avian Class-Mu Glutathione S-Transferase, cGSTM1-1 at 1.94A Resolution' J.Mol.Biol. 
278 239  252  1998 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.1998.1716 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chern, M.K.' 1  
primary 'Wu, T.C.'    2  
primary 'Hsieh, C.H.' 3  
primary 'Chou, C.C.'  4  
primary 'Liu, L.F.'   5  
primary 'Kuan, I.C.'  6  
primary 'Yeh, Y.H.'   7  
primary 'Hsiao, C.D.' 8  
primary 'Tam, M.F.'   9  
1       'Sun, Y.J.'   10 
1       'Kuan, I.C.'  11 
1       'Tam, M.F.'   12 
1       'Hsiao, C.D.' 13 
# 
_cell.entry_id           1C72 
_cell.length_a           125.600 
_cell.length_b           136.650 
_cell.length_c           125.740 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1C72 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (GLUTATHIONE S-TRANSFERASE)'                  25779.650 4   2.5.1.18 ? ? 
'1,2-EPOXY-3-(P-NITROPHENOXY)PROPANE' 
2 non-polymer syn 1-HYDROXY-2-S-GLUTATHIONYL-3-PARA-NITROPHENOXY-PROPANE 502.496   4   ?        ? ? ? 
3 water       nat water                                                  18.015    158 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        GSTS 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIA
RKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLELLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAY
DVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNKKE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIA
RKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLELLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAY
DVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNKKE
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   VAL n 
1 3   THR n 
1 4   LEU n 
1 5   GLY n 
1 6   TYR n 
1 7   TRP n 
1 8   ASP n 
1 9   ILE n 
1 10  ARG n 
1 11  GLY n 
1 12  LEU n 
1 13  ALA n 
1 14  HIS n 
1 15  ALA n 
1 16  ILE n 
1 17  ARG n 
1 18  LEU n 
1 19  LEU n 
1 20  LEU n 
1 21  GLU n 
1 22  TYR n 
1 23  THR n 
1 24  GLU n 
1 25  THR n 
1 26  PRO n 
1 27  TYR n 
1 28  GLN n 
1 29  GLU n 
1 30  ARG n 
1 31  ARG n 
1 32  TYR n 
1 33  LYS n 
1 34  ALA n 
1 35  GLY n 
1 36  PRO n 
1 37  ALA n 
1 38  PRO n 
1 39  ASP n 
1 40  PHE n 
1 41  ASP n 
1 42  PRO n 
1 43  SER n 
1 44  ASP n 
1 45  TRP n 
1 46  THR n 
1 47  ASN n 
1 48  GLU n 
1 49  LYS n 
1 50  GLU n 
1 51  LYS n 
1 52  LEU n 
1 53  GLY n 
1 54  LEU n 
1 55  ASP n 
1 56  PHE n 
1 57  PRO n 
1 58  ASN n 
1 59  LEU n 
1 60  PRO n 
1 61  TYR n 
1 62  LEU n 
1 63  ILE n 
1 64  ASP n 
1 65  GLY n 
1 66  ASP n 
1 67  VAL n 
1 68  LYS n 
1 69  LEU n 
1 70  THR n 
1 71  GLN n 
1 72  SER n 
1 73  ASN n 
1 74  ALA n 
1 75  ILE n 
1 76  LEU n 
1 77  ARG n 
1 78  TYR n 
1 79  ILE n 
1 80  ALA n 
1 81  ARG n 
1 82  LYS n 
1 83  HIS n 
1 84  ASN n 
1 85  MET n 
1 86  CYS n 
1 87  GLY n 
1 88  GLU n 
1 89  THR n 
1 90  GLU n 
1 91  VAL n 
1 92  GLU n 
1 93  LYS n 
1 94  GLN n 
1 95  ARG n 
1 96  VAL n 
1 97  ASP n 
1 98  VAL n 
1 99  LEU n 
1 100 GLU n 
1 101 ASN n 
1 102 HIS n 
1 103 LEU n 
1 104 MET n 
1 105 ASP n 
1 106 LEU n 
1 107 ARG n 
1 108 MET n 
1 109 ALA n 
1 110 PHE n 
1 111 ALA n 
1 112 ARG n 
1 113 LEU n 
1 114 CYS n 
1 115 TYR n 
1 116 SER n 
1 117 PRO n 
1 118 ASP n 
1 119 PHE n 
1 120 GLU n 
1 121 LYS n 
1 122 LEU n 
1 123 LYS n 
1 124 PRO n 
1 125 ALA n 
1 126 TYR n 
1 127 LEU n 
1 128 GLU n 
1 129 LEU n 
1 130 LEU n 
1 131 PRO n 
1 132 GLY n 
1 133 LYS n 
1 134 LEU n 
1 135 ARG n 
1 136 GLN n 
1 137 LEU n 
1 138 SER n 
1 139 ARG n 
1 140 PHE n 
1 141 LEU n 
1 142 GLY n 
1 143 SER n 
1 144 ARG n 
1 145 SER n 
1 146 TRP n 
1 147 PHE n 
1 148 VAL n 
1 149 GLY n 
1 150 ASP n 
1 151 LYS n 
1 152 LEU n 
1 153 THR n 
1 154 PHE n 
1 155 VAL n 
1 156 ASP n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 TYR n 
1 161 ASP n 
1 162 VAL n 
1 163 LEU n 
1 164 ASP n 
1 165 GLN n 
1 166 GLN n 
1 167 ARG n 
1 168 MET n 
1 169 PHE n 
1 170 VAL n 
1 171 PRO n 
1 172 ASP n 
1 173 CYS n 
1 174 PRO n 
1 175 GLU n 
1 176 LEU n 
1 177 GLN n 
1 178 GLY n 
1 179 ASN n 
1 180 LEU n 
1 181 SER n 
1 182 GLN n 
1 183 PHE n 
1 184 LEU n 
1 185 GLN n 
1 186 ARG n 
1 187 PHE n 
1 188 GLU n 
1 189 ALA n 
1 190 LEU n 
1 191 GLU n 
1 192 LYS n 
1 193 ILE n 
1 194 SER n 
1 195 ALA n 
1 196 TYR n 
1 197 MET n 
1 198 ARG n 
1 199 SER n 
1 200 GLY n 
1 201 ARG n 
1 202 PHE n 
1 203 MET n 
1 204 LYS n 
1 205 ALA n 
1 206 PRO n 
1 207 ILE n 
1 208 PHE n 
1 209 TRP n 
1 210 TYR n 
1 211 THR n 
1 212 ALA n 
1 213 LEU n 
1 214 TRP n 
1 215 ASN n 
1 216 ASN n 
1 217 LYS n 
1 218 LYS n 
1 219 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               chicken 
_entity_src_gen.gene_src_genus                     Gallus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Gallus gallus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9031 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                LIVER 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               TG1 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GSTM2_CHICK 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P20136 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1C72 A 1 ? 219 ? P20136 2 ? 220 ? 1 219 
2 1 1C72 B 1 ? 219 ? P20136 2 ? 220 ? 1 219 
3 1 1C72 C 1 ? 219 ? P20136 2 ? 220 ? 1 219 
4 1 1C72 D 1 ? 219 ? P20136 2 ? 220 ? 1 219 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                               ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                             ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                        ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                               ? 'C3 H7 N O2 S'     121.158 
EPY non-polymer         . 1-HYDROXY-2-S-GLUTATHIONYL-3-PARA-NITROPHENOXY-PROPANE ? 'C19 H26 N4 O10 S' 502.496 
GLN 'L-peptide linking' y GLUTAMINE                                              ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                        ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                              ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                  ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                             ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                 ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                             ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                          ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                 ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                              ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                             ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                               ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                 ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1C72 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.7 
_exptl_crystal.density_percent_sol   55.0 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'pH 7.5' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           287 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1998-07-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1C72 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             31.0 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   25597 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0900000 
_reflns.pdbx_netI_over_sigmaI        14.6 
_reflns.B_iso_Wilson_estimate        37.0 
_reflns.pdbx_redundancy              2.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   89.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.3170000 
_reflns_shell.meanI_over_sigI_obs    3.17 
_reflns_shell.pdbx_redundancy        2.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1C72 
_refine.ls_number_reflns_obs                     21857 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             31.0 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    86.6 
_refine.ls_R_factor_obs                          0.1900000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1900000 
_refine.ls_R_factor_R_free                       0.2800000 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  2163 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               31.6 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1GSU' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1C72 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.38 
_refine_analyze.Luzzati_d_res_low_obs           3.5 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.5 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7200 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         136 
_refine_hist.number_atoms_solvent             158 
_refine_hist.number_atoms_total               7494 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        31.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.014 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      26.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      2.68  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             4.40  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            6.39  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             4.66  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            6.55  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.8 
_refine_ls_shell.d_res_low                        2.98 
_refine_ls_shell.number_reflns_R_work             2468 
_refine_ls_shell.R_factor_R_work                  0.2460000 
_refine_ls_shell.percent_reflns_obs               73.6 
_refine_ls_shell.R_factor_R_free                  0.3500000 
_refine_ls_shell.R_factor_R_free_error            0.021 
_refine_ls_shell.percent_reflns_R_free            9.8 
_refine_ls_shell.number_reflns_R_free             267 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO    TOPHCSDX.PRO   'X-RAY DIFFRACTION' 
2 TIP3P.PARAMETER TIP3P.TOPOLOGY 'X-RAY DIFFRACTION' 
3 GSH-EPNP.PAR    GSH-EPNP.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1C72 
_struct.title                     
;TYR115, GLN165 AND TRP209 CONTRIBUTE TO THE 1,2-EPOXY-3-(P-NITROPHENOXY)PROPANE CONJUGATING ACTIVITIES OF GLUTATHIONE S-TRANSFERASE CGSTM1-1
;
_struct.pdbx_descriptor           'GLUTATHIONE S-TRANSFERASE (E.C.2.5.1.18)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1C72 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'GLUTATHIONE S-TRANSFERASE, 1, 2-EPOXY-3-(P-NITROPHENOXY)PROPANE, EPOXIDASE ACTIVITY, STEADY-STATE KINETICS, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 10  ? LEU A 12  ? ARG A 10  LEU A 12  5 ? 3  
HELX_P HELX_P2  2  ALA A 13  ? THR A 23  ? ALA A 13  THR A 23  1 ? 11 
HELX_P HELX_P3  3  PRO A 42  ? ASN A 47  ? PRO A 42  ASN A 47  1 ? 6  
HELX_P HELX_P4  4  GLN A 71  ? HIS A 83  ? GLN A 71  HIS A 83  1 ? 13 
HELX_P HELX_P5  5  THR A 89  ? SER A 116 ? THR A 89  SER A 116 1 ? 28 
HELX_P HELX_P6  6  ASP A 118 ? GLY A 142 ? ASP A 118 GLY A 142 1 ? 25 
HELX_P HELX_P7  7  THR A 153 ? VAL A 170 ? THR A 153 VAL A 170 1 ? 18 
HELX_P HELX_P8  8  CYS A 173 ? GLN A 177 ? CYS A 173 GLN A 177 5 ? 5  
HELX_P HELX_P9  9  GLY A 178 ? ALA A 189 ? GLY A 178 ALA A 189 1 ? 12 
HELX_P HELX_P10 10 LEU A 190 ? ARG A 198 ? LEU A 190 ARG A 198 1 ? 9  
HELX_P HELX_P11 11 ARG B 10  ? LEU B 12  ? ARG B 10  LEU B 12  5 ? 3  
HELX_P HELX_P12 12 ALA B 13  ? THR B 23  ? ALA B 13  THR B 23  1 ? 11 
HELX_P HELX_P13 13 PRO B 42  ? ASN B 47  ? PRO B 42  ASN B 47  1 ? 6  
HELX_P HELX_P14 14 GLN B 71  ? LYS B 82  ? GLN B 71  LYS B 82  1 ? 12 
HELX_P HELX_P15 15 THR B 89  ? SER B 116 ? THR B 89  SER B 116 1 ? 28 
HELX_P HELX_P16 16 ASP B 118 ? GLY B 142 ? ASP B 118 GLY B 142 1 ? 25 
HELX_P HELX_P17 17 THR B 153 ? VAL B 170 ? THR B 153 VAL B 170 1 ? 18 
HELX_P HELX_P18 18 CYS B 173 ? GLN B 177 ? CYS B 173 GLN B 177 5 ? 5  
HELX_P HELX_P19 19 GLY B 178 ? ALA B 189 ? GLY B 178 ALA B 189 1 ? 12 
HELX_P HELX_P20 20 LEU B 190 ? ARG B 198 ? LEU B 190 ARG B 198 1 ? 9  
HELX_P HELX_P21 21 ARG C 10  ? LEU C 12  ? ARG C 10  LEU C 12  5 ? 3  
HELX_P HELX_P22 22 ALA C 13  ? THR C 23  ? ALA C 13  THR C 23  1 ? 11 
HELX_P HELX_P23 23 PRO C 42  ? ASN C 47  ? PRO C 42  ASN C 47  1 ? 6  
HELX_P HELX_P24 24 GLN C 71  ? HIS C 83  ? GLN C 71  HIS C 83  1 ? 13 
HELX_P HELX_P25 25 THR C 89  ? SER C 116 ? THR C 89  SER C 116 1 ? 28 
HELX_P HELX_P26 26 ASP C 118 ? GLY C 142 ? ASP C 118 GLY C 142 1 ? 25 
HELX_P HELX_P27 27 THR C 153 ? VAL C 170 ? THR C 153 VAL C 170 1 ? 18 
HELX_P HELX_P28 28 CYS C 173 ? GLN C 177 ? CYS C 173 GLN C 177 5 ? 5  
HELX_P HELX_P29 29 GLY C 178 ? ALA C 189 ? GLY C 178 ALA C 189 1 ? 12 
HELX_P HELX_P30 30 LEU C 190 ? ARG C 198 ? LEU C 190 ARG C 198 1 ? 9  
HELX_P HELX_P31 31 ARG D 10  ? LEU D 12  ? ARG D 10  LEU D 12  5 ? 3  
HELX_P HELX_P32 32 ALA D 13  ? THR D 23  ? ALA D 13  THR D 23  1 ? 11 
HELX_P HELX_P33 33 PRO D 42  ? ASN D 47  ? PRO D 42  ASN D 47  1 ? 6  
HELX_P HELX_P34 34 GLN D 71  ? LYS D 82  ? GLN D 71  LYS D 82  1 ? 12 
HELX_P HELX_P35 35 THR D 89  ? SER D 116 ? THR D 89  SER D 116 1 ? 28 
HELX_P HELX_P36 36 ASP D 118 ? GLY D 142 ? ASP D 118 GLY D 142 1 ? 25 
HELX_P HELX_P37 37 THR D 153 ? VAL D 170 ? THR D 153 VAL D 170 1 ? 18 
HELX_P HELX_P38 38 CYS D 173 ? GLN D 177 ? CYS D 173 GLN D 177 5 ? 5  
HELX_P HELX_P39 39 GLY D 178 ? ALA D 189 ? GLY D 178 ALA D 189 1 ? 12 
HELX_P HELX_P40 40 LEU D 190 ? ARG D 198 ? LEU D 190 ARG D 198 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 37  A . ? ALA 37  A PRO 38  A ? PRO 38  A 1 -4.18  
2  LEU 59  A . ? LEU 59  A PRO 60  A ? PRO 60  A 1 13.42  
3  ALA 205 A . ? ALA 205 A PRO 206 A ? PRO 206 A 1 -11.50 
4  ALA 37  B . ? ALA 37  B PRO 38  B ? PRO 38  B 1 5.65   
5  LEU 59  B . ? LEU 59  B PRO 60  B ? PRO 60  B 1 8.99   
6  ALA 205 B . ? ALA 205 B PRO 206 B ? PRO 206 B 1 -1.67  
7  ALA 37  C . ? ALA 37  C PRO 38  C ? PRO 38  C 1 -1.65  
8  LEU 59  C . ? LEU 59  C PRO 60  C ? PRO 60  C 1 11.60  
9  ALA 205 C . ? ALA 205 C PRO 206 C ? PRO 206 C 1 -4.40  
10 ALA 37  D . ? ALA 37  D PRO 38  D ? PRO 38  D 1 -2.22  
11 LEU 59  D . ? LEU 59  D PRO 60  D ? PRO 60  D 1 14.04  
12 ALA 205 D . ? ALA 205 D PRO 206 D ? PRO 206 D 1 -11.17 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 27 ? TYR A 32 ? TYR A 27 TYR A 32 
A 2 VAL A 2  ? TRP A 7  ? VAL A 2  TRP A 7  
A 3 TYR A 61 ? ASP A 64 ? TYR A 61 ASP A 64 
A 4 VAL A 67 ? THR A 70 ? VAL A 67 THR A 70 
B 1 TYR B 27 ? TYR B 32 ? TYR B 27 TYR B 32 
B 2 VAL B 2  ? TRP B 7  ? VAL B 2  TRP B 7  
B 3 TYR B 61 ? ASP B 64 ? TYR B 61 ASP B 64 
B 4 VAL B 67 ? THR B 70 ? VAL B 67 THR B 70 
C 1 TYR C 27 ? TYR C 32 ? TYR C 27 TYR C 32 
C 2 VAL C 2  ? TRP C 7  ? VAL C 2  TRP C 7  
C 3 TYR C 61 ? ASP C 64 ? TYR C 61 ASP C 64 
C 4 VAL C 67 ? THR C 70 ? VAL C 67 THR C 70 
D 1 TYR D 27 ? TYR D 32 ? TYR D 27 TYR D 32 
D 2 VAL D 2  ? TRP D 7  ? VAL D 2  TRP D 7  
D 3 TYR D 61 ? ASP D 64 ? TYR D 61 ASP D 64 
D 4 VAL D 67 ? THR D 70 ? VAL D 67 THR D 70 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 28 ? N GLN A 28 O VAL A 2  ? O VAL A 2  
A 2 3 N GLY A 5  ? N GLY A 5  O TYR A 61 ? O TYR A 61 
A 3 4 N ASP A 64 ? N ASP A 64 O VAL A 67 ? O VAL A 67 
B 1 2 N GLN B 28 ? N GLN B 28 O VAL B 2  ? O VAL B 2  
B 2 3 N GLY B 5  ? N GLY B 5  O TYR B 61 ? O TYR B 61 
B 3 4 N ASP B 64 ? N ASP B 64 O VAL B 67 ? O VAL B 67 
C 1 2 N GLN C 28 ? N GLN C 28 O VAL C 2  ? O VAL C 2  
C 2 3 N GLY C 5  ? N GLY C 5  O TYR C 61 ? O TYR C 61 
C 3 4 N ASP C 64 ? N ASP C 64 O VAL C 67 ? O VAL C 67 
D 1 2 N GLN D 28 ? N GLN D 28 O VAL D 2  ? O VAL D 2  
D 2 3 N GLY D 5  ? N GLY D 5  O TYR D 61 ? O TYR D 61 
D 3 4 N ASP D 64 ? N ASP D 64 O VAL D 67 ? O VAL D 67 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE EPY A 220' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE EPY B 221' 
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE EPY C 222' 
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE EPY D 223' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 TYR A 6   ? TYR A 6    . ? 1_555 ? 
2  AC1 15 TRP A 7   ? TRP A 7    . ? 1_555 ? 
3  AC1 15 LEU A 12  ? LEU A 12   . ? 1_555 ? 
4  AC1 15 TRP A 45  ? TRP A 45   . ? 1_555 ? 
5  AC1 15 ASN A 58  ? ASN A 58   . ? 1_555 ? 
6  AC1 15 LEU A 59  ? LEU A 59   . ? 1_555 ? 
7  AC1 15 PRO A 60  ? PRO A 60   . ? 1_555 ? 
8  AC1 15 GLN A 71  ? GLN A 71   . ? 1_555 ? 
9  AC1 15 SER A 72  ? SER A 72   . ? 1_555 ? 
10 AC1 15 ARG A 107 ? ARG A 107  . ? 1_555 ? 
11 AC1 15 TYR A 115 ? TYR A 115  . ? 1_555 ? 
12 AC1 15 GLN A 165 ? GLN A 165  . ? 1_555 ? 
13 AC1 15 PHE A 208 ? PHE A 208  . ? 1_555 ? 
14 AC1 15 TRP A 209 ? TRP A 209  . ? 1_555 ? 
15 AC1 15 ASP B 105 ? ASP B 105  . ? 1_555 ? 
16 AC2 15 ASP A 105 ? ASP A 105  . ? 1_555 ? 
17 AC2 15 TYR B 6   ? TYR B 6    . ? 1_555 ? 
18 AC2 15 TRP B 7   ? TRP B 7    . ? 1_555 ? 
19 AC2 15 TRP B 45  ? TRP B 45   . ? 1_555 ? 
20 AC2 15 LYS B 49  ? LYS B 49   . ? 1_555 ? 
21 AC2 15 ASN B 58  ? ASN B 58   . ? 1_555 ? 
22 AC2 15 LEU B 59  ? LEU B 59   . ? 1_555 ? 
23 AC2 15 GLN B 71  ? GLN B 71   . ? 1_555 ? 
24 AC2 15 SER B 72  ? SER B 72   . ? 1_555 ? 
25 AC2 15 ARG B 107 ? ARG B 107  . ? 1_555 ? 
26 AC2 15 ALA B 111 ? ALA B 111  . ? 1_555 ? 
27 AC2 15 TYR B 115 ? TYR B 115  . ? 1_555 ? 
28 AC2 15 GLN B 165 ? GLN B 165  . ? 1_555 ? 
29 AC2 15 PHE B 208 ? PHE B 208  . ? 1_555 ? 
30 AC2 15 TRP B 209 ? TRP B 209  . ? 1_555 ? 
31 AC3 15 TYR C 6   ? TYR C 6    . ? 1_555 ? 
32 AC3 15 TRP C 7   ? TRP C 7    . ? 1_555 ? 
33 AC3 15 PRO C 42  ? PRO C 42   . ? 1_555 ? 
34 AC3 15 TRP C 45  ? TRP C 45   . ? 1_555 ? 
35 AC3 15 LYS C 49  ? LYS C 49   . ? 1_555 ? 
36 AC3 15 ASN C 58  ? ASN C 58   . ? 1_555 ? 
37 AC3 15 LEU C 59  ? LEU C 59   . ? 1_555 ? 
38 AC3 15 PRO C 60  ? PRO C 60   . ? 1_555 ? 
39 AC3 15 GLN C 71  ? GLN C 71   . ? 1_555 ? 
40 AC3 15 SER C 72  ? SER C 72   . ? 1_555 ? 
41 AC3 15 TYR C 115 ? TYR C 115  . ? 1_555 ? 
42 AC3 15 TRP C 209 ? TRP C 209  . ? 1_555 ? 
43 AC3 15 HOH K .   ? HOH C 2157 . ? 1_555 ? 
44 AC3 15 HOH K .   ? HOH C 2158 . ? 1_555 ? 
45 AC3 15 ASP D 105 ? ASP D 105  . ? 1_555 ? 
46 AC4 12 ASP C 105 ? ASP C 105  . ? 1_555 ? 
47 AC4 12 TYR D 6   ? TYR D 6    . ? 1_555 ? 
48 AC4 12 TRP D 7   ? TRP D 7    . ? 1_555 ? 
49 AC4 12 LEU D 12  ? LEU D 12   . ? 1_555 ? 
50 AC4 12 PRO D 42  ? PRO D 42   . ? 1_555 ? 
51 AC4 12 TRP D 45  ? TRP D 45   . ? 1_555 ? 
52 AC4 12 ASN D 58  ? ASN D 58   . ? 1_555 ? 
53 AC4 12 LEU D 59  ? LEU D 59   . ? 1_555 ? 
54 AC4 12 PRO D 60  ? PRO D 60   . ? 1_555 ? 
55 AC4 12 GLN D 71  ? GLN D 71   . ? 1_555 ? 
56 AC4 12 SER D 72  ? SER D 72   . ? 1_555 ? 
57 AC4 12 TYR D 115 ? TYR D 115  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1C72 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1C72 
_atom_sites.fract_transf_matrix[1][1]   0.007962 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007318 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007953 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 1   ? 32.019  35.248  65.519 1.00 39.85 ? 1    VAL A N   1 
ATOM   2    C CA  . VAL A 1 1   ? 33.003  36.005  66.365 1.00 45.09 ? 1    VAL A CA  1 
ATOM   3    C C   . VAL A 1 1   ? 34.218  35.161  66.764 1.00 44.93 ? 1    VAL A C   1 
ATOM   4    O O   . VAL A 1 1   ? 34.070  34.077  67.337 1.00 51.57 ? 1    VAL A O   1 
ATOM   5    C CB  . VAL A 1 1   ? 32.356  36.535  67.671 1.00 42.86 ? 1    VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 1   ? 33.362  37.391  68.447 1.00 34.20 ? 1    VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 1   ? 31.100  37.340  67.352 1.00 45.59 ? 1    VAL A CG2 1 
ATOM   8    N N   . VAL A 1 2   ? 35.414  35.710  66.543 1.00 40.53 ? 2    VAL A N   1 
ATOM   9    C CA  . VAL A 1 2   ? 36.655  35.008  66.847 1.00 31.49 ? 2    VAL A CA  1 
ATOM   10   C C   . VAL A 1 2   ? 37.431  35.690  67.961 1.00 30.31 ? 2    VAL A C   1 
ATOM   11   O O   . VAL A 1 2   ? 37.271  36.883  68.208 1.00 35.27 ? 2    VAL A O   1 
ATOM   12   C CB  . VAL A 1 2   ? 37.577  34.874  65.600 1.00 28.55 ? 2    VAL A CB  1 
ATOM   13   C CG1 . VAL A 1 2   ? 36.750  34.627  64.365 1.00 30.25 ? 2    VAL A CG1 1 
ATOM   14   C CG2 . VAL A 1 2   ? 38.439  36.110  65.416 1.00 29.93 ? 2    VAL A CG2 1 
ATOM   15   N N   . THR A 1 3   ? 38.348  34.940  68.559 1.00 32.02 ? 3    THR A N   1 
ATOM   16   C CA  . THR A 1 3   ? 39.089  35.398  69.725 1.00 29.94 ? 3    THR A CA  1 
ATOM   17   C C   . THR A 1 3   ? 40.585  35.316  69.442 1.00 30.91 ? 3    THR A C   1 
ATOM   18   O O   . THR A 1 3   ? 41.092  34.273  69.025 1.00 31.39 ? 3    THR A O   1 
ATOM   19   C CB  . THR A 1 3   ? 38.775  34.524  70.966 1.00 29.19 ? 3    THR A CB  1 
ATOM   20   O OG1 . THR A 1 3   ? 37.358  34.310  71.066 1.00 23.30 ? 3    THR A OG1 1 
ATOM   21   C CG2 . THR A 1 3   ? 39.276  35.199  72.230 1.00 23.86 ? 3    THR A CG2 1 
ATOM   22   N N   . LEU A 1 4   ? 41.278  36.428  69.661 1.00 27.17 ? 4    LEU A N   1 
ATOM   23   C CA  . LEU A 1 4   ? 42.717  36.501  69.461 1.00 19.43 ? 4    LEU A CA  1 
ATOM   24   C C   . LEU A 1 4   ? 43.392  36.625  70.826 1.00 22.96 ? 4    LEU A C   1 
ATOM   25   O O   . LEU A 1 4   ? 43.154  37.587  71.557 1.00 37.13 ? 4    LEU A O   1 
ATOM   26   C CB  . LEU A 1 4   ? 43.045  37.717  68.580 1.00 20.82 ? 4    LEU A CB  1 
ATOM   27   C CG  . LEU A 1 4   ? 44.379  37.870  67.824 1.00 20.70 ? 4    LEU A CG  1 
ATOM   28   C CD1 . LEU A 1 4   ? 45.397  38.562  68.688 1.00 20.44 ? 4    LEU A CD1 1 
ATOM   29   C CD2 . LEU A 1 4   ? 44.895  36.527  67.356 1.00 26.23 ? 4    LEU A CD2 1 
ATOM   30   N N   . GLY A 1 5   ? 44.191  35.633  71.193 1.00 20.69 ? 5    GLY A N   1 
ATOM   31   C CA  . GLY A 1 5   ? 44.905  35.711  72.453 1.00 21.42 ? 5    GLY A CA  1 
ATOM   32   C C   . GLY A 1 5   ? 46.360  36.097  72.286 1.00 27.75 ? 5    GLY A C   1 
ATOM   33   O O   . GLY A 1 5   ? 47.071  35.518  71.470 1.00 29.39 ? 5    GLY A O   1 
ATOM   34   N N   . TYR A 1 6   ? 46.806  37.068  73.074 1.00 24.61 ? 6    TYR A N   1 
ATOM   35   C CA  . TYR A 1 6   ? 48.189  37.535  73.034 1.00 19.57 ? 6    TYR A CA  1 
ATOM   36   C C   . TYR A 1 6   ? 48.413  38.424  74.260 1.00 19.64 ? 6    TYR A C   1 
ATOM   37   O O   . TYR A 1 6   ? 47.464  38.728  74.970 1.00 25.78 ? 6    TYR A O   1 
ATOM   38   C CB  . TYR A 1 6   ? 48.434  38.322  71.735 1.00 17.00 ? 6    TYR A CB  1 
ATOM   39   C CG  . TYR A 1 6   ? 49.890  38.439  71.360 1.00 12.97 ? 6    TYR A CG  1 
ATOM   40   C CD1 . TYR A 1 6   ? 50.674  37.302  71.184 1.00 21.99 ? 6    TYR A CD1 1 
ATOM   41   C CD2 . TYR A 1 6   ? 50.521  39.673  71.352 1.00 9.20  ? 6    TYR A CD2 1 
ATOM   42   C CE1 . TYR A 1 6   ? 52.059  37.394  71.040 1.00 20.87 ? 6    TYR A CE1 1 
ATOM   43   C CE2 . TYR A 1 6   ? 51.899  39.778  71.207 1.00 15.04 ? 6    TYR A CE2 1 
ATOM   44   C CZ  . TYR A 1 6   ? 52.666  38.637  71.067 1.00 16.00 ? 6    TYR A CZ  1 
ATOM   45   O OH  . TYR A 1 6   ? 54.042  38.737  71.079 1.00 16.24 ? 6    TYR A OH  1 
ATOM   46   N N   . TRP A 1 7   ? 49.652  38.811  74.545 1.00 25.36 ? 7    TRP A N   1 
ATOM   47   C CA  . TRP A 1 7   ? 49.875  39.751  75.641 1.00 28.27 ? 7    TRP A CA  1 
ATOM   48   C C   . TRP A 1 7   ? 49.398  41.152  75.262 1.00 35.24 ? 7    TRP A C   1 
ATOM   49   O O   . TRP A 1 7   ? 49.019  41.413  74.110 1.00 33.86 ? 7    TRP A O   1 
ATOM   50   C CB  . TRP A 1 7   ? 51.352  39.835  76.041 1.00 33.88 ? 7    TRP A CB  1 
ATOM   51   C CG  . TRP A 1 7   ? 52.073  38.538  76.152 1.00 39.74 ? 7    TRP A CG  1 
ATOM   52   C CD1 . TRP A 1 7   ? 52.893  38.001  75.216 1.00 41.70 ? 7    TRP A CD1 1 
ATOM   53   C CD2 . TRP A 1 7   ? 52.161  37.679  77.305 1.00 44.26 ? 7    TRP A CD2 1 
ATOM   54   N NE1 . TRP A 1 7   ? 53.502  36.881  75.709 1.00 43.32 ? 7    TRP A NE1 1 
ATOM   55   C CE2 . TRP A 1 7   ? 53.058  36.643  76.980 1.00 44.07 ? 7    TRP A CE2 1 
ATOM   56   C CE3 . TRP A 1 7   ? 51.575  37.690  78.579 1.00 42.63 ? 7    TRP A CE3 1 
ATOM   57   C CZ2 . TRP A 1 7   ? 53.384  35.616  77.877 1.00 39.83 ? 7    TRP A CZ2 1 
ATOM   58   C CZ3 . TRP A 1 7   ? 51.902  36.671  79.475 1.00 39.85 ? 7    TRP A CZ3 1 
ATOM   59   C CH2 . TRP A 1 7   ? 52.799  35.648  79.115 1.00 41.60 ? 7    TRP A CH2 1 
ATOM   60   N N   . ASP A 1 8   ? 49.517  42.074  76.215 1.00 41.08 ? 8    ASP A N   1 
ATOM   61   C CA  . ASP A 1 8   ? 49.203  43.470  75.959 1.00 40.13 ? 8    ASP A CA  1 
ATOM   62   C C   . ASP A 1 8   ? 50.398  44.219  75.385 1.00 40.70 ? 8    ASP A C   1 
ATOM   63   O O   . ASP A 1 8   ? 50.761  45.298  75.865 1.00 43.02 ? 8    ASP A O   1 
ATOM   64   C CB  . ASP A 1 8   ? 48.729  44.158  77.234 1.00 39.67 ? 8    ASP A CB  1 
ATOM   65   C CG  . ASP A 1 8   ? 48.100  45.511  76.958 1.00 47.54 ? 8    ASP A CG  1 
ATOM   66   O OD1 . ASP A 1 8   ? 48.105  45.960  75.790 1.00 51.76 ? 8    ASP A OD1 1 
ATOM   67   O OD2 . ASP A 1 8   ? 47.596  46.130  77.916 1.00 54.37 ? 8    ASP A OD2 1 
ATOM   68   N N   . ILE A 1 9   ? 51.024  43.621  74.374 1.00 38.05 ? 9    ILE A N   1 
ATOM   69   C CA  . ILE A 1 9   ? 52.081  44.271  73.599 1.00 32.88 ? 9    ILE A CA  1 
ATOM   70   C C   . ILE A 1 9   ? 51.742  44.211  72.116 1.00 33.49 ? 9    ILE A C   1 
ATOM   71   O O   . ILE A 1 9   ? 50.787  43.548  71.715 1.00 33.05 ? 9    ILE A O   1 
ATOM   72   C CB  . ILE A 1 9   ? 53.462  43.584  73.778 1.00 27.80 ? 9    ILE A CB  1 
ATOM   73   C CG1 . ILE A 1 9   ? 53.371  42.105  73.402 1.00 25.27 ? 9    ILE A CG1 1 
ATOM   74   C CG2 . ILE A 1 9   ? 53.971  43.771  75.196 1.00 32.03 ? 9    ILE A CG2 1 
ATOM   75   C CD1 . ILE A 1 9   ? 54.686  41.495  72.989 1.00 23.62 ? 9    ILE A CD1 1 
ATOM   76   N N   . ARG A 1 10  ? 52.566  44.867  71.308 1.00 29.54 ? 10   ARG A N   1 
ATOM   77   C CA  . ARG A 1 10  ? 52.480  44.806  69.854 1.00 28.47 ? 10   ARG A CA  1 
ATOM   78   C C   . ARG A 1 10  ? 53.001  43.451  69.364 1.00 29.53 ? 10   ARG A C   1 
ATOM   79   O O   . ARG A 1 10  ? 52.227  42.612  68.905 1.00 32.76 ? 10   ARG A O   1 
ATOM   80   C CB  . ARG A 1 10  ? 53.318  45.942  69.265 1.00 31.68 ? 10   ARG A CB  1 
ATOM   81   C CG  . ARG A 1 10  ? 53.093  46.295  67.808 1.00 22.73 ? 10   ARG A CG  1 
ATOM   82   C CD  . ARG A 1 10  ? 53.563  47.737  67.612 1.00 29.72 ? 10   ARG A CD  1 
ATOM   83   N NE  . ARG A 1 10  ? 53.910  48.118  66.241 1.00 32.71 ? 10   ARG A NE  1 
ATOM   84   C CZ  . ARG A 1 10  ? 54.956  47.651  65.559 1.00 31.59 ? 10   ARG A CZ  1 
ATOM   85   N NH1 . ARG A 1 10  ? 55.582  46.541  65.940 1.00 34.76 ? 10   ARG A NH1 1 
ATOM   86   N NH2 . ARG A 1 10  ? 55.281  48.216  64.408 1.00 29.68 ? 10   ARG A NH2 1 
ATOM   87   N N   . GLY A 1 11  ? 54.312  43.246  69.477 1.00 30.48 ? 11   GLY A N   1 
ATOM   88   C CA  . GLY A 1 11  ? 54.913  41.950  69.194 1.00 29.77 ? 11   GLY A CA  1 
ATOM   89   C C   . GLY A 1 11  ? 54.488  41.291  67.897 1.00 21.50 ? 11   GLY A C   1 
ATOM   90   O O   . GLY A 1 11  ? 54.329  41.962  66.875 1.00 20.33 ? 11   GLY A O   1 
ATOM   91   N N   . LEU A 1 12  ? 54.201  39.995  67.985 1.00 24.10 ? 12   LEU A N   1 
ATOM   92   C CA  . LEU A 1 12  ? 53.883  39.163  66.826 1.00 28.56 ? 12   LEU A CA  1 
ATOM   93   C C   . LEU A 1 12  ? 52.442  39.285  66.343 1.00 29.53 ? 12   LEU A C   1 
ATOM   94   O O   . LEU A 1 12  ? 52.111  38.807  65.251 1.00 35.95 ? 12   LEU A O   1 
ATOM   95   C CB  . LEU A 1 12  ? 54.147  37.697  67.147 1.00 25.11 ? 12   LEU A CB  1 
ATOM   96   C CG  . LEU A 1 12  ? 55.560  37.331  67.566 1.00 28.89 ? 12   LEU A CG  1 
ATOM   97   C CD1 . LEU A 1 12  ? 55.515  35.995  68.253 1.00 27.88 ? 12   LEU A CD1 1 
ATOM   98   C CD2 . LEU A 1 12  ? 56.481  37.296  66.353 1.00 32.14 ? 12   LEU A CD2 1 
ATOM   99   N N   . ALA A 1 13  ? 51.569  39.814  67.199 1.00 26.09 ? 13   ALA A N   1 
ATOM   100  C CA  . ALA A 1 13  ? 50.144  39.877  66.898 1.00 20.10 ? 13   ALA A CA  1 
ATOM   101  C C   . ALA A 1 13  ? 49.747  41.111  66.091 1.00 22.89 ? 13   ALA A C   1 
ATOM   102  O O   . ALA A 1 13  ? 48.581  41.260  65.725 1.00 22.93 ? 13   ALA A O   1 
ATOM   103  C CB  . ALA A 1 13  ? 49.353  39.823  68.182 1.00 24.53 ? 13   ALA A CB  1 
ATOM   104  N N   . HIS A 1 14  ? 50.718  41.970  65.785 1.00 21.78 ? 14   HIS A N   1 
ATOM   105  C CA  . HIS A 1 14  ? 50.433  43.222  65.099 1.00 23.42 ? 14   HIS A CA  1 
ATOM   106  C C   . HIS A 1 14  ? 49.889  42.987  63.707 1.00 27.10 ? 14   HIS A C   1 
ATOM   107  O O   . HIS A 1 14  ? 48.869  43.557  63.327 1.00 34.40 ? 14   HIS A O   1 
ATOM   108  C CB  . HIS A 1 14  ? 51.676  44.085  64.994 1.00 19.31 ? 14   HIS A CB  1 
ATOM   109  C CG  . HIS A 1 14  ? 51.375  45.527  64.745 1.00 23.49 ? 14   HIS A CG  1 
ATOM   110  N ND1 . HIS A 1 14  ? 50.498  46.246  65.530 1.00 19.13 ? 14   HIS A ND1 1 
ATOM   111  C CD2 . HIS A 1 14  ? 51.876  46.401  63.840 1.00 19.63 ? 14   HIS A CD2 1 
ATOM   112  C CE1 . HIS A 1 14  ? 50.485  47.504  65.129 1.00 19.13 ? 14   HIS A CE1 1 
ATOM   113  N NE2 . HIS A 1 14  ? 51.313  47.626  64.106 1.00 19.51 ? 14   HIS A NE2 1 
ATOM   114  N N   . ALA A 1 15  ? 50.574  42.135  62.955 1.00 22.75 ? 15   ALA A N   1 
ATOM   115  C CA  . ALA A 1 15  ? 50.161  41.783  61.604 1.00 21.29 ? 15   ALA A CA  1 
ATOM   116  C C   . ALA A 1 15  ? 48.784  41.111  61.577 1.00 21.74 ? 15   ALA A C   1 
ATOM   117  O O   . ALA A 1 15  ? 47.990  41.327  60.660 1.00 19.16 ? 15   ALA A O   1 
ATOM   118  C CB  . ALA A 1 15  ? 51.206  40.865  60.979 1.00 25.06 ? 15   ALA A CB  1 
ATOM   119  N N   . ILE A 1 16  ? 48.517  40.271  62.571 1.00 20.48 ? 16   ILE A N   1 
ATOM   120  C CA  . ILE A 1 16  ? 47.246  39.566  62.652 1.00 13.91 ? 16   ILE A CA  1 
ATOM   121  C C   . ILE A 1 16  ? 46.090  40.526  62.949 1.00 17.55 ? 16   ILE A C   1 
ATOM   122  O O   . ILE A 1 16  ? 45.022  40.398  62.355 1.00 19.92 ? 16   ILE A O   1 
ATOM   123  C CB  . ILE A 1 16  ? 47.288  38.467  63.735 1.00 11.64 ? 16   ILE A CB  1 
ATOM   124  C CG1 . ILE A 1 16  ? 48.448  37.514  63.466 1.00 10.34 ? 16   ILE A CG1 1 
ATOM   125  C CG2 . ILE A 1 16  ? 45.987  37.673  63.736 1.00 13.92 ? 16   ILE A CG2 1 
ATOM   126  C CD1 . ILE A 1 16  ? 48.718  36.569  64.607 1.00 10.24 ? 16   ILE A CD1 1 
ATOM   127  N N   . ARG A 1 17  ? 46.325  41.504  63.830 1.00 15.67 ? 17   ARG A N   1 
ATOM   128  C CA  . ARG A 1 17  ? 45.338  42.531  64.169 1.00 12.21 ? 17   ARG A CA  1 
ATOM   129  C C   . ARG A 1 17  ? 44.938  43.341  62.954 1.00 18.04 ? 17   ARG A C   1 
ATOM   130  O O   . ARG A 1 17  ? 43.753  43.459  62.645 1.00 23.57 ? 17   ARG A O   1 
ATOM   131  C CB  . ARG A 1 17  ? 45.892  43.479  65.221 1.00 12.28 ? 17   ARG A CB  1 
ATOM   132  C CG  . ARG A 1 17  ? 45.914  42.888  66.598 1.00 19.39 ? 17   ARG A CG  1 
ATOM   133  C CD  . ARG A 1 17  ? 46.627  43.797  67.577 1.00 23.71 ? 17   ARG A CD  1 
ATOM   134  N NE  . ARG A 1 17  ? 46.679  43.184  68.898 1.00 18.42 ? 17   ARG A NE  1 
ATOM   135  C CZ  . ARG A 1 17  ? 47.799  42.975  69.577 1.00 25.59 ? 17   ARG A CZ  1 
ATOM   136  N NH1 . ARG A 1 17  ? 48.946  43.465  69.125 1.00 25.69 ? 17   ARG A NH1 1 
ATOM   137  N NH2 . ARG A 1 17  ? 47.762  42.323  70.734 1.00 24.59 ? 17   ARG A NH2 1 
ATOM   138  N N   . LEU A 1 18  ? 45.934  43.881  62.256 1.00 19.80 ? 18   LEU A N   1 
ATOM   139  C CA  . LEU A 1 18  ? 45.717  44.643  61.024 1.00 19.97 ? 18   LEU A CA  1 
ATOM   140  C C   . LEU A 1 18  ? 44.924  43.833  60.007 1.00 24.41 ? 18   LEU A C   1 
ATOM   141  O O   . LEU A 1 18  ? 44.144  44.387  59.239 1.00 23.07 ? 18   LEU A O   1 
ATOM   142  C CB  . LEU A 1 18  ? 47.056  45.027  60.390 1.00 20.54 ? 18   LEU A CB  1 
ATOM   143  C CG  . LEU A 1 18  ? 48.020  45.994  61.076 1.00 23.26 ? 18   LEU A CG  1 
ATOM   144  C CD1 . LEU A 1 18  ? 49.410  45.814  60.482 1.00 22.44 ? 18   LEU A CD1 1 
ATOM   145  C CD2 . LEU A 1 18  ? 47.542  47.424  60.891 1.00 25.19 ? 18   LEU A CD2 1 
ATOM   146  N N   . LEU A 1 19  ? 45.198  42.530  59.955 1.00 29.52 ? 19   LEU A N   1 
ATOM   147  C CA  . LEU A 1 19  ? 44.560  41.636  58.994 1.00 28.25 ? 19   LEU A CA  1 
ATOM   148  C C   . LEU A 1 19  ? 43.094  41.408  59.329 1.00 26.17 ? 19   LEU A C   1 
ATOM   149  O O   . LEU A 1 19  ? 42.241  41.443  58.447 1.00 32.17 ? 19   LEU A O   1 
ATOM   150  C CB  . LEU A 1 19  ? 45.283  40.287  58.949 1.00 26.37 ? 19   LEU A CB  1 
ATOM   151  C CG  . LEU A 1 19  ? 44.760  39.359  57.855 1.00 24.22 ? 19   LEU A CG  1 
ATOM   152  C CD1 . LEU A 1 19  ? 44.946  40.030  56.522 1.00 21.36 ? 19   LEU A CD1 1 
ATOM   153  C CD2 . LEU A 1 19  ? 45.473  38.033  57.884 1.00 24.98 ? 19   LEU A CD2 1 
ATOM   154  N N   . LEU A 1 20  ? 42.814  41.139  60.601 1.00 24.92 ? 20   LEU A N   1 
ATOM   155  C CA  . LEU A 1 20  ? 41.442  40.950  61.058 1.00 18.64 ? 20   LEU A CA  1 
ATOM   156  C C   . LEU A 1 20  ? 40.630  42.199  60.788 1.00 19.87 ? 20   LEU A C   1 
ATOM   157  O O   . LEU A 1 20  ? 39.468  42.114  60.399 1.00 19.95 ? 20   LEU A O   1 
ATOM   158  C CB  . LEU A 1 20  ? 41.400  40.628  62.551 1.00 7.93  ? 20   LEU A CB  1 
ATOM   159  C CG  . LEU A 1 20  ? 41.622  39.164  62.923 1.00 10.76 ? 20   LEU A CG  1 
ATOM   160  C CD1 . LEU A 1 20  ? 41.575  38.985  64.410 1.00 12.27 ? 20   LEU A CD1 1 
ATOM   161  C CD2 . LEU A 1 20  ? 40.571  38.309  62.281 1.00 17.96 ? 20   LEU A CD2 1 
ATOM   162  N N   . GLU A 1 21  ? 41.273  43.356  60.909 1.00 21.74 ? 21   GLU A N   1 
ATOM   163  C CA  . GLU A 1 21  ? 40.608  44.626  60.645 1.00 29.66 ? 21   GLU A CA  1 
ATOM   164  C C   . GLU A 1 21  ? 40.361  44.851  59.158 1.00 28.92 ? 21   GLU A C   1 
ATOM   165  O O   . GLU A 1 21  ? 39.231  45.138  58.765 1.00 33.41 ? 21   GLU A O   1 
ATOM   166  C CB  . GLU A 1 21  ? 41.417  45.783  61.226 1.00 31.16 ? 21   GLU A CB  1 
ATOM   167  C CG  . GLU A 1 21  ? 41.413  45.822  62.747 1.00 37.86 ? 21   GLU A CG  1 
ATOM   168  C CD  . GLU A 1 21  ? 40.123  46.381  63.312 1.00 36.83 ? 21   GLU A CD  1 
ATOM   169  O OE1 . GLU A 1 21  ? 39.742  47.501  62.916 1.00 37.05 ? 21   GLU A OE1 1 
ATOM   170  O OE2 . GLU A 1 21  ? 39.494  45.708  64.158 1.00 37.74 ? 21   GLU A OE2 1 
ATOM   171  N N   . TYR A 1 22  ? 41.383  44.615  58.332 1.00 24.25 ? 22   TYR A N   1 
ATOM   172  C CA  . TYR A 1 22  ? 41.277  44.796  56.880 1.00 19.47 ? 22   TYR A CA  1 
ATOM   173  C C   . TYR A 1 22  ? 40.225  43.868  56.270 1.00 19.59 ? 22   TYR A C   1 
ATOM   174  O O   . TYR A 1 22  ? 39.531  44.239  55.324 1.00 18.81 ? 22   TYR A O   1 
ATOM   175  C CB  . TYR A 1 22  ? 42.642  44.559  56.202 1.00 17.36 ? 22   TYR A CB  1 
ATOM   176  C CG  . TYR A 1 22  ? 42.667  44.796  54.691 1.00 17.49 ? 22   TYR A CG  1 
ATOM   177  C CD1 . TYR A 1 22  ? 42.538  46.081  54.159 1.00 13.76 ? 22   TYR A CD1 1 
ATOM   178  C CD2 . TYR A 1 22  ? 42.705  43.722  53.796 1.00 21.96 ? 22   TYR A CD2 1 
ATOM   179  C CE1 . TYR A 1 22  ? 42.419  46.287  52.773 1.00 19.24 ? 22   TYR A CE1 1 
ATOM   180  C CE2 . TYR A 1 22  ? 42.586  43.918  52.410 1.00 22.43 ? 22   TYR A CE2 1 
ATOM   181  C CZ  . TYR A 1 22  ? 42.434  45.199  51.904 1.00 22.99 ? 22   TYR A CZ  1 
ATOM   182  O OH  . TYR A 1 22  ? 42.237  45.384  50.543 1.00 26.36 ? 22   TYR A OH  1 
ATOM   183  N N   . THR A 1 23  ? 40.092  42.677  56.841 1.00 22.82 ? 23   THR A N   1 
ATOM   184  C CA  . THR A 1 23  ? 39.158  41.680  56.344 1.00 19.83 ? 23   THR A CA  1 
ATOM   185  C C   . THR A 1 23  ? 37.786  41.817  57.002 1.00 26.63 ? 23   THR A C   1 
ATOM   186  O O   . THR A 1 23  ? 36.841  41.106  56.643 1.00 26.88 ? 23   THR A O   1 
ATOM   187  C CB  . THR A 1 23  ? 39.713  40.282  56.589 1.00 17.00 ? 23   THR A CB  1 
ATOM   188  O OG1 . THR A 1 23  ? 39.980  40.105  57.986 1.00 25.07 ? 23   THR A OG1 1 
ATOM   189  C CG2 . THR A 1 23  ? 41.003  40.109  55.829 1.00 19.94 ? 23   THR A CG2 1 
ATOM   190  N N   . GLU A 1 24  ? 37.692  42.753  57.951 1.00 31.09 ? 24   GLU A N   1 
ATOM   191  C CA  . GLU A 1 24  ? 36.463  43.042  58.693 1.00 31.69 ? 24   GLU A CA  1 
ATOM   192  C C   . GLU A 1 24  ? 35.912  41.829  59.429 1.00 30.81 ? 24   GLU A C   1 
ATOM   193  O O   . GLU A 1 24  ? 34.700  41.696  59.607 1.00 34.37 ? 24   GLU A O   1 
ATOM   194  C CB  . GLU A 1 24  ? 35.393  43.606  57.761 1.00 31.18 ? 24   GLU A CB  1 
ATOM   195  C CG  . GLU A 1 24  ? 35.548  45.073  57.463 1.00 36.38 ? 24   GLU A CG  1 
ATOM   196  C CD  . GLU A 1 24  ? 34.655  45.515  56.332 1.00 37.97 ? 24   GLU A CD  1 
ATOM   197  O OE1 . GLU A 1 24  ? 34.838  45.013  55.200 1.00 34.99 ? 24   GLU A OE1 1 
ATOM   198  O OE2 . GLU A 1 24  ? 33.763  46.354  56.585 1.00 38.31 ? 24   GLU A OE2 1 
ATOM   199  N N   . THR A 1 25  ? 36.805  40.920  59.805 1.00 28.71 ? 25   THR A N   1 
ATOM   200  C CA  . THR A 1 25  ? 36.433  39.772  60.617 1.00 25.06 ? 25   THR A CA  1 
ATOM   201  C C   . THR A 1 25  ? 36.070  40.293  62.007 1.00 29.96 ? 25   THR A C   1 
ATOM   202  O O   . THR A 1 25  ? 36.818  41.086  62.585 1.00 29.86 ? 25   THR A O   1 
ATOM   203  C CB  . THR A 1 25  ? 37.602  38.754  60.706 1.00 19.85 ? 25   THR A CB  1 
ATOM   204  O OG1 . THR A 1 25  ? 37.935  38.295  59.392 1.00 22.08 ? 25   THR A OG1 1 
ATOM   205  C CG2 . THR A 1 25  ? 37.214  37.553  61.537 1.00 14.55 ? 25   THR A CG2 1 
ATOM   206  N N   . PRO A 1 26  ? 34.831  40.020  62.460 1.00 31.80 ? 26   PRO A N   1 
ATOM   207  C CA  . PRO A 1 26  ? 34.420  40.273  63.844 1.00 29.37 ? 26   PRO A CA  1 
ATOM   208  C C   . PRO A 1 26  ? 35.211  39.461  64.856 1.00 28.45 ? 26   PRO A C   1 
ATOM   209  O O   . PRO A 1 26  ? 35.201  38.231  64.828 1.00 28.78 ? 26   PRO A O   1 
ATOM   210  C CB  . PRO A 1 26  ? 32.937  39.905  63.852 1.00 36.15 ? 26   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 26  ? 32.746  39.038  62.642 1.00 40.01 ? 26   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 26  ? 33.693  39.592  61.632 1.00 34.58 ? 26   PRO A CD  1 
ATOM   213  N N   . TYR A 1 27  ? 35.910  40.165  65.738 1.00 26.86 ? 27   TYR A N   1 
ATOM   214  C CA  . TYR A 1 27  ? 36.775  39.523  66.715 1.00 24.51 ? 27   TYR A CA  1 
ATOM   215  C C   . TYR A 1 27  ? 36.835  40.321  68.012 1.00 29.79 ? 27   TYR A C   1 
ATOM   216  O O   . TYR A 1 27  ? 36.599  41.534  68.034 1.00 36.51 ? 27   TYR A O   1 
ATOM   217  C CB  . TYR A 1 27  ? 38.193  39.363  66.150 1.00 27.64 ? 27   TYR A CB  1 
ATOM   218  C CG  . TYR A 1 27  ? 39.003  40.648  66.135 1.00 27.93 ? 27   TYR A CG  1 
ATOM   219  C CD1 . TYR A 1 27  ? 38.845  41.583  65.111 1.00 25.51 ? 27   TYR A CD1 1 
ATOM   220  C CD2 . TYR A 1 27  ? 39.895  40.947  67.170 1.00 30.98 ? 27   TYR A CD2 1 
ATOM   221  C CE1 . TYR A 1 27  ? 39.553  42.780  65.112 1.00 25.52 ? 27   TYR A CE1 1 
ATOM   222  C CE2 . TYR A 1 27  ? 40.610  42.145  67.184 1.00 31.55 ? 27   TYR A CE2 1 
ATOM   223  C CZ  . TYR A 1 27  ? 40.441  43.056  66.146 1.00 29.68 ? 27   TYR A CZ  1 
ATOM   224  O OH  . TYR A 1 27  ? 41.218  44.200  66.098 1.00 34.78 ? 27   TYR A OH  1 
ATOM   225  N N   . GLN A 1 28  ? 37.222  39.637  69.082 1.00 32.90 ? 28   GLN A N   1 
ATOM   226  C CA  . GLN A 1 28  ? 37.619  40.303  70.307 1.00 37.58 ? 28   GLN A CA  1 
ATOM   227  C C   . GLN A 1 28  ? 38.994  39.811  70.721 1.00 36.42 ? 28   GLN A C   1 
ATOM   228  O O   . GLN A 1 28  ? 39.577  38.951  70.069 1.00 33.38 ? 28   GLN A O   1 
ATOM   229  C CB  . GLN A 1 28  ? 36.598  40.050  71.417 1.00 42.51 ? 28   GLN A CB  1 
ATOM   230  C CG  . GLN A 1 28  ? 36.272  38.594  71.675 1.00 44.12 ? 28   GLN A CG  1 
ATOM   231  C CD  . GLN A 1 28  ? 35.053  38.435  72.565 1.00 50.31 ? 28   GLN A CD  1 
ATOM   232  O OE1 . GLN A 1 28  ? 33.945  38.233  72.077 1.00 52.64 ? 28   GLN A OE1 1 
ATOM   233  N NE2 . GLN A 1 28  ? 35.245  38.572  73.872 1.00 53.11 ? 28   GLN A NE2 1 
ATOM   234  N N   . GLU A 1 29  ? 39.503  40.354  71.818 1.00 38.08 ? 29   GLU A N   1 
ATOM   235  C CA  . GLU A 1 29  ? 40.869  40.089  72.230 1.00 34.06 ? 29   GLU A CA  1 
ATOM   236  C C   . GLU A 1 29  ? 41.005  39.668  73.690 1.00 38.81 ? 29   GLU A C   1 
ATOM   237  O O   . GLU A 1 29  ? 40.563  40.380  74.592 1.00 45.36 ? 29   GLU A O   1 
ATOM   238  C CB  . GLU A 1 29  ? 41.711  41.326  71.996 1.00 32.32 ? 29   GLU A CB  1 
ATOM   239  C CG  . GLU A 1 29  ? 42.270  41.420  70.618 1.00 30.61 ? 29   GLU A CG  1 
ATOM   240  C CD  . GLU A 1 29  ? 43.536  42.214  70.615 1.00 31.77 ? 29   GLU A CD  1 
ATOM   241  O OE1 . GLU A 1 29  ? 44.570  41.688  71.100 1.00 34.82 ? 29   GLU A OE1 1 
ATOM   242  O OE2 . GLU A 1 29  ? 43.473  43.395  70.218 1.00 29.15 ? 29   GLU A OE2 1 
ATOM   243  N N   . ARG A 1 30  ? 41.651  38.527  73.918 1.00 34.89 ? 30   ARG A N   1 
ATOM   244  C CA  . ARG A 1 30  ? 42.101  38.147  75.255 1.00 35.87 ? 30   ARG A CA  1 
ATOM   245  C C   . ARG A 1 30  ? 43.545  38.613  75.444 1.00 35.90 ? 30   ARG A C   1 
ATOM   246  O O   . ARG A 1 30  ? 44.485  37.893  75.102 1.00 38.64 ? 30   ARG A O   1 
ATOM   247  C CB  . ARG A 1 30  ? 42.026  36.621  75.437 1.00 33.05 ? 30   ARG A CB  1 
ATOM   248  C CG  . ARG A 1 30  ? 40.985  36.124  76.444 1.00 38.58 ? 30   ARG A CG  1 
ATOM   249  C CD  . ARG A 1 30  ? 41.118  36.796  77.817 1.00 45.47 ? 30   ARG A CD  1 
ATOM   250  N NE  . ARG A 1 30  ? 41.737  35.942  78.835 1.00 46.71 ? 30   ARG A NE  1 
ATOM   251  C CZ  . ARG A 1 30  ? 42.455  36.403  79.860 1.00 46.46 ? 30   ARG A CZ  1 
ATOM   252  N NH1 . ARG A 1 30  ? 42.686  37.708  79.985 1.00 42.14 ? 30   ARG A NH1 1 
ATOM   253  N NH2 . ARG A 1 30  ? 42.948  35.559  80.759 1.00 41.47 ? 30   ARG A NH2 1 
ATOM   254  N N   . ARG A 1 31  ? 43.717  39.843  75.920 1.00 33.77 ? 31   ARG A N   1 
ATOM   255  C CA  . ARG A 1 31  ? 45.051  40.379  76.148 1.00 33.09 ? 31   ARG A CA  1 
ATOM   256  C C   . ARG A 1 31  ? 45.551  40.013  77.540 1.00 31.54 ? 31   ARG A C   1 
ATOM   257  O O   . ARG A 1 31  ? 44.816  40.117  78.522 1.00 33.41 ? 31   ARG A O   1 
ATOM   258  C CB  . ARG A 1 31  ? 45.071  41.896  75.921 1.00 30.05 ? 31   ARG A CB  1 
ATOM   259  C CG  . ARG A 1 31  ? 45.096  42.284  74.435 1.00 36.61 ? 31   ARG A CG  1 
ATOM   260  C CD  . ARG A 1 31  ? 45.561  43.727  74.212 1.00 38.11 ? 31   ARG A CD  1 
ATOM   261  N NE  . ARG A 1 31  ? 45.385  44.165  72.825 1.00 38.06 ? 31   ARG A NE  1 
ATOM   262  C CZ  . ARG A 1 31  ? 45.286  45.438  72.440 1.00 43.68 ? 31   ARG A CZ  1 
ATOM   263  N NH1 . ARG A 1 31  ? 45.356  46.412  73.334 1.00 46.93 ? 31   ARG A NH1 1 
ATOM   264  N NH2 . ARG A 1 31  ? 45.110  45.743  71.160 1.00 46.78 ? 31   ARG A NH2 1 
ATOM   265  N N   . TYR A 1 32  ? 46.754  39.444  77.582 1.00 31.29 ? 32   TYR A N   1 
ATOM   266  C CA  . TYR A 1 32  ? 47.305  38.850  78.792 1.00 28.84 ? 32   TYR A CA  1 
ATOM   267  C C   . TYR A 1 32  ? 48.259  39.814  79.477 1.00 37.24 ? 32   TYR A C   1 
ATOM   268  O O   . TYR A 1 32  ? 48.883  40.648  78.815 1.00 34.38 ? 32   TYR A O   1 
ATOM   269  C CB  . TYR A 1 32  ? 48.017  37.536  78.453 1.00 19.92 ? 32   TYR A CB  1 
ATOM   270  C CG  . TYR A 1 32  ? 47.054  36.399  78.225 1.00 21.97 ? 32   TYR A CG  1 
ATOM   271  C CD1 . TYR A 1 32  ? 46.557  35.669  79.303 1.00 24.75 ? 32   TYR A CD1 1 
ATOM   272  C CD2 . TYR A 1 32  ? 46.502  36.167  76.963 1.00 19.46 ? 32   TYR A CD2 1 
ATOM   273  C CE1 . TYR A 1 32  ? 45.527  34.754  79.136 1.00 28.77 ? 32   TYR A CE1 1 
ATOM   274  C CE2 . TYR A 1 32  ? 45.468  35.254  76.788 1.00 17.93 ? 32   TYR A CE2 1 
ATOM   275  C CZ  . TYR A 1 32  ? 44.982  34.556  77.881 1.00 26.43 ? 32   TYR A CZ  1 
ATOM   276  O OH  . TYR A 1 32  ? 43.901  33.717  77.745 1.00 30.95 ? 32   TYR A OH  1 
ATOM   277  N N   . LYS A 1 33  ? 48.338  39.711  80.804 1.00 42.42 ? 33   LYS A N   1 
ATOM   278  C CA  . LYS A 1 33  ? 49.048  40.691  81.625 1.00 42.16 ? 33   LYS A CA  1 
ATOM   279  C C   . LYS A 1 33  ? 50.153  40.055  82.454 1.00 39.93 ? 33   LYS A C   1 
ATOM   280  O O   . LYS A 1 33  ? 49.975  38.991  83.053 1.00 42.66 ? 33   LYS A O   1 
ATOM   281  C CB  . LYS A 1 33  ? 48.074  41.409  82.563 1.00 42.75 ? 33   LYS A CB  1 
ATOM   282  C CG  . LYS A 1 33  ? 47.304  40.461  83.483 1.00 50.86 ? 33   LYS A CG  1 
ATOM   283  C CD  . LYS A 1 33  ? 45.832  40.853  83.649 1.00 51.81 ? 33   LYS A CD  1 
ATOM   284  C CE  . LYS A 1 33  ? 45.273  41.608  82.437 1.00 50.31 ? 33   LYS A CE  1 
ATOM   285  N NZ  . LYS A 1 33  ? 45.303  40.842  81.162 1.00 45.81 ? 33   LYS A NZ  1 
ATOM   286  N N   . ALA A 1 34  ? 51.292  40.733  82.498 1.00 40.34 ? 34   ALA A N   1 
ATOM   287  C CA  . ALA A 1 34  ? 52.382  40.347  83.378 1.00 46.03 ? 34   ALA A CA  1 
ATOM   288  C C   . ALA A 1 34  ? 52.238  41.032  84.739 1.00 50.29 ? 34   ALA A C   1 
ATOM   289  O O   . ALA A 1 34  ? 51.555  42.055  84.870 1.00 54.66 ? 34   ALA A O   1 
ATOM   290  C CB  . ALA A 1 34  ? 53.721  40.716  82.740 1.00 47.33 ? 34   ALA A CB  1 
ATOM   291  N N   . GLY A 1 35  ? 52.882  40.461  85.751 1.00 46.87 ? 35   GLY A N   1 
ATOM   292  C CA  . GLY A 1 35  ? 52.995  41.142  87.025 1.00 49.21 ? 35   GLY A CA  1 
ATOM   293  C C   . GLY A 1 35  ? 53.920  42.339  86.901 1.00 52.22 ? 35   GLY A C   1 
ATOM   294  O O   . GLY A 1 35  ? 54.504  42.569  85.838 1.00 52.28 ? 35   GLY A O   1 
ATOM   295  N N   . PRO A 1 36  ? 54.021  43.162  87.952 1.00 52.00 ? 36   PRO A N   1 
ATOM   296  C CA  . PRO A 1 36  ? 54.899  44.338  87.962 1.00 53.97 ? 36   PRO A CA  1 
ATOM   297  C C   . PRO A 1 36  ? 56.398  44.004  87.915 1.00 58.18 ? 36   PRO A C   1 
ATOM   298  O O   . PRO A 1 36  ? 56.787  42.835  87.996 1.00 57.47 ? 36   PRO A O   1 
ATOM   299  C CB  . PRO A 1 36  ? 54.508  45.052  89.257 1.00 58.64 ? 36   PRO A CB  1 
ATOM   300  C CG  . PRO A 1 36  ? 53.083  44.601  89.506 1.00 56.02 ? 36   PRO A CG  1 
ATOM   301  C CD  . PRO A 1 36  ? 53.110  43.156  89.109 1.00 54.55 ? 36   PRO A CD  1 
ATOM   302  N N   . ALA A 1 37  ? 57.223  45.038  87.744 1.00 56.96 ? 37   ALA A N   1 
ATOM   303  C CA  . ALA A 1 37  ? 58.678  44.887  87.662 1.00 52.57 ? 37   ALA A CA  1 
ATOM   304  C C   . ALA A 1 37  ? 59.303  44.611  89.035 1.00 56.53 ? 37   ALA A C   1 
ATOM   305  O O   . ALA A 1 37  ? 58.798  45.083  90.060 1.00 54.83 ? 37   ALA A O   1 
ATOM   306  C CB  . ALA A 1 37  ? 59.297  46.145  87.043 1.00 46.14 ? 37   ALA A CB  1 
ATOM   307  N N   . PRO A 1 38  ? 60.450  43.901  89.066 1.00 58.72 ? 38   PRO A N   1 
ATOM   308  C CA  . PRO A 1 38  ? 61.120  43.288  87.909 1.00 57.32 ? 38   PRO A CA  1 
ATOM   309  C C   . PRO A 1 38  ? 60.685  41.852  87.594 1.00 58.53 ? 38   PRO A C   1 
ATOM   310  O O   . PRO A 1 38  ? 61.132  41.263  86.604 1.00 59.60 ? 38   PRO A O   1 
ATOM   311  C CB  . PRO A 1 38  ? 62.595  43.351  88.295 1.00 55.85 ? 38   PRO A CB  1 
ATOM   312  C CG  . PRO A 1 38  ? 62.572  43.181  89.784 1.00 56.85 ? 38   PRO A CG  1 
ATOM   313  C CD  . PRO A 1 38  ? 61.323  43.895  90.258 1.00 55.17 ? 38   PRO A CD  1 
ATOM   314  N N   . ASP A 1 39  ? 59.834  41.289  88.447 1.00 59.23 ? 39   ASP A N   1 
ATOM   315  C CA  . ASP A 1 39  ? 59.432  39.891  88.315 1.00 64.06 ? 39   ASP A CA  1 
ATOM   316  C C   . ASP A 1 39  ? 58.684  39.608  87.008 1.00 61.71 ? 39   ASP A C   1 
ATOM   317  O O   . ASP A 1 39  ? 59.033  38.671  86.283 1.00 61.84 ? 39   ASP A O   1 
ATOM   318  C CB  . ASP A 1 39  ? 58.586  39.451  89.529 1.00 64.91 ? 39   ASP A CB  1 
ATOM   319  C CG  . ASP A 1 39  ? 57.541  40.486  89.940 1.00 67.72 ? 39   ASP A CG  1 
ATOM   320  O OD1 . ASP A 1 39  ? 57.914  41.486  90.588 1.00 68.45 ? 39   ASP A OD1 1 
ATOM   321  O OD2 . ASP A 1 39  ? 56.341  40.275  89.655 1.00 71.91 ? 39   ASP A OD2 1 
ATOM   322  N N   . PHE A 1 40  ? 57.755  40.501  86.659 1.00 57.51 ? 40   PHE A N   1 
ATOM   323  C CA  . PHE A 1 40  ? 56.872  40.344  85.499 1.00 59.56 ? 40   PHE A CA  1 
ATOM   324  C C   . PHE A 1 40  ? 56.144  38.998  85.492 1.00 56.95 ? 40   PHE A C   1 
ATOM   325  O O   . PHE A 1 40  ? 56.353  38.166  84.605 1.00 58.41 ? 40   PHE A O   1 
ATOM   326  C CB  . PHE A 1 40  ? 57.654  40.523  84.186 1.00 60.56 ? 40   PHE A CB  1 
ATOM   327  C CG  . PHE A 1 40  ? 58.173  41.924  83.961 1.00 68.04 ? 40   PHE A CG  1 
ATOM   328  C CD1 . PHE A 1 40  ? 57.368  43.033  84.212 1.00 67.74 ? 40   PHE A CD1 1 
ATOM   329  C CD2 . PHE A 1 40  ? 59.474  42.129  83.495 1.00 69.20 ? 40   PHE A CD2 1 
ATOM   330  C CE1 . PHE A 1 40  ? 57.855  44.329  84.003 1.00 70.68 ? 40   PHE A CE1 1 
ATOM   331  C CE2 . PHE A 1 40  ? 59.970  43.416  83.286 1.00 67.03 ? 40   PHE A CE2 1 
ATOM   332  C CZ  . PHE A 1 40  ? 59.160  44.518  83.540 1.00 68.35 ? 40   PHE A CZ  1 
ATOM   333  N N   . ASP A 1 41  ? 55.225  38.832  86.436 1.00 51.25 ? 41   ASP A N   1 
ATOM   334  C CA  . ASP A 1 41  ? 54.580  37.547  86.662 1.00 49.70 ? 41   ASP A CA  1 
ATOM   335  C C   . ASP A 1 41  ? 53.629  37.128  85.535 1.00 49.96 ? 41   ASP A C   1 
ATOM   336  O O   . ASP A 1 41  ? 52.583  37.751  85.315 1.00 51.23 ? 41   ASP A O   1 
ATOM   337  C CB  . ASP A 1 41  ? 53.842  37.567  87.998 1.00 49.66 ? 41   ASP A CB  1 
ATOM   338  C CG  . ASP A 1 41  ? 53.345  36.199  88.403 1.00 54.11 ? 41   ASP A CG  1 
ATOM   339  O OD1 . ASP A 1 41  ? 54.166  35.262  88.531 1.00 50.76 ? 41   ASP A OD1 1 
ATOM   340  O OD2 . ASP A 1 41  ? 52.117  36.059  88.560 1.00 58.51 ? 41   ASP A OD2 1 
ATOM   341  N N   . PRO A 1 42  ? 53.951  36.008  84.862 1.00 46.57 ? 42   PRO A N   1 
ATOM   342  C CA  . PRO A 1 42  ? 53.232  35.512  83.686 1.00 43.29 ? 42   PRO A CA  1 
ATOM   343  C C   . PRO A 1 42  ? 51.956  34.730  84.013 1.00 42.80 ? 42   PRO A C   1 
ATOM   344  O O   . PRO A 1 42  ? 51.352  34.132  83.122 1.00 46.75 ? 42   PRO A O   1 
ATOM   345  C CB  . PRO A 1 42  ? 54.265  34.618  83.013 1.00 44.74 ? 42   PRO A CB  1 
ATOM   346  C CG  . PRO A 1 42  ? 55.001  34.027  84.169 1.00 42.65 ? 42   PRO A CG  1 
ATOM   347  C CD  . PRO A 1 42  ? 55.112  35.152  85.177 1.00 46.05 ? 42   PRO A CD  1 
ATOM   348  N N   . SER A 1 43  ? 51.523  34.773  85.271 1.00 39.47 ? 43   SER A N   1 
ATOM   349  C CA  . SER A 1 43  ? 50.508  33.843  85.753 1.00 33.92 ? 43   SER A CA  1 
ATOM   350  C C   . SER A 1 43  ? 49.158  33.941  85.060 1.00 32.26 ? 43   SER A C   1 
ATOM   351  O O   . SER A 1 43  ? 48.462  32.937  84.937 1.00 29.38 ? 43   SER A O   1 
ATOM   352  C CB  . SER A 1 43  ? 50.321  33.977  87.260 1.00 34.45 ? 43   SER A CB  1 
ATOM   353  O OG  . SER A 1 43  ? 51.415  33.397  87.950 1.00 39.38 ? 43   SER A OG  1 
ATOM   354  N N   . ASP A 1 44  ? 48.798  35.126  84.576 1.00 32.58 ? 44   ASP A N   1 
ATOM   355  C CA  . ASP A 1 44  ? 47.521  35.282  83.875 1.00 30.83 ? 44   ASP A CA  1 
ATOM   356  C C   . ASP A 1 44  ? 47.404  34.316  82.683 1.00 35.92 ? 44   ASP A C   1 
ATOM   357  O O   . ASP A 1 44  ? 46.332  33.761  82.423 1.00 37.35 ? 44   ASP A O   1 
ATOM   358  C CB  . ASP A 1 44  ? 47.330  36.727  83.398 1.00 22.27 ? 44   ASP A CB  1 
ATOM   359  C CG  . ASP A 1 44  ? 45.964  36.961  82.758 1.00 23.10 ? 44   ASP A CG  1 
ATOM   360  O OD1 . ASP A 1 44  ? 45.018  36.189  83.034 1.00 25.67 ? 44   ASP A OD1 1 
ATOM   361  O OD2 . ASP A 1 44  ? 45.835  37.912  81.965 1.00 23.26 ? 44   ASP A OD2 1 
ATOM   362  N N   . TRP A 1 45  ? 48.533  34.074  82.016 1.00 37.38 ? 45   TRP A N   1 
ATOM   363  C CA  . TRP A 1 45  ? 48.608  33.168  80.875 1.00 28.85 ? 45   TRP A CA  1 
ATOM   364  C C   . TRP A 1 45  ? 48.844  31.725  81.323 1.00 29.30 ? 45   TRP A C   1 
ATOM   365  O O   . TRP A 1 45  ? 48.078  30.836  80.975 1.00 33.27 ? 45   TRP A O   1 
ATOM   366  C CB  . TRP A 1 45  ? 49.724  33.648  79.932 1.00 32.89 ? 45   TRP A CB  1 
ATOM   367  C CG  . TRP A 1 45  ? 50.185  32.660  78.886 1.00 32.44 ? 45   TRP A CG  1 
ATOM   368  C CD1 . TRP A 1 45  ? 51.450  32.177  78.729 1.00 30.09 ? 45   TRP A CD1 1 
ATOM   369  C CD2 . TRP A 1 45  ? 49.371  31.967  77.926 1.00 30.52 ? 45   TRP A CD2 1 
ATOM   370  N NE1 . TRP A 1 45  ? 51.469  31.203  77.767 1.00 23.94 ? 45   TRP A NE1 1 
ATOM   371  C CE2 . TRP A 1 45  ? 50.208  31.057  77.250 1.00 24.44 ? 45   TRP A CE2 1 
ATOM   372  C CE3 . TRP A 1 45  ? 48.013  32.014  77.583 1.00 30.17 ? 45   TRP A CE3 1 
ATOM   373  C CZ2 . TRP A 1 45  ? 49.737  30.202  76.254 1.00 26.67 ? 45   TRP A CZ2 1 
ATOM   374  C CZ3 . TRP A 1 45  ? 47.546  31.159  76.593 1.00 28.19 ? 45   TRP A CZ3 1 
ATOM   375  C CH2 . TRP A 1 45  ? 48.409  30.266  75.941 1.00 26.46 ? 45   TRP A CH2 1 
ATOM   376  N N   . THR A 1 46  ? 49.842  31.519  82.174 1.00 27.14 ? 46   THR A N   1 
ATOM   377  C CA  . THR A 1 46  ? 50.261  30.184  82.580 1.00 32.58 ? 46   THR A CA  1 
ATOM   378  C C   . THR A 1 46  ? 49.160  29.365  83.255 1.00 37.34 ? 46   THR A C   1 
ATOM   379  O O   . THR A 1 46  ? 49.146  28.133  83.141 1.00 36.71 ? 46   THR A O   1 
ATOM   380  C CB  . THR A 1 46  ? 51.460  30.268  83.533 1.00 35.55 ? 46   THR A CB  1 
ATOM   381  O OG1 . THR A 1 46  ? 52.455  31.124  82.961 1.00 41.53 ? 46   THR A OG1 1 
ATOM   382  C CG2 . THR A 1 46  ? 52.062  28.887  83.775 1.00 38.64 ? 46   THR A CG2 1 
ATOM   383  N N   . ASN A 1 47  ? 48.239  30.046  83.942 1.00 40.53 ? 47   ASN A N   1 
ATOM   384  C CA  . ASN A 1 47  ? 47.128  29.386  84.650 1.00 49.41 ? 47   ASN A CA  1 
ATOM   385  C C   . ASN A 1 47  ? 46.047  28.903  83.674 1.00 49.05 ? 47   ASN A C   1 
ATOM   386  O O   . ASN A 1 47  ? 45.080  28.250  84.070 1.00 49.08 ? 47   ASN A O   1 
ATOM   387  C CB  . ASN A 1 47  ? 46.472  30.347  85.661 1.00 49.11 ? 47   ASN A CB  1 
ATOM   388  C CG  . ASN A 1 47  ? 47.416  30.786  86.776 1.00 53.97 ? 47   ASN A CG  1 
ATOM   389  O OD1 . ASN A 1 47  ? 48.350  30.069  87.144 1.00 53.60 ? 47   ASN A OD1 1 
ATOM   390  N ND2 . ASN A 1 47  ? 47.155  31.970  87.335 1.00 55.40 ? 47   ASN A ND2 1 
ATOM   391  N N   . GLU A 1 48  ? 46.250  29.191  82.393 1.00 46.04 ? 48   GLU A N   1 
ATOM   392  C CA  . GLU A 1 48  ? 45.209  29.044  81.389 1.00 44.32 ? 48   GLU A CA  1 
ATOM   393  C C   . GLU A 1 48  ? 45.753  28.293  80.177 1.00 39.18 ? 48   GLU A C   1 
ATOM   394  O O   . GLU A 1 48  ? 44.982  27.714  79.407 1.00 31.63 ? 48   GLU A O   1 
ATOM   395  C CB  . GLU A 1 48  ? 44.724  30.431  80.969 1.00 42.88 ? 48   GLU A CB  1 
ATOM   396  C CG  . GLU A 1 48  ? 43.315  30.470  80.417 1.00 43.10 ? 48   GLU A CG  1 
ATOM   397  C CD  . GLU A 1 48  ? 42.755  31.878  80.340 1.00 47.55 ? 48   GLU A CD  1 
ATOM   398  O OE1 . GLU A 1 48  ? 43.504  32.847  80.588 1.00 50.75 ? 48   GLU A OE1 1 
ATOM   399  O OE2 . GLU A 1 48  ? 41.547  32.014  80.054 1.00 48.40 ? 48   GLU A OE2 1 
ATOM   400  N N   . LYS A 1 49  ? 47.083  28.227  80.087 1.00 34.60 ? 49   LYS A N   1 
ATOM   401  C CA  . LYS A 1 49  ? 47.805  27.674  78.934 1.00 33.98 ? 49   LYS A CA  1 
ATOM   402  C C   . LYS A 1 49  ? 47.251  26.328  78.443 1.00 38.83 ? 49   LYS A C   1 
ATOM   403  O O   . LYS A 1 49  ? 47.119  26.105  77.232 1.00 29.20 ? 49   LYS A O   1 
ATOM   404  C CB  . LYS A 1 49  ? 49.300  27.536  79.285 1.00 39.35 ? 49   LYS A CB  1 
ATOM   405  C CG  . LYS A 1 49  ? 50.252  27.367  78.097 1.00 34.00 ? 49   LYS A CG  1 
ATOM   406  C CD  . LYS A 1 49  ? 51.712  27.344  78.534 1.00 33.06 ? 49   LYS A CD  1 
ATOM   407  C CE  . LYS A 1 49  ? 52.644  26.999  77.365 1.00 44.31 ? 49   LYS A CE  1 
ATOM   408  N NZ  . LYS A 1 49  ? 52.684  25.529  77.017 1.00 39.85 ? 49   LYS A NZ  1 
ATOM   409  N N   . GLU A 1 50  ? 46.798  25.503  79.387 1.00 44.11 ? 50   GLU A N   1 
ATOM   410  C CA  . GLU A 1 50  ? 46.423  24.115  79.105 1.00 46.77 ? 50   GLU A CA  1 
ATOM   411  C C   . GLU A 1 50  ? 44.909  23.885  78.944 1.00 43.16 ? 50   GLU A C   1 
ATOM   412  O O   . GLU A 1 50  ? 44.475  22.922  78.295 1.00 37.06 ? 50   GLU A O   1 
ATOM   413  C CB  . GLU A 1 50  ? 46.964  23.199  80.213 1.00 48.90 ? 50   GLU A CB  1 
ATOM   414  C CG  . GLU A 1 50  ? 48.483  23.283  80.442 1.00 51.33 ? 50   GLU A CG  1 
ATOM   415  C CD  . GLU A 1 50  ? 49.315  22.644  79.328 1.00 52.04 ? 50   GLU A CD  1 
ATOM   416  O OE1 . GLU A 1 50  ? 48.761  21.879  78.501 1.00 52.34 ? 50   GLU A OE1 1 
ATOM   417  O OE2 . GLU A 1 50  ? 50.546  22.883  79.306 1.00 54.79 ? 50   GLU A OE2 1 
ATOM   418  N N   . LYS A 1 51  ? 44.111  24.786  79.506 1.00 43.05 ? 51   LYS A N   1 
ATOM   419  C CA  . LYS A 1 51  ? 42.672  24.576  79.566 1.00 42.53 ? 51   LYS A CA  1 
ATOM   420  C C   . LYS A 1 51  ? 41.943  25.126  78.346 1.00 39.76 ? 51   LYS A C   1 
ATOM   421  O O   . LYS A 1 51  ? 40.711  25.065  78.273 1.00 45.78 ? 51   LYS A O   1 
ATOM   422  C CB  . LYS A 1 51  ? 42.095  25.196  80.847 1.00 44.95 ? 51   LYS A CB  1 
ATOM   423  C CG  . LYS A 1 51  ? 42.453  24.459  82.151 1.00 48.75 ? 51   LYS A CG  1 
ATOM   424  C CD  . LYS A 1 51  ? 41.834  23.050  82.225 1.00 57.37 ? 51   LYS A CD  1 
ATOM   425  C CE  . LYS A 1 51  ? 41.823  22.507  83.665 1.00 59.07 ? 51   LYS A CE  1 
ATOM   426  N NZ  . LYS A 1 51  ? 41.147  21.177  83.817 1.00 55.19 ? 51   LYS A NZ  1 
ATOM   427  N N   . LEU A 1 52  ? 42.696  25.590  77.352 1.00 35.07 ? 52   LEU A N   1 
ATOM   428  C CA  . LEU A 1 52  ? 42.084  26.198  76.175 1.00 26.70 ? 52   LEU A CA  1 
ATOM   429  C C   . LEU A 1 52  ? 41.822  25.214  75.039 1.00 29.04 ? 52   LEU A C   1 
ATOM   430  O O   . LEU A 1 52  ? 41.011  25.489  74.150 1.00 28.91 ? 52   LEU A O   1 
ATOM   431  C CB  . LEU A 1 52  ? 42.929  27.369  75.682 1.00 25.10 ? 52   LEU A CB  1 
ATOM   432  C CG  . LEU A 1 52  ? 42.576  28.682  76.372 1.00 25.79 ? 52   LEU A CG  1 
ATOM   433  C CD1 . LEU A 1 52  ? 43.772  29.214  77.105 1.00 31.39 ? 52   LEU A CD1 1 
ATOM   434  C CD2 . LEU A 1 52  ? 42.107  29.679  75.347 1.00 30.55 ? 52   LEU A CD2 1 
ATOM   435  N N   . GLY A 1 53  ? 42.429  24.031  75.128 1.00 30.89 ? 53   GLY A N   1 
ATOM   436  C CA  . GLY A 1 53  ? 42.204  23.000  74.128 1.00 31.05 ? 53   GLY A CA  1 
ATOM   437  C C   . GLY A 1 53  ? 43.058  23.143  72.872 1.00 34.51 ? 53   GLY A C   1 
ATOM   438  O O   . GLY A 1 53  ? 42.775  22.527  71.830 1.00 31.01 ? 53   GLY A O   1 
ATOM   439  N N   . LEU A 1 54  ? 44.104  23.962  72.966 1.00 30.82 ? 54   LEU A N   1 
ATOM   440  C CA  . LEU A 1 54  ? 45.059  24.125  71.881 1.00 23.52 ? 54   LEU A CA  1 
ATOM   441  C C   . LEU A 1 54  ? 45.965  22.896  71.772 1.00 28.83 ? 54   LEU A C   1 
ATOM   442  O O   . LEU A 1 54  ? 46.338  22.285  72.780 1.00 29.90 ? 54   LEU A O   1 
ATOM   443  C CB  . LEU A 1 54  ? 45.900  25.373  72.123 1.00 21.88 ? 54   LEU A CB  1 
ATOM   444  C CG  . LEU A 1 54  ? 45.178  26.719  72.168 1.00 20.18 ? 54   LEU A CG  1 
ATOM   445  C CD1 . LEU A 1 54  ? 46.107  27.766  72.750 1.00 4.76  ? 54   LEU A CD1 1 
ATOM   446  C CD2 . LEU A 1 54  ? 44.738  27.122  70.765 1.00 23.48 ? 54   LEU A CD2 1 
ATOM   447  N N   . ASP A 1 55  ? 46.293  22.521  70.539 1.00 36.81 ? 55   ASP A N   1 
ATOM   448  C CA  . ASP A 1 55  ? 47.136  21.356  70.296 1.00 35.98 ? 55   ASP A CA  1 
ATOM   449  C C   . ASP A 1 55  ? 48.558  21.595  70.798 1.00 29.84 ? 55   ASP A C   1 
ATOM   450  O O   . ASP A 1 55  ? 49.110  20.767  71.523 1.00 27.06 ? 55   ASP A O   1 
ATOM   451  C CB  . ASP A 1 55  ? 47.147  21.001  68.803 1.00 41.87 ? 55   ASP A CB  1 
ATOM   452  C CG  . ASP A 1 55  ? 45.782  20.562  68.294 1.00 45.47 ? 55   ASP A CG  1 
ATOM   453  O OD1 . ASP A 1 55  ? 45.192  19.622  68.873 1.00 42.53 ? 55   ASP A OD1 1 
ATOM   454  O OD2 . ASP A 1 55  ? 45.284  21.176  67.325 1.00 49.47 ? 55   ASP A OD2 1 
ATOM   455  N N   . PHE A 1 56  ? 49.110  22.760  70.459 1.00 27.60 ? 56   PHE A N   1 
ATOM   456  C CA  . PHE A 1 56  ? 50.440  23.174  70.912 1.00 23.24 ? 56   PHE A CA  1 
ATOM   457  C C   . PHE A 1 56  ? 50.372  24.579  71.517 1.00 27.20 ? 56   PHE A C   1 
ATOM   458  O O   . PHE A 1 56  ? 50.680  25.568  70.846 1.00 33.57 ? 56   PHE A O   1 
ATOM   459  C CB  . PHE A 1 56  ? 51.429  23.190  69.736 1.00 22.10 ? 56   PHE A CB  1 
ATOM   460  C CG  . PHE A 1 56  ? 51.474  21.907  68.961 1.00 20.79 ? 56   PHE A CG  1 
ATOM   461  C CD1 . PHE A 1 56  ? 52.102  20.783  69.486 1.00 16.01 ? 56   PHE A CD1 1 
ATOM   462  C CD2 . PHE A 1 56  ? 50.868  21.814  67.718 1.00 16.55 ? 56   PHE A CD2 1 
ATOM   463  C CE1 . PHE A 1 56  ? 52.122  19.588  68.788 1.00 10.45 ? 56   PHE A CE1 1 
ATOM   464  C CE2 . PHE A 1 56  ? 50.886  20.621  67.012 1.00 19.66 ? 56   PHE A CE2 1 
ATOM   465  C CZ  . PHE A 1 56  ? 51.517  19.504  67.555 1.00 14.15 ? 56   PHE A CZ  1 
ATOM   466  N N   . PRO A 1 57  ? 49.951  24.688  72.786 1.00 25.15 ? 57   PRO A N   1 
ATOM   467  C CA  . PRO A 1 57  ? 49.684  25.985  73.412 1.00 26.78 ? 57   PRO A CA  1 
ATOM   468  C C   . PRO A 1 57  ? 50.832  26.994  73.261 1.00 27.80 ? 57   PRO A C   1 
ATOM   469  O O   . PRO A 1 57  ? 52.003  26.656  73.457 1.00 32.21 ? 57   PRO A O   1 
ATOM   470  C CB  . PRO A 1 57  ? 49.425  25.620  74.876 1.00 22.60 ? 57   PRO A CB  1 
ATOM   471  C CG  . PRO A 1 57  ? 48.867  24.250  74.811 1.00 22.67 ? 57   PRO A CG  1 
ATOM   472  C CD  . PRO A 1 57  ? 49.652  23.576  73.707 1.00 26.12 ? 57   PRO A CD  1 
ATOM   473  N N   . ASN A 1 58  ? 50.477  28.232  72.927 1.00 17.17 ? 58   ASN A N   1 
ATOM   474  C CA  . ASN A 1 58  ? 51.448  29.287  72.661 1.00 20.78 ? 58   ASN A CA  1 
ATOM   475  C C   . ASN A 1 58  ? 50.688  30.601  72.467 1.00 22.51 ? 58   ASN A C   1 
ATOM   476  O O   . ASN A 1 58  ? 49.462  30.611  72.451 1.00 24.01 ? 58   ASN A O   1 
ATOM   477  C CB  . ASN A 1 58  ? 52.247  28.954  71.391 1.00 24.68 ? 58   ASN A CB  1 
ATOM   478  C CG  . ASN A 1 58  ? 53.738  29.191  71.549 1.00 29.67 ? 58   ASN A CG  1 
ATOM   479  O OD1 . ASN A 1 58  ? 54.167  30.267  71.962 1.00 29.14 ? 58   ASN A OD1 1 
ATOM   480  N ND2 . ASN A 1 58  ? 54.541  28.205  71.142 1.00 37.02 ? 58   ASN A ND2 1 
ATOM   481  N N   . LEU A 1 59  ? 51.421  31.693  72.260 1.00 25.69 ? 59   LEU A N   1 
ATOM   482  C CA  . LEU A 1 59  ? 50.832  33.018  72.033 1.00 17.47 ? 59   LEU A CA  1 
ATOM   483  C C   . LEU A 1 59  ? 51.524  33.700  70.839 1.00 20.44 ? 59   LEU A C   1 
ATOM   484  O O   . LEU A 1 59  ? 52.740  33.838  70.825 1.00 24.62 ? 59   LEU A O   1 
ATOM   485  C CB  . LEU A 1 59  ? 50.997  33.871  73.297 1.00 10.12 ? 59   LEU A CB  1 
ATOM   486  C CG  . LEU A 1 59  ? 49.777  34.327  74.120 1.00 19.15 ? 59   LEU A CG  1 
ATOM   487  C CD1 . LEU A 1 59  ? 48.609  33.387  73.962 1.00 10.97 ? 59   LEU A CD1 1 
ATOM   488  C CD2 . LEU A 1 59  ? 50.163  34.441  75.591 1.00 19.05 ? 59   LEU A CD2 1 
ATOM   489  N N   . PRO A 1 60  ? 50.760  34.110  69.811 1.00 21.88 ? 60   PRO A N   1 
ATOM   490  C CA  . PRO A 1 60  ? 49.298  34.245  69.761 1.00 22.67 ? 60   PRO A CA  1 
ATOM   491  C C   . PRO A 1 60  ? 48.535  32.944  69.509 1.00 22.07 ? 60   PRO A C   1 
ATOM   492  O O   . PRO A 1 60  ? 49.088  31.981  68.965 1.00 28.46 ? 60   PRO A O   1 
ATOM   493  C CB  . PRO A 1 60  ? 49.063  35.249  68.625 1.00 22.26 ? 60   PRO A CB  1 
ATOM   494  C CG  . PRO A 1 60  ? 50.452  35.582  68.057 1.00 18.69 ? 60   PRO A CG  1 
ATOM   495  C CD  . PRO A 1 60  ? 51.385  34.543  68.550 1.00 16.91 ? 60   PRO A CD  1 
ATOM   496  N N   . TYR A 1 61  ? 47.285  32.902  69.968 1.00 20.03 ? 61   TYR A N   1 
ATOM   497  C CA  . TYR A 1 61  ? 46.328  31.903  69.488 1.00 23.38 ? 61   TYR A CA  1 
ATOM   498  C C   . TYR A 1 61  ? 45.140  32.557  68.814 1.00 21.54 ? 61   TYR A C   1 
ATOM   499  O O   . TYR A 1 61  ? 44.880  33.746  68.998 1.00 20.51 ? 61   TYR A O   1 
ATOM   500  C CB  . TYR A 1 61  ? 45.830  30.977  70.618 1.00 24.51 ? 61   TYR A CB  1 
ATOM   501  C CG  . TYR A 1 61  ? 45.088  31.648  71.767 1.00 24.29 ? 61   TYR A CG  1 
ATOM   502  C CD1 . TYR A 1 61  ? 43.789  32.136  71.611 1.00 22.09 ? 61   TYR A CD1 1 
ATOM   503  C CD2 . TYR A 1 61  ? 45.678  31.753  73.023 1.00 25.78 ? 61   TYR A CD2 1 
ATOM   504  C CE1 . TYR A 1 61  ? 43.105  32.723  72.675 1.00 23.78 ? 61   TYR A CE1 1 
ATOM   505  C CE2 . TYR A 1 61  ? 45.002  32.323  74.095 1.00 25.07 ? 61   TYR A CE2 1 
ATOM   506  C CZ  . TYR A 1 61  ? 43.719  32.813  73.919 1.00 28.61 ? 61   TYR A CZ  1 
ATOM   507  O OH  . TYR A 1 61  ? 43.080  33.421  74.984 1.00 24.50 ? 61   TYR A OH  1 
ATOM   508  N N   . LEU A 1 62  ? 44.415  31.769  68.036 1.00 20.38 ? 62   LEU A N   1 
ATOM   509  C CA  . LEU A 1 62  ? 43.154  32.228  67.480 1.00 29.02 ? 62   LEU A CA  1 
ATOM   510  C C   . LEU A 1 62  ? 42.087  31.151  67.603 1.00 30.90 ? 62   LEU A C   1 
ATOM   511  O O   . LEU A 1 62  ? 42.341  29.970  67.344 1.00 28.95 ? 62   LEU A O   1 
ATOM   512  C CB  . LEU A 1 62  ? 43.339  32.616  66.021 1.00 22.76 ? 62   LEU A CB  1 
ATOM   513  C CG  . LEU A 1 62  ? 42.175  33.404  65.464 1.00 21.83 ? 62   LEU A CG  1 
ATOM   514  C CD1 . LEU A 1 62  ? 42.674  34.749  64.987 1.00 27.05 ? 62   LEU A CD1 1 
ATOM   515  C CD2 . LEU A 1 62  ? 41.533  32.609  64.346 1.00 29.33 ? 62   LEU A CD2 1 
ATOM   516  N N   . ILE A 1 63  ? 40.916  31.548  68.087 1.00 32.95 ? 63   ILE A N   1 
ATOM   517  C CA  . ILE A 1 63  ? 39.803  30.621  68.183 1.00 31.56 ? 63   ILE A CA  1 
ATOM   518  C C   . ILE A 1 63  ? 38.634  31.094  67.348 1.00 26.14 ? 63   ILE A C   1 
ATOM   519  O O   . ILE A 1 63  ? 38.161  32.210  67.516 1.00 34.36 ? 63   ILE A O   1 
ATOM   520  C CB  . ILE A 1 63  ? 39.348  30.442  69.632 1.00 28.32 ? 63   ILE A CB  1 
ATOM   521  C CG1 . ILE A 1 63  ? 40.528  29.976  70.482 1.00 27.88 ? 63   ILE A CG1 1 
ATOM   522  C CG2 . ILE A 1 63  ? 38.244  29.410  69.696 1.00 28.95 ? 63   ILE A CG2 1 
ATOM   523  C CD1 . ILE A 1 63  ? 40.184  29.691  71.918 1.00 28.85 ? 63   ILE A CD1 1 
ATOM   524  N N   . ASP A 1 64  ? 38.250  30.285  66.372 1.00 21.33 ? 64   ASP A N   1 
ATOM   525  C CA  . ASP A 1 64  ? 37.092  30.592  65.548 1.00 28.99 ? 64   ASP A CA  1 
ATOM   526  C C   . ASP A 1 64  ? 36.178  29.383  65.542 1.00 29.35 ? 64   ASP A C   1 
ATOM   527  O O   . ASP A 1 64  ? 36.171  28.573  64.611 1.00 36.74 ? 64   ASP A O   1 
ATOM   528  C CB  . ASP A 1 64  ? 37.513  30.969  64.122 1.00 29.28 ? 64   ASP A CB  1 
ATOM   529  C CG  . ASP A 1 64  ? 36.333  31.363  63.246 1.00 32.58 ? 64   ASP A CG  1 
ATOM   530  O OD1 . ASP A 1 64  ? 35.250  31.680  63.791 1.00 40.48 ? 64   ASP A OD1 1 
ATOM   531  O OD2 . ASP A 1 64  ? 36.495  31.361  62.006 1.00 32.94 ? 64   ASP A OD2 1 
ATOM   532  N N   . GLY A 1 65  ? 35.441  29.243  66.634 1.00 26.32 ? 65   GLY A N   1 
ATOM   533  C CA  . GLY A 1 65  ? 34.571  28.100  66.787 1.00 32.01 ? 65   GLY A CA  1 
ATOM   534  C C   . GLY A 1 65  ? 35.345  26.895  67.264 1.00 39.59 ? 65   GLY A C   1 
ATOM   535  O O   . GLY A 1 65  ? 35.879  26.895  68.379 1.00 35.73 ? 65   GLY A O   1 
ATOM   536  N N   . ASP A 1 66  ? 35.432  25.882  66.407 1.00 41.89 ? 66   ASP A N   1 
ATOM   537  C CA  . ASP A 1 66  ? 36.147  24.649  66.739 1.00 52.35 ? 66   ASP A CA  1 
ATOM   538  C C   . ASP A 1 66  ? 37.541  24.629  66.136 1.00 46.47 ? 66   ASP A C   1 
ATOM   539  O O   . ASP A 1 66  ? 38.328  23.712  66.395 1.00 46.03 ? 66   ASP A O   1 
ATOM   540  C CB  . ASP A 1 66  ? 35.359  23.425  66.262 1.00 53.65 ? 66   ASP A CB  1 
ATOM   541  C CG  . ASP A 1 66  ? 34.109  23.177  67.093 1.00 57.97 ? 66   ASP A CG  1 
ATOM   542  O OD1 . ASP A 1 66  ? 34.110  23.515  68.302 1.00 59.90 ? 66   ASP A OD1 1 
ATOM   543  O OD2 . ASP A 1 66  ? 33.122  22.666  66.522 1.00 56.11 ? 66   ASP A OD2 1 
ATOM   544  N N   . VAL A 1 67  ? 37.820  25.629  65.304 1.00 38.54 ? 67   VAL A N   1 
ATOM   545  C CA  . VAL A 1 67  ? 39.157  25.860  64.790 1.00 28.91 ? 67   VAL A CA  1 
ATOM   546  C C   . VAL A 1 67  ? 39.972  26.649  65.812 1.00 30.11 ? 67   VAL A C   1 
ATOM   547  O O   . VAL A 1 67  ? 39.615  27.762  66.197 1.00 29.03 ? 67   VAL A O   1 
ATOM   548  C CB  . VAL A 1 67  ? 39.092  26.593  63.443 1.00 22.02 ? 67   VAL A CB  1 
ATOM   549  C CG1 . VAL A 1 67  ? 40.434  27.166  63.083 1.00 20.44 ? 67   VAL A CG1 1 
ATOM   550  C CG2 . VAL A 1 67  ? 38.658  25.618  62.373 1.00 24.31 ? 67   VAL A CG2 1 
ATOM   551  N N   . LYS A 1 68  ? 40.993  25.993  66.347 1.00 30.40 ? 68   LYS A N   1 
ATOM   552  C CA  . LYS A 1 68  ? 41.765  26.545  67.444 1.00 28.73 ? 68   LYS A CA  1 
ATOM   553  C C   . LYS A 1 68  ? 43.249  26.441  67.111 1.00 31.31 ? 68   LYS A C   1 
ATOM   554  O O   . LYS A 1 68  ? 43.813  25.344  67.069 1.00 36.88 ? 68   LYS A O   1 
ATOM   555  C CB  . LYS A 1 68  ? 41.421  25.789  68.735 1.00 27.37 ? 68   LYS A CB  1 
ATOM   556  C CG  . LYS A 1 68  ? 39.915  25.636  68.940 1.00 31.40 ? 68   LYS A CG  1 
ATOM   557  C CD  . LYS A 1 68  ? 39.501  25.570  70.396 1.00 35.58 ? 68   LYS A CD  1 
ATOM   558  C CE  . LYS A 1 68  ? 37.973  25.576  70.524 1.00 42.07 ? 68   LYS A CE  1 
ATOM   559  N NZ  . LYS A 1 68  ? 37.502  25.533  71.938 1.00 39.98 ? 68   LYS A NZ  1 
ATOM   560  N N   . LEU A 1 69  ? 43.863  27.583  66.820 1.00 22.52 ? 69   LEU A N   1 
ATOM   561  C CA  . LEU A 1 69  ? 45.190  27.600  66.220 1.00 16.92 ? 69   LEU A CA  1 
ATOM   562  C C   . LEU A 1 69  ? 46.222  28.350  67.044 1.00 20.53 ? 69   LEU A C   1 
ATOM   563  O O   . LEU A 1 69  ? 45.904  29.306  67.750 1.00 22.09 ? 69   LEU A O   1 
ATOM   564  C CB  . LEU A 1 69  ? 45.127  28.224  64.831 1.00 13.33 ? 69   LEU A CB  1 
ATOM   565  C CG  . LEU A 1 69  ? 44.392  27.494  63.712 1.00 9.80  ? 69   LEU A CG  1 
ATOM   566  C CD1 . LEU A 1 69  ? 43.687  28.503  62.844 1.00 15.82 ? 69   LEU A CD1 1 
ATOM   567  C CD2 . LEU A 1 69  ? 45.375  26.728  62.883 1.00 16.52 ? 69   LEU A CD2 1 
ATOM   568  N N   . THR A 1 70  ? 47.477  27.953  66.864 1.00 22.86 ? 70   THR A N   1 
ATOM   569  C CA  . THR A 1 70  ? 48.627  28.696  67.367 1.00 27.00 ? 70   THR A CA  1 
ATOM   570  C C   . THR A 1 70  ? 49.634  28.904  66.234 1.00 26.82 ? 70   THR A C   1 
ATOM   571  O O   . THR A 1 70  ? 49.413  28.429  65.121 1.00 27.11 ? 70   THR A O   1 
ATOM   572  C CB  . THR A 1 70  ? 49.281  27.951  68.531 1.00 29.04 ? 70   THR A CB  1 
ATOM   573  O OG1 . THR A 1 70  ? 48.814  26.594  68.554 1.00 35.48 ? 70   THR A OG1 1 
ATOM   574  C CG2 . THR A 1 70  ? 48.910  28.617  69.839 1.00 28.62 ? 70   THR A CG2 1 
ATOM   575  N N   . GLN A 1 71  ? 50.708  29.648  66.505 1.00 25.11 ? 71   GLN A N   1 
ATOM   576  C CA  . GLN A 1 71  ? 51.693  30.064  65.485 1.00 21.30 ? 71   GLN A CA  1 
ATOM   577  C C   . GLN A 1 71  ? 51.183  31.192  64.596 1.00 20.36 ? 71   GLN A C   1 
ATOM   578  O O   . GLN A 1 71  ? 50.284  30.992  63.779 1.00 24.64 ? 71   GLN A O   1 
ATOM   579  C CB  . GLN A 1 71  ? 52.133  28.902  64.580 1.00 16.66 ? 71   GLN A CB  1 
ATOM   580  C CG  . GLN A 1 71  ? 52.768  27.711  65.287 1.00 24.30 ? 71   GLN A CG  1 
ATOM   581  C CD  . GLN A 1 71  ? 54.031  28.059  66.058 1.00 29.78 ? 71   GLN A CD  1 
ATOM   582  O OE1 . GLN A 1 71  ? 54.310  27.462  67.099 1.00 34.73 ? 71   GLN A OE1 1 
ATOM   583  N NE2 . GLN A 1 71  ? 54.813  29.003  65.539 1.00 25.69 ? 71   GLN A NE2 1 
ATOM   584  N N   . SER A 1 72  ? 51.896  32.311  64.629 1.00 16.97 ? 72   SER A N   1 
ATOM   585  C CA  . SER A 1 72  ? 51.457  33.532  63.976 1.00 20.11 ? 72   SER A CA  1 
ATOM   586  C C   . SER A 1 72  ? 51.317  33.376  62.471 1.00 22.66 ? 72   SER A C   1 
ATOM   587  O O   . SER A 1 72  ? 50.343  33.838  61.887 1.00 19.67 ? 72   SER A O   1 
ATOM   588  C CB  . SER A 1 72  ? 52.421  34.674  64.286 1.00 21.22 ? 72   SER A CB  1 
ATOM   589  O OG  . SER A 1 72  ? 53.613  34.578  63.523 1.00 23.46 ? 72   SER A OG  1 
ATOM   590  N N   . ASN A 1 73  ? 52.287  32.724  61.841 1.00 25.44 ? 73   ASN A N   1 
ATOM   591  C CA  . ASN A 1 73  ? 52.236  32.555  60.396 1.00 15.65 ? 73   ASN A CA  1 
ATOM   592  C C   . ASN A 1 73  ? 51.076  31.647  60.004 1.00 13.90 ? 73   ASN A C   1 
ATOM   593  O O   . ASN A 1 73  ? 50.356  31.953  59.058 1.00 11.84 ? 73   ASN A O   1 
ATOM   594  C CB  . ASN A 1 73  ? 53.565  32.003  59.864 1.00 19.21 ? 73   ASN A CB  1 
ATOM   595  C CG  . ASN A 1 73  ? 54.621  33.099  59.616 1.00 22.86 ? 73   ASN A CG  1 
ATOM   596  O OD1 . ASN A 1 73  ? 54.314  34.289  59.549 1.00 20.54 ? 73   ASN A OD1 1 
ATOM   597  N ND2 . ASN A 1 73  ? 55.874  32.684  59.477 1.00 29.09 ? 73   ASN A ND2 1 
ATOM   598  N N   . ALA A 1 74  ? 50.795  30.642  60.834 1.00 17.69 ? 74   ALA A N   1 
ATOM   599  C CA  . ALA A 1 74  ? 49.703  29.706  60.575 1.00 18.44 ? 74   ALA A CA  1 
ATOM   600  C C   . ALA A 1 74  ? 48.338  30.365  60.765 1.00 20.39 ? 74   ALA A C   1 
ATOM   601  O O   . ALA A 1 74  ? 47.361  30.049  60.066 1.00 23.04 ? 74   ALA A O   1 
ATOM   602  C CB  . ALA A 1 74  ? 49.833  28.511  61.487 1.00 17.11 ? 74   ALA A CB  1 
ATOM   603  N N   . ILE A 1 75  ? 48.293  31.291  61.716 1.00 18.20 ? 75   ILE A N   1 
ATOM   604  C CA  . ILE A 1 75  ? 47.093  32.053  62.008 1.00 20.42 ? 75   ILE A CA  1 
ATOM   605  C C   . ILE A 1 75  ? 46.776  33.001  60.840 1.00 19.11 ? 75   ILE A C   1 
ATOM   606  O O   . ILE A 1 75  ? 45.649  33.020  60.331 1.00 26.42 ? 75   ILE A O   1 
ATOM   607  C CB  . ILE A 1 75  ? 47.288  32.813  63.346 1.00 12.25 ? 75   ILE A CB  1 
ATOM   608  C CG1 . ILE A 1 75  ? 47.183  31.818  64.510 1.00 11.09 ? 75   ILE A CG1 1 
ATOM   609  C CG2 . ILE A 1 75  ? 46.279  33.945  63.482 1.00 10.85 ? 75   ILE A CG2 1 
ATOM   610  C CD1 . ILE A 1 75  ? 47.784  32.294  65.817 1.00 2.00  ? 75   ILE A CD1 1 
ATOM   611  N N   . LEU A 1 76  ? 47.822  33.616  60.294 1.00 19.25 ? 76   LEU A N   1 
ATOM   612  C CA  . LEU A 1 76  ? 47.679  34.532  59.163 1.00 19.33 ? 76   LEU A CA  1 
ATOM   613  C C   . LEU A 1 76  ? 47.274  33.816  57.878 1.00 19.18 ? 76   LEU A C   1 
ATOM   614  O O   . LEU A 1 76  ? 46.475  34.330  57.097 1.00 28.85 ? 76   LEU A O   1 
ATOM   615  C CB  . LEU A 1 76  ? 48.980  35.298  58.935 1.00 9.73  ? 76   LEU A CB  1 
ATOM   616  C CG  . LEU A 1 76  ? 49.232  36.381  59.978 1.00 8.45  ? 76   LEU A CG  1 
ATOM   617  C CD1 . LEU A 1 76  ? 50.675  36.805  59.917 1.00 13.04 ? 76   LEU A CD1 1 
ATOM   618  C CD2 . LEU A 1 76  ? 48.310  37.552  59.742 1.00 5.93  ? 76   LEU A CD2 1 
ATOM   619  N N   . ARG A 1 77  ? 47.797  32.610  57.691 1.00 18.71 ? 77   ARG A N   1 
ATOM   620  C CA  . ARG A 1 77  ? 47.461  31.786  56.539 1.00 14.99 ? 77   ARG A CA  1 
ATOM   621  C C   . ARG A 1 77  ? 45.991  31.403  56.555 1.00 21.80 ? 77   ARG A C   1 
ATOM   622  O O   . ARG A 1 77  ? 45.352  31.310  55.508 1.00 25.62 ? 77   ARG A O   1 
ATOM   623  C CB  . ARG A 1 77  ? 48.311  30.516  56.541 1.00 16.96 ? 77   ARG A CB  1 
ATOM   624  C CG  . ARG A 1 77  ? 49.779  30.759  56.236 1.00 9.92  ? 77   ARG A CG  1 
ATOM   625  C CD  . ARG A 1 77  ? 50.280  29.760  55.218 1.00 10.91 ? 77   ARG A CD  1 
ATOM   626  N NE  . ARG A 1 77  ? 51.713  29.872  54.993 1.00 8.16  ? 77   ARG A NE  1 
ATOM   627  C CZ  . ARG A 1 77  ? 52.281  29.806  53.796 1.00 8.59  ? 77   ARG A CZ  1 
ATOM   628  N NH1 . ARG A 1 77  ? 51.538  29.670  52.707 1.00 5.62  ? 77   ARG A NH1 1 
ATOM   629  N NH2 . ARG A 1 77  ? 53.597  29.869  53.688 1.00 5.29  ? 77   ARG A NH2 1 
ATOM   630  N N   . TYR A 1 78  ? 45.451  31.186  57.749 1.00 24.09 ? 78   TYR A N   1 
ATOM   631  C CA  . TYR A 1 78  ? 44.073  30.748  57.874 1.00 16.19 ? 78   TYR A CA  1 
ATOM   632  C C   . TYR A 1 78  ? 43.083  31.854  57.522 1.00 16.37 ? 78   TYR A C   1 
ATOM   633  O O   . TYR A 1 78  ? 42.102  31.605  56.824 1.00 20.93 ? 78   TYR A O   1 
ATOM   634  C CB  . TYR A 1 78  ? 43.819  30.229  59.282 1.00 19.67 ? 78   TYR A CB  1 
ATOM   635  C CG  . TYR A 1 78  ? 42.361  29.999  59.609 1.00 22.47 ? 78   TYR A CG  1 
ATOM   636  C CD1 . TYR A 1 78  ? 41.640  28.965  59.009 1.00 22.96 ? 78   TYR A CD1 1 
ATOM   637  C CD2 . TYR A 1 78  ? 41.711  30.797  60.548 1.00 22.47 ? 78   TYR A CD2 1 
ATOM   638  C CE1 . TYR A 1 78  ? 40.310  28.733  59.341 1.00 25.38 ? 78   TYR A CE1 1 
ATOM   639  C CE2 . TYR A 1 78  ? 40.387  30.576  60.886 1.00 22.24 ? 78   TYR A CE2 1 
ATOM   640  C CZ  . TYR A 1 78  ? 39.690  29.547  60.281 1.00 23.04 ? 78   TYR A CZ  1 
ATOM   641  O OH  . TYR A 1 78  ? 38.368  29.366  60.612 1.00 24.58 ? 78   TYR A OH  1 
ATOM   642  N N   . ILE A 1 79  ? 43.334  33.071  58.000 1.00 12.55 ? 79   ILE A N   1 
ATOM   643  C CA  . ILE A 1 79  ? 42.483  34.201  57.653 1.00 15.99 ? 79   ILE A CA  1 
ATOM   644  C C   . ILE A 1 79  ? 42.621  34.501  56.171 1.00 16.84 ? 79   ILE A C   1 
ATOM   645  O O   . ILE A 1 79  ? 41.650  34.821  55.503 1.00 23.90 ? 79   ILE A O   1 
ATOM   646  C CB  . ILE A 1 79  ? 42.872  35.468  58.425 1.00 20.69 ? 79   ILE A CB  1 
ATOM   647  C CG1 . ILE A 1 79  ? 42.894  35.187  59.917 1.00 21.17 ? 79   ILE A CG1 1 
ATOM   648  C CG2 . ILE A 1 79  ? 41.881  36.583  58.144 1.00 19.85 ? 79   ILE A CG2 1 
ATOM   649  C CD1 . ILE A 1 79  ? 43.395  36.360  60.719 1.00 28.51 ? 79   ILE A CD1 1 
ATOM   650  N N   . ALA A 1 80  ? 43.841  34.398  55.662 1.00 20.73 ? 80   ALA A N   1 
ATOM   651  C CA  . ALA A 1 80  ? 44.125  34.697  54.265 1.00 18.92 ? 80   ALA A CA  1 
ATOM   652  C C   . ALA A 1 80  ? 43.372  33.768  53.317 1.00 20.97 ? 80   ALA A C   1 
ATOM   653  O O   . ALA A 1 80  ? 42.820  34.219  52.316 1.00 19.77 ? 80   ALA A O   1 
ATOM   654  C CB  . ALA A 1 80  ? 45.620  34.606  54.011 1.00 22.94 ? 80   ALA A CB  1 
ATOM   655  N N   . ARG A 1 81  ? 43.304  32.486  53.666 1.00 17.18 ? 81   ARG A N   1 
ATOM   656  C CA  . ARG A 1 81  ? 42.601  31.501  52.844 1.00 20.47 ? 81   ARG A CA  1 
ATOM   657  C C   . ARG A 1 81  ? 41.095  31.813  52.740 1.00 28.56 ? 81   ARG A C   1 
ATOM   658  O O   . ARG A 1 81  ? 40.495  31.662  51.671 1.00 33.98 ? 81   ARG A O   1 
ATOM   659  C CB  . ARG A 1 81  ? 42.803  30.087  53.410 1.00 16.42 ? 81   ARG A CB  1 
ATOM   660  C CG  . ARG A 1 81  ? 44.072  29.385  52.976 1.00 13.31 ? 81   ARG A CG  1 
ATOM   661  C CD  . ARG A 1 81  ? 44.010  27.876  53.258 1.00 16.31 ? 81   ARG A CD  1 
ATOM   662  N NE  . ARG A 1 81  ? 43.952  27.554  54.687 1.00 21.21 ? 81   ARG A NE  1 
ATOM   663  C CZ  . ARG A 1 81  ? 45.009  27.509  55.496 1.00 26.30 ? 81   ARG A CZ  1 
ATOM   664  N NH1 . ARG A 1 81  ? 46.219  27.776  55.028 1.00 23.99 ? 81   ARG A NH1 1 
ATOM   665  N NH2 . ARG A 1 81  ? 44.856  27.232  56.783 1.00 29.63 ? 81   ARG A NH2 1 
ATOM   666  N N   . LYS A 1 82  ? 40.503  32.280  53.841 1.00 32.71 ? 82   LYS A N   1 
ATOM   667  C CA  . LYS A 1 82  ? 39.084  32.639  53.882 1.00 30.93 ? 82   LYS A CA  1 
ATOM   668  C C   . LYS A 1 82  ? 38.769  33.854  53.011 1.00 33.64 ? 82   LYS A C   1 
ATOM   669  O O   . LYS A 1 82  ? 37.601  34.148  52.757 1.00 42.13 ? 82   LYS A O   1 
ATOM   670  C CB  . LYS A 1 82  ? 38.637  32.945  55.322 1.00 30.88 ? 82   LYS A CB  1 
ATOM   671  C CG  . LYS A 1 82  ? 38.380  31.731  56.192 1.00 31.20 ? 82   LYS A CG  1 
ATOM   672  C CD  . LYS A 1 82  ? 37.418  32.038  57.338 1.00 31.64 ? 82   LYS A CD  1 
ATOM   673  C CE  . LYS A 1 82  ? 36.556  30.810  57.659 1.00 36.17 ? 82   LYS A CE  1 
ATOM   674  N NZ  . LYS A 1 82  ? 35.828  30.876  58.969 1.00 31.93 ? 82   LYS A NZ  1 
ATOM   675  N N   . HIS A 1 83  ? 39.802  34.608  52.632 1.00 35.40 ? 83   HIS A N   1 
ATOM   676  C CA  . HIS A 1 83  ? 39.627  35.857  51.885 1.00 29.05 ? 83   HIS A CA  1 
ATOM   677  C C   . HIS A 1 83  ? 40.515  35.933  50.641 1.00 30.24 ? 83   HIS A C   1 
ATOM   678  O O   . HIS A 1 83  ? 40.748  37.014  50.098 1.00 25.92 ? 83   HIS A O   1 
ATOM   679  C CB  . HIS A 1 83  ? 39.902  37.055  52.794 1.00 26.95 ? 83   HIS A CB  1 
ATOM   680  C CG  . HIS A 1 83  ? 39.143  37.014  54.085 1.00 33.63 ? 83   HIS A CG  1 
ATOM   681  N ND1 . HIS A 1 83  ? 37.767  36.948  54.135 1.00 29.68 ? 83   HIS A ND1 1 
ATOM   682  C CD2 . HIS A 1 83  ? 39.568  36.962  55.366 1.00 35.83 ? 83   HIS A CD2 1 
ATOM   683  C CE1 . HIS A 1 83  ? 37.379  36.859  55.394 1.00 33.73 ? 83   HIS A CE1 1 
ATOM   684  N NE2 . HIS A 1 83  ? 38.449  36.866  56.164 1.00 34.48 ? 83   HIS A NE2 1 
ATOM   685  N N   . ASN A 1 84  ? 41.001  34.773  50.199 1.00 36.40 ? 84   ASN A N   1 
ATOM   686  C CA  . ASN A 1 84  ? 41.761  34.640  48.957 1.00 38.01 ? 84   ASN A CA  1 
ATOM   687  C C   . ASN A 1 84  ? 42.926  35.621  48.881 1.00 35.57 ? 84   ASN A C   1 
ATOM   688  O O   . ASN A 1 84  ? 43.158  36.259  47.848 1.00 38.25 ? 84   ASN A O   1 
ATOM   689  C CB  . ASN A 1 84  ? 40.838  34.817  47.746 1.00 42.24 ? 84   ASN A CB  1 
ATOM   690  C CG  . ASN A 1 84  ? 41.334  34.071  46.521 1.00 49.05 ? 84   ASN A CG  1 
ATOM   691  O OD1 . ASN A 1 84  ? 41.196  32.851  46.430 1.00 53.52 ? 84   ASN A OD1 1 
ATOM   692  N ND2 . ASN A 1 84  ? 41.922  34.799  45.576 1.00 51.00 ? 84   ASN A ND2 1 
ATOM   693  N N   . MET A 1 85  ? 43.612  35.786  50.007 1.00 23.89 ? 85   MET A N   1 
ATOM   694  C CA  . MET A 1 85  ? 44.786  36.646  50.067 1.00 16.88 ? 85   MET A CA  1 
ATOM   695  C C   . MET A 1 85  ? 46.066  35.834  50.208 1.00 20.44 ? 85   MET A C   1 
ATOM   696  O O   . MET A 1 85  ? 47.042  36.277  50.823 1.00 20.56 ? 85   MET A O   1 
ATOM   697  C CB  . MET A 1 85  ? 44.657  37.644  51.211 1.00 15.84 ? 85   MET A CB  1 
ATOM   698  C CG  . MET A 1 85  ? 43.659  38.750  50.945 1.00 12.16 ? 85   MET A CG  1 
ATOM   699  S SD  . MET A 1 85  ? 43.788  39.991  52.207 1.00 8.02  ? 85   MET A SD  1 
ATOM   700  C CE  . MET A 1 85  ? 43.932  38.971  53.590 1.00 24.14 ? 85   MET A CE  1 
ATOM   701  N N   . CYS A 1 86  ? 46.027  34.614  49.684 1.00 24.40 ? 86   CYS A N   1 
ATOM   702  C CA  . CYS A 1 86  ? 47.234  33.834  49.465 1.00 32.55 ? 86   CYS A CA  1 
ATOM   703  C C   . CYS A 1 86  ? 47.632  33.976  47.999 1.00 30.60 ? 86   CYS A C   1 
ATOM   704  O O   . CYS A 1 86  ? 47.024  34.757  47.256 1.00 39.04 ? 86   CYS A O   1 
ATOM   705  C CB  . CYS A 1 86  ? 46.981  32.363  49.815 1.00 41.14 ? 86   CYS A CB  1 
ATOM   706  S SG  . CYS A 1 86  ? 46.749  32.045  51.592 1.00 41.57 ? 86   CYS A SG  1 
ATOM   707  N N   . GLY A 1 87  ? 48.673  33.258  47.590 1.00 27.60 ? 87   GLY A N   1 
ATOM   708  C CA  . GLY A 1 87  ? 49.052  33.270  46.189 1.00 28.59 ? 87   GLY A CA  1 
ATOM   709  C C   . GLY A 1 87  ? 48.003  32.600  45.325 1.00 27.27 ? 87   GLY A C   1 
ATOM   710  O O   . GLY A 1 87  ? 47.197  31.815  45.828 1.00 30.41 ? 87   GLY A O   1 
ATOM   711  N N   . GLU A 1 88  ? 47.980  32.938  44.040 1.00 26.94 ? 88   GLU A N   1 
ATOM   712  C CA  . GLU A 1 88  ? 47.091  32.267  43.110 1.00 24.12 ? 88   GLU A CA  1 
ATOM   713  C C   . GLU A 1 88  ? 47.845  31.395  42.116 1.00 26.25 ? 88   GLU A C   1 
ATOM   714  O O   . GLU A 1 88  ? 47.599  30.195  42.060 1.00 33.76 ? 88   GLU A O   1 
ATOM   715  C CB  . GLU A 1 88  ? 46.203  33.285  42.406 1.00 32.00 ? 88   GLU A CB  1 
ATOM   716  C CG  . GLU A 1 88  ? 45.364  34.089  43.387 1.00 37.76 ? 88   GLU A CG  1 
ATOM   717  C CD  . GLU A 1 88  ? 44.348  34.973  42.704 1.00 44.00 ? 88   GLU A CD  1 
ATOM   718  O OE1 . GLU A 1 88  ? 44.742  36.041  42.192 1.00 43.01 ? 88   GLU A OE1 1 
ATOM   719  O OE2 . GLU A 1 88  ? 43.155  34.601  42.686 1.00 48.10 ? 88   GLU A OE2 1 
ATOM   720  N N   . THR A 1 89  ? 48.829  31.953  41.411 1.00 24.68 ? 89   THR A N   1 
ATOM   721  C CA  . THR A 1 89  ? 49.681  31.128  40.553 1.00 22.24 ? 89   THR A CA  1 
ATOM   722  C C   . THR A 1 89  ? 50.875  30.568  41.307 1.00 16.43 ? 89   THR A C   1 
ATOM   723  O O   . THR A 1 89  ? 51.060  30.870  42.483 1.00 23.34 ? 89   THR A O   1 
ATOM   724  C CB  . THR A 1 89  ? 50.188  31.888  39.321 1.00 29.00 ? 89   THR A CB  1 
ATOM   725  O OG1 . THR A 1 89  ? 50.629  33.204  39.690 1.00 26.22 ? 89   THR A OG1 1 
ATOM   726  C CG2 . THR A 1 89  ? 49.088  31.965  38.283 1.00 29.99 ? 89   THR A CG2 1 
ATOM   727  N N   . GLU A 1 90  ? 51.642  29.698  40.646 1.00 21.37 ? 90   GLU A N   1 
ATOM   728  C CA  . GLU A 1 90  ? 52.832  29.081  41.241 1.00 17.28 ? 90   GLU A CA  1 
ATOM   729  C C   . GLU A 1 90  ? 53.845  30.140  41.643 1.00 19.12 ? 90   GLU A C   1 
ATOM   730  O O   . GLU A 1 90  ? 54.475  30.046  42.693 1.00 27.40 ? 90   GLU A O   1 
ATOM   731  C CB  . GLU A 1 90  ? 53.506  28.140  40.244 1.00 10.14 ? 90   GLU A CB  1 
ATOM   732  C CG  . GLU A 1 90  ? 53.615  26.695  40.690 1.00 15.38 ? 90   GLU A CG  1 
ATOM   733  C CD  . GLU A 1 90  ? 54.285  26.519  42.037 1.00 15.01 ? 90   GLU A CD  1 
ATOM   734  O OE1 . GLU A 1 90  ? 55.506  26.758  42.153 1.00 6.82  ? 90   GLU A OE1 1 
ATOM   735  O OE2 . GLU A 1 90  ? 53.598  26.039  42.960 1.00 15.55 ? 90   GLU A OE2 1 
ATOM   736  N N   . VAL A 1 91  ? 54.030  31.124  40.771 1.00 18.82 ? 91   VAL A N   1 
ATOM   737  C CA  . VAL A 1 91  ? 55.006  32.177  41.008 1.00 18.46 ? 91   VAL A CA  1 
ATOM   738  C C   . VAL A 1 91  ? 54.620  32.941  42.261 1.00 17.29 ? 91   VAL A C   1 
ATOM   739  O O   . VAL A 1 91  ? 55.441  33.121  43.156 1.00 16.04 ? 91   VAL A O   1 
ATOM   740  C CB  . VAL A 1 91  ? 55.081  33.161  39.816 1.00 16.52 ? 91   VAL A CB  1 
ATOM   741  C CG1 . VAL A 1 91  ? 56.034  34.310  40.121 1.00 16.98 ? 91   VAL A CG1 1 
ATOM   742  C CG2 . VAL A 1 91  ? 55.535  32.433  38.582 1.00 13.96 ? 91   VAL A CG2 1 
ATOM   743  N N   . GLU A 1 92  ? 53.337  33.276  42.371 1.00 22.87 ? 92   GLU A N   1 
ATOM   744  C CA  . GLU A 1 92  ? 52.824  34.010  43.525 1.00 25.45 ? 92   GLU A CA  1 
ATOM   745  C C   . GLU A 1 92  ? 52.995  33.250  44.830 1.00 24.49 ? 92   GLU A C   1 
ATOM   746  O O   . GLU A 1 92  ? 53.398  33.824  45.836 1.00 31.68 ? 92   GLU A O   1 
ATOM   747  C CB  . GLU A 1 92  ? 51.354  34.353  43.329 1.00 27.17 ? 92   GLU A CB  1 
ATOM   748  C CG  . GLU A 1 92  ? 51.127  35.663  42.614 1.00 35.05 ? 92   GLU A CG  1 
ATOM   749  C CD  . GLU A 1 92  ? 49.845  35.670  41.813 1.00 42.71 ? 92   GLU A CD  1 
ATOM   750  O OE1 . GLU A 1 92  ? 48.756  35.702  42.433 1.00 41.61 ? 92   GLU A OE1 1 
ATOM   751  O OE2 . GLU A 1 92  ? 49.924  35.641  40.564 1.00 51.29 ? 92   GLU A OE2 1 
ATOM   752  N N   . LYS A 1 93  ? 52.765  31.945  44.795 1.00 21.62 ? 93   LYS A N   1 
ATOM   753  C CA  . LYS A 1 93  ? 52.985  31.118  45.973 1.00 19.04 ? 93   LYS A CA  1 
ATOM   754  C C   . LYS A 1 93  ? 54.473  30.979  46.339 1.00 17.10 ? 93   LYS A C   1 
ATOM   755  O O   . LYS A 1 93  ? 54.821  30.993  47.518 1.00 21.20 ? 93   LYS A O   1 
ATOM   756  C CB  . LYS A 1 93  ? 52.334  29.748  45.776 1.00 15.08 ? 93   LYS A CB  1 
ATOM   757  C CG  . LYS A 1 93  ? 50.817  29.815  45.711 1.00 17.69 ? 93   LYS A CG  1 
ATOM   758  C CD  . LYS A 1 93  ? 50.194  28.451  45.471 1.00 23.49 ? 93   LYS A CD  1 
ATOM   759  C CE  . LYS A 1 93  ? 48.787  28.353  46.078 1.00 31.58 ? 93   LYS A CE  1 
ATOM   760  N NZ  . LYS A 1 93  ? 48.776  28.108  47.563 1.00 31.11 ? 93   LYS A NZ  1 
ATOM   761  N N   . GLN A 1 94  ? 55.348  30.973  45.331 1.00 15.78 ? 94   GLN A N   1 
ATOM   762  C CA  . GLN A 1 94  ? 56.794  30.958  45.562 1.00 11.05 ? 94   GLN A CA  1 
ATOM   763  C C   . GLN A 1 94  ? 57.212  32.212  46.295 1.00 9.84  ? 94   GLN A C   1 
ATOM   764  O O   . GLN A 1 94  ? 58.008  32.156  47.222 1.00 18.02 ? 94   GLN A O   1 
ATOM   765  C CB  . GLN A 1 94  ? 57.558  30.900  44.245 1.00 8.43  ? 94   GLN A CB  1 
ATOM   766  C CG  . GLN A 1 94  ? 57.680  29.519  43.648 1.00 12.67 ? 94   GLN A CG  1 
ATOM   767  C CD  . GLN A 1 94  ? 58.279  29.547  42.253 1.00 13.30 ? 94   GLN A CD  1 
ATOM   768  O OE1 . GLN A 1 94  ? 59.289  30.218  42.005 1.00 20.46 ? 94   GLN A OE1 1 
ATOM   769  N NE2 . GLN A 1 94  ? 57.653  28.825  41.329 1.00 16.89 ? 94   GLN A NE2 1 
ATOM   770  N N   . ARG A 1 95  ? 56.640  33.339  45.891 1.00 17.42 ? 95   ARG A N   1 
ATOM   771  C CA  . ARG A 1 95  ? 56.964  34.623  46.488 1.00 15.70 ? 95   ARG A CA  1 
ATOM   772  C C   . ARG A 1 95  ? 56.439  34.727  47.917 1.00 16.44 ? 95   ARG A C   1 
ATOM   773  O O   . ARG A 1 95  ? 57.100  35.300  48.782 1.00 27.48 ? 95   ARG A O   1 
ATOM   774  C CB  . ARG A 1 95  ? 56.390  35.768  45.650 1.00 22.74 ? 95   ARG A CB  1 
ATOM   775  C CG  . ARG A 1 95  ? 57.105  36.072  44.334 1.00 22.76 ? 95   ARG A CG  1 
ATOM   776  C CD  . ARG A 1 95  ? 56.632  37.428  43.820 1.00 30.78 ? 95   ARG A CD  1 
ATOM   777  N NE  . ARG A 1 95  ? 56.942  37.680  42.415 1.00 31.51 ? 95   ARG A NE  1 
ATOM   778  C CZ  . ARG A 1 95  ? 56.039  38.011  41.493 1.00 34.30 ? 95   ARG A CZ  1 
ATOM   779  N NH1 . ARG A 1 95  ? 54.744  37.888  41.741 1.00 30.97 ? 95   ARG A NH1 1 
ATOM   780  N NH2 . ARG A 1 95  ? 56.426  38.375  40.278 1.00 42.58 ? 95   ARG A NH2 1 
ATOM   781  N N   . VAL A 1 96  ? 55.262  34.168  48.173 1.00 17.27 ? 96   VAL A N   1 
ATOM   782  C CA  . VAL A 1 96  ? 54.690  34.193  49.521 1.00 15.94 ? 96   VAL A CA  1 
ATOM   783  C C   . VAL A 1 96  ? 55.520  33.334  50.483 1.00 15.82 ? 96   VAL A C   1 
ATOM   784  O O   . VAL A 1 96  ? 55.860  33.749  51.590 1.00 9.83  ? 96   VAL A O   1 
ATOM   785  C CB  . VAL A 1 96  ? 53.235  33.675  49.508 1.00 20.13 ? 96   VAL A CB  1 
ATOM   786  C CG1 . VAL A 1 96  ? 52.694  33.564  50.919 1.00 14.76 ? 96   VAL A CG1 1 
ATOM   787  C CG2 . VAL A 1 96  ? 52.365  34.593  48.679 1.00 14.65 ? 96   VAL A CG2 1 
ATOM   788  N N   . ASP A 1 97  ? 55.894  32.150  50.029 1.00 15.48 ? 97   ASP A N   1 
ATOM   789  C CA  . ASP A 1 97  ? 56.582  31.218  50.895 1.00 16.62 ? 97   ASP A CA  1 
ATOM   790  C C   . ASP A 1 97  ? 58.007  31.674  51.235 1.00 13.78 ? 97   ASP A C   1 
ATOM   791  O O   . ASP A 1 97  ? 58.463  31.495  52.359 1.00 19.78 ? 97   ASP A O   1 
ATOM   792  C CB  . ASP A 1 97  ? 56.566  29.816  50.260 1.00 21.83 ? 97   ASP A CB  1 
ATOM   793  C CG  . ASP A 1 97  ? 55.154  29.198  50.209 1.00 20.08 ? 97   ASP A CG  1 
ATOM   794  O OD1 . ASP A 1 97  ? 54.259  29.610  50.972 1.00 24.34 ? 97   ASP A OD1 1 
ATOM   795  O OD2 . ASP A 1 97  ? 54.941  28.259  49.430 1.00 19.17 ? 97   ASP A OD2 1 
ATOM   796  N N   . VAL A 1 98  ? 58.673  32.352  50.306 1.00 11.32 ? 98   VAL A N   1 
ATOM   797  C CA  . VAL A 1 98  ? 60.026  32.822  50.574 1.00 7.63  ? 98   VAL A CA  1 
ATOM   798  C C   . VAL A 1 98  ? 60.027  34.064  51.459 1.00 10.71 ? 98   VAL A C   1 
ATOM   799  O O   . VAL A 1 98  ? 60.760  34.126  52.448 1.00 13.67 ? 98   VAL A O   1 
ATOM   800  C CB  . VAL A 1 98  ? 60.817  33.079  49.265 1.00 13.98 ? 98   VAL A CB  1 
ATOM   801  C CG1 . VAL A 1 98  ? 60.120  34.098  48.408 1.00 18.73 ? 98   VAL A CG1 1 
ATOM   802  C CG2 . VAL A 1 98  ? 62.233  33.539  49.589 1.00 14.85 ? 98   VAL A CG2 1 
ATOM   803  N N   . LEU A 1 99  ? 59.103  34.981  51.186 1.00 12.06 ? 99   LEU A N   1 
ATOM   804  C CA  . LEU A 1 99  ? 58.990  36.210  51.954 1.00 11.29 ? 99   LEU A CA  1 
ATOM   805  C C   . LEU A 1 99  ? 58.503  35.968  53.375 1.00 14.79 ? 99   LEU A C   1 
ATOM   806  O O   . LEU A 1 99  ? 58.969  36.614  54.305 1.00 27.51 ? 99   LEU A O   1 
ATOM   807  C CB  . LEU A 1 99  ? 58.048  37.170  51.251 1.00 16.65 ? 99   LEU A CB  1 
ATOM   808  C CG  . LEU A 1 99  ? 58.688  38.216  50.346 1.00 15.39 ? 99   LEU A CG  1 
ATOM   809  C CD1 . LEU A 1 99  ? 57.630  39.202  49.908 1.00 14.40 ? 99   LEU A CD1 1 
ATOM   810  C CD2 . LEU A 1 99  ? 59.776  38.941  51.091 1.00 15.54 ? 99   LEU A CD2 1 
ATOM   811  N N   . GLU A 1 100 ? 57.570  35.031  53.539 1.00 28.81 ? 100  GLU A N   1 
ATOM   812  C CA  . GLU A 1 100 ? 57.051  34.650  54.860 1.00 23.73 ? 100  GLU A CA  1 
ATOM   813  C C   . GLU A 1 100 ? 58.191  34.220  55.786 1.00 23.71 ? 100  GLU A C   1 
ATOM   814  O O   . GLU A 1 100 ? 58.240  34.605  56.961 1.00 29.15 ? 100  GLU A O   1 
ATOM   815  C CB  . GLU A 1 100 ? 56.040  33.502  54.720 1.00 19.32 ? 100  GLU A CB  1 
ATOM   816  C CG  . GLU A 1 100 ? 55.438  33.015  56.044 1.00 13.89 ? 100  GLU A CG  1 
ATOM   817  C CD  . GLU A 1 100 ? 54.886  31.589  55.963 1.00 24.67 ? 100  GLU A CD  1 
ATOM   818  O OE1 . GLU A 1 100 ? 55.579  30.704  55.408 1.00 31.17 ? 100  GLU A OE1 1 
ATOM   819  O OE2 . GLU A 1 100 ? 53.775  31.338  56.487 1.00 19.23 ? 100  GLU A OE2 1 
ATOM   820  N N   . ASN A 1 101 ? 59.133  33.466  55.225 1.00 24.59 ? 101  ASN A N   1 
ATOM   821  C CA  . ASN A 1 101 ? 60.225  32.898  55.994 1.00 19.33 ? 101  ASN A CA  1 
ATOM   822  C C   . ASN A 1 101 ? 61.379  33.875  56.126 1.00 17.18 ? 101  ASN A C   1 
ATOM   823  O O   . ASN A 1 101 ? 61.979  33.987  57.194 1.00 17.65 ? 101  ASN A O   1 
ATOM   824  C CB  . ASN A 1 101 ? 60.695  31.594  55.350 1.00 23.48 ? 101  ASN A CB  1 
ATOM   825  C CG  . ASN A 1 101 ? 59.878  30.393  55.802 1.00 23.18 ? 101  ASN A CG  1 
ATOM   826  O OD1 . ASN A 1 101 ? 59.990  29.939  56.943 1.00 30.43 ? 101  ASN A OD1 1 
ATOM   827  N ND2 . ASN A 1 101 ? 59.074  29.858  54.900 1.00 15.39 ? 101  ASN A ND2 1 
ATOM   828  N N   . HIS A 1 102 ? 61.594  34.676  55.087 1.00 18.51 ? 102  HIS A N   1 
ATOM   829  C CA  . HIS A 1 102 ? 62.663  35.673  55.095 1.00 11.74 ? 102  HIS A CA  1 
ATOM   830  C C   . HIS A 1 102 ? 62.403  36.776  56.108 1.00 14.90 ? 102  HIS A C   1 
ATOM   831  O O   . HIS A 1 102 ? 63.293  37.172  56.857 1.00 23.65 ? 102  HIS A O   1 
ATOM   832  C CB  . HIS A 1 102 ? 62.822  36.292  53.711 1.00 11.49 ? 102  HIS A CB  1 
ATOM   833  C CG  . HIS A 1 102 ? 63.822  37.407  53.660 1.00 17.52 ? 102  HIS A CG  1 
ATOM   834  N ND1 . HIS A 1 102 ? 65.139  37.242  54.033 1.00 16.07 ? 102  HIS A ND1 1 
ATOM   835  C CD2 . HIS A 1 102 ? 63.689  38.710  53.314 1.00 18.42 ? 102  HIS A CD2 1 
ATOM   836  C CE1 . HIS A 1 102 ? 65.773  38.395  53.922 1.00 17.69 ? 102  HIS A CE1 1 
ATOM   837  N NE2 . HIS A 1 102 ? 64.917  39.302  53.489 1.00 17.56 ? 102  HIS A NE2 1 
ATOM   838  N N   . LEU A 1 103 ? 61.174  37.276  56.113 1.00 17.13 ? 103  LEU A N   1 
ATOM   839  C CA  . LEU A 1 103 ? 60.762  38.322  57.041 1.00 16.29 ? 103  LEU A CA  1 
ATOM   840  C C   . LEU A 1 103 ? 60.762  37.864  58.498 1.00 16.48 ? 103  LEU A C   1 
ATOM   841  O O   . LEU A 1 103 ? 60.914  38.678  59.401 1.00 16.76 ? 103  LEU A O   1 
ATOM   842  C CB  . LEU A 1 103 ? 59.379  38.844  56.658 1.00 12.76 ? 103  LEU A CB  1 
ATOM   843  C CG  . LEU A 1 103 ? 59.326  39.657  55.364 1.00 13.67 ? 103  LEU A CG  1 
ATOM   844  C CD1 . LEU A 1 103 ? 57.881  39.854  54.950 1.00 8.82  ? 103  LEU A CD1 1 
ATOM   845  C CD2 . LEU A 1 103 ? 60.017  40.993  55.560 1.00 10.81 ? 103  LEU A CD2 1 
ATOM   846  N N   . MET A 1 104 ? 60.603  36.565  58.728 1.00 15.68 ? 104  MET A N   1 
ATOM   847  C CA  . MET A 1 104 ? 60.728  36.024  60.073 1.00 16.27 ? 104  MET A CA  1 
ATOM   848  C C   . MET A 1 104 ? 62.192  36.067  60.505 1.00 19.98 ? 104  MET A C   1 
ATOM   849  O O   . MET A 1 104 ? 62.487  36.431  61.639 1.00 17.35 ? 104  MET A O   1 
ATOM   850  C CB  . MET A 1 104 ? 60.180  34.588  60.131 1.00 22.43 ? 104  MET A CB  1 
ATOM   851  C CG  . MET A 1 104 ? 60.128  33.961  61.536 1.00 22.18 ? 104  MET A CG  1 
ATOM   852  S SD  . MET A 1 104 ? 58.920  34.710  62.679 1.00 23.05 ? 104  MET A SD  1 
ATOM   853  C CE  . MET A 1 104 ? 58.987  33.541  64.093 1.00 23.24 ? 104  MET A CE  1 
ATOM   854  N N   . ASP A 1 105 ? 63.102  35.782  59.572 1.00 15.89 ? 105  ASP A N   1 
ATOM   855  C CA  . ASP A 1 105 ? 64.540  35.883  59.830 1.00 8.55  ? 105  ASP A CA  1 
ATOM   856  C C   . ASP A 1 105 ? 64.885  37.292  60.245 1.00 13.08 ? 105  ASP A C   1 
ATOM   857  O O   . ASP A 1 105 ? 65.558  37.499  61.250 1.00 16.90 ? 105  ASP A O   1 
ATOM   858  C CB  . ASP A 1 105 ? 65.354  35.548  58.578 1.00 17.16 ? 105  ASP A CB  1 
ATOM   859  C CG  . ASP A 1 105 ? 65.725  34.079  58.487 1.00 20.41 ? 105  ASP A CG  1 
ATOM   860  O OD1 . ASP A 1 105 ? 65.487  33.330  59.453 1.00 27.31 ? 105  ASP A OD1 1 
ATOM   861  O OD2 . ASP A 1 105 ? 66.250  33.672  57.434 1.00 23.06 ? 105  ASP A OD2 1 
ATOM   862  N N   . LEU A 1 106 ? 64.428  38.260  59.456 1.00 18.09 ? 106  LEU A N   1 
ATOM   863  C CA  . LEU A 1 106 ? 64.656  39.677  59.738 1.00 23.50 ? 106  LEU A CA  1 
ATOM   864  C C   . LEU A 1 106 ? 64.071  40.082  61.086 1.00 23.19 ? 106  LEU A C   1 
ATOM   865  O O   . LEU A 1 106 ? 64.719  40.755  61.885 1.00 25.38 ? 106  LEU A O   1 
ATOM   866  C CB  . LEU A 1 106 ? 64.032  40.525  58.629 1.00 24.63 ? 106  LEU A CB  1 
ATOM   867  C CG  . LEU A 1 106 ? 64.925  40.953  57.459 1.00 22.83 ? 106  LEU A CG  1 
ATOM   868  C CD1 . LEU A 1 106 ? 66.004  39.915  57.185 1.00 22.68 ? 106  LEU A CD1 1 
ATOM   869  C CD2 . LEU A 1 106 ? 64.064  41.179  56.229 1.00 20.21 ? 106  LEU A CD2 1 
ATOM   870  N N   . ARG A 1 107 ? 62.843  39.638  61.323 1.00 27.87 ? 107  ARG A N   1 
ATOM   871  C CA  . ARG A 1 107 ? 62.131  39.870  62.568 1.00 28.44 ? 107  ARG A CA  1 
ATOM   872  C C   . ARG A 1 107 ? 62.916  39.348  63.768 1.00 29.51 ? 107  ARG A C   1 
ATOM   873  O O   . ARG A 1 107 ? 63.097  40.057  64.755 1.00 33.62 ? 107  ARG A O   1 
ATOM   874  C CB  . ARG A 1 107 ? 60.781  39.171  62.491 1.00 27.42 ? 107  ARG A CB  1 
ATOM   875  C CG  . ARG A 1 107 ? 59.782  39.596  63.525 1.00 28.37 ? 107  ARG A CG  1 
ATOM   876  C CD  . ARG A 1 107 ? 58.508  38.779  63.394 1.00 22.98 ? 107  ARG A CD  1 
ATOM   877  N NE  . ARG A 1 107 ? 57.359  39.479  63.956 1.00 23.68 ? 107  ARG A NE  1 
ATOM   878  C CZ  . ARG A 1 107 ? 56.457  40.144  63.240 1.00 27.58 ? 107  ARG A CZ  1 
ATOM   879  N NH1 . ARG A 1 107 ? 56.636  40.348  61.943 1.00 21.58 ? 107  ARG A NH1 1 
ATOM   880  N NH2 . ARG A 1 107 ? 55.385  40.633  63.838 1.00 33.36 ? 107  ARG A NH2 1 
ATOM   881  N N   . MET A 1 108 ? 63.422  38.124  63.657 1.00 28.69 ? 108  MET A N   1 
ATOM   882  C CA  . MET A 1 108 ? 64.077  37.473  64.780 1.00 32.17 ? 108  MET A CA  1 
ATOM   883  C C   . MET A 1 108 ? 65.496  37.979  65.033 1.00 32.71 ? 108  MET A C   1 
ATOM   884  O O   . MET A 1 108 ? 65.932  38.052  66.179 1.00 28.60 ? 108  MET A O   1 
ATOM   885  C CB  . MET A 1 108 ? 64.086  35.967  64.577 1.00 35.06 ? 108  MET A CB  1 
ATOM   886  C CG  . MET A 1 108 ? 63.241  35.238  65.588 1.00 40.58 ? 108  MET A CG  1 
ATOM   887  S SD  . MET A 1 108 ? 62.483  33.808  64.849 1.00 54.18 ? 108  MET A SD  1 
ATOM   888  C CE  . MET A 1 108 ? 63.922  33.021  64.029 1.00 48.29 ? 108  MET A CE  1 
ATOM   889  N N   . ALA A 1 109 ? 66.184  38.392  63.974 1.00 36.61 ? 109  ALA A N   1 
ATOM   890  C CA  . ALA A 1 109 ? 67.522  38.968  64.099 1.00 31.23 ? 109  ALA A CA  1 
ATOM   891  C C   . ALA A 1 109 ? 67.478  40.294  64.854 1.00 30.98 ? 109  ALA A C   1 
ATOM   892  O O   . ALA A 1 109 ? 68.380  40.608  65.635 1.00 34.29 ? 109  ALA A O   1 
ATOM   893  C CB  . ALA A 1 109 ? 68.133  39.176  62.722 1.00 26.46 ? 109  ALA A CB  1 
ATOM   894  N N   . PHE A 1 110 ? 66.425  41.063  64.597 1.00 28.16 ? 110  PHE A N   1 
ATOM   895  C CA  . PHE A 1 110 ? 66.159  42.325  65.279 1.00 26.53 ? 110  PHE A CA  1 
ATOM   896  C C   . PHE A 1 110 ? 65.809  42.095  66.757 1.00 28.00 ? 110  PHE A C   1 
ATOM   897  O O   . PHE A 1 110 ? 66.312  42.794  67.638 1.00 34.48 ? 110  PHE A O   1 
ATOM   898  C CB  . PHE A 1 110 ? 65.011  43.026  64.545 1.00 29.94 ? 110  PHE A CB  1 
ATOM   899  C CG  . PHE A 1 110 ? 64.571  44.314  65.169 1.00 26.21 ? 110  PHE A CG  1 
ATOM   900  C CD1 . PHE A 1 110 ? 65.481  45.349  65.375 1.00 32.86 ? 110  PHE A CD1 1 
ATOM   901  C CD2 . PHE A 1 110 ? 63.221  44.539  65.426 1.00 25.34 ? 110  PHE A CD2 1 
ATOM   902  C CE1 . PHE A 1 110 ? 65.051  46.595  65.819 1.00 33.78 ? 110  PHE A CE1 1 
ATOM   903  C CE2 . PHE A 1 110 ? 62.775  45.779  65.867 1.00 31.61 ? 110  PHE A CE2 1 
ATOM   904  C CZ  . PHE A 1 110 ? 63.688  46.813  66.064 1.00 34.93 ? 110  PHE A CZ  1 
ATOM   905  N N   . ALA A 1 111 ? 64.977  41.089  67.021 1.00 25.85 ? 111  ALA A N   1 
ATOM   906  C CA  . ALA A 1 111 ? 64.543  40.769  68.379 1.00 25.03 ? 111  ALA A CA  1 
ATOM   907  C C   . ALA A 1 111 ? 65.737  40.376  69.222 1.00 33.93 ? 111  ALA A C   1 
ATOM   908  O O   . ALA A 1 111 ? 65.884  40.840  70.353 1.00 36.13 ? 111  ALA A O   1 
ATOM   909  C CB  . ALA A 1 111 ? 63.543  39.633  68.353 1.00 26.80 ? 111  ALA A CB  1 
ATOM   910  N N   . ARG A 1 112 ? 66.600  39.540  68.643 1.00 41.34 ? 112  ARG A N   1 
ATOM   911  C CA  . ARG A 1 112 ? 67.835  39.096  69.291 1.00 41.71 ? 112  ARG A CA  1 
ATOM   912  C C   . ARG A 1 112 ? 68.635  40.271  69.822 1.00 37.70 ? 112  ARG A C   1 
ATOM   913  O O   . ARG A 1 112 ? 69.052  40.269  70.977 1.00 40.44 ? 112  ARG A O   1 
ATOM   914  C CB  . ARG A 1 112 ? 68.712  38.317  68.305 1.00 44.09 ? 112  ARG A CB  1 
ATOM   915  C CG  . ARG A 1 112 ? 68.411  36.837  68.245 1.00 50.86 ? 112  ARG A CG  1 
ATOM   916  C CD  . ARG A 1 112 ? 68.921  36.234  66.952 1.00 55.74 ? 112  ARG A CD  1 
ATOM   917  N NE  . ARG A 1 112 ? 68.210  35.000  66.629 1.00 55.76 ? 112  ARG A NE  1 
ATOM   918  C CZ  . ARG A 1 112 ? 67.830  34.652  65.404 1.00 57.60 ? 112  ARG A CZ  1 
ATOM   919  N NH1 . ARG A 1 112 ? 68.093  35.445  64.369 1.00 59.42 ? 112  ARG A NH1 1 
ATOM   920  N NH2 . ARG A 1 112 ? 67.187  33.508  65.212 1.00 58.21 ? 112  ARG A NH2 1 
ATOM   921  N N   . LEU A 1 113 ? 68.834  41.274  68.969 1.00 35.00 ? 113  LEU A N   1 
ATOM   922  C CA  . LEU A 1 113 ? 69.589  42.468  69.338 1.00 24.40 ? 113  LEU A CA  1 
ATOM   923  C C   . LEU A 1 113 ? 68.941  43.211  70.500 1.00 32.86 ? 113  LEU A C   1 
ATOM   924  O O   . LEU A 1 113 ? 69.610  43.528  71.489 1.00 44.78 ? 113  LEU A O   1 
ATOM   925  C CB  . LEU A 1 113 ? 69.731  43.415  68.143 1.00 14.48 ? 113  LEU A CB  1 
ATOM   926  C CG  . LEU A 1 113 ? 70.056  44.879  68.457 1.00 13.26 ? 113  LEU A CG  1 
ATOM   927  C CD1 . LEU A 1 113 ? 71.497  44.999  68.865 1.00 28.52 ? 113  LEU A CD1 1 
ATOM   928  C CD2 . LEU A 1 113 ? 69.774  45.772  67.257 1.00 13.70 ? 113  LEU A CD2 1 
ATOM   929  N N   . CYS A 1 114 ? 67.637  43.454  70.401 1.00 30.87 ? 114  CYS A N   1 
ATOM   930  C CA  . CYS A 1 114 ? 66.954  44.324  71.350 1.00 28.75 ? 114  CYS A CA  1 
ATOM   931  C C   . CYS A 1 114 ? 66.667  43.664  72.697 1.00 27.00 ? 114  CYS A C   1 
ATOM   932  O O   . CYS A 1 114 ? 66.336  44.341  73.666 1.00 32.68 ? 114  CYS A O   1 
ATOM   933  C CB  . CYS A 1 114 ? 65.668  44.855  70.723 1.00 26.87 ? 114  CYS A CB  1 
ATOM   934  S SG  . CYS A 1 114 ? 65.976  46.006  69.360 1.00 35.24 ? 114  CYS A SG  1 
ATOM   935  N N   . TYR A 1 115 ? 66.849  42.352  72.772 1.00 24.15 ? 115  TYR A N   1 
ATOM   936  C CA  . TYR A 1 115 ? 66.699  41.644  74.034 1.00 39.42 ? 115  TYR A CA  1 
ATOM   937  C C   . TYR A 1 115 ? 68.054  41.345  74.674 1.00 43.94 ? 115  TYR A C   1 
ATOM   938  O O   . TYR A 1 115 ? 68.124  41.047  75.866 1.00 47.13 ? 115  TYR A O   1 
ATOM   939  C CB  . TYR A 1 115 ? 65.918  40.342  73.832 1.00 45.55 ? 115  TYR A CB  1 
ATOM   940  C CG  . TYR A 1 115 ? 64.415  40.519  73.691 1.00 56.41 ? 115  TYR A CG  1 
ATOM   941  C CD1 . TYR A 1 115 ? 63.632  40.920  74.779 1.00 60.39 ? 115  TYR A CD1 1 
ATOM   942  C CD2 . TYR A 1 115 ? 63.766  40.201  72.495 1.00 61.86 ? 115  TYR A CD2 1 
ATOM   943  C CE1 . TYR A 1 115 ? 62.241  40.990  74.680 1.00 63.08 ? 115  TYR A CE1 1 
ATOM   944  C CE2 . TYR A 1 115 ? 62.384  40.269  72.385 1.00 62.09 ? 115  TYR A CE2 1 
ATOM   945  C CZ  . TYR A 1 115 ? 61.625  40.658  73.479 1.00 64.29 ? 115  TYR A CZ  1 
ATOM   946  O OH  . TYR A 1 115 ? 60.250  40.667  73.378 1.00 66.21 ? 115  TYR A OH  1 
ATOM   947  N N   . SER A 1 116 ? 69.125  41.463  73.887 1.00 44.55 ? 116  SER A N   1 
ATOM   948  C CA  . SER A 1 116 ? 70.491  41.200  74.349 1.00 41.10 ? 116  SER A CA  1 
ATOM   949  C C   . SER A 1 116 ? 70.965  42.314  75.281 1.00 42.39 ? 116  SER A C   1 
ATOM   950  O O   . SER A 1 116 ? 70.863  43.494  74.939 1.00 37.25 ? 116  SER A O   1 
ATOM   951  C CB  . SER A 1 116 ? 71.436  41.106  73.143 1.00 37.66 ? 116  SER A CB  1 
ATOM   952  O OG  . SER A 1 116 ? 72.743  40.729  73.531 1.00 36.51 ? 116  SER A OG  1 
ATOM   953  N N   . PRO A 1 117 ? 71.492  41.954  76.469 1.00 45.46 ? 117  PRO A N   1 
ATOM   954  C CA  . PRO A 1 117 ? 72.116  42.938  77.367 1.00 43.25 ? 117  PRO A CA  1 
ATOM   955  C C   . PRO A 1 117 ? 73.359  43.616  76.771 1.00 44.23 ? 117  PRO A C   1 
ATOM   956  O O   . PRO A 1 117 ? 73.618  44.795  77.039 1.00 45.12 ? 117  PRO A O   1 
ATOM   957  C CB  . PRO A 1 117 ? 72.436  42.124  78.622 1.00 43.26 ? 117  PRO A CB  1 
ATOM   958  C CG  . PRO A 1 117 ? 72.478  40.702  78.154 1.00 45.46 ? 117  PRO A CG  1 
ATOM   959  C CD  . PRO A 1 117 ? 71.443  40.613  77.079 1.00 43.78 ? 117  PRO A CD  1 
ATOM   960  N N   . ASP A 1 118 ? 74.011  42.924  75.835 1.00 42.45 ? 118  ASP A N   1 
ATOM   961  C CA  . ASP A 1 118 ? 75.138  43.475  75.071 1.00 43.72 ? 118  ASP A CA  1 
ATOM   962  C C   . ASP A 1 118 ? 74.622  44.377  73.948 1.00 42.31 ? 118  ASP A C   1 
ATOM   963  O O   . ASP A 1 118 ? 75.299  44.567  72.937 1.00 41.77 ? 118  ASP A O   1 
ATOM   964  C CB  . ASP A 1 118 ? 75.982  42.342  74.445 1.00 43.50 ? 118  ASP A CB  1 
ATOM   965  C CG  . ASP A 1 118 ? 76.697  41.466  75.484 1.00 49.53 ? 118  ASP A CG  1 
ATOM   966  O OD1 . ASP A 1 118 ? 76.280  41.423  76.665 1.00 57.17 ? 118  ASP A OD1 1 
ATOM   967  O OD2 . ASP A 1 118 ? 77.658  40.767  75.095 1.00 49.50 ? 118  ASP A OD2 1 
ATOM   968  N N   . PHE A 1 119 ? 73.420  44.918  74.130 1.00 36.34 ? 119  PHE A N   1 
ATOM   969  C CA  . PHE A 1 119 ? 72.724  45.646  73.078 1.00 35.32 ? 119  PHE A CA  1 
ATOM   970  C C   . PHE A 1 119 ? 73.604  46.723  72.440 1.00 32.44 ? 119  PHE A C   1 
ATOM   971  O O   . PHE A 1 119 ? 73.823  46.717  71.229 1.00 32.95 ? 119  PHE A O   1 
ATOM   972  C CB  . PHE A 1 119 ? 71.441  46.263  73.649 1.00 37.44 ? 119  PHE A CB  1 
ATOM   973  C CG  . PHE A 1 119 ? 70.758  47.218  72.718 1.00 42.55 ? 119  PHE A CG  1 
ATOM   974  C CD1 . PHE A 1 119 ? 69.946  46.751  71.696 1.00 48.61 ? 119  PHE A CD1 1 
ATOM   975  C CD2 . PHE A 1 119 ? 70.981  48.588  72.821 1.00 43.10 ? 119  PHE A CD2 1 
ATOM   976  C CE1 . PHE A 1 119 ? 69.374  47.633  70.782 1.00 47.97 ? 119  PHE A CE1 1 
ATOM   977  C CE2 . PHE A 1 119 ? 70.416  49.475  71.912 1.00 40.89 ? 119  PHE A CE2 1 
ATOM   978  C CZ  . PHE A 1 119 ? 69.613  48.996  70.889 1.00 42.48 ? 119  PHE A CZ  1 
ATOM   979  N N   . GLU A 1 120 ? 74.203  47.561  73.279 1.00 41.72 ? 120  GLU A N   1 
ATOM   980  C CA  . GLU A 1 120 ? 74.984  48.702  72.812 1.00 46.66 ? 120  GLU A CA  1 
ATOM   981  C C   . GLU A 1 120 ? 76.213  48.270  72.022 1.00 44.52 ? 120  GLU A C   1 
ATOM   982  O O   . GLU A 1 120 ? 76.570  48.897  71.029 1.00 44.32 ? 120  GLU A O   1 
ATOM   983  C CB  . GLU A 1 120 ? 75.409  49.569  74.000 1.00 54.01 ? 120  GLU A CB  1 
ATOM   984  C CG  . GLU A 1 120 ? 74.989  51.037  73.887 1.00 62.11 ? 120  GLU A CG  1 
ATOM   985  C CD  . GLU A 1 120 ? 73.527  51.269  74.234 1.00 62.12 ? 120  GLU A CD  1 
ATOM   986  O OE1 . GLU A 1 120 ? 73.104  50.857  75.341 1.00 60.79 ? 120  GLU A OE1 1 
ATOM   987  O OE2 . GLU A 1 120 ? 72.817  51.895  73.416 1.00 59.53 ? 120  GLU A OE2 1 
ATOM   988  N N   . LYS A 1 121 ? 76.820  47.166  72.440 1.00 46.72 ? 121  LYS A N   1 
ATOM   989  C CA  . LYS A 1 121 ? 77.997  46.619  71.769 1.00 52.91 ? 121  LYS A CA  1 
ATOM   990  C C   . LYS A 1 121 ? 77.633  46.084  70.384 1.00 52.80 ? 121  LYS A C   1 
ATOM   991  O O   . LYS A 1 121 ? 78.445  46.140  69.457 1.00 56.24 ? 121  LYS A O   1 
ATOM   992  C CB  . LYS A 1 121 ? 78.614  45.497  72.629 1.00 55.80 ? 121  LYS A CB  1 
ATOM   993  C CG  . LYS A 1 121 ? 79.672  44.632  71.931 1.00 60.70 ? 121  LYS A CG  1 
ATOM   994  C CD  . LYS A 1 121 ? 79.845  43.273  72.623 1.00 56.98 ? 121  LYS A CD  1 
ATOM   995  C CE  . LYS A 1 121 ? 80.177  42.179  71.614 1.00 56.09 ? 121  LYS A CE  1 
ATOM   996  N NZ  . LYS A 1 121 ? 80.197  40.820  72.219 1.00 55.55 ? 121  LYS A NZ  1 
ATOM   997  N N   . LEU A 1 122 ? 76.391  45.621  70.240 1.00 45.94 ? 122  LEU A N   1 
ATOM   998  C CA  . LEU A 1 122 ? 75.956  44.925  69.028 1.00 40.45 ? 122  LEU A CA  1 
ATOM   999  C C   . LEU A 1 122 ? 75.248  45.843  68.037 1.00 34.10 ? 122  LEU A C   1 
ATOM   1000 O O   . LEU A 1 122 ? 75.179  45.543  66.842 1.00 28.74 ? 122  LEU A O   1 
ATOM   1001 C CB  . LEU A 1 122 ? 75.041  43.750  69.391 1.00 37.99 ? 122  LEU A CB  1 
ATOM   1002 C CG  . LEU A 1 122 ? 75.647  42.649  70.271 1.00 39.84 ? 122  LEU A CG  1 
ATOM   1003 C CD1 . LEU A 1 122 ? 74.569  41.646  70.642 1.00 35.99 ? 122  LEU A CD1 1 
ATOM   1004 C CD2 . LEU A 1 122 ? 76.812  41.965  69.548 1.00 36.58 ? 122  LEU A CD2 1 
ATOM   1005 N N   . LYS A 1 123 ? 74.811  47.000  68.524 1.00 28.92 ? 123  LYS A N   1 
ATOM   1006 C CA  . LYS A 1 123 ? 74.064  47.947  67.704 1.00 35.02 ? 123  LYS A CA  1 
ATOM   1007 C C   . LYS A 1 123 ? 74.782  48.360  66.408 1.00 37.24 ? 123  LYS A C   1 
ATOM   1008 O O   . LYS A 1 123 ? 74.212  48.228  65.328 1.00 40.50 ? 123  LYS A O   1 
ATOM   1009 C CB  . LYS A 1 123 ? 73.699  49.182  68.533 1.00 33.79 ? 123  LYS A CB  1 
ATOM   1010 C CG  . LYS A 1 123 ? 72.678  50.092  67.888 1.00 35.12 ? 123  LYS A CG  1 
ATOM   1011 C CD  . LYS A 1 123 ? 72.652  51.438  68.594 1.00 40.50 ? 123  LYS A CD  1 
ATOM   1012 C CE  . LYS A 1 123 ? 71.783  52.437  67.850 1.00 40.65 ? 123  LYS A CE  1 
ATOM   1013 N NZ  . LYS A 1 123 ? 72.279  53.838  68.002 1.00 43.19 ? 123  LYS A NZ  1 
ATOM   1014 N N   . PRO A 1 124 ? 76.057  48.796  66.487 1.00 36.85 ? 124  PRO A N   1 
ATOM   1015 C CA  . PRO A 1 124 ? 76.788  49.196  65.274 1.00 34.70 ? 124  PRO A CA  1 
ATOM   1016 C C   . PRO A 1 124 ? 76.880  48.118  64.201 1.00 39.25 ? 124  PRO A C   1 
ATOM   1017 O O   . PRO A 1 124 ? 76.721  48.412  63.016 1.00 43.09 ? 124  PRO A O   1 
ATOM   1018 C CB  . PRO A 1 124 ? 78.175  49.574  65.794 1.00 40.39 ? 124  PRO A CB  1 
ATOM   1019 C CG  . PRO A 1 124 ? 78.274  48.904  67.140 1.00 47.87 ? 124  PRO A CG  1 
ATOM   1020 C CD  . PRO A 1 124 ? 76.885  48.990  67.690 1.00 43.09 ? 124  PRO A CD  1 
ATOM   1021 N N   . ALA A 1 125 ? 77.118  46.874  64.621 1.00 33.24 ? 125  ALA A N   1 
ATOM   1022 C CA  . ALA A 1 125 ? 77.232  45.743  63.698 1.00 29.29 ? 125  ALA A CA  1 
ATOM   1023 C C   . ALA A 1 125 ? 75.938  45.528  62.915 1.00 34.36 ? 125  ALA A C   1 
ATOM   1024 O O   . ALA A 1 125 ? 75.957  45.380  61.688 1.00 30.76 ? 125  ALA A O   1 
ATOM   1025 C CB  . ALA A 1 125 ? 77.597  44.475  64.465 1.00 27.02 ? 125  ALA A CB  1 
ATOM   1026 N N   . TYR A 1 126 ? 74.818  45.575  63.637 1.00 36.13 ? 126  TYR A N   1 
ATOM   1027 C CA  . TYR A 1 126 ? 73.485  45.456  63.053 1.00 39.22 ? 126  TYR A CA  1 
ATOM   1028 C C   . TYR A 1 126 ? 73.232  46.538  62.004 1.00 38.32 ? 126  TYR A C   1 
ATOM   1029 O O   . TYR A 1 126 ? 72.795  46.234  60.899 1.00 39.20 ? 126  TYR A O   1 
ATOM   1030 C CB  . TYR A 1 126 ? 72.425  45.541  64.164 1.00 44.52 ? 126  TYR A CB  1 
ATOM   1031 C CG  . TYR A 1 126 ? 70.992  45.362  63.697 1.00 44.98 ? 126  TYR A CG  1 
ATOM   1032 C CD1 . TYR A 1 126 ? 70.456  44.089  63.500 1.00 43.10 ? 126  TYR A CD1 1 
ATOM   1033 C CD2 . TYR A 1 126 ? 70.199  46.467  63.374 1.00 48.60 ? 126  TYR A CD2 1 
ATOM   1034 C CE1 . TYR A 1 126 ? 69.173  43.920  62.975 1.00 46.24 ? 126  TYR A CE1 1 
ATOM   1035 C CE2 . TYR A 1 126 ? 68.917  46.307  62.846 1.00 50.73 ? 126  TYR A CE2 1 
ATOM   1036 C CZ  . TYR A 1 126 ? 68.413  45.032  62.642 1.00 46.05 ? 126  TYR A CZ  1 
ATOM   1037 O OH  . TYR A 1 126 ? 67.175  44.869  62.057 1.00 46.46 ? 126  TYR A OH  1 
ATOM   1038 N N   . LEU A 1 127 ? 73.588  47.780  62.328 1.00 36.18 ? 127  LEU A N   1 
ATOM   1039 C CA  . LEU A 1 127 ? 73.316  48.922  61.454 1.00 37.79 ? 127  LEU A CA  1 
ATOM   1040 C C   . LEU A 1 127 ? 74.186  48.977  60.193 1.00 41.88 ? 127  LEU A C   1 
ATOM   1041 O O   . LEU A 1 127 ? 73.887  49.731  59.266 1.00 40.24 ? 127  LEU A O   1 
ATOM   1042 C CB  . LEU A 1 127 ? 73.458  50.225  62.236 1.00 29.96 ? 127  LEU A CB  1 
ATOM   1043 C CG  . LEU A 1 127 ? 72.636  50.274  63.525 1.00 34.82 ? 127  LEU A CG  1 
ATOM   1044 C CD1 . LEU A 1 127 ? 72.988  51.513  64.320 1.00 37.00 ? 127  LEU A CD1 1 
ATOM   1045 C CD2 . LEU A 1 127 ? 71.159  50.254  63.205 1.00 38.27 ? 127  LEU A CD2 1 
ATOM   1046 N N   . GLU A 1 128 ? 75.253  48.179  60.156 1.00 43.78 ? 128  GLU A N   1 
ATOM   1047 C CA  . GLU A 1 128 ? 76.090  48.062  58.959 1.00 51.14 ? 128  GLU A CA  1 
ATOM   1048 C C   . GLU A 1 128 ? 75.434  47.133  57.941 1.00 50.00 ? 128  GLU A C   1 
ATOM   1049 O O   . GLU A 1 128 ? 75.362  47.450  56.749 1.00 54.45 ? 128  GLU A O   1 
ATOM   1050 C CB  . GLU A 1 128 ? 77.475  47.505  59.312 1.00 57.92 ? 128  GLU A CB  1 
ATOM   1051 C CG  . GLU A 1 128 ? 78.207  48.245  60.430 1.00 70.21 ? 128  GLU A CG  1 
ATOM   1052 C CD  . GLU A 1 128 ? 79.428  49.025  59.956 1.00 76.16 ? 128  GLU A CD  1 
ATOM   1053 O OE1 . GLU A 1 128 ? 79.971  48.701  58.875 1.00 76.10 ? 128  GLU A OE1 1 
ATOM   1054 O OE2 . GLU A 1 128 ? 79.860  49.948  60.685 1.00 77.47 ? 128  GLU A OE2 1 
ATOM   1055 N N   . LEU A 1 129 ? 74.974  45.982  58.429 1.00 41.40 ? 129  LEU A N   1 
ATOM   1056 C CA  . LEU A 1 129 ? 74.363  44.951  57.599 1.00 36.70 ? 129  LEU A CA  1 
ATOM   1057 C C   . LEU A 1 129 ? 72.931  45.295  57.155 1.00 35.13 ? 129  LEU A C   1 
ATOM   1058 O O   . LEU A 1 129 ? 72.428  44.727  56.186 1.00 33.51 ? 129  LEU A O   1 
ATOM   1059 C CB  . LEU A 1 129 ? 74.397  43.614  58.363 1.00 36.82 ? 129  LEU A CB  1 
ATOM   1060 C CG  . LEU A 1 129 ? 73.321  42.533  58.179 1.00 42.07 ? 129  LEU A CG  1 
ATOM   1061 C CD1 . LEU A 1 129 ? 73.974  41.158  58.085 1.00 40.14 ? 129  LEU A CD1 1 
ATOM   1062 C CD2 . LEU A 1 129 ? 72.332  42.581  59.347 1.00 40.13 ? 129  LEU A CD2 1 
ATOM   1063 N N   . LEU A 1 130 ? 72.325  46.292  57.798 1.00 32.70 ? 130  LEU A N   1 
ATOM   1064 C CA  . LEU A 1 130 ? 70.907  46.581  57.602 1.00 32.88 ? 130  LEU A CA  1 
ATOM   1065 C C   . LEU A 1 130 ? 70.592  47.235  56.261 1.00 33.86 ? 130  LEU A C   1 
ATOM   1066 O O   . LEU A 1 130 ? 69.673  46.809  55.570 1.00 34.57 ? 130  LEU A O   1 
ATOM   1067 C CB  . LEU A 1 130 ? 70.365  47.436  58.755 1.00 33.54 ? 130  LEU A CB  1 
ATOM   1068 C CG  . LEU A 1 130 ? 68.865  47.467  59.107 1.00 34.65 ? 130  LEU A CG  1 
ATOM   1069 C CD1 . LEU A 1 130 ? 68.320  48.833  58.745 1.00 40.40 ? 130  LEU A CD1 1 
ATOM   1070 C CD2 . LEU A 1 130 ? 68.064  46.351  58.415 1.00 32.95 ? 130  LEU A CD2 1 
ATOM   1071 N N   . PRO A 1 131 ? 71.354  48.266  55.864 1.00 34.10 ? 131  PRO A N   1 
ATOM   1072 C CA  . PRO A 1 131 ? 71.121  48.881  54.553 1.00 27.16 ? 131  PRO A CA  1 
ATOM   1073 C C   . PRO A 1 131 ? 71.088  47.873  53.412 1.00 21.72 ? 131  PRO A C   1 
ATOM   1074 O O   . PRO A 1 131 ? 70.282  47.996  52.495 1.00 24.05 ? 131  PRO A O   1 
ATOM   1075 C CB  . PRO A 1 131 ? 72.286  49.853  54.417 1.00 26.67 ? 131  PRO A CB  1 
ATOM   1076 C CG  . PRO A 1 131 ? 72.572  50.249  55.834 1.00 28.84 ? 131  PRO A CG  1 
ATOM   1077 C CD  . PRO A 1 131 ? 72.385  48.992  56.628 1.00 34.40 ? 131  PRO A CD  1 
ATOM   1078 N N   . GLY A 1 132 ? 71.928  46.847  53.505 1.00 22.90 ? 132  GLY A N   1 
ATOM   1079 C CA  . GLY A 1 132 ? 71.984  45.833  52.462 1.00 26.51 ? 132  GLY A CA  1 
ATOM   1080 C C   . GLY A 1 132 ? 70.757  44.941  52.440 1.00 28.14 ? 132  GLY A C   1 
ATOM   1081 O O   . GLY A 1 132 ? 70.266  44.572  51.372 1.00 25.91 ? 132  GLY A O   1 
ATOM   1082 N N   . LYS A 1 133 ? 70.257  44.611  53.629 1.00 30.73 ? 133  LYS A N   1 
ATOM   1083 C CA  . LYS A 1 133 ? 69.021  43.849  53.777 1.00 33.51 ? 133  LYS A CA  1 
ATOM   1084 C C   . LYS A 1 133 ? 67.834  44.630  53.215 1.00 28.72 ? 133  LYS A C   1 
ATOM   1085 O O   . LYS A 1 133 ? 66.987  44.072  52.516 1.00 29.68 ? 133  LYS A O   1 
ATOM   1086 C CB  . LYS A 1 133 ? 68.759  43.512  55.257 1.00 35.13 ? 133  LYS A CB  1 
ATOM   1087 C CG  . LYS A 1 133 ? 69.808  42.627  55.935 1.00 34.81 ? 133  LYS A CG  1 
ATOM   1088 C CD  . LYS A 1 133 ? 70.018  41.311  55.204 1.00 35.52 ? 133  LYS A CD  1 
ATOM   1089 C CE  . LYS A 1 133 ? 71.505  41.037  54.996 1.00 44.80 ? 133  LYS A CE  1 
ATOM   1090 N NZ  . LYS A 1 133 ? 72.238  42.181  54.352 1.00 45.80 ? 133  LYS A NZ  1 
ATOM   1091 N N   . LEU A 1 134 ? 67.825  45.936  53.459 1.00 20.17 ? 134  LEU A N   1 
ATOM   1092 C CA  . LEU A 1 134 ? 66.769  46.798  52.948 1.00 17.25 ? 134  LEU A CA  1 
ATOM   1093 C C   . LEU A 1 134 ? 66.825  47.001  51.434 1.00 20.98 ? 134  LEU A C   1 
ATOM   1094 O O   . LEU A 1 134 ? 65.785  47.174  50.794 1.00 20.66 ? 134  LEU A O   1 
ATOM   1095 C CB  . LEU A 1 134 ? 66.806  48.152  53.655 1.00 12.80 ? 134  LEU A CB  1 
ATOM   1096 C CG  . LEU A 1 134 ? 66.508  48.084  55.153 1.00 17.44 ? 134  LEU A CG  1 
ATOM   1097 C CD1 . LEU A 1 134 ? 66.551  49.480  55.705 1.00 16.41 ? 134  LEU A CD1 1 
ATOM   1098 C CD2 . LEU A 1 134 ? 65.149  47.415  55.424 1.00 16.01 ? 134  LEU A CD2 1 
ATOM   1099 N N   . ARG A 1 135 ? 68.033  46.982  50.867 1.00 25.17 ? 135  ARG A N   1 
ATOM   1100 C CA  . ARG A 1 135 ? 68.201  47.132  49.423 1.00 29.05 ? 135  ARG A CA  1 
ATOM   1101 C C   . ARG A 1 135 ? 67.746  45.876  48.677 1.00 28.18 ? 135  ARG A C   1 
ATOM   1102 O O   . ARG A 1 135 ? 67.319  45.954  47.525 1.00 29.59 ? 135  ARG A O   1 
ATOM   1103 C CB  . ARG A 1 135 ? 69.662  47.458  49.066 1.00 36.61 ? 135  ARG A CB  1 
ATOM   1104 C CG  . ARG A 1 135 ? 70.025  48.948  49.175 1.00 49.55 ? 135  ARG A CG  1 
ATOM   1105 C CD  . ARG A 1 135 ? 71.127  49.382  48.185 1.00 56.26 ? 135  ARG A CD  1 
ATOM   1106 N NE  . ARG A 1 135 ? 71.336  50.838  48.214 1.00 57.90 ? 135  ARG A NE  1 
ATOM   1107 C CZ  . ARG A 1 135 ? 71.641  51.600  47.158 1.00 56.13 ? 135  ARG A CZ  1 
ATOM   1108 N NH1 . ARG A 1 135 ? 71.965  51.055  45.985 1.00 55.63 ? 135  ARG A NH1 1 
ATOM   1109 N NH2 . ARG A 1 135 ? 71.696  52.921  47.300 1.00 51.93 ? 135  ARG A NH2 1 
ATOM   1110 N N   . GLN A 1 136 ? 67.802  44.729  49.350 1.00 24.82 ? 136  GLN A N   1 
ATOM   1111 C CA  . GLN A 1 136 ? 67.340  43.472  48.763 1.00 18.85 ? 136  GLN A CA  1 
ATOM   1112 C C   . GLN A 1 136 ? 65.823  43.474  48.606 1.00 17.81 ? 136  GLN A C   1 
ATOM   1113 O O   . GLN A 1 136 ? 65.294  43.013  47.594 1.00 16.62 ? 136  GLN A O   1 
ATOM   1114 C CB  . GLN A 1 136 ? 67.756  42.288  49.639 1.00 18.50 ? 136  GLN A CB  1 
ATOM   1115 C CG  . GLN A 1 136 ? 69.237  41.961  49.628 1.00 16.62 ? 136  GLN A CG  1 
ATOM   1116 C CD  . GLN A 1 136 ? 69.602  40.868  50.618 1.00 25.30 ? 136  GLN A CD  1 
ATOM   1117 O OE1 . GLN A 1 136 ? 68.945  40.696  51.650 1.00 27.67 ? 136  GLN A OE1 1 
ATOM   1118 N NE2 . GLN A 1 136 ? 70.656  40.120  50.308 1.00 24.87 ? 136  GLN A NE2 1 
ATOM   1119 N N   . LEU A 1 137 ? 65.142  43.918  49.661 1.00 15.21 ? 137  LEU A N   1 
ATOM   1120 C CA  . LEU A 1 137 ? 63.691  44.098  49.682 1.00 14.90 ? 137  LEU A CA  1 
ATOM   1121 C C   . LEU A 1 137 ? 63.243  45.140  48.668 1.00 15.67 ? 137  LEU A C   1 
ATOM   1122 O O   . LEU A 1 137 ? 62.187  45.008  48.062 1.00 23.47 ? 137  LEU A O   1 
ATOM   1123 C CB  . LEU A 1 137 ? 63.256  44.547  51.076 1.00 10.45 ? 137  LEU A CB  1 
ATOM   1124 C CG  . LEU A 1 137 ? 62.419  43.650  52.000 1.00 9.24  ? 137  LEU A CG  1 
ATOM   1125 C CD1 . LEU A 1 137 ? 62.266  42.259  51.431 1.00 11.65 ? 137  LEU A CD1 1 
ATOM   1126 C CD2 . LEU A 1 137 ? 63.064  43.603  53.374 1.00 2.00  ? 137  LEU A CD2 1 
ATOM   1127 N N   . SER A 1 138 ? 64.008  46.221  48.560 1.00 23.55 ? 138  SER A N   1 
ATOM   1128 C CA  . SER A 1 138 ? 63.713  47.281  47.603 1.00 27.21 ? 138  SER A CA  1 
ATOM   1129 C C   . SER A 1 138 ? 63.796  46.763  46.163 1.00 27.75 ? 138  SER A C   1 
ATOM   1130 O O   . SER A 1 138 ? 62.934  47.067  45.337 1.00 29.99 ? 138  SER A O   1 
ATOM   1131 C CB  . SER A 1 138 ? 64.675  48.458  47.813 1.00 28.39 ? 138  SER A CB  1 
ATOM   1132 O OG  . SER A 1 138 ? 64.576  49.407  46.766 1.00 26.99 ? 138  SER A OG  1 
ATOM   1133 N N   . ARG A 1 139 ? 64.799  45.939  45.877 1.00 25.95 ? 139  ARG A N   1 
ATOM   1134 C CA  . ARG A 1 139 ? 64.939  45.384  44.540 1.00 28.32 ? 139  ARG A CA  1 
ATOM   1135 C C   . ARG A 1 139 ? 63.805  44.404  44.235 1.00 31.21 ? 139  ARG A C   1 
ATOM   1136 O O   . ARG A 1 139 ? 63.223  44.460  43.154 1.00 28.33 ? 139  ARG A O   1 
ATOM   1137 C CB  . ARG A 1 139 ? 66.300  44.703  44.376 1.00 30.04 ? 139  ARG A CB  1 
ATOM   1138 C CG  . ARG A 1 139 ? 67.240  45.380  43.377 1.00 40.90 ? 139  ARG A CG  1 
ATOM   1139 C CD  . ARG A 1 139 ? 68.137  44.360  42.659 1.00 44.52 ? 139  ARG A CD  1 
ATOM   1140 N NE  . ARG A 1 139 ? 68.625  43.312  43.556 1.00 41.79 ? 139  ARG A NE  1 
ATOM   1141 C CZ  . ARG A 1 139 ? 68.492  42.006  43.335 1.00 49.45 ? 139  ARG A CZ  1 
ATOM   1142 N NH1 . ARG A 1 139 ? 68.092  41.558  42.149 1.00 47.22 ? 139  ARG A NH1 1 
ATOM   1143 N NH2 . ARG A 1 139 ? 68.841  41.141  44.281 1.00 51.41 ? 139  ARG A NH2 1 
ATOM   1144 N N   . PHE A 1 140 ? 63.410  43.610  45.231 1.00 29.73 ? 140  PHE A N   1 
ATOM   1145 C CA  . PHE A 1 140 ? 62.386  42.585  45.042 1.00 22.61 ? 140  PHE A CA  1 
ATOM   1146 C C   . PHE A 1 140 ? 61.032  43.194  44.699 1.00 28.40 ? 140  PHE A C   1 
ATOM   1147 O O   . PHE A 1 140 ? 60.426  42.837  43.683 1.00 36.17 ? 140  PHE A O   1 
ATOM   1148 C CB  . PHE A 1 140 ? 62.256  41.715  46.295 1.00 26.33 ? 140  PHE A CB  1 
ATOM   1149 C CG  . PHE A 1 140 ? 61.327  40.541  46.124 1.00 24.54 ? 140  PHE A CG  1 
ATOM   1150 C CD1 . PHE A 1 140 ? 61.646  39.507  45.257 1.00 24.42 ? 140  PHE A CD1 1 
ATOM   1151 C CD2 . PHE A 1 140 ? 60.128  40.478  46.824 1.00 23.40 ? 140  PHE A CD2 1 
ATOM   1152 C CE1 . PHE A 1 140 ? 60.790  38.432  45.086 1.00 25.02 ? 140  PHE A CE1 1 
ATOM   1153 C CE2 . PHE A 1 140 ? 59.262  39.404  46.655 1.00 26.93 ? 140  PHE A CE2 1 
ATOM   1154 C CZ  . PHE A 1 140 ? 59.595  38.378  45.785 1.00 29.43 ? 140  PHE A CZ  1 
ATOM   1155 N N   . LEU A 1 141 ? 60.562  44.114  45.544 1.00 25.09 ? 141  LEU A N   1 
ATOM   1156 C CA  . LEU A 1 141 ? 59.299  44.800  45.301 1.00 18.61 ? 141  LEU A CA  1 
ATOM   1157 C C   . LEU A 1 141 ? 59.314  45.532  43.950 1.00 20.50 ? 141  LEU A C   1 
ATOM   1158 O O   . LEU A 1 141 ? 58.386  45.400  43.163 1.00 28.10 ? 141  LEU A O   1 
ATOM   1159 C CB  . LEU A 1 141 ? 59.003  45.769  46.447 1.00 10.04 ? 141  LEU A CB  1 
ATOM   1160 C CG  . LEU A 1 141 ? 57.778  46.685  46.334 1.00 9.52  ? 141  LEU A CG  1 
ATOM   1161 C CD1 . LEU A 1 141 ? 56.542  45.905  45.966 1.00 4.46  ? 141  LEU A CD1 1 
ATOM   1162 C CD2 . LEU A 1 141 ? 57.579  47.397  47.650 1.00 14.94 ? 141  LEU A CD2 1 
ATOM   1163 N N   . GLY A 1 142 ? 60.404  46.233  43.658 1.00 23.58 ? 142  GLY A N   1 
ATOM   1164 C CA  . GLY A 1 142 ? 60.535  46.899  42.373 1.00 20.77 ? 142  GLY A CA  1 
ATOM   1165 C C   . GLY A 1 142 ? 59.542  48.029  42.187 1.00 13.47 ? 142  GLY A C   1 
ATOM   1166 O O   . GLY A 1 142 ? 59.351  48.848  43.082 1.00 20.24 ? 142  GLY A O   1 
ATOM   1167 N N   . SER A 1 143 ? 58.925  48.080  41.011 1.00 20.79 ? 143  SER A N   1 
ATOM   1168 C CA  . SER A 1 143 ? 57.890  49.069  40.725 1.00 24.17 ? 143  SER A CA  1 
ATOM   1169 C C   . SER A 1 143 ? 56.491  48.521  41.016 1.00 22.22 ? 143  SER A C   1 
ATOM   1170 O O   . SER A 1 143 ? 55.491  49.167  40.723 1.00 11.41 ? 143  SER A O   1 
ATOM   1171 C CB  . SER A 1 143 ? 57.981  49.521  39.265 1.00 25.46 ? 143  SER A CB  1 
ATOM   1172 O OG  . SER A 1 143 ? 59.142  50.304  39.049 1.00 33.68 ? 143  SER A OG  1 
ATOM   1173 N N   . ARG A 1 144 ? 56.433  47.357  41.653 1.00 17.48 ? 144  ARG A N   1 
ATOM   1174 C CA  . ARG A 1 144 ? 55.170  46.704  41.949 1.00 19.95 ? 144  ARG A CA  1 
ATOM   1175 C C   . ARG A 1 144 ? 54.376  47.507  42.976 1.00 29.22 ? 144  ARG A C   1 
ATOM   1176 O O   . ARG A 1 144 ? 54.938  48.312  43.724 1.00 27.36 ? 144  ARG A O   1 
ATOM   1177 C CB  . ARG A 1 144 ? 55.438  45.300  42.482 1.00 20.62 ? 144  ARG A CB  1 
ATOM   1178 C CG  . ARG A 1 144 ? 54.548  44.222  41.915 1.00 21.46 ? 144  ARG A CG  1 
ATOM   1179 C CD  . ARG A 1 144 ? 55.319  42.927  41.710 1.00 16.40 ? 144  ARG A CD  1 
ATOM   1180 N NE  . ARG A 1 144 ? 56.102  42.548  42.884 1.00 22.73 ? 144  ARG A NE  1 
ATOM   1181 C CZ  . ARG A 1 144 ? 57.211  41.822  42.827 1.00 26.48 ? 144  ARG A CZ  1 
ATOM   1182 N NH1 . ARG A 1 144 ? 57.615  41.331  41.668 1.00 25.15 ? 144  ARG A NH1 1 
ATOM   1183 N NH2 . ARG A 1 144 ? 57.886  41.544  43.932 1.00 25.88 ? 144  ARG A NH2 1 
ATOM   1184 N N   . SER A 1 145 ? 53.058  47.335  42.967 1.00 29.92 ? 145  SER A N   1 
ATOM   1185 C CA  . SER A 1 145 ? 52.225  47.896  44.017 1.00 31.47 ? 145  SER A CA  1 
ATOM   1186 C C   . SER A 1 145 ? 52.391  47.118  45.321 1.00 30.22 ? 145  SER A C   1 
ATOM   1187 O O   . SER A 1 145 ? 52.699  47.700  46.352 1.00 29.07 ? 145  SER A O   1 
ATOM   1188 C CB  . SER A 1 145 ? 50.758  47.902  43.592 1.00 34.45 ? 145  SER A CB  1 
ATOM   1189 O OG  . SER A 1 145 ? 50.429  49.126  42.960 1.00 36.78 ? 145  SER A OG  1 
ATOM   1190 N N   . TRP A 1 146 ? 52.188  45.804  45.275 1.00 27.90 ? 146  TRP A N   1 
ATOM   1191 C CA  . TRP A 1 146 ? 52.342  44.961  46.457 1.00 18.95 ? 146  TRP A CA  1 
ATOM   1192 C C   . TRP A 1 146 ? 53.496  43.984  46.277 1.00 19.17 ? 146  TRP A C   1 
ATOM   1193 O O   . TRP A 1 146 ? 54.101  43.908  45.208 1.00 26.58 ? 146  TRP A O   1 
ATOM   1194 C CB  . TRP A 1 146 ? 51.050  44.191  46.735 1.00 23.83 ? 146  TRP A CB  1 
ATOM   1195 C CG  . TRP A 1 146 ? 49.843  45.070  46.778 1.00 23.40 ? 146  TRP A CG  1 
ATOM   1196 C CD1 . TRP A 1 146 ? 48.868  45.161  45.828 1.00 23.41 ? 146  TRP A CD1 1 
ATOM   1197 C CD2 . TRP A 1 146 ? 49.592  46.129  47.708 1.00 23.08 ? 146  TRP A CD2 1 
ATOM   1198 N NE1 . TRP A 1 146 ? 48.053  46.232  46.086 1.00 24.70 ? 146  TRP A NE1 1 
ATOM   1199 C CE2 . TRP A 1 146 ? 48.476  46.844  47.237 1.00 22.79 ? 146  TRP A CE2 1 
ATOM   1200 C CE3 . TRP A 1 146 ? 50.225  46.560  48.883 1.00 22.34 ? 146  TRP A CE3 1 
ATOM   1201 C CZ2 . TRP A 1 146 ? 47.978  47.968  47.898 1.00 20.29 ? 146  TRP A CZ2 1 
ATOM   1202 C CZ3 . TRP A 1 146 ? 49.736  47.675  49.530 1.00 10.61 ? 146  TRP A CZ3 1 
ATOM   1203 C CH2 . TRP A 1 146 ? 48.624  48.366  49.039 1.00 16.22 ? 146  TRP A CH2 1 
ATOM   1204 N N   . PHE A 1 147 ? 53.753  43.184  47.303 1.00 16.14 ? 147  PHE A N   1 
ATOM   1205 C CA  . PHE A 1 147 ? 54.969  42.385  47.350 1.00 9.54  ? 147  PHE A CA  1 
ATOM   1206 C C   . PHE A 1 147 ? 54.921  41.105  46.532 1.00 14.80 ? 147  PHE A C   1 
ATOM   1207 O O   . PHE A 1 147 ? 55.954  40.636  46.057 1.00 26.69 ? 147  PHE A O   1 
ATOM   1208 C CB  . PHE A 1 147 ? 55.331  42.067  48.804 1.00 14.33 ? 147  PHE A CB  1 
ATOM   1209 C CG  . PHE A 1 147 ? 56.479  42.883  49.329 1.00 15.08 ? 147  PHE A CG  1 
ATOM   1210 C CD1 . PHE A 1 147 ? 57.774  42.664  48.859 1.00 13.86 ? 147  PHE A CD1 1 
ATOM   1211 C CD2 . PHE A 1 147 ? 56.252  43.956  50.188 1.00 14.50 ? 147  PHE A CD2 1 
ATOM   1212 C CE1 . PHE A 1 147 ? 58.821  43.504  49.221 1.00 13.05 ? 147  PHE A CE1 1 
ATOM   1213 C CE2 . PHE A 1 147 ? 57.295  44.809  50.559 1.00 17.77 ? 147  PHE A CE2 1 
ATOM   1214 C CZ  . PHE A 1 147 ? 58.581  44.583  50.071 1.00 16.19 ? 147  PHE A CZ  1 
ATOM   1215 N N   . VAL A 1 148 ? 53.722  40.566  46.338 1.00 14.11 ? 148  VAL A N   1 
ATOM   1216 C CA  . VAL A 1 148 ? 53.544  39.302  45.643 1.00 18.23 ? 148  VAL A CA  1 
ATOM   1217 C C   . VAL A 1 148 ? 52.953  39.500  44.241 1.00 20.83 ? 148  VAL A C   1 
ATOM   1218 O O   . VAL A 1 148 ? 52.944  38.579  43.433 1.00 28.60 ? 148  VAL A O   1 
ATOM   1219 C CB  . VAL A 1 148 ? 52.647  38.377  46.480 1.00 19.88 ? 148  VAL A CB  1 
ATOM   1220 C CG1 . VAL A 1 148 ? 52.435  37.052  45.770 1.00 23.11 ? 148  VAL A CG1 1 
ATOM   1221 C CG2 . VAL A 1 148 ? 53.282  38.153  47.844 1.00 15.07 ? 148  VAL A CG2 1 
ATOM   1222 N N   . GLY A 1 149 ? 52.514  40.718  43.942 1.00 22.60 ? 149  GLY A N   1 
ATOM   1223 C CA  . GLY A 1 149 ? 51.997  41.007  42.619 1.00 23.13 ? 149  GLY A CA  1 
ATOM   1224 C C   . GLY A 1 149 ? 50.993  42.143  42.599 1.00 31.08 ? 149  GLY A C   1 
ATOM   1225 O O   . GLY A 1 149 ? 51.245  43.240  43.123 1.00 31.86 ? 149  GLY A O   1 
ATOM   1226 N N   . ASP A 1 150 ? 49.863  41.884  41.944 1.00 30.00 ? 150  ASP A N   1 
ATOM   1227 C CA  . ASP A 1 150 ? 48.797  42.872  41.774 1.00 30.19 ? 150  ASP A CA  1 
ATOM   1228 C C   . ASP A 1 150 ? 47.911  42.900  43.013 1.00 32.14 ? 150  ASP A C   1 
ATOM   1229 O O   . ASP A 1 150 ? 47.307  43.924  43.352 1.00 31.17 ? 150  ASP A O   1 
ATOM   1230 C CB  . ASP A 1 150 ? 47.930  42.519  40.554 1.00 28.48 ? 150  ASP A CB  1 
ATOM   1231 C CG  . ASP A 1 150 ? 48.744  42.291  39.282 1.00 26.05 ? 150  ASP A CG  1 
ATOM   1232 O OD1 . ASP A 1 150 ? 49.726  43.018  39.030 1.00 29.87 ? 150  ASP A OD1 1 
ATOM   1233 O OD2 . ASP A 1 150 ? 48.339  41.435  38.474 1.00 27.17 ? 150  ASP A OD2 1 
ATOM   1234 N N   . LYS A 1 151 ? 47.870  41.761  43.692 1.00 31.47 ? 151  LYS A N   1 
ATOM   1235 C CA  . LYS A 1 151 ? 46.925  41.504  44.764 1.00 31.66 ? 151  LYS A CA  1 
ATOM   1236 C C   . LYS A 1 151 ? 47.614  41.683  46.113 1.00 27.81 ? 151  LYS A C   1 
ATOM   1237 O O   . LYS A 1 151 ? 48.749  41.256  46.301 1.00 32.36 ? 151  LYS A O   1 
ATOM   1238 C CB  . LYS A 1 151 ? 46.388  40.068  44.655 1.00 40.44 ? 151  LYS A CB  1 
ATOM   1239 C CG  . LYS A 1 151 ? 46.465  39.438  43.242 1.00 54.11 ? 151  LYS A CG  1 
ATOM   1240 C CD  . LYS A 1 151 ? 47.886  38.955  42.856 1.00 53.55 ? 151  LYS A CD  1 
ATOM   1241 C CE  . LYS A 1 151 ? 48.148  39.067  41.337 1.00 52.31 ? 151  LYS A CE  1 
ATOM   1242 N NZ  . LYS A 1 151 ? 49.601  38.966  40.944 1.00 49.53 ? 151  LYS A NZ  1 
ATOM   1243 N N   . LEU A 1 152 ? 46.943  42.375  47.026 1.00 23.19 ? 152  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 152 ? 47.314  42.358  48.438 1.00 19.11 ? 152  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 152 ? 47.248  40.934  48.957 1.00 18.48 ? 152  LEU A C   1 
ATOM   1246 O O   . LEU A 1 152 ? 46.320  40.194  48.650 1.00 20.12 ? 152  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 152 ? 46.346  43.208  49.253 1.00 21.81 ? 152  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 152 ? 46.832  44.531  49.834 1.00 29.54 ? 152  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 152 ? 45.642  45.247  50.428 1.00 29.04 ? 152  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 152 ? 47.902  44.318  50.887 1.00 21.44 ? 152  LEU A CD2 1 
ATOM   1251 N N   . THR A 1 153 ? 48.259  40.548  49.719 1.00 20.42 ? 153  THR A N   1 
ATOM   1252 C CA  . THR A 1 153 ? 48.290  39.239  50.357 1.00 21.41 ? 153  THR A CA  1 
ATOM   1253 C C   . THR A 1 153 ? 48.759  39.412  51.796 1.00 17.57 ? 153  THR A C   1 
ATOM   1254 O O   . THR A 1 153 ? 49.188  40.500  52.186 1.00 13.29 ? 153  THR A O   1 
ATOM   1255 C CB  . THR A 1 153 ? 49.252  38.283  49.615 1.00 23.65 ? 153  THR A CB  1 
ATOM   1256 O OG1 . THR A 1 153 ? 50.471  38.973  49.305 1.00 35.33 ? 153  THR A OG1 1 
ATOM   1257 C CG2 . THR A 1 153 ? 48.625  37.797  48.315 1.00 23.67 ? 153  THR A CG2 1 
ATOM   1258 N N   . PHE A 1 154 ? 48.715  38.337  52.576 1.00 16.90 ? 154  PHE A N   1 
ATOM   1259 C CA  . PHE A 1 154 ? 49.018  38.435  54.001 1.00 20.20 ? 154  PHE A CA  1 
ATOM   1260 C C   . PHE A 1 154 ? 50.487  38.753  54.246 1.00 22.70 ? 154  PHE A C   1 
ATOM   1261 O O   . PHE A 1 154 ? 50.854  39.237  55.321 1.00 32.74 ? 154  PHE A O   1 
ATOM   1262 C CB  . PHE A 1 154 ? 48.605  37.148  54.739 1.00 14.57 ? 154  PHE A CB  1 
ATOM   1263 C CG  . PHE A 1 154 ? 49.534  35.986  54.528 1.00 12.48 ? 154  PHE A CG  1 
ATOM   1264 C CD1 . PHE A 1 154 ? 49.434  35.195  53.390 1.00 16.73 ? 154  PHE A CD1 1 
ATOM   1265 C CD2 . PHE A 1 154 ? 50.494  35.665  55.484 1.00 22.29 ? 154  PHE A CD2 1 
ATOM   1266 C CE1 . PHE A 1 154 ? 50.276  34.107  53.205 1.00 12.68 ? 154  PHE A CE1 1 
ATOM   1267 C CE2 . PHE A 1 154 ? 51.339  34.578  55.311 1.00 14.39 ? 154  PHE A CE2 1 
ATOM   1268 C CZ  . PHE A 1 154 ? 51.228  33.798  54.166 1.00 18.43 ? 154  PHE A CZ  1 
ATOM   1269 N N   . VAL A 1 155 ? 51.305  38.568  53.214 1.00 16.64 ? 155  VAL A N   1 
ATOM   1270 C CA  . VAL A 1 155 ? 52.736  38.780  53.327 1.00 12.52 ? 155  VAL A CA  1 
ATOM   1271 C C   . VAL A 1 155 ? 53.044  40.262  53.312 1.00 11.60 ? 155  VAL A C   1 
ATOM   1272 O O   . VAL A 1 155 ? 54.058  40.695  53.855 1.00 16.71 ? 155  VAL A O   1 
ATOM   1273 C CB  . VAL A 1 155 ? 53.471  38.077  52.195 1.00 9.90  ? 155  VAL A CB  1 
ATOM   1274 C CG1 . VAL A 1 155 ? 54.915  38.482  52.180 1.00 13.27 ? 155  VAL A CG1 1 
ATOM   1275 C CG2 . VAL A 1 155 ? 53.369  36.583  52.382 1.00 15.69 ? 155  VAL A CG2 1 
ATOM   1276 N N   . ASP A 1 156 ? 52.128  41.047  52.756 1.00 20.37 ? 156  ASP A N   1 
ATOM   1277 C CA  . ASP A 1 156 ? 52.266  42.500  52.770 1.00 23.09 ? 156  ASP A CA  1 
ATOM   1278 C C   . ASP A 1 156 ? 52.038  43.062  54.178 1.00 23.99 ? 156  ASP A C   1 
ATOM   1279 O O   . ASP A 1 156 ? 52.650  44.061  54.556 1.00 32.18 ? 156  ASP A O   1 
ATOM   1280 C CB  . ASP A 1 156 ? 51.301  43.143  51.769 1.00 10.87 ? 156  ASP A CB  1 
ATOM   1281 C CG  . ASP A 1 156 ? 51.771  43.003  50.323 1.00 17.06 ? 156  ASP A CG  1 
ATOM   1282 O OD1 . ASP A 1 156 ? 52.740  43.689  49.942 1.00 21.98 ? 156  ASP A OD1 1 
ATOM   1283 O OD2 . ASP A 1 156 ? 51.138  42.255  49.542 1.00 24.30 ? 156  ASP A OD2 1 
ATOM   1284 N N   . PHE A 1 157 ? 51.283  42.322  54.991 1.00 20.07 ? 157  PHE A N   1 
ATOM   1285 C CA  . PHE A 1 157 ? 51.045  42.680  56.388 1.00 21.03 ? 157  PHE A CA  1 
ATOM   1286 C C   . PHE A 1 157 ? 52.278  42.408  57.244 1.00 25.59 ? 157  PHE A C   1 
ATOM   1287 O O   . PHE A 1 157 ? 52.550  43.130  58.205 1.00 36.11 ? 157  PHE A O   1 
ATOM   1288 C CB  . PHE A 1 157 ? 49.850  41.896  56.943 1.00 15.55 ? 157  PHE A CB  1 
ATOM   1289 C CG  . PHE A 1 157 ? 48.533  42.322  56.370 1.00 18.16 ? 157  PHE A CG  1 
ATOM   1290 C CD1 . PHE A 1 157 ? 48.251  42.126  55.021 1.00 18.60 ? 157  PHE A CD1 1 
ATOM   1291 C CD2 . PHE A 1 157 ? 47.592  42.967  57.161 1.00 16.57 ? 157  PHE A CD2 1 
ATOM   1292 C CE1 . PHE A 1 157 ? 47.061  42.565  54.472 1.00 15.70 ? 157  PHE A CE1 1 
ATOM   1293 C CE2 . PHE A 1 157 ? 46.396  43.413  56.615 1.00 14.43 ? 157  PHE A CE2 1 
ATOM   1294 C CZ  . PHE A 1 157 ? 46.133  43.211  55.270 1.00 18.39 ? 157  PHE A CZ  1 
ATOM   1295 N N   . LEU A 1 158 ? 52.986  41.328  56.926 1.00 24.97 ? 158  LEU A N   1 
ATOM   1296 C CA  . LEU A 1 158 ? 54.249  41.007  57.582 1.00 18.17 ? 158  LEU A CA  1 
ATOM   1297 C C   . LEU A 1 158 ? 55.348  41.989  57.166 1.00 19.69 ? 158  LEU A C   1 
ATOM   1298 O O   . LEU A 1 158 ? 56.117  42.460  58.003 1.00 25.13 ? 158  LEU A O   1 
ATOM   1299 C CB  . LEU A 1 158 ? 54.670  39.580  57.231 1.00 18.17 ? 158  LEU A CB  1 
ATOM   1300 C CG  . LEU A 1 158 ? 53.769  38.476  57.774 1.00 20.23 ? 158  LEU A CG  1 
ATOM   1301 C CD1 . LEU A 1 158 ? 54.256  37.126  57.293 1.00 7.88  ? 158  LEU A CD1 1 
ATOM   1302 C CD2 . LEU A 1 158 ? 53.765  38.540  59.291 1.00 14.92 ? 158  LEU A CD2 1 
ATOM   1303 N N   . ALA A 1 159 ? 55.393  42.306  55.873 1.00 14.33 ? 159  ALA A N   1 
ATOM   1304 C CA  . ALA A 1 159 ? 56.361  43.242  55.319 1.00 11.23 ? 159  ALA A CA  1 
ATOM   1305 C C   . ALA A 1 159 ? 56.248  44.572  56.027 1.00 12.88 ? 159  ALA A C   1 
ATOM   1306 O O   . ALA A 1 159 ? 57.234  45.106  56.524 1.00 2.65  ? 159  ALA A O   1 
ATOM   1307 C CB  . ALA A 1 159 ? 56.107  43.428  53.842 1.00 2.00  ? 159  ALA A CB  1 
ATOM   1308 N N   . TYR A 1 160 ? 55.018  45.066  56.129 1.00 17.85 ? 160  TYR A N   1 
ATOM   1309 C CA  . TYR A 1 160 ? 54.763  46.363  56.734 1.00 14.95 ? 160  TYR A CA  1 
ATOM   1310 C C   . TYR A 1 160 ? 55.197  46.375  58.186 1.00 22.62 ? 160  TYR A C   1 
ATOM   1311 O O   . TYR A 1 160 ? 55.831  47.332  58.628 1.00 28.49 ? 160  TYR A O   1 
ATOM   1312 C CB  . TYR A 1 160 ? 53.280  46.736  56.634 1.00 12.62 ? 160  TYR A CB  1 
ATOM   1313 C CG  . TYR A 1 160 ? 52.914  47.990  57.411 1.00 14.08 ? 160  TYR A CG  1 
ATOM   1314 C CD1 . TYR A 1 160 ? 52.585  47.916  58.767 1.00 11.62 ? 160  TYR A CD1 1 
ATOM   1315 C CD2 . TYR A 1 160 ? 52.953  49.252  56.812 1.00 5.55  ? 160  TYR A CD2 1 
ATOM   1316 C CE1 . TYR A 1 160 ? 52.317  49.053  59.518 1.00 7.56  ? 160  TYR A CE1 1 
ATOM   1317 C CE2 . TYR A 1 160 ? 52.675  50.407  57.555 1.00 9.91  ? 160  TYR A CE2 1 
ATOM   1318 C CZ  . TYR A 1 160 ? 52.360  50.295  58.916 1.00 10.50 ? 160  TYR A CZ  1 
ATOM   1319 O OH  . TYR A 1 160 ? 52.108  51.410  59.686 1.00 14.83 ? 160  TYR A OH  1 
ATOM   1320 N N   . ASP A 1 161 ? 54.829  45.325  58.921 1.00 24.35 ? 161  ASP A N   1 
ATOM   1321 C CA  . ASP A 1 161 ? 55.120  45.217  60.349 1.00 20.89 ? 161  ASP A CA  1 
ATOM   1322 C C   . ASP A 1 161 ? 56.622  45.240  60.602 1.00 23.14 ? 161  ASP A C   1 
ATOM   1323 O O   . ASP A 1 161 ? 57.113  45.997  61.444 1.00 29.14 ? 161  ASP A O   1 
ATOM   1324 C CB  . ASP A 1 161 ? 54.520  43.926  60.891 1.00 12.65 ? 161  ASP A CB  1 
ATOM   1325 C CG  . ASP A 1 161 ? 54.635  43.803  62.396 1.00 19.90 ? 161  ASP A CG  1 
ATOM   1326 O OD1 . ASP A 1 161 ? 54.910  44.811  63.094 1.00 21.26 ? 161  ASP A OD1 1 
ATOM   1327 O OD2 . ASP A 1 161 ? 54.398  42.685  62.887 1.00 24.15 ? 161  ASP A OD2 1 
ATOM   1328 N N   . VAL A 1 162 ? 57.343  44.445  59.817 1.00 23.71 ? 162  VAL A N   1 
ATOM   1329 C CA  . VAL A 1 162 ? 58.796  44.349  59.909 1.00 24.28 ? 162  VAL A CA  1 
ATOM   1330 C C   . VAL A 1 162 ? 59.463  45.684  59.557 1.00 26.73 ? 162  VAL A C   1 
ATOM   1331 O O   . VAL A 1 162 ? 60.281  46.198  60.328 1.00 30.15 ? 162  VAL A O   1 
ATOM   1332 C CB  . VAL A 1 162 ? 59.319  43.224  58.984 1.00 16.13 ? 162  VAL A CB  1 
ATOM   1333 C CG1 . VAL A 1 162 ? 60.808  43.342  58.786 1.00 14.44 ? 162  VAL A CG1 1 
ATOM   1334 C CG2 . VAL A 1 162 ? 58.976  41.864  59.583 1.00 14.46 ? 162  VAL A CG2 1 
ATOM   1335 N N   . LEU A 1 163 ? 59.024  46.292  58.457 1.00 27.93 ? 163  LEU A N   1 
ATOM   1336 C CA  . LEU A 1 163 ? 59.546  47.589  58.032 1.00 24.20 ? 163  LEU A CA  1 
ATOM   1337 C C   . LEU A 1 163 ? 59.199  48.690  59.025 1.00 23.15 ? 163  LEU A C   1 
ATOM   1338 O O   . LEU A 1 163 ? 59.988  49.600  59.247 1.00 20.77 ? 163  LEU A O   1 
ATOM   1339 C CB  . LEU A 1 163 ? 59.002  47.963  56.654 1.00 27.21 ? 163  LEU A CB  1 
ATOM   1340 C CG  . LEU A 1 163 ? 59.733  47.480  55.403 1.00 26.88 ? 163  LEU A CG  1 
ATOM   1341 C CD1 . LEU A 1 163 ? 61.068  46.841  55.747 1.00 31.96 ? 163  LEU A CD1 1 
ATOM   1342 C CD2 . LEU A 1 163 ? 58.841  46.503  54.673 1.00 29.79 ? 163  LEU A CD2 1 
ATOM   1343 N N   . ASP A 1 164 ? 58.011  48.611  59.611 1.00 25.19 ? 164  ASP A N   1 
ATOM   1344 C CA  . ASP A 1 164 ? 57.566  49.610  60.571 1.00 30.23 ? 164  ASP A CA  1 
ATOM   1345 C C   . ASP A 1 164 ? 58.543  49.601  61.739 1.00 30.68 ? 164  ASP A C   1 
ATOM   1346 O O   . ASP A 1 164 ? 58.987  50.654  62.185 1.00 33.97 ? 164  ASP A O   1 
ATOM   1347 C CB  . ASP A 1 164 ? 56.145  49.276  61.056 1.00 36.35 ? 164  ASP A CB  1 
ATOM   1348 C CG  . ASP A 1 164 ? 55.533  50.367  61.954 1.00 35.20 ? 164  ASP A CG  1 
ATOM   1349 O OD1 . ASP A 1 164 ? 56.096  51.478  62.050 1.00 34.29 ? 164  ASP A OD1 1 
ATOM   1350 O OD2 . ASP A 1 164 ? 54.449  50.114  62.540 1.00 38.75 ? 164  ASP A OD2 1 
ATOM   1351 N N   . GLN A 1 165 ? 58.963  48.404  62.145 1.00 26.13 ? 165  GLN A N   1 
ATOM   1352 C CA  . GLN A 1 165 ? 59.885  48.238  63.265 1.00 27.08 ? 165  GLN A CA  1 
ATOM   1353 C C   . GLN A 1 165 ? 61.235  48.886  62.974 1.00 29.22 ? 165  GLN A C   1 
ATOM   1354 O O   . GLN A 1 165 ? 61.858  49.468  63.866 1.00 25.88 ? 165  GLN A O   1 
ATOM   1355 C CB  . GLN A 1 165 ? 60.111  46.756  63.553 1.00 25.35 ? 165  GLN A CB  1 
ATOM   1356 C CG  . GLN A 1 165 ? 58.909  46.011  64.076 1.00 12.60 ? 165  GLN A CG  1 
ATOM   1357 C CD  . GLN A 1 165 ? 59.271  44.634  64.582 1.00 9.42  ? 165  GLN A CD  1 
ATOM   1358 O OE1 . GLN A 1 165 ? 58.543  44.089  65.621 1.00 13.50 ? 165  GLN A OE1 1 
ATOM   1359 N NE2 . GLN A 1 165 ? 60.303  44.024  63.989 1.00 17.77 ? 165  GLN A NE2 1 
ATOM   1360 N N   . GLN A 1 166 ? 61.717  48.724  61.744 1.00 23.06 ? 166  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 166 ? 62.997  49.302  61.352 1.00 22.85 ? 166  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 166 ? 62.882  50.808  61.278 1.00 22.71 ? 166  GLN A C   1 
ATOM   1363 O O   . GLN A 1 166 ? 63.808  51.519  61.641 1.00 34.46 ? 166  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 166 ? 63.457  48.775  59.990 1.00 25.73 ? 166  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 166 ? 63.579  47.271  59.899 1.00 27.45 ? 166  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 166 ? 64.272  46.667  61.101 1.00 29.03 ? 166  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 166 ? 65.416  46.996  61.406 1.00 32.38 ? 166  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 166 ? 63.577  45.772  61.790 1.00 36.92 ? 166  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 167 ? 61.726  51.281  60.828 1.00 23.94 ? 167  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 167 ? 61.439  52.709  60.663 1.00 31.02 ? 167  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 167 ? 61.364  53.424  62.014 1.00 30.89 ? 167  ARG A C   1 
ATOM   1372 O O   . ARG A 1 167 ? 61.690  54.601  62.121 1.00 28.44 ? 167  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 167 ? 60.099  52.868  59.933 1.00 37.07 ? 167  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 167 ? 59.838  54.232  59.313 1.00 36.64 ? 167  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 167 ? 58.474  54.812  59.732 1.00 37.15 ? 167  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 167 ? 57.448  53.792  59.953 1.00 34.34 ? 167  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 167 ? 56.247  53.784  59.375 1.00 35.90 ? 167  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 167 ? 55.904  54.736  58.520 1.00 32.57 ? 167  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 167 ? 55.387  52.811  59.645 1.00 38.76 ? 167  ARG A NH2 1 
ATOM   1380 N N   . MET A 1 168 ? 60.863  52.715  63.021 1.00 35.38 ? 168  MET A N   1 
ATOM   1381 C CA  . MET A 1 168 ? 60.793  53.230  64.384 1.00 37.44 ? 168  MET A CA  1 
ATOM   1382 C C   . MET A 1 168 ? 62.166  53.226  65.027 1.00 37.69 ? 168  MET A C   1 
ATOM   1383 O O   . MET A 1 168 ? 62.467  54.076  65.865 1.00 40.22 ? 168  MET A O   1 
ATOM   1384 C CB  . MET A 1 168 ? 59.850  52.380  65.234 1.00 40.75 ? 168  MET A CB  1 
ATOM   1385 C CG  . MET A 1 168 ? 58.412  52.400  64.771 1.00 43.96 ? 168  MET A CG  1 
ATOM   1386 S SD  . MET A 1 168 ? 57.269  52.606  66.129 1.00 47.55 ? 168  MET A SD  1 
ATOM   1387 C CE  . MET A 1 168 ? 56.923  54.363  66.029 1.00 49.21 ? 168  MET A CE  1 
ATOM   1388 N N   . PHE A 1 169 ? 62.995  52.267  64.622 1.00 37.76 ? 169  PHE A N   1 
ATOM   1389 C CA  . PHE A 1 169 ? 64.341  52.116  65.162 1.00 36.07 ? 169  PHE A CA  1 
ATOM   1390 C C   . PHE A 1 169 ? 65.308  53.166  64.619 1.00 36.40 ? 169  PHE A C   1 
ATOM   1391 O O   . PHE A 1 169 ? 65.952  53.876  65.391 1.00 42.68 ? 169  PHE A O   1 
ATOM   1392 C CB  . PHE A 1 169 ? 64.876  50.717  64.853 1.00 39.87 ? 169  PHE A CB  1 
ATOM   1393 C CG  . PHE A 1 169 ? 66.148  50.384  65.572 1.00 41.25 ? 169  PHE A CG  1 
ATOM   1394 C CD1 . PHE A 1 169 ? 66.216  50.452  66.964 1.00 44.20 ? 169  PHE A CD1 1 
ATOM   1395 C CD2 . PHE A 1 169 ? 67.278  49.994  64.862 1.00 41.07 ? 169  PHE A CD2 1 
ATOM   1396 C CE1 . PHE A 1 169 ? 67.394  50.133  67.642 1.00 43.43 ? 169  PHE A CE1 1 
ATOM   1397 C CE2 . PHE A 1 169 ? 68.464  49.673  65.528 1.00 41.86 ? 169  PHE A CE2 1 
ATOM   1398 C CZ  . PHE A 1 169 ? 68.520  49.742  66.922 1.00 43.00 ? 169  PHE A CZ  1 
ATOM   1399 N N   . VAL A 1 170 ? 65.414  53.250  63.296 1.00 35.51 ? 170  VAL A N   1 
ATOM   1400 C CA  . VAL A 1 170 ? 66.313  54.189  62.644 1.00 35.03 ? 170  VAL A CA  1 
ATOM   1401 C C   . VAL A 1 170 ? 65.574  54.941  61.535 1.00 34.24 ? 170  VAL A C   1 
ATOM   1402 O O   . VAL A 1 170 ? 65.634  54.568  60.369 1.00 32.77 ? 170  VAL A O   1 
ATOM   1403 C CB  . VAL A 1 170 ? 67.557  53.445  62.072 1.00 36.13 ? 170  VAL A CB  1 
ATOM   1404 C CG1 . VAL A 1 170 ? 67.135  52.208  61.282 1.00 33.79 ? 170  VAL A CG1 1 
ATOM   1405 C CG2 . VAL A 1 170 ? 68.388  54.384  61.212 1.00 44.04 ? 170  VAL A CG2 1 
ATOM   1406 N N   . PRO A 1 171 ? 64.810  55.979  61.901 1.00 37.87 ? 171  PRO A N   1 
ATOM   1407 C CA  . PRO A 1 171 ? 63.868  56.623  60.973 1.00 39.01 ? 171  PRO A CA  1 
ATOM   1408 C C   . PRO A 1 171 ? 64.557  57.379  59.843 1.00 40.68 ? 171  PRO A C   1 
ATOM   1409 O O   . PRO A 1 171 ? 63.949  57.652  58.808 1.00 40.53 ? 171  PRO A O   1 
ATOM   1410 C CB  . PRO A 1 171 ? 63.071  57.572  61.870 1.00 40.40 ? 171  PRO A CB  1 
ATOM   1411 C CG  . PRO A 1 171 ? 63.314  57.071  63.274 1.00 43.38 ? 171  PRO A CG  1 
ATOM   1412 C CD  . PRO A 1 171 ? 64.714  56.555  63.249 1.00 38.52 ? 171  PRO A CD  1 
ATOM   1413 N N   . ASP A 1 172 ? 65.830  57.706  60.045 1.00 47.10 ? 172  ASP A N   1 
ATOM   1414 C CA  . ASP A 1 172 ? 66.568  58.524  59.091 1.00 50.57 ? 172  ASP A CA  1 
ATOM   1415 C C   . ASP A 1 172 ? 67.376  57.704  58.087 1.00 51.06 ? 172  ASP A C   1 
ATOM   1416 O O   . ASP A 1 172 ? 68.092  58.268  57.260 1.00 51.34 ? 172  ASP A O   1 
ATOM   1417 C CB  . ASP A 1 172 ? 67.476  59.520  59.830 1.00 54.19 ? 172  ASP A CB  1 
ATOM   1418 C CG  . ASP A 1 172 ? 68.595  58.842  60.614 1.00 64.10 ? 172  ASP A CG  1 
ATOM   1419 O OD1 . ASP A 1 172 ? 68.372  57.758  61.208 1.00 63.21 ? 172  ASP A OD1 1 
ATOM   1420 O OD2 . ASP A 1 172 ? 69.697  59.430  60.669 1.00 67.07 ? 172  ASP A OD2 1 
ATOM   1421 N N   . CYS A 1 173 ? 67.222  56.381  58.129 1.00 50.75 ? 173  CYS A N   1 
ATOM   1422 C CA  . CYS A 1 173 ? 67.940  55.499  57.209 1.00 46.28 ? 173  CYS A CA  1 
ATOM   1423 C C   . CYS A 1 173 ? 67.503  55.740  55.775 1.00 40.16 ? 173  CYS A C   1 
ATOM   1424 O O   . CYS A 1 173 ? 66.327  55.604  55.449 1.00 35.20 ? 173  CYS A O   1 
ATOM   1425 C CB  . CYS A 1 173 ? 67.721  54.024  57.561 1.00 48.00 ? 173  CYS A CB  1 
ATOM   1426 S SG  . CYS A 1 173 ? 68.887  52.904  56.726 1.00 51.05 ? 173  CYS A SG  1 
ATOM   1427 N N   . PRO A 1 174 ? 68.456  56.118  54.904 1.00 43.99 ? 174  PRO A N   1 
ATOM   1428 C CA  . PRO A 1 174 ? 68.188  56.582  53.537 1.00 42.06 ? 174  PRO A CA  1 
ATOM   1429 C C   . PRO A 1 174 ? 67.653  55.476  52.636 1.00 40.41 ? 174  PRO A C   1 
ATOM   1430 O O   . PRO A 1 174 ? 67.000  55.752  51.631 1.00 48.23 ? 174  PRO A O   1 
ATOM   1431 C CB  . PRO A 1 174 ? 69.553  57.079  53.058 1.00 40.84 ? 174  PRO A CB  1 
ATOM   1432 C CG  . PRO A 1 174 ? 70.533  56.263  53.841 1.00 37.26 ? 174  PRO A CG  1 
ATOM   1433 C CD  . PRO A 1 174 ? 69.902  56.110  55.200 1.00 41.93 ? 174  PRO A CD  1 
ATOM   1434 N N   . GLU A 1 175 ? 67.940  54.230  53.013 1.00 45.20 ? 175  GLU A N   1 
ATOM   1435 C CA  . GLU A 1 175 ? 67.497  53.047  52.269 1.00 46.80 ? 175  GLU A CA  1 
ATOM   1436 C C   . GLU A 1 175 ? 66.014  52.766  52.516 1.00 41.82 ? 175  GLU A C   1 
ATOM   1437 O O   . GLU A 1 175 ? 65.430  51.884  51.884 1.00 40.36 ? 175  GLU A O   1 
ATOM   1438 C CB  . GLU A 1 175 ? 68.305  51.808  52.682 1.00 47.66 ? 175  GLU A CB  1 
ATOM   1439 C CG  . GLU A 1 175 ? 69.765  52.076  53.041 1.00 47.92 ? 175  GLU A CG  1 
ATOM   1440 C CD  . GLU A 1 175 ? 70.681  52.091  51.831 1.00 54.28 ? 175  GLU A CD  1 
ATOM   1441 O OE1 . GLU A 1 175 ? 70.240  51.695  50.730 1.00 58.30 ? 175  GLU A OE1 1 
ATOM   1442 O OE2 . GLU A 1 175 ? 71.860  52.478  51.993 1.00 55.03 ? 175  GLU A OE2 1 
ATOM   1443 N N   . LEU A 1 176 ? 65.447  53.458  53.503 1.00 39.70 ? 176  LEU A N   1 
ATOM   1444 C CA  . LEU A 1 176 ? 64.019  53.389  53.808 1.00 37.68 ? 176  LEU A CA  1 
ATOM   1445 C C   . LEU A 1 176 ? 63.223  54.350  52.928 1.00 39.68 ? 176  LEU A C   1 
ATOM   1446 O O   . LEU A 1 176 ? 62.000  54.254  52.852 1.00 45.50 ? 176  LEU A O   1 
ATOM   1447 C CB  . LEU A 1 176 ? 63.779  53.738  55.284 1.00 29.42 ? 176  LEU A CB  1 
ATOM   1448 C CG  . LEU A 1 176 ? 63.363  52.661  56.293 1.00 31.25 ? 176  LEU A CG  1 
ATOM   1449 C CD1 . LEU A 1 176 ? 63.744  51.276  55.831 1.00 27.34 ? 176  LEU A CD1 1 
ATOM   1450 C CD2 . LEU A 1 176 ? 64.011  52.960  57.629 1.00 30.22 ? 176  LEU A CD2 1 
ATOM   1451 N N   . GLN A 1 177 ? 63.911  55.356  52.393 1.00 36.50 ? 177  GLN A N   1 
ATOM   1452 C CA  . GLN A 1 177 ? 63.332  56.289  51.429 1.00 44.45 ? 177  GLN A CA  1 
ATOM   1453 C C   . GLN A 1 177 ? 63.324  55.649  50.033 1.00 39.11 ? 177  GLN A C   1 
ATOM   1454 O O   . GLN A 1 177 ? 64.253  54.930  49.665 1.00 43.88 ? 177  GLN A O   1 
ATOM   1455 C CB  . GLN A 1 177 ? 64.154  57.592  51.411 1.00 45.58 ? 177  GLN A CB  1 
ATOM   1456 C CG  . GLN A 1 177 ? 63.728  58.671  52.437 1.00 50.39 ? 177  GLN A CG  1 
ATOM   1457 C CD  . GLN A 1 177 ? 64.233  58.427  53.865 1.00 51.11 ? 177  GLN A CD  1 
ATOM   1458 O OE1 . GLN A 1 177 ? 65.063  57.554  54.104 1.00 55.86 ? 177  GLN A OE1 1 
ATOM   1459 N NE2 . GLN A 1 177 ? 63.741  59.220  54.814 1.00 47.52 ? 177  GLN A NE2 1 
ATOM   1460 N N   . GLY A 1 178 ? 62.255  55.872  49.278 1.00 31.86 ? 178  GLY A N   1 
ATOM   1461 C CA  . GLY A 1 178 ? 62.129  55.222  47.985 1.00 25.39 ? 178  GLY A CA  1 
ATOM   1462 C C   . GLY A 1 178 ? 60.871  54.388  47.906 1.00 21.95 ? 178  GLY A C   1 
ATOM   1463 O O   . GLY A 1 178 ? 59.879  54.704  48.558 1.00 20.73 ? 178  GLY A O   1 
ATOM   1464 N N   . ASN A 1 179 ? 60.924  53.301  47.143 1.00 25.38 ? 179  ASN A N   1 
ATOM   1465 C CA  . ASN A 1 179 ? 59.760  52.441  46.951 1.00 27.59 ? 179  ASN A CA  1 
ATOM   1466 C C   . ASN A 1 179 ? 59.279  51.752  48.229 1.00 26.01 ? 179  ASN A C   1 
ATOM   1467 O O   . ASN A 1 179 ? 58.098  51.442  48.362 1.00 30.98 ? 179  ASN A O   1 
ATOM   1468 C CB  . ASN A 1 179 ? 60.027  51.414  45.830 1.00 28.56 ? 179  ASN A CB  1 
ATOM   1469 C CG  . ASN A 1 179 ? 61.124  50.412  46.169 1.00 27.77 ? 179  ASN A CG  1 
ATOM   1470 O OD1 . ASN A 1 179 ? 61.092  49.282  45.687 1.00 30.40 ? 179  ASN A OD1 1 
ATOM   1471 N ND2 . ASN A 1 179 ? 62.158  50.857  46.876 1.00 31.68 ? 179  ASN A ND2 1 
ATOM   1472 N N   . LEU A 1 180 ? 60.167  51.635  49.211 1.00 29.98 ? 180  LEU A N   1 
ATOM   1473 C CA  . LEU A 1 180 ? 59.821  51.039  50.503 1.00 26.78 ? 180  LEU A CA  1 
ATOM   1474 C C   . LEU A 1 180 ? 59.131  52.042  51.425 1.00 19.95 ? 180  LEU A C   1 
ATOM   1475 O O   . LEU A 1 180 ? 58.379  51.654  52.308 1.00 27.50 ? 180  LEU A O   1 
ATOM   1476 C CB  . LEU A 1 180 ? 61.069  50.461  51.200 1.00 28.64 ? 180  LEU A CB  1 
ATOM   1477 C CG  . LEU A 1 180 ? 61.832  49.316  50.511 1.00 24.57 ? 180  LEU A CG  1 
ATOM   1478 C CD1 . LEU A 1 180 ? 62.876  48.745  51.445 1.00 11.96 ? 180  LEU A CD1 1 
ATOM   1479 C CD2 . LEU A 1 180 ? 60.866  48.233  50.080 1.00 19.81 ? 180  LEU A CD2 1 
ATOM   1480 N N   . SER A 1 181 ? 59.376  53.330  51.208 1.00 24.67 ? 181  SER A N   1 
ATOM   1481 C CA  . SER A 1 181 ? 58.602  54.372  51.878 1.00 29.67 ? 181  SER A CA  1 
ATOM   1482 C C   . SER A 1 181 ? 57.226  54.499  51.228 1.00 30.73 ? 181  SER A C   1 
ATOM   1483 O O   . SER A 1 181 ? 56.220  54.641  51.922 1.00 34.67 ? 181  SER A O   1 
ATOM   1484 C CB  . SER A 1 181 ? 59.336  55.716  51.813 1.00 34.35 ? 181  SER A CB  1 
ATOM   1485 O OG  . SER A 1 181 ? 58.488  56.757  51.344 1.00 41.05 ? 181  SER A OG  1 
ATOM   1486 N N   . GLN A 1 182 ? 57.189  54.444  49.897 1.00 27.72 ? 182  GLN A N   1 
ATOM   1487 C CA  . GLN A 1 182 ? 55.928  54.461  49.162 1.00 29.47 ? 182  GLN A CA  1 
ATOM   1488 C C   . GLN A 1 182 ? 55.037  53.308  49.611 1.00 28.10 ? 182  GLN A C   1 
ATOM   1489 O O   . GLN A 1 182 ? 53.818  53.443  49.664 1.00 31.62 ? 182  GLN A O   1 
ATOM   1490 C CB  . GLN A 1 182 ? 56.171  54.324  47.661 1.00 34.39 ? 182  GLN A CB  1 
ATOM   1491 C CG  . GLN A 1 182 ? 57.131  55.326  47.047 1.00 36.62 ? 182  GLN A CG  1 
ATOM   1492 C CD  . GLN A 1 182 ? 57.582  54.905  45.652 1.00 42.09 ? 182  GLN A CD  1 
ATOM   1493 O OE1 . GLN A 1 182 ? 56.977  54.029  45.017 1.00 43.73 ? 182  GLN A OE1 1 
ATOM   1494 N NE2 . GLN A 1 182 ? 58.655  55.517  45.175 1.00 43.43 ? 182  GLN A NE2 1 
ATOM   1495 N N   . PHE A 1 183 ? 55.656  52.170  49.913 1.00 22.12 ? 183  PHE A N   1 
ATOM   1496 C CA  . PHE A 1 183 ? 54.927  50.978  50.305 1.00 17.71 ? 183  PHE A CA  1 
ATOM   1497 C C   . PHE A 1 183 ? 54.248  51.148  51.657 1.00 17.42 ? 183  PHE A C   1 
ATOM   1498 O O   . PHE A 1 183 ? 53.080  50.788  51.818 1.00 23.75 ? 183  PHE A O   1 
ATOM   1499 C CB  . PHE A 1 183 ? 55.868  49.778  50.335 1.00 20.18 ? 183  PHE A CB  1 
ATOM   1500 C CG  . PHE A 1 183 ? 55.278  48.576  50.998 1.00 25.39 ? 183  PHE A CG  1 
ATOM   1501 C CD1 . PHE A 1 183 ? 54.214  47.896  50.402 1.00 22.91 ? 183  PHE A CD1 1 
ATOM   1502 C CD2 . PHE A 1 183 ? 55.672  48.217  52.290 1.00 21.42 ? 183  PHE A CD2 1 
ATOM   1503 C CE1 . PHE A 1 183 ? 53.539  46.888  51.088 1.00 19.01 ? 183  PHE A CE1 1 
ATOM   1504 C CE2 . PHE A 1 183 ? 55.004  47.211  52.983 1.00 26.33 ? 183  PHE A CE2 1 
ATOM   1505 C CZ  . PHE A 1 183 ? 53.932  46.545  52.384 1.00 22.29 ? 183  PHE A CZ  1 
ATOM   1506 N N   . LEU A 1 184 ? 54.982  51.693  52.622 1.00 13.97 ? 184  LEU A N   1 
ATOM   1507 C CA  . LEU A 1 184 ? 54.443  51.947  53.961 1.00 22.50 ? 184  LEU A CA  1 
ATOM   1508 C C   . LEU A 1 184 ? 53.200  52.850  53.948 1.00 25.65 ? 184  LEU A C   1 
ATOM   1509 O O   . LEU A 1 184 ? 52.197  52.543  54.591 1.00 31.24 ? 184  LEU A O   1 
ATOM   1510 C CB  . LEU A 1 184 ? 55.506  52.594  54.850 1.00 21.77 ? 184  LEU A CB  1 
ATOM   1511 C CG  . LEU A 1 184 ? 56.817  51.862  55.110 1.00 19.11 ? 184  LEU A CG  1 
ATOM   1512 C CD1 . LEU A 1 184 ? 57.590  52.619  56.162 1.00 18.01 ? 184  LEU A CD1 1 
ATOM   1513 C CD2 . LEU A 1 184 ? 56.555  50.447  55.564 1.00 14.57 ? 184  LEU A CD2 1 
ATOM   1514 N N   . GLN A 1 185 ? 53.286  53.966  53.222 1.00 28.19 ? 185  GLN A N   1 
ATOM   1515 C CA  . GLN A 1 185 ? 52.176  54.911  53.065 1.00 23.33 ? 185  GLN A CA  1 
ATOM   1516 C C   . GLN A 1 185 ? 50.960  54.262  52.403 1.00 23.29 ? 185  GLN A C   1 
ATOM   1517 O O   . GLN A 1 185 ? 49.820  54.487  52.819 1.00 27.44 ? 185  GLN A O   1 
ATOM   1518 C CB  . GLN A 1 185 ? 52.601  56.104  52.198 1.00 31.07 ? 185  GLN A CB  1 
ATOM   1519 C CG  . GLN A 1 185 ? 53.672  57.032  52.778 1.00 37.52 ? 185  GLN A CG  1 
ATOM   1520 C CD  . GLN A 1 185 ? 53.715  58.395  52.074 1.00 41.30 ? 185  GLN A CD  1 
ATOM   1521 O OE1 . GLN A 1 185 ? 53.674  58.479  50.834 1.00 37.18 ? 185  GLN A OE1 1 
ATOM   1522 N NE2 . GLN A 1 185 ? 53.746  59.470  52.867 1.00 40.90 ? 185  GLN A NE2 1 
ATOM   1523 N N   . ARG A 1 186 ? 51.207  53.537  51.313 1.00 18.98 ? 186  ARG A N   1 
ATOM   1524 C CA  . ARG A 1 186 ? 50.144  52.919  50.520 1.00 22.01 ? 186  ARG A CA  1 
ATOM   1525 C C   . ARG A 1 186 ? 49.316  52.007  51.395 1.00 22.36 ? 186  ARG A C   1 
ATOM   1526 O O   . ARG A 1 186 ? 48.095  51.926  51.256 1.00 28.35 ? 186  ARG A O   1 
ATOM   1527 C CB  . ARG A 1 186 ? 50.729  52.084  49.380 1.00 23.86 ? 186  ARG A CB  1 
ATOM   1528 C CG  . ARG A 1 186 ? 50.856  52.792  48.034 1.00 28.79 ? 186  ARG A CG  1 
ATOM   1529 C CD  . ARG A 1 186 ? 50.981  51.771  46.895 1.00 32.58 ? 186  ARG A CD  1 
ATOM   1530 N NE  . ARG A 1 186 ? 52.010  50.754  47.129 1.00 28.66 ? 186  ARG A NE  1 
ATOM   1531 C CZ  . ARG A 1 186 ? 53.310  50.946  46.927 1.00 32.36 ? 186  ARG A CZ  1 
ATOM   1532 N NH1 . ARG A 1 186 ? 53.766  52.144  46.585 1.00 35.71 ? 186  ARG A NH1 1 
ATOM   1533 N NH2 . ARG A 1 186 ? 54.169  49.956  47.121 1.00 39.01 ? 186  ARG A NH2 1 
ATOM   1534 N N   . PHE A 1 187 ? 49.998  51.273  52.262 1.00 18.99 ? 187  PHE A N   1 
ATOM   1535 C CA  . PHE A 1 187 ? 49.327  50.344  53.145 1.00 21.98 ? 187  PHE A CA  1 
ATOM   1536 C C   . PHE A 1 187 ? 48.536  51.105  54.191 1.00 23.65 ? 187  PHE A C   1 
ATOM   1537 O O   . PHE A 1 187 ? 47.411  50.736  54.517 1.00 36.51 ? 187  PHE A O   1 
ATOM   1538 C CB  . PHE A 1 187 ? 50.338  49.435  53.824 1.00 15.28 ? 187  PHE A CB  1 
ATOM   1539 C CG  . PHE A 1 187 ? 49.718  48.380  54.677 1.00 5.28  ? 187  PHE A CG  1 
ATOM   1540 C CD1 . PHE A 1 187 ? 49.409  48.636  56.010 1.00 7.80  ? 187  PHE A CD1 1 
ATOM   1541 C CD2 . PHE A 1 187 ? 49.517  47.108  54.180 1.00 3.91  ? 187  PHE A CD2 1 
ATOM   1542 C CE1 . PHE A 1 187 ? 48.920  47.635  56.842 1.00 13.57 ? 187  PHE A CE1 1 
ATOM   1543 C CE2 . PHE A 1 187 ? 49.025  46.097  55.006 1.00 19.67 ? 187  PHE A CE2 1 
ATOM   1544 C CZ  . PHE A 1 187 ? 48.728  46.367  56.342 1.00 18.80 ? 187  PHE A CZ  1 
ATOM   1545 N N   . GLU A 1 188 ? 49.123  52.173  54.711 1.00 16.62 ? 188  GLU A N   1 
ATOM   1546 C CA  . GLU A 1 188 ? 48.456  52.963  55.734 1.00 24.99 ? 188  GLU A CA  1 
ATOM   1547 C C   . GLU A 1 188 ? 47.294  53.759  55.165 1.00 21.47 ? 188  GLU A C   1 
ATOM   1548 O O   . GLU A 1 188 ? 46.398  54.164  55.898 1.00 28.08 ? 188  GLU A O   1 
ATOM   1549 C CB  . GLU A 1 188 ? 49.444  53.906  56.398 1.00 26.77 ? 188  GLU A CB  1 
ATOM   1550 C CG  . GLU A 1 188 ? 50.106  53.324  57.632 1.00 27.96 ? 188  GLU A CG  1 
ATOM   1551 C CD  . GLU A 1 188 ? 51.407  54.023  57.988 1.00 32.72 ? 188  GLU A CD  1 
ATOM   1552 O OE1 . GLU A 1 188 ? 51.990  54.700  57.110 1.00 41.49 ? 188  GLU A OE1 1 
ATOM   1553 O OE2 . GLU A 1 188 ? 51.849  53.893  59.148 1.00 36.31 ? 188  GLU A OE2 1 
ATOM   1554 N N   . ALA A 1 189 ? 47.280  53.919  53.848 1.00 21.32 ? 189  ALA A N   1 
ATOM   1555 C CA  . ALA A 1 189 ? 46.224  54.658  53.173 1.00 19.78 ? 189  ALA A CA  1 
ATOM   1556 C C   . ALA A 1 189 ? 45.020  53.778  52.857 1.00 25.99 ? 189  ALA A C   1 
ATOM   1557 O O   . ALA A 1 189 ? 44.004  54.276  52.367 1.00 26.72 ? 189  ALA A O   1 
ATOM   1558 C CB  . ALA A 1 189 ? 46.763  55.289  51.895 1.00 22.34 ? 189  ALA A CB  1 
ATOM   1559 N N   . LEU A 1 190 ? 45.160  52.469  53.067 1.00 26.95 ? 190  LEU A N   1 
ATOM   1560 C CA  . LEU A 1 190 ? 44.059  51.533  52.858 1.00 24.22 ? 190  LEU A CA  1 
ATOM   1561 C C   . LEU A 1 190 ? 42.897  51.915  53.767 1.00 32.14 ? 190  LEU A C   1 
ATOM   1562 O O   . LEU A 1 190 ? 43.106  52.213  54.946 1.00 31.94 ? 190  LEU A O   1 
ATOM   1563 C CB  . LEU A 1 190 ? 44.501  50.112  53.182 1.00 25.36 ? 190  LEU A CB  1 
ATOM   1564 C CG  . LEU A 1 190 ? 45.509  49.407  52.274 1.00 29.66 ? 190  LEU A CG  1 
ATOM   1565 C CD1 . LEU A 1 190 ? 45.902  48.094  52.944 1.00 31.02 ? 190  LEU A CD1 1 
ATOM   1566 C CD2 . LEU A 1 190 ? 44.924  49.154  50.883 1.00 26.10 ? 190  LEU A CD2 1 
ATOM   1567 N N   . GLU A 1 191 ? 41.678  51.881  53.230 1.00 34.97 ? 191  GLU A N   1 
ATOM   1568 C CA  . GLU A 1 191 ? 40.527  52.468  53.908 1.00 36.75 ? 191  GLU A CA  1 
ATOM   1569 C C   . GLU A 1 191 ? 40.282  51.937  55.324 1.00 34.25 ? 191  GLU A C   1 
ATOM   1570 O O   . GLU A 1 191 ? 40.231  52.725  56.269 1.00 34.10 ? 191  GLU A O   1 
ATOM   1571 C CB  . GLU A 1 191 ? 39.265  52.332  53.040 1.00 43.45 ? 191  GLU A CB  1 
ATOM   1572 C CG  . GLU A 1 191 ? 38.870  53.644  52.339 1.00 54.20 ? 191  GLU A CG  1 
ATOM   1573 C CD  . GLU A 1 191 ? 37.697  53.504  51.376 1.00 61.33 ? 191  GLU A CD  1 
ATOM   1574 O OE1 . GLU A 1 191 ? 36.771  52.717  51.663 1.00 65.09 ? 191  GLU A OE1 1 
ATOM   1575 O OE2 . GLU A 1 191 ? 37.660  54.264  50.376 1.00 58.66 ? 191  GLU A OE2 1 
ATOM   1576 N N   . LYS A 1 192 ? 40.311  50.617  55.494 1.00 31.86 ? 192  LYS A N   1 
ATOM   1577 C CA  . LYS A 1 192 ? 40.028  49.995  56.791 1.00 30.47 ? 192  LYS A CA  1 
ATOM   1578 C C   . LYS A 1 192 ? 41.251  49.972  57.723 1.00 30.19 ? 192  LYS A C   1 
ATOM   1579 O O   . LYS A 1 192 ? 41.110  49.864  58.941 1.00 27.87 ? 192  LYS A O   1 
ATOM   1580 C CB  . LYS A 1 192 ? 39.509  48.571  56.599 1.00 30.75 ? 192  LYS A CB  1 
ATOM   1581 C CG  . LYS A 1 192 ? 38.693  48.351  55.329 1.00 46.12 ? 192  LYS A CG  1 
ATOM   1582 C CD  . LYS A 1 192 ? 39.575  48.170  54.078 1.00 48.95 ? 192  LYS A CD  1 
ATOM   1583 C CE  . LYS A 1 192 ? 38.762  47.582  52.915 1.00 55.48 ? 192  LYS A CE  1 
ATOM   1584 N NZ  . LYS A 1 192 ? 39.066  48.185  51.578 1.00 53.81 ? 192  LYS A NZ  1 
ATOM   1585 N N   . ILE A 1 193 ? 42.448  50.074  57.147 1.00 29.24 ? 193  ILE A N   1 
ATOM   1586 C CA  . ILE A 1 193 ? 43.688  50.184  57.926 1.00 24.46 ? 193  ILE A CA  1 
ATOM   1587 C C   . ILE A 1 193 ? 43.779  51.567  58.565 1.00 22.09 ? 193  ILE A C   1 
ATOM   1588 O O   . ILE A 1 193 ? 44.070  51.695  59.750 1.00 26.74 ? 193  ILE A O   1 
ATOM   1589 C CB  . ILE A 1 193 ? 44.948  49.992  57.029 1.00 17.38 ? 193  ILE A CB  1 
ATOM   1590 C CG1 . ILE A 1 193 ? 45.099  48.522  56.616 1.00 8.21  ? 193  ILE A CG1 1 
ATOM   1591 C CG2 . ILE A 1 193 ? 46.190  50.520  57.747 1.00 12.98 ? 193  ILE A CG2 1 
ATOM   1592 C CD1 . ILE A 1 193 ? 45.218  47.557  57.772 1.00 3.48  ? 193  ILE A CD1 1 
ATOM   1593 N N   . SER A 1 194 ? 43.588  52.589  57.737 1.00 21.50 ? 194  SER A N   1 
ATOM   1594 C CA  . SER A 1 194 ? 43.634  53.985  58.146 1.00 18.68 ? 194  SER A CA  1 
ATOM   1595 C C   . SER A 1 194 ? 42.660  54.267  59.285 1.00 24.14 ? 194  SER A C   1 
ATOM   1596 O O   . SER A 1 194 ? 43.029  54.870  60.291 1.00 29.94 ? 194  SER A O   1 
ATOM   1597 C CB  . SER A 1 194 ? 43.300  54.873  56.947 1.00 21.56 ? 194  SER A CB  1 
ATOM   1598 O OG  . SER A 1 194 ? 43.993  56.102  57.016 1.00 28.70 ? 194  SER A OG  1 
ATOM   1599 N N   . ALA A 1 195 ? 41.428  53.788  59.133 1.00 22.21 ? 195  ALA A N   1 
ATOM   1600 C CA  . ALA A 1 195 ? 40.392  53.931  60.155 1.00 21.97 ? 195  ALA A CA  1 
ATOM   1601 C C   . ALA A 1 195 ? 40.786  53.274  61.474 1.00 30.44 ? 195  ALA A C   1 
ATOM   1602 O O   . ALA A 1 195 ? 40.449  53.772  62.549 1.00 36.02 ? 195  ALA A O   1 
ATOM   1603 C CB  . ALA A 1 195 ? 39.099  53.321  59.657 1.00 23.89 ? 195  ALA A CB  1 
ATOM   1604 N N   . TYR A 1 196 ? 41.408  52.100  61.380 1.00 40.07 ? 196  TYR A N   1 
ATOM   1605 C CA  . TYR A 1 196 ? 41.853  51.364  62.560 1.00 34.90 ? 196  TYR A CA  1 
ATOM   1606 C C   . TYR A 1 196 ? 42.965  52.126  63.275 1.00 34.10 ? 196  TYR A C   1 
ATOM   1607 O O   . TYR A 1 196 ? 43.064  52.072  64.499 1.00 39.27 ? 196  TYR A O   1 
ATOM   1608 C CB  . TYR A 1 196 ? 42.335  49.965  62.157 1.00 33.57 ? 196  TYR A CB  1 
ATOM   1609 C CG  . TYR A 1 196 ? 42.973  49.165  63.276 1.00 33.29 ? 196  TYR A CG  1 
ATOM   1610 C CD1 . TYR A 1 196 ? 42.266  48.853  64.437 1.00 31.93 ? 196  TYR A CD1 1 
ATOM   1611 C CD2 . TYR A 1 196 ? 44.269  48.658  63.143 1.00 35.55 ? 196  TYR A CD2 1 
ATOM   1612 C CE1 . TYR A 1 196 ? 42.831  48.046  65.433 1.00 33.50 ? 196  TYR A CE1 1 
ATOM   1613 C CE2 . TYR A 1 196 ? 44.844  47.854  64.135 1.00 30.39 ? 196  TYR A CE2 1 
ATOM   1614 C CZ  . TYR A 1 196 ? 44.121  47.553  65.274 1.00 31.39 ? 196  TYR A CZ  1 
ATOM   1615 O OH  . TYR A 1 196 ? 44.696  46.775  66.258 1.00 35.39 ? 196  TYR A OH  1 
ATOM   1616 N N   . MET A 1 197 ? 43.758  52.875  62.508 1.00 34.88 ? 197  MET A N   1 
ATOM   1617 C CA  . MET A 1 197 ? 44.867  53.659  63.047 1.00 39.61 ? 197  MET A CA  1 
ATOM   1618 C C   . MET A 1 197 ? 44.377  54.954  63.679 1.00 38.79 ? 197  MET A C   1 
ATOM   1619 O O   . MET A 1 197 ? 45.002  55.484  64.592 1.00 43.01 ? 197  MET A O   1 
ATOM   1620 C CB  . MET A 1 197 ? 45.880  53.975  61.944 1.00 38.16 ? 197  MET A CB  1 
ATOM   1621 C CG  . MET A 1 197 ? 46.890  52.860  61.676 1.00 42.48 ? 197  MET A CG  1 
ATOM   1622 S SD  . MET A 1 197 ? 47.951  53.199  60.269 1.00 44.43 ? 197  MET A SD  1 
ATOM   1623 C CE  . MET A 1 197 ? 48.218  54.987  60.478 1.00 48.62 ? 197  MET A CE  1 
ATOM   1624 N N   . ARG A 1 198 ? 43.238  55.443  63.209 1.00 44.58 ? 198  ARG A N   1 
ATOM   1625 C CA  . ARG A 1 198 ? 42.648  56.656  63.757 1.00 48.13 ? 198  ARG A CA  1 
ATOM   1626 C C   . ARG A 1 198 ? 41.764  56.330  64.967 1.00 50.84 ? 198  ARG A C   1 
ATOM   1627 O O   . ARG A 1 198 ? 41.235  57.237  65.615 1.00 57.08 ? 198  ARG A O   1 
ATOM   1628 C CB  . ARG A 1 198 ? 41.837  57.385  62.676 1.00 53.88 ? 198  ARG A CB  1 
ATOM   1629 C CG  . ARG A 1 198 ? 41.980  58.908  62.677 1.00 62.66 ? 198  ARG A CG  1 
ATOM   1630 C CD  . ARG A 1 198 ? 42.717  59.411  61.433 1.00 70.67 ? 198  ARG A CD  1 
ATOM   1631 N NE  . ARG A 1 198 ? 42.378  60.797  61.099 1.00 74.52 ? 198  ARG A NE  1 
ATOM   1632 C CZ  . ARG A 1 198 ? 42.779  61.867  61.786 1.00 72.80 ? 198  ARG A CZ  1 
ATOM   1633 N NH1 . ARG A 1 198 ? 43.537  61.727  62.867 1.00 70.63 ? 198  ARG A NH1 1 
ATOM   1634 N NH2 . ARG A 1 198 ? 42.417  63.084  61.393 1.00 68.19 ? 198  ARG A NH2 1 
ATOM   1635 N N   . SER A 1 199 ? 41.657  55.042  65.304 1.00 47.79 ? 199  SER A N   1 
ATOM   1636 C CA  . SER A 1 199 ? 40.874  54.601  66.463 1.00 40.14 ? 199  SER A CA  1 
ATOM   1637 C C   . SER A 1 199 ? 41.728  54.411  67.719 1.00 41.42 ? 199  SER A C   1 
ATOM   1638 O O   . SER A 1 199 ? 42.927  54.715  67.736 1.00 40.25 ? 199  SER A O   1 
ATOM   1639 C CB  . SER A 1 199 ? 40.130  53.296  66.141 1.00 32.60 ? 199  SER A CB  1 
ATOM   1640 O OG  . SER A 1 199 ? 40.743  52.171  66.750 1.00 30.76 ? 199  SER A OG  1 
ATOM   1641 N N   . GLY A 1 200 ? 41.088  53.906  68.771 1.00 45.54 ? 200  GLY A N   1 
ATOM   1642 C CA  . GLY A 1 200 ? 41.775  53.672  70.027 1.00 48.10 ? 200  GLY A CA  1 
ATOM   1643 C C   . GLY A 1 200 ? 42.028  52.199  70.301 1.00 49.42 ? 200  GLY A C   1 
ATOM   1644 O O   . GLY A 1 200 ? 42.388  51.836  71.422 1.00 54.34 ? 200  GLY A O   1 
ATOM   1645 N N   . ARG A 1 201 ? 41.773  51.348  69.308 1.00 43.68 ? 201  ARG A N   1 
ATOM   1646 C CA  . ARG A 1 201 ? 42.141  49.933  69.378 1.00 42.45 ? 201  ARG A CA  1 
ATOM   1647 C C   . ARG A 1 201 ? 43.618  49.770  69.056 1.00 41.57 ? 201  ARG A C   1 
ATOM   1648 O O   . ARG A 1 201 ? 44.203  48.707  69.295 1.00 38.93 ? 201  ARG A O   1 
ATOM   1649 C CB  . ARG A 1 201 ? 41.350  49.114  68.357 1.00 40.14 ? 201  ARG A CB  1 
ATOM   1650 C CG  . ARG A 1 201 ? 39.969  48.678  68.785 1.00 40.02 ? 201  ARG A CG  1 
ATOM   1651 C CD  . ARG A 1 201 ? 39.274  47.985  67.640 1.00 38.97 ? 201  ARG A CD  1 
ATOM   1652 N NE  . ARG A 1 201 ? 39.400  48.764  66.411 1.00 44.83 ? 201  ARG A NE  1 
ATOM   1653 C CZ  . ARG A 1 201 ? 38.379  49.144  65.645 1.00 47.34 ? 201  ARG A CZ  1 
ATOM   1654 N NH1 . ARG A 1 201 ? 37.158  48.668  65.869 1.00 47.76 ? 201  ARG A NH1 1 
ATOM   1655 N NH2 . ARG A 1 201 ? 38.597  49.928  64.594 1.00 41.13 ? 201  ARG A NH2 1 
ATOM   1656 N N   . PHE A 1 202 ? 44.199  50.827  68.488 1.00 40.59 ? 202  PHE A N   1 
ATOM   1657 C CA  . PHE A 1 202 ? 45.486  50.744  67.818 1.00 43.82 ? 202  PHE A CA  1 
ATOM   1658 C C   . PHE A 1 202 ? 46.692  50.766  68.758 1.00 45.33 ? 202  PHE A C   1 
ATOM   1659 O O   . PHE A 1 202 ? 46.893  51.717  69.518 1.00 46.13 ? 202  PHE A O   1 
ATOM   1660 C CB  . PHE A 1 202 ? 45.607  51.864  66.783 1.00 39.94 ? 202  PHE A CB  1 
ATOM   1661 C CG  . PHE A 1 202 ? 46.777  51.700  65.860 1.00 46.99 ? 202  PHE A CG  1 
ATOM   1662 C CD1 . PHE A 1 202 ? 46.910  50.549  65.086 1.00 48.36 ? 202  PHE A CD1 1 
ATOM   1663 C CD2 . PHE A 1 202 ? 47.809  52.636  65.849 1.00 52.70 ? 202  PHE A CD2 1 
ATOM   1664 C CE1 . PHE A 1 202 ? 48.058  50.320  64.321 1.00 48.27 ? 202  PHE A CE1 1 
ATOM   1665 C CE2 . PHE A 1 202 ? 48.963  52.419  65.088 1.00 52.47 ? 202  PHE A CE2 1 
ATOM   1666 C CZ  . PHE A 1 202 ? 49.087  51.256  64.324 1.00 49.23 ? 202  PHE A CZ  1 
ATOM   1667 N N   . MET A 1 203 ? 47.574  49.793  68.562 1.00 45.02 ? 203  MET A N   1 
ATOM   1668 C CA  . MET A 1 203 ? 48.726  49.610  69.425 1.00 46.21 ? 203  MET A CA  1 
ATOM   1669 C C   . MET A 1 203 ? 50.022  49.776  68.634 1.00 45.00 ? 203  MET A C   1 
ATOM   1670 O O   . MET A 1 203 ? 50.522  48.825  68.033 1.00 50.02 ? 203  MET A O   1 
ATOM   1671 C CB  . MET A 1 203 ? 48.656  48.220  70.053 1.00 46.12 ? 203  MET A CB  1 
ATOM   1672 C CG  . MET A 1 203 ? 49.544  48.038  71.252 1.00 53.76 ? 203  MET A CG  1 
ATOM   1673 S SD  . MET A 1 203 ? 48.754  46.968  72.450 1.00 63.83 ? 203  MET A SD  1 
ATOM   1674 C CE  . MET A 1 203 ? 47.968  48.184  73.505 1.00 65.61 ? 203  MET A CE  1 
ATOM   1675 N N   . LYS A 1 204 ? 50.549  50.995  68.610 1.00 42.41 ? 204  LYS A N   1 
ATOM   1676 C CA  . LYS A 1 204 ? 51.828  51.255  67.960 1.00 35.16 ? 204  LYS A CA  1 
ATOM   1677 C C   . LYS A 1 204 ? 53.013  50.901  68.865 1.00 35.19 ? 204  LYS A C   1 
ATOM   1678 O O   . LYS A 1 204 ? 54.155  50.876  68.408 1.00 37.21 ? 204  LYS A O   1 
ATOM   1679 C CB  . LYS A 1 204 ? 51.907  52.725  67.540 1.00 34.61 ? 204  LYS A CB  1 
ATOM   1680 C CG  . LYS A 1 204 ? 52.982  53.035  66.500 1.00 42.08 ? 204  LYS A CG  1 
ATOM   1681 C CD  . LYS A 1 204 ? 52.508  52.726  65.083 1.00 46.31 ? 204  LYS A CD  1 
ATOM   1682 C CE  . LYS A 1 204 ? 53.414  53.361  64.020 1.00 47.00 ? 204  LYS A CE  1 
ATOM   1683 N NZ  . LYS A 1 204 ? 52.736  53.482  62.685 1.00 41.59 ? 204  LYS A NZ  1 
ATOM   1684 N N   . ALA A 1 205 ? 52.722  50.534  70.114 1.00 36.68 ? 205  ALA A N   1 
ATOM   1685 C CA  . ALA A 1 205 ? 53.755  50.322  71.132 1.00 31.10 ? 205  ALA A CA  1 
ATOM   1686 C C   . ALA A 1 205 ? 53.211  49.531  72.331 1.00 32.94 ? 205  ALA A C   1 
ATOM   1687 O O   . ALA A 1 205 ? 52.018  49.607  72.628 1.00 42.04 ? 205  ALA A O   1 
ATOM   1688 C CB  . ALA A 1 205 ? 54.269  51.660  71.590 1.00 30.73 ? 205  ALA A CB  1 
ATOM   1689 N N   . PRO A 1 206 ? 54.085  48.827  73.080 1.00 26.47 ? 206  PRO A N   1 
ATOM   1690 C CA  . PRO A 1 206 ? 55.484  48.526  72.765 1.00 30.03 ? 206  PRO A CA  1 
ATOM   1691 C C   . PRO A 1 206 ? 55.634  47.350  71.803 1.00 32.49 ? 206  PRO A C   1 
ATOM   1692 O O   . PRO A 1 206 ? 54.843  46.411  71.831 1.00 33.59 ? 206  PRO A O   1 
ATOM   1693 C CB  . PRO A 1 206 ? 56.096  48.220  74.132 1.00 25.19 ? 206  PRO A CB  1 
ATOM   1694 C CG  . PRO A 1 206 ? 54.983  47.610  74.887 1.00 27.93 ? 206  PRO A CG  1 
ATOM   1695 C CD  . PRO A 1 206 ? 53.736  48.360  74.436 1.00 28.18 ? 206  PRO A CD  1 
ATOM   1696 N N   . ILE A 1 207 ? 56.661  47.404  70.963 1.00 28.64 ? 207  ILE A N   1 
ATOM   1697 C CA  . ILE A 1 207 ? 56.940  46.325  70.024 1.00 27.43 ? 207  ILE A CA  1 
ATOM   1698 C C   . ILE A 1 207 ? 57.422  45.077  70.776 1.00 33.37 ? 207  ILE A C   1 
ATOM   1699 O O   . ILE A 1 207 ? 57.039  43.950  70.443 1.00 27.64 ? 207  ILE A O   1 
ATOM   1700 C CB  . ILE A 1 207 ? 58.011  46.762  68.989 1.00 25.59 ? 207  ILE A CB  1 
ATOM   1701 C CG1 . ILE A 1 207 ? 57.538  48.009  68.242 1.00 21.52 ? 207  ILE A CG1 1 
ATOM   1702 C CG2 . ILE A 1 207 ? 58.281  45.650  67.997 1.00 23.15 ? 207  ILE A CG2 1 
ATOM   1703 C CD1 . ILE A 1 207 ? 58.595  48.625  67.329 1.00 27.51 ? 207  ILE A CD1 1 
ATOM   1704 N N   . PHE A 1 208 ? 58.169  45.301  71.855 1.00 35.89 ? 208  PHE A N   1 
ATOM   1705 C CA  . PHE A 1 208 ? 58.850  44.224  72.573 1.00 36.75 ? 208  PHE A CA  1 
ATOM   1706 C C   . PHE A 1 208 ? 58.313  44.042  73.986 1.00 34.76 ? 208  PHE A C   1 
ATOM   1707 O O   . PHE A 1 208 ? 57.699  44.956  74.557 1.00 34.85 ? 208  PHE A O   1 
ATOM   1708 C CB  . PHE A 1 208 ? 60.358  44.508  72.652 1.00 43.11 ? 208  PHE A CB  1 
ATOM   1709 C CG  . PHE A 1 208 ? 61.044  44.540  71.317 1.00 39.06 ? 208  PHE A CG  1 
ATOM   1710 C CD1 . PHE A 1 208 ? 61.321  43.357  70.638 1.00 34.12 ? 208  PHE A CD1 1 
ATOM   1711 C CD2 . PHE A 1 208 ? 61.320  45.750  70.696 1.00 32.41 ? 208  PHE A CD2 1 
ATOM   1712 C CE1 . PHE A 1 208 ? 61.847  43.373  69.354 1.00 26.34 ? 208  PHE A CE1 1 
ATOM   1713 C CE2 . PHE A 1 208 ? 61.847  45.775  69.413 1.00 39.72 ? 208  PHE A CE2 1 
ATOM   1714 C CZ  . PHE A 1 208 ? 62.108  44.574  68.740 1.00 30.34 ? 208  PHE A CZ  1 
ATOM   1715 N N   . TRP A 1 209 ? 58.617  42.878  74.561 1.00 31.52 ? 209  TRP A N   1 
ATOM   1716 C CA  . TRP A 1 209 ? 58.376  42.616  75.977 1.00 41.43 ? 209  TRP A CA  1 
ATOM   1717 C C   . TRP A 1 209 ? 59.186  43.602  76.826 1.00 45.80 ? 209  TRP A C   1 
ATOM   1718 O O   . TRP A 1 209 ? 60.198  44.152  76.376 1.00 46.31 ? 209  TRP A O   1 
ATOM   1719 C CB  . TRP A 1 209 ? 58.759  41.169  76.326 1.00 46.12 ? 209  TRP A CB  1 
ATOM   1720 C CG  . TRP A 1 209 ? 58.114  40.608  77.590 1.00 56.66 ? 209  TRP A CG  1 
ATOM   1721 C CD1 . TRP A 1 209 ? 58.026  41.213  78.814 1.00 58.53 ? 209  TRP A CD1 1 
ATOM   1722 C CD2 . TRP A 1 209 ? 57.555  39.295  77.758 1.00 60.97 ? 209  TRP A CD2 1 
ATOM   1723 N NE1 . TRP A 1 209 ? 57.454  40.363  79.726 1.00 61.22 ? 209  TRP A NE1 1 
ATOM   1724 C CE2 . TRP A 1 209 ? 57.153  39.179  79.106 1.00 61.30 ? 209  TRP A CE2 1 
ATOM   1725 C CE3 . TRP A 1 209 ? 57.363  38.203  76.900 1.00 58.62 ? 209  TRP A CE3 1 
ATOM   1726 C CZ2 . TRP A 1 209 ? 56.568  38.015  79.617 1.00 63.75 ? 209  TRP A CZ2 1 
ATOM   1727 C CZ3 . TRP A 1 209 ? 56.787  37.045  77.406 1.00 58.57 ? 209  TRP A CZ3 1 
ATOM   1728 C CH2 . TRP A 1 209 ? 56.395  36.961  78.753 1.00 61.46 ? 209  TRP A CH2 1 
ATOM   1729 N N   . TYR A 1 210 ? 58.846  43.922  77.989 1.00 47.35 ? 210  TYR A N   1 
ATOM   1730 C CA  . TYR A 1 210 ? 59.397  44.957  78.855 1.00 51.42 ? 210  TYR A CA  1 
ATOM   1731 C C   . TYR A 1 210 ? 60.835  44.696  79.278 1.00 48.29 ? 210  TYR A C   1 
ATOM   1732 O O   . TYR A 1 210 ? 61.514  45.612  79.740 1.00 55.17 ? 210  TYR A O   1 
ATOM   1733 C CB  . TYR A 1 210 ? 58.524  45.129  80.098 1.00 55.96 ? 210  TYR A CB  1 
ATOM   1734 C CG  . TYR A 1 210 ? 57.030  45.275  79.895 1.00 72.62 ? 210  TYR A CG  1 
ATOM   1735 C CD1 . TYR A 1 210 ? 56.458  46.524  79.620 1.00 77.82 ? 210  TYR A CD1 1 
ATOM   1736 C CD2 . TYR A 1 210 ? 56.177  44.172  80.018 1.00 77.21 ? 210  TYR A CD2 1 
ATOM   1737 C CE1 . TYR A 1 210 ? 55.073  46.672  79.483 1.00 79.46 ? 210  TYR A CE1 1 
ATOM   1738 C CE2 . TYR A 1 210 ? 54.792  44.309  79.885 1.00 77.76 ? 210  TYR A CE2 1 
ATOM   1739 C CZ  . TYR A 1 210 ? 54.247  45.560  79.619 1.00 79.57 ? 210  TYR A CZ  1 
ATOM   1740 O OH  . TYR A 1 210 ? 52.879  45.699  79.506 1.00 80.11 ? 210  TYR A OH  1 
ATOM   1741 N N   . THR A 1 211 ? 61.171  43.370  79.154 1.00 38.72 ? 211  THR A N   1 
ATOM   1742 C CA  . THR A 1 211 ? 62.546  42.974  79.484 1.00 35.75 ? 211  THR A CA  1 
ATOM   1743 C C   . THR A 1 211 ? 63.544  43.428  78.415 1.00 38.51 ? 211  THR A C   1 
ATOM   1744 O O   . THR A 1 211 ? 64.731  43.088  78.467 1.00 35.12 ? 211  THR A O   1 
ATOM   1745 C CB  . THR A 1 211 ? 62.679  41.424  79.631 1.00 38.73 ? 211  THR A CB  1 
ATOM   1746 O OG1 . THR A 1 211 ? 62.735  40.807  78.334 1.00 39.16 ? 211  THR A OG1 1 
ATOM   1747 C CG2 . THR A 1 211 ? 61.499  40.852  80.409 1.00 43.80 ? 211  THR A CG2 1 
ATOM   1748 N N   . ALA A 1 212 ? 63.043  44.136  77.410 1.00 36.34 ? 212  ALA A N   1 
ATOM   1749 C CA  . ALA A 1 212 ? 63.864  44.548  76.286 1.00 38.38 ? 212  ALA A CA  1 
ATOM   1750 C C   . ALA A 1 212 ? 64.656  45.823  76.570 1.00 38.58 ? 212  ALA A C   1 
ATOM   1751 O O   . ALA A 1 212 ? 64.197  46.720  77.282 1.00 38.13 ? 212  ALA A O   1 
ATOM   1752 C CB  . ALA A 1 212 ? 62.996  44.724  75.050 1.00 36.98 ? 212  ALA A CB  1 
ATOM   1753 N N   . LEU A 1 213 ? 65.856  45.880  76.001 1.00 37.98 ? 213  LEU A N   1 
ATOM   1754 C CA  . LEU A 1 213 ? 66.756  47.026  76.119 1.00 38.17 ? 213  LEU A CA  1 
ATOM   1755 C C   . LEU A 1 213 ? 66.300  48.200  75.246 1.00 40.28 ? 213  LEU A C   1 
ATOM   1756 O O   . LEU A 1 213 ? 66.694  49.348  75.477 1.00 36.04 ? 213  LEU A O   1 
ATOM   1757 C CB  . LEU A 1 213 ? 68.179  46.607  75.711 1.00 38.20 ? 213  LEU A CB  1 
ATOM   1758 C CG  . LEU A 1 213 ? 69.127  45.939  76.719 1.00 36.83 ? 213  LEU A CG  1 
ATOM   1759 C CD1 . LEU A 1 213 ? 70.015  47.000  77.349 1.00 41.40 ? 213  LEU A CD1 1 
ATOM   1760 C CD2 . LEU A 1 213 ? 68.356  45.165  77.787 1.00 39.35 ? 213  LEU A CD2 1 
ATOM   1761 N N   . TRP A 1 214 ? 65.538  47.896  74.199 1.00 38.93 ? 214  TRP A N   1 
ATOM   1762 C CA  . TRP A 1 214 ? 64.976  48.933  73.347 1.00 48.36 ? 214  TRP A CA  1 
ATOM   1763 C C   . TRP A 1 214 ? 63.471  48.763  73.177 1.00 48.02 ? 214  TRP A C   1 
ATOM   1764 O O   . TRP A 1 214 ? 62.962  47.645  73.163 1.00 52.45 ? 214  TRP A O   1 
ATOM   1765 C CB  . TRP A 1 214 ? 65.656  48.934  71.974 1.00 49.05 ? 214  TRP A CB  1 
ATOM   1766 C CG  . TRP A 1 214 ? 65.444  50.219  71.229 1.00 53.48 ? 214  TRP A CG  1 
ATOM   1767 C CD1 . TRP A 1 214 ? 65.989  51.428  71.536 1.00 58.89 ? 214  TRP A CD1 1 
ATOM   1768 C CD2 . TRP A 1 214 ? 64.492  50.466  70.180 1.00 55.84 ? 214  TRP A CD2 1 
ATOM   1769 N NE1 . TRP A 1 214 ? 65.419  52.418  70.769 1.00 64.27 ? 214  TRP A NE1 1 
ATOM   1770 C CE2 . TRP A 1 214 ? 64.496  51.854  69.929 1.00 57.34 ? 214  TRP A CE2 1 
ATOM   1771 C CE3 . TRP A 1 214 ? 63.629  49.649  69.439 1.00 58.15 ? 214  TRP A CE3 1 
ATOM   1772 C CZ2 . TRP A 1 214 ? 63.668  52.447  68.973 1.00 56.41 ? 214  TRP A CZ2 1 
ATOM   1773 C CZ3 . TRP A 1 214 ? 62.804  50.243  68.483 1.00 58.07 ? 214  TRP A CZ3 1 
ATOM   1774 C CH2 . TRP A 1 214 ? 62.831  51.627  68.264 1.00 56.30 ? 214  TRP A CH2 1 
ATOM   1775 N N   . ASN A 1 215 ? 62.766  49.889  73.108 1.00 43.79 ? 215  ASN A N   1 
ATOM   1776 C CA  . ASN A 1 215 ? 61.334  49.918  72.819 1.00 40.81 ? 215  ASN A CA  1 
ATOM   1777 C C   . ASN A 1 215 ? 60.929  51.320  72.393 1.00 51.30 ? 215  ASN A C   1 
ATOM   1778 O O   . ASN A 1 215 ? 61.747  52.244  72.431 1.00 57.64 ? 215  ASN A O   1 
ATOM   1779 C CB  . ASN A 1 215 ? 60.523  49.503  74.045 1.00 35.02 ? 215  ASN A CB  1 
ATOM   1780 C CG  . ASN A 1 215 ? 60.021  48.084  73.951 1.00 35.54 ? 215  ASN A CG  1 
ATOM   1781 O OD1 . ASN A 1 215 ? 59.999  47.352  74.938 1.00 42.03 ? 215  ASN A OD1 1 
ATOM   1782 N ND2 . ASN A 1 215 ? 59.615  47.684  72.759 1.00 34.65 ? 215  ASN A ND2 1 
ATOM   1783 N N   . ASN A 1 216 ? 59.674  51.479  71.980 1.00 53.28 ? 216  ASN A N   1 
ATOM   1784 C CA  . ASN A 1 216 ? 59.170  52.796  71.594 1.00 52.18 ? 216  ASN A CA  1 
ATOM   1785 C C   . ASN A 1 216 ? 58.136  53.341  72.578 1.00 54.11 ? 216  ASN A C   1 
ATOM   1786 O O   . ASN A 1 216 ? 57.805  54.531  72.547 1.00 58.80 ? 216  ASN A O   1 
ATOM   1787 C CB  . ASN A 1 216 ? 58.608  52.771  70.169 1.00 52.82 ? 216  ASN A CB  1 
ATOM   1788 C CG  . ASN A 1 216 ? 57.579  51.678  69.958 1.00 55.27 ? 216  ASN A CG  1 
ATOM   1789 O OD1 . ASN A 1 216 ? 57.734  50.554  70.439 1.00 52.38 ? 216  ASN A OD1 1 
ATOM   1790 N ND2 . ASN A 1 216 ? 56.542  51.992  69.189 1.00 56.00 ? 216  ASN A ND2 1 
ATOM   1791 N N   . LYS A 1 217 ? 57.684  52.478  73.487 1.00 54.77 ? 217  LYS A N   1 
ATOM   1792 C CA  . LYS A 1 217 ? 56.886  52.892  74.645 1.00 62.38 ? 217  LYS A CA  1 
ATOM   1793 C C   . LYS A 1 217 ? 57.060  51.861  75.777 1.00 66.60 ? 217  LYS A C   1 
ATOM   1794 O O   . LYS A 1 217 ? 56.049  51.444  76.390 1.00 69.21 ? 217  LYS A O   1 
ATOM   1795 C CB  . LYS A 1 217 ? 55.404  53.013  74.247 1.00 58.75 ? 217  LYS A CB  1 
ATOM   1796 C CG  . LYS A 1 217 ? 54.564  53.967  75.091 1.00 62.44 ? 217  LYS A CG  1 
ATOM   1797 C CD  . LYS A 1 217 ? 53.147  53.426  75.308 1.00 63.82 ? 217  LYS A CD  1 
ATOM   1798 C CE  . LYS A 1 217 ? 53.098  52.415  76.461 1.00 66.62 ? 217  LYS A CE  1 
ATOM   1799 N NZ  . LYS A 1 217 ? 51.748  51.808  76.688 1.00 66.57 ? 217  LYS A NZ  1 
ATOM   1800 N N   . VAL B 1 1   ? 67.218  18.770  35.805 1.00 27.28 ? 1    VAL B N   1 
ATOM   1801 C CA  . VAL B 1 1   ? 68.136  18.593  36.973 1.00 31.21 ? 1    VAL B CA  1 
ATOM   1802 C C   . VAL B 1 1   ? 68.253  19.863  37.804 1.00 33.16 ? 1    VAL B C   1 
ATOM   1803 O O   . VAL B 1 1   ? 68.437  20.957  37.267 1.00 37.95 ? 1    VAL B O   1 
ATOM   1804 C CB  . VAL B 1 1   ? 69.548  18.163  36.528 1.00 29.20 ? 1    VAL B CB  1 
ATOM   1805 C CG1 . VAL B 1 1   ? 70.478  18.016  37.738 1.00 16.45 ? 1    VAL B CG1 1 
ATOM   1806 C CG2 . VAL B 1 1   ? 69.460  16.862  35.761 1.00 36.18 ? 1    VAL B CG2 1 
ATOM   1807 N N   . VAL B 1 2   ? 68.178  19.696  39.124 1.00 31.45 ? 2    VAL B N   1 
ATOM   1808 C CA  . VAL B 1 2   ? 68.199  20.819  40.059 1.00 29.02 ? 2    VAL B CA  1 
ATOM   1809 C C   . VAL B 1 2   ? 69.462  20.830  40.927 1.00 25.92 ? 2    VAL B C   1 
ATOM   1810 O O   . VAL B 1 2   ? 70.105  19.804  41.125 1.00 27.01 ? 2    VAL B O   1 
ATOM   1811 C CB  . VAL B 1 2   ? 66.935  20.820  40.979 1.00 28.49 ? 2    VAL B CB  1 
ATOM   1812 C CG1 . VAL B 1 2   ? 65.717  20.355  40.197 1.00 30.83 ? 2    VAL B CG1 1 
ATOM   1813 C CG2 . VAL B 1 2   ? 67.143  19.929  42.198 1.00 24.13 ? 2    VAL B CG2 1 
ATOM   1814 N N   . THR B 1 3   ? 69.761  21.987  41.501 1.00 23.45 ? 3    THR B N   1 
ATOM   1815 C CA  . THR B 1 3   ? 70.969  22.172  42.287 1.00 21.55 ? 3    THR B CA  1 
ATOM   1816 C C   . THR B 1 3   ? 70.612  22.611  43.701 1.00 24.86 ? 3    THR B C   1 
ATOM   1817 O O   . THR B 1 3   ? 69.892  23.587  43.891 1.00 30.40 ? 3    THR B O   1 
ATOM   1818 C CB  . THR B 1 3   ? 71.865  23.243  41.646 1.00 21.51 ? 3    THR B CB  1 
ATOM   1819 O OG1 . THR B 1 3   ? 72.261  22.808  40.344 1.00 28.17 ? 3    THR B OG1 1 
ATOM   1820 C CG2 . THR B 1 3   ? 73.104  23.487  42.482 1.00 25.20 ? 3    THR B CG2 1 
ATOM   1821 N N   . LEU B 1 4   ? 71.118  21.881  44.686 1.00 21.28 ? 4    LEU B N   1 
ATOM   1822 C CA  . LEU B 1 4   ? 70.898  22.215  46.086 1.00 16.64 ? 4    LEU B CA  1 
ATOM   1823 C C   . LEU B 1 4   ? 72.187  22.752  46.688 1.00 17.21 ? 4    LEU B C   1 
ATOM   1824 O O   . LEU B 1 4   ? 73.186  22.042  46.746 1.00 24.28 ? 4    LEU B O   1 
ATOM   1825 C CB  . LEU B 1 4   ? 70.439  20.971  46.863 1.00 15.49 ? 4    LEU B CB  1 
ATOM   1826 C CG  . LEU B 1 4   ? 70.448  21.026  48.402 1.00 9.96  ? 4    LEU B CG  1 
ATOM   1827 C CD1 . LEU B 1 4   ? 69.329  21.923  48.902 1.00 10.22 ? 4    LEU B CD1 1 
ATOM   1828 C CD2 . LEU B 1 4   ? 70.291  19.634  48.979 1.00 5.86  ? 4    LEU B CD2 1 
ATOM   1829 N N   . GLY B 1 5   ? 72.154  23.994  47.160 1.00 16.85 ? 5    GLY B N   1 
ATOM   1830 C CA  . GLY B 1 5   ? 73.333  24.586  47.761 1.00 15.65 ? 5    GLY B CA  1 
ATOM   1831 C C   . GLY B 1 5   ? 73.231  24.673  49.262 1.00 11.90 ? 5    GLY B C   1 
ATOM   1832 O O   . GLY B 1 5   ? 72.259  25.202  49.785 1.00 21.45 ? 5    GLY B O   1 
ATOM   1833 N N   . TYR B 1 6   ? 74.197  24.078  49.950 1.00 15.39 ? 6    TYR B N   1 
ATOM   1834 C CA  . TYR B 1 6   ? 74.299  24.172  51.405 1.00 21.18 ? 6    TYR B CA  1 
ATOM   1835 C C   . TYR B 1 6   ? 75.734  23.843  51.832 1.00 22.30 ? 6    TYR B C   1 
ATOM   1836 O O   . TYR B 1 6   ? 76.570  23.521  50.989 1.00 22.65 ? 6    TYR B O   1 
ATOM   1837 C CB  . TYR B 1 6   ? 73.314  23.200  52.074 1.00 15.28 ? 6    TYR B CB  1 
ATOM   1838 C CG  . TYR B 1 6   ? 73.072  23.480  53.553 1.00 12.78 ? 6    TYR B CG  1 
ATOM   1839 C CD1 . TYR B 1 6   ? 72.592  24.721  53.979 1.00 6.12  ? 6    TYR B CD1 1 
ATOM   1840 C CD2 . TYR B 1 6   ? 73.372  22.523  54.530 1.00 9.91  ? 6    TYR B CD2 1 
ATOM   1841 C CE1 . TYR B 1 6   ? 72.425  25.006  55.326 1.00 6.87  ? 6    TYR B CE1 1 
ATOM   1842 C CE2 . TYR B 1 6   ? 73.203  22.804  55.886 1.00 8.41  ? 6    TYR B CE2 1 
ATOM   1843 C CZ  . TYR B 1 6   ? 72.732  24.048  56.276 1.00 9.76  ? 6    TYR B CZ  1 
ATOM   1844 O OH  . TYR B 1 6   ? 72.563  24.346  57.616 1.00 11.50 ? 6    TYR B OH  1 
ATOM   1845 N N   . TRP B 1 7   ? 76.022  23.967  53.127 1.00 17.96 ? 7    TRP B N   1 
ATOM   1846 C CA  . TRP B 1 7   ? 77.299  23.538  53.693 1.00 22.15 ? 7    TRP B CA  1 
ATOM   1847 C C   . TRP B 1 7   ? 77.472  22.023  53.617 1.00 30.71 ? 7    TRP B C   1 
ATOM   1848 O O   . TRP B 1 7   ? 76.504  21.298  53.405 1.00 39.79 ? 7    TRP B O   1 
ATOM   1849 C CB  . TRP B 1 7   ? 77.387  23.965  55.157 1.00 27.00 ? 7    TRP B CB  1 
ATOM   1850 C CG  . TRP B 1 7   ? 77.252  25.428  55.364 1.00 27.21 ? 7    TRP B CG  1 
ATOM   1851 C CD1 . TRP B 1 7   ? 76.167  26.086  55.855 1.00 31.34 ? 7    TRP B CD1 1 
ATOM   1852 C CD2 . TRP B 1 7   ? 78.249  26.422  55.114 1.00 29.48 ? 7    TRP B CD2 1 
ATOM   1853 N NE1 . TRP B 1 7   ? 76.425  27.432  55.935 1.00 24.52 ? 7    TRP B NE1 1 
ATOM   1854 C CE2 . TRP B 1 7   ? 77.695  27.669  55.483 1.00 28.89 ? 7    TRP B CE2 1 
ATOM   1855 C CE3 . TRP B 1 7   ? 79.559  26.385  54.615 1.00 30.03 ? 7    TRP B CE3 1 
ATOM   1856 C CZ2 . TRP B 1 7   ? 78.403  28.871  55.369 1.00 34.22 ? 7    TRP B CZ2 1 
ATOM   1857 C CZ3 . TRP B 1 7   ? 80.264  27.578  54.499 1.00 31.02 ? 7    TRP B CZ3 1 
ATOM   1858 C CH2 . TRP B 1 7   ? 79.681  28.807  54.876 1.00 31.99 ? 7    TRP B CH2 1 
ATOM   1859 N N   . ASP B 1 8   ? 78.685  21.545  53.894 1.00 35.67 ? 8    ASP B N   1 
ATOM   1860 C CA  . ASP B 1 8   ? 78.945  20.108  53.990 1.00 37.12 ? 8    ASP B CA  1 
ATOM   1861 C C   . ASP B 1 8   ? 78.579  19.607  55.398 1.00 34.35 ? 8    ASP B C   1 
ATOM   1862 O O   . ASP B 1 8   ? 79.363  18.912  56.050 1.00 42.78 ? 8    ASP B O   1 
ATOM   1863 C CB  . ASP B 1 8   ? 80.428  19.824  53.673 1.00 41.53 ? 8    ASP B CB  1 
ATOM   1864 C CG  . ASP B 1 8   ? 80.674  18.390  53.180 1.00 46.45 ? 8    ASP B CG  1 
ATOM   1865 O OD1 . ASP B 1 8   ? 80.783  17.462  54.016 1.00 50.88 ? 8    ASP B OD1 1 
ATOM   1866 O OD2 . ASP B 1 8   ? 80.855  18.201  51.957 1.00 52.21 ? 8    ASP B OD2 1 
ATOM   1867 N N   . ILE B 1 9   ? 77.421  20.036  55.896 1.00 26.95 ? 9    ILE B N   1 
ATOM   1868 C CA  . ILE B 1 9   ? 76.894  19.530  57.160 1.00 23.37 ? 9    ILE B CA  1 
ATOM   1869 C C   . ILE B 1 9   ? 75.436  19.106  56.972 1.00 27.95 ? 9    ILE B C   1 
ATOM   1870 O O   . ILE B 1 9   ? 74.869  19.295  55.888 1.00 32.02 ? 9    ILE B O   1 
ATOM   1871 C CB  . ILE B 1 9   ? 77.008  20.592  58.299 1.00 23.89 ? 9    ILE B CB  1 
ATOM   1872 C CG1 . ILE B 1 9   ? 76.093  21.779  58.022 1.00 21.68 ? 9    ILE B CG1 1 
ATOM   1873 C CG2 . ILE B 1 9   ? 78.446  21.079  58.435 1.00 20.23 ? 9    ILE B CG2 1 
ATOM   1874 C CD1 . ILE B 1 9   ? 75.971  22.732  59.189 1.00 21.73 ? 9    ILE B CD1 1 
ATOM   1875 N N   . ARG B 1 10  ? 74.879  18.423  57.971 1.00 30.32 ? 10   ARG B N   1 
ATOM   1876 C CA  . ARG B 1 10  ? 73.471  18.032  57.941 1.00 36.35 ? 10   ARG B CA  1 
ATOM   1877 C C   . ARG B 1 10  ? 72.547  19.254  58.025 1.00 36.95 ? 10   ARG B C   1 
ATOM   1878 O O   . ARG B 1 10  ? 71.863  19.594  57.055 1.00 43.70 ? 10   ARG B O   1 
ATOM   1879 C CB  . ARG B 1 10  ? 73.157  17.063  59.086 1.00 37.96 ? 10   ARG B CB  1 
ATOM   1880 C CG  . ARG B 1 10  ? 71.745  16.514  59.029 1.00 39.20 ? 10   ARG B CG  1 
ATOM   1881 C CD  . ARG B 1 10  ? 71.172  16.288  60.405 1.00 36.74 ? 10   ARG B CD  1 
ATOM   1882 N NE  . ARG B 1 10  ? 71.149  14.864  60.703 1.00 39.52 ? 10   ARG B NE  1 
ATOM   1883 C CZ  . ARG B 1 10  ? 70.130  14.230  61.271 1.00 38.45 ? 10   ARG B CZ  1 
ATOM   1884 N NH1 . ARG B 1 10  ? 69.092  14.913  61.730 1.00 38.21 ? 10   ARG B NH1 1 
ATOM   1885 N NH2 . ARG B 1 10  ? 70.185  12.916  61.437 1.00 36.93 ? 10   ARG B NH2 1 
ATOM   1886 N N   . GLY B 1 11  ? 72.507  19.885  59.195 1.00 24.17 ? 11   GLY B N   1 
ATOM   1887 C CA  . GLY B 1 11  ? 71.746  21.114  59.369 1.00 22.98 ? 11   GLY B CA  1 
ATOM   1888 C C   . GLY B 1 11  ? 70.330  21.141  58.812 1.00 23.06 ? 11   GLY B C   1 
ATOM   1889 O O   . GLY B 1 11  ? 69.577  20.170  58.946 1.00 26.75 ? 11   GLY B O   1 
ATOM   1890 N N   . LEU B 1 12  ? 70.018  22.228  58.106 1.00 18.59 ? 12   LEU B N   1 
ATOM   1891 C CA  . LEU B 1 12  ? 68.671  22.527  57.618 1.00 14.00 ? 12   LEU B CA  1 
ATOM   1892 C C   . LEU B 1 12  ? 68.290  21.769  56.361 1.00 15.27 ? 12   LEU B C   1 
ATOM   1893 O O   . LEU B 1 12  ? 67.124  21.752  55.973 1.00 23.71 ? 12   LEU B O   1 
ATOM   1894 C CB  . LEU B 1 12  ? 68.540  24.013  57.304 1.00 10.94 ? 12   LEU B CB  1 
ATOM   1895 C CG  . LEU B 1 12  ? 68.628  25.015  58.444 1.00 17.65 ? 12   LEU B CG  1 
ATOM   1896 C CD1 . LEU B 1 12  ? 68.648  26.409  57.864 1.00 23.68 ? 12   LEU B CD1 1 
ATOM   1897 C CD2 . LEU B 1 12  ? 67.447  24.846  59.372 1.00 19.79 ? 12   LEU B CD2 1 
ATOM   1898 N N   . ALA B 1 13  ? 69.296  21.290  55.643 1.00 7.97  ? 13   ALA B N   1 
ATOM   1899 C CA  . ALA B 1 13  ? 69.080  20.696  54.331 1.00 14.05 ? 13   ALA B CA  1 
ATOM   1900 C C   . ALA B 1 13  ? 68.785  19.206  54.396 1.00 27.38 ? 13   ALA B C   1 
ATOM   1901 O O   . ALA B 1 13  ? 68.588  18.565  53.366 1.00 27.71 ? 13   ALA B O   1 
ATOM   1902 C CB  . ALA B 1 13  ? 70.287  20.940  53.444 1.00 18.75 ? 13   ALA B CB  1 
ATOM   1903 N N   . HIS B 1 14  ? 68.737  18.656  55.603 1.00 26.03 ? 14   HIS B N   1 
ATOM   1904 C CA  . HIS B 1 14  ? 68.555  17.225  55.772 1.00 18.26 ? 14   HIS B CA  1 
ATOM   1905 C C   . HIS B 1 14  ? 67.183  16.767  55.277 1.00 23.54 ? 14   HIS B C   1 
ATOM   1906 O O   . HIS B 1 14  ? 67.084  15.820  54.490 1.00 27.24 ? 14   HIS B O   1 
ATOM   1907 C CB  . HIS B 1 14  ? 68.752  16.849  57.236 1.00 10.83 ? 14   HIS B CB  1 
ATOM   1908 C CG  . HIS B 1 14  ? 68.835  15.377  57.470 1.00 12.64 ? 14   HIS B CG  1 
ATOM   1909 N ND1 . HIS B 1 14  ? 69.905  14.620  57.051 1.00 16.45 ? 14   HIS B ND1 1 
ATOM   1910 C CD2 . HIS B 1 14  ? 67.960  14.515  58.037 1.00 15.28 ? 14   HIS B CD2 1 
ATOM   1911 C CE1 . HIS B 1 14  ? 69.688  13.353  57.348 1.00 15.19 ? 14   HIS B CE1 1 
ATOM   1912 N NE2 . HIS B 1 14  ? 68.513  13.262  57.948 1.00 21.78 ? 14   HIS B NE2 1 
ATOM   1913 N N   . ALA B 1 15  ? 66.139  17.503  55.655 1.00 29.10 ? 15   ALA B N   1 
ATOM   1914 C CA  . ALA B 1 15  ? 64.785  17.155  55.228 1.00 19.74 ? 15   ALA B CA  1 
ATOM   1915 C C   . ALA B 1 15  ? 64.571  17.423  53.742 1.00 20.58 ? 15   ALA B C   1 
ATOM   1916 O O   . ALA B 1 15  ? 63.814  16.701  53.094 1.00 30.51 ? 15   ALA B O   1 
ATOM   1917 C CB  . ALA B 1 15  ? 63.753  17.890  56.050 1.00 9.15  ? 15   ALA B CB  1 
ATOM   1918 N N   . ILE B 1 16  ? 65.303  18.396  53.194 1.00 16.39 ? 16   ILE B N   1 
ATOM   1919 C CA  . ILE B 1 16  ? 65.237  18.703  51.770 1.00 15.35 ? 16   ILE B CA  1 
ATOM   1920 C C   . ILE B 1 16  ? 65.875  17.586  50.949 1.00 16.95 ? 16   ILE B C   1 
ATOM   1921 O O   . ILE B 1 16  ? 65.377  17.211  49.881 1.00 19.89 ? 16   ILE B O   1 
ATOM   1922 C CB  . ILE B 1 16  ? 65.969  20.000  51.436 1.00 12.67 ? 16   ILE B CB  1 
ATOM   1923 C CG1 . ILE B 1 16  ? 65.439  21.140  52.298 1.00 4.22  ? 16   ILE B CG1 1 
ATOM   1924 C CG2 . ILE B 1 16  ? 65.789  20.322  49.962 1.00 9.84  ? 16   ILE B CG2 1 
ATOM   1925 C CD1 . ILE B 1 16  ? 66.207  22.437  52.125 1.00 10.33 ? 16   ILE B CD1 1 
ATOM   1926 N N   . ARG B 1 17  ? 66.977  17.054  51.465 1.00 16.36 ? 17   ARG B N   1 
ATOM   1927 C CA  . ARG B 1 17  ? 67.701  15.982  50.803 1.00 8.31  ? 17   ARG B CA  1 
ATOM   1928 C C   . ARG B 1 17  ? 66.855  14.720  50.757 1.00 14.24 ? 17   ARG B C   1 
ATOM   1929 O O   . ARG B 1 17  ? 66.693  14.118  49.695 1.00 28.07 ? 17   ARG B O   1 
ATOM   1930 C CB  . ARG B 1 17  ? 69.011  15.700  51.538 1.00 12.80 ? 17   ARG B CB  1 
ATOM   1931 C CG  . ARG B 1 17  ? 70.143  16.684  51.249 1.00 9.00  ? 17   ARG B CG  1 
ATOM   1932 C CD  . ARG B 1 17  ? 71.379  16.400  52.128 1.00 9.60  ? 17   ARG B CD  1 
ATOM   1933 N NE  . ARG B 1 17  ? 72.431  17.411  51.967 1.00 2.00  ? 17   ARG B NE  1 
ATOM   1934 C CZ  . ARG B 1 17  ? 72.968  18.106  52.966 1.00 9.10  ? 17   ARG B CZ  1 
ATOM   1935 N NH1 . ARG B 1 17  ? 72.668  17.811  54.225 1.00 11.53 ? 17   ARG B NH1 1 
ATOM   1936 N NH2 . ARG B 1 17  ? 73.833  19.076  52.708 1.00 3.84  ? 17   ARG B NH2 1 
ATOM   1937 N N   . LEU B 1 18  ? 66.257  14.368  51.894 1.00 16.58 ? 18   LEU B N   1 
ATOM   1938 C CA  . LEU B 1 18  ? 65.342  13.230  51.970 1.00 17.24 ? 18   LEU B CA  1 
ATOM   1939 C C   . LEU B 1 18  ? 64.129  13.376  51.046 1.00 16.07 ? 18   LEU B C   1 
ATOM   1940 O O   . LEU B 1 18  ? 63.619  12.384  50.527 1.00 22.08 ? 18   LEU B O   1 
ATOM   1941 C CB  . LEU B 1 18  ? 64.862  13.046  53.404 1.00 21.86 ? 18   LEU B CB  1 
ATOM   1942 C CG  . LEU B 1 18  ? 65.922  12.564  54.387 1.00 19.05 ? 18   LEU B CG  1 
ATOM   1943 C CD1 . LEU B 1 18  ? 65.520  12.957  55.788 1.00 21.58 ? 18   LEU B CD1 1 
ATOM   1944 C CD2 . LEU B 1 18  ? 66.073  11.060  54.279 1.00 16.46 ? 18   LEU B CD2 1 
ATOM   1945 N N   . LEU B 1 19  ? 63.668  14.611  50.857 1.00 14.83 ? 19   LEU B N   1 
ATOM   1946 C CA  . LEU B 1 19  ? 62.458  14.878  50.083 1.00 10.98 ? 19   LEU B CA  1 
ATOM   1947 C C   . LEU B 1 19  ? 62.751  14.735  48.605 1.00 14.05 ? 19   LEU B C   1 
ATOM   1948 O O   . LEU B 1 19  ? 61.985  14.116  47.860 1.00 15.13 ? 19   LEU B O   1 
ATOM   1949 C CB  . LEU B 1 19  ? 61.943  16.287  50.373 1.00 9.73  ? 19   LEU B CB  1 
ATOM   1950 C CG  . LEU B 1 19  ? 60.439  16.603  50.324 1.00 17.41 ? 19   LEU B CG  1 
ATOM   1951 C CD1 . LEU B 1 19  ? 60.232  17.824  49.442 1.00 10.35 ? 19   LEU B CD1 1 
ATOM   1952 C CD2 . LEU B 1 19  ? 59.602  15.425  49.823 1.00 16.00 ? 19   LEU B CD2 1 
ATOM   1953 N N   . LEU B 1 20  ? 63.895  15.276  48.202 1.00 16.83 ? 20   LEU B N   1 
ATOM   1954 C CA  . LEU B 1 20  ? 64.355  15.168  46.829 1.00 19.93 ? 20   LEU B CA  1 
ATOM   1955 C C   . LEU B 1 20  ? 64.587  13.709  46.441 1.00 22.33 ? 20   LEU B C   1 
ATOM   1956 O O   . LEU B 1 20  ? 64.290  13.300  45.319 1.00 28.88 ? 20   LEU B O   1 
ATOM   1957 C CB  . LEU B 1 20  ? 65.634  15.980  46.653 1.00 18.62 ? 20   LEU B CB  1 
ATOM   1958 C CG  . LEU B 1 20  ? 65.436  17.497  46.588 1.00 18.49 ? 20   LEU B CG  1 
ATOM   1959 C CD1 . LEU B 1 20  ? 66.761  18.191  46.855 1.00 19.70 ? 20   LEU B CD1 1 
ATOM   1960 C CD2 . LEU B 1 20  ? 64.896  17.892  45.224 1.00 12.20 ? 20   LEU B CD2 1 
ATOM   1961 N N   . GLU B 1 21  ? 65.034  12.911  47.400 1.00 20.51 ? 21   GLU B N   1 
ATOM   1962 C CA  . GLU B 1 21  ? 65.230  11.486  47.175 1.00 23.58 ? 21   GLU B CA  1 
ATOM   1963 C C   . GLU B 1 21  ? 63.908  10.726  47.075 1.00 28.04 ? 21   GLU B C   1 
ATOM   1964 O O   . GLU B 1 21  ? 63.706  9.925   46.157 1.00 28.93 ? 21   GLU B O   1 
ATOM   1965 C CB  . GLU B 1 21  ? 66.082  10.913  48.299 1.00 23.17 ? 21   GLU B CB  1 
ATOM   1966 C CG  . GLU B 1 21  ? 67.517  11.364  48.227 1.00 28.13 ? 21   GLU B CG  1 
ATOM   1967 C CD  . GLU B 1 21  ? 68.325  10.588  47.203 1.00 33.76 ? 21   GLU B CD  1 
ATOM   1968 O OE1 . GLU B 1 21  ? 67.971  9.427   46.896 1.00 35.80 ? 21   GLU B OE1 1 
ATOM   1969 O OE2 . GLU B 1 21  ? 69.361  11.115  46.753 1.00 28.04 ? 21   GLU B OE2 1 
ATOM   1970 N N   . TYR B 1 22  ? 62.999  11.027  47.994 1.00 26.73 ? 22   TYR B N   1 
ATOM   1971 C CA  . TYR B 1 22  ? 61.694  10.398  48.027 1.00 29.46 ? 22   TYR B CA  1 
ATOM   1972 C C   . TYR B 1 22  ? 60.889  10.682  46.762 1.00 27.79 ? 22   TYR B C   1 
ATOM   1973 O O   . TYR B 1 22  ? 60.147  9.820   46.277 1.00 31.12 ? 22   TYR B O   1 
ATOM   1974 C CB  . TYR B 1 22  ? 60.923  10.882  49.250 1.00 26.57 ? 22   TYR B CB  1 
ATOM   1975 C CG  . TYR B 1 22  ? 59.544  10.304  49.323 1.00 22.26 ? 22   TYR B CG  1 
ATOM   1976 C CD1 . TYR B 1 22  ? 59.350  8.985   49.715 1.00 20.27 ? 22   TYR B CD1 1 
ATOM   1977 C CD2 . TYR B 1 22  ? 58.445  11.032  48.885 1.00 22.42 ? 22   TYR B CD2 1 
ATOM   1978 C CE1 . TYR B 1 22  ? 58.096  8.398   49.659 1.00 31.72 ? 22   TYR B CE1 1 
ATOM   1979 C CE2 . TYR B 1 22  ? 57.186  10.459  48.829 1.00 27.55 ? 22   TYR B CE2 1 
ATOM   1980 C CZ  . TYR B 1 22  ? 57.014  9.140   49.215 1.00 28.99 ? 22   TYR B CZ  1 
ATOM   1981 O OH  . TYR B 1 22  ? 55.763  8.569   49.159 1.00 36.55 ? 22   TYR B OH  1 
ATOM   1982 N N   . THR B 1 23  ? 61.000  11.908  46.259 1.00 28.07 ? 23   THR B N   1 
ATOM   1983 C CA  . THR B 1 23  ? 60.254  12.302  45.063 1.00 31.92 ? 23   THR B CA  1 
ATOM   1984 C C   . THR B 1 23  ? 60.960  11.928  43.768 1.00 29.24 ? 23   THR B C   1 
ATOM   1985 O O   . THR B 1 23  ? 60.411  12.122  42.686 1.00 30.71 ? 23   THR B O   1 
ATOM   1986 C CB  . THR B 1 23  ? 59.952  13.823  45.034 1.00 31.03 ? 23   THR B CB  1 
ATOM   1987 O OG1 . THR B 1 23  ? 61.174  14.572  45.096 1.00 20.96 ? 23   THR B OG1 1 
ATOM   1988 C CG2 . THR B 1 23  ? 59.039  14.202  46.193 1.00 29.93 ? 23   THR B CG2 1 
ATOM   1989 N N   . GLU B 1 24  ? 62.153  11.349  43.886 1.00 28.18 ? 24   GLU B N   1 
ATOM   1990 C CA  . GLU B 1 24  ? 62.963  10.960  42.730 1.00 34.39 ? 24   GLU B CA  1 
ATOM   1991 C C   . GLU B 1 24  ? 63.276  12.131  41.799 1.00 32.62 ? 24   GLU B C   1 
ATOM   1992 O O   . GLU B 1 24  ? 63.401  11.953  40.586 1.00 27.57 ? 24   GLU B O   1 
ATOM   1993 C CB  . GLU B 1 24  ? 62.275  9.848   41.929 1.00 37.26 ? 24   GLU B CB  1 
ATOM   1994 C CG  . GLU B 1 24  ? 62.613  8.437   42.383 1.00 40.50 ? 24   GLU B CG  1 
ATOM   1995 C CD  . GLU B 1 24  ? 62.099  7.376   41.427 1.00 43.97 ? 24   GLU B CD  1 
ATOM   1996 O OE1 . GLU B 1 24  ? 60.894  7.042   41.492 1.00 42.11 ? 24   GLU B OE1 1 
ATOM   1997 O OE2 . GLU B 1 24  ? 62.907  6.867   40.614 1.00 46.54 ? 24   GLU B OE2 1 
ATOM   1998 N N   . THR B 1 25  ? 63.381  13.326  42.374 1.00 30.53 ? 25   THR B N   1 
ATOM   1999 C CA  . THR B 1 25  ? 63.799  14.512  41.636 1.00 27.62 ? 25   THR B CA  1 
ATOM   2000 C C   . THR B 1 25  ? 65.297  14.423  41.339 1.00 29.32 ? 25   THR B C   1 
ATOM   2001 O O   . THR B 1 25  ? 66.098  14.168  42.248 1.00 41.71 ? 25   THR B O   1 
ATOM   2002 C CB  . THR B 1 25  ? 63.520  15.793  42.456 1.00 24.71 ? 25   THR B CB  1 
ATOM   2003 O OG1 . THR B 1 25  ? 62.216  15.718  43.052 1.00 27.72 ? 25   THR B OG1 1 
ATOM   2004 C CG2 . THR B 1 25  ? 63.572  17.004  41.561 1.00 29.34 ? 25   THR B CG2 1 
ATOM   2005 N N   . PRO B 1 26  ? 65.681  14.496  40.045 1.00 23.51 ? 26   PRO B N   1 
ATOM   2006 C CA  . PRO B 1 26  ? 67.101  14.555  39.657 1.00 14.17 ? 26   PRO B CA  1 
ATOM   2007 C C   . PRO B 1 26  ? 67.786  15.780  40.227 1.00 14.41 ? 26   PRO B C   1 
ATOM   2008 O O   . PRO B 1 26  ? 67.419  16.907  39.899 1.00 23.14 ? 26   PRO B O   1 
ATOM   2009 C CB  . PRO B 1 26  ? 67.062  14.602  38.125 1.00 14.82 ? 26   PRO B CB  1 
ATOM   2010 C CG  . PRO B 1 26  ? 65.681  15.061  37.787 1.00 21.81 ? 26   PRO B CG  1 
ATOM   2011 C CD  . PRO B 1 26  ? 64.804  14.472  38.861 1.00 22.58 ? 26   PRO B CD  1 
ATOM   2012 N N   . TYR B 1 27  ? 68.764  15.558  41.102 1.00 17.25 ? 27   TYR B N   1 
ATOM   2013 C CA  . TYR B 1 27  ? 69.482  16.663  41.732 1.00 19.13 ? 27   TYR B CA  1 
ATOM   2014 C C   . TYR B 1 27  ? 70.986  16.414  41.853 1.00 19.26 ? 27   TYR B C   1 
ATOM   2015 O O   . TYR B 1 27  ? 71.438  15.268  41.886 1.00 26.73 ? 27   TYR B O   1 
ATOM   2016 C CB  . TYR B 1 27  ? 68.896  16.939  43.120 1.00 9.10  ? 27   TYR B CB  1 
ATOM   2017 C CG  . TYR B 1 27  ? 69.366  15.991  44.198 1.00 5.20  ? 27   TYR B CG  1 
ATOM   2018 C CD1 . TYR B 1 27  ? 69.114  14.622  44.111 1.00 12.03 ? 27   TYR B CD1 1 
ATOM   2019 C CD2 . TYR B 1 27  ? 70.035  16.466  45.323 1.00 4.86  ? 27   TYR B CD2 1 
ATOM   2020 C CE1 . TYR B 1 27  ? 69.511  13.754  45.110 1.00 8.01  ? 27   TYR B CE1 1 
ATOM   2021 C CE2 . TYR B 1 27  ? 70.430  15.606  46.334 1.00 2.25  ? 27   TYR B CE2 1 
ATOM   2022 C CZ  . TYR B 1 27  ? 70.165  14.250  46.219 1.00 8.89  ? 27   TYR B CZ  1 
ATOM   2023 O OH  . TYR B 1 27  ? 70.569  13.382  47.213 1.00 21.01 ? 27   TYR B OH  1 
ATOM   2024 N N   . GLN B 1 28  ? 71.749  17.494  41.938 1.00 24.05 ? 28   GLN B N   1 
ATOM   2025 C CA  . GLN B 1 28  ? 73.120  17.420  42.395 1.00 26.86 ? 28   GLN B CA  1 
ATOM   2026 C C   . GLN B 1 28  ? 73.329  18.462  43.495 1.00 27.48 ? 28   GLN B C   1 
ATOM   2027 O O   . GLN B 1 28  ? 72.422  19.235  43.799 1.00 32.42 ? 28   GLN B O   1 
ATOM   2028 C CB  . GLN B 1 28  ? 74.071  17.642  41.221 1.00 31.07 ? 28   GLN B CB  1 
ATOM   2029 C CG  . GLN B 1 28  ? 74.313  19.094  40.856 1.00 39.93 ? 28   GLN B CG  1 
ATOM   2030 C CD  . GLN B 1 28  ? 74.708  19.281  39.400 1.00 47.97 ? 28   GLN B CD  1 
ATOM   2031 O OE1 . GLN B 1 28  ? 74.572  20.378  38.857 1.00 49.54 ? 28   GLN B OE1 1 
ATOM   2032 N NE2 . GLN B 1 28  ? 75.220  18.223  38.769 1.00 44.37 ? 28   GLN B NE2 1 
ATOM   2033 N N   . GLU B 1 29  ? 74.504  18.458  44.115 1.00 25.76 ? 29   GLU B N   1 
ATOM   2034 C CA  . GLU B 1 29  ? 74.732  19.271  45.302 1.00 23.72 ? 29   GLU B CA  1 
ATOM   2035 C C   . GLU B 1 29  ? 75.959  20.159  45.220 1.00 26.43 ? 29   GLU B C   1 
ATOM   2036 O O   . GLU B 1 29  ? 77.050  19.695  44.901 1.00 32.35 ? 29   GLU B O   1 
ATOM   2037 C CB  . GLU B 1 29  ? 74.854  18.382  46.531 1.00 24.99 ? 29   GLU B CB  1 
ATOM   2038 C CG  . GLU B 1 29  ? 73.534  17.906  47.088 1.00 28.95 ? 29   GLU B CG  1 
ATOM   2039 C CD  . GLU B 1 29  ? 73.638  17.541  48.545 1.00 26.06 ? 29   GLU B CD  1 
ATOM   2040 O OE1 . GLU B 1 29  ? 73.911  18.451  49.364 1.00 22.95 ? 29   GLU B OE1 1 
ATOM   2041 O OE2 . GLU B 1 29  ? 73.498  16.336  48.856 1.00 24.22 ? 29   GLU B OE2 1 
ATOM   2042 N N   . ARG B 1 30  ? 75.768  21.437  45.531 1.00 24.14 ? 30   ARG B N   1 
ATOM   2043 C CA  . ARG B 1 30  ? 76.875  22.361  45.756 1.00 22.30 ? 30   ARG B CA  1 
ATOM   2044 C C   . ARG B 1 30  ? 77.155  22.470  47.249 1.00 15.78 ? 30   ARG B C   1 
ATOM   2045 O O   . ARG B 1 30  ? 76.603  23.330  47.932 1.00 16.02 ? 30   ARG B O   1 
ATOM   2046 C CB  . ARG B 1 30  ? 76.542  23.749  45.185 1.00 27.08 ? 30   ARG B CB  1 
ATOM   2047 C CG  . ARG B 1 30  ? 77.604  24.829  45.425 1.00 25.37 ? 30   ARG B CG  1 
ATOM   2048 C CD  . ARG B 1 30  ? 78.902  24.525  44.697 1.00 32.31 ? 30   ARG B CD  1 
ATOM   2049 N NE  . ARG B 1 30  ? 80.052  24.683  45.581 1.00 30.02 ? 30   ARG B NE  1 
ATOM   2050 C CZ  . ARG B 1 30  ? 80.864  25.731  45.559 1.00 27.43 ? 30   ARG B CZ  1 
ATOM   2051 N NH1 . ARG B 1 30  ? 80.675  26.695  44.672 1.00 34.39 ? 30   ARG B NH1 1 
ATOM   2052 N NH2 . ARG B 1 30  ? 81.862  25.812  46.423 1.00 25.11 ? 30   ARG B NH2 1 
ATOM   2053 N N   . ARG B 1 31  ? 77.989  21.567  47.752 1.00 25.96 ? 31   ARG B N   1 
ATOM   2054 C CA  . ARG B 1 31  ? 78.400  21.576  49.154 1.00 28.93 ? 31   ARG B CA  1 
ATOM   2055 C C   . ARG B 1 31  ? 79.516  22.598  49.388 1.00 26.21 ? 31   ARG B C   1 
ATOM   2056 O O   . ARG B 1 31  ? 80.544  22.582  48.709 1.00 31.21 ? 31   ARG B O   1 
ATOM   2057 C CB  . ARG B 1 31  ? 78.874  20.178  49.572 1.00 27.95 ? 31   ARG B CB  1 
ATOM   2058 C CG  . ARG B 1 31  ? 77.969  19.039  49.108 1.00 38.83 ? 31   ARG B CG  1 
ATOM   2059 C CD  . ARG B 1 31  ? 77.613  18.089  50.261 1.00 47.77 ? 31   ARG B CD  1 
ATOM   2060 N NE  . ARG B 1 31  ? 76.907  16.887  49.798 1.00 51.17 ? 31   ARG B NE  1 
ATOM   2061 C CZ  . ARG B 1 31  ? 76.302  16.002  50.593 1.00 47.84 ? 31   ARG B CZ  1 
ATOM   2062 N NH1 . ARG B 1 31  ? 76.390  16.113  51.913 1.00 47.05 ? 31   ARG B NH1 1 
ATOM   2063 N NH2 . ARG B 1 31  ? 75.634  14.977  50.068 1.00 45.22 ? 31   ARG B NH2 1 
ATOM   2064 N N   . TYR B 1 32  ? 79.290  23.513  50.321 1.00 26.66 ? 32   TYR B N   1 
ATOM   2065 C CA  . TYR B 1 32  ? 80.274  24.539  50.643 1.00 19.59 ? 32   TYR B CA  1 
ATOM   2066 C C   . TYR B 1 32  ? 81.172  24.129  51.793 1.00 29.25 ? 32   TYR B C   1 
ATOM   2067 O O   . TYR B 1 32  ? 80.767  23.392  52.704 1.00 23.27 ? 32   TYR B O   1 
ATOM   2068 C CB  . TYR B 1 32  ? 79.593  25.865  50.984 1.00 21.11 ? 32   TYR B CB  1 
ATOM   2069 C CG  . TYR B 1 32  ? 78.902  26.498  49.809 1.00 19.05 ? 32   TYR B CG  1 
ATOM   2070 C CD1 . TYR B 1 32  ? 77.660  26.047  49.387 1.00 17.61 ? 32   TYR B CD1 1 
ATOM   2071 C CD2 . TYR B 1 32  ? 79.530  27.482  49.063 1.00 18.78 ? 32   TYR B CD2 1 
ATOM   2072 C CE1 . TYR B 1 32  ? 77.067  26.552  48.251 1.00 25.91 ? 32   TYR B CE1 1 
ATOM   2073 C CE2 . TYR B 1 32  ? 78.947  27.996  47.926 1.00 21.18 ? 32   TYR B CE2 1 
ATOM   2074 C CZ  . TYR B 1 32  ? 77.713  27.530  47.522 1.00 25.83 ? 32   TYR B CZ  1 
ATOM   2075 O OH  . TYR B 1 32  ? 77.113  28.043  46.393 1.00 29.26 ? 32   TYR B OH  1 
ATOM   2076 N N   . LYS B 1 33  ? 82.367  24.710  51.786 1.00 36.54 ? 33   LYS B N   1 
ATOM   2077 C CA  . LYS B 1 33  ? 83.444  24.304  52.670 1.00 35.29 ? 33   LYS B CA  1 
ATOM   2078 C C   . LYS B 1 33  ? 83.949  25.489  53.485 1.00 33.78 ? 33   LYS B C   1 
ATOM   2079 O O   . LYS B 1 33  ? 84.114  26.599  52.969 1.00 33.27 ? 33   LYS B O   1 
ATOM   2080 C CB  . LYS B 1 33  ? 84.589  23.717  51.841 1.00 37.41 ? 33   LYS B CB  1 
ATOM   2081 C CG  . LYS B 1 33  ? 84.256  22.411  51.142 1.00 36.02 ? 33   LYS B CG  1 
ATOM   2082 C CD  . LYS B 1 33  ? 83.890  21.338  52.161 1.00 36.97 ? 33   LYS B CD  1 
ATOM   2083 C CE  . LYS B 1 33  ? 84.046  19.948  51.579 1.00 41.03 ? 33   LYS B CE  1 
ATOM   2084 N NZ  . LYS B 1 33  ? 83.313  19.812  50.290 1.00 44.56 ? 33   LYS B NZ  1 
ATOM   2085 N N   . ALA B 1 34  ? 84.153  25.253  54.774 1.00 34.62 ? 34   ALA B N   1 
ATOM   2086 C CA  . ALA B 1 34  ? 84.769  26.242  55.644 1.00 37.98 ? 34   ALA B CA  1 
ATOM   2087 C C   . ALA B 1 34  ? 86.277  26.032  55.650 1.00 38.05 ? 34   ALA B C   1 
ATOM   2088 O O   . ALA B 1 34  ? 86.754  24.950  55.308 1.00 39.09 ? 34   ALA B O   1 
ATOM   2089 C CB  . ALA B 1 34  ? 84.216  26.104  57.048 1.00 34.51 ? 34   ALA B CB  1 
ATOM   2090 N N   . GLY B 1 35  ? 87.024  27.066  56.022 1.00 41.04 ? 35   GLY B N   1 
ATOM   2091 C CA  . GLY B 1 35  ? 88.447  26.896  56.263 1.00 48.14 ? 35   GLY B CA  1 
ATOM   2092 C C   . GLY B 1 35  ? 88.690  26.084  57.525 1.00 57.08 ? 35   GLY B C   1 
ATOM   2093 O O   . GLY B 1 35  ? 87.730  25.718  58.212 1.00 57.38 ? 35   GLY B O   1 
ATOM   2094 N N   . PRO B 1 36  ? 89.959  25.799  57.879 1.00 59.74 ? 36   PRO B N   1 
ATOM   2095 C CA  . PRO B 1 36  ? 90.279  24.972  59.051 1.00 56.59 ? 36   PRO B CA  1 
ATOM   2096 C C   . PRO B 1 36  ? 90.056  25.714  60.380 1.00 55.28 ? 36   PRO B C   1 
ATOM   2097 O O   . PRO B 1 36  ? 89.789  26.921  60.392 1.00 55.79 ? 36   PRO B O   1 
ATOM   2098 C CB  . PRO B 1 36  ? 91.756  24.605  58.848 1.00 57.78 ? 36   PRO B CB  1 
ATOM   2099 C CG  . PRO B 1 36  ? 92.195  25.313  57.562 1.00 58.21 ? 36   PRO B CG  1 
ATOM   2100 C CD  . PRO B 1 36  ? 91.176  26.372  57.283 1.00 59.31 ? 36   PRO B CD  1 
ATOM   2101 N N   . ALA B 1 37  ? 90.180  24.990  61.490 1.00 50.34 ? 37   ALA B N   1 
ATOM   2102 C CA  . ALA B 1 37  ? 89.985  25.568  62.821 1.00 43.96 ? 37   ALA B CA  1 
ATOM   2103 C C   . ALA B 1 37  ? 91.161  26.452  63.243 1.00 44.25 ? 37   ALA B C   1 
ATOM   2104 O O   . ALA B 1 37  ? 92.314  26.178  62.885 1.00 43.06 ? 37   ALA B O   1 
ATOM   2105 C CB  . ALA B 1 37  ? 89.770  24.457  63.843 1.00 40.54 ? 37   ALA B CB  1 
ATOM   2106 N N   . PRO B 1 38  ? 90.890  27.521  64.023 1.00 46.96 ? 38   PRO B N   1 
ATOM   2107 C CA  . PRO B 1 38  ? 89.586  27.852  64.602 1.00 46.53 ? 38   PRO B CA  1 
ATOM   2108 C C   . PRO B 1 38  ? 88.842  28.875  63.755 1.00 53.01 ? 38   PRO B C   1 
ATOM   2109 O O   . PRO B 1 38  ? 87.719  29.256  64.086 1.00 57.01 ? 38   PRO B O   1 
ATOM   2110 C CB  . PRO B 1 38  ? 89.963  28.452  65.946 1.00 43.84 ? 38   PRO B CB  1 
ATOM   2111 C CG  . PRO B 1 38  ? 91.204  29.252  65.605 1.00 46.10 ? 38   PRO B CG  1 
ATOM   2112 C CD  . PRO B 1 38  ? 91.905  28.500  64.458 1.00 50.03 ? 38   PRO B CD  1 
ATOM   2113 N N   . ASP B 1 39  ? 89.502  29.375  62.712 1.00 56.62 ? 39   ASP B N   1 
ATOM   2114 C CA  . ASP B 1 39  ? 88.964  30.490  61.938 1.00 62.78 ? 39   ASP B CA  1 
ATOM   2115 C C   . ASP B 1 39  ? 87.691  30.106  61.190 1.00 57.05 ? 39   ASP B C   1 
ATOM   2116 O O   . ASP B 1 39  ? 86.699  30.833  61.246 1.00 58.18 ? 39   ASP B O   1 
ATOM   2117 C CB  . ASP B 1 39  ? 90.004  31.054  60.953 1.00 66.92 ? 39   ASP B CB  1 
ATOM   2118 C CG  . ASP B 1 39  ? 91.436  30.704  61.328 1.00 77.66 ? 39   ASP B CG  1 
ATOM   2119 O OD1 . ASP B 1 39  ? 91.908  29.622  60.914 1.00 78.25 ? 39   ASP B OD1 1 
ATOM   2120 O OD2 . ASP B 1 39  ? 92.114  31.554  61.958 1.00 84.69 ? 39   ASP B OD2 1 
ATOM   2121 N N   . PHE B 1 40  ? 87.697  28.925  60.575 1.00 51.27 ? 40   PHE B N   1 
ATOM   2122 C CA  . PHE B 1 40  ? 86.556  28.436  59.794 1.00 48.11 ? 40   PHE B CA  1 
ATOM   2123 C C   . PHE B 1 40  ? 86.153  29.386  58.658 1.00 46.00 ? 40   PHE B C   1 
ATOM   2124 O O   . PHE B 1 40  ? 85.028  29.897  58.621 1.00 36.85 ? 40   PHE B O   1 
ATOM   2125 C CB  . PHE B 1 40  ? 85.351  28.176  60.714 1.00 44.99 ? 40   PHE B CB  1 
ATOM   2126 C CG  . PHE B 1 40  ? 85.484  26.938  61.557 1.00 39.58 ? 40   PHE B CG  1 
ATOM   2127 C CD1 . PHE B 1 40  ? 85.775  25.706  60.970 1.00 37.98 ? 40   PHE B CD1 1 
ATOM   2128 C CD2 . PHE B 1 40  ? 85.342  27.008  62.938 1.00 33.92 ? 40   PHE B CD2 1 
ATOM   2129 C CE1 . PHE B 1 40  ? 85.930  24.563  61.748 1.00 39.52 ? 40   PHE B CE1 1 
ATOM   2130 C CE2 . PHE B 1 40  ? 85.495  25.876  63.727 1.00 36.88 ? 40   PHE B CE2 1 
ATOM   2131 C CZ  . PHE B 1 40  ? 85.792  24.649  63.132 1.00 33.82 ? 40   PHE B CZ  1 
ATOM   2132 N N   . ASP B 1 41  ? 87.051  29.549  57.689 1.00 47.84 ? 41   ASP B N   1 
ATOM   2133 C CA  . ASP B 1 41  ? 86.873  30.549  56.646 1.00 50.16 ? 41   ASP B CA  1 
ATOM   2134 C C   . ASP B 1 41  ? 85.687  30.242  55.733 1.00 49.41 ? 41   ASP B C   1 
ATOM   2135 O O   . ASP B 1 41  ? 85.713  29.282  54.951 1.00 50.49 ? 41   ASP B O   1 
ATOM   2136 C CB  . ASP B 1 41  ? 88.151  30.689  55.816 1.00 51.83 ? 41   ASP B CB  1 
ATOM   2137 C CG  . ASP B 1 41  ? 88.098  31.862  54.843 1.00 56.16 ? 41   ASP B CG  1 
ATOM   2138 O OD1 . ASP B 1 41  ? 87.360  32.842  55.104 1.00 56.11 ? 41   ASP B OD1 1 
ATOM   2139 O OD2 . ASP B 1 41  ? 88.826  31.818  53.829 1.00 55.61 ? 41   ASP B OD2 1 
ATOM   2140 N N   . PRO B 1 42  ? 84.646  31.094  55.794 1.00 43.37 ? 42   PRO B N   1 
ATOM   2141 C CA  . PRO B 1 42  ? 83.436  31.002  54.966 1.00 45.96 ? 42   PRO B CA  1 
ATOM   2142 C C   . PRO B 1 42  ? 83.589  31.436  53.499 1.00 46.03 ? 42   PRO B C   1 
ATOM   2143 O O   . PRO B 1 42  ? 82.604  31.499  52.766 1.00 46.61 ? 42   PRO B O   1 
ATOM   2144 C CB  . PRO B 1 42  ? 82.430  31.881  55.716 1.00 42.45 ? 42   PRO B CB  1 
ATOM   2145 C CG  . PRO B 1 42  ? 83.274  32.870  56.433 1.00 43.34 ? 42   PRO B CG  1 
ATOM   2146 C CD  . PRO B 1 42  ? 84.499  32.110  56.853 1.00 42.57 ? 42   PRO B CD  1 
ATOM   2147 N N   . SER B 1 43  ? 84.834  31.627  53.066 1.00 47.41 ? 43   SER B N   1 
ATOM   2148 C CA  . SER B 1 43  ? 85.182  32.138  51.733 1.00 45.95 ? 43   SER B CA  1 
ATOM   2149 C C   . SER B 1 43  ? 84.451  31.483  50.562 1.00 40.83 ? 43   SER B C   1 
ATOM   2150 O O   . SER B 1 43  ? 84.109  32.143  49.577 1.00 40.39 ? 43   SER B O   1 
ATOM   2151 C CB  . SER B 1 43  ? 86.684  31.954  51.507 1.00 51.14 ? 43   SER B CB  1 
ATOM   2152 O OG  . SER B 1 43  ? 87.046  30.584  51.636 1.00 53.99 ? 43   SER B OG  1 
ATOM   2153 N N   . ASP B 1 44  ? 84.404  30.157  50.602 1.00 38.01 ? 44   ASP B N   1 
ATOM   2154 C CA  . ASP B 1 44  ? 83.817  29.354  49.537 1.00 42.27 ? 44   ASP B CA  1 
ATOM   2155 C C   . ASP B 1 44  ? 82.433  29.871  49.147 1.00 42.66 ? 44   ASP B C   1 
ATOM   2156 O O   . ASP B 1 44  ? 82.105  29.982  47.960 1.00 43.05 ? 44   ASP B O   1 
ATOM   2157 C CB  . ASP B 1 44  ? 83.713  27.899  50.005 1.00 42.23 ? 44   ASP B CB  1 
ATOM   2158 C CG  . ASP B 1 44  ? 83.589  26.918  48.856 1.00 50.41 ? 44   ASP B CG  1 
ATOM   2159 O OD1 . ASP B 1 44  ? 84.068  27.219  47.740 1.00 56.57 ? 44   ASP B OD1 1 
ATOM   2160 O OD2 . ASP B 1 44  ? 83.045  25.817  49.081 1.00 58.72 ? 44   ASP B OD2 1 
ATOM   2161 N N   . TRP B 1 45  ? 81.647  30.212  50.167 1.00 38.85 ? 45   TRP B N   1 
ATOM   2162 C CA  . TRP B 1 45  ? 80.285  30.698  49.998 1.00 24.71 ? 45   TRP B CA  1 
ATOM   2163 C C   . TRP B 1 45  ? 80.259  32.192  49.729 1.00 26.85 ? 45   TRP B C   1 
ATOM   2164 O O   . TRP B 1 45  ? 79.672  32.626  48.744 1.00 37.40 ? 45   TRP B O   1 
ATOM   2165 C CB  . TRP B 1 45  ? 79.458  30.365  51.248 1.00 28.64 ? 45   TRP B CB  1 
ATOM   2166 C CG  . TRP B 1 45  ? 78.176  31.146  51.392 1.00 21.59 ? 45   TRP B CG  1 
ATOM   2167 C CD1 . TRP B 1 45  ? 77.816  31.935  52.446 1.00 21.93 ? 45   TRP B CD1 1 
ATOM   2168 C CD2 . TRP B 1 45  ? 77.099  31.223  50.448 1.00 18.15 ? 45   TRP B CD2 1 
ATOM   2169 N NE1 . TRP B 1 45  ? 76.588  32.503  52.214 1.00 20.59 ? 45   TRP B NE1 1 
ATOM   2170 C CE2 . TRP B 1 45  ? 76.126  32.087  50.992 1.00 19.89 ? 45   TRP B CE2 1 
ATOM   2171 C CE3 . TRP B 1 45  ? 76.857  30.640  49.197 1.00 21.09 ? 45   TRP B CE3 1 
ATOM   2172 C CZ2 . TRP B 1 45  ? 74.928  32.386  50.325 1.00 17.99 ? 45   TRP B CZ2 1 
ATOM   2173 C CZ3 . TRP B 1 45  ? 75.665  30.932  48.541 1.00 17.29 ? 45   TRP B CZ3 1 
ATOM   2174 C CH2 . TRP B 1 45  ? 74.717  31.799  49.108 1.00 14.45 ? 45   TRP B CH2 1 
ATOM   2175 N N   . THR B 1 46  ? 80.951  32.960  50.570 1.00 31.13 ? 46   THR B N   1 
ATOM   2176 C CA  . THR B 1 46  ? 80.891  34.425  50.537 1.00 34.66 ? 46   THR B CA  1 
ATOM   2177 C C   . THR B 1 46  ? 81.342  35.057  49.215 1.00 34.54 ? 46   THR B C   1 
ATOM   2178 O O   . THR B 1 46  ? 80.813  36.093  48.811 1.00 39.19 ? 46   THR B O   1 
ATOM   2179 C CB  . THR B 1 46  ? 81.701  35.056  51.709 1.00 35.17 ? 46   THR B CB  1 
ATOM   2180 O OG1 . THR B 1 46  ? 82.947  34.367  51.874 1.00 37.79 ? 46   THR B OG1 1 
ATOM   2181 C CG2 . THR B 1 46  ? 80.909  34.974  53.008 1.00 37.11 ? 46   THR B CG2 1 
ATOM   2182 N N   . ASN B 1 47  ? 82.224  34.373  48.489 1.00 36.98 ? 47   ASN B N   1 
ATOM   2183 C CA  . ASN B 1 47  ? 82.690  34.850  47.183 1.00 43.53 ? 47   ASN B CA  1 
ATOM   2184 C C   . ASN B 1 47  ? 81.706  34.554  46.046 1.00 40.43 ? 47   ASN B C   1 
ATOM   2185 O O   . ASN B 1 47  ? 81.950  34.900  44.891 1.00 41.56 ? 47   ASN B O   1 
ATOM   2186 C CB  . ASN B 1 47  ? 84.060  34.238  46.854 1.00 46.51 ? 47   ASN B CB  1 
ATOM   2187 C CG  . ASN B 1 47  ? 85.201  35.222  47.051 1.00 51.34 ? 47   ASN B CG  1 
ATOM   2188 O OD1 . ASN B 1 47  ? 85.743  35.351  48.155 1.00 53.25 ? 47   ASN B OD1 1 
ATOM   2189 N ND2 . ASN B 1 47  ? 85.552  35.945  45.986 1.00 50.13 ? 47   ASN B ND2 1 
ATOM   2190 N N   . GLU B 1 48  ? 80.545  34.024  46.403 1.00 41.57 ? 48   GLU B N   1 
ATOM   2191 C CA  . GLU B 1 48  ? 79.600  33.500  45.430 1.00 39.72 ? 48   GLU B CA  1 
ATOM   2192 C C   . GLU B 1 48  ? 78.178  33.911  45.813 1.00 37.93 ? 48   GLU B C   1 
ATOM   2193 O O   . GLU B 1 48  ? 77.260  33.860  44.989 1.00 38.79 ? 48   GLU B O   1 
ATOM   2194 C CB  . GLU B 1 48  ? 79.715  31.981  45.403 1.00 41.39 ? 48   GLU B CB  1 
ATOM   2195 C CG  . GLU B 1 48  ? 79.339  31.330  44.091 1.00 45.17 ? 48   GLU B CG  1 
ATOM   2196 C CD  . GLU B 1 48  ? 79.444  29.820  44.160 1.00 45.97 ? 48   GLU B CD  1 
ATOM   2197 O OE1 . GLU B 1 48  ? 79.422  29.269  45.280 1.00 44.02 ? 48   GLU B OE1 1 
ATOM   2198 O OE2 . GLU B 1 48  ? 79.573  29.182  43.094 1.00 51.10 ? 48   GLU B OE2 1 
ATOM   2199 N N   . LYS B 1 49  ? 78.026  34.361  47.060 1.00 35.66 ? 49   LYS B N   1 
ATOM   2200 C CA  . LYS B 1 49  ? 76.750  34.771  47.642 1.00 28.87 ? 49   LYS B CA  1 
ATOM   2201 C C   . LYS B 1 49  ? 75.876  35.589  46.681 1.00 32.08 ? 49   LYS B C   1 
ATOM   2202 O O   . LYS B 1 49  ? 74.685  35.310  46.522 1.00 33.96 ? 49   LYS B O   1 
ATOM   2203 C CB  . LYS B 1 49  ? 77.020  35.587  48.916 1.00 28.20 ? 49   LYS B CB  1 
ATOM   2204 C CG  . LYS B 1 49  ? 76.014  35.380  50.039 1.00 25.87 ? 49   LYS B CG  1 
ATOM   2205 C CD  . LYS B 1 49  ? 75.903  36.611  50.928 1.00 27.21 ? 49   LYS B CD  1 
ATOM   2206 C CE  . LYS B 1 49  ? 75.826  36.247  52.417 1.00 37.32 ? 49   LYS B CE  1 
ATOM   2207 N NZ  . LYS B 1 49  ? 74.528  35.646  52.854 1.00 31.71 ? 49   LYS B NZ  1 
ATOM   2208 N N   . GLU B 1 50  ? 76.510  36.509  45.953 1.00 39.53 ? 50   GLU B N   1 
ATOM   2209 C CA  . GLU B 1 50  ? 75.805  37.548  45.199 1.00 42.53 ? 50   GLU B CA  1 
ATOM   2210 C C   . GLU B 1 50  ? 75.693  37.261  43.707 1.00 42.75 ? 50   GLU B C   1 
ATOM   2211 O O   . GLU B 1 50  ? 74.890  37.886  43.011 1.00 45.85 ? 50   GLU B O   1 
ATOM   2212 C CB  . GLU B 1 50  ? 76.503  38.898  45.387 1.00 46.02 ? 50   GLU B CB  1 
ATOM   2213 C CG  . GLU B 1 50  ? 76.610  39.364  46.840 1.00 52.89 ? 50   GLU B CG  1 
ATOM   2214 C CD  . GLU B 1 50  ? 75.285  39.852  47.405 1.00 56.21 ? 50   GLU B CD  1 
ATOM   2215 O OE1 . GLU B 1 50  ? 74.447  40.348  46.621 1.00 56.04 ? 50   GLU B OE1 1 
ATOM   2216 O OE2 . GLU B 1 50  ? 75.085  39.749  48.637 1.00 61.38 ? 50   GLU B OE2 1 
ATOM   2217 N N   . LYS B 1 51  ? 76.504  36.327  43.219 1.00 42.55 ? 51   LYS B N   1 
ATOM   2218 C CA  . LYS B 1 51  ? 76.604  36.055  41.787 1.00 40.71 ? 51   LYS B CA  1 
ATOM   2219 C C   . LYS B 1 51  ? 75.648  34.955  41.305 1.00 33.56 ? 51   LYS B C   1 
ATOM   2220 O O   . LYS B 1 51  ? 75.624  34.607  40.122 1.00 41.01 ? 51   LYS B O   1 
ATOM   2221 C CB  . LYS B 1 51  ? 78.058  35.695  41.445 1.00 45.71 ? 51   LYS B CB  1 
ATOM   2222 C CG  . LYS B 1 51  ? 79.028  36.866  41.625 1.00 50.97 ? 51   LYS B CG  1 
ATOM   2223 C CD  . LYS B 1 51  ? 80.451  36.408  41.871 1.00 52.72 ? 51   LYS B CD  1 
ATOM   2224 C CE  . LYS B 1 51  ? 81.387  37.603  42.005 1.00 58.15 ? 51   LYS B CE  1 
ATOM   2225 N NZ  . LYS B 1 51  ? 81.690  38.251  40.689 1.00 63.07 ? 51   LYS B NZ  1 
ATOM   2226 N N   . LEU B 1 52  ? 74.799  34.477  42.207 1.00 28.14 ? 52   LEU B N   1 
ATOM   2227 C CA  . LEU B 1 52  ? 73.911  33.366  41.901 1.00 22.56 ? 52   LEU B CA  1 
ATOM   2228 C C   . LEU B 1 52  ? 72.561  33.815  41.361 1.00 21.61 ? 52   LEU B C   1 
ATOM   2229 O O   . LEU B 1 52  ? 71.855  33.038  40.716 1.00 24.08 ? 52   LEU B O   1 
ATOM   2230 C CB  . LEU B 1 52  ? 73.713  32.505  43.143 1.00 24.98 ? 52   LEU B CB  1 
ATOM   2231 C CG  . LEU B 1 52  ? 74.825  31.486  43.376 1.00 18.74 ? 52   LEU B CG  1 
ATOM   2232 C CD1 . LEU B 1 52  ? 74.780  30.991  44.814 1.00 19.99 ? 52   LEU B CD1 1 
ATOM   2233 C CD2 . LEU B 1 52  ? 74.673  30.341  42.376 1.00 19.79 ? 52   LEU B CD2 1 
ATOM   2234 N N   . GLY B 1 53  ? 72.220  35.076  41.596 1.00 23.29 ? 53   GLY B N   1 
ATOM   2235 C CA  . GLY B 1 53  ? 70.962  35.605  41.105 1.00 25.69 ? 53   GLY B CA  1 
ATOM   2236 C C   . GLY B 1 53  ? 69.795  35.375  42.052 1.00 21.94 ? 53   GLY B C   1 
ATOM   2237 O O   . GLY B 1 53  ? 68.635  35.538  41.654 1.00 24.39 ? 53   GLY B O   1 
ATOM   2238 N N   . LEU B 1 54  ? 70.093  35.008  43.301 1.00 14.40 ? 54   LEU B N   1 
ATOM   2239 C CA  . LEU B 1 54  ? 69.062  34.808  44.318 1.00 8.75  ? 54   LEU B CA  1 
ATOM   2240 C C   . LEU B 1 54  ? 68.518  36.145  44.784 1.00 11.56 ? 54   LEU B C   1 
ATOM   2241 O O   . LEU B 1 54  ? 69.259  37.116  44.903 1.00 12.23 ? 54   LEU B O   1 
ATOM   2242 C CB  . LEU B 1 54  ? 69.614  34.049  45.520 1.00 8.07  ? 54   LEU B CB  1 
ATOM   2243 C CG  . LEU B 1 54  ? 70.259  32.688  45.259 1.00 12.51 ? 54   LEU B CG  1 
ATOM   2244 C CD1 . LEU B 1 54  ? 71.056  32.262  46.491 1.00 6.26  ? 54   LEU B CD1 1 
ATOM   2245 C CD2 . LEU B 1 54  ? 69.195  31.661  44.890 1.00 4.39  ? 54   LEU B CD2 1 
ATOM   2246 N N   . ASP B 1 55  ? 67.215  36.179  45.052 1.00 14.69 ? 55   ASP B N   1 
ATOM   2247 C CA  . ASP B 1 55  ? 66.547  37.393  45.496 1.00 14.55 ? 55   ASP B CA  1 
ATOM   2248 C C   . ASP B 1 55  ? 66.998  37.815  46.894 1.00 18.14 ? 55   ASP B C   1 
ATOM   2249 O O   . ASP B 1 55  ? 67.346  38.981  47.121 1.00 18.43 ? 55   ASP B O   1 
ATOM   2250 C CB  . ASP B 1 55  ? 65.035  37.189  45.450 1.00 14.55 ? 55   ASP B CB  1 
ATOM   2251 C CG  . ASP B 1 55  ? 64.509  37.097  44.036 1.00 16.11 ? 55   ASP B CG  1 
ATOM   2252 O OD1 . ASP B 1 55  ? 65.235  37.499  43.104 1.00 23.92 ? 55   ASP B OD1 1 
ATOM   2253 O OD2 . ASP B 1 55  ? 63.366  36.628  43.849 1.00 18.42 ? 55   ASP B OD2 1 
ATOM   2254 N N   . PHE B 1 56  ? 67.043  36.847  47.806 1.00 18.91 ? 56   PHE B N   1 
ATOM   2255 C CA  . PHE B 1 56  ? 67.570  37.066  49.150 1.00 13.66 ? 56   PHE B CA  1 
ATOM   2256 C C   . PHE B 1 56  ? 68.573  35.959  49.502 1.00 20.68 ? 56   PHE B C   1 
ATOM   2257 O O   . PHE B 1 56  ? 68.209  34.927  50.073 1.00 21.90 ? 56   PHE B O   1 
ATOM   2258 C CB  . PHE B 1 56  ? 66.423  37.105  50.162 1.00 18.61 ? 56   PHE B CB  1 
ATOM   2259 C CG  . PHE B 1 56  ? 65.216  37.873  49.682 1.00 22.48 ? 56   PHE B CG  1 
ATOM   2260 C CD1 . PHE B 1 56  ? 65.206  39.262  49.694 1.00 26.19 ? 56   PHE B CD1 1 
ATOM   2261 C CD2 . PHE B 1 56  ? 64.100  37.208  49.196 1.00 21.91 ? 56   PHE B CD2 1 
ATOM   2262 C CE1 . PHE B 1 56  ? 64.111  39.967  49.233 1.00 18.79 ? 56   PHE B CE1 1 
ATOM   2263 C CE2 . PHE B 1 56  ? 63.001  37.913  48.734 1.00 20.75 ? 56   PHE B CE2 1 
ATOM   2264 C CZ  . PHE B 1 56  ? 63.011  39.289  48.754 1.00 21.76 ? 56   PHE B CZ  1 
ATOM   2265 N N   . PRO B 1 57  ? 69.840  36.130  49.076 1.00 21.83 ? 57   PRO B N   1 
ATOM   2266 C CA  . PRO B 1 57  ? 70.858  35.077  49.141 1.00 20.58 ? 57   PRO B CA  1 
ATOM   2267 C C   . PRO B 1 57  ? 70.999  34.473  50.533 1.00 20.70 ? 57   PRO B C   1 
ATOM   2268 O O   . PRO B 1 57  ? 71.081  35.201  51.528 1.00 24.98 ? 57   PRO B O   1 
ATOM   2269 C CB  . PRO B 1 57  ? 72.130  35.795  48.700 1.00 21.85 ? 57   PRO B CB  1 
ATOM   2270 C CG  . PRO B 1 57  ? 71.639  36.919  47.832 1.00 15.47 ? 57   PRO B CG  1 
ATOM   2271 C CD  . PRO B 1 57  ? 70.376  37.371  48.479 1.00 19.55 ? 57   PRO B CD  1 
ATOM   2272 N N   . ASN B 1 58  ? 70.991  33.141  50.588 1.00 22.18 ? 58   ASN B N   1 
ATOM   2273 C CA  . ASN B 1 58  ? 71.064  32.400  51.849 1.00 21.03 ? 58   ASN B CA  1 
ATOM   2274 C C   . ASN B 1 58  ? 71.364  30.925  51.590 1.00 17.79 ? 58   ASN B C   1 
ATOM   2275 O O   . ASN B 1 58  ? 71.428  30.498  50.441 1.00 21.20 ? 58   ASN B O   1 
ATOM   2276 C CB  . ASN B 1 58  ? 69.738  32.521  52.600 1.00 20.64 ? 58   ASN B CB  1 
ATOM   2277 C CG  . ASN B 1 58  ? 69.920  32.556  54.101 1.00 23.50 ? 58   ASN B CG  1 
ATOM   2278 O OD1 . ASN B 1 58  ? 70.733  31.821  54.659 1.00 25.15 ? 58   ASN B OD1 1 
ATOM   2279 N ND2 . ASN B 1 58  ? 69.144  33.402  54.768 1.00 25.07 ? 58   ASN B ND2 1 
ATOM   2280 N N   . LEU B 1 59  ? 71.533  30.155  52.665 1.00 13.80 ? 59   LEU B N   1 
ATOM   2281 C CA  . LEU B 1 59  ? 71.736  28.712  52.580 1.00 17.41 ? 59   LEU B CA  1 
ATOM   2282 C C   . LEU B 1 59  ? 70.765  27.974  53.501 1.00 21.88 ? 59   LEU B C   1 
ATOM   2283 O O   . LEU B 1 59  ? 70.743  28.214  54.704 1.00 21.22 ? 59   LEU B O   1 
ATOM   2284 C CB  . LEU B 1 59  ? 73.171  28.360  52.982 1.00 19.28 ? 59   LEU B CB  1 
ATOM   2285 C CG  . LEU B 1 59  ? 74.303  28.768  52.041 1.00 18.09 ? 59   LEU B CG  1 
ATOM   2286 C CD1 . LEU B 1 59  ? 75.625  28.506  52.728 1.00 16.44 ? 59   LEU B CD1 1 
ATOM   2287 C CD2 . LEU B 1 59  ? 74.193  27.999  50.721 1.00 12.48 ? 59   LEU B CD2 1 
ATOM   2288 N N   . PRO B 1 60  ? 70.009  27.004  52.964 1.00 19.36 ? 60   PRO B N   1 
ATOM   2289 C CA  . PRO B 1 60  ? 70.127  26.432  51.618 1.00 24.19 ? 60   PRO B CA  1 
ATOM   2290 C C   . PRO B 1 60  ? 69.459  27.243  50.506 1.00 22.82 ? 60   PRO B C   1 
ATOM   2291 O O   . PRO B 1 60  ? 68.621  28.114  50.760 1.00 27.07 ? 60   PRO B O   1 
ATOM   2292 C CB  . PRO B 1 60  ? 69.484  25.053  51.765 1.00 30.45 ? 60   PRO B CB  1 
ATOM   2293 C CG  . PRO B 1 60  ? 68.427  25.271  52.788 1.00 32.45 ? 60   PRO B CG  1 
ATOM   2294 C CD  . PRO B 1 60  ? 68.994  26.295  53.764 1.00 23.34 ? 60   PRO B CD  1 
ATOM   2295 N N   . TYR B 1 61  ? 69.891  26.978  49.279 1.00 16.94 ? 61   TYR B N   1 
ATOM   2296 C CA  . TYR B 1 61  ? 69.194  27.461  48.106 1.00 15.08 ? 61   TYR B CA  1 
ATOM   2297 C C   . TYR B 1 61  ? 68.907  26.286  47.187 1.00 10.32 ? 61   TYR B C   1 
ATOM   2298 O O   . TYR B 1 61  ? 69.477  25.217  47.361 1.00 10.19 ? 61   TYR B O   1 
ATOM   2299 C CB  . TYR B 1 61  ? 70.021  28.539  47.386 1.00 16.58 ? 61   TYR B CB  1 
ATOM   2300 C CG  . TYR B 1 61  ? 71.287  28.051  46.711 1.00 14.77 ? 61   TYR B CG  1 
ATOM   2301 C CD1 . TYR B 1 61  ? 71.256  27.519  45.421 1.00 15.96 ? 61   TYR B CD1 1 
ATOM   2302 C CD2 . TYR B 1 61  ? 72.529  28.198  47.329 1.00 15.66 ? 61   TYR B CD2 1 
ATOM   2303 C CE1 . TYR B 1 61  ? 72.428  27.150  44.767 1.00 15.34 ? 61   TYR B CE1 1 
ATOM   2304 C CE2 . TYR B 1 61  ? 73.708  27.830  46.681 1.00 14.44 ? 61   TYR B CE2 1 
ATOM   2305 C CZ  . TYR B 1 61  ? 73.651  27.306  45.403 1.00 12.24 ? 61   TYR B CZ  1 
ATOM   2306 O OH  . TYR B 1 61  ? 74.808  26.900  44.776 1.00 17.57 ? 61   TYR B OH  1 
ATOM   2307 N N   . LEU B 1 62  ? 67.906  26.438  46.328 1.00 18.60 ? 62   LEU B N   1 
ATOM   2308 C CA  . LEU B 1 62  ? 67.643  25.453  45.286 1.00 16.47 ? 62   LEU B CA  1 
ATOM   2309 C C   . LEU B 1 62  ? 67.482  26.166  43.963 1.00 12.52 ? 62   LEU B C   1 
ATOM   2310 O O   . LEU B 1 62  ? 66.863  27.222  43.894 1.00 22.20 ? 62   LEU B O   1 
ATOM   2311 C CB  . LEU B 1 62  ? 66.368  24.654  45.580 1.00 20.32 ? 62   LEU B CB  1 
ATOM   2312 C CG  . LEU B 1 62  ? 66.067  23.546  44.561 1.00 23.06 ? 62   LEU B CG  1 
ATOM   2313 C CD1 . LEU B 1 62  ? 66.724  22.253  45.000 1.00 25.70 ? 62   LEU B CD1 1 
ATOM   2314 C CD2 . LEU B 1 62  ? 64.577  23.341  44.419 1.00 25.35 ? 62   LEU B CD2 1 
ATOM   2315 N N   . ILE B 1 63  ? 68.068  25.606  42.917 1.00 15.06 ? 63   ILE B N   1 
ATOM   2316 C CA  . ILE B 1 63  ? 67.900  26.161  41.588 1.00 20.28 ? 63   ILE B CA  1 
ATOM   2317 C C   . ILE B 1 63  ? 67.297  25.108  40.685 1.00 16.07 ? 63   ILE B C   1 
ATOM   2318 O O   . ILE B 1 63  ? 67.781  23.984  40.623 1.00 21.87 ? 63   ILE B O   1 
ATOM   2319 C CB  . ILE B 1 63  ? 69.246  26.671  41.013 1.00 24.20 ? 63   ILE B CB  1 
ATOM   2320 C CG1 . ILE B 1 63  ? 69.812  27.761  41.932 1.00 20.54 ? 63   ILE B CG1 1 
ATOM   2321 C CG2 . ILE B 1 63  ? 69.051  27.218  39.596 1.00 21.45 ? 63   ILE B CG2 1 
ATOM   2322 C CD1 . ILE B 1 63  ? 71.017  28.466  41.385 1.00 21.74 ? 63   ILE B CD1 1 
ATOM   2323 N N   . ASP B 1 64  ? 66.153  25.450  40.104 1.00 23.67 ? 64   ASP B N   1 
ATOM   2324 C CA  . ASP B 1 64  ? 65.397  24.560  39.224 1.00 34.57 ? 64   ASP B CA  1 
ATOM   2325 C C   . ASP B 1 64  ? 65.112  25.313  37.916 1.00 37.06 ? 64   ASP B C   1 
ATOM   2326 O O   . ASP B 1 64  ? 63.990  25.768  37.674 1.00 42.38 ? 64   ASP B O   1 
ATOM   2327 C CB  . ASP B 1 64  ? 64.079  24.167  39.909 1.00 36.65 ? 64   ASP B CB  1 
ATOM   2328 C CG  . ASP B 1 64  ? 63.472  22.893  39.353 1.00 37.51 ? 64   ASP B CG  1 
ATOM   2329 O OD1 . ASP B 1 64  ? 63.958  22.388  38.316 1.00 42.04 ? 64   ASP B OD1 1 
ATOM   2330 O OD2 . ASP B 1 64  ? 62.513  22.384  39.973 1.00 36.88 ? 64   ASP B OD2 1 
ATOM   2331 N N   . GLY B 1 65  ? 66.155  25.502  37.115 1.00 35.66 ? 65   GLY B N   1 
ATOM   2332 C CA  . GLY B 1 65  ? 66.031  26.323  35.929 1.00 29.12 ? 65   GLY B CA  1 
ATOM   2333 C C   . GLY B 1 65  ? 66.057  27.793  36.276 1.00 25.39 ? 65   GLY B C   1 
ATOM   2334 O O   . GLY B 1 65  ? 67.060  28.296  36.774 1.00 30.70 ? 65   GLY B O   1 
ATOM   2335 N N   . ASP B 1 66  ? 64.936  28.471  36.045 1.00 27.77 ? 66   ASP B N   1 
ATOM   2336 C CA  . ASP B 1 66  ? 64.811  29.900  36.330 1.00 32.11 ? 66   ASP B CA  1 
ATOM   2337 C C   . ASP B 1 66  ? 64.114  30.142  37.671 1.00 29.90 ? 66   ASP B C   1 
ATOM   2338 O O   . ASP B 1 66  ? 63.969  31.284  38.114 1.00 24.73 ? 66   ASP B O   1 
ATOM   2339 C CB  . ASP B 1 66  ? 64.055  30.619  35.198 1.00 35.82 ? 66   ASP B CB  1 
ATOM   2340 C CG  . ASP B 1 66  ? 62.885  29.804  34.641 1.00 34.34 ? 66   ASP B CG  1 
ATOM   2341 O OD1 . ASP B 1 66  ? 62.110  29.229  35.434 1.00 30.28 ? 66   ASP B OD1 1 
ATOM   2342 O OD2 . ASP B 1 66  ? 62.726  29.766  33.403 1.00 36.73 ? 66   ASP B OD2 1 
ATOM   2343 N N   . VAL B 1 67  ? 63.646  29.054  38.280 1.00 28.47 ? 67   VAL B N   1 
ATOM   2344 C CA  . VAL B 1 67  ? 63.182  29.049  39.664 1.00 24.95 ? 67   VAL B CA  1 
ATOM   2345 C C   . VAL B 1 67  ? 64.405  29.047  40.584 1.00 24.71 ? 67   VAL B C   1 
ATOM   2346 O O   . VAL B 1 67  ? 65.193  28.102  40.565 1.00 30.20 ? 67   VAL B O   1 
ATOM   2347 C CB  . VAL B 1 67  ? 62.354  27.773  39.964 1.00 19.81 ? 67   VAL B CB  1 
ATOM   2348 C CG1 . VAL B 1 67  ? 62.013  27.712  41.443 1.00 14.62 ? 67   VAL B CG1 1 
ATOM   2349 C CG2 . VAL B 1 67  ? 61.092  27.731  39.108 1.00 12.79 ? 67   VAL B CG2 1 
ATOM   2350 N N   . LYS B 1 68  ? 64.588  30.129  41.338 1.00 25.27 ? 68   LYS B N   1 
ATOM   2351 C CA  . LYS B 1 68  ? 65.744  30.276  42.219 1.00 25.88 ? 68   LYS B CA  1 
ATOM   2352 C C   . LYS B 1 68  ? 65.306  30.672  43.634 1.00 23.15 ? 68   LYS B C   1 
ATOM   2353 O O   . LYS B 1 68  ? 64.964  31.827  43.895 1.00 23.70 ? 68   LYS B O   1 
ATOM   2354 C CB  . LYS B 1 68  ? 66.699  31.323  41.642 1.00 32.50 ? 68   LYS B CB  1 
ATOM   2355 C CG  . LYS B 1 68  ? 67.406  30.874  40.364 1.00 36.99 ? 68   LYS B CG  1 
ATOM   2356 C CD  . LYS B 1 68  ? 68.207  32.008  39.738 1.00 37.34 ? 68   LYS B CD  1 
ATOM   2357 C CE  . LYS B 1 68  ? 69.101  31.507  38.606 1.00 37.69 ? 68   LYS B CE  1 
ATOM   2358 N NZ  . LYS B 1 68  ? 68.330  31.043  37.417 1.00 36.15 ? 68   LYS B NZ  1 
ATOM   2359 N N   . LEU B 1 69  ? 65.396  29.719  44.555 1.00 23.99 ? 69   LEU B N   1 
ATOM   2360 C CA  . LEU B 1 69  ? 64.777  29.828  45.872 1.00 18.55 ? 69   LEU B CA  1 
ATOM   2361 C C   . LEU B 1 69  ? 65.779  29.855  47.022 1.00 20.13 ? 69   LEU B C   1 
ATOM   2362 O O   . LEU B 1 69  ? 66.758  29.107  47.015 1.00 22.64 ? 69   LEU B O   1 
ATOM   2363 C CB  . LEU B 1 69  ? 63.861  28.634  46.108 1.00 11.71 ? 69   LEU B CB  1 
ATOM   2364 C CG  . LEU B 1 69  ? 62.553  28.512  45.355 1.00 13.64 ? 69   LEU B CG  1 
ATOM   2365 C CD1 . LEU B 1 69  ? 62.041  27.092  45.500 1.00 9.92  ? 69   LEU B CD1 1 
ATOM   2366 C CD2 . LEU B 1 69  ? 61.552  29.516  45.903 1.00 16.87 ? 69   LEU B CD2 1 
ATOM   2367 N N   . THR B 1 70  ? 65.422  30.586  48.078 1.00 19.51 ? 70   THR B N   1 
ATOM   2368 C CA  . THR B 1 70  ? 66.068  30.467  49.382 1.00 15.64 ? 70   THR B CA  1 
ATOM   2369 C C   . THR B 1 70  ? 65.006  30.184  50.447 1.00 17.85 ? 70   THR B C   1 
ATOM   2370 O O   . THR B 1 70  ? 63.813  30.120  50.133 1.00 18.79 ? 70   THR B O   1 
ATOM   2371 C CB  . THR B 1 70  ? 66.847  31.747  49.753 1.00 8.94  ? 70   THR B CB  1 
ATOM   2372 O OG1 . THR B 1 70  ? 66.121  32.905  49.326 1.00 14.72 ? 70   THR B OG1 1 
ATOM   2373 C CG2 . THR B 1 70  ? 68.208  31.739  49.086 1.00 9.37  ? 70   THR B CG2 1 
ATOM   2374 N N   . GLN B 1 71  ? 65.450  29.933  51.680 1.00 23.27 ? 71   GLN B N   1 
ATOM   2375 C CA  . GLN B 1 71  ? 64.565  29.536  52.788 1.00 20.07 ? 71   GLN B CA  1 
ATOM   2376 C C   . GLN B 1 71  ? 64.151  28.069  52.714 1.00 19.06 ? 71   GLN B C   1 
ATOM   2377 O O   . GLN B 1 71  ? 63.432  27.670  51.795 1.00 16.23 ? 71   GLN B O   1 
ATOM   2378 C CB  . GLN B 1 71  ? 63.302  30.408  52.836 1.00 21.73 ? 71   GLN B CB  1 
ATOM   2379 C CG  . GLN B 1 71  ? 63.548  31.845  53.222 1.00 18.77 ? 71   GLN B CG  1 
ATOM   2380 C CD  . GLN B 1 71  ? 64.193  31.946  54.572 1.00 18.98 ? 71   GLN B CD  1 
ATOM   2381 O OE1 . GLN B 1 71  ? 63.715  31.349  55.543 1.00 26.15 ? 71   GLN B OE1 1 
ATOM   2382 N NE2 . GLN B 1 71  ? 65.324  32.654  54.640 1.00 16.76 ? 71   GLN B NE2 1 
ATOM   2383 N N   . SER B 1 72  ? 64.500  27.309  53.752 1.00 17.69 ? 72   SER B N   1 
ATOM   2384 C CA  . SER B 1 72  ? 64.275  25.868  53.787 1.00 14.16 ? 72   SER B CA  1 
ATOM   2385 C C   . SER B 1 72  ? 62.803  25.507  53.650 1.00 17.89 ? 72   SER B C   1 
ATOM   2386 O O   . SER B 1 72  ? 62.453  24.640  52.860 1.00 24.84 ? 72   SER B O   1 
ATOM   2387 C CB  . SER B 1 72  ? 64.843  25.270  55.079 1.00 17.70 ? 72   SER B CB  1 
ATOM   2388 O OG  . SER B 1 72  ? 64.370  25.947  56.235 1.00 12.63 ? 72   SER B OG  1 
ATOM   2389 N N   . ASN B 1 73  ? 61.942  26.184  54.406 1.00 22.24 ? 73   ASN B N   1 
ATOM   2390 C CA  . ASN B 1 73  ? 60.501  25.935  54.355 1.00 12.36 ? 73   ASN B CA  1 
ATOM   2391 C C   . ASN B 1 73  ? 59.946  26.180  52.952 1.00 12.29 ? 73   ASN B C   1 
ATOM   2392 O O   . ASN B 1 73  ? 59.191  25.366  52.415 1.00 11.38 ? 73   ASN B O   1 
ATOM   2393 C CB  . ASN B 1 73  ? 59.771  26.844  55.346 1.00 17.30 ? 73   ASN B CB  1 
ATOM   2394 C CG  . ASN B 1 73  ? 59.718  26.270  56.751 1.00 22.78 ? 73   ASN B CG  1 
ATOM   2395 O OD1 . ASN B 1 73  ? 59.559  27.009  57.726 1.00 30.84 ? 73   ASN B OD1 1 
ATOM   2396 N ND2 . ASN B 1 73  ? 59.766  24.949  56.858 1.00 19.57 ? 73   ASN B ND2 1 
ATOM   2397 N N   . ALA B 1 74  ? 60.345  27.302  52.366 1.00 9.77  ? 74   ALA B N   1 
ATOM   2398 C CA  . ALA B 1 74  ? 59.933  27.676  51.019 1.00 8.47  ? 74   ALA B CA  1 
ATOM   2399 C C   . ALA B 1 74  ? 60.407  26.685  49.966 1.00 15.56 ? 74   ALA B C   1 
ATOM   2400 O O   . ALA B 1 74  ? 59.708  26.455  48.976 1.00 19.14 ? 74   ALA B O   1 
ATOM   2401 C CB  . ALA B 1 74  ? 60.452  29.061  50.677 1.00 4.26  ? 74   ALA B CB  1 
ATOM   2402 N N   . ILE B 1 75  ? 61.608  26.135  50.153 1.00 12.33 ? 75   ILE B N   1 
ATOM   2403 C CA  . ILE B 1 75  ? 62.141  25.133  49.229 1.00 12.83 ? 75   ILE B CA  1 
ATOM   2404 C C   . ILE B 1 75  ? 61.353  23.823  49.314 1.00 16.92 ? 75   ILE B C   1 
ATOM   2405 O O   . ILE B 1 75  ? 60.933  23.274  48.293 1.00 18.65 ? 75   ILE B O   1 
ATOM   2406 C CB  . ILE B 1 75  ? 63.621  24.815  49.499 1.00 5.83  ? 75   ILE B CB  1 
ATOM   2407 C CG1 . ILE B 1 75  ? 64.478  26.064  49.300 1.00 10.35 ? 75   ILE B CG1 1 
ATOM   2408 C CG2 . ILE B 1 75  ? 64.088  23.720  48.563 1.00 3.15  ? 75   ILE B CG2 1 
ATOM   2409 C CD1 . ILE B 1 75  ? 65.913  25.914  49.797 1.00 8.98  ? 75   ILE B CD1 1 
ATOM   2410 N N   . LEU B 1 76  ? 61.053  23.393  50.536 1.00 17.99 ? 76   LEU B N   1 
ATOM   2411 C CA  . LEU B 1 76  ? 60.264  22.185  50.748 1.00 12.91 ? 76   LEU B CA  1 
ATOM   2412 C C   . LEU B 1 76  ? 58.843  22.302  50.197 1.00 12.87 ? 76   LEU B C   1 
ATOM   2413 O O   . LEU B 1 76  ? 58.337  21.369  49.588 1.00 12.66 ? 76   LEU B O   1 
ATOM   2414 C CB  . LEU B 1 76  ? 60.223  21.840  52.238 1.00 16.44 ? 76   LEU B CB  1 
ATOM   2415 C CG  . LEU B 1 76  ? 61.524  21.284  52.838 1.00 15.22 ? 76   LEU B CG  1 
ATOM   2416 C CD1 . LEU B 1 76  ? 61.333  21.042  54.315 1.00 11.70 ? 76   LEU B CD1 1 
ATOM   2417 C CD2 . LEU B 1 76  ? 61.925  19.989  52.143 1.00 11.24 ? 76   LEU B CD2 1 
ATOM   2418 N N   . ARG B 1 77  ? 58.219  23.461  50.377 1.00 16.95 ? 77   ARG B N   1 
ATOM   2419 C CA  . ARG B 1 77  ? 56.869  23.682  49.880 1.00 11.02 ? 77   ARG B CA  1 
ATOM   2420 C C   . ARG B 1 77  ? 56.846  23.609  48.361 1.00 15.70 ? 77   ARG B C   1 
ATOM   2421 O O   . ARG B 1 77  ? 55.865  23.149  47.772 1.00 19.84 ? 77   ARG B O   1 
ATOM   2422 C CB  . ARG B 1 77  ? 56.347  25.048  50.335 1.00 12.47 ? 77   ARG B CB  1 
ATOM   2423 C CG  . ARG B 1 77  ? 56.103  25.187  51.832 1.00 10.81 ? 77   ARG B CG  1 
ATOM   2424 C CD  . ARG B 1 77  ? 54.826  25.965  52.088 1.00 17.20 ? 77   ARG B CD  1 
ATOM   2425 N NE  . ARG B 1 77  ? 54.440  26.000  53.497 1.00 17.67 ? 77   ARG B NE  1 
ATOM   2426 C CZ  . ARG B 1 77  ? 53.183  25.932  53.935 1.00 16.41 ? 77   ARG B CZ  1 
ATOM   2427 N NH1 . ARG B 1 77  ? 52.176  25.812  53.078 1.00 16.93 ? 77   ARG B NH1 1 
ATOM   2428 N NH2 . ARG B 1 77  ? 52.927  25.981  55.233 1.00 20.99 ? 77   ARG B NH2 1 
ATOM   2429 N N   . TYR B 1 78  ? 57.939  24.035  47.733 1.00 18.81 ? 78   TYR B N   1 
ATOM   2430 C CA  . TYR B 1 78  ? 58.011  24.066  46.277 1.00 17.23 ? 78   TYR B CA  1 
ATOM   2431 C C   . TYR B 1 78  ? 58.053  22.671  45.680 1.00 14.75 ? 78   TYR B C   1 
ATOM   2432 O O   . TYR B 1 78  ? 57.416  22.406  44.664 1.00 20.81 ? 78   TYR B O   1 
ATOM   2433 C CB  . TYR B 1 78  ? 59.238  24.841  45.813 1.00 16.17 ? 78   TYR B CB  1 
ATOM   2434 C CG  . TYR B 1 78  ? 59.484  24.734  44.326 1.00 15.93 ? 78   TYR B CG  1 
ATOM   2435 C CD1 . TYR B 1 78  ? 58.486  25.069  43.409 1.00 22.56 ? 78   TYR B CD1 1 
ATOM   2436 C CD2 . TYR B 1 78  ? 60.695  24.248  43.835 1.00 17.58 ? 78   TYR B CD2 1 
ATOM   2437 C CE1 . TYR B 1 78  ? 58.687  24.917  42.046 1.00 26.06 ? 78   TYR B CE1 1 
ATOM   2438 C CE2 . TYR B 1 78  ? 60.907  24.093  42.472 1.00 11.62 ? 78   TYR B CE2 1 
ATOM   2439 C CZ  . TYR B 1 78  ? 59.897  24.423  41.583 1.00 18.38 ? 78   TYR B CZ  1 
ATOM   2440 O OH  . TYR B 1 78  ? 60.072  24.206  40.235 1.00 26.16 ? 78   TYR B OH  1 
ATOM   2441 N N   . ILE B 1 79  ? 58.905  21.822  46.242 1.00 15.91 ? 79   ILE B N   1 
ATOM   2442 C CA  . ILE B 1 79  ? 58.962  20.426  45.837 1.00 11.74 ? 79   ILE B CA  1 
ATOM   2443 C C   . ILE B 1 79  ? 57.654  19.717  46.157 1.00 12.83 ? 79   ILE B C   1 
ATOM   2444 O O   . ILE B 1 79  ? 57.198  18.895  45.374 1.00 24.65 ? 79   ILE B O   1 
ATOM   2445 C CB  . ILE B 1 79  ? 60.080  19.672  46.558 1.00 11.15 ? 79   ILE B CB  1 
ATOM   2446 C CG1 . ILE B 1 79  ? 61.432  20.320  46.273 1.00 18.16 ? 79   ILE B CG1 1 
ATOM   2447 C CG2 . ILE B 1 79  ? 60.092  18.230  46.101 1.00 18.93 ? 79   ILE B CG2 1 
ATOM   2448 C CD1 . ILE B 1 79  ? 62.561  19.732  47.091 1.00 20.82 ? 79   ILE B CD1 1 
ATOM   2449 N N   . ALA B 1 80  ? 57.063  20.027  47.311 1.00 15.04 ? 80   ALA B N   1 
ATOM   2450 C CA  . ALA B 1 80  ? 55.815  19.398  47.727 1.00 5.77  ? 80   ALA B CA  1 
ATOM   2451 C C   . ALA B 1 80  ? 54.653  19.731  46.802 1.00 17.53 ? 80   ALA B C   1 
ATOM   2452 O O   . ALA B 1 80  ? 53.837  18.859  46.507 1.00 25.80 ? 80   ALA B O   1 
ATOM   2453 C CB  . ALA B 1 80  ? 55.476  19.779  49.139 1.00 11.80 ? 80   ALA B CB  1 
ATOM   2454 N N   . ARG B 1 81  ? 54.605  20.961  46.294 1.00 14.96 ? 81   ARG B N   1 
ATOM   2455 C CA  . ARG B 1 81  ? 53.547  21.357  45.362 1.00 14.85 ? 81   ARG B CA  1 
ATOM   2456 C C   . ARG B 1 81  ? 53.608  20.595  44.042 1.00 19.83 ? 81   ARG B C   1 
ATOM   2457 O O   . ARG B 1 81  ? 52.572  20.195  43.506 1.00 32.06 ? 81   ARG B O   1 
ATOM   2458 C CB  . ARG B 1 81  ? 53.590  22.866  45.087 1.00 7.80  ? 81   ARG B CB  1 
ATOM   2459 C CG  . ARG B 1 81  ? 53.031  23.706  46.216 1.00 6.17  ? 81   ARG B CG  1 
ATOM   2460 C CD  . ARG B 1 81  ? 52.942  25.161  45.849 1.00 2.00  ? 81   ARG B CD  1 
ATOM   2461 N NE  . ARG B 1 81  ? 53.779  25.969  46.719 1.00 5.35  ? 81   ARG B NE  1 
ATOM   2462 C CZ  . ARG B 1 81  ? 54.740  26.773  46.280 1.00 11.77 ? 81   ARG B CZ  1 
ATOM   2463 N NH1 . ARG B 1 81  ? 54.840  27.038  44.993 1.00 13.18 ? 81   ARG B NH1 1 
ATOM   2464 N NH2 . ARG B 1 81  ? 55.568  27.363  47.128 1.00 15.94 ? 81   ARG B NH2 1 
ATOM   2465 N N   . LYS B 1 82  ? 54.819  20.346  43.545 1.00 28.79 ? 82   LYS B N   1 
ATOM   2466 C CA  . LYS B 1 82  ? 55.012  19.584  42.305 1.00 29.59 ? 82   LYS B CA  1 
ATOM   2467 C C   . LYS B 1 82  ? 54.671  18.102  42.457 1.00 30.06 ? 82   LYS B C   1 
ATOM   2468 O O   . LYS B 1 82  ? 54.568  17.385  41.462 1.00 36.25 ? 82   LYS B O   1 
ATOM   2469 C CB  . LYS B 1 82  ? 56.451  19.726  41.803 1.00 30.63 ? 82   LYS B CB  1 
ATOM   2470 C CG  . LYS B 1 82  ? 56.678  20.962  40.949 1.00 41.75 ? 82   LYS B CG  1 
ATOM   2471 C CD  . LYS B 1 82  ? 58.098  21.482  41.093 1.00 45.17 ? 82   LYS B CD  1 
ATOM   2472 C CE  . LYS B 1 82  ? 58.981  21.063  39.929 1.00 48.70 ? 82   LYS B CE  1 
ATOM   2473 N NZ  . LYS B 1 82  ? 60.382  20.802  40.374 1.00 52.72 ? 82   LYS B NZ  1 
ATOM   2474 N N   . HIS B 1 83  ? 54.449  17.665  43.695 1.00 25.99 ? 83   HIS B N   1 
ATOM   2475 C CA  . HIS B 1 83  ? 54.209  16.262  43.993 1.00 17.95 ? 83   HIS B CA  1 
ATOM   2476 C C   . HIS B 1 83  ? 53.015  16.032  44.912 1.00 27.98 ? 83   HIS B C   1 
ATOM   2477 O O   . HIS B 1 83  ? 52.872  14.949  45.483 1.00 32.38 ? 83   HIS B O   1 
ATOM   2478 C CB  . HIS B 1 83  ? 55.460  15.650  44.617 1.00 19.18 ? 83   HIS B CB  1 
ATOM   2479 C CG  . HIS B 1 83  ? 56.659  15.706  43.727 1.00 26.33 ? 83   HIS B CG  1 
ATOM   2480 N ND1 . HIS B 1 83  ? 56.801  14.885  42.629 1.00 28.27 ? 83   HIS B ND1 1 
ATOM   2481 C CD2 . HIS B 1 83  ? 57.686  16.587  43.671 1.00 32.55 ? 83   HIS B CD2 1 
ATOM   2482 C CE1 . HIS B 1 83  ? 57.850  15.272  41.924 1.00 28.09 ? 83   HIS B CE1 1 
ATOM   2483 N NE2 . HIS B 1 83  ? 58.404  16.303  42.536 1.00 31.11 ? 83   HIS B NE2 1 
ATOM   2484 N N   . ASN B 1 84  ? 52.173  17.051  45.069 1.00 32.64 ? 84   ASN B N   1 
ATOM   2485 C CA  . ASN B 1 84  ? 50.900  16.897  45.776 1.00 42.20 ? 84   ASN B CA  1 
ATOM   2486 C C   . ASN B 1 84  ? 51.083  16.499  47.238 1.00 40.44 ? 84   ASN B C   1 
ATOM   2487 O O   . ASN B 1 84  ? 50.277  15.737  47.784 1.00 41.66 ? 84   ASN B O   1 
ATOM   2488 C CB  . ASN B 1 84  ? 50.042  15.819  45.101 1.00 47.10 ? 84   ASN B CB  1 
ATOM   2489 C CG  . ASN B 1 84  ? 49.573  16.211  43.717 1.00 58.66 ? 84   ASN B CG  1 
ATOM   2490 O OD1 . ASN B 1 84  ? 48.464  15.857  43.315 1.00 64.15 ? 84   ASN B OD1 1 
ATOM   2491 N ND2 . ASN B 1 84  ? 50.444  16.861  42.945 1.00 60.51 ? 84   ASN B ND2 1 
ATOM   2492 N N   . MET B 1 85  ? 52.186  16.925  47.841 1.00 33.94 ? 85   MET B N   1 
ATOM   2493 C CA  . MET B 1 85  ? 52.488  16.545  49.214 1.00 23.43 ? 85   MET B CA  1 
ATOM   2494 C C   . MET B 1 85  ? 52.228  17.693  50.178 1.00 15.96 ? 85   MET B C   1 
ATOM   2495 O O   . MET B 1 85  ? 52.874  17.814  51.211 1.00 16.25 ? 85   MET B O   1 
ATOM   2496 C CB  . MET B 1 85  ? 53.939  16.076  49.316 1.00 26.49 ? 85   MET B CB  1 
ATOM   2497 C CG  . MET B 1 85  ? 54.218  14.757  48.612 1.00 20.86 ? 85   MET B CG  1 
ATOM   2498 S SD  . MET B 1 85  ? 55.883  14.166  48.965 1.00 28.04 ? 85   MET B SD  1 
ATOM   2499 C CE  . MET B 1 85  ? 55.575  13.155  50.354 1.00 27.18 ? 85   MET B CE  1 
ATOM   2500 N N   . CYS B 1 86  ? 51.357  18.602  49.762 1.00 25.55 ? 86   CYS B N   1 
ATOM   2501 C CA  . CYS B 1 86  ? 50.814  19.626  50.641 1.00 31.01 ? 86   CYS B CA  1 
ATOM   2502 C C   . CYS B 1 86  ? 49.463  19.142  51.175 1.00 32.73 ? 86   CYS B C   1 
ATOM   2503 O O   . CYS B 1 86  ? 49.024  18.031  50.866 1.00 40.03 ? 86   CYS B O   1 
ATOM   2504 C CB  . CYS B 1 86  ? 50.632  20.935  49.862 1.00 29.64 ? 86   CYS B CB  1 
ATOM   2505 S SG  . CYS B 1 86  ? 52.170  21.707  49.298 1.00 29.31 ? 86   CYS B SG  1 
ATOM   2506 N N   . GLY B 1 87  ? 48.819  19.957  52.001 1.00 34.35 ? 87   GLY B N   1 
ATOM   2507 C CA  . GLY B 1 87  ? 47.469  19.640  52.429 1.00 38.20 ? 87   GLY B CA  1 
ATOM   2508 C C   . GLY B 1 87  ? 46.486  19.656  51.269 1.00 42.40 ? 87   GLY B C   1 
ATOM   2509 O O   . GLY B 1 87  ? 46.753  20.262  50.222 1.00 37.71 ? 87   GLY B O   1 
ATOM   2510 N N   . GLU B 1 88  ? 45.359  18.969  51.444 1.00 45.82 ? 88   GLU B N   1 
ATOM   2511 C CA  . GLU B 1 88  ? 44.317  18.928  50.423 1.00 48.95 ? 88   GLU B CA  1 
ATOM   2512 C C   . GLU B 1 88  ? 43.059  19.652  50.904 1.00 41.97 ? 88   GLU B C   1 
ATOM   2513 O O   . GLU B 1 88  ? 42.615  20.609  50.273 1.00 46.87 ? 88   GLU B O   1 
ATOM   2514 C CB  . GLU B 1 88  ? 43.997  17.473  50.038 1.00 52.91 ? 88   GLU B CB  1 
ATOM   2515 C CG  . GLU B 1 88  ? 45.192  16.706  49.437 1.00 64.65 ? 88   GLU B CG  1 
ATOM   2516 C CD  . GLU B 1 88  ? 44.879  15.253  49.087 1.00 70.75 ? 88   GLU B CD  1 
ATOM   2517 O OE1 . GLU B 1 88  ? 44.395  14.505  49.970 1.00 74.14 ? 88   GLU B OE1 1 
ATOM   2518 O OE2 . GLU B 1 88  ? 45.174  14.843  47.941 1.00 73.35 ? 88   GLU B OE2 1 
ATOM   2519 N N   . THR B 1 89  ? 42.554  19.267  52.072 1.00 35.30 ? 89   THR B N   1 
ATOM   2520 C CA  . THR B 1 89  ? 41.408  19.944  52.669 1.00 31.16 ? 89   THR B CA  1 
ATOM   2521 C C   . THR B 1 89  ? 41.891  21.047  53.617 1.00 31.97 ? 89   THR B C   1 
ATOM   2522 O O   . THR B 1 89  ? 43.093  21.152  53.868 1.00 35.32 ? 89   THR B O   1 
ATOM   2523 C CB  . THR B 1 89  ? 40.515  18.931  53.407 1.00 27.38 ? 89   THR B CB  1 
ATOM   2524 O OG1 . THR B 1 89  ? 41.085  18.609  54.684 1.00 33.71 ? 89   THR B OG1 1 
ATOM   2525 C CG2 . THR B 1 89  ? 40.393  17.650  52.575 1.00 28.85 ? 89   THR B CG2 1 
ATOM   2526 N N   . GLU B 1 90  ? 40.989  21.906  54.098 1.00 25.75 ? 90   GLU B N   1 
ATOM   2527 C CA  . GLU B 1 90  ? 41.435  23.035  54.912 1.00 21.19 ? 90   GLU B CA  1 
ATOM   2528 C C   . GLU B 1 90  ? 41.969  22.589  56.250 1.00 23.95 ? 90   GLU B C   1 
ATOM   2529 O O   . GLU B 1 90  ? 42.898  23.193  56.783 1.00 28.32 ? 90   GLU B O   1 
ATOM   2530 C CB  . GLU B 1 90  ? 40.339  24.081  55.128 1.00 20.90 ? 90   GLU B CB  1 
ATOM   2531 C CG  . GLU B 1 90  ? 40.845  25.526  54.933 1.00 26.68 ? 90   GLU B CG  1 
ATOM   2532 C CD  . GLU B 1 90  ? 41.046  26.290  56.233 1.00 28.90 ? 90   GLU B CD  1 
ATOM   2533 O OE1 . GLU B 1 90  ? 41.063  25.648  57.301 1.00 26.23 ? 90   GLU B OE1 1 
ATOM   2534 O OE2 . GLU B 1 90  ? 41.162  27.537  56.192 1.00 29.73 ? 90   GLU B OE2 1 
ATOM   2535 N N   . VAL B 1 91  ? 41.452  21.481  56.759 1.00 19.98 ? 91   VAL B N   1 
ATOM   2536 C CA  . VAL B 1 91  ? 41.906  21.019  58.054 1.00 20.12 ? 91   VAL B CA  1 
ATOM   2537 C C   . VAL B 1 91  ? 43.318  20.481  57.903 1.00 22.43 ? 91   VAL B C   1 
ATOM   2538 O O   . VAL B 1 91  ? 44.188  20.792  58.716 1.00 30.39 ? 91   VAL B O   1 
ATOM   2539 C CB  . VAL B 1 91  ? 40.958  19.954  58.639 1.00 22.57 ? 91   VAL B CB  1 
ATOM   2540 C CG1 . VAL B 1 91  ? 40.936  20.058  60.154 1.00 17.83 ? 91   VAL B CG1 1 
ATOM   2541 C CG2 . VAL B 1 91  ? 39.548  20.162  58.098 1.00 29.12 ? 91   VAL B CG2 1 
ATOM   2542 N N   . GLU B 1 92  ? 43.594  19.883  56.746 1.00 24.66 ? 92   GLU B N   1 
ATOM   2543 C CA  . GLU B 1 92  ? 44.931  19.375  56.442 1.00 21.17 ? 92   GLU B CA  1 
ATOM   2544 C C   . GLU B 1 92  ? 45.921  20.527  56.259 1.00 15.84 ? 92   GLU B C   1 
ATOM   2545 O O   . GLU B 1 92  ? 47.024  20.489  56.798 1.00 25.03 ? 92   GLU B O   1 
ATOM   2546 C CB  . GLU B 1 92  ? 44.887  18.475  55.194 1.00 20.18 ? 92   GLU B CB  1 
ATOM   2547 C CG  . GLU B 1 92  ? 44.284  17.075  55.432 1.00 15.78 ? 92   GLU B CG  1 
ATOM   2548 C CD  . GLU B 1 92  ? 44.387  16.163  54.206 1.00 19.87 ? 92   GLU B CD  1 
ATOM   2549 O OE1 . GLU B 1 92  ? 44.588  16.683  53.096 1.00 17.05 ? 92   GLU B OE1 1 
ATOM   2550 O OE2 . GLU B 1 92  ? 44.269  14.919  54.342 1.00 21.80 ? 92   GLU B OE2 1 
ATOM   2551 N N   . LYS B 1 93  ? 45.459  21.613  55.649 1.00 16.39 ? 93   LYS B N   1 
ATOM   2552 C CA  . LYS B 1 93  ? 46.274  22.819  55.500 1.00 18.47 ? 93   LYS B CA  1 
ATOM   2553 C C   . LYS B 1 93  ? 46.583  23.460  56.857 1.00 21.30 ? 93   LYS B C   1 
ATOM   2554 O O   . LYS B 1 93  ? 47.710  23.891  57.104 1.00 20.10 ? 93   LYS B O   1 
ATOM   2555 C CB  . LYS B 1 93  ? 45.560  23.842  54.607 1.00 13.93 ? 93   LYS B CB  1 
ATOM   2556 C CG  . LYS B 1 93  ? 45.277  23.375  53.180 1.00 12.42 ? 93   LYS B CG  1 
ATOM   2557 C CD  . LYS B 1 93  ? 46.484  23.562  52.249 1.00 24.01 ? 93   LYS B CD  1 
ATOM   2558 C CE  . LYS B 1 93  ? 46.089  23.866  50.787 1.00 24.34 ? 93   LYS B CE  1 
ATOM   2559 N NZ  . LYS B 1 93  ? 44.614  23.871  50.513 1.00 27.39 ? 93   LYS B NZ  1 
ATOM   2560 N N   . GLN B 1 94  ? 45.586  23.494  57.739 1.00 23.10 ? 94   GLN B N   1 
ATOM   2561 C CA  . GLN B 1 94  ? 45.759  24.018  59.098 1.00 16.16 ? 94   GLN B CA  1 
ATOM   2562 C C   . GLN B 1 94  ? 46.835  23.235  59.855 1.00 14.21 ? 94   GLN B C   1 
ATOM   2563 O O   . GLN B 1 94  ? 47.632  23.810  60.601 1.00 14.43 ? 94   GLN B O   1 
ATOM   2564 C CB  . GLN B 1 94  ? 44.450  23.929  59.885 1.00 14.75 ? 94   GLN B CB  1 
ATOM   2565 C CG  . GLN B 1 94  ? 43.312  24.800  59.389 1.00 13.86 ? 94   GLN B CG  1 
ATOM   2566 C CD  . GLN B 1 94  ? 42.017  24.545  60.150 1.00 18.03 ? 94   GLN B CD  1 
ATOM   2567 O OE1 . GLN B 1 94  ? 41.948  23.662  61.003 1.00 21.36 ? 94   GLN B OE1 1 
ATOM   2568 N NE2 . GLN B 1 94  ? 41.002  25.348  59.874 1.00 13.62 ? 94   GLN B NE2 1 
ATOM   2569 N N   . ARG B 1 95  ? 46.865  21.925  59.628 1.00 16.13 ? 95   ARG B N   1 
ATOM   2570 C CA  . ARG B 1 95  ? 47.810  21.044  60.299 1.00 19.94 ? 95   ARG B CA  1 
ATOM   2571 C C   . ARG B 1 95  ? 49.233  21.252  59.792 1.00 23.38 ? 95   ARG B C   1 
ATOM   2572 O O   . ARG B 1 95  ? 50.182  21.250  60.570 1.00 24.68 ? 95   ARG B O   1 
ATOM   2573 C CB  . ARG B 1 95  ? 47.407  19.588  60.080 1.00 25.20 ? 95   ARG B CB  1 
ATOM   2574 C CG  . ARG B 1 95  ? 46.048  19.212  60.652 1.00 25.14 ? 95   ARG B CG  1 
ATOM   2575 C CD  . ARG B 1 95  ? 46.047  17.780  61.175 1.00 23.58 ? 95   ARG B CD  1 
ATOM   2576 N NE  . ARG B 1 95  ? 45.188  17.638  62.350 1.00 32.87 ? 95   ARG B NE  1 
ATOM   2577 C CZ  . ARG B 1 95  ? 45.498  16.930  63.434 1.00 35.57 ? 95   ARG B CZ  1 
ATOM   2578 N NH1 . ARG B 1 95  ? 46.624  16.217  63.479 1.00 30.81 ? 95   ARG B NH1 1 
ATOM   2579 N NH2 . ARG B 1 95  ? 44.658  16.909  64.465 1.00 29.59 ? 95   ARG B NH2 1 
ATOM   2580 N N   . VAL B 1 96  ? 49.370  21.417  58.480 1.00 22.56 ? 96   VAL B N   1 
ATOM   2581 C CA  . VAL B 1 96  ? 50.661  21.686  57.858 1.00 17.98 ? 96   VAL B CA  1 
ATOM   2582 C C   . VAL B 1 96  ? 51.268  22.998  58.366 1.00 17.15 ? 96   VAL B C   1 
ATOM   2583 O O   . VAL B 1 96  ? 52.406  23.025  58.818 1.00 15.07 ? 96   VAL B O   1 
ATOM   2584 C CB  . VAL B 1 96  ? 50.525  21.753  56.325 1.00 17.13 ? 96   VAL B CB  1 
ATOM   2585 C CG1 . VAL B 1 96  ? 51.859  22.058  55.686 1.00 12.95 ? 96   VAL B CG1 1 
ATOM   2586 C CG2 . VAL B 1 96  ? 49.995  20.447  55.798 1.00 6.37  ? 96   VAL B CG2 1 
ATOM   2587 N N   . ASP B 1 97  ? 50.475  24.065  58.353 1.00 24.27 ? 97   ASP B N   1 
ATOM   2588 C CA  . ASP B 1 97  ? 50.967  25.392  58.707 1.00 23.33 ? 97   ASP B CA  1 
ATOM   2589 C C   . ASP B 1 97  ? 51.403  25.474  60.170 1.00 28.84 ? 97   ASP B C   1 
ATOM   2590 O O   . ASP B 1 97  ? 52.398  26.123  60.500 1.00 35.13 ? 97   ASP B O   1 
ATOM   2591 C CB  . ASP B 1 97  ? 49.890  26.444  58.454 1.00 22.07 ? 97   ASP B CB  1 
ATOM   2592 C CG  . ASP B 1 97  ? 49.364  26.424  57.036 1.00 25.24 ? 97   ASP B CG  1 
ATOM   2593 O OD1 . ASP B 1 97  ? 49.924  25.694  56.183 1.00 23.09 ? 97   ASP B OD1 1 
ATOM   2594 O OD2 . ASP B 1 97  ? 48.391  27.169  56.778 1.00 23.68 ? 97   ASP B OD2 1 
ATOM   2595 N N   . VAL B 1 98  ? 50.645  24.832  61.050 1.00 29.15 ? 98   VAL B N   1 
ATOM   2596 C CA  . VAL B 1 98  ? 50.943  24.873  62.476 1.00 24.80 ? 98   VAL B CA  1 
ATOM   2597 C C   . VAL B 1 98  ? 52.204  24.073  62.781 1.00 17.69 ? 98   VAL B C   1 
ATOM   2598 O O   . VAL B 1 98  ? 53.130  24.578  63.406 1.00 21.91 ? 98   VAL B O   1 
ATOM   2599 C CB  . VAL B 1 98  ? 49.751  24.318  63.295 1.00 30.13 ? 98   VAL B CB  1 
ATOM   2600 C CG1 . VAL B 1 98  ? 50.117  24.200  64.775 1.00 21.67 ? 98   VAL B CG1 1 
ATOM   2601 C CG2 . VAL B 1 98  ? 48.538  25.222  63.109 1.00 27.96 ? 98   VAL B CG2 1 
ATOM   2602 N N   . LEU B 1 99  ? 52.282  22.877  62.213 1.00 16.07 ? 99   LEU B N   1 
ATOM   2603 C CA  . LEU B 1 99  ? 53.393  21.966  62.453 1.00 15.44 ? 99   LEU B CA  1 
ATOM   2604 C C   . LEU B 1 99  ? 54.685  22.493  61.839 1.00 15.23 ? 99   LEU B C   1 
ATOM   2605 O O   . LEU B 1 99  ? 55.744  22.388  62.435 1.00 17.75 ? 99   LEU B O   1 
ATOM   2606 C CB  . LEU B 1 99  ? 53.047  20.599  61.867 1.00 10.49 ? 99   LEU B CB  1 
ATOM   2607 C CG  . LEU B 1 99  ? 53.658  19.324  62.441 1.00 11.77 ? 99   LEU B CG  1 
ATOM   2608 C CD1 . LEU B 1 99  ? 53.787  19.387  63.951 1.00 16.22 ? 99   LEU B CD1 1 
ATOM   2609 C CD2 . LEU B 1 99  ? 52.774  18.171  62.026 1.00 16.70 ? 99   LEU B CD2 1 
ATOM   2610 N N   . GLU B 1 100 ? 54.573  23.110  60.669 1.00 18.99 ? 100  GLU B N   1 
ATOM   2611 C CA  . GLU B 1 100 ? 55.711  23.680  59.962 1.00 12.02 ? 100  GLU B CA  1 
ATOM   2612 C C   . GLU B 1 100 ? 56.394  24.720  60.839 1.00 21.66 ? 100  GLU B C   1 
ATOM   2613 O O   . GLU B 1 100 ? 57.618  24.729  60.960 1.00 34.00 ? 100  GLU B O   1 
ATOM   2614 C CB  . GLU B 1 100 ? 55.214  24.310  58.657 1.00 13.80 ? 100  GLU B CB  1 
ATOM   2615 C CG  . GLU B 1 100 ? 56.250  25.061  57.870 1.00 12.80 ? 100  GLU B CG  1 
ATOM   2616 C CD  . GLU B 1 100 ? 55.647  25.938  56.793 1.00 26.95 ? 100  GLU B CD  1 
ATOM   2617 O OE1 . GLU B 1 100 ? 54.824  26.827  57.117 1.00 35.57 ? 100  GLU B OE1 1 
ATOM   2618 O OE2 . GLU B 1 100 ? 56.065  25.796  55.629 1.00 23.91 ? 100  GLU B OE2 1 
ATOM   2619 N N   . ASN B 1 101 ? 55.579  25.509  61.537 1.00 23.00 ? 101  ASN B N   1 
ATOM   2620 C CA  . ASN B 1 101 ? 56.052  26.623  62.351 1.00 16.43 ? 101  ASN B CA  1 
ATOM   2621 C C   . ASN B 1 101 ? 56.460  26.191  63.755 1.00 19.24 ? 101  ASN B C   1 
ATOM   2622 O O   . ASN B 1 101 ? 57.428  26.702  64.318 1.00 27.65 ? 101  ASN B O   1 
ATOM   2623 C CB  . ASN B 1 101 ? 54.965  27.681  62.439 1.00 11.18 ? 101  ASN B CB  1 
ATOM   2624 C CG  . ASN B 1 101 ? 54.872  28.522  61.188 1.00 23.15 ? 101  ASN B CG  1 
ATOM   2625 O OD1 . ASN B 1 101 ? 54.246  28.130  60.198 1.00 22.37 ? 101  ASN B OD1 1 
ATOM   2626 N ND2 . ASN B 1 101 ? 55.474  29.708  61.233 1.00 28.79 ? 101  ASN B ND2 1 
ATOM   2627 N N   . HIS B 1 102 ? 55.732  25.227  64.302 1.00 22.70 ? 102  HIS B N   1 
ATOM   2628 C CA  . HIS B 1 102 ? 56.033  24.688  65.619 1.00 18.42 ? 102  HIS B CA  1 
ATOM   2629 C C   . HIS B 1 102 ? 57.352  23.921  65.605 1.00 20.29 ? 102  HIS B C   1 
ATOM   2630 O O   . HIS B 1 102 ? 58.175  24.088  66.495 1.00 24.15 ? 102  HIS B O   1 
ATOM   2631 C CB  . HIS B 1 102 ? 54.899  23.770  66.089 1.00 21.32 ? 102  HIS B CB  1 
ATOM   2632 C CG  . HIS B 1 102 ? 55.100  23.211  67.465 1.00 14.85 ? 102  HIS B CG  1 
ATOM   2633 N ND1 . HIS B 1 102 ? 55.297  24.005  68.573 1.00 19.97 ? 102  HIS B ND1 1 
ATOM   2634 C CD2 . HIS B 1 102 ? 55.134  21.932  67.911 1.00 16.87 ? 102  HIS B CD2 1 
ATOM   2635 C CE1 . HIS B 1 102 ? 55.446  23.245  69.643 1.00 17.73 ? 102  HIS B CE1 1 
ATOM   2636 N NE2 . HIS B 1 102 ? 55.349  21.983  69.267 1.00 26.05 ? 102  HIS B NE2 1 
ATOM   2637 N N   . LEU B 1 103 ? 57.549  23.079  64.596 1.00 17.28 ? 103  LEU B N   1 
ATOM   2638 C CA  . LEU B 1 103 ? 58.789  22.325  64.465 1.00 17.41 ? 103  LEU B CA  1 
ATOM   2639 C C   . LEU B 1 103 ? 60.007  23.229  64.310 1.00 24.65 ? 103  LEU B C   1 
ATOM   2640 O O   . LEU B 1 103 ? 61.109  22.847  64.688 1.00 36.28 ? 103  LEU B O   1 
ATOM   2641 C CB  . LEU B 1 103 ? 58.722  21.380  63.273 1.00 10.37 ? 103  LEU B CB  1 
ATOM   2642 C CG  . LEU B 1 103 ? 57.759  20.207  63.391 1.00 13.33 ? 103  LEU B CG  1 
ATOM   2643 C CD1 . LEU B 1 103 ? 57.608  19.571  62.023 1.00 9.39  ? 103  LEU B CD1 1 
ATOM   2644 C CD2 . LEU B 1 103 ? 58.269  19.201  64.416 1.00 15.62 ? 103  LEU B CD2 1 
ATOM   2645 N N   . MET B 1 104 ? 59.817  24.406  63.720 1.00 24.88 ? 104  MET B N   1 
ATOM   2646 C CA  . MET B 1 104 ? 60.906  25.369  63.589 1.00 24.53 ? 104  MET B CA  1 
ATOM   2647 C C   . MET B 1 104 ? 61.258  25.929  64.955 1.00 26.10 ? 104  MET B C   1 
ATOM   2648 O O   . MET B 1 104 ? 62.427  26.142  65.263 1.00 35.30 ? 104  MET B O   1 
ATOM   2649 C CB  . MET B 1 104 ? 60.513  26.515  62.651 1.00 25.27 ? 104  MET B CB  1 
ATOM   2650 C CG  . MET B 1 104 ? 61.625  27.538  62.422 1.00 20.91 ? 104  MET B CG  1 
ATOM   2651 S SD  . MET B 1 104 ? 63.163  26.822  61.767 1.00 27.32 ? 104  MET B SD  1 
ATOM   2652 C CE  . MET B 1 104 ? 62.985  27.124  60.023 1.00 7.76  ? 104  MET B CE  1 
ATOM   2653 N N   . ASP B 1 105 ? 60.241  26.145  65.781 1.00 26.38 ? 105  ASP B N   1 
ATOM   2654 C CA  . ASP B 1 105 ? 60.449  26.566  67.166 1.00 28.71 ? 105  ASP B CA  1 
ATOM   2655 C C   . ASP B 1 105 ? 61.289  25.544  67.934 1.00 27.44 ? 105  ASP B C   1 
ATOM   2656 O O   . ASP B 1 105 ? 62.236  25.906  68.626 1.00 32.21 ? 105  ASP B O   1 
ATOM   2657 C CB  . ASP B 1 105 ? 59.101  26.741  67.877 1.00 29.18 ? 105  ASP B CB  1 
ATOM   2658 C CG  . ASP B 1 105 ? 58.394  28.029  67.500 1.00 32.30 ? 105  ASP B CG  1 
ATOM   2659 O OD1 . ASP B 1 105 ? 58.971  28.839  66.737 1.00 40.39 ? 105  ASP B OD1 1 
ATOM   2660 O OD2 . ASP B 1 105 ? 57.267  28.241  68.002 1.00 30.88 ? 105  ASP B OD2 1 
ATOM   2661 N N   . LEU B 1 106 ? 60.938  24.267  67.800 1.00 24.82 ? 106  LEU B N   1 
ATOM   2662 C CA  . LEU B 1 106 ? 61.644  23.189  68.484 1.00 22.42 ? 106  LEU B CA  1 
ATOM   2663 C C   . LEU B 1 106 ? 63.106  22.982  67.959 1.00 27.30 ? 106  LEU B C   1 
ATOM   2664 O O   . LEU B 1 106 ? 64.022  23.062  68.747 1.00 31.80 ? 106  LEU B O   1 
ATOM   2665 C CB  . LEU B 1 106 ? 60.918  21.859  68.263 1.00 17.97 ? 106  LEU B CB  1 
ATOM   2666 C CG  . LEU B 1 106 ? 59.838  21.418  69.263 1.00 24.98 ? 106  LEU B CG  1 
ATOM   2667 C CD1 . LEU B 1 106 ? 59.345  22.565  70.132 1.00 23.77 ? 106  LEU B CD1 1 
ATOM   2668 C CD2 . LEU B 1 106 ? 58.686  20.805  68.494 1.00 21.29 ? 106  LEU B CD2 1 
ATOM   2669 N N   . ARG B 1 107 ? 63.213  22.949  66.637 1.00 24.60 ? 107  ARG B N   1 
ATOM   2670 C CA  . ARG B 1 107 ? 64.451  23.132  65.895 1.00 21.84 ? 107  ARG B CA  1 
ATOM   2671 C C   . ARG B 1 107 ? 65.379  24.174  66.513 1.00 28.04 ? 107  ARG B C   1 
ATOM   2672 O O   . ARG B 1 107 ? 66.548  23.903  66.812 1.00 24.60 ? 107  ARG B O   1 
ATOM   2673 C CB  . ARG B 1 107 ? 64.078  23.614  64.508 1.00 26.10 ? 107  ARG B CB  1 
ATOM   2674 C CG  . ARG B 1 107 ? 65.224  23.883  63.566 1.00 31.61 ? 107  ARG B CG  1 
ATOM   2675 C CD  . ARG B 1 107 ? 65.531  22.628  62.732 1.00 36.15 ? 107  ARG B CD  1 
ATOM   2676 N NE  . ARG B 1 107 ? 65.647  22.614  61.374 1.00 33.24 ? 107  ARG B NE  1 
ATOM   2677 C CZ  . ARG B 1 107 ? 64.620  21.958  60.854 1.00 35.63 ? 107  ARG B CZ  1 
ATOM   2678 N NH1 . ARG B 1 107 ? 63.419  22.518  60.827 1.00 34.09 ? 107  ARG B NH1 1 
ATOM   2679 N NH2 . ARG B 1 107 ? 64.813  20.782  60.273 1.00 29.08 ? 107  ARG B NH2 1 
ATOM   2680 N N   . MET B 1 108 ? 64.844  25.391  66.613 1.00 25.80 ? 108  MET B N   1 
ATOM   2681 C CA  . MET B 1 108 ? 65.566  26.661  66.922 1.00 30.42 ? 108  MET B CA  1 
ATOM   2682 C C   . MET B 1 108 ? 65.967  26.649  68.394 1.00 35.17 ? 108  MET B C   1 
ATOM   2683 O O   . MET B 1 108 ? 67.031  27.154  68.756 1.00 38.65 ? 108  MET B O   1 
ATOM   2684 C CB  . MET B 1 108 ? 64.692  27.891  66.648 1.00 33.78 ? 108  MET B CB  1 
ATOM   2685 C CG  . MET B 1 108 ? 65.190  28.857  65.558 1.00 47.17 ? 108  MET B CG  1 
ATOM   2686 S SD  . MET B 1 108 ? 66.517  28.252  64.458 1.00 56.08 ? 108  MET B SD  1 
ATOM   2687 C CE  . MET B 1 108 ? 67.975  28.833  65.347 1.00 57.01 ? 108  MET B CE  1 
ATOM   2688 N N   . ALA B 1 109 ? 65.093  26.105  69.240 1.00 34.81 ? 109  ALA B N   1 
ATOM   2689 C CA  . ALA B 1 109 ? 65.342  26.021  70.682 1.00 32.34 ? 109  ALA B CA  1 
ATOM   2690 C C   . ALA B 1 109 ? 66.496  25.069  70.995 1.00 30.82 ? 109  ALA B C   1 
ATOM   2691 O O   . ALA B 1 109 ? 67.304  25.330  71.891 1.00 32.30 ? 109  ALA B O   1 
ATOM   2692 C CB  . ALA B 1 109 ? 64.077  25.568  71.416 1.00 25.67 ? 109  ALA B CB  1 
ATOM   2693 N N   . PHE B 1 110 ? 66.569  23.974  70.247 1.00 24.18 ? 110  PHE B N   1 
ATOM   2694 C CA  . PHE B 1 110 ? 67.655  23.017  70.387 1.00 29.09 ? 110  PHE B CA  1 
ATOM   2695 C C   . PHE B 1 110 ? 68.987  23.588  69.887 1.00 31.27 ? 110  PHE B C   1 
ATOM   2696 O O   . PHE B 1 110 ? 70.019  23.418  70.533 1.00 41.65 ? 110  PHE B O   1 
ATOM   2697 C CB  . PHE B 1 110 ? 67.314  21.732  69.626 1.00 33.59 ? 110  PHE B CB  1 
ATOM   2698 C CG  . PHE B 1 110 ? 68.358  20.658  69.744 1.00 33.71 ? 110  PHE B CG  1 
ATOM   2699 C CD1 . PHE B 1 110 ? 68.796  20.230  70.992 1.00 38.11 ? 110  PHE B CD1 1 
ATOM   2700 C CD2 . PHE B 1 110 ? 68.841  20.021  68.612 1.00 33.52 ? 110  PHE B CD2 1 
ATOM   2701 C CE1 . PHE B 1 110 ? 69.694  19.174  71.109 1.00 37.56 ? 110  PHE B CE1 1 
ATOM   2702 C CE2 . PHE B 1 110 ? 69.735  18.968  68.720 1.00 34.73 ? 110  PHE B CE2 1 
ATOM   2703 C CZ  . PHE B 1 110 ? 70.162  18.543  69.972 1.00 37.54 ? 110  PHE B CZ  1 
ATOM   2704 N N   . ALA B 1 111 ? 68.960  24.274  68.748 1.00 28.81 ? 111  ALA B N   1 
ATOM   2705 C CA  . ALA B 1 111 ? 70.170  24.857  68.178 1.00 27.73 ? 111  ALA B CA  1 
ATOM   2706 C C   . ALA B 1 111 ? 70.790  25.895  69.112 1.00 35.13 ? 111  ALA B C   1 
ATOM   2707 O O   . ALA B 1 111 ? 72.001  25.889  69.341 1.00 41.68 ? 111  ALA B O   1 
ATOM   2708 C CB  . ALA B 1 111 ? 69.862  25.483  66.829 1.00 32.65 ? 111  ALA B CB  1 
ATOM   2709 N N   . ARG B 1 112 ? 69.944  26.756  69.673 1.00 36.81 ? 112  ARG B N   1 
ATOM   2710 C CA  . ARG B 1 112 ? 70.359  27.742  70.666 1.00 39.92 ? 112  ARG B CA  1 
ATOM   2711 C C   . ARG B 1 112 ? 71.200  27.113  71.770 1.00 37.60 ? 112  ARG B C   1 
ATOM   2712 O O   . ARG B 1 112 ? 72.250  27.635  72.140 1.00 38.79 ? 112  ARG B O   1 
ATOM   2713 C CB  . ARG B 1 112 ? 69.140  28.361  71.320 1.00 39.54 ? 112  ARG B CB  1 
ATOM   2714 C CG  . ARG B 1 112 ? 68.360  29.346  70.488 1.00 52.46 ? 112  ARG B CG  1 
ATOM   2715 C CD  . ARG B 1 112 ? 67.043  29.673  71.206 1.00 62.08 ? 112  ARG B CD  1 
ATOM   2716 N NE  . ARG B 1 112 ? 67.245  30.083  72.604 1.00 63.80 ? 112  ARG B NE  1 
ATOM   2717 C CZ  . ARG B 1 112 ? 67.181  29.270  73.664 1.00 66.84 ? 112  ARG B CZ  1 
ATOM   2718 N NH1 . ARG B 1 112 ? 66.984  27.962  73.513 1.00 64.63 ? 112  ARG B NH1 1 
ATOM   2719 N NH2 . ARG B 1 112 ? 67.397  29.757  74.881 1.00 64.22 ? 112  ARG B NH2 1 
ATOM   2720 N N   . LEU B 1 113 ? 70.681  26.034  72.344 1.00 32.30 ? 113  LEU B N   1 
ATOM   2721 C CA  . LEU B 1 113 ? 71.356  25.343  73.431 1.00 32.05 ? 113  LEU B CA  1 
ATOM   2722 C C   . LEU B 1 113 ? 72.721  24.775  73.015 1.00 38.24 ? 113  LEU B C   1 
ATOM   2723 O O   . LEU B 1 113 ? 73.726  25.017  73.686 1.00 38.40 ? 113  LEU B O   1 
ATOM   2724 C CB  . LEU B 1 113 ? 70.448  24.235  73.976 1.00 28.57 ? 113  LEU B CB  1 
ATOM   2725 C CG  . LEU B 1 113 ? 71.045  23.080  74.781 1.00 25.96 ? 113  LEU B CG  1 
ATOM   2726 C CD1 . LEU B 1 113 ? 71.188  23.455  76.240 1.00 30.50 ? 113  LEU B CD1 1 
ATOM   2727 C CD2 . LEU B 1 113 ? 70.156  21.863  74.611 1.00 27.46 ? 113  LEU B CD2 1 
ATOM   2728 N N   . CYS B 1 114 ? 72.765  24.084  71.879 1.00 33.31 ? 114  CYS B N   1 
ATOM   2729 C CA  . CYS B 1 114 ? 73.986  23.425  71.436 1.00 28.26 ? 114  CYS B CA  1 
ATOM   2730 C C   . CYS B 1 114 ? 75.032  24.394  70.899 1.00 33.84 ? 114  CYS B C   1 
ATOM   2731 O O   . CYS B 1 114 ? 76.199  24.036  70.767 1.00 29.93 ? 114  CYS B O   1 
ATOM   2732 C CB  . CYS B 1 114 ? 73.660  22.381  70.380 1.00 26.31 ? 114  CYS B CB  1 
ATOM   2733 S SG  . CYS B 1 114 ? 72.648  21.040  71.022 1.00 38.02 ? 114  CYS B SG  1 
ATOM   2734 N N   . TYR B 1 115 ? 74.626  25.630  70.632 1.00 31.96 ? 115  TYR B N   1 
ATOM   2735 C CA  . TYR B 1 115 ? 75.571  26.649  70.203 1.00 36.41 ? 115  TYR B CA  1 
ATOM   2736 C C   . TYR B 1 115 ? 76.073  27.506  71.352 1.00 40.07 ? 115  TYR B C   1 
ATOM   2737 O O   . TYR B 1 115 ? 77.120  28.142  71.235 1.00 43.65 ? 115  TYR B O   1 
ATOM   2738 C CB  . TYR B 1 115 ? 74.947  27.547  69.138 1.00 34.74 ? 115  TYR B CB  1 
ATOM   2739 C CG  . TYR B 1 115 ? 74.998  26.958  67.751 1.00 35.80 ? 115  TYR B CG  1 
ATOM   2740 C CD1 . TYR B 1 115 ? 76.137  26.300  67.293 1.00 33.85 ? 115  TYR B CD1 1 
ATOM   2741 C CD2 . TYR B 1 115 ? 73.882  27.001  66.920 1.00 36.39 ? 115  TYR B CD2 1 
ATOM   2742 C CE1 . TYR B 1 115 ? 76.161  25.697  66.051 1.00 28.48 ? 115  TYR B CE1 1 
ATOM   2743 C CE2 . TYR B 1 115 ? 73.895  26.393  65.676 1.00 34.32 ? 115  TYR B CE2 1 
ATOM   2744 C CZ  . TYR B 1 115 ? 75.036  25.745  65.249 1.00 33.42 ? 115  TYR B CZ  1 
ATOM   2745 O OH  . TYR B 1 115 ? 75.046  25.152  64.014 1.00 37.76 ? 115  TYR B OH  1 
ATOM   2746 N N   . SER B 1 116 ? 75.328  27.532  72.456 1.00 40.61 ? 116  SER B N   1 
ATOM   2747 C CA  . SER B 1 116 ? 75.686  28.378  73.595 1.00 42.03 ? 116  SER B CA  1 
ATOM   2748 C C   . SER B 1 116 ? 76.846  27.794  74.396 1.00 42.64 ? 116  SER B C   1 
ATOM   2749 O O   . SER B 1 116 ? 76.876  26.594  74.682 1.00 44.55 ? 116  SER B O   1 
ATOM   2750 C CB  . SER B 1 116 ? 74.477  28.608  74.509 1.00 41.32 ? 116  SER B CB  1 
ATOM   2751 O OG  . SER B 1 116 ? 73.929  27.384  74.961 1.00 48.45 ? 116  SER B OG  1 
ATOM   2752 N N   . PRO B 1 117 ? 77.836  28.639  74.743 1.00 42.49 ? 117  PRO B N   1 
ATOM   2753 C CA  . PRO B 1 117 ? 78.977  28.226  75.569 1.00 41.36 ? 117  PRO B CA  1 
ATOM   2754 C C   . PRO B 1 117 ? 78.577  27.830  76.998 1.00 45.54 ? 117  PRO B C   1 
ATOM   2755 O O   . PRO B 1 117 ? 79.210  26.965  77.618 1.00 47.84 ? 117  PRO B O   1 
ATOM   2756 C CB  . PRO B 1 117 ? 79.902  29.447  75.534 1.00 36.96 ? 117  PRO B CB  1 
ATOM   2757 C CG  . PRO B 1 117 ? 78.998  30.596  75.256 1.00 36.05 ? 117  PRO B CG  1 
ATOM   2758 C CD  . PRO B 1 117 ? 77.945  30.051  74.332 1.00 43.02 ? 117  PRO B CD  1 
ATOM   2759 N N   . ASP B 1 118 ? 77.441  28.357  77.452 1.00 44.97 ? 118  ASP B N   1 
ATOM   2760 C CA  . ASP B 1 118 ? 76.851  27.940  78.723 1.00 49.56 ? 118  ASP B CA  1 
ATOM   2761 C C   . ASP B 1 118 ? 76.084  26.624  78.558 1.00 48.97 ? 118  ASP B C   1 
ATOM   2762 O O   . ASP B 1 118 ? 75.155  26.337  79.321 1.00 50.34 ? 118  ASP B O   1 
ATOM   2763 C CB  . ASP B 1 118 ? 75.904  29.027  79.259 1.00 51.29 ? 118  ASP B CB  1 
ATOM   2764 C CG  . ASP B 1 118 ? 76.629  30.326  79.610 1.00 60.76 ? 118  ASP B CG  1 
ATOM   2765 O OD1 . ASP B 1 118 ? 76.732  31.198  78.721 1.00 63.37 ? 118  ASP B OD1 1 
ATOM   2766 O OD2 . ASP B 1 118 ? 77.058  30.493  80.777 1.00 59.59 ? 118  ASP B OD2 1 
ATOM   2767 N N   . PHE B 1 119 ? 76.505  25.818  77.583 1.00 43.60 ? 119  PHE B N   1 
ATOM   2768 C CA  . PHE B 1 119 ? 75.797  24.600  77.203 1.00 43.40 ? 119  PHE B CA  1 
ATOM   2769 C C   . PHE B 1 119 ? 75.491  23.724  78.414 1.00 45.94 ? 119  PHE B C   1 
ATOM   2770 O O   . PHE B 1 119 ? 74.328  23.409  78.680 1.00 44.14 ? 119  PHE B O   1 
ATOM   2771 C CB  . PHE B 1 119 ? 76.628  23.810  76.183 1.00 39.83 ? 119  PHE B CB  1 
ATOM   2772 C CG  . PHE B 1 119 ? 75.995  22.512  75.751 1.00 39.86 ? 119  PHE B CG  1 
ATOM   2773 C CD1 . PHE B 1 119 ? 75.018  22.494  74.759 1.00 41.69 ? 119  PHE B CD1 1 
ATOM   2774 C CD2 . PHE B 1 119 ? 76.361  21.309  76.349 1.00 34.96 ? 119  PHE B CD2 1 
ATOM   2775 C CE1 . PHE B 1 119 ? 74.414  21.295  74.368 1.00 42.93 ? 119  PHE B CE1 1 
ATOM   2776 C CE2 . PHE B 1 119 ? 75.762  20.108  75.968 1.00 31.45 ? 119  PHE B CE2 1 
ATOM   2777 C CZ  . PHE B 1 119 ? 74.787  20.099  74.975 1.00 34.14 ? 119  PHE B CZ  1 
ATOM   2778 N N   . GLU B 1 120 ? 76.528  23.435  79.198 1.00 52.11 ? 120  GLU B N   1 
ATOM   2779 C CA  . GLU B 1 120 ? 76.425  22.512  80.325 1.00 54.76 ? 120  GLU B CA  1 
ATOM   2780 C C   . GLU B 1 120 ? 75.462  23.009  81.402 1.00 55.78 ? 120  GLU B C   1 
ATOM   2781 O O   . GLU B 1 120 ? 74.720  22.217  81.993 1.00 54.39 ? 120  GLU B O   1 
ATOM   2782 C CB  . GLU B 1 120 ? 77.806  22.287  80.936 1.00 57.36 ? 120  GLU B CB  1 
ATOM   2783 C CG  . GLU B 1 120 ? 78.081  20.844  81.345 1.00 64.38 ? 120  GLU B CG  1 
ATOM   2784 C CD  . GLU B 1 120 ? 78.326  19.929  80.154 1.00 63.52 ? 120  GLU B CD  1 
ATOM   2785 O OE1 . GLU B 1 120 ? 78.989  20.366  79.188 1.00 66.41 ? 120  GLU B OE1 1 
ATOM   2786 O OE2 . GLU B 1 120 ? 77.873  18.765  80.192 1.00 60.85 ? 120  GLU B OE2 1 
ATOM   2787 N N   . LYS B 1 121 ? 75.445  24.326  81.612 1.00 52.39 ? 121  LYS B N   1 
ATOM   2788 C CA  . LYS B 1 121 ? 74.550  24.950  82.588 1.00 54.58 ? 121  LYS B CA  1 
ATOM   2789 C C   . LYS B 1 121 ? 73.085  24.944  82.131 1.00 54.44 ? 121  LYS B C   1 
ATOM   2790 O O   . LYS B 1 121 ? 72.168  24.881  82.956 1.00 53.56 ? 121  LYS B O   1 
ATOM   2791 C CB  . LYS B 1 121 ? 74.996  26.388  82.878 1.00 53.71 ? 121  LYS B CB  1 
ATOM   2792 C CG  . LYS B 1 121 ? 76.477  26.521  83.199 1.00 55.21 ? 121  LYS B CG  1 
ATOM   2793 C CD  . LYS B 1 121 ? 76.786  27.824  83.929 1.00 56.35 ? 121  LYS B CD  1 
ATOM   2794 C CE  . LYS B 1 121 ? 78.129  28.408  83.488 1.00 58.68 ? 121  LYS B CE  1 
ATOM   2795 N NZ  . LYS B 1 121 ? 79.230  27.404  83.459 1.00 57.52 ? 121  LYS B NZ  1 
ATOM   2796 N N   . LEU B 1 122 ? 72.881  24.944  80.813 1.00 49.41 ? 122  LEU B N   1 
ATOM   2797 C CA  . LEU B 1 122 ? 71.547  25.004  80.216 1.00 43.20 ? 122  LEU B CA  1 
ATOM   2798 C C   . LEU B 1 122 ? 70.937  23.627  79.974 1.00 44.49 ? 122  LEU B C   1 
ATOM   2799 O O   . LEU B 1 122 ? 69.718  23.495  79.854 1.00 48.11 ? 122  LEU B O   1 
ATOM   2800 C CB  . LEU B 1 122 ? 71.608  25.753  78.887 1.00 42.86 ? 122  LEU B CB  1 
ATOM   2801 C CG  . LEU B 1 122 ? 71.737  27.269  78.951 1.00 45.69 ? 122  LEU B CG  1 
ATOM   2802 C CD1 . LEU B 1 122 ? 71.730  27.858  77.545 1.00 43.66 ? 122  LEU B CD1 1 
ATOM   2803 C CD2 . LEU B 1 122 ? 70.588  27.822  79.780 1.00 49.61 ? 122  LEU B CD2 1 
ATOM   2804 N N   . LYS B 1 123 ? 71.794  22.614  79.889 1.00 41.15 ? 123  LYS B N   1 
ATOM   2805 C CA  . LYS B 1 123 ? 71.388  21.251  79.552 1.00 44.36 ? 123  LYS B CA  1 
ATOM   2806 C C   . LYS B 1 123 ? 70.248  20.700  80.418 1.00 44.61 ? 123  LYS B C   1 
ATOM   2807 O O   . LYS B 1 123 ? 69.226  20.266  79.885 1.00 44.56 ? 123  LYS B O   1 
ATOM   2808 C CB  . LYS B 1 123 ? 72.608  20.324  79.627 1.00 44.77 ? 123  LYS B CB  1 
ATOM   2809 C CG  . LYS B 1 123 ? 72.425  18.969  78.972 1.00 46.11 ? 123  LYS B CG  1 
ATOM   2810 C CD  . LYS B 1 123 ? 73.772  18.273  78.787 1.00 51.05 ? 123  LYS B CD  1 
ATOM   2811 C CE  . LYS B 1 123 ? 73.697  16.776  79.097 1.00 53.08 ? 123  LYS B CE  1 
ATOM   2812 N NZ  . LYS B 1 123 ? 72.752  16.044  78.205 1.00 48.92 ? 123  LYS B NZ  1 
ATOM   2813 N N   . PRO B 1 124 ? 70.373  20.775  81.758 1.00 43.28 ? 124  PRO B N   1 
ATOM   2814 C CA  . PRO B 1 124 ? 69.335  20.189  82.619 1.00 40.60 ? 124  PRO B CA  1 
ATOM   2815 C C   . PRO B 1 124 ? 67.955  20.835  82.437 1.00 40.47 ? 124  PRO B C   1 
ATOM   2816 O O   . PRO B 1 124 ? 66.943  20.133  82.415 1.00 46.09 ? 124  PRO B O   1 
ATOM   2817 C CB  . PRO B 1 124 ? 69.883  20.408  84.025 1.00 39.98 ? 124  PRO B CB  1 
ATOM   2818 C CG  . PRO B 1 124 ? 70.732  21.648  83.883 1.00 39.08 ? 124  PRO B CG  1 
ATOM   2819 C CD  . PRO B 1 124 ? 71.398  21.479  82.555 1.00 34.32 ? 124  PRO B CD  1 
ATOM   2820 N N   . ALA B 1 125 ? 67.930  22.154  82.234 1.00 39.04 ? 125  ALA B N   1 
ATOM   2821 C CA  . ALA B 1 125 ? 66.678  22.897  82.047 1.00 41.14 ? 125  ALA B CA  1 
ATOM   2822 C C   . ALA B 1 125 ? 65.928  22.442  80.792 1.00 42.00 ? 125  ALA B C   1 
ATOM   2823 O O   . ALA B 1 125 ? 64.719  22.197  80.833 1.00 41.71 ? 125  ALA B O   1 
ATOM   2824 C CB  . ALA B 1 125 ? 66.960  24.400  81.976 1.00 40.64 ? 125  ALA B CB  1 
ATOM   2825 N N   . TYR B 1 126 ? 66.668  22.296  79.694 1.00 37.09 ? 126  TYR B N   1 
ATOM   2826 C CA  . TYR B 1 126 ? 66.131  21.795  78.430 1.00 34.15 ? 126  TYR B CA  1 
ATOM   2827 C C   . TYR B 1 126 ? 65.505  20.414  78.599 1.00 32.54 ? 126  TYR B C   1 
ATOM   2828 O O   . TYR B 1 126 ? 64.416  20.148  78.086 1.00 35.82 ? 126  TYR B O   1 
ATOM   2829 C CB  . TYR B 1 126 ? 67.253  21.710  77.386 1.00 32.96 ? 126  TYR B CB  1 
ATOM   2830 C CG  . TYR B 1 126 ? 66.813  21.236  76.010 1.00 26.20 ? 126  TYR B CG  1 
ATOM   2831 C CD1 . TYR B 1 126 ? 66.253  22.127  75.097 1.00 23.35 ? 126  TYR B CD1 1 
ATOM   2832 C CD2 . TYR B 1 126 ? 66.981  19.904  75.614 1.00 26.45 ? 126  TYR B CD2 1 
ATOM   2833 C CE1 . TYR B 1 126 ? 65.876  21.714  73.825 1.00 23.91 ? 126  TYR B CE1 1 
ATOM   2834 C CE2 . TYR B 1 126 ? 66.594  19.477  74.337 1.00 22.77 ? 126  TYR B CE2 1 
ATOM   2835 C CZ  . TYR B 1 126 ? 66.047  20.392  73.450 1.00 24.23 ? 126  TYR B CZ  1 
ATOM   2836 O OH  . TYR B 1 126 ? 65.699  20.017  72.174 1.00 25.99 ? 126  TYR B OH  1 
ATOM   2837 N N   . LEU B 1 127 ? 66.208  19.550  79.326 1.00 33.77 ? 127  LEU B N   1 
ATOM   2838 C CA  . LEU B 1 127 ? 65.829  18.149  79.495 1.00 35.69 ? 127  LEU B CA  1 
ATOM   2839 C C   . LEU B 1 127 ? 64.576  17.979  80.349 1.00 34.95 ? 127  LEU B C   1 
ATOM   2840 O O   . LEU B 1 127 ? 63.950  16.910  80.354 1.00 30.81 ? 127  LEU B O   1 
ATOM   2841 C CB  . LEU B 1 127 ? 66.987  17.381  80.131 1.00 33.37 ? 127  LEU B CB  1 
ATOM   2842 C CG  . LEU B 1 127 ? 68.314  17.406  79.368 1.00 25.13 ? 127  LEU B CG  1 
ATOM   2843 C CD1 . LEU B 1 127 ? 69.475  17.270  80.341 1.00 28.55 ? 127  LEU B CD1 1 
ATOM   2844 C CD2 . LEU B 1 127 ? 68.329  16.294  78.338 1.00 18.58 ? 127  LEU B CD2 1 
ATOM   2845 N N   . GLU B 1 128 ? 64.241  19.026  81.098 1.00 35.57 ? 128  GLU B N   1 
ATOM   2846 C CA  . GLU B 1 128 ? 63.033  19.037  81.906 1.00 50.61 ? 128  GLU B CA  1 
ATOM   2847 C C   . GLU B 1 128 ? 61.799  19.303  81.061 1.00 47.83 ? 128  GLU B C   1 
ATOM   2848 O O   . GLU B 1 128 ? 60.789  18.594  81.161 1.00 50.19 ? 128  GLU B O   1 
ATOM   2849 C CB  . GLU B 1 128 ? 63.139  20.101  82.990 1.00 54.09 ? 128  GLU B CB  1 
ATOM   2850 C CG  . GLU B 1 128 ? 63.737  19.591  84.279 1.00 56.63 ? 128  GLU B CG  1 
ATOM   2851 C CD  . GLU B 1 128 ? 63.875  20.680  85.312 1.00 58.43 ? 128  GLU B CD  1 
ATOM   2852 O OE1 . GLU B 1 128 ? 62.918  21.473  85.460 1.00 58.65 ? 128  GLU B OE1 1 
ATOM   2853 O OE2 . GLU B 1 128 ? 64.952  20.761  85.946 1.00 59.32 ? 128  GLU B OE2 1 
ATOM   2854 N N   . LEU B 1 129 ? 61.869  20.345  80.243 1.00 42.47 ? 129  LEU B N   1 
ATOM   2855 C CA  . LEU B 1 129 ? 60.711  20.725  79.459 1.00 41.99 ? 129  LEU B CA  1 
ATOM   2856 C C   . LEU B 1 129 ? 60.581  19.922  78.169 1.00 36.48 ? 129  LEU B C   1 
ATOM   2857 O O   . LEU B 1 129 ? 59.537  19.964  77.524 1.00 44.73 ? 129  LEU B O   1 
ATOM   2858 C CB  . LEU B 1 129 ? 60.718  22.234  79.194 1.00 42.92 ? 129  LEU B CB  1 
ATOM   2859 C CG  . LEU B 1 129 ? 59.922  23.063  80.219 1.00 51.15 ? 129  LEU B CG  1 
ATOM   2860 C CD1 . LEU B 1 129 ? 58.434  22.852  79.995 1.00 52.53 ? 129  LEU B CD1 1 
ATOM   2861 C CD2 . LEU B 1 129 ? 60.303  22.677  81.657 1.00 52.35 ? 129  LEU B CD2 1 
ATOM   2862 N N   . LEU B 1 130 ? 61.537  19.024  77.942 1.00 31.46 ? 130  LEU B N   1 
ATOM   2863 C CA  . LEU B 1 130 ? 61.585  18.208  76.726 1.00 34.89 ? 130  LEU B CA  1 
ATOM   2864 C C   . LEU B 1 130 ? 60.481  17.150  76.666 1.00 30.69 ? 130  LEU B C   1 
ATOM   2865 O O   . LEU B 1 130 ? 59.762  17.051  75.668 1.00 31.64 ? 130  LEU B O   1 
ATOM   2866 C CB  . LEU B 1 130 ? 62.955  17.524  76.600 1.00 33.26 ? 130  LEU B CB  1 
ATOM   2867 C CG  . LEU B 1 130 ? 63.602  17.337  75.223 1.00 32.67 ? 130  LEU B CG  1 
ATOM   2868 C CD1 . LEU B 1 130 ? 64.648  16.247  75.316 1.00 31.81 ? 130  LEU B CD1 1 
ATOM   2869 C CD2 . LEU B 1 130 ? 62.583  16.962  74.180 1.00 28.79 ? 130  LEU B CD2 1 
ATOM   2870 N N   . PRO B 1 131 ? 60.370  16.306  77.705 1.00 32.64 ? 131  PRO B N   1 
ATOM   2871 C CA  . PRO B 1 131 ? 59.338  15.261  77.689 1.00 34.18 ? 131  PRO B CA  1 
ATOM   2872 C C   . PRO B 1 131 ? 57.923  15.794  77.443 1.00 35.27 ? 131  PRO B C   1 
ATOM   2873 O O   . PRO B 1 131 ? 57.134  15.157  76.750 1.00 32.40 ? 131  PRO B O   1 
ATOM   2874 C CB  . PRO B 1 131 ? 59.473  14.605  79.065 1.00 33.18 ? 131  PRO B CB  1 
ATOM   2875 C CG  . PRO B 1 131 ? 60.184  15.627  79.908 1.00 36.87 ? 131  PRO B CG  1 
ATOM   2876 C CD  . PRO B 1 131 ? 61.144  16.270  78.958 1.00 32.78 ? 131  PRO B CD  1 
ATOM   2877 N N   . GLY B 1 132 ? 57.646  16.998  77.944 1.00 36.00 ? 132  GLY B N   1 
ATOM   2878 C CA  . GLY B 1 132 ? 56.345  17.616  77.746 1.00 38.89 ? 132  GLY B CA  1 
ATOM   2879 C C   . GLY B 1 132 ? 56.092  18.018  76.307 1.00 41.99 ? 132  GLY B C   1 
ATOM   2880 O O   . GLY B 1 132 ? 54.993  17.832  75.783 1.00 44.92 ? 132  GLY B O   1 
ATOM   2881 N N   . LYS B 1 133 ? 57.132  18.534  75.663 1.00 38.57 ? 133  LYS B N   1 
ATOM   2882 C CA  . LYS B 1 133 ? 57.080  18.894  74.256 1.00 27.68 ? 133  LYS B CA  1 
ATOM   2883 C C   . LYS B 1 133 ? 56.877  17.657  73.402 1.00 25.40 ? 133  LYS B C   1 
ATOM   2884 O O   . LYS B 1 133 ? 56.081  17.659  72.465 1.00 21.24 ? 133  LYS B O   1 
ATOM   2885 C CB  . LYS B 1 133 ? 58.374  19.595  73.867 1.00 24.99 ? 133  LYS B CB  1 
ATOM   2886 C CG  . LYS B 1 133 ? 58.592  20.889  74.631 1.00 24.15 ? 133  LYS B CG  1 
ATOM   2887 C CD  . LYS B 1 133 ? 59.692  21.741  74.026 1.00 30.76 ? 133  LYS B CD  1 
ATOM   2888 C CE  . LYS B 1 133 ? 59.717  23.122  74.670 1.00 36.31 ? 133  LYS B CE  1 
ATOM   2889 N NZ  . LYS B 1 133 ? 59.883  23.054  76.157 1.00 45.10 ? 133  LYS B NZ  1 
ATOM   2890 N N   . LEU B 1 134 ? 57.533  16.574  73.797 1.00 26.09 ? 134  LEU B N   1 
ATOM   2891 C CA  . LEU B 1 134 ? 57.415  15.307  73.101 1.00 26.16 ? 134  LEU B CA  1 
ATOM   2892 C C   . LEU B 1 134 ? 56.033  14.684  73.283 1.00 23.84 ? 134  LEU B C   1 
ATOM   2893 O O   . LEU B 1 134 ? 55.512  14.046  72.373 1.00 30.10 ? 134  LEU B O   1 
ATOM   2894 C CB  . LEU B 1 134 ? 58.498  14.353  73.601 1.00 33.66 ? 134  LEU B CB  1 
ATOM   2895 C CG  . LEU B 1 134 ? 59.693  14.108  72.673 1.00 35.34 ? 134  LEU B CG  1 
ATOM   2896 C CD1 . LEU B 1 134 ? 60.237  15.425  72.146 1.00 35.73 ? 134  LEU B CD1 1 
ATOM   2897 C CD2 . LEU B 1 134 ? 60.770  13.326  73.416 1.00 34.27 ? 134  LEU B CD2 1 
ATOM   2898 N N   . ARG B 1 135 ? 55.439  14.895  74.456 1.00 22.04 ? 135  ARG B N   1 
ATOM   2899 C CA  . ARG B 1 135 ? 54.117  14.363  74.780 1.00 15.14 ? 135  ARG B CA  1 
ATOM   2900 C C   . ARG B 1 135 ? 53.041  15.063  73.969 1.00 21.49 ? 135  ARG B C   1 
ATOM   2901 O O   . ARG B 1 135 ? 52.009  14.473  73.651 1.00 29.03 ? 135  ARG B O   1 
ATOM   2902 C CB  . ARG B 1 135 ? 53.828  14.558  76.264 1.00 17.37 ? 135  ARG B CB  1 
ATOM   2903 C CG  . ARG B 1 135 ? 53.772  13.274  77.058 1.00 16.37 ? 135  ARG B CG  1 
ATOM   2904 C CD  . ARG B 1 135 ? 53.534  13.578  78.524 1.00 18.39 ? 135  ARG B CD  1 
ATOM   2905 N NE  . ARG B 1 135 ? 54.757  13.466  79.309 1.00 11.06 ? 135  ARG B NE  1 
ATOM   2906 C CZ  . ARG B 1 135 ? 55.183  14.391  80.161 1.00 13.99 ? 135  ARG B CZ  1 
ATOM   2907 N NH1 . ARG B 1 135 ? 54.548  15.546  80.250 1.00 14.13 ? 135  ARG B NH1 1 
ATOM   2908 N NH2 . ARG B 1 135 ? 56.257  14.177  80.914 1.00 18.09 ? 135  ARG B NH2 1 
ATOM   2909 N N   . GLN B 1 136 ? 53.276  16.339  73.673 1.00 26.30 ? 136  GLN B N   1 
ATOM   2910 C CA  . GLN B 1 136 ? 52.367  17.133  72.853 1.00 33.15 ? 136  GLN B CA  1 
ATOM   2911 C C   . GLN B 1 136 ? 52.272  16.569  71.440 1.00 33.02 ? 136  GLN B C   1 
ATOM   2912 O O   . GLN B 1 136 ? 51.170  16.384  70.910 1.00 37.61 ? 136  GLN B O   1 
ATOM   2913 C CB  . GLN B 1 136 ? 52.850  18.583  72.793 1.00 34.37 ? 136  GLN B CB  1 
ATOM   2914 C CG  . GLN B 1 136 ? 52.956  19.271  74.139 1.00 36.25 ? 136  GLN B CG  1 
ATOM   2915 C CD  . GLN B 1 136 ? 53.247  20.748  74.009 1.00 34.21 ? 136  GLN B CD  1 
ATOM   2916 O OE1 . GLN B 1 136 ? 53.704  21.217  72.962 1.00 39.11 ? 136  GLN B OE1 1 
ATOM   2917 N NE2 . GLN B 1 136 ? 52.970  21.499  75.072 1.00 36.35 ? 136  GLN B NE2 1 
ATOM   2918 N N   . LEU B 1 137 ? 53.439  16.300  70.849 1.00 29.45 ? 137  LEU B N   1 
ATOM   2919 C CA  . LEU B 1 137 ? 53.548  15.719  69.512 1.00 29.93 ? 137  LEU B CA  1 
ATOM   2920 C C   . LEU B 1 137 ? 52.974  14.312  69.449 1.00 26.90 ? 137  LEU B C   1 
ATOM   2921 O O   . LEU B 1 137 ? 52.404  13.915  68.439 1.00 25.26 ? 137  LEU B O   1 
ATOM   2922 C CB  . LEU B 1 137 ? 55.009  15.669  69.071 1.00 34.26 ? 137  LEU B CB  1 
ATOM   2923 C CG  . LEU B 1 137 ? 55.635  16.880  68.374 1.00 35.26 ? 137  LEU B CG  1 
ATOM   2924 C CD1 . LEU B 1 137 ? 57.129  16.619  68.210 1.00 35.25 ? 137  LEU B CD1 1 
ATOM   2925 C CD2 . LEU B 1 137 ? 54.983  17.130  67.021 1.00 35.27 ? 137  LEU B CD2 1 
ATOM   2926 N N   . SER B 1 138 ? 53.172  13.542  70.510 1.00 26.27 ? 138  SER B N   1 
ATOM   2927 C CA  . SER B 1 138 ? 52.583  12.213  70.605 1.00 28.18 ? 138  SER B CA  1 
ATOM   2928 C C   . SER B 1 138 ? 51.046  12.264  70.653 1.00 32.55 ? 138  SER B C   1 
ATOM   2929 O O   . SER B 1 138 ? 50.373  11.409  70.062 1.00 32.54 ? 138  SER B O   1 
ATOM   2930 C CB  . SER B 1 138 ? 53.126  11.497  71.839 1.00 26.30 ? 138  SER B CB  1 
ATOM   2931 O OG  . SER B 1 138 ? 52.907  10.104  71.749 1.00 28.00 ? 138  SER B OG  1 
ATOM   2932 N N   . ARG B 1 139 ? 50.502  13.283  71.324 1.00 28.30 ? 139  ARG B N   1 
ATOM   2933 C CA  . ARG B 1 139 ? 49.059  13.497  71.391 1.00 32.42 ? 139  ARG B CA  1 
ATOM   2934 C C   . ARG B 1 139 ? 48.503  13.872  70.018 1.00 34.24 ? 139  ARG B C   1 
ATOM   2935 O O   . ARG B 1 139 ? 47.514  13.298  69.562 1.00 31.48 ? 139  ARG B O   1 
ATOM   2936 C CB  . ARG B 1 139 ? 48.726  14.596  72.416 1.00 37.37 ? 139  ARG B CB  1 
ATOM   2937 C CG  . ARG B 1 139 ? 48.605  14.092  73.867 1.00 46.45 ? 139  ARG B CG  1 
ATOM   2938 C CD  . ARG B 1 139 ? 48.123  15.173  74.842 1.00 47.81 ? 139  ARG B CD  1 
ATOM   2939 N NE  . ARG B 1 139 ? 49.203  15.991  75.413 1.00 45.66 ? 139  ARG B NE  1 
ATOM   2940 C CZ  . ARG B 1 139 ? 50.048  15.590  76.368 1.00 47.89 ? 139  ARG B CZ  1 
ATOM   2941 N NH1 . ARG B 1 139 ? 50.098  14.313  76.742 1.00 51.01 ? 139  ARG B NH1 1 
ATOM   2942 N NH2 . ARG B 1 139 ? 50.903  16.457  76.900 1.00 47.15 ? 139  ARG B NH2 1 
ATOM   2943 N N   . PHE B 1 140 ? 49.214  14.757  69.323 1.00 37.24 ? 140  PHE B N   1 
ATOM   2944 C CA  . PHE B 1 140 ? 48.811  15.243  67.998 1.00 34.01 ? 140  PHE B CA  1 
ATOM   2945 C C   . PHE B 1 140 ? 48.711  14.123  66.950 1.00 31.10 ? 140  PHE B C   1 
ATOM   2946 O O   . PHE B 1 140 ? 47.666  13.940  66.320 1.00 35.47 ? 140  PHE B O   1 
ATOM   2947 C CB  . PHE B 1 140 ? 49.802  16.319  67.520 1.00 31.04 ? 140  PHE B CB  1 
ATOM   2948 C CG  . PHE B 1 140 ? 49.365  17.060  66.281 1.00 32.61 ? 140  PHE B CG  1 
ATOM   2949 C CD1 . PHE B 1 140 ? 48.235  17.869  66.299 1.00 31.04 ? 140  PHE B CD1 1 
ATOM   2950 C CD2 . PHE B 1 140 ? 50.161  17.058  65.139 1.00 36.44 ? 140  PHE B CD2 1 
ATOM   2951 C CE1 . PHE B 1 140 ? 47.913  18.674  65.205 1.00 28.72 ? 140  PHE B CE1 1 
ATOM   2952 C CE2 . PHE B 1 140 ? 49.844  17.855  64.039 1.00 33.63 ? 140  PHE B CE2 1 
ATOM   2953 C CZ  . PHE B 1 140 ? 48.721  18.666  64.074 1.00 30.44 ? 140  PHE B CZ  1 
ATOM   2954 N N   . LEU B 1 141 ? 49.804  13.382  66.773 1.00 28.24 ? 141  LEU B N   1 
ATOM   2955 C CA  . LEU B 1 141 ? 49.841  12.247  65.849 1.00 27.25 ? 141  LEU B CA  1 
ATOM   2956 C C   . LEU B 1 141 ? 48.732  11.249  66.150 1.00 23.63 ? 141  LEU B C   1 
ATOM   2957 O O   . LEU B 1 141 ? 47.991  10.856  65.255 1.00 26.72 ? 141  LEU B O   1 
ATOM   2958 C CB  . LEU B 1 141 ? 51.200  11.532  65.917 1.00 25.56 ? 141  LEU B CB  1 
ATOM   2959 C CG  . LEU B 1 141 ? 51.385  10.305  65.012 1.00 25.23 ? 141  LEU B CG  1 
ATOM   2960 C CD1 . LEU B 1 141 ? 51.297  10.701  63.548 1.00 20.11 ? 141  LEU B CD1 1 
ATOM   2961 C CD2 . LEU B 1 141 ? 52.719  9.652   65.296 1.00 18.77 ? 141  LEU B CD2 1 
ATOM   2962 N N   . GLY B 1 142 ? 48.608  10.863  67.417 1.00 25.95 ? 142  GLY B N   1 
ATOM   2963 C CA  . GLY B 1 142 ? 47.590  9.901   67.808 1.00 24.66 ? 142  GLY B CA  1 
ATOM   2964 C C   . GLY B 1 142 ? 47.825  8.538   67.189 1.00 32.19 ? 142  GLY B C   1 
ATOM   2965 O O   . GLY B 1 142 ? 48.957  8.059   67.143 1.00 39.04 ? 142  GLY B O   1 
ATOM   2966 N N   . SER B 1 143 ? 46.760  7.911   66.704 1.00 31.34 ? 143  SER B N   1 
ATOM   2967 C CA  . SER B 1 143 ? 46.895  6.613   66.043 1.00 38.13 ? 143  SER B CA  1 
ATOM   2968 C C   . SER B 1 143 ? 47.031  6.764   64.525 1.00 39.26 ? 143  SER B C   1 
ATOM   2969 O O   . SER B 1 143 ? 46.966  5.775   63.783 1.00 40.67 ? 143  SER B O   1 
ATOM   2970 C CB  . SER B 1 143 ? 45.711  5.688   66.388 1.00 40.26 ? 143  SER B CB  1 
ATOM   2971 O OG  . SER B 1 143 ? 46.069  4.758   67.408 1.00 46.37 ? 143  SER B OG  1 
ATOM   2972 N N   . ARG B 1 144 ? 47.317  7.991   64.086 1.00 35.47 ? 144  ARG B N   1 
ATOM   2973 C CA  . ARG B 1 144 ? 47.506  8.300   62.669 1.00 38.75 ? 144  ARG B CA  1 
ATOM   2974 C C   . ARG B 1 144 ? 48.778  7.681   62.081 1.00 39.20 ? 144  ARG B C   1 
ATOM   2975 O O   . ARG B 1 144 ? 49.735  7.396   62.804 1.00 46.42 ? 144  ARG B O   1 
ATOM   2976 C CB  . ARG B 1 144 ? 47.534  9.818   62.459 1.00 39.76 ? 144  ARG B CB  1 
ATOM   2977 C CG  . ARG B 1 144 ? 46.165  10.447  62.253 1.00 49.04 ? 144  ARG B CG  1 
ATOM   2978 C CD  . ARG B 1 144 ? 46.268  11.937  61.942 1.00 54.86 ? 144  ARG B CD  1 
ATOM   2979 N NE  . ARG B 1 144 ? 46.189  12.770  63.143 1.00 58.03 ? 144  ARG B NE  1 
ATOM   2980 C CZ  . ARG B 1 144 ? 45.052  13.166  63.720 1.00 60.91 ? 144  ARG B CZ  1 
ATOM   2981 N NH1 . ARG B 1 144 ? 43.874  12.800  63.222 1.00 60.07 ? 144  ARG B NH1 1 
ATOM   2982 N NH2 . ARG B 1 144 ? 45.092  13.926  64.809 1.00 57.56 ? 144  ARG B NH2 1 
ATOM   2983 N N   . SER B 1 145 ? 48.730  7.382   60.782 1.00 37.51 ? 145  SER B N   1 
ATOM   2984 C CA  . SER B 1 145 ? 49.900  6.923   60.032 1.00 33.38 ? 145  SER B CA  1 
ATOM   2985 C C   . SER B 1 145 ? 50.894  8.073   59.924 1.00 36.58 ? 145  SER B C   1 
ATOM   2986 O O   . SER B 1 145 ? 52.043  7.974   60.355 1.00 40.06 ? 145  SER B O   1 
ATOM   2987 C CB  . SER B 1 145 ? 49.488  6.488   58.618 1.00 29.67 ? 145  SER B CB  1 
ATOM   2988 O OG  . SER B 1 145 ? 49.235  5.099   58.548 1.00 23.37 ? 145  SER B OG  1 
ATOM   2989 N N   . TRP B 1 146 ? 50.425  9.176   59.353 1.00 33.43 ? 146  TRP B N   1 
ATOM   2990 C CA  . TRP B 1 146 ? 51.258  10.345  59.126 1.00 25.80 ? 146  TRP B CA  1 
ATOM   2991 C C   . TRP B 1 146 ? 50.723  11.530  59.926 1.00 21.79 ? 146  TRP B C   1 
ATOM   2992 O O   . TRP B 1 146 ? 49.680  11.428  60.566 1.00 25.63 ? 146  TRP B O   1 
ATOM   2993 C CB  . TRP B 1 146 ? 51.304  10.656  57.623 1.00 18.26 ? 146  TRP B CB  1 
ATOM   2994 C CG  . TRP B 1 146 ? 51.786  9.485   56.800 1.00 13.18 ? 146  TRP B CG  1 
ATOM   2995 C CD1 . TRP B 1 146 ? 51.068  8.784   55.873 1.00 17.67 ? 146  TRP B CD1 1 
ATOM   2996 C CD2 . TRP B 1 146 ? 53.048  8.808   56.920 1.00 12.18 ? 146  TRP B CD2 1 
ATOM   2997 N NE1 . TRP B 1 146 ? 51.796  7.710   55.421 1.00 14.36 ? 146  TRP B NE1 1 
ATOM   2998 C CE2 . TRP B 1 146 ? 53.013  7.698   56.051 1.00 10.35 ? 146  TRP B CE2 1 
ATOM   2999 C CE3 . TRP B 1 146 ? 54.203  9.027   57.687 1.00 12.03 ? 146  TRP B CE3 1 
ATOM   3000 C CZ2 . TRP B 1 146 ? 54.084  6.809   55.929 1.00 8.14  ? 146  TRP B CZ2 1 
ATOM   3001 C CZ3 . TRP B 1 146 ? 55.264  8.145   57.564 1.00 7.23  ? 146  TRP B CZ3 1 
ATOM   3002 C CH2 . TRP B 1 146 ? 55.197  7.049   56.692 1.00 11.85 ? 146  TRP B CH2 1 
ATOM   3003 N N   . PHE B 1 147 ? 51.451  12.642  59.911 1.00 26.31 ? 147  PHE B N   1 
ATOM   3004 C CA  . PHE B 1 147 ? 51.163  13.765  60.807 1.00 23.48 ? 147  PHE B CA  1 
ATOM   3005 C C   . PHE B 1 147 ? 49.975  14.638  60.396 1.00 21.41 ? 147  PHE B C   1 
ATOM   3006 O O   . PHE B 1 147 ? 49.312  15.221  61.252 1.00 35.03 ? 147  PHE B O   1 
ATOM   3007 C CB  . PHE B 1 147 ? 52.411  14.639  60.988 1.00 23.80 ? 147  PHE B CB  1 
ATOM   3008 C CG  . PHE B 1 147 ? 53.209  14.314  62.229 1.00 28.85 ? 147  PHE B CG  1 
ATOM   3009 C CD1 . PHE B 1 147 ? 52.883  14.891  63.455 1.00 29.49 ? 147  PHE B CD1 1 
ATOM   3010 C CD2 . PHE B 1 147 ? 54.276  13.428  62.174 1.00 19.26 ? 147  PHE B CD2 1 
ATOM   3011 C CE1 . PHE B 1 147 ? 53.608  14.590  64.603 1.00 23.29 ? 147  PHE B CE1 1 
ATOM   3012 C CE2 . PHE B 1 147 ? 54.997  13.124  63.313 1.00 14.42 ? 147  PHE B CE2 1 
ATOM   3013 C CZ  . PHE B 1 147 ? 54.664  13.709  64.531 1.00 19.64 ? 147  PHE B CZ  1 
ATOM   3014 N N   . VAL B 1 148 ? 49.687  14.703  59.100 1.00 23.61 ? 148  VAL B N   1 
ATOM   3015 C CA  . VAL B 1 148 ? 48.577  15.514  58.590 1.00 22.79 ? 148  VAL B CA  1 
ATOM   3016 C C   . VAL B 1 148 ? 47.331  14.675  58.256 1.00 25.72 ? 148  VAL B C   1 
ATOM   3017 O O   . VAL B 1 148 ? 46.273  15.214  57.946 1.00 26.71 ? 148  VAL B O   1 
ATOM   3018 C CB  . VAL B 1 148 ? 49.005  16.297  57.325 1.00 21.58 ? 148  VAL B CB  1 
ATOM   3019 C CG1 . VAL B 1 148 ? 49.161  15.346  56.158 1.00 40.89 ? 148  VAL B CG1 1 
ATOM   3020 C CG2 . VAL B 1 148 ? 47.991  17.349  56.985 1.00 22.45 ? 148  VAL B CG2 1 
ATOM   3021 N N   . GLY B 1 149 ? 47.475  13.354  58.282 1.00 31.13 ? 149  GLY B N   1 
ATOM   3022 C CA  . GLY B 1 149 ? 46.358  12.480  57.980 1.00 26.60 ? 149  GLY B CA  1 
ATOM   3023 C C   . GLY B 1 149 ? 46.786  11.152  57.378 1.00 33.77 ? 149  GLY B C   1 
ATOM   3024 O O   . GLY B 1 149 ? 47.587  10.420  57.960 1.00 36.01 ? 149  GLY B O   1 
ATOM   3025 N N   . ASP B 1 150 ? 46.232  10.834  56.213 1.00 39.57 ? 150  ASP B N   1 
ATOM   3026 C CA  . ASP B 1 150 ? 46.507  9.561   55.561 1.00 40.50 ? 150  ASP B CA  1 
ATOM   3027 C C   . ASP B 1 150 ? 47.623  9.720   54.545 1.00 41.05 ? 150  ASP B C   1 
ATOM   3028 O O   . ASP B 1 150 ? 48.288  8.751   54.186 1.00 42.85 ? 150  ASP B O   1 
ATOM   3029 C CB  . ASP B 1 150 ? 45.251  9.046   54.869 1.00 44.25 ? 150  ASP B CB  1 
ATOM   3030 C CG  . ASP B 1 150 ? 44.035  9.105   55.762 1.00 47.76 ? 150  ASP B CG  1 
ATOM   3031 O OD1 . ASP B 1 150 ? 43.895  8.207   56.621 1.00 44.93 ? 150  ASP B OD1 1 
ATOM   3032 O OD2 . ASP B 1 150 ? 43.245  10.072  55.620 1.00 53.52 ? 150  ASP B OD2 1 
ATOM   3033 N N   . LYS B 1 151 ? 47.819  10.956  54.096 1.00 44.05 ? 151  LYS B N   1 
ATOM   3034 C CA  . LYS B 1 151 ? 48.810  11.269  53.079 1.00 48.94 ? 151  LYS B CA  1 
ATOM   3035 C C   . LYS B 1 151 ? 50.124  11.699  53.733 1.00 39.19 ? 151  LYS B C   1 
ATOM   3036 O O   . LYS B 1 151 ? 50.124  12.454  54.708 1.00 40.83 ? 151  LYS B O   1 
ATOM   3037 C CB  . LYS B 1 151 ? 48.279  12.395  52.173 1.00 53.25 ? 151  LYS B CB  1 
ATOM   3038 C CG  . LYS B 1 151 ? 48.405  12.126  50.660 1.00 61.25 ? 151  LYS B CG  1 
ATOM   3039 C CD  . LYS B 1 151 ? 49.553  12.926  50.011 1.00 61.01 ? 151  LYS B CD  1 
ATOM   3040 C CE  . LYS B 1 151 ? 50.336  12.093  48.973 1.00 62.41 ? 151  LYS B CE  1 
ATOM   3041 N NZ  . LYS B 1 151 ? 51.306  11.098  49.568 1.00 60.60 ? 151  LYS B NZ  1 
ATOM   3042 N N   . LEU B 1 152 ? 51.231  11.167  53.225 1.00 35.49 ? 152  LEU B N   1 
ATOM   3043 C CA  . LEU B 1 152 ? 52.551  11.722  53.493 1.00 28.97 ? 152  LEU B CA  1 
ATOM   3044 C C   . LEU B 1 152 ? 52.655  13.136  52.918 1.00 22.07 ? 152  LEU B C   1 
ATOM   3045 O O   . LEU B 1 152 ? 52.229  13.397  51.799 1.00 19.57 ? 152  LEU B O   1 
ATOM   3046 C CB  . LEU B 1 152 ? 53.615  10.822  52.867 1.00 25.43 ? 152  LEU B CB  1 
ATOM   3047 C CG  . LEU B 1 152 ? 55.089  11.153  53.076 1.00 20.69 ? 152  LEU B CG  1 
ATOM   3048 C CD1 . LEU B 1 152 ? 55.397  11.339  54.543 1.00 15.63 ? 152  LEU B CD1 1 
ATOM   3049 C CD2 . LEU B 1 152 ? 55.910  10.032  52.492 1.00 18.57 ? 152  LEU B CD2 1 
ATOM   3050 N N   . THR B 1 153 ? 53.129  14.064  53.735 1.00 23.69 ? 153  THR B N   1 
ATOM   3051 C CA  . THR B 1 153 ? 53.378  15.432  53.300 1.00 27.33 ? 153  THR B CA  1 
ATOM   3052 C C   . THR B 1 153 ? 54.777  15.862  53.734 1.00 18.13 ? 153  THR B C   1 
ATOM   3053 O O   . THR B 1 153 ? 55.444  15.151  54.481 1.00 20.85 ? 153  THR B O   1 
ATOM   3054 C CB  . THR B 1 153 ? 52.344  16.405  53.901 1.00 26.29 ? 153  THR B CB  1 
ATOM   3055 O OG1 . THR B 1 153 ? 52.264  16.207  55.319 1.00 25.60 ? 153  THR B OG1 1 
ATOM   3056 C CG2 . THR B 1 153 ? 50.982  16.174  53.279 1.00 24.22 ? 153  THR B CG2 1 
ATOM   3057 N N   . PHE B 1 154 ? 55.200  17.043  53.302 1.00 12.77 ? 154  PHE B N   1 
ATOM   3058 C CA  . PHE B 1 154 ? 56.544  17.502  53.591 1.00 12.44 ? 154  PHE B CA  1 
ATOM   3059 C C   . PHE B 1 154 ? 56.773  17.749  55.087 1.00 10.73 ? 154  PHE B C   1 
ATOM   3060 O O   . PHE B 1 154 ? 57.912  17.732  55.541 1.00 30.46 ? 154  PHE B O   1 
ATOM   3061 C CB  . PHE B 1 154 ? 56.852  18.762  52.785 1.00 10.21 ? 154  PHE B CB  1 
ATOM   3062 C CG  . PHE B 1 154 ? 56.204  19.996  53.328 1.00 8.70  ? 154  PHE B CG  1 
ATOM   3063 C CD1 . PHE B 1 154 ? 54.931  20.361  52.917 1.00 9.34  ? 154  PHE B CD1 1 
ATOM   3064 C CD2 . PHE B 1 154 ? 56.854  20.778  54.286 1.00 2.56  ? 154  PHE B CD2 1 
ATOM   3065 C CE1 . PHE B 1 154 ? 54.314  21.493  53.455 1.00 6.98  ? 154  PHE B CE1 1 
ATOM   3066 C CE2 . PHE B 1 154 ? 56.250  21.903  54.832 1.00 2.00  ? 154  PHE B CE2 1 
ATOM   3067 C CZ  . PHE B 1 154 ? 54.976  22.264  54.416 1.00 2.77  ? 154  PHE B CZ  1 
ATOM   3068 N N   . VAL B 1 155 ? 55.700  17.935  55.859 1.00 14.70 ? 155  VAL B N   1 
ATOM   3069 C CA  . VAL B 1 155 ? 55.849  18.195  57.300 1.00 15.89 ? 155  VAL B CA  1 
ATOM   3070 C C   . VAL B 1 155 ? 56.350  16.965  58.018 1.00 12.56 ? 155  VAL B C   1 
ATOM   3071 O O   . VAL B 1 155 ? 56.985  17.064  59.061 1.00 9.64  ? 155  VAL B O   1 
ATOM   3072 C CB  . VAL B 1 155 ? 54.531  18.652  58.027 1.00 17.72 ? 155  VAL B CB  1 
ATOM   3073 C CG1 . VAL B 1 155 ? 54.404  20.164  57.986 1.00 15.04 ? 155  VAL B CG1 1 
ATOM   3074 C CG2 . VAL B 1 155 ? 53.305  17.980  57.438 1.00 15.68 ? 155  VAL B CG2 1 
ATOM   3075 N N   . ASP B 1 156 ? 56.066  15.805  57.444 1.00 17.60 ? 156  ASP B N   1 
ATOM   3076 C CA  . ASP B 1 156 ? 56.537  14.544  57.983 1.00 20.03 ? 156  ASP B CA  1 
ATOM   3077 C C   . ASP B 1 156 ? 58.050  14.459  57.885 1.00 24.35 ? 156  ASP B C   1 
ATOM   3078 O O   . ASP B 1 156 ? 58.706  13.879  58.752 1.00 31.18 ? 156  ASP B O   1 
ATOM   3079 C CB  . ASP B 1 156 ? 55.900  13.388  57.219 1.00 22.99 ? 156  ASP B CB  1 
ATOM   3080 C CG  . ASP B 1 156 ? 54.418  13.287  57.462 1.00 25.57 ? 156  ASP B CG  1 
ATOM   3081 O OD1 . ASP B 1 156 ? 54.023  13.189  58.639 1.00 29.25 ? 156  ASP B OD1 1 
ATOM   3082 O OD2 . ASP B 1 156 ? 53.642  13.362  56.493 1.00 32.86 ? 156  ASP B OD2 1 
ATOM   3083 N N   . PHE B 1 157 ? 58.602  15.110  56.867 1.00 14.01 ? 157  PHE B N   1 
ATOM   3084 C CA  . PHE B 1 157 ? 60.039  15.119  56.666 1.00 15.63 ? 157  PHE B CA  1 
ATOM   3085 C C   . PHE B 1 157 ? 60.721  16.060  57.653 1.00 14.38 ? 157  PHE B C   1 
ATOM   3086 O O   . PHE B 1 157 ? 61.837  15.793  58.096 1.00 23.37 ? 157  PHE B O   1 
ATOM   3087 C CB  . PHE B 1 157 ? 60.368  15.506  55.222 1.00 10.27 ? 157  PHE B CB  1 
ATOM   3088 C CG  . PHE B 1 157 ? 59.965  14.465  54.200 1.00 11.17 ? 157  PHE B CG  1 
ATOM   3089 C CD1 . PHE B 1 157 ? 58.621  14.162  53.975 1.00 13.93 ? 157  PHE B CD1 1 
ATOM   3090 C CD2 . PHE B 1 157 ? 60.927  13.816  53.429 1.00 12.12 ? 157  PHE B CD2 1 
ATOM   3091 C CE1 . PHE B 1 157 ? 58.234  13.233  52.989 1.00 7.80  ? 157  PHE B CE1 1 
ATOM   3092 C CE2 . PHE B 1 157 ? 60.550  12.886  52.446 1.00 18.20 ? 157  PHE B CE2 1 
ATOM   3093 C CZ  . PHE B 1 157 ? 59.198  12.602  52.228 1.00 12.30 ? 157  PHE B CZ  1 
ATOM   3094 N N   . LEU B 1 158 ? 60.015  17.115  58.055 1.00 17.88 ? 158  LEU B N   1 
ATOM   3095 C CA  . LEU B 1 158 ? 60.501  18.015  59.104 1.00 14.87 ? 158  LEU B CA  1 
ATOM   3096 C C   . LEU B 1 158 ? 60.381  17.370  60.471 1.00 12.74 ? 158  LEU B C   1 
ATOM   3097 O O   . LEU B 1 158 ? 61.263  17.506  61.313 1.00 12.79 ? 158  LEU B O   1 
ATOM   3098 C CB  . LEU B 1 158 ? 59.708  19.320  59.108 1.00 13.83 ? 158  LEU B CB  1 
ATOM   3099 C CG  . LEU B 1 158 ? 59.836  20.182  57.854 1.00 16.29 ? 158  LEU B CG  1 
ATOM   3100 C CD1 . LEU B 1 158 ? 58.898  21.366  57.953 1.00 9.45  ? 158  LEU B CD1 1 
ATOM   3101 C CD2 . LEU B 1 158 ? 61.275  20.637  57.684 1.00 16.12 ? 158  LEU B CD2 1 
ATOM   3102 N N   . ALA B 1 159 ? 59.268  16.682  60.695 1.00 19.93 ? 159  ALA B N   1 
ATOM   3103 C CA  . ALA B 1 159 ? 59.033  16.025  61.977 1.00 28.25 ? 159  ALA B CA  1 
ATOM   3104 C C   . ALA B 1 159 ? 60.126  15.004  62.228 1.00 25.80 ? 159  ALA B C   1 
ATOM   3105 O O   . ALA B 1 159 ? 60.784  15.030  63.264 1.00 25.56 ? 159  ALA B O   1 
ATOM   3106 C CB  . ALA B 1 159 ? 57.668  15.350  61.983 1.00 25.08 ? 159  ALA B CB  1 
ATOM   3107 N N   . TYR B 1 160 ? 60.405  14.203  61.205 1.00 28.03 ? 160  TYR B N   1 
ATOM   3108 C CA  . TYR B 1 160 ? 61.424  13.166  61.289 1.00 32.85 ? 160  TYR B CA  1 
ATOM   3109 C C   . TYR B 1 160 ? 62.792  13.748  61.639 1.00 32.04 ? 160  TYR B C   1 
ATOM   3110 O O   . TYR B 1 160 ? 63.475  13.257  62.529 1.00 38.17 ? 160  TYR B O   1 
ATOM   3111 C CB  . TYR B 1 160 ? 61.506  12.418  59.962 1.00 28.84 ? 160  TYR B CB  1 
ATOM   3112 C CG  . TYR B 1 160 ? 62.680  11.478  59.873 1.00 31.68 ? 160  TYR B CG  1 
ATOM   3113 C CD1 . TYR B 1 160 ? 62.580  10.165  60.326 1.00 31.92 ? 160  TYR B CD1 1 
ATOM   3114 C CD2 . TYR B 1 160 ? 63.893  11.899  59.329 1.00 34.64 ? 160  TYR B CD2 1 
ATOM   3115 C CE1 . TYR B 1 160 ? 63.655  9.295   60.234 1.00 31.08 ? 160  TYR B CE1 1 
ATOM   3116 C CE2 . TYR B 1 160 ? 64.974  11.039  59.241 1.00 33.69 ? 160  TYR B CE2 1 
ATOM   3117 C CZ  . TYR B 1 160 ? 64.848  9.740   59.696 1.00 32.67 ? 160  TYR B CZ  1 
ATOM   3118 O OH  . TYR B 1 160 ? 65.929  8.896   59.634 1.00 40.49 ? 160  TYR B OH  1 
ATOM   3119 N N   . ASP B 1 161 ? 63.197  14.773  60.901 1.00 36.14 ? 161  ASP B N   1 
ATOM   3120 C CA  . ASP B 1 161 ? 64.482  15.425  61.113 1.00 29.44 ? 161  ASP B CA  1 
ATOM   3121 C C   . ASP B 1 161 ? 64.605  15.982  62.535 1.00 28.99 ? 161  ASP B C   1 
ATOM   3122 O O   . ASP B 1 161 ? 65.589  15.717  63.213 1.00 37.78 ? 161  ASP B O   1 
ATOM   3123 C CB  . ASP B 1 161 ? 64.670  16.536  60.074 1.00 33.29 ? 161  ASP B CB  1 
ATOM   3124 C CG  . ASP B 1 161 ? 66.012  17.231  60.181 1.00 38.75 ? 161  ASP B CG  1 
ATOM   3125 O OD1 . ASP B 1 161 ? 67.012  16.607  60.605 1.00 42.24 ? 161  ASP B OD1 1 
ATOM   3126 O OD2 . ASP B 1 161 ? 66.081  18.407  59.776 1.00 38.52 ? 161  ASP B OD2 1 
ATOM   3127 N N   . VAL B 1 162 ? 63.575  16.685  63.005 1.00 28.22 ? 162  VAL B N   1 
ATOM   3128 C CA  . VAL B 1 162 ? 63.565  17.247  64.361 1.00 24.37 ? 162  VAL B CA  1 
ATOM   3129 C C   . VAL B 1 162 ? 63.604  16.147  65.426 1.00 31.54 ? 162  VAL B C   1 
ATOM   3130 O O   . VAL B 1 162 ? 64.378  16.225  66.379 1.00 31.85 ? 162  VAL B O   1 
ATOM   3131 C CB  . VAL B 1 162 ? 62.316  18.155  64.583 1.00 20.93 ? 162  VAL B CB  1 
ATOM   3132 C CG1 . VAL B 1 162 ? 61.870  18.137  66.038 1.00 21.57 ? 162  VAL B CG1 1 
ATOM   3133 C CG2 . VAL B 1 162 ? 62.640  19.571  64.179 1.00 22.71 ? 162  VAL B CG2 1 
ATOM   3134 N N   . LEU B 1 163 ? 62.798  15.108  65.220 1.00 31.28 ? 163  LEU B N   1 
ATOM   3135 C CA  . LEU B 1 163 ? 62.728  13.967  66.120 1.00 31.11 ? 163  LEU B CA  1 
ATOM   3136 C C   . LEU B 1 163 ? 64.038  13.203  66.146 1.00 28.27 ? 163  LEU B C   1 
ATOM   3137 O O   . LEU B 1 163 ? 64.466  12.714  67.191 1.00 27.14 ? 163  LEU B O   1 
ATOM   3138 C CB  . LEU B 1 163 ? 61.608  13.027  65.671 1.00 36.38 ? 163  LEU B CB  1 
ATOM   3139 C CG  . LEU B 1 163 ? 60.200  13.445  66.099 1.00 39.09 ? 163  LEU B CG  1 
ATOM   3140 C CD1 . LEU B 1 163 ? 59.164  12.456  65.581 1.00 33.99 ? 163  LEU B CD1 1 
ATOM   3141 C CD2 . LEU B 1 163 ? 60.156  13.523  67.612 1.00 35.69 ? 163  LEU B CD2 1 
ATOM   3142 N N   . ASP B 1 164 ? 64.669  13.108  64.982 1.00 32.38 ? 164  ASP B N   1 
ATOM   3143 C CA  . ASP B 1 164 ? 65.909  12.364  64.839 1.00 30.71 ? 164  ASP B CA  1 
ATOM   3144 C C   . ASP B 1 164 ? 67.042  13.035  65.609 1.00 26.14 ? 164  ASP B C   1 
ATOM   3145 O O   . ASP B 1 164 ? 67.845  12.361  66.251 1.00 25.10 ? 164  ASP B O   1 
ATOM   3146 C CB  . ASP B 1 164 ? 66.286  12.244  63.371 1.00 31.25 ? 164  ASP B CB  1 
ATOM   3147 C CG  . ASP B 1 164 ? 67.419  11.291  63.156 1.00 38.77 ? 164  ASP B CG  1 
ATOM   3148 O OD1 . ASP B 1 164 ? 68.582  11.722  63.272 1.00 45.52 ? 164  ASP B OD1 1 
ATOM   3149 O OD2 . ASP B 1 164 ? 67.145  10.089  62.970 1.00 41.13 ? 164  ASP B OD2 1 
ATOM   3150 N N   . GLN B 1 165 ? 67.053  14.364  65.597 1.00 21.04 ? 165  GLN B N   1 
ATOM   3151 C CA  . GLN B 1 165 ? 68.022  15.140  66.364 1.00 15.20 ? 165  GLN B CA  1 
ATOM   3152 C C   . GLN B 1 165 ? 67.852  14.959  67.867 1.00 18.02 ? 165  GLN B C   1 
ATOM   3153 O O   . GLN B 1 165 ? 68.829  14.984  68.604 1.00 25.49 ? 165  GLN B O   1 
ATOM   3154 C CB  . GLN B 1 165 ? 67.924  16.634  66.031 1.00 14.85 ? 165  GLN B CB  1 
ATOM   3155 C CG  . GLN B 1 165 ? 68.056  16.973  64.561 1.00 11.50 ? 165  GLN B CG  1 
ATOM   3156 C CD  . GLN B 1 165 ? 67.941  18.463  64.281 1.00 15.36 ? 165  GLN B CD  1 
ATOM   3157 O OE1 . GLN B 1 165 ? 67.775  19.281  65.195 1.00 14.54 ? 165  GLN B OE1 1 
ATOM   3158 N NE2 . GLN B 1 165 ? 68.071  18.828  63.010 1.00 21.81 ? 165  GLN B NE2 1 
ATOM   3159 N N   . GLN B 1 166 ? 66.616  14.817  68.331 1.00 23.13 ? 166  GLN B N   1 
ATOM   3160 C CA  . GLN B 1 166 ? 66.376  14.603  69.751 1.00 26.78 ? 166  GLN B CA  1 
ATOM   3161 C C   . GLN B 1 166 ? 66.716  13.186  70.167 1.00 29.12 ? 166  GLN B C   1 
ATOM   3162 O O   . GLN B 1 166 ? 67.245  12.975  71.253 1.00 36.17 ? 166  GLN B O   1 
ATOM   3163 C CB  . GLN B 1 166 ? 64.928  14.926  70.095 1.00 28.68 ? 166  GLN B CB  1 
ATOM   3164 C CG  . GLN B 1 166 ? 64.619  16.409  70.011 1.00 30.20 ? 166  GLN B CG  1 
ATOM   3165 C CD  . GLN B 1 166 ? 65.573  17.237  70.839 1.00 32.51 ? 166  GLN B CD  1 
ATOM   3166 O OE1 . GLN B 1 166 ? 65.491  17.252  72.067 1.00 37.00 ? 166  GLN B OE1 1 
ATOM   3167 N NE2 . GLN B 1 166 ? 66.515  17.899  70.176 1.00 41.58 ? 166  GLN B NE2 1 
ATOM   3168 N N   . ARG B 1 167 ? 66.518  12.235  69.255 1.00 25.12 ? 167  ARG B N   1 
ATOM   3169 C CA  . ARG B 1 167 ? 66.827  10.830  69.511 1.00 24.92 ? 167  ARG B CA  1 
ATOM   3170 C C   . ARG B 1 167 ? 68.335  10.599  69.565 1.00 31.84 ? 167  ARG B C   1 
ATOM   3171 O O   . ARG B 1 167 ? 68.813  9.680   70.230 1.00 33.73 ? 167  ARG B O   1 
ATOM   3172 C CB  . ARG B 1 167 ? 66.227  9.948   68.419 1.00 19.41 ? 167  ARG B CB  1 
ATOM   3173 C CG  . ARG B 1 167 ? 66.165  8.481   68.799 1.00 13.21 ? 167  ARG B CG  1 
ATOM   3174 C CD  . ARG B 1 167 ? 66.625  7.570   67.676 1.00 23.67 ? 167  ARG B CD  1 
ATOM   3175 N NE  . ARG B 1 167 ? 66.364  8.100   66.338 1.00 21.44 ? 167  ARG B NE  1 
ATOM   3176 C CZ  . ARG B 1 167 ? 66.135  7.342   65.270 1.00 20.72 ? 167  ARG B CZ  1 
ATOM   3177 N NH1 . ARG B 1 167 ? 65.929  6.043   65.412 1.00 21.89 ? 167  ARG B NH1 1 
ATOM   3178 N NH2 . ARG B 1 167 ? 66.044  7.891   64.067 1.00 16.57 ? 167  ARG B NH2 1 
ATOM   3179 N N   . MET B 1 168 ? 69.065  11.398  68.792 1.00 32.57 ? 168  MET B N   1 
ATOM   3180 C CA  . MET B 1 168 ? 70.518  11.348  68.750 1.00 27.28 ? 168  MET B CA  1 
ATOM   3181 C C   . MET B 1 168 ? 71.076  11.983  70.020 1.00 28.82 ? 168  MET B C   1 
ATOM   3182 O O   . MET B 1 168 ? 72.127  11.582  70.521 1.00 35.24 ? 168  MET B O   1 
ATOM   3183 C CB  . MET B 1 168 ? 71.014  12.111  67.519 1.00 29.87 ? 168  MET B CB  1 
ATOM   3184 C CG  . MET B 1 168 ? 72.148  11.445  66.780 1.00 36.60 ? 168  MET B CG  1 
ATOM   3185 S SD  . MET B 1 168 ? 71.778  11.146  65.052 1.00 42.77 ? 168  MET B SD  1 
ATOM   3186 C CE  . MET B 1 168 ? 70.983  9.532   65.142 1.00 39.81 ? 168  MET B CE  1 
ATOM   3187 N N   . PHE B 1 169 ? 70.338  12.947  70.559 1.00 26.94 ? 169  PHE B N   1 
ATOM   3188 C CA  . PHE B 1 169 ? 70.756  13.667  71.756 1.00 31.80 ? 169  PHE B CA  1 
ATOM   3189 C C   . PHE B 1 169 ? 70.553  12.833  73.016 1.00 38.09 ? 169  PHE B C   1 
ATOM   3190 O O   . PHE B 1 169 ? 71.502  12.608  73.764 1.00 48.42 ? 169  PHE B O   1 
ATOM   3191 C CB  . PHE B 1 169 ? 69.982  14.979  71.876 1.00 35.76 ? 169  PHE B CB  1 
ATOM   3192 C CG  . PHE B 1 169 ? 70.434  15.849  73.010 1.00 44.89 ? 169  PHE B CG  1 
ATOM   3193 C CD1 . PHE B 1 169 ? 71.527  16.692  72.863 1.00 51.08 ? 169  PHE B CD1 1 
ATOM   3194 C CD2 . PHE B 1 169 ? 69.737  15.868  74.211 1.00 49.07 ? 169  PHE B CD2 1 
ATOM   3195 C CE1 . PHE B 1 169 ? 71.916  17.552  73.900 1.00 54.61 ? 169  PHE B CE1 1 
ATOM   3196 C CE2 . PHE B 1 169 ? 70.120  16.722  75.252 1.00 53.66 ? 169  PHE B CE2 1 
ATOM   3197 C CZ  . PHE B 1 169 ? 71.209  17.564  75.096 1.00 52.82 ? 169  PHE B CZ  1 
ATOM   3198 N N   . VAL B 1 170 ? 69.307  12.442  73.282 1.00 34.03 ? 170  VAL B N   1 
ATOM   3199 C CA  . VAL B 1 170 ? 68.978  11.606  74.435 1.00 29.34 ? 170  VAL B CA  1 
ATOM   3200 C C   . VAL B 1 170 ? 68.175  10.389  74.005 1.00 32.49 ? 170  VAL B C   1 
ATOM   3201 O O   . VAL B 1 170 ? 66.950  10.388  74.063 1.00 33.95 ? 170  VAL B O   1 
ATOM   3202 C CB  . VAL B 1 170 ? 68.162  12.374  75.507 1.00 31.38 ? 170  VAL B CB  1 
ATOM   3203 C CG1 . VAL B 1 170 ? 69.098  13.126  76.438 1.00 36.20 ? 170  VAL B CG1 1 
ATOM   3204 C CG2 . VAL B 1 170 ? 67.171  13.326  74.844 1.00 36.41 ? 170  VAL B CG2 1 
ATOM   3205 N N   . PRO B 1 171 ? 68.866  9.310   73.623 1.00 33.43 ? 171  PRO B N   1 
ATOM   3206 C CA  . PRO B 1 171 ? 68.234  8.183   72.934 1.00 37.66 ? 171  PRO B CA  1 
ATOM   3207 C C   . PRO B 1 171 ? 67.396  7.333   73.878 1.00 43.84 ? 171  PRO B C   1 
ATOM   3208 O O   . PRO B 1 171 ? 66.553  6.549   73.437 1.00 46.30 ? 171  PRO B O   1 
ATOM   3209 C CB  . PRO B 1 171 ? 69.420  7.411   72.374 1.00 39.54 ? 171  PRO B CB  1 
ATOM   3210 C CG  . PRO B 1 171 ? 70.524  7.681   73.355 1.00 39.32 ? 171  PRO B CG  1 
ATOM   3211 C CD  . PRO B 1 171 ? 70.277  9.040   73.952 1.00 33.58 ? 171  PRO B CD  1 
ATOM   3212 N N   . ASP B 1 172 ? 67.608  7.535   75.178 1.00 50.27 ? 172  ASP B N   1 
ATOM   3213 C CA  . ASP B 1 172 ? 66.950  6.744   76.215 1.00 55.82 ? 172  ASP B CA  1 
ATOM   3214 C C   . ASP B 1 172 ? 65.658  7.376   76.732 1.00 54.25 ? 172  ASP B C   1 
ATOM   3215 O O   . ASP B 1 172 ? 65.021  6.835   77.638 1.00 57.58 ? 172  ASP B O   1 
ATOM   3216 C CB  . ASP B 1 172 ? 67.907  6.507   77.394 1.00 58.21 ? 172  ASP B CB  1 
ATOM   3217 C CG  . ASP B 1 172 ? 68.458  7.804   77.982 1.00 63.70 ? 172  ASP B CG  1 
ATOM   3218 O OD1 . ASP B 1 172 ? 67.676  8.743   78.266 1.00 62.92 ? 172  ASP B OD1 1 
ATOM   3219 O OD2 . ASP B 1 172 ? 69.688  7.870   78.182 1.00 65.41 ? 172  ASP B OD2 1 
ATOM   3220 N N   . CYS B 1 173 ? 65.322  8.556   76.216 1.00 52.73 ? 173  CYS B N   1 
ATOM   3221 C CA  . CYS B 1 173 ? 64.131  9.264   76.665 1.00 51.52 ? 173  CYS B CA  1 
ATOM   3222 C C   . CYS B 1 173 ? 62.885  8.434   76.378 1.00 49.59 ? 173  CYS B C   1 
ATOM   3223 O O   . CYS B 1 173 ? 62.617  8.070   75.231 1.00 45.68 ? 173  CYS B O   1 
ATOM   3224 C CB  . CYS B 1 173 ? 64.018  10.625  75.979 1.00 50.77 ? 173  CYS B CB  1 
ATOM   3225 S SG  . CYS B 1 173 ? 63.116  11.850  76.944 1.00 54.15 ? 173  CYS B SG  1 
ATOM   3226 N N   . PRO B 1 174 ? 62.171  8.025   77.443 1.00 45.94 ? 174  PRO B N   1 
ATOM   3227 C CA  . PRO B 1 174 ? 61.045  7.087   77.318 1.00 40.49 ? 174  PRO B CA  1 
ATOM   3228 C C   . PRO B 1 174 ? 59.839  7.667   76.576 1.00 35.93 ? 174  PRO B C   1 
ATOM   3229 O O   . PRO B 1 174 ? 59.037  6.921   76.016 1.00 34.88 ? 174  PRO B O   1 
ATOM   3230 C CB  . PRO B 1 174 ? 60.714  6.728   78.766 1.00 42.23 ? 174  PRO B CB  1 
ATOM   3231 C CG  . PRO B 1 174 ? 61.214  7.910   79.562 1.00 44.43 ? 174  PRO B CG  1 
ATOM   3232 C CD  . PRO B 1 174 ? 62.453  8.368   78.850 1.00 40.41 ? 174  PRO B CD  1 
ATOM   3233 N N   . GLU B 1 175 ? 59.763  8.996   76.516 1.00 32.82 ? 175  GLU B N   1 
ATOM   3234 C CA  . GLU B 1 175 ? 58.699  9.687   75.800 1.00 30.96 ? 175  GLU B CA  1 
ATOM   3235 C C   . GLU B 1 175 ? 58.908  9.590   74.296 1.00 32.98 ? 175  GLU B C   1 
ATOM   3236 O O   . GLU B 1 175 ? 58.046  9.987   73.515 1.00 36.65 ? 175  GLU B O   1 
ATOM   3237 C CB  . GLU B 1 175 ? 58.649  11.158  76.217 1.00 31.83 ? 175  GLU B CB  1 
ATOM   3238 C CG  . GLU B 1 175 ? 58.649  11.393  77.729 1.00 41.45 ? 175  GLU B CG  1 
ATOM   3239 C CD  . GLU B 1 175 ? 57.302  11.120  78.414 1.00 41.78 ? 175  GLU B CD  1 
ATOM   3240 O OE1 . GLU B 1 175 ? 56.363  10.597  77.766 1.00 37.23 ? 175  GLU B OE1 1 
ATOM   3241 O OE2 . GLU B 1 175 ? 57.197  11.404  79.627 1.00 40.18 ? 175  GLU B OE2 1 
ATOM   3242 N N   . LEU B 1 176 ? 60.063  9.068   73.895 1.00 31.20 ? 176  LEU B N   1 
ATOM   3243 C CA  . LEU B 1 176 ? 60.325  8.819   72.485 1.00 36.52 ? 176  LEU B CA  1 
ATOM   3244 C C   . LEU B 1 176 ? 59.939  7.412   72.070 1.00 39.34 ? 176  LEU B C   1 
ATOM   3245 O O   . LEU B 1 176 ? 59.894  7.107   70.875 1.00 39.01 ? 176  LEU B O   1 
ATOM   3246 C CB  . LEU B 1 176 ? 61.793  9.088   72.148 1.00 40.73 ? 176  LEU B CB  1 
ATOM   3247 C CG  . LEU B 1 176 ? 61.978  10.303  71.236 1.00 34.96 ? 176  LEU B CG  1 
ATOM   3248 C CD1 . LEU B 1 176 ? 63.366  10.899  71.425 1.00 32.91 ? 176  LEU B CD1 1 
ATOM   3249 C CD2 . LEU B 1 176 ? 61.726  9.893   69.794 1.00 29.99 ? 176  LEU B CD2 1 
ATOM   3250 N N   . GLN B 1 177 ? 59.691  6.550   73.057 1.00 43.99 ? 177  GLN B N   1 
ATOM   3251 C CA  . GLN B 1 177 ? 59.093  5.241   72.799 1.00 55.17 ? 177  GLN B CA  1 
ATOM   3252 C C   . GLN B 1 177 ? 57.579  5.398   72.714 1.00 53.85 ? 177  GLN B C   1 
ATOM   3253 O O   . GLN B 1 177 ? 56.995  6.249   73.392 1.00 59.51 ? 177  GLN B O   1 
ATOM   3254 C CB  . GLN B 1 177 ? 59.467  4.241   73.907 1.00 61.46 ? 177  GLN B CB  1 
ATOM   3255 C CG  . GLN B 1 177 ? 58.517  3.031   74.062 1.00 70.66 ? 177  GLN B CG  1 
ATOM   3256 C CD  . GLN B 1 177 ? 58.727  1.933   73.018 1.00 74.07 ? 177  GLN B CD  1 
ATOM   3257 O OE1 . GLN B 1 177 ? 58.677  2.189   71.811 1.00 73.67 ? 177  GLN B OE1 1 
ATOM   3258 N NE2 . GLN B 1 177 ? 58.851  0.689   73.482 1.00 73.22 ? 177  GLN B NE2 1 
ATOM   3259 N N   . GLY B 1 178 ? 56.964  4.606   71.841 1.00 44.09 ? 178  GLY B N   1 
ATOM   3260 C CA  . GLY B 1 178 ? 55.543  4.738   71.591 1.00 38.34 ? 178  GLY B CA  1 
ATOM   3261 C C   . GLY B 1 178 ? 55.274  5.017   70.127 1.00 40.05 ? 178  GLY B C   1 
ATOM   3262 O O   . GLY B 1 178 ? 56.038  4.590   69.261 1.00 42.46 ? 178  GLY B O   1 
ATOM   3263 N N   . ASN B 1 179 ? 54.203  5.755   69.843 1.00 41.55 ? 179  ASN B N   1 
ATOM   3264 C CA  . ASN B 1 179 ? 53.836  6.061   68.463 1.00 39.08 ? 179  ASN B CA  1 
ATOM   3265 C C   . ASN B 1 179 ? 54.867  6.957   67.768 1.00 36.94 ? 179  ASN B C   1 
ATOM   3266 O O   . ASN B 1 179 ? 55.014  6.894   66.550 1.00 38.15 ? 179  ASN B O   1 
ATOM   3267 C CB  . ASN B 1 179 ? 52.433  6.696   68.399 1.00 35.59 ? 179  ASN B CB  1 
ATOM   3268 C CG  . ASN B 1 179 ? 52.327  7.985   69.209 1.00 36.22 ? 179  ASN B CG  1 
ATOM   3269 O OD1 . ASN B 1 179 ? 53.106  8.217   70.132 1.00 43.85 ? 179  ASN B OD1 1 
ATOM   3270 N ND2 . ASN B 1 179 ? 51.354  8.825   68.868 1.00 28.35 ? 179  ASN B ND2 1 
ATOM   3271 N N   . LEU B 1 180 ? 55.639  7.707   68.554 1.00 33.37 ? 180  LEU B N   1 
ATOM   3272 C CA  . LEU B 1 180 ? 56.692  8.557   68.014 1.00 32.12 ? 180  LEU B CA  1 
ATOM   3273 C C   . LEU B 1 180 ? 57.904  7.747   67.549 1.00 37.23 ? 180  LEU B C   1 
ATOM   3274 O O   . LEU B 1 180 ? 58.567  8.118   66.584 1.00 43.59 ? 180  LEU B O   1 
ATOM   3275 C CB  . LEU B 1 180 ? 57.106  9.604   69.055 1.00 32.36 ? 180  LEU B CB  1 
ATOM   3276 C CG  . LEU B 1 180 ? 56.168  10.811  69.232 1.00 30.04 ? 180  LEU B CG  1 
ATOM   3277 C CD1 . LEU B 1 180 ? 56.864  11.930  70.007 1.00 20.79 ? 180  LEU B CD1 1 
ATOM   3278 C CD2 . LEU B 1 180 ? 55.723  11.320  67.864 1.00 27.60 ? 180  LEU B CD2 1 
ATOM   3279 N N   . SER B 1 181 ? 58.150  6.612   68.198 1.00 37.39 ? 181  SER B N   1 
ATOM   3280 C CA  . SER B 1 181 ? 59.132  5.646   67.711 1.00 38.24 ? 181  SER B CA  1 
ATOM   3281 C C   . SER B 1 181 ? 58.605  4.919   66.463 1.00 31.85 ? 181  SER B C   1 
ATOM   3282 O O   . SER B 1 181 ? 59.343  4.715   65.498 1.00 27.54 ? 181  SER B O   1 
ATOM   3283 C CB  . SER B 1 181 ? 59.473  4.640   68.820 1.00 39.05 ? 181  SER B CB  1 
ATOM   3284 O OG  . SER B 1 181 ? 59.326  3.296   68.381 1.00 48.19 ? 181  SER B OG  1 
ATOM   3285 N N   . GLN B 1 182 ? 57.324  4.554   66.489 1.00 28.32 ? 182  GLN B N   1 
ATOM   3286 C CA  . GLN B 1 182 ? 56.658  3.895   65.365 1.00 30.32 ? 182  GLN B CA  1 
ATOM   3287 C C   . GLN B 1 182 ? 56.818  4.729   64.116 1.00 32.82 ? 182  GLN B C   1 
ATOM   3288 O O   . GLN B 1 182 ? 56.875  4.200   63.006 1.00 34.39 ? 182  GLN B O   1 
ATOM   3289 C CB  . GLN B 1 182 ? 55.154  3.760   65.629 1.00 38.38 ? 182  GLN B CB  1 
ATOM   3290 C CG  . GLN B 1 182 ? 54.664  2.357   65.942 1.00 45.76 ? 182  GLN B CG  1 
ATOM   3291 C CD  . GLN B 1 182 ? 54.460  2.144   67.430 1.00 49.25 ? 182  GLN B CD  1 
ATOM   3292 O OE1 . GLN B 1 182 ? 53.713  2.883   68.076 1.00 46.14 ? 182  GLN B OE1 1 
ATOM   3293 N NE2 . GLN B 1 182 ? 55.170  1.168   67.994 1.00 50.44 ? 182  GLN B NE2 1 
ATOM   3294 N N   . PHE B 1 183 ? 56.710  6.040   64.307 1.00 35.30 ? 183  PHE B N   1 
ATOM   3295 C CA  . PHE B 1 183 ? 56.730  6.998   63.207 1.00 29.51 ? 183  PHE B CA  1 
ATOM   3296 C C   . PHE B 1 183 ? 58.114  7.054   62.561 1.00 31.89 ? 183  PHE B C   1 
ATOM   3297 O O   . PHE B 1 183 ? 58.233  7.004   61.332 1.00 37.62 ? 183  PHE B O   1 
ATOM   3298 C CB  . PHE B 1 183 ? 56.301  8.389   63.713 1.00 28.09 ? 183  PHE B CB  1 
ATOM   3299 C CG  . PHE B 1 183 ? 56.685  9.520   62.797 1.00 27.60 ? 183  PHE B CG  1 
ATOM   3300 C CD1 . PHE B 1 183 ? 55.900  9.835   61.695 1.00 30.87 ? 183  PHE B CD1 1 
ATOM   3301 C CD2 . PHE B 1 183 ? 57.885  10.202  62.980 1.00 25.63 ? 183  PHE B CD2 1 
ATOM   3302 C CE1 . PHE B 1 183 ? 56.311  10.802  60.778 1.00 23.74 ? 183  PHE B CE1 1 
ATOM   3303 C CE2 . PHE B 1 183 ? 58.300  11.163  62.073 1.00 20.27 ? 183  PHE B CE2 1 
ATOM   3304 C CZ  . PHE B 1 183 ? 57.512  11.462  60.965 1.00 18.15 ? 183  PHE B CZ  1 
ATOM   3305 N N   . LEU B 1 184 ? 59.151  7.134   63.394 1.00 25.46 ? 184  LEU B N   1 
ATOM   3306 C CA  . LEU B 1 184 ? 60.524  7.173   62.910 1.00 23.00 ? 184  LEU B CA  1 
ATOM   3307 C C   . LEU B 1 184 ? 60.882  5.969   62.043 1.00 26.97 ? 184  LEU B C   1 
ATOM   3308 O O   . LEU B 1 184 ? 61.416  6.139   60.951 1.00 31.73 ? 184  LEU B O   1 
ATOM   3309 C CB  . LEU B 1 184 ? 61.495  7.269   64.080 1.00 19.98 ? 184  LEU B CB  1 
ATOM   3310 C CG  . LEU B 1 184 ? 61.367  8.518   64.947 1.00 23.76 ? 184  LEU B CG  1 
ATOM   3311 C CD1 . LEU B 1 184 ? 62.470  8.518   65.967 1.00 24.03 ? 184  LEU B CD1 1 
ATOM   3312 C CD2 . LEU B 1 184 ? 61.430  9.767   64.098 1.00 29.47 ? 184  LEU B CD2 1 
ATOM   3313 N N   . GLN B 1 185 ? 60.522  4.764   62.482 1.00 27.96 ? 185  GLN B N   1 
ATOM   3314 C CA  . GLN B 1 185 ? 60.793  3.578   61.678 1.00 35.76 ? 185  GLN B CA  1 
ATOM   3315 C C   . GLN B 1 185 ? 59.972  3.538   60.398 1.00 32.28 ? 185  GLN B C   1 
ATOM   3316 O O   . GLN B 1 185 ? 60.469  3.122   59.357 1.00 30.15 ? 185  GLN B O   1 
ATOM   3317 C CB  . GLN B 1 185 ? 60.540  2.290   62.456 1.00 39.26 ? 185  GLN B CB  1 
ATOM   3318 C CG  . GLN B 1 185 ? 60.817  1.022   61.614 1.00 51.01 ? 185  GLN B CG  1 
ATOM   3319 C CD  . GLN B 1 185 ? 59.549  0.318   61.104 1.00 51.69 ? 185  GLN B CD  1 
ATOM   3320 O OE1 . GLN B 1 185 ? 58.443  0.854   61.185 1.00 56.37 ? 185  GLN B OE1 1 
ATOM   3321 N NE2 . GLN B 1 185 ? 59.717  -0.894  60.579 1.00 46.28 ? 185  GLN B NE2 1 
ATOM   3322 N N   . ARG B 1 186 ? 58.698  3.907   60.493 1.00 33.22 ? 186  ARG B N   1 
ATOM   3323 C CA  . ARG B 1 186 ? 57.798  3.837   59.343 1.00 37.77 ? 186  ARG B CA  1 
ATOM   3324 C C   . ARG B 1 186 ? 58.300  4.726   58.217 1.00 37.97 ? 186  ARG B C   1 
ATOM   3325 O O   . ARG B 1 186 ? 58.147  4.400   57.042 1.00 39.43 ? 186  ARG B O   1 
ATOM   3326 C CB  . ARG B 1 186 ? 56.380  4.270   59.729 1.00 38.04 ? 186  ARG B CB  1 
ATOM   3327 C CG  . ARG B 1 186 ? 55.334  4.061   58.625 1.00 41.33 ? 186  ARG B CG  1 
ATOM   3328 C CD  . ARG B 1 186 ? 53.947  4.615   59.008 1.00 41.11 ? 186  ARG B CD  1 
ATOM   3329 N NE  . ARG B 1 186 ? 53.344  3.918   60.148 1.00 37.40 ? 186  ARG B NE  1 
ATOM   3330 C CZ  . ARG B 1 186 ? 53.110  4.479   61.333 1.00 43.18 ? 186  ARG B CZ  1 
ATOM   3331 N NH1 . ARG B 1 186 ? 53.240  5.787   61.494 1.00 40.69 ? 186  ARG B NH1 1 
ATOM   3332 N NH2 . ARG B 1 186 ? 52.713  3.735   62.357 1.00 47.35 ? 186  ARG B NH2 1 
ATOM   3333 N N   . PHE B 1 187 ? 58.894  5.853   58.593 1.00 34.64 ? 187  PHE B N   1 
ATOM   3334 C CA  . PHE B 1 187 ? 59.502  6.769   57.637 1.00 26.47 ? 187  PHE B CA  1 
ATOM   3335 C C   . PHE B 1 187 ? 60.769  6.157   57.049 1.00 25.90 ? 187  PHE B C   1 
ATOM   3336 O O   . PHE B 1 187 ? 61.010  6.262   55.853 1.00 27.05 ? 187  PHE B O   1 
ATOM   3337 C CB  . PHE B 1 187 ? 59.826  8.105   58.326 1.00 25.11 ? 187  PHE B CB  1 
ATOM   3338 C CG  . PHE B 1 187 ? 60.336  9.174   57.389 1.00 29.09 ? 187  PHE B CG  1 
ATOM   3339 C CD1 . PHE B 1 187 ? 61.691  9.259   57.073 1.00 26.71 ? 187  PHE B CD1 1 
ATOM   3340 C CD2 . PHE B 1 187 ? 59.469  10.127  56.859 1.00 31.38 ? 187  PHE B CD2 1 
ATOM   3341 C CE1 . PHE B 1 187 ? 62.175  10.274  56.251 1.00 22.21 ? 187  PHE B CE1 1 
ATOM   3342 C CE2 . PHE B 1 187 ? 59.946  11.149  56.034 1.00 30.32 ? 187  PHE B CE2 1 
ATOM   3343 C CZ  . PHE B 1 187 ? 61.305  11.219  55.733 1.00 26.50 ? 187  PHE B CZ  1 
ATOM   3344 N N   . GLU B 1 188 ? 61.573  5.513   57.892 1.00 26.05 ? 188  GLU B N   1 
ATOM   3345 C CA  . GLU B 1 188 ? 62.839  4.939   57.447 1.00 24.87 ? 188  GLU B CA  1 
ATOM   3346 C C   . GLU B 1 188 ? 62.609  3.656   56.649 1.00 32.63 ? 188  GLU B C   1 
ATOM   3347 O O   . GLU B 1 188 ? 63.467  3.235   55.873 1.00 31.01 ? 188  GLU B O   1 
ATOM   3348 C CB  . GLU B 1 188 ? 63.750  4.660   58.641 1.00 23.04 ? 188  GLU B CB  1 
ATOM   3349 C CG  . GLU B 1 188 ? 64.169  5.903   59.419 1.00 25.41 ? 188  GLU B CG  1 
ATOM   3350 C CD  . GLU B 1 188 ? 65.166  5.605   60.531 1.00 34.14 ? 188  GLU B CD  1 
ATOM   3351 O OE1 . GLU B 1 188 ? 64.841  4.818   61.447 1.00 35.89 ? 188  GLU B OE1 1 
ATOM   3352 O OE2 . GLU B 1 188 ? 66.279  6.174   60.500 1.00 45.55 ? 188  GLU B OE2 1 
ATOM   3353 N N   . ALA B 1 189 ? 61.390  3.129   56.746 1.00 35.96 ? 189  ALA B N   1 
ATOM   3354 C CA  . ALA B 1 189 ? 60.980  1.925   56.027 1.00 33.67 ? 189  ALA B CA  1 
ATOM   3355 C C   . ALA B 1 189 ? 60.602  2.229   54.592 1.00 30.51 ? 189  ALA B C   1 
ATOM   3356 O O   . ALA B 1 189 ? 60.399  1.310   53.799 1.00 40.02 ? 189  ALA B O   1 
ATOM   3357 C CB  . ALA B 1 189 ? 59.793  1.277   56.729 1.00 33.86 ? 189  ALA B CB  1 
ATOM   3358 N N   . LEU B 1 190 ? 60.332  3.501   54.311 1.00 31.42 ? 190  LEU B N   1 
ATOM   3359 C CA  . LEU B 1 190 ? 59.900  3.916   52.976 1.00 33.26 ? 190  LEU B CA  1 
ATOM   3360 C C   . LEU B 1 190 ? 60.943  3.467   51.960 1.00 35.09 ? 190  LEU B C   1 
ATOM   3361 O O   . LEU B 1 190 ? 62.144  3.583   52.205 1.00 40.87 ? 190  LEU B O   1 
ATOM   3362 C CB  . LEU B 1 190 ? 59.743  5.442   52.895 1.00 32.51 ? 190  LEU B CB  1 
ATOM   3363 C CG  . LEU B 1 190 ? 58.601  6.188   53.599 1.00 32.05 ? 190  LEU B CG  1 
ATOM   3364 C CD1 . LEU B 1 190 ? 58.877  7.689   53.508 1.00 31.15 ? 190  LEU B CD1 1 
ATOM   3365 C CD2 . LEU B 1 190 ? 57.252  5.859   52.968 1.00 30.62 ? 190  LEU B CD2 1 
ATOM   3366 N N   . GLU B 1 191 ? 60.474  2.956   50.826 1.00 40.77 ? 191  GLU B N   1 
ATOM   3367 C CA  . GLU B 1 191 ? 61.342  2.330   49.826 1.00 46.81 ? 191  GLU B CA  1 
ATOM   3368 C C   . GLU B 1 191 ? 62.542  3.203   49.450 1.00 46.71 ? 191  GLU B C   1 
ATOM   3369 O O   . GLU B 1 191 ? 63.691  2.776   49.591 1.00 52.90 ? 191  GLU B O   1 
ATOM   3370 C CB  . GLU B 1 191 ? 60.527  1.989   48.562 1.00 51.00 ? 191  GLU B CB  1 
ATOM   3371 C CG  . GLU B 1 191 ? 61.236  1.070   47.556 1.00 61.34 ? 191  GLU B CG  1 
ATOM   3372 C CD  . GLU B 1 191 ? 60.494  0.940   46.220 1.00 68.69 ? 191  GLU B CD  1 
ATOM   3373 O OE1 . GLU B 1 191 ? 60.593  1.871   45.384 1.00 69.95 ? 191  GLU B OE1 1 
ATOM   3374 O OE2 . GLU B 1 191 ? 59.870  -0.122  45.979 1.00 69.49 ? 191  GLU B OE2 1 
ATOM   3375 N N   . LYS B 1 192 ? 62.273  4.445   49.047 1.00 43.24 ? 192  LYS B N   1 
ATOM   3376 C CA  . LYS B 1 192 ? 63.302  5.329   48.487 1.00 38.27 ? 192  LYS B CA  1 
ATOM   3377 C C   . LYS B 1 192 ? 64.167  5.961   49.565 1.00 38.26 ? 192  LYS B C   1 
ATOM   3378 O O   . LYS B 1 192 ? 65.298  6.374   49.305 1.00 38.98 ? 192  LYS B O   1 
ATOM   3379 C CB  . LYS B 1 192 ? 62.656  6.441   47.652 1.00 40.00 ? 192  LYS B CB  1 
ATOM   3380 C CG  . LYS B 1 192 ? 62.508  6.121   46.171 1.00 43.47 ? 192  LYS B CG  1 
ATOM   3381 C CD  . LYS B 1 192 ? 61.051  6.217   45.726 1.00 52.98 ? 192  LYS B CD  1 
ATOM   3382 C CE  . LYS B 1 192 ? 60.775  5.323   44.517 1.00 52.90 ? 192  LYS B CE  1 
ATOM   3383 N NZ  . LYS B 1 192 ? 59.348  5.379   44.080 1.00 49.58 ? 192  LYS B NZ  1 
ATOM   3384 N N   . ILE B 1 193 ? 63.621  6.044   50.772 1.00 32.23 ? 193  ILE B N   1 
ATOM   3385 C CA  . ILE B 1 193 ? 64.322  6.637   51.897 1.00 30.70 ? 193  ILE B CA  1 
ATOM   3386 C C   . ILE B 1 193 ? 65.297  5.625   52.503 1.00 31.04 ? 193  ILE B C   1 
ATOM   3387 O O   . ILE B 1 193 ? 66.457  5.954   52.769 1.00 33.87 ? 193  ILE B O   1 
ATOM   3388 C CB  . ILE B 1 193 ? 63.297  7.150   52.954 1.00 31.03 ? 193  ILE B CB  1 
ATOM   3389 C CG1 . ILE B 1 193 ? 62.426  8.243   52.333 1.00 26.89 ? 193  ILE B CG1 1 
ATOM   3390 C CG2 . ILE B 1 193 ? 63.992  7.708   54.176 1.00 26.77 ? 193  ILE B CG2 1 
ATOM   3391 C CD1 . ILE B 1 193 ? 63.201  9.278   51.534 1.00 31.18 ? 193  ILE B CD1 1 
ATOM   3392 N N   . SER B 1 194 ? 64.866  4.368   52.577 1.00 30.14 ? 194  SER B N   1 
ATOM   3393 C CA  . SER B 1 194 ? 65.704  3.286   53.085 1.00 34.20 ? 194  SER B CA  1 
ATOM   3394 C C   . SER B 1 194 ? 66.922  3.066   52.194 1.00 34.38 ? 194  SER B C   1 
ATOM   3395 O O   . SER B 1 194 ? 68.050  2.989   52.679 1.00 32.11 ? 194  SER B O   1 
ATOM   3396 C CB  . SER B 1 194 ? 64.894  1.992   53.172 1.00 37.05 ? 194  SER B CB  1 
ATOM   3397 O OG  . SER B 1 194 ? 64.852  1.508   54.504 1.00 40.59 ? 194  SER B OG  1 
ATOM   3398 N N   . ALA B 1 195 ? 66.691  3.041   50.884 1.00 31.58 ? 195  ALA B N   1 
ATOM   3399 C CA  . ALA B 1 195 ? 67.762  2.865   49.911 1.00 22.66 ? 195  ALA B CA  1 
ATOM   3400 C C   . ALA B 1 195 ? 68.726  4.051   49.911 1.00 24.96 ? 195  ALA B C   1 
ATOM   3401 O O   . ALA B 1 195 ? 69.925  3.891   49.668 1.00 35.17 ? 195  ALA B O   1 
ATOM   3402 C CB  . ALA B 1 195 ? 67.171  2.659   48.524 1.00 28.89 ? 195  ALA B CB  1 
ATOM   3403 N N   . TYR B 1 196 ? 68.204  5.234   50.218 1.00 26.42 ? 196  TYR B N   1 
ATOM   3404 C CA  . TYR B 1 196 ? 69.026  6.433   50.357 1.00 25.84 ? 196  TYR B CA  1 
ATOM   3405 C C   . TYR B 1 196 ? 69.958  6.312   51.559 1.00 28.02 ? 196  TYR B C   1 
ATOM   3406 O O   . TYR B 1 196 ? 71.108  6.750   51.502 1.00 27.68 ? 196  TYR B O   1 
ATOM   3407 C CB  . TYR B 1 196 ? 68.126  7.667   50.514 1.00 25.72 ? 196  TYR B CB  1 
ATOM   3408 C CG  . TYR B 1 196 ? 68.878  8.960   50.762 1.00 22.93 ? 196  TYR B CG  1 
ATOM   3409 C CD1 . TYR B 1 196 ? 69.970  9.319   49.971 1.00 16.56 ? 196  TYR B CD1 1 
ATOM   3410 C CD2 . TYR B 1 196 ? 68.493  9.827   51.784 1.00 20.76 ? 196  TYR B CD2 1 
ATOM   3411 C CE1 . TYR B 1 196 ? 70.656  10.510  50.186 1.00 14.67 ? 196  TYR B CE1 1 
ATOM   3412 C CE2 . TYR B 1 196 ? 69.181  11.016  52.017 1.00 18.31 ? 196  TYR B CE2 1 
ATOM   3413 C CZ  . TYR B 1 196 ? 70.263  11.355  51.212 1.00 15.28 ? 196  TYR B CZ  1 
ATOM   3414 O OH  . TYR B 1 196 ? 70.965  12.526  51.447 1.00 15.15 ? 196  TYR B OH  1 
ATOM   3415 N N   . MET B 1 197 ? 69.458  5.704   52.636 1.00 27.23 ? 197  MET B N   1 
ATOM   3416 C CA  . MET B 1 197 ? 70.225  5.550   53.873 1.00 29.36 ? 197  MET B CA  1 
ATOM   3417 C C   . MET B 1 197 ? 71.221  4.400   53.782 1.00 30.02 ? 197  MET B C   1 
ATOM   3418 O O   . MET B 1 197 ? 72.233  4.392   54.477 1.00 33.07 ? 197  MET B O   1 
ATOM   3419 C CB  . MET B 1 197 ? 69.282  5.329   55.058 1.00 31.32 ? 197  MET B CB  1 
ATOM   3420 C CG  . MET B 1 197 ? 69.011  6.583   55.877 1.00 30.31 ? 197  MET B CG  1 
ATOM   3421 S SD  . MET B 1 197 ? 67.659  6.387   57.062 1.00 27.08 ? 197  MET B SD  1 
ATOM   3422 C CE  . MET B 1 197 ? 66.363  7.134   56.190 1.00 21.82 ? 197  MET B CE  1 
ATOM   3423 N N   . ARG B 1 198 ? 70.958  3.472   52.866 1.00 34.96 ? 198  ARG B N   1 
ATOM   3424 C CA  . ARG B 1 198 ? 71.857  2.359   52.582 1.00 36.48 ? 198  ARG B CA  1 
ATOM   3425 C C   . ARG B 1 198 ? 72.994  2.780   51.653 1.00 41.20 ? 198  ARG B C   1 
ATOM   3426 O O   . ARG B 1 198 ? 73.934  2.019   51.431 1.00 47.33 ? 198  ARG B O   1 
ATOM   3427 C CB  . ARG B 1 198 ? 71.074  1.220   51.930 1.00 38.16 ? 198  ARG B CB  1 
ATOM   3428 C CG  . ARG B 1 198 ? 71.163  -0.113  52.653 1.00 47.08 ? 198  ARG B CG  1 
ATOM   3429 C CD  . ARG B 1 198 ? 70.062  -1.059  52.185 1.00 49.22 ? 198  ARG B CD  1 
ATOM   3430 N NE  . ARG B 1 198 ? 69.870  -0.971  50.742 1.00 50.04 ? 198  ARG B NE  1 
ATOM   3431 C CZ  . ARG B 1 198 ? 70.596  -1.630  49.844 1.00 53.02 ? 198  ARG B CZ  1 
ATOM   3432 N NH1 . ARG B 1 198 ? 71.278  -2.714  50.184 1.00 52.22 ? 198  ARG B NH1 1 
ATOM   3433 N NH2 . ARG B 1 198 ? 70.510  -1.302  48.573 1.00 51.78 ? 198  ARG B NH2 1 
ATOM   3434 N N   . SER B 1 199 ? 72.895  3.982   51.093 1.00 39.70 ? 199  SER B N   1 
ATOM   3435 C CA  . SER B 1 199 ? 73.902  4.469   50.160 1.00 32.61 ? 199  SER B CA  1 
ATOM   3436 C C   . SER B 1 199 ? 74.960  5.344   50.841 1.00 31.82 ? 199  SER B C   1 
ATOM   3437 O O   . SER B 1 199 ? 74.992  5.464   52.073 1.00 29.87 ? 199  SER B O   1 
ATOM   3438 C CB  . SER B 1 199 ? 73.228  5.239   49.026 1.00 30.36 ? 199  SER B CB  1 
ATOM   3439 O OG  . SER B 1 199 ? 73.043  6.592   49.387 1.00 30.97 ? 199  SER B OG  1 
ATOM   3440 N N   . GLY B 1 200 ? 75.855  5.906   50.029 1.00 30.12 ? 200  GLY B N   1 
ATOM   3441 C CA  . GLY B 1 200 ? 76.943  6.717   50.552 1.00 23.36 ? 200  GLY B CA  1 
ATOM   3442 C C   . GLY B 1 200 ? 76.746  8.206   50.324 1.00 29.34 ? 200  GLY B C   1 
ATOM   3443 O O   . GLY B 1 200 ? 77.674  8.994   50.515 1.00 29.12 ? 200  GLY B O   1 
ATOM   3444 N N   . ARG B 1 201 ? 75.548  8.584   49.886 1.00 28.45 ? 201  ARG B N   1 
ATOM   3445 C CA  . ARG B 1 201 ? 75.181  9.986   49.758 1.00 24.95 ? 201  ARG B CA  1 
ATOM   3446 C C   . ARG B 1 201 ? 74.623  10.500  51.077 1.00 25.12 ? 201  ARG B C   1 
ATOM   3447 O O   . ARG B 1 201 ? 74.500  11.707  51.269 1.00 33.23 ? 201  ARG B O   1 
ATOM   3448 C CB  . ARG B 1 201 ? 74.140  10.161  48.653 1.00 29.16 ? 201  ARG B CB  1 
ATOM   3449 C CG  . ARG B 1 201 ? 74.565  9.607   47.300 1.00 32.00 ? 201  ARG B CG  1 
ATOM   3450 C CD  . ARG B 1 201 ? 73.533  9.916   46.220 1.00 33.14 ? 201  ARG B CD  1 
ATOM   3451 N NE  . ARG B 1 201 ? 72.218  9.333   46.501 1.00 31.85 ? 201  ARG B NE  1 
ATOM   3452 C CZ  . ARG B 1 201 ? 71.870  8.084   46.204 1.00 29.51 ? 201  ARG B CZ  1 
ATOM   3453 N NH1 . ARG B 1 201 ? 72.788  7.211   45.798 1.00 38.14 ? 201  ARG B NH1 1 
ATOM   3454 N NH2 . ARG B 1 201 ? 70.611  7.695   46.370 1.00 24.00 ? 201  ARG B NH2 1 
ATOM   3455 N N   . PHE B 1 202 ? 74.424  9.584   52.024 1.00 28.57 ? 202  PHE B N   1 
ATOM   3456 C CA  . PHE B 1 202 ? 73.734  9.885   53.278 1.00 28.72 ? 202  PHE B CA  1 
ATOM   3457 C C   . PHE B 1 202 ? 74.587  10.538  54.361 1.00 30.62 ? 202  PHE B C   1 
ATOM   3458 O O   . PHE B 1 202 ? 75.594  9.984   54.804 1.00 24.83 ? 202  PHE B O   1 
ATOM   3459 C CB  . PHE B 1 202 ? 73.082  8.627   53.847 1.00 32.10 ? 202  PHE B CB  1 
ATOM   3460 C CG  . PHE B 1 202 ? 72.083  8.911   54.917 1.00 35.38 ? 202  PHE B CG  1 
ATOM   3461 C CD1 . PHE B 1 202 ? 70.926  9.624   54.622 1.00 38.17 ? 202  PHE B CD1 1 
ATOM   3462 C CD2 . PHE B 1 202 ? 72.365  8.608   56.243 1.00 37.47 ? 202  PHE B CD2 1 
ATOM   3463 C CE1 . PHE B 1 202 ? 70.072  10.047  55.628 1.00 38.04 ? 202  PHE B CE1 1 
ATOM   3464 C CE2 . PHE B 1 202 ? 71.516  9.024   57.259 1.00 38.98 ? 202  PHE B CE2 1 
ATOM   3465 C CZ  . PHE B 1 202 ? 70.370  9.749   56.953 1.00 40.38 ? 202  PHE B CZ  1 
ATOM   3466 N N   . MET B 1 203 ? 74.016  11.586  54.941 1.00 37.57 ? 203  MET B N   1 
ATOM   3467 C CA  . MET B 1 203 ? 74.694  12.430  55.915 1.00 43.11 ? 203  MET B CA  1 
ATOM   3468 C C   . MET B 1 203 ? 73.957  12.411  57.258 1.00 42.34 ? 203  MET B C   1 
ATOM   3469 O O   . MET B 1 203 ? 73.080  13.240  57.509 1.00 41.73 ? 203  MET B O   1 
ATOM   3470 C CB  . MET B 1 203 ? 74.746  13.866  55.393 1.00 46.32 ? 203  MET B CB  1 
ATOM   3471 C CG  . MET B 1 203 ? 75.927  14.162  54.510 1.00 42.70 ? 203  MET B CG  1 
ATOM   3472 S SD  . MET B 1 203 ? 77.298  14.713  55.506 1.00 47.46 ? 203  MET B SD  1 
ATOM   3473 C CE  . MET B 1 203 ? 76.850  16.383  55.791 1.00 41.07 ? 203  MET B CE  1 
ATOM   3474 N N   . LYS B 1 204 ? 74.333  11.474  58.122 1.00 43.99 ? 204  LYS B N   1 
ATOM   3475 C CA  . LYS B 1 204 ? 73.765  11.387  59.463 1.00 37.99 ? 204  LYS B CA  1 
ATOM   3476 C C   . LYS B 1 204 ? 74.388  12.422  60.401 1.00 32.96 ? 204  LYS B C   1 
ATOM   3477 O O   . LYS B 1 204 ? 73.865  12.676  61.485 1.00 40.33 ? 204  LYS B O   1 
ATOM   3478 C CB  . LYS B 1 204 ? 73.984  9.976   60.023 1.00 40.61 ? 204  LYS B CB  1 
ATOM   3479 C CG  . LYS B 1 204 ? 73.222  9.667   61.316 1.00 46.58 ? 204  LYS B CG  1 
ATOM   3480 C CD  . LYS B 1 204 ? 73.125  8.161   61.561 1.00 51.48 ? 204  LYS B CD  1 
ATOM   3481 C CE  . LYS B 1 204 ? 72.364  7.456   60.435 1.00 54.20 ? 204  LYS B CE  1 
ATOM   3482 N NZ  . LYS B 1 204 ? 72.099  6.014   60.713 1.00 52.60 ? 204  LYS B NZ  1 
ATOM   3483 N N   . ALA B 1 205 ? 75.507  13.010  59.978 1.00 34.68 ? 205  ALA B N   1 
ATOM   3484 C CA  . ALA B 1 205 ? 76.274  13.945  60.807 1.00 29.91 ? 205  ALA B CA  1 
ATOM   3485 C C   . ALA B 1 205 ? 77.235  14.779  59.949 1.00 34.38 ? 205  ALA B C   1 
ATOM   3486 O O   . ALA B 1 205 ? 77.613  14.373  58.843 1.00 39.35 ? 205  ALA B O   1 
ATOM   3487 C CB  . ALA B 1 205 ? 77.045  13.181  61.865 1.00 30.19 ? 205  ALA B CB  1 
ATOM   3488 N N   . PRO B 1 206 ? 77.623  15.970  60.435 1.00 28.56 ? 206  PRO B N   1 
ATOM   3489 C CA  . PRO B 1 206 ? 77.214  16.612  61.696 1.00 30.99 ? 206  PRO B CA  1 
ATOM   3490 C C   . PRO B 1 206 ? 75.871  17.342  61.584 1.00 33.41 ? 206  PRO B C   1 
ATOM   3491 O O   . PRO B 1 206 ? 75.573  17.933  60.547 1.00 33.05 ? 206  PRO B O   1 
ATOM   3492 C CB  . PRO B 1 206 ? 78.352  17.595  61.973 1.00 27.53 ? 206  PRO B CB  1 
ATOM   3493 C CG  . PRO B 1 206 ? 78.832  17.995  60.596 1.00 25.29 ? 206  PRO B CG  1 
ATOM   3494 C CD  . PRO B 1 206 ? 78.593  16.796  59.685 1.00 28.14 ? 206  PRO B CD  1 
ATOM   3495 N N   . ILE B 1 207 ? 75.083  17.331  62.656 1.00 32.32 ? 207  ILE B N   1 
ATOM   3496 C CA  . ILE B 1 207 ? 73.833  18.088  62.676 1.00 26.26 ? 207  ILE B CA  1 
ATOM   3497 C C   . ILE B 1 207 ? 74.144  19.585  62.655 1.00 28.75 ? 207  ILE B C   1 
ATOM   3498 O O   . ILE B 1 207 ? 73.490  20.354  61.949 1.00 31.57 ? 207  ILE B O   1 
ATOM   3499 C CB  . ILE B 1 207 ? 72.987  17.800  63.947 1.00 21.44 ? 207  ILE B CB  1 
ATOM   3500 C CG1 . ILE B 1 207 ? 72.687  16.314  64.081 1.00 19.75 ? 207  ILE B CG1 1 
ATOM   3501 C CG2 . ILE B 1 207 ? 71.662  18.540  63.874 1.00 22.08 ? 207  ILE B CG2 1 
ATOM   3502 C CD1 . ILE B 1 207 ? 72.160  15.941  65.459 1.00 16.32 ? 207  ILE B CD1 1 
ATOM   3503 N N   . PHE B 1 208 ? 75.146  19.991  63.431 1.00 30.68 ? 208  PHE B N   1 
ATOM   3504 C CA  . PHE B 1 208 ? 75.428  21.409  63.633 1.00 34.32 ? 208  PHE B CA  1 
ATOM   3505 C C   . PHE B 1 208 ? 76.750  21.852  63.019 1.00 30.63 ? 208  PHE B C   1 
ATOM   3506 O O   . PHE B 1 208 ? 77.614  21.037  62.692 1.00 32.73 ? 208  PHE B O   1 
ATOM   3507 C CB  . PHE B 1 208 ? 75.440  21.759  65.130 1.00 36.04 ? 208  PHE B CB  1 
ATOM   3508 C CG  . PHE B 1 208 ? 74.114  21.572  65.823 1.00 39.53 ? 208  PHE B CG  1 
ATOM   3509 C CD1 . PHE B 1 208 ? 73.081  22.486  65.636 1.00 41.91 ? 208  PHE B CD1 1 
ATOM   3510 C CD2 . PHE B 1 208 ? 73.918  20.511  66.707 1.00 42.98 ? 208  PHE B CD2 1 
ATOM   3511 C CE1 . PHE B 1 208 ? 71.870  22.348  66.320 1.00 41.47 ? 208  PHE B CE1 1 
ATOM   3512 C CE2 . PHE B 1 208 ? 72.716  20.366  67.393 1.00 41.94 ? 208  PHE B CE2 1 
ATOM   3513 C CZ  . PHE B 1 208 ? 71.689  21.288  67.198 1.00 41.28 ? 208  PHE B CZ  1 
ATOM   3514 N N   . TRP B 1 209 ? 76.876  23.165  62.862 1.00 35.16 ? 209  TRP B N   1 
ATOM   3515 C CA  . TRP B 1 209 ? 78.130  23.834  62.521 1.00 47.88 ? 209  TRP B CA  1 
ATOM   3516 C C   . TRP B 1 209 ? 79.248  23.445  63.496 1.00 48.74 ? 209  TRP B C   1 
ATOM   3517 O O   . TRP B 1 209 ? 78.993  23.124  64.658 1.00 50.16 ? 209  TRP B O   1 
ATOM   3518 C CB  . TRP B 1 209 ? 77.902  25.354  62.556 1.00 54.88 ? 209  TRP B CB  1 
ATOM   3519 C CG  . TRP B 1 209 ? 78.977  26.198  61.920 1.00 68.25 ? 209  TRP B CG  1 
ATOM   3520 C CD1 . TRP B 1 209 ? 79.553  27.321  62.452 1.00 70.56 ? 209  TRP B CD1 1 
ATOM   3521 C CD2 . TRP B 1 209 ? 79.509  26.067  60.591 1.00 70.24 ? 209  TRP B CD2 1 
ATOM   3522 N NE1 . TRP B 1 209 ? 80.397  27.899  61.536 1.00 72.03 ? 209  TRP B NE1 1 
ATOM   3523 C CE2 . TRP B 1 209 ? 80.388  27.154  60.385 1.00 72.63 ? 209  TRP B CE2 1 
ATOM   3524 C CE3 . TRP B 1 209 ? 79.325  25.139  59.556 1.00 71.86 ? 209  TRP B CE3 1 
ATOM   3525 C CZ2 . TRP B 1 209 ? 81.079  27.342  59.182 1.00 70.82 ? 209  TRP B CZ2 1 
ATOM   3526 C CZ3 . TRP B 1 209 ? 80.017  25.325  58.361 1.00 70.19 ? 209  TRP B CZ3 1 
ATOM   3527 C CH2 . TRP B 1 209 ? 80.880  26.418  58.187 1.00 69.31 ? 209  TRP B CH2 1 
ATOM   3528 N N   . TYR B 1 210 ? 80.488  23.561  63.032 1.00 47.83 ? 210  TYR B N   1 
ATOM   3529 C CA  . TYR B 1 210 ? 81.653  23.065  63.756 1.00 44.07 ? 210  TYR B CA  1 
ATOM   3530 C C   . TYR B 1 210 ? 81.921  23.805  65.075 1.00 42.51 ? 210  TYR B C   1 
ATOM   3531 O O   . TYR B 1 210 ? 82.568  23.264  65.978 1.00 39.82 ? 210  TYR B O   1 
ATOM   3532 C CB  . TYR B 1 210 ? 82.879  23.146  62.845 1.00 41.00 ? 210  TYR B CB  1 
ATOM   3533 C CG  . TYR B 1 210 ? 82.657  22.606  61.437 1.00 45.60 ? 210  TYR B CG  1 
ATOM   3534 C CD1 . TYR B 1 210 ? 82.536  21.232  61.203 1.00 45.89 ? 210  TYR B CD1 1 
ATOM   3535 C CD2 . TYR B 1 210 ? 82.664  23.461  60.333 1.00 47.38 ? 210  TYR B CD2 1 
ATOM   3536 C CE1 . TYR B 1 210 ? 82.446  20.720  59.901 1.00 49.29 ? 210  TYR B CE1 1 
ATOM   3537 C CE2 . TYR B 1 210 ? 82.574  22.963  59.027 1.00 51.47 ? 210  TYR B CE2 1 
ATOM   3538 C CZ  . TYR B 1 210 ? 82.474  21.590  58.814 1.00 52.18 ? 210  TYR B CZ  1 
ATOM   3539 O OH  . TYR B 1 210 ? 82.467  21.089  57.522 1.00 49.75 ? 210  TYR B OH  1 
ATOM   3540 N N   . THR B 1 211 ? 81.368  25.009  65.213 1.00 37.37 ? 211  THR B N   1 
ATOM   3541 C CA  . THR B 1 211 ? 81.558  25.787  66.435 1.00 38.81 ? 211  THR B CA  1 
ATOM   3542 C C   . THR B 1 211 ? 80.541  25.430  67.512 1.00 41.56 ? 211  THR B C   1 
ATOM   3543 O O   . THR B 1 211 ? 80.393  26.157  68.499 1.00 40.79 ? 211  THR B O   1 
ATOM   3544 C CB  . THR B 1 211 ? 81.469  27.309  66.185 1.00 42.37 ? 211  THR B CB  1 
ATOM   3545 O OG1 . THR B 1 211 ? 80.096  27.687  66.022 1.00 50.36 ? 211  THR B OG1 1 
ATOM   3546 C CG2 . THR B 1 211 ? 82.264  27.702  64.947 1.00 47.82 ? 211  THR B CG2 1 
ATOM   3547 N N   . ALA B 1 212 ? 79.839  24.315  67.320 1.00 45.63 ? 212  ALA B N   1 
ATOM   3548 C CA  . ALA B 1 212 ? 78.844  23.859  68.287 1.00 45.79 ? 212  ALA B CA  1 
ATOM   3549 C C   . ALA B 1 212 ? 79.480  23.048  69.410 1.00 46.26 ? 212  ALA B C   1 
ATOM   3550 O O   . ALA B 1 212 ? 80.442  22.309  69.183 1.00 51.13 ? 212  ALA B O   1 
ATOM   3551 C CB  . ALA B 1 212 ? 77.774  23.033  67.592 1.00 44.61 ? 212  ALA B CB  1 
ATOM   3552 N N   . LEU B 1 213 ? 78.934  23.195  70.617 1.00 48.80 ? 213  LEU B N   1 
ATOM   3553 C CA  . LEU B 1 213 ? 79.399  22.465  71.797 1.00 38.85 ? 213  LEU B CA  1 
ATOM   3554 C C   . LEU B 1 213 ? 78.927  21.009  71.791 1.00 39.29 ? 213  LEU B C   1 
ATOM   3555 O O   . LEU B 1 213 ? 79.465  20.177  72.518 1.00 40.97 ? 213  LEU B O   1 
ATOM   3556 C CB  . LEU B 1 213 ? 78.903  23.144  73.077 1.00 39.62 ? 213  LEU B CB  1 
ATOM   3557 C CG  . LEU B 1 213 ? 79.442  24.510  73.522 1.00 44.21 ? 213  LEU B CG  1 
ATOM   3558 C CD1 . LEU B 1 213 ? 80.197  24.350  74.836 1.00 45.36 ? 213  LEU B CD1 1 
ATOM   3559 C CD2 . LEU B 1 213 ? 80.331  25.132  72.454 1.00 43.95 ? 213  LEU B CD2 1 
ATOM   3560 N N   . TRP B 1 214 ? 77.889  20.713  71.012 1.00 37.01 ? 214  TRP B N   1 
ATOM   3561 C CA  . TRP B 1 214 ? 77.432  19.334  70.847 1.00 35.93 ? 214  TRP B CA  1 
ATOM   3562 C C   . TRP B 1 214 ? 77.297  18.956  69.375 1.00 32.82 ? 214  TRP B C   1 
ATOM   3563 O O   . TRP B 1 214 ? 76.947  19.784  68.535 1.00 38.14 ? 214  TRP B O   1 
ATOM   3564 C CB  . TRP B 1 214 ? 76.088  19.104  71.569 1.00 32.73 ? 214  TRP B CB  1 
ATOM   3565 C CG  . TRP B 1 214 ? 75.650  17.640  71.621 1.00 33.80 ? 214  TRP B CG  1 
ATOM   3566 C CD1 . TRP B 1 214 ? 76.066  16.686  72.512 1.00 29.10 ? 214  TRP B CD1 1 
ATOM   3567 C CD2 . TRP B 1 214 ? 74.770  16.970  70.700 1.00 33.87 ? 214  TRP B CD2 1 
ATOM   3568 N NE1 . TRP B 1 214 ? 75.516  15.465  72.190 1.00 33.52 ? 214  TRP B NE1 1 
ATOM   3569 C CE2 . TRP B 1 214 ? 74.718  15.607  71.087 1.00 34.58 ? 214  TRP B CE2 1 
ATOM   3570 C CE3 . TRP B 1 214 ? 74.032  17.384  69.580 1.00 32.56 ? 214  TRP B CE3 1 
ATOM   3571 C CZ2 . TRP B 1 214 ? 73.958  14.659  70.392 1.00 34.72 ? 214  TRP B CZ2 1 
ATOM   3572 C CZ3 . TRP B 1 214 ? 73.276  16.437  68.885 1.00 29.41 ? 214  TRP B CZ3 1 
ATOM   3573 C CH2 . TRP B 1 214 ? 73.248  15.090  69.296 1.00 31.58 ? 214  TRP B CH2 1 
ATOM   3574 N N   . ASN B 1 215 ? 77.637  17.707  69.072 1.00 32.49 ? 215  ASN B N   1 
ATOM   3575 C CA  . ASN B 1 215 ? 77.428  17.126  67.753 1.00 37.59 ? 215  ASN B CA  1 
ATOM   3576 C C   . ASN B 1 215 ? 77.497  15.614  67.829 1.00 44.26 ? 215  ASN B C   1 
ATOM   3577 O O   . ASN B 1 215 ? 77.807  15.049  68.878 1.00 50.60 ? 215  ASN B O   1 
ATOM   3578 C CB  . ASN B 1 215 ? 78.475  17.620  66.769 1.00 34.04 ? 215  ASN B CB  1 
ATOM   3579 C CG  . ASN B 1 215 ? 77.865  18.372  65.622 1.00 35.43 ? 215  ASN B CG  1 
ATOM   3580 O OD1 . ASN B 1 215 ? 78.110  19.560  65.453 1.00 35.55 ? 215  ASN B OD1 1 
ATOM   3581 N ND2 . ASN B 1 215 ? 77.018  17.698  64.855 1.00 38.59 ? 215  ASN B ND2 1 
ATOM   3582 N N   . ASN B 1 216 ? 77.213  14.958  66.710 1.00 41.81 ? 216  ASN B N   1 
ATOM   3583 C CA  . ASN B 1 216 ? 77.268  13.505  66.652 1.00 45.29 ? 216  ASN B CA  1 
ATOM   3584 C C   . ASN B 1 216 ? 78.450  13.005  65.820 1.00 49.34 ? 216  ASN B C   1 
ATOM   3585 O O   . ASN B 1 216 ? 78.844  11.840  65.925 1.00 53.67 ? 216  ASN B O   1 
ATOM   3586 C CB  . ASN B 1 216 ? 75.939  12.932  66.134 1.00 50.08 ? 216  ASN B CB  1 
ATOM   3587 C CG  . ASN B 1 216 ? 75.443  13.620  64.867 1.00 53.46 ? 216  ASN B CG  1 
ATOM   3588 O OD1 . ASN B 1 216 ? 75.597  14.831  64.687 1.00 52.90 ? 216  ASN B OD1 1 
ATOM   3589 N ND2 . ASN B 1 216 ? 74.802  12.847  64.000 1.00 56.13 ? 216  ASN B ND2 1 
ATOM   3590 N N   . LYS B 1 217 ? 79.033  13.903  65.027 1.00 46.78 ? 217  LYS B N   1 
ATOM   3591 C CA  . LYS B 1 217 ? 80.325  13.664  64.375 1.00 52.90 ? 217  LYS B CA  1 
ATOM   3592 C C   . LYS B 1 217 ? 81.002  15.019  64.097 1.00 56.72 ? 217  LYS B C   1 
ATOM   3593 O O   . LYS B 1 217 ? 81.567  15.216  62.995 1.00 54.84 ? 217  LYS B O   1 
ATOM   3594 C CB  . LYS B 1 217 ? 80.136  12.863  63.069 1.00 54.42 ? 217  LYS B CB  1 
ATOM   3595 C CG  . LYS B 1 217 ? 81.377  12.085  62.593 1.00 59.28 ? 217  LYS B CG  1 
ATOM   3596 C CD  . LYS B 1 217 ? 81.774  12.451  61.155 1.00 56.86 ? 217  LYS B CD  1 
ATOM   3597 C CE  . LYS B 1 217 ? 81.120  11.533  60.129 1.00 58.63 ? 217  LYS B CE  1 
ATOM   3598 N NZ  . LYS B 1 217 ? 82.080  10.540  59.554 1.00 59.08 ? 217  LYS B NZ  1 
ATOM   3599 N N   . VAL C 1 1   ? 106.508 70.325  9.516  1.00 33.86 ? 1    VAL C N   1 
ATOM   3600 C CA  . VAL C 1 1   ? 106.463 71.419  10.536 1.00 42.92 ? 1    VAL C CA  1 
ATOM   3601 C C   . VAL C 1 1   ? 105.176 71.347  11.366 1.00 39.52 ? 1    VAL C C   1 
ATOM   3602 O O   . VAL C 1 1   ? 104.085 71.328  10.803 1.00 49.88 ? 1    VAL C O   1 
ATOM   3603 C CB  . VAL C 1 1   ? 106.528 72.803  9.839  1.00 45.49 ? 1    VAL C CB  1 
ATOM   3604 C CG1 . VAL C 1 1   ? 106.250 73.928  10.841 1.00 45.86 ? 1    VAL C CG1 1 
ATOM   3605 C CG2 . VAL C 1 1   ? 107.893 72.989  9.184  1.00 50.51 ? 1    VAL C CG2 1 
ATOM   3606 N N   . VAL C 1 2   ? 105.303 71.346  12.693 1.00 26.89 ? 2    VAL C N   1 
ATOM   3607 C CA  . VAL C 1 2   ? 104.137 71.283  13.571 1.00 24.08 ? 2    VAL C CA  1 
ATOM   3608 C C   . VAL C 1 2   ? 103.968 72.566  14.385 1.00 26.03 ? 2    VAL C C   1 
ATOM   3609 O O   . VAL C 1 2   ? 104.893 73.368  14.489 1.00 32.18 ? 2    VAL C O   1 
ATOM   3610 C CB  . VAL C 1 2   ? 104.205 70.059  14.529 1.00 22.11 ? 2    VAL C CB  1 
ATOM   3611 C CG1 . VAL C 1 2   ? 104.650 68.835  13.777 1.00 36.95 ? 2    VAL C CG1 1 
ATOM   3612 C CG2 . VAL C 1 2   ? 105.152 70.311  15.658 1.00 26.36 ? 2    VAL C CG2 1 
ATOM   3613 N N   . THR C 1 3   ? 102.778 72.762  14.944 1.00 22.66 ? 3    THR C N   1 
ATOM   3614 C CA  . THR C 1 3   ? 102.464 73.980  15.679 1.00 23.74 ? 3    THR C CA  1 
ATOM   3615 C C   . THR C 1 3   ? 101.934 73.657  17.079 1.00 27.99 ? 3    THR C C   1 
ATOM   3616 O O   . THR C 1 3   ? 101.078 72.795  17.252 1.00 26.92 ? 3    THR C O   1 
ATOM   3617 C CB  . THR C 1 3   ? 101.430 74.825  14.911 1.00 20.23 ? 3    THR C CB  1 
ATOM   3618 O OG1 . THR C 1 3   ? 101.977 75.208  13.642 1.00 22.29 ? 3    THR C OG1 1 
ATOM   3619 C CG2 . THR C 1 3   ? 101.057 76.069  15.696 1.00 22.27 ? 3    THR C CG2 1 
ATOM   3620 N N   . LEU C 1 4   ? 102.505 74.311  18.082 1.00 28.01 ? 4    LEU C N   1 
ATOM   3621 C CA  . LEU C 1 4   ? 102.108 74.101  19.463 1.00 21.83 ? 4    LEU C CA  1 
ATOM   3622 C C   . LEU C 1 4   ? 101.448 75.363  19.975 1.00 19.70 ? 4    LEU C C   1 
ATOM   3623 O O   . LEU C 1 4   ? 102.068 76.422  20.002 1.00 21.11 ? 4    LEU C O   1 
ATOM   3624 C CB  . LEU C 1 4   ? 103.336 73.779  20.321 1.00 28.39 ? 4    LEU C CB  1 
ATOM   3625 C CG  . LEU C 1 4   ? 103.185 73.855  21.842 1.00 24.92 ? 4    LEU C CG  1 
ATOM   3626 C CD1 . LEU C 1 4   ? 102.149 72.847  22.304 1.00 27.14 ? 4    LEU C CD1 1 
ATOM   3627 C CD2 . LEU C 1 4   ? 104.528 73.593  22.503 1.00 26.75 ? 4    LEU C CD2 1 
ATOM   3628 N N   . GLY C 1 5   ? 100.197 75.239  20.400 1.00 23.43 ? 5    GLY C N   1 
ATOM   3629 C CA  . GLY C 1 5   ? 99.474  76.386  20.908 1.00 25.82 ? 5    GLY C CA  1 
ATOM   3630 C C   . GLY C 1 5   ? 99.305  76.338  22.409 1.00 25.10 ? 5    GLY C C   1 
ATOM   3631 O O   . GLY C 1 5   ? 98.847  75.338  22.952 1.00 25.68 ? 5    GLY C O   1 
ATOM   3632 N N   . TYR C 1 6   ? 99.684  77.424  23.073 1.00 24.08 ? 6    TYR C N   1 
ATOM   3633 C CA  . TYR C 1 6   ? 99.554  77.552  24.520 1.00 24.87 ? 6    TYR C CA  1 
ATOM   3634 C C   . TYR C 1 6   ? 99.735  79.016  24.896 1.00 20.06 ? 6    TYR C C   1 
ATOM   3635 O O   . TYR C 1 6   ? 100.019 79.838  24.032 1.00 21.86 ? 6    TYR C O   1 
ATOM   3636 C CB  . TYR C 1 6   ? 100.614 76.707  25.235 1.00 16.88 ? 6    TYR C CB  1 
ATOM   3637 C CG  . TYR C 1 6   ? 100.221 76.343  26.648 1.00 10.52 ? 6    TYR C CG  1 
ATOM   3638 C CD1 . TYR C 1 6   ? 99.035  75.656  26.904 1.00 7.22  ? 6    TYR C CD1 1 
ATOM   3639 C CD2 . TYR C 1 6   ? 100.994 76.745  27.733 1.00 6.72  ? 6    TYR C CD2 1 
ATOM   3640 C CE1 . TYR C 1 6   ? 98.627  75.389  28.194 1.00 5.79  ? 6    TYR C CE1 1 
ATOM   3641 C CE2 . TYR C 1 6   ? 100.594 76.471  29.036 1.00 9.09  ? 6    TYR C CE2 1 
ATOM   3642 C CZ  . TYR C 1 6   ? 99.406  75.801  29.257 1.00 4.06  ? 6    TYR C CZ  1 
ATOM   3643 O OH  . TYR C 1 6   ? 98.972  75.587  30.546 1.00 17.93 ? 6    TYR C OH  1 
ATOM   3644 N N   . TRP C 1 7   ? 99.569  79.343  26.177 1.00 18.81 ? 7    TRP C N   1 
ATOM   3645 C CA  . TRP C 1 7   ? 99.867  80.693  26.659 1.00 23.08 ? 7    TRP C CA  1 
ATOM   3646 C C   . TRP C 1 7   ? 101.365 80.978  26.670 1.00 28.68 ? 7    TRP C C   1 
ATOM   3647 O O   . TRP C 1 7   ? 102.186 80.060  26.625 1.00 30.41 ? 7    TRP C O   1 
ATOM   3648 C CB  . TRP C 1 7   ? 99.358  80.898  28.080 1.00 25.40 ? 7    TRP C CB  1 
ATOM   3649 C CG  . TRP C 1 7   ? 97.944  80.556  28.271 1.00 22.36 ? 7    TRP C CG  1 
ATOM   3650 C CD1 . TRP C 1 7   ? 97.450  79.444  28.886 1.00 25.89 ? 7    TRP C CD1 1 
ATOM   3651 C CD2 . TRP C 1 7   ? 96.814  81.302  27.815 1.00 20.43 ? 7    TRP C CD2 1 
ATOM   3652 N NE1 . TRP C 1 7   ? 96.077  79.444  28.831 1.00 25.02 ? 7    TRP C NE1 1 
ATOM   3653 C CE2 . TRP C 1 7   ? 95.660  80.569  28.168 1.00 25.02 ? 7    TRP C CE2 1 
ATOM   3654 C CE3 . TRP C 1 7   ? 96.663  82.516  27.144 1.00 15.81 ? 7    TRP C CE3 1 
ATOM   3655 C CZ2 . TRP C 1 7   ? 94.369  81.009  27.860 1.00 22.10 ? 7    TRP C CZ2 1 
ATOM   3656 C CZ3 . TRP C 1 7   ? 95.381  82.952  26.839 1.00 19.33 ? 7    TRP C CZ3 1 
ATOM   3657 C CH2 . TRP C 1 7   ? 94.253  82.200  27.195 1.00 22.55 ? 7    TRP C CH2 1 
ATOM   3658 N N   . ASP C 1 8   ? 101.700 82.236  26.930 1.00 29.00 ? 8    ASP C N   1 
ATOM   3659 C CA  . ASP C 1 8   ? 103.086 82.655  27.107 1.00 36.54 ? 8    ASP C CA  1 
ATOM   3660 C C   . ASP C 1 8   ? 103.549 82.364  28.537 1.00 38.30 ? 8    ASP C C   1 
ATOM   3661 O O   . ASP C 1 8   ? 104.066 83.242  29.229 1.00 44.70 ? 8    ASP C O   1 
ATOM   3662 C CB  . ASP C 1 8   ? 103.196 84.152  26.828 1.00 40.04 ? 8    ASP C CB  1 
ATOM   3663 C CG  . ASP C 1 8   ? 104.478 84.528  26.114 1.00 51.34 ? 8    ASP C CG  1 
ATOM   3664 O OD1 . ASP C 1 8   ? 105.572 84.126  26.575 1.00 58.35 ? 8    ASP C OD1 1 
ATOM   3665 O OD2 . ASP C 1 8   ? 104.392 85.281  25.118 1.00 56.74 ? 8    ASP C OD2 1 
ATOM   3666 N N   . ILE C 1 9   ? 103.333 81.132  28.981 1.00 39.97 ? 9    ILE C N   1 
ATOM   3667 C CA  . ILE C 1 9   ? 103.652 80.712  30.339 1.00 35.72 ? 9    ILE C CA  1 
ATOM   3668 C C   . ILE C 1 9   ? 104.255 79.299  30.245 1.00 34.53 ? 9    ILE C C   1 
ATOM   3669 O O   . ILE C 1 9   ? 104.228 78.682  29.179 1.00 39.36 ? 9    ILE C O   1 
ATOM   3670 C CB  . ILE C 1 9   ? 102.349 80.747  31.192 1.00 35.58 ? 9    ILE C CB  1 
ATOM   3671 C CG1 . ILE C 1 9   ? 101.983 82.202  31.481 1.00 30.77 ? 9    ILE C CG1 1 
ATOM   3672 C CG2 . ILE C 1 9   ? 102.496 79.967  32.483 1.00 37.61 ? 9    ILE C CG2 1 
ATOM   3673 C CD1 . ILE C 1 9   ? 100.703 82.365  32.252 1.00 40.79 ? 9    ILE C CD1 1 
ATOM   3674 N N   . ARG C 1 10  ? 104.928 78.856  31.301 1.00 27.18 ? 10   ARG C N   1 
ATOM   3675 C CA  . ARG C 1 10  ? 105.471 77.504  31.340 1.00 20.82 ? 10   ARG C CA  1 
ATOM   3676 C C   . ARG C 1 10  ? 104.358 76.450  31.423 1.00 23.10 ? 10   ARG C C   1 
ATOM   3677 O O   . ARG C 1 10  ? 104.180 75.654  30.494 1.00 30.61 ? 10   ARG C O   1 
ATOM   3678 C CB  . ARG C 1 10  ? 106.428 77.374  32.520 1.00 11.41 ? 10   ARG C CB  1 
ATOM   3679 C CG  . ARG C 1 10  ? 107.156 76.057  32.607 1.00 5.60  ? 10   ARG C CG  1 
ATOM   3680 C CD  . ARG C 1 10  ? 108.054 76.066  33.826 1.00 10.90 ? 10   ARG C CD  1 
ATOM   3681 N NE  . ARG C 1 10  ? 108.100 74.776  34.509 1.00 17.78 ? 10   ARG C NE  1 
ATOM   3682 C CZ  . ARG C 1 10  ? 109.130 74.363  35.243 1.00 17.65 ? 10   ARG C CZ  1 
ATOM   3683 N NH1 . ARG C 1 10  ? 110.194 75.142  35.401 1.00 13.25 ? 10   ARG C NH1 1 
ATOM   3684 N NH2 . ARG C 1 10  ? 109.112 73.158  35.793 1.00 15.64 ? 10   ARG C NH2 1 
ATOM   3685 N N   . GLY C 1 11  ? 103.616 76.460  32.530 1.00 25.06 ? 11   GLY C N   1 
ATOM   3686 C CA  . GLY C 1 11  ? 102.455 75.598  32.694 1.00 18.80 ? 11   GLY C CA  1 
ATOM   3687 C C   . GLY C 1 11  ? 102.590 74.157  32.244 1.00 18.90 ? 11   GLY C C   1 
ATOM   3688 O O   . GLY C 1 11  ? 103.615 73.514  32.462 1.00 26.36 ? 11   GLY C O   1 
ATOM   3689 N N   . LEU C 1 12  ? 101.567 73.694  31.531 1.00 23.53 ? 12   LEU C N   1 
ATOM   3690 C CA  . LEU C 1 12  ? 101.445 72.307  31.076 1.00 16.89 ? 12   LEU C CA  1 
ATOM   3691 C C   . LEU C 1 12  ? 102.274 71.971  29.841 1.00 23.00 ? 12   LEU C C   1 
ATOM   3692 O O   . LEU C 1 12  ? 102.471 70.793  29.526 1.00 29.02 ? 12   LEU C O   1 
ATOM   3693 C CB  . LEU C 1 12  ? 99.983  71.995  30.774 1.00 14.59 ? 12   LEU C CB  1 
ATOM   3694 C CG  . LEU C 1 12  ? 99.256  71.089  31.754 1.00 17.32 ? 12   LEU C CG  1 
ATOM   3695 C CD1 . LEU C 1 12  ? 100.020 71.087  33.062 1.00 25.95 ? 12   LEU C CD1 1 
ATOM   3696 C CD2 . LEU C 1 12  ? 97.826  71.562  31.954 1.00 13.69 ? 12   LEU C CD2 1 
ATOM   3697 N N   . ALA C 1 13  ? 102.701 73.002  29.115 1.00 18.96 ? 13   ALA C N   1 
ATOM   3698 C CA  . ALA C 1 13  ? 103.384 72.816  27.848 1.00 19.55 ? 13   ALA C CA  1 
ATOM   3699 C C   . ALA C 1 13  ? 104.888 72.654  28.009 1.00 19.78 ? 13   ALA C C   1 
ATOM   3700 O O   . ALA C 1 13  ? 105.595 72.444  27.027 1.00 20.94 ? 13   ALA C O   1 
ATOM   3701 C CB  . ALA C 1 13  ? 103.090 73.971  26.937 1.00 16.17 ? 13   ALA C CB  1 
ATOM   3702 N N   . HIS C 1 14  ? 105.367 72.711  29.248 1.00 18.61 ? 14   HIS C N   1 
ATOM   3703 C CA  . HIS C 1 14  ? 106.789 72.606  29.507 1.00 22.44 ? 14   HIS C CA  1 
ATOM   3704 C C   . HIS C 1 14  ? 107.333 71.253  29.081 1.00 24.67 ? 14   HIS C C   1 
ATOM   3705 O O   . HIS C 1 14  ? 108.321 71.181  28.349 1.00 32.30 ? 14   HIS C O   1 
ATOM   3706 C CB  . HIS C 1 14  ? 107.087 72.831  30.984 1.00 23.48 ? 14   HIS C CB  1 
ATOM   3707 C CG  . HIS C 1 14  ? 108.546 72.963  31.290 1.00 27.06 ? 14   HIS C CG  1 
ATOM   3708 N ND1 . HIS C 1 14  ? 109.388 73.776  30.556 1.00 28.11 ? 14   HIS C ND1 1 
ATOM   3709 C CD2 . HIS C 1 14  ? 109.315 72.397  32.249 1.00 30.60 ? 14   HIS C CD2 1 
ATOM   3710 C CE1 . HIS C 1 14  ? 110.609 73.707  31.057 1.00 31.60 ? 14   HIS C CE1 1 
ATOM   3711 N NE2 . HIS C 1 14  ? 110.593 72.878  32.086 1.00 31.80 ? 14   HIS C NE2 1 
ATOM   3712 N N   . ALA C 1 15  ? 106.653 70.187  29.490 1.00 20.31 ? 15   ALA C N   1 
ATOM   3713 C CA  . ALA C 1 15  ? 107.081 68.829  29.160 1.00 18.34 ? 15   ALA C CA  1 
ATOM   3714 C C   . ALA C 1 15  ? 107.049 68.579  27.658 1.00 18.30 ? 15   ALA C C   1 
ATOM   3715 O O   . ALA C 1 15  ? 107.863 67.829  27.118 1.00 21.36 ? 15   ALA C O   1 
ATOM   3716 C CB  . ALA C 1 15  ? 106.194 67.825  29.868 1.00 13.94 ? 15   ALA C CB  1 
ATOM   3717 N N   . ILE C 1 16  ? 106.088 69.207  26.993 1.00 16.15 ? 16   ILE C N   1 
ATOM   3718 C CA  . ILE C 1 16  ? 105.870 69.001  25.571 1.00 12.33 ? 16   ILE C CA  1 
ATOM   3719 C C   . ILE C 1 16  ? 106.962 69.717  24.774 1.00 15.31 ? 16   ILE C C   1 
ATOM   3720 O O   . ILE C 1 16  ? 107.525 69.157  23.836 1.00 16.27 ? 16   ILE C O   1 
ATOM   3721 C CB  . ILE C 1 16  ? 104.474 69.521  25.166 1.00 8.89  ? 16   ILE C CB  1 
ATOM   3722 C CG1 . ILE C 1 16  ? 103.422 68.952  26.113 1.00 4.54  ? 16   ILE C CG1 1 
ATOM   3723 C CG2 . ILE C 1 16  ? 104.155 69.128  23.742 1.00 2.16  ? 16   ILE C CG2 1 
ATOM   3724 C CD1 . ILE C 1 16  ? 102.046 69.487  25.882 1.00 6.85  ? 16   ILE C CD1 1 
ATOM   3725 N N   . ARG C 1 17  ? 107.340 70.908  25.233 1.00 16.20 ? 17   ARG C N   1 
ATOM   3726 C CA  . ARG C 1 17  ? 108.411 71.673  24.608 1.00 13.14 ? 17   ARG C CA  1 
ATOM   3727 C C   . ARG C 1 17  ? 109.744 70.933  24.675 1.00 18.94 ? 17   ARG C C   1 
ATOM   3728 O O   . ARG C 1 17  ? 110.400 70.722  23.652 1.00 16.59 ? 17   ARG C O   1 
ATOM   3729 C CB  . ARG C 1 17  ? 108.539 73.038  25.275 1.00 10.91 ? 17   ARG C CB  1 
ATOM   3730 C CG  . ARG C 1 17  ? 107.401 73.992  24.941 1.00 10.98 ? 17   ARG C CG  1 
ATOM   3731 C CD  . ARG C 1 17  ? 107.472 75.244  25.796 1.00 4.50  ? 17   ARG C CD  1 
ATOM   3732 N NE  . ARG C 1 17  ? 106.394 76.181  25.494 1.00 12.76 ? 17   ARG C NE  1 
ATOM   3733 C CZ  . ARG C 1 17  ? 105.710 76.855  26.416 1.00 18.43 ? 17   ARG C CZ  1 
ATOM   3734 N NH1 . ARG C 1 17  ? 106.000 76.701  27.704 1.00 17.57 ? 17   ARG C NH1 1 
ATOM   3735 N NH2 . ARG C 1 17  ? 104.734 77.684  26.054 1.00 10.11 ? 17   ARG C NH2 1 
ATOM   3736 N N   . LEU C 1 18  ? 110.076 70.434  25.861 1.00 20.47 ? 18   LEU C N   1 
ATOM   3737 C CA  . LEU C 1 18  ? 111.281 69.638  26.050 1.00 22.28 ? 18   LEU C CA  1 
ATOM   3738 C C   . LEU C 1 18  ? 111.303 68.383  25.185 1.00 23.31 ? 18   LEU C C   1 
ATOM   3739 O O   . LEU C 1 18  ? 112.360 67.960  24.731 1.00 33.03 ? 18   LEU C O   1 
ATOM   3740 C CB  . LEU C 1 18  ? 111.422 69.248  27.517 1.00 20.92 ? 18   LEU C CB  1 
ATOM   3741 C CG  . LEU C 1 18  ? 111.586 70.395  28.516 1.00 27.40 ? 18   LEU C CG  1 
ATOM   3742 C CD1 . LEU C 1 18  ? 111.301 69.888  29.916 1.00 29.87 ? 18   LEU C CD1 1 
ATOM   3743 C CD2 . LEU C 1 18  ? 112.989 70.970  28.436 1.00 26.03 ? 18   LEU C CD2 1 
ATOM   3744 N N   . LEU C 1 19  ? 110.137 67.779  24.977 1.00 24.68 ? 19   LEU C N   1 
ATOM   3745 C CA  . LEU C 1 19  ? 110.033 66.538  24.209 1.00 18.41 ? 19   LEU C CA  1 
ATOM   3746 C C   . LEU C 1 19  ? 110.219 66.824  22.742 1.00 16.88 ? 19   LEU C C   1 
ATOM   3747 O O   . LEU C 1 19  ? 110.895 66.080  22.044 1.00 27.88 ? 19   LEU C O   1 
ATOM   3748 C CB  . LEU C 1 19  ? 108.666 65.876  24.404 1.00 25.13 ? 19   LEU C CB  1 
ATOM   3749 C CG  . LEU C 1 19  ? 108.564 64.340  24.409 1.00 25.40 ? 19   LEU C CG  1 
ATOM   3750 C CD1 . LEU C 1 19  ? 107.281 63.925  23.698 1.00 25.08 ? 19   LEU C CD1 1 
ATOM   3751 C CD2 . LEU C 1 19  ? 109.773 63.691  23.750 1.00 23.96 ? 19   LEU C CD2 1 
ATOM   3752 N N   . LEU C 1 20  ? 109.585 67.890  22.276 1.00 14.07 ? 20   LEU C N   1 
ATOM   3753 C CA  . LEU C 1 20  ? 109.748 68.349  20.906 1.00 16.35 ? 20   LEU C CA  1 
ATOM   3754 C C   . LEU C 1 20  ? 111.218 68.621  20.577 1.00 20.81 ? 20   LEU C C   1 
ATOM   3755 O O   . LEU C 1 20  ? 111.701 68.286  19.491 1.00 28.63 ? 20   LEU C O   1 
ATOM   3756 C CB  . LEU C 1 20  ? 108.929 69.621  20.707 1.00 17.92 ? 20   LEU C CB  1 
ATOM   3757 C CG  . LEU C 1 20  ? 107.419 69.421  20.592 1.00 12.82 ? 20   LEU C CG  1 
ATOM   3758 C CD1 . LEU C 1 20  ? 106.727 70.763  20.590 1.00 17.71 ? 20   LEU C CD1 1 
ATOM   3759 C CD2 . LEU C 1 20  ? 107.097 68.656  19.324 1.00 9.60  ? 20   LEU C CD2 1 
ATOM   3760 N N   . GLU C 1 21  ? 111.931 69.200  21.541 1.00 30.34 ? 21   GLU C N   1 
ATOM   3761 C CA  . GLU C 1 21  ? 113.338 69.544  21.363 1.00 24.17 ? 21   GLU C CA  1 
ATOM   3762 C C   . GLU C 1 21  ? 114.225 68.304  21.359 1.00 23.82 ? 21   GLU C C   1 
ATOM   3763 O O   . GLU C 1 21  ? 115.066 68.157  20.473 1.00 34.60 ? 21   GLU C O   1 
ATOM   3764 C CB  . GLU C 1 21  ? 113.796 70.526  22.452 1.00 20.88 ? 21   GLU C CB  1 
ATOM   3765 C CG  . GLU C 1 21  ? 113.329 71.988  22.252 1.00 21.65 ? 21   GLU C CG  1 
ATOM   3766 C CD  . GLU C 1 21  ? 114.036 72.743  21.108 1.00 24.34 ? 21   GLU C CD  1 
ATOM   3767 O OE1 . GLU C 1 21  ? 115.018 72.229  20.515 1.00 28.90 ? 21   GLU C OE1 1 
ATOM   3768 O OE2 . GLU C 1 21  ? 113.596 73.869  20.792 1.00 23.42 ? 21   GLU C OE2 1 
ATOM   3769 N N   . TYR C 1 22  ? 113.980 67.382  22.291 1.00 20.66 ? 22   TYR C N   1 
ATOM   3770 C CA  . TYR C 1 22  ? 114.756 66.143  22.379 1.00 26.73 ? 22   TYR C CA  1 
ATOM   3771 C C   . TYR C 1 22  ? 114.599 65.272  21.137 1.00 30.47 ? 22   TYR C C   1 
ATOM   3772 O O   . TYR C 1 22  ? 115.538 64.602  20.705 1.00 29.24 ? 22   TYR C O   1 
ATOM   3773 C CB  . TYR C 1 22  ? 114.350 65.330  23.609 1.00 25.72 ? 22   TYR C CB  1 
ATOM   3774 C CG  . TYR C 1 22  ? 114.988 63.954  23.670 1.00 24.36 ? 22   TYR C CG  1 
ATOM   3775 C CD1 . TYR C 1 22  ? 116.310 63.789  24.077 1.00 19.73 ? 22   TYR C CD1 1 
ATOM   3776 C CD2 . TYR C 1 22  ? 114.278 62.825  23.283 1.00 23.43 ? 22   TYR C CD2 1 
ATOM   3777 C CE1 . TYR C 1 22  ? 116.910 62.525  24.093 1.00 21.28 ? 22   TYR C CE1 1 
ATOM   3778 C CE2 . TYR C 1 22  ? 114.868 61.564  23.294 1.00 27.91 ? 22   TYR C CE2 1 
ATOM   3779 C CZ  . TYR C 1 22  ? 116.182 61.417  23.695 1.00 21.09 ? 22   TYR C CZ  1 
ATOM   3780 O OH  . TYR C 1 22  ? 116.757 60.161  23.663 1.00 24.85 ? 22   TYR C OH  1 
ATOM   3781 N N   . THR C 1 23  ? 113.390 65.248  20.595 1.00 35.45 ? 23   THR C N   1 
ATOM   3782 C CA  . THR C 1 23  ? 113.098 64.422  19.434 1.00 36.77 ? 23   THR C CA  1 
ATOM   3783 C C   . THR C 1 23  ? 113.460 65.133  18.132 1.00 33.59 ? 23   THR C C   1 
ATOM   3784 O O   . THR C 1 23  ? 113.378 64.552  17.050 1.00 38.07 ? 23   THR C O   1 
ATOM   3785 C CB  . THR C 1 23  ? 111.607 64.024  19.410 1.00 41.27 ? 23   THR C CB  1 
ATOM   3786 O OG1 . THR C 1 23  ? 110.793 65.203  19.466 1.00 35.30 ? 23   THR C OG1 1 
ATOM   3787 C CG2 . THR C 1 23  ? 111.280 63.111  20.600 1.00 41.04 ? 23   THR C CG2 1 
ATOM   3788 N N   . GLU C 1 24  ? 113.868 66.392  18.249 1.00 31.79 ? 24   GLU C N   1 
ATOM   3789 C CA  . GLU C 1 24  ? 114.280 67.189  17.101 1.00 40.99 ? 24   GLU C CA  1 
ATOM   3790 C C   . GLU C 1 24  ? 113.148 67.365  16.087 1.00 39.09 ? 24   GLU C C   1 
ATOM   3791 O O   . GLU C 1 24  ? 113.387 67.492  14.886 1.00 49.25 ? 24   GLU C O   1 
ATOM   3792 C CB  . GLU C 1 24  ? 115.508 66.553  16.432 1.00 48.37 ? 24   GLU C CB  1 
ATOM   3793 C CG  . GLU C 1 24  ? 116.652 66.239  17.400 1.00 63.31 ? 24   GLU C CG  1 
ATOM   3794 C CD  . GLU C 1 24  ? 117.875 65.668  16.709 1.00 67.18 ? 24   GLU C CD  1 
ATOM   3795 O OE1 . GLU C 1 24  ? 117.756 64.611  16.053 1.00 67.14 ? 24   GLU C OE1 1 
ATOM   3796 O OE2 . GLU C 1 24  ? 118.895 66.384  16.644 1.00 68.40 ? 24   GLU C OE2 1 
ATOM   3797 N N   . THR C 1 25  ? 111.917 67.354  16.583 1.00 35.10 ? 25   THR C N   1 
ATOM   3798 C CA  . THR C 1 25  ? 110.743 67.614  15.762 1.00 34.07 ? 25   THR C CA  1 
ATOM   3799 C C   . THR C 1 25  ? 110.740 69.093  15.394 1.00 27.83 ? 25   THR C C   1 
ATOM   3800 O O   . THR C 1 25  ? 110.904 69.951  16.258 1.00 37.30 ? 25   THR C O   1 
ATOM   3801 C CB  . THR C 1 25  ? 109.436 67.275  16.542 1.00 34.02 ? 25   THR C CB  1 
ATOM   3802 O OG1 . THR C 1 25  ? 109.483 65.911  16.984 1.00 45.13 ? 25   THR C OG1 1 
ATOM   3803 C CG2 . THR C 1 25  ? 108.197 67.471  15.661 1.00 42.36 ? 25   THR C CG2 1 
ATOM   3804 N N   . PRO C 1 26  ? 110.654 69.403  14.092 1.00 23.77 ? 26   PRO C N   1 
ATOM   3805 C CA  . PRO C 1 26  ? 110.513 70.782  13.622 1.00 21.98 ? 26   PRO C CA  1 
ATOM   3806 C C   . PRO C 1 26  ? 109.184 71.368  14.074 1.00 26.36 ? 26   PRO C C   1 
ATOM   3807 O O   . PRO C 1 26  ? 108.131 70.848  13.710 1.00 33.51 ? 26   PRO C O   1 
ATOM   3808 C CB  . PRO C 1 26  ? 110.569 70.636  12.102 1.00 22.57 ? 26   PRO C CB  1 
ATOM   3809 C CG  . PRO C 1 26  ? 110.037 69.262  11.855 1.00 25.04 ? 26   PRO C CG  1 
ATOM   3810 C CD  . PRO C 1 26  ? 110.605 68.444  12.974 1.00 26.57 ? 26   PRO C CD  1 
ATOM   3811 N N   . TYR C 1 27  ? 109.234 72.426  14.882 1.00 26.27 ? 27   TYR C N   1 
ATOM   3812 C CA  . TYR C 1 27  ? 108.014 73.056  15.375 1.00 18.26 ? 27   TYR C CA  1 
ATOM   3813 C C   . TYR C 1 27  ? 108.118 74.576  15.509 1.00 20.14 ? 27   TYR C C   1 
ATOM   3814 O O   . TYR C 1 27  ? 109.209 75.123  15.654 1.00 29.22 ? 27   TYR C O   1 
ATOM   3815 C CB  . TYR C 1 27  ? 107.600 72.430  16.721 1.00 21.81 ? 27   TYR C CB  1 
ATOM   3816 C CG  . TYR C 1 27  ? 108.380 72.906  17.929 1.00 19.89 ? 27   TYR C CG  1 
ATOM   3817 C CD1 . TYR C 1 27  ? 109.652 72.414  18.195 1.00 20.20 ? 27   TYR C CD1 1 
ATOM   3818 C CD2 . TYR C 1 27  ? 107.881 73.914  18.756 1.00 20.51 ? 27   TYR C CD2 1 
ATOM   3819 C CE1 . TYR C 1 27  ? 110.418 72.921  19.240 1.00 21.92 ? 27   TYR C CE1 1 
ATOM   3820 C CE2 . TYR C 1 27  ? 108.646 74.435  19.799 1.00 15.42 ? 27   TYR C CE2 1 
ATOM   3821 C CZ  . TYR C 1 27  ? 109.916 73.936  20.025 1.00 22.35 ? 27   TYR C CZ  1 
ATOM   3822 O OH  . TYR C 1 27  ? 110.733 74.506  20.970 1.00 23.61 ? 27   TYR C OH  1 
ATOM   3823 N N   . GLN C 1 28  ? 106.969 75.244  15.487 1.00 25.38 ? 28   GLN C N   1 
ATOM   3824 C CA  . GLN C 1 28  ? 106.868 76.638  15.914 1.00 29.18 ? 28   GLN C CA  1 
ATOM   3825 C C   . GLN C 1 28  ? 105.789 76.764  16.984 1.00 27.50 ? 28   GLN C C   1 
ATOM   3826 O O   . GLN C 1 28  ? 105.102 75.794  17.288 1.00 32.39 ? 28   GLN C O   1 
ATOM   3827 C CB  . GLN C 1 28  ? 106.554 77.555  14.720 1.00 35.18 ? 28   GLN C CB  1 
ATOM   3828 C CG  . GLN C 1 28  ? 105.125 77.459  14.163 1.00 37.00 ? 28   GLN C CG  1 
ATOM   3829 C CD  . GLN C 1 28  ? 105.068 77.589  12.643 1.00 33.83 ? 28   GLN C CD  1 
ATOM   3830 O OE1 . GLN C 1 28  ? 104.154 77.069  12.004 1.00 35.73 ? 28   GLN C OE1 1 
ATOM   3831 N NE2 . GLN C 1 28  ? 106.066 78.253  12.059 1.00 31.88 ? 28   GLN C NE2 1 
ATOM   3832 N N   . GLU C 1 29  ? 105.651 77.951  17.565 1.00 26.98 ? 29   GLU C N   1 
ATOM   3833 C CA  . GLU C 1 29  ? 104.745 78.133  18.694 1.00 22.36 ? 29   GLU C CA  1 
ATOM   3834 C C   . GLU C 1 29  ? 103.756 79.281  18.504 1.00 22.23 ? 29   GLU C C   1 
ATOM   3835 O O   . GLU C 1 29  ? 104.150 80.409  18.210 1.00 30.06 ? 29   GLU C O   1 
ATOM   3836 C CB  . GLU C 1 29  ? 105.543 78.364  19.978 1.00 17.76 ? 29   GLU C CB  1 
ATOM   3837 C CG  . GLU C 1 29  ? 105.880 77.102  20.758 1.00 17.43 ? 29   GLU C CG  1 
ATOM   3838 C CD  . GLU C 1 29  ? 106.340 77.396  22.183 1.00 28.30 ? 29   GLU C CD  1 
ATOM   3839 O OE1 . GLU C 1 29  ? 105.527 77.905  22.992 1.00 32.85 ? 29   GLU C OE1 1 
ATOM   3840 O OE2 . GLU C 1 29  ? 107.513 77.105  22.499 1.00 24.19 ? 29   GLU C OE2 1 
ATOM   3841 N N   . ARG C 1 30  ? 102.470 78.988  18.687 1.00 23.64 ? 30   ARG C N   1 
ATOM   3842 C CA  . ARG C 1 30  ? 101.457 80.033  18.839 1.00 26.22 ? 30   ARG C CA  1 
ATOM   3843 C C   . ARG C 1 30  ? 101.243 80.334  20.321 1.00 26.84 ? 30   ARG C C   1 
ATOM   3844 O O   . ARG C 1 30  ? 100.478 79.653  21.001 1.00 34.31 ? 30   ARG C O   1 
ATOM   3845 C CB  . ARG C 1 30  ? 100.128 79.609  18.195 1.00 28.18 ? 30   ARG C CB  1 
ATOM   3846 C CG  . ARG C 1 30  ? 98.968  80.568  18.468 1.00 36.20 ? 30   ARG C CG  1 
ATOM   3847 C CD  . ARG C 1 30  ? 99.238  81.963  17.901 1.00 46.27 ? 30   ARG C CD  1 
ATOM   3848 N NE  . ARG C 1 30  ? 99.171  83.020  18.905 1.00 52.60 ? 30   ARG C NE  1 
ATOM   3849 C CZ  . ARG C 1 30  ? 98.294  84.020  18.883 1.00 46.96 ? 30   ARG C CZ  1 
ATOM   3850 N NH1 . ARG C 1 30  ? 97.270  84.003  18.034 1.00 42.68 ? 30   ARG C NH1 1 
ATOM   3851 N NH2 . ARG C 1 30  ? 98.388  84.991  19.777 1.00 41.17 ? 30   ARG C NH2 1 
ATOM   3852 N N   . ARG C 1 31  ? 101.990 81.304  20.835 1.00 27.13 ? 31   ARG C N   1 
ATOM   3853 C CA  . ARG C 1 31  ? 101.869 81.696  22.232 1.00 28.77 ? 31   ARG C CA  1 
ATOM   3854 C C   . ARG C 1 31  ? 100.791 82.756  22.373 1.00 33.21 ? 31   ARG C C   1 
ATOM   3855 O O   . ARG C 1 31  ? 100.785 83.758  21.650 1.00 30.59 ? 31   ARG C O   1 
ATOM   3856 C CB  . ARG C 1 31  ? 103.202 82.224  22.770 1.00 31.04 ? 31   ARG C CB  1 
ATOM   3857 C CG  . ARG C 1 31  ? 104.305 81.171  22.849 1.00 35.90 ? 31   ARG C CG  1 
ATOM   3858 C CD  . ARG C 1 31  ? 105.400 81.597  23.798 1.00 34.89 ? 31   ARG C CD  1 
ATOM   3859 N NE  . ARG C 1 31  ? 106.563 80.719  23.740 1.00 34.57 ? 31   ARG C NE  1 
ATOM   3860 C CZ  . ARG C 1 31  ? 107.638 80.866  24.508 1.00 41.29 ? 31   ARG C CZ  1 
ATOM   3861 N NH1 . ARG C 1 31  ? 107.677 81.839  25.410 1.00 39.87 ? 31   ARG C NH1 1 
ATOM   3862 N NH2 . ARG C 1 31  ? 108.677 80.048  24.374 1.00 39.79 ? 31   ARG C NH2 1 
ATOM   3863 N N   . TYR C 1 32  ? 99.853  82.505  23.281 1.00 35.15 ? 32   TYR C N   1 
ATOM   3864 C CA  . TYR C 1 32  ? 98.699  83.373  23.440 1.00 29.41 ? 32   TYR C CA  1 
ATOM   3865 C C   . TYR C 1 32  ? 98.918  84.332  24.588 1.00 32.09 ? 32   TYR C C   1 
ATOM   3866 O O   . TYR C 1 32  ? 99.623  84.023  25.556 1.00 39.71 ? 32   TYR C O   1 
ATOM   3867 C CB  . TYR C 1 32  ? 97.431  82.548  23.673 1.00 34.20 ? 32   TYR C CB  1 
ATOM   3868 C CG  . TYR C 1 32  ? 96.940  81.821  22.441 1.00 38.59 ? 32   TYR C CG  1 
ATOM   3869 C CD1 . TYR C 1 32  ? 96.210  82.490  21.460 1.00 43.07 ? 32   TYR C CD1 1 
ATOM   3870 C CD2 . TYR C 1 32  ? 97.219  80.470  22.244 1.00 39.09 ? 32   TYR C CD2 1 
ATOM   3871 C CE1 . TYR C 1 32  ? 95.766  81.834  20.314 1.00 39.94 ? 32   TYR C CE1 1 
ATOM   3872 C CE2 . TYR C 1 32  ? 96.786  79.808  21.095 1.00 40.11 ? 32   TYR C CE2 1 
ATOM   3873 C CZ  . TYR C 1 32  ? 96.058  80.499  20.139 1.00 35.80 ? 32   TYR C CZ  1 
ATOM   3874 O OH  . TYR C 1 32  ? 95.617  79.856  19.010 1.00 37.99 ? 32   TYR C OH  1 
ATOM   3875 N N   . LYS C 1 33  ? 98.306  85.503  24.471 1.00 37.70 ? 33   LYS C N   1 
ATOM   3876 C CA  . LYS C 1 33  ? 98.534  86.575  25.421 1.00 39.95 ? 33   LYS C CA  1 
ATOM   3877 C C   . LYS C 1 33  ? 97.254  87.017  26.107 1.00 46.39 ? 33   LYS C C   1 
ATOM   3878 O O   . LYS C 1 33  ? 96.170  87.040  25.501 1.00 41.81 ? 33   LYS C O   1 
ATOM   3879 C CB  . LYS C 1 33  ? 99.195  87.768  24.729 1.00 42.31 ? 33   LYS C CB  1 
ATOM   3880 C CG  . LYS C 1 33  ? 100.664 87.556  24.376 1.00 49.20 ? 33   LYS C CG  1 
ATOM   3881 C CD  . LYS C 1 33  ? 101.597 87.966  25.518 1.00 53.20 ? 33   LYS C CD  1 
ATOM   3882 C CE  . LYS C 1 33  ? 101.496 87.024  26.718 1.00 54.40 ? 33   LYS C CE  1 
ATOM   3883 N NZ  . LYS C 1 33  ? 102.511 87.303  27.778 1.00 54.81 ? 33   LYS C NZ  1 
ATOM   3884 N N   . ALA C 1 34  ? 97.380  87.290  27.403 1.00 43.57 ? 34   ALA C N   1 
ATOM   3885 C CA  . ALA C 1 34  ? 96.290  87.859  28.176 1.00 41.16 ? 34   ALA C CA  1 
ATOM   3886 C C   . ALA C 1 34  ? 96.408  89.383  28.184 1.00 45.77 ? 34   ALA C C   1 
ATOM   3887 O O   . ALA C 1 34  ? 97.473  89.937  27.889 1.00 50.00 ? 34   ALA C O   1 
ATOM   3888 C CB  . ALA C 1 34  ? 96.320  87.313  29.596 1.00 36.32 ? 34   ALA C CB  1 
ATOM   3889 N N   . GLY C 1 35  ? 95.290  90.055  28.450 1.00 45.43 ? 35   GLY C N   1 
ATOM   3890 C CA  . GLY C 1 35  ? 95.315  91.493  28.650 1.00 45.85 ? 35   GLY C CA  1 
ATOM   3891 C C   . GLY C 1 35  ? 96.056  91.861  29.928 1.00 47.25 ? 35   GLY C C   1 
ATOM   3892 O O   . GLY C 1 35  ? 96.474  90.973  30.677 1.00 44.19 ? 35   GLY C O   1 
ATOM   3893 N N   . PRO C 1 36  ? 96.309  93.158  30.169 1.00 46.47 ? 36   PRO C N   1 
ATOM   3894 C CA  . PRO C 1 36  ? 96.972  93.579  31.411 1.00 46.36 ? 36   PRO C CA  1 
ATOM   3895 C C   . PRO C 1 36  ? 96.135  93.374  32.679 1.00 47.40 ? 36   PRO C C   1 
ATOM   3896 O O   . PRO C 1 36  ? 94.967  92.981  32.618 1.00 47.83 ? 36   PRO C O   1 
ATOM   3897 C CB  . PRO C 1 36  ? 97.288  95.054  31.160 1.00 43.94 ? 36   PRO C CB  1 
ATOM   3898 C CG  . PRO C 1 36  ? 97.347  95.167  29.662 1.00 39.64 ? 36   PRO C CG  1 
ATOM   3899 C CD  . PRO C 1 36  ? 96.260  94.256  29.186 1.00 41.59 ? 36   PRO C CD  1 
ATOM   3900 N N   . ALA C 1 37  ? 96.760  93.617  33.828 1.00 46.03 ? 37   ALA C N   1 
ATOM   3901 C CA  . ALA C 1 37  ? 96.116  93.423  35.122 1.00 48.00 ? 37   ALA C CA  1 
ATOM   3902 C C   . ALA C 1 37  ? 95.107  94.538  35.442 1.00 50.99 ? 37   ALA C C   1 
ATOM   3903 O O   . ALA C 1 37  ? 95.276  95.680  35.010 1.00 49.02 ? 37   ALA C O   1 
ATOM   3904 C CB  . ALA C 1 37  ? 97.179  93.347  36.210 1.00 46.79 ? 37   ALA C CB  1 
ATOM   3905 N N   . PRO C 1 38  ? 94.072  94.230  36.250 1.00 51.70 ? 38   PRO C N   1 
ATOM   3906 C CA  . PRO C 1 38  ? 93.783  92.915  36.839 1.00 56.04 ? 38   PRO C CA  1 
ATOM   3907 C C   . PRO C 1 38  ? 92.856  92.029  35.993 1.00 60.34 ? 38   PRO C C   1 
ATOM   3908 O O   . PRO C 1 38  ? 92.617  90.865  36.330 1.00 63.31 ? 38   PRO C O   1 
ATOM   3909 C CB  . PRO C 1 38  ? 93.157  93.272  38.186 1.00 55.94 ? 38   PRO C CB  1 
ATOM   3910 C CG  . PRO C 1 38  ? 92.441  94.577  37.917 1.00 56.08 ? 38   PRO C CG  1 
ATOM   3911 C CD  . PRO C 1 38  ? 93.169  95.271  36.779 1.00 49.94 ? 38   PRO C CD  1 
ATOM   3912 N N   . ASP C 1 39  ? 92.359  92.579  34.888 1.00 61.87 ? 39   ASP C N   1 
ATOM   3913 C CA  . ASP C 1 39  ? 91.394  91.887  34.034 1.00 64.54 ? 39   ASP C CA  1 
ATOM   3914 C C   . ASP C 1 39  ? 91.954  90.599  33.438 1.00 65.23 ? 39   ASP C C   1 
ATOM   3915 O O   . ASP C 1 39  ? 91.318  89.543  33.513 1.00 63.21 ? 39   ASP C O   1 
ATOM   3916 C CB  . ASP C 1 39  ? 90.943  92.809  32.901 1.00 65.06 ? 39   ASP C CB  1 
ATOM   3917 C CG  . ASP C 1 39  ? 89.777  93.684  33.298 1.00 76.58 ? 39   ASP C CG  1 
ATOM   3918 O OD1 . ASP C 1 39  ? 89.914  94.471  34.263 1.00 80.44 ? 39   ASP C OD1 1 
ATOM   3919 O OD2 . ASP C 1 39  ? 88.717  93.574  32.647 1.00 81.38 ? 39   ASP C OD2 1 
ATOM   3920 N N   . PHE C 1 40  ? 93.162  90.699  32.882 1.00 63.62 ? 40   PHE C N   1 
ATOM   3921 C CA  . PHE C 1 40  ? 93.808  89.606  32.154 1.00 56.32 ? 40   PHE C CA  1 
ATOM   3922 C C   . PHE C 1 40  ? 92.936  89.063  31.015 1.00 53.25 ? 40   PHE C C   1 
ATOM   3923 O O   . PHE C 1 40  ? 92.513  87.905  31.024 1.00 52.18 ? 40   PHE C O   1 
ATOM   3924 C CB  . PHE C 1 40  ? 94.230  88.492  33.127 1.00 52.04 ? 40   PHE C CB  1 
ATOM   3925 C CG  . PHE C 1 40  ? 95.509  88.787  33.873 1.00 51.02 ? 40   PHE C CG  1 
ATOM   3926 C CD1 . PHE C 1 40  ? 96.654  89.197  33.186 1.00 52.30 ? 40   PHE C CD1 1 
ATOM   3927 C CD2 . PHE C 1 40  ? 95.557  88.710  35.259 1.00 51.21 ? 40   PHE C CD2 1 
ATOM   3928 C CE1 . PHE C 1 40  ? 97.826  89.535  33.871 1.00 50.96 ? 40   PHE C CE1 1 
ATOM   3929 C CE2 . PHE C 1 40  ? 96.725  89.044  35.955 1.00 51.15 ? 40   PHE C CE2 1 
ATOM   3930 C CZ  . PHE C 1 40  ? 97.860  89.460  35.255 1.00 50.51 ? 40   PHE C CZ  1 
ATOM   3931 N N   . ASP C 1 41  ? 92.741  89.905  30.005 1.00 53.68 ? 41   ASP C N   1 
ATOM   3932 C CA  . ASP C 1 41  ? 91.846  89.626  28.890 1.00 53.85 ? 41   ASP C CA  1 
ATOM   3933 C C   . ASP C 1 41  ? 92.290  88.432  28.037 1.00 56.21 ? 41   ASP C C   1 
ATOM   3934 O O   . ASP C 1 41  ? 93.285  88.507  27.311 1.00 55.50 ? 41   ASP C O   1 
ATOM   3935 C CB  . ASP C 1 41  ? 91.730  90.877  28.022 1.00 54.53 ? 41   ASP C CB  1 
ATOM   3936 C CG  . ASP C 1 41  ? 91.073  90.605  26.688 1.00 61.79 ? 41   ASP C CG  1 
ATOM   3937 O OD1 . ASP C 1 41  ? 89.855  90.319  26.673 1.00 61.29 ? 41   ASP C OD1 1 
ATOM   3938 O OD2 . ASP C 1 41  ? 91.780  90.681  25.658 1.00 67.17 ? 41   ASP C OD2 1 
ATOM   3939 N N   . PRO C 1 42  ? 91.483  87.355  28.034 1.00 57.75 ? 42   PRO C N   1 
ATOM   3940 C CA  . PRO C 1 42  ? 91.763  86.096  27.328 1.00 51.21 ? 42   PRO C CA  1 
ATOM   3941 C C   . PRO C 1 42  ? 91.451  86.122  25.829 1.00 51.38 ? 42   PRO C C   1 
ATOM   3942 O O   . PRO C 1 42  ? 91.570  85.102  25.149 1.00 54.86 ? 42   PRO C O   1 
ATOM   3943 C CB  . PRO C 1 42  ? 90.878  85.091  28.057 1.00 56.04 ? 42   PRO C CB  1 
ATOM   3944 C CG  . PRO C 1 42  ? 89.685  85.909  28.465 1.00 56.14 ? 42   PRO C CG  1 
ATOM   3945 C CD  . PRO C 1 42  ? 90.233  87.274  28.817 1.00 55.64 ? 42   PRO C CD  1 
ATOM   3946 N N   . SER C 1 43  ? 91.122  87.303  25.312 1.00 46.72 ? 43   SER C N   1 
ATOM   3947 C CA  . SER C 1 43  ? 90.539  87.429  23.982 1.00 42.08 ? 43   SER C CA  1 
ATOM   3948 C C   . SER C 1 43  ? 91.384  86.878  22.843 1.00 41.52 ? 43   SER C C   1 
ATOM   3949 O O   . SER C 1 43  ? 90.839  86.413  21.846 1.00 47.11 ? 43   SER C O   1 
ATOM   3950 C CB  . SER C 1 43  ? 90.174  88.883  23.690 1.00 41.42 ? 43   SER C CB  1 
ATOM   3951 O OG  . SER C 1 43  ? 88.976  89.245  24.356 1.00 46.65 ? 43   SER C OG  1 
ATOM   3952 N N   . ASP C 1 44  ? 92.705  86.916  22.986 1.00 38.39 ? 44   ASP C N   1 
ATOM   3953 C CA  . ASP C 1 44  ? 93.586  86.418  21.931 1.00 39.66 ? 44   ASP C CA  1 
ATOM   3954 C C   . ASP C 1 44  ? 93.290  84.954  21.619 1.00 39.29 ? 44   ASP C C   1 
ATOM   3955 O O   . ASP C 1 44  ? 93.300  84.544  20.455 1.00 38.92 ? 44   ASP C O   1 
ATOM   3956 C CB  . ASP C 1 44  ? 95.050  86.573  22.340 1.00 40.76 ? 44   ASP C CB  1 
ATOM   3957 C CG  . ASP C 1 44  ? 96.006  86.509  21.156 1.00 43.21 ? 44   ASP C CG  1 
ATOM   3958 O OD1 . ASP C 1 44  ? 95.566  86.428  19.982 1.00 42.08 ? 44   ASP C OD1 1 
ATOM   3959 O OD2 . ASP C 1 44  ? 97.221  86.564  21.416 1.00 44.99 ? 44   ASP C OD2 1 
ATOM   3960 N N   . TRP C 1 45  ? 92.968  84.191  22.662 1.00 37.25 ? 45   TRP C N   1 
ATOM   3961 C CA  . TRP C 1 45  ? 92.629  82.782  22.521 1.00 35.73 ? 45   TRP C CA  1 
ATOM   3962 C C   . TRP C 1 45  ? 91.151  82.591  22.183 1.00 39.32 ? 45   TRP C C   1 
ATOM   3963 O O   . TRP C 1 45  ? 90.822  81.917  21.207 1.00 43.23 ? 45   TRP C O   1 
ATOM   3964 C CB  . TRP C 1 45  ? 92.981  82.028  23.808 1.00 34.01 ? 45   TRP C CB  1 
ATOM   3965 C CG  . TRP C 1 45  ? 92.281  80.695  23.964 1.00 32.88 ? 45   TRP C CG  1 
ATOM   3966 C CD1 . TRP C 1 45  ? 91.380  80.348  24.940 1.00 32.94 ? 45   TRP C CD1 1 
ATOM   3967 C CD2 . TRP C 1 45  ? 92.381  79.558  23.090 1.00 31.46 ? 45   TRP C CD2 1 
ATOM   3968 N NE1 . TRP C 1 45  ? 90.903  79.083  24.713 1.00 28.36 ? 45   TRP C NE1 1 
ATOM   3969 C CE2 . TRP C 1 45  ? 91.507  78.566  23.593 1.00 28.86 ? 45   TRP C CE2 1 
ATOM   3970 C CE3 . TRP C 1 45  ? 93.121  79.282  21.929 1.00 27.01 ? 45   TRP C CE3 1 
ATOM   3971 C CZ2 . TRP C 1 45  ? 91.359  77.316  22.981 1.00 20.65 ? 45   TRP C CZ2 1 
ATOM   3972 C CZ3 . TRP C 1 45  ? 92.967  78.042  21.317 1.00 31.92 ? 45   TRP C CZ3 1 
ATOM   3973 C CH2 . TRP C 1 45  ? 92.093  77.074  21.849 1.00 27.53 ? 45   TRP C CH2 1 
ATOM   3974 N N   . THR C 1 46  ? 90.274  83.219  22.968 1.00 41.12 ? 46   THR C N   1 
ATOM   3975 C CA  . THR C 1 46  ? 88.830  83.000  22.861 1.00 40.76 ? 46   THR C CA  1 
ATOM   3976 C C   . THR C 1 46  ? 88.232  83.346  21.493 1.00 42.12 ? 46   THR C C   1 
ATOM   3977 O O   . THR C 1 46  ? 87.238  82.747  21.083 1.00 50.30 ? 46   THR C O   1 
ATOM   3978 C CB  . THR C 1 46  ? 88.055  83.776  23.957 1.00 40.65 ? 46   THR C CB  1 
ATOM   3979 O OG1 . THR C 1 46  ? 88.681  85.042  24.187 1.00 40.38 ? 46   THR C OG1 1 
ATOM   3980 C CG2 . THR C 1 46  ? 88.029  82.982  25.261 1.00 43.13 ? 46   THR C CG2 1 
ATOM   3981 N N   . ASN C 1 47  ? 88.894  84.238  20.758 1.00 40.03 ? 47   ASN C N   1 
ATOM   3982 C CA  . ASN C 1 47  ? 88.461  84.627  19.414 1.00 40.13 ? 47   ASN C CA  1 
ATOM   3983 C C   . ASN C 1 47  ? 88.914  83.654  18.331 1.00 39.37 ? 47   ASN C C   1 
ATOM   3984 O O   . ASN C 1 47  ? 88.572  83.807  17.155 1.00 41.79 ? 47   ASN C O   1 
ATOM   3985 C CB  . ASN C 1 47  ? 88.978  86.028  19.088 1.00 42.39 ? 47   ASN C CB  1 
ATOM   3986 C CG  . ASN C 1 47  ? 88.034  87.111  19.559 1.00 47.62 ? 47   ASN C CG  1 
ATOM   3987 O OD1 . ASN C 1 47  ? 87.651  87.154  20.731 1.00 51.42 ? 47   ASN C OD1 1 
ATOM   3988 N ND2 . ASN C 1 47  ? 87.557  87.915  18.624 1.00 47.28 ? 47   ASN C ND2 1 
ATOM   3989 N N   . GLU C 1 48  ? 89.572  82.586  18.767 1.00 37.15 ? 48   GLU C N   1 
ATOM   3990 C CA  . GLU C 1 48  ? 90.242  81.651  17.875 1.00 34.17 ? 48   GLU C CA  1 
ATOM   3991 C C   . GLU C 1 48  ? 89.887  80.217  18.279 1.00 33.44 ? 48   GLU C C   1 
ATOM   3992 O O   . GLU C 1 48  ? 90.002  79.295  17.470 1.00 33.83 ? 48   GLU C O   1 
ATOM   3993 C CB  . GLU C 1 48  ? 91.762  81.861  17.971 1.00 34.65 ? 48   GLU C CB  1 
ATOM   3994 C CG  . GLU C 1 48  ? 92.516  81.929  16.640 1.00 31.97 ? 48   GLU C CG  1 
ATOM   3995 C CD  . GLU C 1 48  ? 94.025  82.068  16.828 1.00 33.18 ? 48   GLU C CD  1 
ATOM   3996 O OE1 . GLU C 1 48  ? 94.479  83.123  17.314 1.00 36.19 ? 48   GLU C OE1 1 
ATOM   3997 O OE2 . GLU C 1 48  ? 94.764  81.115  16.515 1.00 34.75 ? 48   GLU C OE2 1 
ATOM   3998 N N   . LYS C 1 49  ? 89.394  80.063  19.510 1.00 28.23 ? 49   LYS C N   1 
ATOM   3999 C CA  . LYS C 1 49  ? 89.090  78.762  20.119 1.00 29.88 ? 49   LYS C CA  1 
ATOM   4000 C C   . LYS C 1 49  ? 88.394  77.765  19.184 1.00 34.39 ? 49   LYS C C   1 
ATOM   4001 O O   . LYS C 1 49  ? 88.741  76.581  19.169 1.00 31.46 ? 49   LYS C O   1 
ATOM   4002 C CB  . LYS C 1 49  ? 88.230  78.978  21.375 1.00 25.99 ? 49   LYS C CB  1 
ATOM   4003 C CG  . LYS C 1 49  ? 87.716  77.707  22.037 1.00 30.99 ? 49   LYS C CG  1 
ATOM   4004 C CD  . LYS C 1 49  ? 86.957  78.010  23.329 1.00 37.01 ? 49   LYS C CD  1 
ATOM   4005 C CE  . LYS C 1 49  ? 86.644  76.735  24.101 1.00 41.86 ? 49   LYS C CE  1 
ATOM   4006 N NZ  . LYS C 1 49  ? 86.377  76.982  25.548 1.00 39.56 ? 49   LYS C NZ  1 
ATOM   4007 N N   . GLU C 1 50  ? 87.476  78.276  18.358 1.00 34.39 ? 50   GLU C N   1 
ATOM   4008 C CA  . GLU C 1 50  ? 86.550  77.449  17.580 1.00 31.82 ? 50   GLU C CA  1 
ATOM   4009 C C   . GLU C 1 50  ? 86.925  77.314  16.108 1.00 37.59 ? 50   GLU C C   1 
ATOM   4010 O O   . GLU C 1 50  ? 86.455  76.400  15.424 1.00 41.63 ? 50   GLU C O   1 
ATOM   4011 C CB  . GLU C 1 50  ? 85.129  78.013  17.682 1.00 29.18 ? 50   GLU C CB  1 
ATOM   4012 C CG  . GLU C 1 50  ? 84.585  78.090  19.102 1.00 29.35 ? 50   GLU C CG  1 
ATOM   4013 C CD  . GLU C 1 50  ? 84.560  76.739  19.798 1.00 32.13 ? 50   GLU C CD  1 
ATOM   4014 O OE1 . GLU C 1 50  ? 84.338  75.710  19.110 1.00 36.81 ? 50   GLU C OE1 1 
ATOM   4015 O OE2 . GLU C 1 50  ? 84.769  76.704  21.032 1.00 35.58 ? 50   GLU C OE2 1 
ATOM   4016 N N   . LYS C 1 51  ? 87.751  78.235  15.619 1.00 36.20 ? 51   LYS C N   1 
ATOM   4017 C CA  . LYS C 1 51  ? 88.110  78.278  14.204 1.00 39.60 ? 51   LYS C CA  1 
ATOM   4018 C C   . LYS C 1 51  ? 89.335  77.413  13.876 1.00 43.57 ? 51   LYS C C   1 
ATOM   4019 O O   . LYS C 1 51  ? 89.790  77.399  12.724 1.00 50.13 ? 51   LYS C O   1 
ATOM   4020 C CB  . LYS C 1 51  ? 88.372  79.729  13.756 1.00 38.56 ? 51   LYS C CB  1 
ATOM   4021 C CG  . LYS C 1 51  ? 87.184  80.687  13.899 1.00 41.27 ? 51   LYS C CG  1 
ATOM   4022 C CD  . LYS C 1 51  ? 87.251  81.476  15.207 1.00 41.82 ? 51   LYS C CD  1 
ATOM   4023 C CE  . LYS C 1 51  ? 86.066  82.422  15.362 1.00 44.65 ? 51   LYS C CE  1 
ATOM   4024 N NZ  . LYS C 1 51  ? 86.289  83.767  14.741 1.00 44.36 ? 51   LYS C NZ  1 
ATOM   4025 N N   . LEU C 1 52  ? 89.849  76.681  14.872 1.00 38.31 ? 52   LEU C N   1 
ATOM   4026 C CA  . LEU C 1 52  ? 91.056  75.852  14.708 1.00 31.89 ? 52   LEU C CA  1 
ATOM   4027 C C   . LEU C 1 52  ? 90.765  74.459  14.143 1.00 32.11 ? 52   LEU C C   1 
ATOM   4028 O O   . LEU C 1 52  ? 91.659  73.811  13.589 1.00 30.72 ? 52   LEU C O   1 
ATOM   4029 C CB  . LEU C 1 52  ? 91.797  75.689  16.044 1.00 27.54 ? 52   LEU C CB  1 
ATOM   4030 C CG  . LEU C 1 52  ? 92.930  76.615  16.523 1.00 29.15 ? 52   LEU C CG  1 
ATOM   4031 C CD1 . LEU C 1 52  ? 93.686  77.244  15.369 1.00 23.36 ? 52   LEU C CD1 1 
ATOM   4032 C CD2 . LEU C 1 52  ? 92.358  77.681  17.415 1.00 29.86 ? 52   LEU C CD2 1 
ATOM   4033 N N   . GLY C 1 53  ? 89.533  73.987  14.331 1.00 29.27 ? 53   GLY C N   1 
ATOM   4034 C CA  . GLY C 1 53  ? 89.154  72.674  13.840 1.00 24.59 ? 53   GLY C CA  1 
ATOM   4035 C C   . GLY C 1 53  ? 89.426  71.575  14.851 1.00 29.40 ? 53   GLY C C   1 
ATOM   4036 O O   . GLY C 1 53  ? 89.450  70.392  14.501 1.00 33.21 ? 53   GLY C O   1 
ATOM   4037 N N   . LEU C 1 54  ? 89.618  71.964  16.109 1.00 27.80 ? 54   LEU C N   1 
ATOM   4038 C CA  . LEU C 1 54  ? 89.873  71.014  17.188 1.00 25.18 ? 54   LEU C CA  1 
ATOM   4039 C C   . LEU C 1 54  ? 88.588  70.300  17.612 1.00 27.52 ? 54   LEU C C   1 
ATOM   4040 O O   . LEU C 1 54  ? 87.530  70.920  17.683 1.00 26.84 ? 54   LEU C O   1 
ATOM   4041 C CB  . LEU C 1 54  ? 90.487  71.740  18.392 1.00 27.07 ? 54   LEU C CB  1 
ATOM   4042 C CG  . LEU C 1 54  ? 91.879  72.366  18.205 1.00 21.06 ? 54   LEU C CG  1 
ATOM   4043 C CD1 . LEU C 1 54  ? 92.342  72.962  19.495 1.00 24.16 ? 54   LEU C CD1 1 
ATOM   4044 C CD2 . LEU C 1 54  ? 92.885  71.342  17.740 1.00 19.95 ? 54   LEU C CD2 1 
ATOM   4045 N N   . ASP C 1 55  ? 88.688  68.995  17.877 1.00 32.70 ? 55   ASP C N   1 
ATOM   4046 C CA  . ASP C 1 55  ? 87.553  68.192  18.352 1.00 23.34 ? 55   ASP C CA  1 
ATOM   4047 C C   . ASP C 1 55  ? 87.004  68.765  19.649 1.00 28.18 ? 55   ASP C C   1 
ATOM   4048 O O   . ASP C 1 55  ? 85.797  68.975  19.783 1.00 26.98 ? 55   ASP C O   1 
ATOM   4049 C CB  . ASP C 1 55  ? 87.982  66.739  18.615 1.00 22.37 ? 55   ASP C CB  1 
ATOM   4050 C CG  . ASP C 1 55  ? 88.034  65.897  17.354 1.00 25.51 ? 55   ASP C CG  1 
ATOM   4051 O OD1 . ASP C 1 55  ? 87.155  66.053  16.483 1.00 28.57 ? 55   ASP C OD1 1 
ATOM   4052 O OD2 . ASP C 1 55  ? 88.929  65.033  17.258 1.00 28.58 ? 55   ASP C OD2 1 
ATOM   4053 N N   . PHE C 1 56  ? 87.898  68.944  20.623 1.00 32.51 ? 56   PHE C N   1 
ATOM   4054 C CA  . PHE C 1 56  ? 87.540  69.504  21.924 1.00 28.78 ? 56   PHE C CA  1 
ATOM   4055 C C   . PHE C 1 56  ? 88.523  70.607  22.298 1.00 28.30 ? 56   PHE C C   1 
ATOM   4056 O O   . PHE C 1 56  ? 89.520  70.359  22.984 1.00 34.32 ? 56   PHE C O   1 
ATOM   4057 C CB  . PHE C 1 56  ? 87.555  68.411  22.995 1.00 37.44 ? 56   PHE C CB  1 
ATOM   4058 C CG  . PHE C 1 56  ? 86.966  67.108  22.538 1.00 35.50 ? 56   PHE C CG  1 
ATOM   4059 C CD1 . PHE C 1 56  ? 85.598  66.894  22.587 1.00 36.93 ? 56   PHE C CD1 1 
ATOM   4060 C CD2 . PHE C 1 56  ? 87.784  66.083  22.087 1.00 32.92 ? 56   PHE C CD2 1 
ATOM   4061 C CE1 . PHE C 1 56  ? 85.056  65.674  22.202 1.00 38.47 ? 56   PHE C CE1 1 
ATOM   4062 C CE2 . PHE C 1 56  ? 87.247  64.865  21.702 1.00 36.38 ? 56   PHE C CE2 1 
ATOM   4063 C CZ  . PHE C 1 56  ? 85.882  64.661  21.763 1.00 35.69 ? 56   PHE C CZ  1 
ATOM   4064 N N   . PRO C 1 57  ? 88.281  71.835  21.806 1.00 28.80 ? 57   PRO C N   1 
ATOM   4065 C CA  . PRO C 1 57  ? 89.260  72.917  21.921 1.00 26.67 ? 57   PRO C CA  1 
ATOM   4066 C C   . PRO C 1 57  ? 89.736  73.195  23.347 1.00 24.47 ? 57   PRO C C   1 
ATOM   4067 O O   . PRO C 1 57  ? 88.955  73.188  24.307 1.00 34.15 ? 57   PRO C O   1 
ATOM   4068 C CB  . PRO C 1 57  ? 88.537  74.110  21.293 1.00 23.70 ? 57   PRO C CB  1 
ATOM   4069 C CG  . PRO C 1 57  ? 87.646  73.477  20.285 1.00 25.27 ? 57   PRO C CG  1 
ATOM   4070 C CD  . PRO C 1 57  ? 87.118  72.266  21.010 1.00 27.95 ? 57   PRO C CD  1 
ATOM   4071 N N   . ASN C 1 58  ? 91.047  73.352  23.470 1.00 21.10 ? 58   ASN C N   1 
ATOM   4072 C CA  . ASN C 1 58  ? 91.686  73.570  24.753 1.00 21.57 ? 58   ASN C CA  1 
ATOM   4073 C C   . ASN C 1 58  ? 93.163  73.891  24.523 1.00 27.50 ? 58   ASN C C   1 
ATOM   4074 O O   . ASN C 1 58  ? 93.643  73.856  23.383 1.00 20.65 ? 58   ASN C O   1 
ATOM   4075 C CB  . ASN C 1 58  ? 91.535  72.322  25.619 1.00 23.99 ? 58   ASN C CB  1 
ATOM   4076 C CG  . ASN C 1 58  ? 91.450  72.644  27.092 1.00 27.04 ? 58   ASN C CG  1 
ATOM   4077 O OD1 . ASN C 1 58  ? 92.406  73.150  27.677 1.00 29.80 ? 58   ASN C OD1 1 
ATOM   4078 N ND2 . ASN C 1 58  ? 90.307  72.340  27.706 1.00 30.80 ? 58   ASN C ND2 1 
ATOM   4079 N N   . LEU C 1 59  ? 93.859  74.270  25.594 1.00 26.31 ? 59   LEU C N   1 
ATOM   4080 C CA  . LEU C 1 59  ? 95.292  74.562  25.534 1.00 18.71 ? 59   LEU C CA  1 
ATOM   4081 C C   . LEU C 1 59  ? 96.030  73.678  26.537 1.00 19.56 ? 59   LEU C C   1 
ATOM   4082 O O   . LEU C 1 59  ? 95.671  73.649  27.711 1.00 22.13 ? 59   LEU C O   1 
ATOM   4083 C CB  . LEU C 1 59  ? 95.543  76.038  25.864 1.00 13.82 ? 59   LEU C CB  1 
ATOM   4084 C CG  . LEU C 1 59  ? 94.998  77.075  24.883 1.00 15.52 ? 59   LEU C CG  1 
ATOM   4085 C CD1 . LEU C 1 59  ? 95.084  78.434  25.532 1.00 12.22 ? 59   LEU C CD1 1 
ATOM   4086 C CD2 . LEU C 1 59  ? 95.774  77.041  23.554 1.00 2.00  ? 59   LEU C CD2 1 
ATOM   4087 N N   . PRO C 1 60  ? 97.073  72.950  26.097 1.00 22.29 ? 60   PRO C N   1 
ATOM   4088 C CA  . PRO C 1 60  ? 97.762  73.057  24.808 1.00 21.89 ? 60   PRO C CA  1 
ATOM   4089 C C   . PRO C 1 60  ? 97.036  72.352  23.675 1.00 19.39 ? 60   PRO C C   1 
ATOM   4090 O O   . PRO C 1 60  ? 96.248  71.444  23.912 1.00 24.61 ? 60   PRO C O   1 
ATOM   4091 C CB  . PRO C 1 60  ? 99.126  72.392  25.069 1.00 23.01 ? 60   PRO C CB  1 
ATOM   4092 C CG  . PRO C 1 60  ? 99.128  71.970  26.514 1.00 22.55 ? 60   PRO C CG  1 
ATOM   4093 C CD  . PRO C 1 60  ? 97.693  71.910  26.931 1.00 26.17 ? 60   PRO C CD  1 
ATOM   4094 N N   . TYR C 1 61  ? 97.306  72.783  22.446 1.00 22.77 ? 61   TYR C N   1 
ATOM   4095 C CA  . TYR C 1 61  ? 97.003  71.975  21.266 1.00 22.44 ? 61   TYR C CA  1 
ATOM   4096 C C   . TYR C 1 61  ? 98.258  71.736  20.434 1.00 21.23 ? 61   TYR C C   1 
ATOM   4097 O O   . TYR C 1 61  ? 99.268  72.412  20.616 1.00 29.28 ? 61   TYR C O   1 
ATOM   4098 C CB  . TYR C 1 61  ? 95.901  72.621  20.394 1.00 17.32 ? 61   TYR C CB  1 
ATOM   4099 C CG  . TYR C 1 61  ? 96.213  73.985  19.795 1.00 12.29 ? 61   TYR C CG  1 
ATOM   4100 C CD1 . TYR C 1 61  ? 96.973  74.105  18.626 1.00 14.66 ? 61   TYR C CD1 1 
ATOM   4101 C CD2 . TYR C 1 61  ? 95.682  75.153  20.356 1.00 16.85 ? 61   TYR C CD2 1 
ATOM   4102 C CE1 . TYR C 1 61  ? 97.197  75.353  18.030 1.00 15.49 ? 61   TYR C CE1 1 
ATOM   4103 C CE2 . TYR C 1 61  ? 95.897  76.403  19.771 1.00 17.48 ? 61   TYR C CE2 1 
ATOM   4104 C CZ  . TYR C 1 61  ? 96.657  76.495  18.612 1.00 22.81 ? 61   TYR C CZ  1 
ATOM   4105 O OH  . TYR C 1 61  ? 96.890  77.727  18.052 1.00 26.69 ? 61   TYR C OH  1 
ATOM   4106 N N   . LEU C 1 62  ? 98.224  70.696  19.611 1.00 20.97 ? 62   LEU C N   1 
ATOM   4107 C CA  . LEU C 1 62  ? 99.286  70.447  18.645 1.00 21.61 ? 62   LEU C CA  1 
ATOM   4108 C C   . LEU C 1 62  ? 98.665  70.151  17.285 1.00 23.72 ? 62   LEU C C   1 
ATOM   4109 O O   . LEU C 1 62  ? 97.696  69.401  17.180 1.00 25.02 ? 62   LEU C O   1 
ATOM   4110 C CB  . LEU C 1 62  ? 100.162 69.263  19.083 1.00 24.51 ? 62   LEU C CB  1 
ATOM   4111 C CG  . LEU C 1 62  ? 101.315 68.799  18.167 1.00 26.48 ? 62   LEU C CG  1 
ATOM   4112 C CD1 . LEU C 1 62  ? 102.582 69.555  18.484 1.00 21.29 ? 62   LEU C CD1 1 
ATOM   4113 C CD2 . LEU C 1 62  ? 101.560 67.311  18.334 1.00 26.21 ? 62   LEU C CD2 1 
ATOM   4114 N N   . ILE C 1 63  ? 99.189  70.807  16.257 1.00 19.65 ? 63   ILE C N   1 
ATOM   4115 C CA  . ILE C 1 63  ? 98.789  70.543  14.889 1.00 16.94 ? 63   ILE C CA  1 
ATOM   4116 C C   . ILE C 1 63  ? 99.962  69.977  14.097 1.00 25.91 ? 63   ILE C C   1 
ATOM   4117 O O   . ILE C 1 63  ? 101.007 70.612  13.977 1.00 33.69 ? 63   ILE C O   1 
ATOM   4118 C CB  . ILE C 1 63  ? 98.301  71.817  14.192 1.00 16.84 ? 63   ILE C CB  1 
ATOM   4119 C CG1 . ILE C 1 63  ? 97.140  72.434  14.978 1.00 21.43 ? 63   ILE C CG1 1 
ATOM   4120 C CG2 . ILE C 1 63  ? 97.878  71.488  12.777 1.00 11.74 ? 63   ILE C CG2 1 
ATOM   4121 C CD1 . ILE C 1 63  ? 96.620  73.737  14.404 1.00 21.14 ? 63   ILE C CD1 1 
ATOM   4122 N N   . ASP C 1 64  ? 99.778  68.777  13.561 1.00 23.68 ? 64   ASP C N   1 
ATOM   4123 C CA  . ASP C 1 64  ? 100.788 68.121  12.739 1.00 24.99 ? 64   ASP C CA  1 
ATOM   4124 C C   . ASP C 1 64  ? 100.132 67.706  11.418 1.00 30.69 ? 64   ASP C C   1 
ATOM   4125 O O   . ASP C 1 64  ? 99.840  66.532  11.202 1.00 32.46 ? 64   ASP C O   1 
ATOM   4126 C CB  . ASP C 1 64  ? 101.338 66.894  13.486 1.00 21.33 ? 64   ASP C CB  1 
ATOM   4127 C CG  . ASP C 1 64  ? 102.580 66.302  12.837 1.00 20.26 ? 64   ASP C CG  1 
ATOM   4128 O OD1 . ASP C 1 64  ? 103.141 66.913  11.904 1.00 34.06 ? 64   ASP C OD1 1 
ATOM   4129 O OD2 . ASP C 1 64  ? 103.002 65.211  13.267 1.00 18.28 ? 64   ASP C OD2 1 
ATOM   4130 N N   . GLY C 1 65  ? 99.856  68.688  10.565 1.00 34.63 ? 65   GLY C N   1 
ATOM   4131 C CA  . GLY C 1 65  ? 99.106  68.434  9.348  1.00 37.22 ? 65   GLY C CA  1 
ATOM   4132 C C   . GLY C 1 65  ? 97.613  68.338  9.616  1.00 41.59 ? 65   GLY C C   1 
ATOM   4133 O O   . GLY C 1 65  ? 96.981  69.311  10.035 1.00 33.85 ? 65   GLY C O   1 
ATOM   4134 N N   . ASP C 1 66  ? 97.060  67.144  9.418  1.00 45.76 ? 66   ASP C N   1 
ATOM   4135 C CA  . ASP C 1 66  ? 95.629  66.901  9.617  1.00 47.63 ? 66   ASP C CA  1 
ATOM   4136 C C   . ASP C 1 66  ? 95.344  66.296  10.991 1.00 43.14 ? 66   ASP C C   1 
ATOM   4137 O O   . ASP C 1 66  ? 94.186  66.150  11.388 1.00 46.97 ? 66   ASP C O   1 
ATOM   4138 C CB  . ASP C 1 66  ? 95.071  65.987  8.514  1.00 48.28 ? 66   ASP C CB  1 
ATOM   4139 C CG  . ASP C 1 66  ? 96.149  65.144  7.842  1.00 55.24 ? 66   ASP C CG  1 
ATOM   4140 O OD1 . ASP C 1 66  ? 96.774  65.637  6.872  1.00 55.34 ? 66   ASP C OD1 1 
ATOM   4141 O OD2 . ASP C 1 66  ? 96.387  64.001  8.298  1.00 54.63 ? 66   ASP C OD2 1 
ATOM   4142 N N   . VAL C 1 67  ? 96.408  65.912  11.693 1.00 39.93 ? 67   VAL C N   1 
ATOM   4143 C CA  . VAL C 1 67  ? 96.303  65.473  13.080 1.00 31.97 ? 67   VAL C CA  1 
ATOM   4144 C C   . VAL C 1 67  ? 96.261  66.711  13.957 1.00 27.56 ? 67   VAL C C   1 
ATOM   4145 O O   . VAL C 1 67  ? 97.191  67.510  13.957 1.00 35.11 ? 67   VAL C O   1 
ATOM   4146 C CB  . VAL C 1 67  ? 97.508  64.597  13.499 1.00 27.50 ? 67   VAL C CB  1 
ATOM   4147 C CG1 . VAL C 1 67  ? 97.383  64.197  14.945 1.00 25.05 ? 67   VAL C CG1 1 
ATOM   4148 C CG2 . VAL C 1 67  ? 97.586  63.362  12.631 1.00 16.48 ? 67   VAL C CG2 1 
ATOM   4149 N N   . LYS C 1 68  ? 95.120  66.924  14.596 1.00 27.41 ? 68   LYS C N   1 
ATOM   4150 C CA  . LYS C 1 68  ? 94.908  68.102  15.429 1.00 32.22 ? 68   LYS C CA  1 
ATOM   4151 C C   . LYS C 1 68  ? 94.459  67.677  16.830 1.00 30.57 ? 68   LYS C C   1 
ATOM   4152 O O   . LYS C 1 68  ? 93.331  67.223  17.015 1.00 35.23 ? 68   LYS C O   1 
ATOM   4153 C CB  . LYS C 1 68  ? 93.860  69.024  14.779 1.00 31.40 ? 68   LYS C CB  1 
ATOM   4154 C CG  . LYS C 1 68  ? 94.168  69.427  13.329 1.00 37.19 ? 68   LYS C CG  1 
ATOM   4155 C CD  . LYS C 1 68  ? 93.326  70.620  12.864 1.00 38.35 ? 68   LYS C CD  1 
ATOM   4156 C CE  . LYS C 1 68  ? 92.474  70.295  11.629 1.00 45.03 ? 68   LYS C CE  1 
ATOM   4157 N NZ  . LYS C 1 68  ? 93.232  69.611  10.535 1.00 47.72 ? 68   LYS C NZ  1 
ATOM   4158 N N   . LEU C 1 69  ? 95.351  67.825  17.810 1.00 27.99 ? 69   LEU C N   1 
ATOM   4159 C CA  . LEU C 1 69  ? 95.153  67.249  19.141 1.00 26.37 ? 69   LEU C CA  1 
ATOM   4160 C C   . LEU C 1 69  ? 95.050  68.285  20.255 1.00 26.39 ? 69   LEU C C   1 
ATOM   4161 O O   . LEU C 1 69  ? 95.685  69.340  20.200 1.00 30.70 ? 69   LEU C O   1 
ATOM   4162 C CB  . LEU C 1 69  ? 96.297  66.290  19.470 1.00 21.04 ? 69   LEU C CB  1 
ATOM   4163 C CG  . LEU C 1 69  ? 96.619  65.251  18.404 1.00 21.87 ? 69   LEU C CG  1 
ATOM   4164 C CD1 . LEU C 1 69  ? 98.091  64.932  18.442 1.00 22.84 ? 69   LEU C CD1 1 
ATOM   4165 C CD2 . LEU C 1 69  ? 95.791  64.002  18.622 1.00 19.22 ? 69   LEU C CD2 1 
ATOM   4166 N N   . THR C 1 70  ? 94.279  67.941  21.287 1.00 27.79 ? 70   THR C N   1 
ATOM   4167 C CA  . THR C 1 70  ? 94.285  68.660  22.562 1.00 20.16 ? 70   THR C CA  1 
ATOM   4168 C C   . THR C 1 70  ? 94.599  67.669  23.677 1.00 17.87 ? 70   THR C C   1 
ATOM   4169 O O   . THR C 1 70  ? 94.751  66.477  23.421 1.00 14.40 ? 70   THR C O   1 
ATOM   4170 C CB  . THR C 1 70  ? 92.924  69.328  22.843 1.00 17.75 ? 70   THR C CB  1 
ATOM   4171 O OG1 . THR C 1 70  ? 91.867  68.445  22.453 1.00 25.87 ? 70   THR C OG1 1 
ATOM   4172 C CG2 . THR C 1 70  ? 92.797  70.621  22.061 1.00 17.72 ? 70   THR C CG2 1 
ATOM   4173 N N   . GLN C 1 71  ? 94.734  68.174  24.900 1.00 22.73 ? 71   GLN C N   1 
ATOM   4174 C CA  . GLN C 1 71  ? 95.136  67.366  26.057 1.00 19.78 ? 71   GLN C CA  1 
ATOM   4175 C C   . GLN C 1 71  ? 96.638  67.100  26.094 1.00 19.56 ? 71   GLN C C   1 
ATOM   4176 O O   . GLN C 1 71  ? 97.177  66.400  25.238 1.00 20.45 ? 71   GLN C O   1 
ATOM   4177 C CB  . GLN C 1 71  ? 94.374  66.032  26.099 1.00 13.49 ? 71   GLN C CB  1 
ATOM   4178 C CG  . GLN C 1 71  ? 92.880  66.167  26.312 1.00 16.60 ? 71   GLN C CG  1 
ATOM   4179 C CD  . GLN C 1 71  ? 92.533  66.940  27.570 1.00 15.27 ? 71   GLN C CD  1 
ATOM   4180 O OE1 . GLN C 1 71  ? 91.545  67.670  27.614 1.00 23.67 ? 71   GLN C OE1 1 
ATOM   4181 N NE2 . GLN C 1 71  ? 93.339  66.776  28.604 1.00 20.80 ? 71   GLN C NE2 1 
ATOM   4182 N N   . SER C 1 72  ? 97.277  67.578  27.157 1.00 20.74 ? 72   SER C N   1 
ATOM   4183 C CA  . SER C 1 72  ? 98.715  67.472  27.324 1.00 19.19 ? 72   SER C CA  1 
ATOM   4184 C C   . SER C 1 72  ? 99.238  66.035  27.259 1.00 16.93 ? 72   SER C C   1 
ATOM   4185 O O   . SER C 1 72  ? 100.185 65.751  26.526 1.00 18.81 ? 72   SER C O   1 
ATOM   4186 C CB  . SER C 1 72  ? 99.128  68.124  28.648 1.00 27.98 ? 72   SER C CB  1 
ATOM   4187 O OG  . SER C 1 72  ? 98.731  67.355  29.772 1.00 33.39 ? 72   SER C OG  1 
ATOM   4188 N N   . ASN C 1 73  ? 98.637  65.132  28.029 1.00 16.39 ? 73   ASN C N   1 
ATOM   4189 C CA  . ASN C 1 73  ? 99.083  63.741  28.045 1.00 10.15 ? 73   ASN C CA  1 
ATOM   4190 C C   . ASN C 1 73  ? 98.924  63.103  26.669 1.00 13.95 ? 73   ASN C C   1 
ATOM   4191 O O   . ASN C 1 73  ? 99.805  62.381  26.213 1.00 17.99 ? 73   ASN C O   1 
ATOM   4192 C CB  . ASN C 1 73  ? 98.292  62.924  29.066 1.00 11.60 ? 73   ASN C CB  1 
ATOM   4193 C CG  . ASN C 1 73  ? 98.705  63.199  30.499 1.00 13.77 ? 73   ASN C CG  1 
ATOM   4194 O OD1 . ASN C 1 73  ? 99.553  64.051  30.776 1.00 21.76 ? 73   ASN C OD1 1 
ATOM   4195 N ND2 . ASN C 1 73  ? 98.096  62.470  31.427 1.00 18.84 ? 73   ASN C ND2 1 
ATOM   4196 N N   . ALA C 1 74  ? 97.826  63.429  25.990 1.00 14.09 ? 74   ALA C N   1 
ATOM   4197 C CA  . ALA C 1 74  ? 97.525  62.882  24.669 1.00 15.20 ? 74   ALA C CA  1 
ATOM   4198 C C   . ALA C 1 74  ? 98.506  63.379  23.628 1.00 23.68 ? 74   ALA C C   1 
ATOM   4199 O O   . ALA C 1 74  ? 98.862  62.657  22.696 1.00 34.11 ? 74   ALA C O   1 
ATOM   4200 C CB  . ALA C 1 74  ? 96.110  63.252  24.257 1.00 24.18 ? 74   ALA C CB  1 
ATOM   4201 N N   . ILE C 1 75  ? 98.910  64.633  23.766 1.00 21.10 ? 75   ILE C N   1 
ATOM   4202 C CA  . ILE C 1 75  ? 99.885  65.216  22.853 1.00 22.11 ? 75   ILE C CA  1 
ATOM   4203 C C   . ILE C 1 75  ? 101.265 64.580  23.057 1.00 20.83 ? 75   ILE C C   1 
ATOM   4204 O O   . ILE C 1 75  ? 101.916 64.199  22.088 1.00 27.33 ? 75   ILE C O   1 
ATOM   4205 C CB  . ILE C 1 75  ? 99.946  66.750  23.036 1.00 22.23 ? 75   ILE C CB  1 
ATOM   4206 C CG1 . ILE C 1 75  ? 98.675  67.382  22.459 1.00 17.81 ? 75   ILE C CG1 1 
ATOM   4207 C CG2 . ILE C 1 75  ? 101.177 67.310  22.374 1.00 17.65 ? 75   ILE C CG2 1 
ATOM   4208 C CD1 . ILE C 1 75  ? 98.445  68.822  22.865 1.00 17.71 ? 75   ILE C CD1 1 
ATOM   4209 N N   . LEU C 1 76  ? 101.607 64.295  24.312 1.00 19.93 ? 76   LEU C N   1 
ATOM   4210 C CA  . LEU C 1 76  ? 102.893 63.697  24.640 1.00 16.19 ? 76   LEU C CA  1 
ATOM   4211 C C   . LEU C 1 76  ? 102.979 62.245  24.201 1.00 11.46 ? 76   LEU C C   1 
ATOM   4212 O O   . LEU C 1 76  ? 104.023 61.802  23.713 1.00 19.31 ? 76   LEU C O   1 
ATOM   4213 C CB  . LEU C 1 76  ? 103.167 63.811  26.137 1.00 12.46 ? 76   LEU C CB  1 
ATOM   4214 C CG  . LEU C 1 76  ? 103.783 65.144  26.570 1.00 12.74 ? 76   LEU C CG  1 
ATOM   4215 C CD1 . LEU C 1 76  ? 103.421 65.461  28.008 1.00 9.60  ? 76   LEU C CD1 1 
ATOM   4216 C CD2 . LEU C 1 76  ? 105.283 65.080  26.396 1.00 15.71 ? 76   LEU C CD2 1 
ATOM   4217 N N   . ARG C 1 77  ? 101.853 61.540  24.260 1.00 5.97  ? 77   ARG C N   1 
ATOM   4218 C CA  . ARG C 1 77  ? 101.808 60.149  23.812 1.00 8.39  ? 77   ARG C CA  1 
ATOM   4219 C C   . ARG C 1 77  ? 101.926 60.038  22.294 1.00 11.45 ? 77   ARG C C   1 
ATOM   4220 O O   . ARG C 1 77  ? 102.503 59.085  21.781 1.00 24.39 ? 77   ARG C O   1 
ATOM   4221 C CB  . ARG C 1 77  ? 100.514 59.479  24.281 1.00 10.67 ? 77   ARG C CB  1 
ATOM   4222 C CG  . ARG C 1 77  ? 100.455 59.185  25.774 1.00 9.06  ? 77   ARG C CG  1 
ATOM   4223 C CD  . ARG C 1 77  ? 99.161  58.502  26.136 1.00 8.12  ? 77   ARG C CD  1 
ATOM   4224 N NE  . ARG C 1 77  ? 99.167  57.962  27.490 1.00 6.90  ? 77   ARG C NE  1 
ATOM   4225 C CZ  . ARG C 1 77  ? 99.546  56.731  27.807 1.00 3.67  ? 77   ARG C CZ  1 
ATOM   4226 N NH1 . ARG C 1 77  ? 99.934  55.883  26.863 1.00 2.09  ? 77   ARG C NH1 1 
ATOM   4227 N NH2 . ARG C 1 77  ? 99.509  56.337  29.071 1.00 7.91  ? 77   ARG C NH2 1 
ATOM   4228 N N   . TYR C 1 78  ? 101.443 61.059  21.592 1.00 15.70 ? 78   TYR C N   1 
ATOM   4229 C CA  . TYR C 1 78  ? 101.505 61.118  20.136 1.00 11.91 ? 78   TYR C CA  1 
ATOM   4230 C C   . TYR C 1 78  ? 102.948 61.243  19.627 1.00 17.84 ? 78   TYR C C   1 
ATOM   4231 O O   . TYR C 1 78  ? 103.356 60.526  18.712 1.00 23.04 ? 78   TYR C O   1 
ATOM   4232 C CB  . TYR C 1 78  ? 100.660 62.300  19.655 1.00 16.97 ? 78   TYR C CB  1 
ATOM   4233 C CG  . TYR C 1 78  ? 100.736 62.590  18.175 1.00 23.93 ? 78   TYR C CG  1 
ATOM   4234 C CD1 . TYR C 1 78  ? 100.268 61.673  17.238 1.00 25.02 ? 78   TYR C CD1 1 
ATOM   4235 C CD2 . TYR C 1 78  ? 101.276 63.788  17.711 1.00 27.81 ? 78   TYR C CD2 1 
ATOM   4236 C CE1 . TYR C 1 78  ? 100.347 61.938  15.872 1.00 28.83 ? 78   TYR C CE1 1 
ATOM   4237 C CE2 . TYR C 1 78  ? 101.354 64.066  16.349 1.00 20.91 ? 78   TYR C CE2 1 
ATOM   4238 C CZ  . TYR C 1 78  ? 100.896 63.133  15.440 1.00 23.75 ? 78   TYR C CZ  1 
ATOM   4239 O OH  . TYR C 1 78  ? 101.049 63.366  14.099 1.00 27.51 ? 78   TYR C OH  1 
ATOM   4240 N N   . ILE C 1 79  ? 103.705 62.166  20.215 1.00 15.22 ? 79   ILE C N   1 
ATOM   4241 C CA  . ILE C 1 79  ? 105.112 62.350  19.873 1.00 9.38  ? 79   ILE C CA  1 
ATOM   4242 C C   . ILE C 1 79  ? 105.893 61.116  20.280 1.00 10.89 ? 79   ILE C C   1 
ATOM   4243 O O   . ILE C 1 79  ? 106.754 60.649  19.548 1.00 11.31 ? 79   ILE C O   1 
ATOM   4244 C CB  . ILE C 1 79  ? 105.724 63.559  20.612 1.00 9.89  ? 79   ILE C CB  1 
ATOM   4245 C CG1 . ILE C 1 79  ? 104.856 64.801  20.408 1.00 6.72  ? 79   ILE C CG1 1 
ATOM   4246 C CG2 . ILE C 1 79  ? 107.137 63.829  20.108 1.00 2.00  ? 79   ILE C CG2 1 
ATOM   4247 C CD1 . ILE C 1 79  ? 104.622 65.150  18.957 1.00 7.65  ? 79   ILE C CD1 1 
ATOM   4248 N N   . ALA C 1 80  ? 105.579 60.579  21.450 1.00 13.80 ? 80   ALA C N   1 
ATOM   4249 C CA  . ALA C 1 80  ? 106.282 59.403  21.948 1.00 17.95 ? 80   ALA C CA  1 
ATOM   4250 C C   . ALA C 1 80  ? 106.137 58.198  21.028 1.00 20.16 ? 80   ALA C C   1 
ATOM   4251 O O   . ALA C 1 80  ? 107.090 57.460  20.831 1.00 21.08 ? 80   ALA C O   1 
ATOM   4252 C CB  . ALA C 1 80  ? 105.805 59.052  23.345 1.00 15.40 ? 80   ALA C CB  1 
ATOM   4253 N N   . ARG C 1 81  ? 104.955 58.013  20.450 1.00 22.94 ? 81   ARG C N   1 
ATOM   4254 C CA  . ARG C 1 81  ? 104.709 56.870  19.574 1.00 23.60 ? 81   ARG C CA  1 
ATOM   4255 C C   . ARG C 1 81  ? 105.556 56.954  18.309 1.00 27.30 ? 81   ARG C C   1 
ATOM   4256 O O   . ARG C 1 81  ? 106.069 55.945  17.828 1.00 26.21 ? 81   ARG C O   1 
ATOM   4257 C CB  . ARG C 1 81  ? 103.232 56.799  19.184 1.00 22.72 ? 81   ARG C CB  1 
ATOM   4258 C CG  . ARG C 1 81  ? 102.329 56.109  20.196 1.00 15.18 ? 81   ARG C CG  1 
ATOM   4259 C CD  . ARG C 1 81  ? 100.978 55.759  19.581 1.00 15.08 ? 81   ARG C CD  1 
ATOM   4260 N NE  . ARG C 1 81  ? 100.138 56.930  19.310 1.00 13.64 ? 81   ARG C NE  1 
ATOM   4261 C CZ  . ARG C 1 81  ? 99.233  57.421  20.154 1.00 12.79 ? 81   ARG C CZ  1 
ATOM   4262 N NH1 . ARG C 1 81  ? 99.127  56.934  21.380 1.00 17.10 ? 81   ARG C NH1 1 
ATOM   4263 N NH2 . ARG C 1 81  ? 98.472  58.441  19.791 1.00 22.59 ? 81   ARG C NH2 1 
ATOM   4264 N N   . LYS C 1 82  ? 105.720 58.170  17.796 1.00 31.67 ? 82   LYS C N   1 
ATOM   4265 C CA  . LYS C 1 82  ? 106.482 58.413  16.575 1.00 28.70 ? 82   LYS C CA  1 
ATOM   4266 C C   . LYS C 1 82  ? 107.983 58.204  16.787 1.00 28.27 ? 82   LYS C C   1 
ATOM   4267 O O   . LYS C 1 82  ? 108.755 58.158  15.828 1.00 26.39 ? 82   LYS C O   1 
ATOM   4268 C CB  . LYS C 1 82  ? 106.232 59.843  16.073 1.00 27.45 ? 82   LYS C CB  1 
ATOM   4269 C CG  . LYS C 1 82  ? 104.760 60.236  15.953 1.00 34.76 ? 82   LYS C CG  1 
ATOM   4270 C CD  . LYS C 1 82  ? 104.405 60.762  14.563 1.00 36.64 ? 82   LYS C CD  1 
ATOM   4271 C CE  . LYS C 1 82  ? 105.357 61.858  14.099 1.00 40.73 ? 82   LYS C CE  1 
ATOM   4272 N NZ  . LYS C 1 82  ? 105.567 62.921  15.125 1.00 42.05 ? 82   LYS C NZ  1 
ATOM   4273 N N   . HIS C 1 83  ? 108.396 58.108  18.046 1.00 32.32 ? 83   HIS C N   1 
ATOM   4274 C CA  . HIS C 1 83  ? 109.807 57.952  18.372 1.00 30.27 ? 83   HIS C CA  1 
ATOM   4275 C C   . HIS C 1 83  ? 110.055 56.811  19.369 1.00 32.68 ? 83   HIS C C   1 
ATOM   4276 O O   . HIS C 1 83  ? 111.094 56.765  20.024 1.00 38.42 ? 83   HIS C O   1 
ATOM   4277 C CB  . HIS C 1 83  ? 110.365 59.272  18.924 1.00 31.22 ? 83   HIS C CB  1 
ATOM   4278 C CG  . HIS C 1 83  ? 110.364 60.400  17.936 1.00 26.91 ? 83   HIS C CG  1 
ATOM   4279 N ND1 . HIS C 1 83  ? 111.381 60.593  17.025 1.00 31.85 ? 83   HIS C ND1 1 
ATOM   4280 C CD2 . HIS C 1 83  ? 109.493 61.419  17.743 1.00 27.83 ? 83   HIS C CD2 1 
ATOM   4281 C CE1 . HIS C 1 83  ? 111.138 61.682  16.315 1.00 33.79 ? 83   HIS C CE1 1 
ATOM   4282 N NE2 . HIS C 1 83  ? 109.996 62.202  16.732 1.00 28.96 ? 83   HIS C NE2 1 
ATOM   4283 N N   . ASN C 1 84  ? 109.099 55.895  19.478 1.00 31.50 ? 84   ASN C N   1 
ATOM   4284 C CA  . ASN C 1 84  ? 109.250 54.708  20.309 1.00 38.68 ? 84   ASN C CA  1 
ATOM   4285 C C   . ASN C 1 84  ? 109.696 55.039  21.742 1.00 39.07 ? 84   ASN C C   1 
ATOM   4286 O O   . ASN C 1 84  ? 110.583 54.398  22.307 1.00 45.06 ? 84   ASN C O   1 
ATOM   4287 C CB  . ASN C 1 84  ? 110.229 53.737  19.647 1.00 45.41 ? 84   ASN C CB  1 
ATOM   4288 C CG  . ASN C 1 84  ? 110.067 52.313  20.144 1.00 51.70 ? 84   ASN C CG  1 
ATOM   4289 O OD1 . ASN C 1 84  ? 109.377 52.057  21.142 1.00 51.56 ? 84   ASN C OD1 1 
ATOM   4290 N ND2 . ASN C 1 84  ? 110.719 51.377  19.463 1.00 57.32 ? 84   ASN C ND2 1 
ATOM   4291 N N   . MET C 1 85  ? 109.086 56.067  22.314 1.00 36.25 ? 85   MET C N   1 
ATOM   4292 C CA  . MET C 1 85  ? 109.378 56.466  23.679 1.00 32.49 ? 85   MET C CA  1 
ATOM   4293 C C   . MET C 1 85  ? 108.186 56.168  24.580 1.00 33.77 ? 85   MET C C   1 
ATOM   4294 O O   . MET C 1 85  ? 107.932 56.873  25.553 1.00 39.16 ? 85   MET C O   1 
ATOM   4295 C CB  . MET C 1 85  ? 109.727 57.954  23.715 1.00 27.37 ? 85   MET C CB  1 
ATOM   4296 C CG  . MET C 1 85  ? 111.028 58.288  23.006 1.00 21.29 ? 85   MET C CG  1 
ATOM   4297 S SD  . MET C 1 85  ? 111.496 60.004  23.198 1.00 17.99 ? 85   MET C SD  1 
ATOM   4298 C CE  . MET C 1 85  ? 111.823 60.036  24.966 1.00 20.95 ? 85   MET C CE  1 
ATOM   4299 N N   . CYS C 1 86  ? 107.412 55.160  24.198 1.00 32.10 ? 86   CYS C N   1 
ATOM   4300 C CA  . CYS C 1 86  ? 106.416 54.581  25.084 1.00 33.69 ? 86   CYS C CA  1 
ATOM   4301 C C   . CYS C 1 86  ? 106.968 53.270  25.666 1.00 34.16 ? 86   CYS C C   1 
ATOM   4302 O O   . CYS C 1 86  ? 108.125 52.915  25.428 1.00 41.79 ? 86   CYS C O   1 
ATOM   4303 C CB  . CYS C 1 86  ? 105.126 54.328  24.305 1.00 38.03 ? 86   CYS C CB  1 
ATOM   4304 S SG  . CYS C 1 86  ? 104.322 55.822  23.690 1.00 35.71 ? 86   CYS C SG  1 
ATOM   4305 N N   . GLY C 1 87  ? 106.164 52.574  26.462 1.00 31.03 ? 87   GLY C N   1 
ATOM   4306 C CA  . GLY C 1 87  ? 106.586 51.277  26.967 1.00 28.50 ? 87   GLY C CA  1 
ATOM   4307 C C   . GLY C 1 87  ? 106.751 50.248  25.863 1.00 28.72 ? 87   GLY C C   1 
ATOM   4308 O O   . GLY C 1 87  ? 106.187 50.393  24.786 1.00 33.81 ? 87   GLY C O   1 
ATOM   4309 N N   . GLU C 1 88  ? 107.562 49.227  26.117 1.00 34.72 ? 88   GLU C N   1 
ATOM   4310 C CA  . GLU C 1 88  ? 107.764 48.121  25.176 1.00 40.36 ? 88   GLU C CA  1 
ATOM   4311 C C   . GLU C 1 88  ? 107.028 46.891  25.707 1.00 39.83 ? 88   GLU C C   1 
ATOM   4312 O O   . GLU C 1 88  ? 106.116 46.375  25.058 1.00 43.02 ? 88   GLU C O   1 
ATOM   4313 C CB  . GLU C 1 88  ? 109.261 47.771  25.036 1.00 45.67 ? 88   GLU C CB  1 
ATOM   4314 C CG  . GLU C 1 88  ? 110.189 48.917  24.634 1.00 53.32 ? 88   GLU C CG  1 
ATOM   4315 C CD  . GLU C 1 88  ? 110.517 48.951  23.143 1.00 58.22 ? 88   GLU C CD  1 
ATOM   4316 O OE1 . GLU C 1 88  ? 110.123 48.027  22.392 1.00 58.73 ? 88   GLU C OE1 1 
ATOM   4317 O OE2 . GLU C 1 88  ? 111.190 49.913  22.721 1.00 59.68 ? 88   GLU C OE2 1 
ATOM   4318 N N   . THR C 1 89  ? 107.457 46.409  26.875 1.00 30.81 ? 89   THR C N   1 
ATOM   4319 C CA  . THR C 1 89  ? 106.851 45.244  27.512 1.00 24.39 ? 89   THR C CA  1 
ATOM   4320 C C   . THR C 1 89  ? 105.606 45.663  28.289 1.00 27.62 ? 89   THR C C   1 
ATOM   4321 O O   . THR C 1 89  ? 105.353 46.852  28.460 1.00 31.69 ? 89   THR C O   1 
ATOM   4322 C CB  . THR C 1 89  ? 107.834 44.549  28.493 1.00 21.20 ? 89   THR C CB  1 
ATOM   4323 O OG1 . THR C 1 89  ? 107.992 45.347  29.673 1.00 25.04 ? 89   THR C OG1 1 
ATOM   4324 C CG2 . THR C 1 89  ? 109.183 44.344  27.841 1.00 19.63 ? 89   THR C CG2 1 
ATOM   4325 N N   . GLU C 1 90  ? 104.845 44.690  28.787 1.00 25.61 ? 90   GLU C N   1 
ATOM   4326 C CA  . GLU C 1 90  ? 103.647 45.005  29.556 1.00 24.43 ? 90   GLU C CA  1 
ATOM   4327 C C   . GLU C 1 90  ? 103.982 45.674  30.891 1.00 26.27 ? 90   GLU C C   1 
ATOM   4328 O O   . GLU C 1 90  ? 103.284 46.591  31.325 1.00 28.68 ? 90   GLU C O   1 
ATOM   4329 C CB  . GLU C 1 90  ? 102.801 43.751  29.785 1.00 18.13 ? 90   GLU C CB  1 
ATOM   4330 C CG  . GLU C 1 90  ? 101.657 43.937  30.788 1.00 20.31 ? 90   GLU C CG  1 
ATOM   4331 C CD  . GLU C 1 90  ? 100.381 44.489  30.181 1.00 20.84 ? 90   GLU C CD  1 
ATOM   4332 O OE1 . GLU C 1 90  ? 100.378 44.863  28.989 1.00 30.01 ? 90   GLU C OE1 1 
ATOM   4333 O OE2 . GLU C 1 90  ? 99.357  44.519  30.894 1.00 27.92 ? 90   GLU C OE2 1 
ATOM   4334 N N   . VAL C 1 91  ? 105.087 45.262  31.503 1.00 22.50 ? 91   VAL C N   1 
ATOM   4335 C CA  . VAL C 1 91  ? 105.511 45.849  32.765 1.00 27.12 ? 91   VAL C CA  1 
ATOM   4336 C C   . VAL C 1 91  ? 105.877 47.312  32.549 1.00 30.22 ? 91   VAL C C   1 
ATOM   4337 O O   . VAL C 1 91  ? 105.489 48.178  33.337 1.00 31.70 ? 91   VAL C O   1 
ATOM   4338 C CB  . VAL C 1 91  ? 106.727 45.115  33.368 1.00 24.72 ? 91   VAL C CB  1 
ATOM   4339 C CG1 . VAL C 1 91  ? 106.654 45.171  34.875 1.00 26.43 ? 91   VAL C CG1 1 
ATOM   4340 C CG2 . VAL C 1 91  ? 106.768 43.668  32.904 1.00 31.83 ? 91   VAL C CG2 1 
ATOM   4341 N N   . GLU C 1 92  ? 106.532 47.592  31.424 1.00 29.80 ? 92   GLU C N   1 
ATOM   4342 C CA  . GLU C 1 92  ? 106.891 48.955  31.059 1.00 25.04 ? 92   GLU C CA  1 
ATOM   4343 C C   . GLU C 1 92  ? 105.659 49.829  30.815 1.00 24.88 ? 92   GLU C C   1 
ATOM   4344 O O   . GLU C 1 92  ? 105.605 50.963  31.278 1.00 35.17 ? 92   GLU C O   1 
ATOM   4345 C CB  . GLU C 1 92  ? 107.779 48.947  29.816 1.00 25.78 ? 92   GLU C CB  1 
ATOM   4346 C CG  . GLU C 1 92  ? 109.199 48.484  30.066 1.00 28.93 ? 92   GLU C CG  1 
ATOM   4347 C CD  . GLU C 1 92  ? 110.121 48.702  28.863 1.00 39.84 ? 92   GLU C CD  1 
ATOM   4348 O OE1 . GLU C 1 92  ? 109.762 49.478  27.951 1.00 36.83 ? 92   GLU C OE1 1 
ATOM   4349 O OE2 . GLU C 1 92  ? 111.235 48.133  28.844 1.00 46.00 ? 92   GLU C OE2 1 
ATOM   4350 N N   . LYS C 1 93  ? 104.643 49.287  30.152 1.00 20.10 ? 93   LYS C N   1 
ATOM   4351 C CA  . LYS C 1 93  ? 103.411 50.036  29.930 1.00 11.12 ? 93   LYS C CA  1 
ATOM   4352 C C   . LYS C 1 93  ? 102.654 50.258  31.237 1.00 16.33 ? 93   LYS C C   1 
ATOM   4353 O O   . LYS C 1 93  ? 102.092 51.332  31.452 1.00 20.68 ? 93   LYS C O   1 
ATOM   4354 C CB  . LYS C 1 93  ? 102.510 49.316  28.940 1.00 6.23  ? 93   LYS C CB  1 
ATOM   4355 C CG  . LYS C 1 93  ? 102.945 49.411  27.487 1.00 9.71  ? 93   LYS C CG  1 
ATOM   4356 C CD  . LYS C 1 93  ? 102.042 48.535  26.607 1.00 14.15 ? 93   LYS C CD  1 
ATOM   4357 C CE  . LYS C 1 93  ? 102.631 48.279  25.235 1.00 11.92 ? 93   LYS C CE  1 
ATOM   4358 N NZ  . LYS C 1 93  ? 102.951 49.563  24.537 1.00 28.57 ? 93   LYS C NZ  1 
ATOM   4359 N N   . GLN C 1 94  ? 102.693 49.263  32.124 1.00 18.99 ? 94   GLN C N   1 
ATOM   4360 C CA  . GLN C 1 94  ? 102.105 49.375  33.456 1.00 22.28 ? 94   GLN C CA  1 
ATOM   4361 C C   . GLN C 1 94  ? 102.700 50.560  34.201 1.00 27.69 ? 94   GLN C C   1 
ATOM   4362 O O   . GLN C 1 94  ? 101.984 51.319  34.848 1.00 39.27 ? 94   GLN C O   1 
ATOM   4363 C CB  . GLN C 1 94  ? 102.347 48.088  34.260 1.00 22.92 ? 94   GLN C CB  1 
ATOM   4364 C CG  . GLN C 1 94  ? 101.335 46.978  33.983 1.00 27.71 ? 94   GLN C CG  1 
ATOM   4365 C CD  . GLN C 1 94  ? 101.635 45.663  34.698 1.00 25.85 ? 94   GLN C CD  1 
ATOM   4366 O OE1 . GLN C 1 94  ? 102.075 45.641  35.857 1.00 29.75 ? 94   GLN C OE1 1 
ATOM   4367 N NE2 . GLN C 1 94  ? 101.327 44.558  34.029 1.00 20.25 ? 94   GLN C NE2 1 
ATOM   4368 N N   . ARG C 1 95  ? 104.006 50.751  34.052 1.00 32.22 ? 95   ARG C N   1 
ATOM   4369 C CA  . ARG C 1 95  ? 104.707 51.815  34.757 1.00 25.86 ? 95   ARG C CA  1 
ATOM   4370 C C   . ARG C 1 95  ? 104.458 53.191  34.144 1.00 20.31 ? 95   ARG C C   1 
ATOM   4371 O O   . ARG C 1 95  ? 104.305 54.167  34.869 1.00 25.54 ? 95   ARG C O   1 
ATOM   4372 C CB  . ARG C 1 95  ? 106.200 51.499  34.810 1.00 23.07 ? 95   ARG C CB  1 
ATOM   4373 C CG  . ARG C 1 95  ? 106.490 50.260  35.628 1.00 26.22 ? 95   ARG C CG  1 
ATOM   4374 C CD  . ARG C 1 95  ? 107.955 49.891  35.581 1.00 31.96 ? 95   ARG C CD  1 
ATOM   4375 N NE  . ARG C 1 95  ? 108.510 49.736  36.922 1.00 36.62 ? 95   ARG C NE  1 
ATOM   4376 C CZ  . ARG C 1 95  ? 109.136 50.704  37.583 1.00 40.91 ? 95   ARG C CZ  1 
ATOM   4377 N NH1 . ARG C 1 95  ? 109.368 51.870  36.999 1.00 39.74 ? 95   ARG C NH1 1 
ATOM   4378 N NH2 . ARG C 1 95  ? 109.568 50.496  38.819 1.00 44.27 ? 95   ARG C NH2 1 
ATOM   4379 N N   . VAL C 1 96  ? 104.318 53.246  32.824 1.00 17.07 ? 96   VAL C N   1 
ATOM   4380 C CA  . VAL C 1 96  ? 103.987 54.494  32.149 1.00 13.60 ? 96   VAL C CA  1 
ATOM   4381 C C   . VAL C 1 96  ? 102.590 54.956  32.557 1.00 19.51 ? 96   VAL C C   1 
ATOM   4382 O O   . VAL C 1 96  ? 102.383 56.126  32.880 1.00 25.89 ? 96   VAL C O   1 
ATOM   4383 C CB  . VAL C 1 96  ? 104.035 54.351  30.605 1.00 6.45  ? 96   VAL C CB  1 
ATOM   4384 C CG1 . VAL C 1 96  ? 103.257 55.473  29.951 1.00 5.01  ? 96   VAL C CG1 1 
ATOM   4385 C CG2 . VAL C 1 96  ? 105.460 54.393  30.116 1.00 8.24  ? 96   VAL C CG2 1 
ATOM   4386 N N   . ASP C 1 97  ? 101.641 54.029  32.582 1.00 19.34 ? 97   ASP C N   1 
ATOM   4387 C CA  . ASP C 1 97  ? 100.250 54.390  32.806 1.00 17.33 ? 97   ASP C CA  1 
ATOM   4388 C C   . ASP C 1 97  ? 100.028 54.897  34.228 1.00 19.32 ? 97   ASP C C   1 
ATOM   4389 O O   . ASP C 1 97  ? 99.301  55.871  34.440 1.00 27.63 ? 97   ASP C O   1 
ATOM   4390 C CB  . ASP C 1 97  ? 99.337  53.191  32.518 1.00 16.24 ? 97   ASP C CB  1 
ATOM   4391 C CG  . ASP C 1 97  ? 99.226  52.868  31.031 1.00 16.90 ? 97   ASP C CG  1 
ATOM   4392 O OD1 . ASP C 1 97  ? 99.630  53.675  30.159 1.00 14.30 ? 97   ASP C OD1 1 
ATOM   4393 O OD2 . ASP C 1 97  ? 98.674  51.804  30.729 1.00 27.41 ? 97   ASP C OD2 1 
ATOM   4394 N N   . VAL C 1 98  ? 100.715 54.283  35.190 1.00 19.07 ? 98   VAL C N   1 
ATOM   4395 C CA  . VAL C 1 98  ? 100.555 54.647  36.598 1.00 18.72 ? 98   VAL C CA  1 
ATOM   4396 C C   . VAL C 1 98  ? 101.206 55.992  36.883 1.00 17.51 ? 98   VAL C C   1 
ATOM   4397 O O   . VAL C 1 98  ? 100.596 56.885  37.468 1.00 14.58 ? 98   VAL C O   1 
ATOM   4398 C CB  . VAL C 1 98  ? 101.169 53.570  37.550 1.00 17.14 ? 98   VAL C CB  1 
ATOM   4399 C CG1 . VAL C 1 98  ? 101.040 54.017  39.003 1.00 18.82 ? 98   VAL C CG1 1 
ATOM   4400 C CG2 . VAL C 1 98  ? 100.450 52.240  37.378 1.00 13.69 ? 98   VAL C CG2 1 
ATOM   4401 N N   . LEU C 1 99  ? 102.426 56.146  36.393 1.00 14.57 ? 99   LEU C N   1 
ATOM   4402 C CA  . LEU C 1 99  ? 103.172 57.374  36.577 1.00 15.04 ? 99   LEU C CA  1 
ATOM   4403 C C   . LEU C 1 99  ? 102.503 58.565  35.908 1.00 17.88 ? 99   LEU C C   1 
ATOM   4404 O O   . LEU C 1 99  ? 102.420 59.633  36.497 1.00 21.65 ? 99   LEU C O   1 
ATOM   4405 C CB  . LEU C 1 99  ? 104.573 57.204  36.021 1.00 17.07 ? 99   LEU C CB  1 
ATOM   4406 C CG  . LEU C 1 99  ? 105.716 57.345  37.010 1.00 16.65 ? 99   LEU C CG  1 
ATOM   4407 C CD1 . LEU C 1 99  ? 106.859 58.048  36.300 1.00 25.35 ? 99   LEU C CD1 1 
ATOM   4408 C CD2 . LEU C 1 99  ? 105.275 58.132  38.233 1.00 12.23 ? 99   LEU C CD2 1 
ATOM   4409 N N   . GLU C 1 100 ? 102.053 58.375  34.669 1.00 16.68 ? 100  GLU C N   1 
ATOM   4410 C CA  . GLU C 1 100 ? 101.368 59.420  33.918 1.00 22.36 ? 100  GLU C CA  1 
ATOM   4411 C C   . GLU C 1 100 ? 100.224 60.022  34.730 1.00 21.73 ? 100  GLU C C   1 
ATOM   4412 O O   . GLU C 1 100 ? 100.027 61.245  34.743 1.00 21.27 ? 100  GLU C O   1 
ATOM   4413 C CB  . GLU C 1 100 ? 100.812 58.857  32.607 1.00 23.55 ? 100  GLU C CB  1 
ATOM   4414 C CG  . GLU C 1 100 ? 99.548  59.563  32.126 1.00 24.41 ? 100  GLU C CG  1 
ATOM   4415 C CD  . GLU C 1 100 ? 98.954  58.931  30.902 1.00 29.56 ? 100  GLU C CD  1 
ATOM   4416 O OE1 . GLU C 1 100 ? 99.393  59.295  29.798 1.00 22.80 ? 100  GLU C OE1 1 
ATOM   4417 O OE2 . GLU C 1 100 ? 98.019  58.108  31.040 1.00 45.46 ? 100  GLU C OE2 1 
ATOM   4418 N N   . ASN C 1 101 ? 99.464  59.145  35.381 1.00 22.07 ? 101  ASN C N   1 
ATOM   4419 C CA  . ASN C 1 101 ? 98.283  59.550  36.122 1.00 20.58 ? 101  ASN C CA  1 
ATOM   4420 C C   . ASN C 1 101 ? 98.620  60.019  37.534 1.00 24.00 ? 101  ASN C C   1 
ATOM   4421 O O   . ASN C 1 101 ? 98.031  60.986  38.012 1.00 17.32 ? 101  ASN C O   1 
ATOM   4422 C CB  . ASN C 1 101 ? 97.262  58.409  36.155 1.00 18.67 ? 101  ASN C CB  1 
ATOM   4423 C CG  . ASN C 1 101 ? 96.544  58.235  34.826 1.00 22.21 ? 101  ASN C CG  1 
ATOM   4424 O OD1 . ASN C 1 101 ? 95.906  59.163  34.315 1.00 28.78 ? 101  ASN C OD1 1 
ATOM   4425 N ND2 . ASN C 1 101 ? 96.669  57.056  34.245 1.00 23.82 ? 101  ASN C ND2 1 
ATOM   4426 N N   . HIS C 1 102 ? 99.637  59.415  38.152 1.00 26.75 ? 102  HIS C N   1 
ATOM   4427 C CA  . HIS C 1 102 ? 100.081 59.843  39.484 1.00 27.05 ? 102  HIS C CA  1 
ATOM   4428 C C   . HIS C 1 102 ? 100.710 61.234  39.444 1.00 26.69 ? 102  HIS C C   1 
ATOM   4429 O O   . HIS C 1 102 ? 100.439 62.068  40.314 1.00 35.76 ? 102  HIS C O   1 
ATOM   4430 C CB  . HIS C 1 102 ? 101.088 58.859  40.094 1.00 27.12 ? 102  HIS C CB  1 
ATOM   4431 C CG  . HIS C 1 102 ? 101.607 59.280  41.443 1.00 29.42 ? 102  HIS C CG  1 
ATOM   4432 N ND1 . HIS C 1 102 ? 100.777 59.594  42.500 1.00 30.57 ? 102  HIS C ND1 1 
ATOM   4433 C CD2 . HIS C 1 102 ? 102.872 59.441  41.903 1.00 31.46 ? 102  HIS C CD2 1 
ATOM   4434 C CE1 . HIS C 1 102 ? 101.506 59.924  43.551 1.00 31.11 ? 102  HIS C CE1 1 
ATOM   4435 N NE2 . HIS C 1 102 ? 102.781 59.840  43.217 1.00 34.08 ? 102  HIS C NE2 1 
ATOM   4436 N N   . LEU C 1 103 ? 101.544 61.478  38.434 1.00 15.91 ? 103  LEU C N   1 
ATOM   4437 C CA  . LEU C 1 103 ? 102.219 62.762  38.288 1.00 14.20 ? 103  LEU C CA  1 
ATOM   4438 C C   . LEU C 1 103 ? 101.243 63.892  38.052 1.00 14.91 ? 103  LEU C C   1 
ATOM   4439 O O   . LEU C 1 103 ? 101.527 65.042  38.380 1.00 18.17 ? 103  LEU C O   1 
ATOM   4440 C CB  . LEU C 1 103 ? 103.201 62.723  37.127 1.00 17.42 ? 103  LEU C CB  1 
ATOM   4441 C CG  . LEU C 1 103 ? 104.423 61.844  37.334 1.00 15.79 ? 103  LEU C CG  1 
ATOM   4442 C CD1 . LEU C 1 103 ? 105.233 61.808  36.042 1.00 11.70 ? 103  LEU C CD1 1 
ATOM   4443 C CD2 . LEU C 1 103 ? 105.233 62.376  38.510 1.00 10.54 ? 103  LEU C CD2 1 
ATOM   4444 N N   . MET C 1 104 ? 100.128 63.571  37.408 1.00 15.79 ? 104  MET C N   1 
ATOM   4445 C CA  . MET C 1 104 ? 99.069  64.547  37.193 1.00 21.65 ? 104  MET C CA  1 
ATOM   4446 C C   . MET C 1 104 ? 98.401  64.910  38.523 1.00 18.15 ? 104  MET C C   1 
ATOM   4447 O O   . MET C 1 104 ? 98.105  66.072  38.776 1.00 15.70 ? 104  MET C O   1 
ATOM   4448 C CB  . MET C 1 104 ? 98.039  63.981  36.218 1.00 24.00 ? 104  MET C CB  1 
ATOM   4449 C CG  . MET C 1 104 ? 96.992  64.972  35.773 1.00 23.27 ? 104  MET C CG  1 
ATOM   4450 S SD  . MET C 1 104 ? 97.559  65.982  34.412 1.00 30.93 ? 104  MET C SD  1 
ATOM   4451 C CE  . MET C 1 104 ? 97.145  67.614  35.031 1.00 30.31 ? 104  MET C CE  1 
ATOM   4452 N N   . ASP C 1 105 ? 98.249  63.920  39.398 1.00 14.37 ? 105  ASP C N   1 
ATOM   4453 C CA  . ASP C 1 105 ? 97.681  64.140  40.722 1.00 17.03 ? 105  ASP C CA  1 
ATOM   4454 C C   . ASP C 1 105 ? 98.585  65.059  41.522 1.00 20.18 ? 105  ASP C C   1 
ATOM   4455 O O   . ASP C 1 105 ? 98.112  65.966  42.203 1.00 22.62 ? 105  ASP C O   1 
ATOM   4456 C CB  . ASP C 1 105 ? 97.512  62.809  41.475 1.00 19.54 ? 105  ASP C CB  1 
ATOM   4457 C CG  . ASP C 1 105 ? 96.260  62.035  41.053 1.00 20.31 ? 105  ASP C CG  1 
ATOM   4458 O OD1 . ASP C 1 105 ? 95.397  62.591  40.326 1.00 24.47 ? 105  ASP C OD1 1 
ATOM   4459 O OD2 . ASP C 1 105 ? 96.145  60.859  41.466 1.00 18.47 ? 105  ASP C OD2 1 
ATOM   4460 N N   . LEU C 1 106 ? 99.891  64.842  41.417 1.00 17.27 ? 106  LEU C N   1 
ATOM   4461 C CA  . LEU C 1 106 ? 100.840 65.661  42.149 1.00 23.32 ? 106  LEU C CA  1 
ATOM   4462 C C   . LEU C 1 106 ? 100.879 67.072  41.580 1.00 25.35 ? 106  LEU C C   1 
ATOM   4463 O O   . LEU C 1 106 ? 100.849 68.046  42.333 1.00 30.36 ? 106  LEU C O   1 
ATOM   4464 C CB  . LEU C 1 106 ? 102.235 65.032  42.116 1.00 22.15 ? 106  LEU C CB  1 
ATOM   4465 C CG  . LEU C 1 106 ? 102.457 63.724  42.883 1.00 27.78 ? 106  LEU C CG  1 
ATOM   4466 C CD1 . LEU C 1 106 ? 103.940 63.398  42.889 1.00 31.43 ? 106  LEU C CD1 1 
ATOM   4467 C CD2 . LEU C 1 106 ? 101.940 63.836  44.304 1.00 26.23 ? 106  LEU C CD2 1 
ATOM   4468 N N   . ARG C 1 107 ? 100.858 67.180  40.253 1.00 19.18 ? 107  ARG C N   1 
ATOM   4469 C CA  . ARG C 1 107 ? 100.845 68.486  39.599 1.00 25.98 ? 107  ARG C CA  1 
ATOM   4470 C C   . ARG C 1 107 ? 99.599  69.280  39.986 1.00 29.88 ? 107  ARG C C   1 
ATOM   4471 O O   . ARG C 1 107 ? 99.682  70.472  40.263 1.00 25.51 ? 107  ARG C O   1 
ATOM   4472 C CB  . ARG C 1 107 ? 100.907 68.341  38.074 1.00 19.25 ? 107  ARG C CB  1 
ATOM   4473 C CG  . ARG C 1 107 ? 100.166 69.435  37.322 1.00 24.01 ? 107  ARG C CG  1 
ATOM   4474 C CD  . ARG C 1 107 ? 100.334 69.294  35.837 1.00 28.57 ? 107  ARG C CD  1 
ATOM   4475 N NE  . ARG C 1 107 ? 101.633 69.800  35.420 1.00 28.08 ? 107  ARG C NE  1 
ATOM   4476 C CZ  . ARG C 1 107 ? 102.558 69.068  34.817 1.00 28.37 ? 107  ARG C CZ  1 
ATOM   4477 N NH1 . ARG C 1 107 ? 102.294 67.818  34.454 1.00 28.50 ? 107  ARG C NH1 1 
ATOM   4478 N NH2 . ARG C 1 107 ? 103.737 69.603  34.546 1.00 37.56 ? 107  ARG C NH2 1 
ATOM   4479 N N   . MET C 1 108 ? 98.453  68.606  40.019 1.00 36.56 ? 108  MET C N   1 
ATOM   4480 C CA  . MET C 1 108 ? 97.173  69.264  40.244 1.00 32.87 ? 108  MET C CA  1 
ATOM   4481 C C   . MET C 1 108 ? 97.013  69.667  41.701 1.00 28.01 ? 108  MET C C   1 
ATOM   4482 O O   . MET C 1 108 ? 96.443  70.712  41.989 1.00 26.05 ? 108  MET C O   1 
ATOM   4483 C CB  . MET C 1 108 ? 96.028  68.341  39.814 1.00 37.74 ? 108  MET C CB  1 
ATOM   4484 C CG  . MET C 1 108 ? 94.921  69.027  39.014 1.00 48.97 ? 108  MET C CG  1 
ATOM   4485 S SD  . MET C 1 108 ? 95.526  70.092  37.670 1.00 57.67 ? 108  MET C SD  1 
ATOM   4486 C CE  . MET C 1 108 ? 94.177  71.362  37.577 1.00 59.76 ? 108  MET C CE  1 
ATOM   4487 N N   . ALA C 1 109 ? 97.597  68.877  42.601 1.00 29.09 ? 109  ALA C N   1 
ATOM   4488 C CA  . ALA C 1 109 ? 97.583  69.161  44.034 1.00 23.55 ? 109  ALA C CA  1 
ATOM   4489 C C   . ALA C 1 109 ? 98.401  70.406  44.371 1.00 29.65 ? 109  ALA C C   1 
ATOM   4490 O O   . ALA C 1 109 ? 98.007  71.204  45.219 1.00 36.87 ? 109  ALA C O   1 
ATOM   4491 C CB  . ALA C 1 109 ? 98.115  67.966  44.802 1.00 22.13 ? 109  ALA C CB  1 
ATOM   4492 N N   . PHE C 1 110 ? 99.533  70.573  43.697 1.00 31.80 ? 110  PHE C N   1 
ATOM   4493 C CA  . PHE C 1 110 ? 100.368 71.763  43.861 1.00 29.25 ? 110  PHE C CA  1 
ATOM   4494 C C   . PHE C 1 110 ? 99.692  73.021  43.296 1.00 28.45 ? 110  PHE C C   1 
ATOM   4495 O O   . PHE C 1 110 ? 99.748  74.089  43.900 1.00 26.53 ? 110  PHE C O   1 
ATOM   4496 C CB  . PHE C 1 110 ? 101.721 71.538  43.177 1.00 26.72 ? 110  PHE C CB  1 
ATOM   4497 C CG  . PHE C 1 110 ? 102.701 72.674  43.351 1.00 29.49 ? 110  PHE C CG  1 
ATOM   4498 C CD1 . PHE C 1 110 ? 103.100 73.082  44.620 1.00 27.98 ? 110  PHE C CD1 1 
ATOM   4499 C CD2 . PHE C 1 110 ? 103.302 73.264  42.241 1.00 23.43 ? 110  PHE C CD2 1 
ATOM   4500 C CE1 . PHE C 1 110 ? 104.085 74.050  44.782 1.00 22.09 ? 110  PHE C CE1 1 
ATOM   4501 C CE2 . PHE C 1 110 ? 104.290 74.234  42.395 1.00 19.87 ? 110  PHE C CE2 1 
ATOM   4502 C CZ  . PHE C 1 110 ? 104.683 74.624  43.666 1.00 23.09 ? 110  PHE C CZ  1 
ATOM   4503 N N   . ALA C 1 111 ? 99.049  72.885  42.141 1.00 33.71 ? 111  ALA C N   1 
ATOM   4504 C CA  . ALA C 1 111 ? 98.418  74.025  41.482 1.00 31.37 ? 111  ALA C CA  1 
ATOM   4505 C C   . ALA C 1 111 ? 97.251  74.569  42.294 1.00 32.33 ? 111  ALA C C   1 
ATOM   4506 O O   . ALA C 1 111 ? 97.128  75.778  42.463 1.00 33.66 ? 111  ALA C O   1 
ATOM   4507 C CB  . ALA C 1 111 ? 97.955  73.643  40.094 1.00 24.71 ? 111  ALA C CB  1 
ATOM   4508 N N   . ARG C 1 112 ? 96.435  73.678  42.851 1.00 36.87 ? 112  ARG C N   1 
ATOM   4509 C CA  . ARG C 1 112 ? 95.315  74.099  43.687 1.00 46.24 ? 112  ARG C CA  1 
ATOM   4510 C C   . ARG C 1 112 ? 95.788  74.948  44.868 1.00 48.51 ? 112  ARG C C   1 
ATOM   4511 O O   . ARG C 1 112 ? 95.208  75.993  45.153 1.00 49.51 ? 112  ARG C O   1 
ATOM   4512 C CB  . ARG C 1 112 ? 94.529  72.879  44.184 1.00 51.54 ? 112  ARG C CB  1 
ATOM   4513 C CG  . ARG C 1 112 ? 93.094  72.765  43.632 1.00 61.81 ? 112  ARG C CG  1 
ATOM   4514 C CD  . ARG C 1 112 ? 93.041  72.851  42.096 1.00 68.58 ? 112  ARG C CD  1 
ATOM   4515 N NE  . ARG C 1 112 ? 91.915  72.108  41.526 1.00 67.97 ? 112  ARG C NE  1 
ATOM   4516 C CZ  . ARG C 1 112 ? 91.895  70.786  41.367 1.00 70.03 ? 112  ARG C CZ  1 
ATOM   4517 N NH1 . ARG C 1 112 ? 92.914  70.047  41.785 1.00 67.35 ? 112  ARG C NH1 1 
ATOM   4518 N NH2 . ARG C 1 112 ? 90.838  70.194  40.826 1.00 70.78 ? 112  ARG C NH2 1 
ATOM   4519 N N   . LEU C 1 113 ? 96.915  74.555  45.457 1.00 45.58 ? 113  LEU C N   1 
ATOM   4520 C CA  . LEU C 1 113 ? 97.554  75.297  46.540 1.00 31.12 ? 113  LEU C CA  1 
ATOM   4521 C C   . LEU C 1 113 ? 97.941  76.703  46.101 1.00 32.00 ? 113  LEU C C   1 
ATOM   4522 O O   . LEU C 1 113 ? 97.516  77.689  46.700 1.00 32.96 ? 113  LEU C O   1 
ATOM   4523 C CB  . LEU C 1 113 ? 98.804  74.545  46.984 1.00 28.92 ? 113  LEU C CB  1 
ATOM   4524 C CG  . LEU C 1 113 ? 99.768  75.178  47.980 1.00 25.71 ? 113  LEU C CG  1 
ATOM   4525 C CD1 . LEU C 1 113 ? 99.183  75.123  49.380 1.00 29.66 ? 113  LEU C CD1 1 
ATOM   4526 C CD2 . LEU C 1 113 ? 101.079 74.419  47.936 1.00 21.74 ? 113  LEU C CD2 1 
ATOM   4527 N N   . CYS C 1 114 ? 98.704  76.787  45.016 1.00 30.74 ? 114  CYS C N   1 
ATOM   4528 C CA  . CYS C 1 114 ? 99.260  78.051  44.562 1.00 32.45 ? 114  CYS C CA  1 
ATOM   4529 C C   . CYS C 1 114 ? 98.232  78.966  43.904 1.00 33.30 ? 114  CYS C C   1 
ATOM   4530 O O   . CYS C 1 114 ? 98.517  80.128  43.637 1.00 34.30 ? 114  CYS C O   1 
ATOM   4531 C CB  . CYS C 1 114 ? 100.401 77.790  43.593 1.00 35.08 ? 114  CYS C CB  1 
ATOM   4532 S SG  . CYS C 1 114 ? 101.693 76.782  44.290 1.00 31.89 ? 114  CYS C SG  1 
ATOM   4533 N N   . TYR C 1 115 ? 97.048  78.435  43.626 1.00 32.58 ? 115  TYR C N   1 
ATOM   4534 C CA  . TYR C 1 115 ? 95.963  79.234  43.068 1.00 30.15 ? 115  TYR C CA  1 
ATOM   4535 C C   . TYR C 1 115 ? 95.015  79.730  44.149 1.00 30.74 ? 115  TYR C C   1 
ATOM   4536 O O   . TYR C 1 115 ? 94.300  80.713  43.937 1.00 28.81 ? 115  TYR C O   1 
ATOM   4537 C CB  . TYR C 1 115 ? 95.169  78.417  42.046 1.00 28.57 ? 115  TYR C CB  1 
ATOM   4538 C CG  . TYR C 1 115 ? 95.742  78.440  40.648 1.00 27.02 ? 115  TYR C CG  1 
ATOM   4539 C CD1 . TYR C 1 115 ? 96.261  79.612  40.099 1.00 32.74 ? 115  TYR C CD1 1 
ATOM   4540 C CD2 . TYR C 1 115 ? 95.764  77.292  39.873 1.00 28.87 ? 115  TYR C CD2 1 
ATOM   4541 C CE1 . TYR C 1 115 ? 96.789  79.635  38.810 1.00 29.41 ? 115  TYR C CE1 1 
ATOM   4542 C CE2 . TYR C 1 115 ? 96.298  77.302  38.585 1.00 35.51 ? 115  TYR C CE2 1 
ATOM   4543 C CZ  . TYR C 1 115 ? 96.810  78.477  38.060 1.00 34.64 ? 115  TYR C CZ  1 
ATOM   4544 O OH  . TYR C 1 115 ? 97.367  78.471  36.800 1.00 35.34 ? 115  TYR C OH  1 
ATOM   4545 N N   . SER C 1 116 ? 95.001  79.027  45.287 1.00 32.39 ? 116  SER C N   1 
ATOM   4546 C CA  . SER C 1 116 ? 94.108  79.329  46.415 1.00 31.43 ? 116  SER C CA  1 
ATOM   4547 C C   . SER C 1 116 ? 94.502  80.584  47.195 1.00 33.59 ? 116  SER C C   1 
ATOM   4548 O O   . SER C 1 116 ? 95.654  80.745  47.600 1.00 33.55 ? 116  SER C O   1 
ATOM   4549 C CB  . SER C 1 116 ? 94.043  78.140  47.381 1.00 33.91 ? 116  SER C CB  1 
ATOM   4550 O OG  . SER C 1 116 ? 93.270  78.448  48.532 1.00 29.96 ? 116  SER C OG  1 
ATOM   4551 N N   . PRO C 1 117 ? 93.524  81.461  47.471 1.00 34.46 ? 117  PRO C N   1 
ATOM   4552 C CA  . PRO C 1 117 ? 93.774  82.690  48.235 1.00 37.63 ? 117  PRO C CA  1 
ATOM   4553 C C   . PRO C 1 117 ? 94.152  82.380  49.683 1.00 38.15 ? 117  PRO C C   1 
ATOM   4554 O O   . PRO C 1 117 ? 94.915  83.123  50.311 1.00 43.08 ? 117  PRO C O   1 
ATOM   4555 C CB  . PRO C 1 117 ? 92.446  83.445  48.142 1.00 37.70 ? 117  PRO C CB  1 
ATOM   4556 C CG  . PRO C 1 117 ? 91.705  82.791  46.996 1.00 36.04 ? 117  PRO C CG  1 
ATOM   4557 C CD  . PRO C 1 117 ? 92.111  81.358  47.073 1.00 33.99 ? 117  PRO C CD  1 
ATOM   4558 N N   . ASP C 1 118 ? 93.729  81.205  50.145 1.00 39.09 ? 118  ASP C N   1 
ATOM   4559 C CA  . ASP C 1 118 ? 94.123  80.667  51.448 1.00 42.22 ? 118  ASP C CA  1 
ATOM   4560 C C   . ASP C 1 118 ? 95.542  80.123  51.435 1.00 41.99 ? 118  ASP C C   1 
ATOM   4561 O O   . ASP C 1 118 ? 95.897  79.319  52.297 1.00 33.33 ? 118  ASP C O   1 
ATOM   4562 C CB  . ASP C 1 118 ? 93.201  79.516  51.845 1.00 41.18 ? 118  ASP C CB  1 
ATOM   4563 C CG  . ASP C 1 118 ? 91.849  79.982  52.287 1.00 43.21 ? 118  ASP C CG  1 
ATOM   4564 O OD1 . ASP C 1 118 ? 91.790  80.967  53.051 1.00 43.45 ? 118  ASP C OD1 1 
ATOM   4565 O OD2 . ASP C 1 118 ? 90.852  79.339  51.892 1.00 48.33 ? 118  ASP C OD2 1 
ATOM   4566 N N   . PHE C 1 119 ? 96.324  80.518  50.433 1.00 41.17 ? 119  PHE C N   1 
ATOM   4567 C CA  . PHE C 1 119 ? 97.628  79.932  50.173 1.00 35.77 ? 119  PHE C CA  1 
ATOM   4568 C C   . PHE C 1 119 ? 98.462  79.774  51.440 1.00 35.48 ? 119  PHE C C   1 
ATOM   4569 O O   . PHE C 1 119 ? 98.863  78.660  51.780 1.00 34.22 ? 119  PHE C O   1 
ATOM   4570 C CB  . PHE C 1 119 ? 98.383  80.779  49.146 1.00 34.73 ? 119  PHE C CB  1 
ATOM   4571 C CG  . PHE C 1 119 ? 99.813  80.364  48.950 1.00 38.78 ? 119  PHE C CG  1 
ATOM   4572 C CD1 . PHE C 1 119 ? 100.124 79.159  48.337 1.00 42.10 ? 119  PHE C CD1 1 
ATOM   4573 C CD2 . PHE C 1 119 ? 100.849 81.180  49.381 1.00 39.31 ? 119  PHE C CD2 1 
ATOM   4574 C CE1 . PHE C 1 119 ? 101.453 78.775  48.155 1.00 45.04 ? 119  PHE C CE1 1 
ATOM   4575 C CE2 . PHE C 1 119 ? 102.180 80.803  49.201 1.00 44.13 ? 119  PHE C CE2 1 
ATOM   4576 C CZ  . PHE C 1 119 ? 102.483 79.600  48.587 1.00 41.95 ? 119  PHE C CZ  1 
ATOM   4577 N N   . GLU C 1 120 ? 98.604  80.866  52.188 1.00 35.90 ? 120  GLU C N   1 
ATOM   4578 C CA  . GLU C 1 120 ? 99.470  80.911  53.364 1.00 42.29 ? 120  GLU C CA  1 
ATOM   4579 C C   . GLU C 1 120 ? 99.010  79.942  54.455 1.00 40.90 ? 120  GLU C C   1 
ATOM   4580 O O   . GLU C 1 120 ? 99.824  79.300  55.121 1.00 46.73 ? 120  GLU C O   1 
ATOM   4581 C CB  . GLU C 1 120 ? 99.507  82.340  53.911 1.00 49.32 ? 120  GLU C CB  1 
ATOM   4582 C CG  . GLU C 1 120 ? 100.300 82.503  55.205 1.00 66.87 ? 120  GLU C CG  1 
ATOM   4583 C CD  . GLU C 1 120 ? 101.684 83.085  54.983 1.00 74.18 ? 120  GLU C CD  1 
ATOM   4584 O OE1 . GLU C 1 120 ? 102.413 82.565  54.110 1.00 76.57 ? 120  GLU C OE1 1 
ATOM   4585 O OE2 . GLU C 1 120 ? 102.033 84.074  55.674 1.00 74.78 ? 120  GLU C OE2 1 
ATOM   4586 N N   . LYS C 1 121 ? 97.694  79.814  54.587 1.00 38.14 ? 121  LYS C N   1 
ATOM   4587 C CA  . LYS C 1 121 ? 97.053  78.938  55.570 1.00 40.18 ? 121  LYS C CA  1 
ATOM   4588 C C   . LYS C 1 121 ? 97.275  77.454  55.232 1.00 42.84 ? 121  LYS C C   1 
ATOM   4589 O O   . LYS C 1 121 ? 97.409  76.611  56.125 1.00 34.67 ? 121  LYS C O   1 
ATOM   4590 C CB  . LYS C 1 121 ? 95.553  79.274  55.598 1.00 40.96 ? 121  LYS C CB  1 
ATOM   4591 C CG  . LYS C 1 121 ? 94.680  78.423  56.502 1.00 39.98 ? 121  LYS C CG  1 
ATOM   4592 C CD  . LYS C 1 121 ? 93.218  78.836  56.364 1.00 40.24 ? 121  LYS C CD  1 
ATOM   4593 C CE  . LYS C 1 121 ? 92.285  77.867  57.075 1.00 41.79 ? 121  LYS C CE  1 
ATOM   4594 N NZ  . LYS C 1 121 ? 90.999  77.690  56.343 1.00 42.99 ? 121  LYS C NZ  1 
ATOM   4595 N N   . LEU C 1 122 ? 97.395  77.171  53.933 1.00 48.62 ? 122  LEU C N   1 
ATOM   4596 C CA  . LEU C 1 122 ? 97.505  75.805  53.410 1.00 42.48 ? 122  LEU C CA  1 
ATOM   4597 C C   . LEU C 1 122 ? 98.951  75.330  53.232 1.00 39.82 ? 122  LEU C C   1 
ATOM   4598 O O   . LEU C 1 122 ? 99.209  74.126  53.181 1.00 39.04 ? 122  LEU C O   1 
ATOM   4599 C CB  . LEU C 1 122 ? 96.782  75.701  52.062 1.00 36.79 ? 122  LEU C CB  1 
ATOM   4600 C CG  . LEU C 1 122 ? 95.272  75.937  52.042 1.00 30.45 ? 122  LEU C CG  1 
ATOM   4601 C CD1 . LEU C 1 122 ? 94.786  76.123  50.605 1.00 26.85 ? 122  LEU C CD1 1 
ATOM   4602 C CD2 . LEU C 1 122 ? 94.577  74.765  52.700 1.00 26.25 ? 122  LEU C CD2 1 
ATOM   4603 N N   . LYS C 1 123 ? 99.886  76.273  53.120 1.00 39.01 ? 123  LYS C N   1 
ATOM   4604 C CA  . LYS C 1 123 ? 101.289 75.942  52.862 1.00 38.27 ? 123  LYS C CA  1 
ATOM   4605 C C   . LYS C 1 123 ? 101.836 74.881  53.823 1.00 34.16 ? 123  LYS C C   1 
ATOM   4606 O O   . LYS C 1 123 ? 102.330 73.848  53.375 1.00 37.58 ? 123  LYS C O   1 
ATOM   4607 C CB  . LYS C 1 123 ? 102.178 77.206  52.903 1.00 40.17 ? 123  LYS C CB  1 
ATOM   4608 C CG  . LYS C 1 123 ? 103.446 77.138  52.022 1.00 43.18 ? 123  LYS C CG  1 
ATOM   4609 C CD  . LYS C 1 123 ? 104.679 77.796  52.676 1.00 47.58 ? 123  LYS C CD  1 
ATOM   4610 C CE  . LYS C 1 123 ? 104.718 79.323  52.519 1.00 52.86 ? 123  LYS C CE  1 
ATOM   4611 N NZ  . LYS C 1 123 ? 105.862 79.964  53.259 1.00 53.83 ? 123  LYS C NZ  1 
ATOM   4612 N N   . PRO C 1 124 ? 101.693 75.087  55.150 1.00 30.88 ? 124  PRO C N   1 
ATOM   4613 C CA  . PRO C 1 124 ? 102.275 74.140  56.112 1.00 31.62 ? 124  PRO C CA  1 
ATOM   4614 C C   . PRO C 1 124 ? 101.788 72.698  55.939 1.00 30.35 ? 124  PRO C C   1 
ATOM   4615 O O   . PRO C 1 124 ? 102.586 71.756  55.994 1.00 32.11 ? 124  PRO C O   1 
ATOM   4616 C CB  . PRO C 1 124 ? 101.866 74.718  57.469 1.00 30.62 ? 124  PRO C CB  1 
ATOM   4617 C CG  . PRO C 1 124 ? 101.737 76.171  57.210 1.00 28.52 ? 124  PRO C CG  1 
ATOM   4618 C CD  . PRO C 1 124 ? 101.107 76.247  55.847 1.00 30.85 ? 124  PRO C CD  1 
ATOM   4619 N N   . ALA C 1 125 ? 100.490 72.540  55.686 1.00 25.56 ? 125  ALA C N   1 
ATOM   4620 C CA  . ALA C 1 125 ? 99.887  71.224  55.484 1.00 22.31 ? 125  ALA C CA  1 
ATOM   4621 C C   . ALA C 1 125 ? 100.497 70.508  54.288 1.00 25.29 ? 125  ALA C C   1 
ATOM   4622 O O   . ALA C 1 125 ? 100.796 69.316  54.361 1.00 30.62 ? 125  ALA C O   1 
ATOM   4623 C CB  . ALA C 1 125 ? 98.380  71.355  55.292 1.00 14.36 ? 125  ALA C CB  1 
ATOM   4624 N N   . TYR C 1 126 ? 100.675 71.240  53.192 1.00 27.92 ? 126  TYR C N   1 
ATOM   4625 C CA  . TYR C 1 126 ? 101.266 70.689  51.983 1.00 30.55 ? 126  TYR C CA  1 
ATOM   4626 C C   . TYR C 1 126 ? 102.690 70.211  52.234 1.00 36.00 ? 126  TYR C C   1 
ATOM   4627 O O   . TYR C 1 126 ? 103.066 69.114  51.813 1.00 39.94 ? 126  TYR C O   1 
ATOM   4628 C CB  . TYR C 1 126 ? 101.263 71.734  50.860 1.00 33.77 ? 126  TYR C CB  1 
ATOM   4629 C CG  . TYR C 1 126 ? 101.758 71.209  49.518 1.00 43.43 ? 126  TYR C CG  1 
ATOM   4630 C CD1 . TYR C 1 126 ? 100.876 70.620  48.613 1.00 43.13 ? 126  TYR C CD1 1 
ATOM   4631 C CD2 . TYR C 1 126 ? 103.116 71.258  49.175 1.00 41.42 ? 126  TYR C CD2 1 
ATOM   4632 C CE1 . TYR C 1 126 ? 101.327 70.079  47.406 1.00 45.79 ? 126  TYR C CE1 1 
ATOM   4633 C CE2 . TYR C 1 126 ? 103.579 70.723  47.964 1.00 41.83 ? 126  TYR C CE2 1 
ATOM   4634 C CZ  . TYR C 1 126 ? 102.679 70.127  47.086 1.00 43.93 ? 126  TYR C CZ  1 
ATOM   4635 O OH  . TYR C 1 126 ? 103.121 69.540  45.909 1.00 43.34 ? 126  TYR C OH  1 
ATOM   4636 N N   . LEU C 1 127 ? 103.460 71.005  52.969 1.00 33.89 ? 127  LEU C N   1 
ATOM   4637 C CA  . LEU C 1 127 ? 104.872 70.701  53.185 1.00 31.31 ? 127  LEU C CA  1 
ATOM   4638 C C   . LEU C 1 127 ? 105.120 69.540  54.144 1.00 31.34 ? 127  LEU C C   1 
ATOM   4639 O O   . LEU C 1 127 ? 106.237 69.029  54.222 1.00 29.69 ? 127  LEU C O   1 
ATOM   4640 C CB  . LEU C 1 127 ? 105.599 71.939  53.683 1.00 31.19 ? 127  LEU C CB  1 
ATOM   4641 C CG  . LEU C 1 127 ? 105.593 73.092  52.684 1.00 32.56 ? 127  LEU C CG  1 
ATOM   4642 C CD1 . LEU C 1 127 ? 106.021 74.369  53.386 1.00 38.03 ? 127  LEU C CD1 1 
ATOM   4643 C CD2 . LEU C 1 127 ? 106.515 72.772  51.516 1.00 32.71 ? 127  LEU C CD2 1 
ATOM   4644 N N   . GLU C 1 128 ? 104.084 69.131  54.874 1.00 36.19 ? 128  GLU C N   1 
ATOM   4645 C CA  . GLU C 1 128 ? 104.179 67.962  55.741 1.00 41.31 ? 128  GLU C CA  1 
ATOM   4646 C C   . GLU C 1 128 ? 104.033 66.688  54.931 1.00 43.27 ? 128  GLU C C   1 
ATOM   4647 O O   . GLU C 1 128 ? 104.785 65.733  55.119 1.00 44.23 ? 128  GLU C O   1 
ATOM   4648 C CB  . GLU C 1 128 ? 103.094 67.998  56.811 1.00 43.76 ? 128  GLU C CB  1 
ATOM   4649 C CG  . GLU C 1 128 ? 103.137 69.238  57.681 1.00 58.31 ? 128  GLU C CG  1 
ATOM   4650 C CD  . GLU C 1 128 ? 104.160 69.140  58.791 1.00 62.55 ? 128  GLU C CD  1 
ATOM   4651 O OE1 . GLU C 1 128 ? 105.378 69.113  58.492 1.00 61.86 ? 128  GLU C OE1 1 
ATOM   4652 O OE2 . GLU C 1 128 ? 103.736 69.089  59.965 1.00 65.81 ? 128  GLU C OE2 1 
ATOM   4653 N N   . LEU C 1 129 ? 103.038 66.681  54.047 1.00 41.84 ? 129  LEU C N   1 
ATOM   4654 C CA  . LEU C 1 129 ? 102.721 65.524  53.218 1.00 38.65 ? 129  LEU C CA  1 
ATOM   4655 C C   . LEU C 1 129 ? 103.739 65.327  52.110 1.00 32.25 ? 129  LEU C C   1 
ATOM   4656 O O   . LEU C 1 129 ? 103.842 64.242  51.538 1.00 38.45 ? 129  LEU C O   1 
ATOM   4657 C CB  . LEU C 1 129 ? 101.335 65.697  52.588 1.00 40.92 ? 129  LEU C CB  1 
ATOM   4658 C CG  . LEU C 1 129 ? 100.116 65.335  53.441 1.00 46.86 ? 129  LEU C CG  1 
ATOM   4659 C CD1 . LEU C 1 129 ? 99.013  66.362  53.208 1.00 46.15 ? 129  LEU C CD1 1 
ATOM   4660 C CD2 . LEU C 1 129 ? 99.637  63.919  53.100 1.00 43.77 ? 129  LEU C CD2 1 
ATOM   4661 N N   . LEU C 1 130 ? 104.498 66.377  51.824 1.00 27.31 ? 130  LEU C N   1 
ATOM   4662 C CA  . LEU C 1 130 ? 105.371 66.417  50.655 1.00 32.57 ? 130  LEU C CA  1 
ATOM   4663 C C   . LEU C 1 130 ? 106.543 65.424  50.710 1.00 32.14 ? 130  LEU C C   1 
ATOM   4664 O O   . LEU C 1 130 ? 106.768 64.684  49.749 1.00 30.95 ? 130  LEU C O   1 
ATOM   4665 C CB  . LEU C 1 130 ? 105.882 67.849  50.444 1.00 30.02 ? 130  LEU C CB  1 
ATOM   4666 C CG  . LEU C 1 130 ? 106.522 68.313  49.131 1.00 30.17 ? 130  LEU C CG  1 
ATOM   4667 C CD1 . LEU C 1 130 ? 108.005 68.548  49.369 1.00 29.60 ? 130  LEU C CD1 1 
ATOM   4668 C CD2 . LEU C 1 130 ? 106.284 67.317  47.997 1.00 27.75 ? 130  LEU C CD2 1 
ATOM   4669 N N   . PRO C 1 131 ? 107.316 65.410  51.816 1.00 28.59 ? 131  PRO C N   1 
ATOM   4670 C CA  . PRO C 1 131 ? 108.456 64.485  51.903 1.00 24.75 ? 131  PRO C CA  1 
ATOM   4671 C C   . PRO C 1 131 ? 108.089 63.024  51.665 1.00 25.03 ? 131  PRO C C   1 
ATOM   4672 O O   . PRO C 1 131 ? 108.875 62.265  51.091 1.00 19.86 ? 131  PRO C O   1 
ATOM   4673 C CB  . PRO C 1 131 ? 108.999 64.700  53.324 1.00 23.90 ? 131  PRO C CB  1 
ATOM   4674 C CG  . PRO C 1 131 ? 107.979 65.538  54.030 1.00 25.35 ? 131  PRO C CG  1 
ATOM   4675 C CD  . PRO C 1 131 ? 107.291 66.327  52.970 1.00 25.89 ? 131  PRO C CD  1 
ATOM   4676 N N   . GLY C 1 132 ? 106.895 62.644  52.118 1.00 30.66 ? 132  GLY C N   1 
ATOM   4677 C CA  . GLY C 1 132 ? 106.413 61.284  51.939 1.00 21.37 ? 132  GLY C CA  1 
ATOM   4678 C C   . GLY C 1 132 ? 106.110 60.978  50.487 1.00 24.99 ? 132  GLY C C   1 
ATOM   4679 O O   . GLY C 1 132 ? 106.469 59.911  49.992 1.00 30.21 ? 132  GLY C O   1 
ATOM   4680 N N   . LYS C 1 133 ? 105.505 61.936  49.791 1.00 29.23 ? 133  LYS C N   1 
ATOM   4681 C CA  . LYS C 1 133 ? 105.273 61.815  48.352 1.00 31.76 ? 133  LYS C CA  1 
ATOM   4682 C C   . LYS C 1 133 ? 106.597 61.652  47.613 1.00 24.17 ? 133  LYS C C   1 
ATOM   4683 O O   . LYS C 1 133 ? 106.736 60.783  46.764 1.00 30.43 ? 133  LYS C O   1 
ATOM   4684 C CB  . LYS C 1 133 ? 104.530 63.047  47.818 1.00 29.02 ? 133  LYS C CB  1 
ATOM   4685 C CG  . LYS C 1 133 ? 103.069 63.133  48.232 1.00 38.66 ? 133  LYS C CG  1 
ATOM   4686 C CD  . LYS C 1 133 ? 102.465 64.464  47.800 1.00 47.51 ? 133  LYS C CD  1 
ATOM   4687 C CE  . LYS C 1 133 ? 101.240 64.844  48.639 1.00 50.07 ? 133  LYS C CE  1 
ATOM   4688 N NZ  . LYS C 1 133 ? 100.853 66.286  48.474 1.00 49.34 ? 133  LYS C NZ  1 
ATOM   4689 N N   . LEU C 1 134 ? 107.583 62.454  48.001 1.00 26.76 ? 134  LEU C N   1 
ATOM   4690 C CA  . LEU C 1 134 ? 108.922 62.410  47.420 1.00 18.15 ? 134  LEU C CA  1 
ATOM   4691 C C   . LEU C 1 134 ? 109.622 61.084  47.663 1.00 20.41 ? 134  LEU C C   1 
ATOM   4692 O O   . LEU C 1 134 ? 110.387 60.623  46.819 1.00 22.50 ? 134  LEU C O   1 
ATOM   4693 C CB  . LEU C 1 134 ? 109.792 63.515  48.010 1.00 21.76 ? 134  LEU C CB  1 
ATOM   4694 C CG  . LEU C 1 134 ? 109.541 64.943  47.533 1.00 25.10 ? 134  LEU C CG  1 
ATOM   4695 C CD1 . LEU C 1 134 ? 110.196 65.930  48.487 1.00 26.03 ? 134  LEU C CD1 1 
ATOM   4696 C CD2 . LEU C 1 134 ? 110.095 65.101  46.133 1.00 33.89 ? 134  LEU C CD2 1 
ATOM   4697 N N   . ARG C 1 135 ? 109.444 60.514  48.854 1.00 20.79 ? 135  ARG C N   1 
ATOM   4698 C CA  . ARG C 1 135 ? 110.101 59.249  49.166 1.00 22.26 ? 135  ARG C CA  1 
ATOM   4699 C C   . ARG C 1 135 ? 109.474 58.068  48.437 1.00 21.34 ? 135  ARG C C   1 
ATOM   4700 O O   . ARG C 1 135 ? 110.150 57.065  48.216 1.00 25.11 ? 135  ARG C O   1 
ATOM   4701 C CB  . ARG C 1 135 ? 110.122 58.985  50.674 1.00 24.39 ? 135  ARG C CB  1 
ATOM   4702 C CG  . ARG C 1 135 ? 111.433 59.394  51.355 1.00 31.42 ? 135  ARG C CG  1 
ATOM   4703 C CD  . ARG C 1 135 ? 111.479 59.022  52.845 1.00 30.11 ? 135  ARG C CD  1 
ATOM   4704 N NE  . ARG C 1 135 ? 110.385 59.614  53.612 1.00 31.62 ? 135  ARG C NE  1 
ATOM   4705 C CZ  . ARG C 1 135 ? 110.519 60.641  54.446 1.00 35.75 ? 135  ARG C CZ  1 
ATOM   4706 N NH1 . ARG C 1 135 ? 111.697 61.237  54.599 1.00 35.43 ? 135  ARG C NH1 1 
ATOM   4707 N NH2 . ARG C 1 135 ? 109.466 61.089  55.118 1.00 37.80 ? 135  ARG C NH2 1 
ATOM   4708 N N   . GLN C 1 136 ? 108.213 58.201  48.020 1.00 17.66 ? 136  GLN C N   1 
ATOM   4709 C CA  . GLN C 1 136 ? 107.555 57.166  47.216 1.00 11.95 ? 136  GLN C CA  1 
ATOM   4710 C C   . GLN C 1 136 ? 108.133 57.090  45.819 1.00 10.22 ? 136  GLN C C   1 
ATOM   4711 O O   . GLN C 1 136 ? 108.396 56.008  45.311 1.00 12.55 ? 136  GLN C O   1 
ATOM   4712 C CB  . GLN C 1 136 ? 106.048 57.408  47.123 1.00 16.45 ? 136  GLN C CB  1 
ATOM   4713 C CG  . GLN C 1 136 ? 105.251 56.862  48.321 1.00 20.64 ? 136  GLN C CG  1 
ATOM   4714 C CD  . GLN C 1 136 ? 103.792 57.313  48.327 1.00 23.92 ? 136  GLN C CD  1 
ATOM   4715 O OE1 . GLN C 1 136 ? 103.367 58.106  47.480 1.00 25.24 ? 136  GLN C OE1 1 
ATOM   4716 N NE2 . GLN C 1 136 ? 103.024 56.823  49.300 1.00 27.43 ? 136  GLN C NE2 1 
ATOM   4717 N N   . LEU C 1 137 ? 108.334 58.251  45.209 1.00 15.00 ? 137  LEU C N   1 
ATOM   4718 C CA  . LEU C 1 137 ? 109.008 58.364  43.918 1.00 16.85 ? 137  LEU C CA  1 
ATOM   4719 C C   . LEU C 1 137 ? 110.467 57.903  43.969 1.00 22.05 ? 137  LEU C C   1 
ATOM   4720 O O   . LEU C 1 137 ? 110.997 57.397  42.981 1.00 16.03 ? 137  LEU C O   1 
ATOM   4721 C CB  . LEU C 1 137 ? 108.980 59.815  43.445 1.00 19.07 ? 137  LEU C CB  1 
ATOM   4722 C CG  . LEU C 1 137 ? 107.664 60.384  42.938 1.00 18.74 ? 137  LEU C CG  1 
ATOM   4723 C CD1 . LEU C 1 137 ? 107.628 61.877  43.214 1.00 14.93 ? 137  LEU C CD1 1 
ATOM   4724 C CD2 . LEU C 1 137 ? 107.530 60.089  41.452 1.00 16.22 ? 137  LEU C CD2 1 
ATOM   4725 N N   . SER C 1 138 ? 111.149 58.199  45.074 1.00 28.42 ? 138  SER C N   1 
ATOM   4726 C CA  . SER C 1 138 ? 112.532 57.779  45.250 1.00 27.06 ? 138  SER C CA  1 
ATOM   4727 C C   . SER C 1 138 ? 112.603 56.258  45.317 1.00 28.99 ? 138  SER C C   1 
ATOM   4728 O O   . SER C 1 138 ? 113.511 55.650  44.751 1.00 34.64 ? 138  SER C O   1 
ATOM   4729 C CB  . SER C 1 138 ? 113.118 58.386  46.527 1.00 32.92 ? 138  SER C CB  1 
ATOM   4730 O OG  . SER C 1 138 ? 114.440 57.917  46.739 1.00 34.65 ? 138  SER C OG  1 
ATOM   4731 N N   . ARG C 1 139 ? 111.633 55.657  46.012 1.00 26.50 ? 139  ARG C N   1 
ATOM   4732 C CA  . ARG C 1 139 ? 111.501 54.201  46.136 1.00 31.54 ? 139  ARG C CA  1 
ATOM   4733 C C   . ARG C 1 139 ? 111.293 53.570  44.764 1.00 34.27 ? 139  ARG C C   1 
ATOM   4734 O O   . ARG C 1 139 ? 111.986 52.619  44.394 1.00 39.00 ? 139  ARG C O   1 
ATOM   4735 C CB  . ARG C 1 139 ? 110.302 53.859  47.043 1.00 36.86 ? 139  ARG C CB  1 
ATOM   4736 C CG  . ARG C 1 139 ? 109.943 52.361  47.149 1.00 45.93 ? 139  ARG C CG  1 
ATOM   4737 C CD  . ARG C 1 139 ? 108.595 52.011  46.481 1.00 56.83 ? 139  ARG C CD  1 
ATOM   4738 N NE  . ARG C 1 139 ? 107.437 52.470  47.251 1.00 58.38 ? 139  ARG C NE  1 
ATOM   4739 C CZ  . ARG C 1 139 ? 106.608 51.672  47.923 1.00 56.39 ? 139  ARG C CZ  1 
ATOM   4740 N NH1 . ARG C 1 139 ? 106.753 50.353  47.861 1.00 54.66 ? 139  ARG C NH1 1 
ATOM   4741 N NH2 . ARG C 1 139 ? 105.620 52.196  48.649 1.00 51.20 ? 139  ARG C NH2 1 
ATOM   4742 N N   . PHE C 1 140 ? 110.354 54.143  44.014 1.00 30.77 ? 140  PHE C N   1 
ATOM   4743 C CA  . PHE C 1 140 ? 109.957 53.675  42.689 1.00 18.94 ? 140  PHE C CA  1 
ATOM   4744 C C   . PHE C 1 140 ? 111.125 53.631  41.692 1.00 23.47 ? 140  PHE C C   1 
ATOM   4745 O O   . PHE C 1 140 ? 111.446 52.567  41.153 1.00 30.34 ? 140  PHE C O   1 
ATOM   4746 C CB  . PHE C 1 140 ? 108.850 54.595  42.168 1.00 14.09 ? 140  PHE C CB  1 
ATOM   4747 C CG  . PHE C 1 140 ? 108.184 54.111  40.904 1.00 19.56 ? 140  PHE C CG  1 
ATOM   4748 C CD1 . PHE C 1 140 ? 107.401 52.958  40.907 1.00 18.77 ? 140  PHE C CD1 1 
ATOM   4749 C CD2 . PHE C 1 140 ? 108.228 54.880  39.743 1.00 17.65 ? 140  PHE C CD2 1 
ATOM   4750 C CE1 . PHE C 1 140 ? 106.668 52.588  39.783 1.00 16.10 ? 140  PHE C CE1 1 
ATOM   4751 C CE2 . PHE C 1 140 ? 107.496 54.516  38.616 1.00 15.60 ? 140  PHE C CE2 1 
ATOM   4752 C CZ  . PHE C 1 140 ? 106.713 53.371  38.640 1.00 10.01 ? 140  PHE C CZ  1 
ATOM   4753 N N   . LEU C 1 141 ? 111.770 54.782  41.483 1.00 22.04 ? 141  LEU C N   1 
ATOM   4754 C CA  . LEU C 1 141 ? 112.935 54.898  40.603 1.00 18.91 ? 141  LEU C CA  1 
ATOM   4755 C C   . LEU C 1 141 ? 114.044 53.931  41.002 1.00 23.26 ? 141  LEU C C   1 
ATOM   4756 O O   . LEU C 1 141 ? 114.567 53.197  40.163 1.00 23.28 ? 141  LEU C O   1 
ATOM   4757 C CB  . LEU C 1 141 ? 113.468 56.338  40.631 1.00 19.53 ? 141  LEU C CB  1 
ATOM   4758 C CG  . LEU C 1 141 ? 114.675 56.761  39.782 1.00 15.99 ? 141  LEU C CG  1 
ATOM   4759 C CD1 . LEU C 1 141 ? 114.365 56.658  38.291 1.00 14.97 ? 141  LEU C CD1 1 
ATOM   4760 C CD2 . LEU C 1 141 ? 115.032 58.192  40.141 1.00 16.09 ? 141  LEU C CD2 1 
ATOM   4761 N N   . GLY C 1 142 ? 114.385 53.925  42.290 1.00 27.12 ? 142  GLY C N   1 
ATOM   4762 C CA  . GLY C 1 142 ? 115.426 53.041  42.783 1.00 29.06 ? 142  GLY C CA  1 
ATOM   4763 C C   . GLY C 1 142 ? 116.784 53.358  42.191 1.00 28.51 ? 142  GLY C C   1 
ATOM   4764 O O   . GLY C 1 142 ? 117.168 54.527  42.084 1.00 30.78 ? 142  GLY C O   1 
ATOM   4765 N N   . SER C 1 143 ? 117.507 52.312  41.801 1.00 27.42 ? 143  SER C N   1 
ATOM   4766 C CA  . SER C 1 143 ? 118.844 52.462  41.241 1.00 38.71 ? 143  SER C CA  1 
ATOM   4767 C C   . SER C 1 143 ? 118.797 52.530  39.716 1.00 31.59 ? 143  SER C C   1 
ATOM   4768 O O   . SER C 1 143 ? 119.833 52.517  39.046 1.00 26.97 ? 143  SER C O   1 
ATOM   4769 C CB  . SER C 1 143 ? 119.734 51.306  41.706 1.00 38.48 ? 143  SER C CB  1 
ATOM   4770 O OG  . SER C 1 143 ? 120.098 51.483  43.071 1.00 51.05 ? 143  SER C OG  1 
ATOM   4771 N N   . ARG C 1 144 ? 117.586 52.707  39.193 1.00 32.56 ? 144  ARG C N   1 
ATOM   4772 C CA  . ARG C 1 144 ? 117.344 52.802  37.753 1.00 31.43 ? 144  ARG C CA  1 
ATOM   4773 C C   . ARG C 1 144 ? 117.936 54.082  37.166 1.00 25.74 ? 144  ARG C C   1 
ATOM   4774 O O   . ARG C 1 144 ? 118.160 55.063  37.879 1.00 31.14 ? 144  ARG C O   1 
ATOM   4775 C CB  . ARG C 1 144 ? 115.835 52.770  37.476 1.00 31.63 ? 144  ARG C CB  1 
ATOM   4776 C CG  . ARG C 1 144 ? 115.339 51.539  36.750 1.00 37.60 ? 144  ARG C CG  1 
ATOM   4777 C CD  . ARG C 1 144 ? 113.822 51.481  36.766 1.00 40.30 ? 144  ARG C CD  1 
ATOM   4778 N NE  . ARG C 1 144 ? 113.304 51.288  38.120 1.00 46.82 ? 144  ARG C NE  1 
ATOM   4779 C CZ  . ARG C 1 144 ? 112.739 50.165  38.556 1.00 46.40 ? 144  ARG C CZ  1 
ATOM   4780 N NH1 . ARG C 1 144 ? 112.457 49.186  37.704 1.00 47.54 ? 144  ARG C NH1 1 
ATOM   4781 N NH2 . ARG C 1 144 ? 112.380 50.052  39.832 1.00 40.03 ? 144  ARG C NH2 1 
ATOM   4782 N N   . SER C 1 145 ? 118.185 54.064  35.863 1.00 29.25 ? 145  SER C N   1 
ATOM   4783 C CA  . SER C 1 145 ? 118.622 55.259  35.159 1.00 31.22 ? 145  SER C CA  1 
ATOM   4784 C C   . SER C 1 145 ? 117.409 56.131  34.886 1.00 32.49 ? 145  SER C C   1 
ATOM   4785 O O   . SER C 1 145 ? 117.400 57.314  35.228 1.00 35.51 ? 145  SER C O   1 
ATOM   4786 C CB  . SER C 1 145 ? 119.291 54.882  33.841 1.00 34.50 ? 145  SER C CB  1 
ATOM   4787 O OG  . SER C 1 145 ? 120.071 53.709  33.984 1.00 42.34 ? 145  SER C OG  1 
ATOM   4788 N N   . TRP C 1 146 ? 116.363 55.516  34.334 1.00 28.70 ? 146  TRP C N   1 
ATOM   4789 C CA  . TRP C 1 146 ? 115.122 56.213  34.023 1.00 21.15 ? 146  TRP C CA  1 
ATOM   4790 C C   . TRP C 1 146 ? 113.937 55.614  34.751 1.00 24.55 ? 146  TRP C C   1 
ATOM   4791 O O   . TRP C 1 146 ? 114.051 54.552  35.357 1.00 33.44 ? 146  TRP C O   1 
ATOM   4792 C CB  . TRP C 1 146 ? 114.886 56.173  32.532 1.00 21.14 ? 146  TRP C CB  1 
ATOM   4793 C CG  . TRP C 1 146 ? 116.001 56.777  31.805 1.00 21.26 ? 146  TRP C CG  1 
ATOM   4794 C CD1 . TRP C 1 146 ? 116.890 56.140  30.998 1.00 16.06 ? 146  TRP C CD1 1 
ATOM   4795 C CD2 . TRP C 1 146 ? 116.404 58.149  31.852 1.00 20.30 ? 146  TRP C CD2 1 
ATOM   4796 N NE1 . TRP C 1 146 ? 117.817 57.033  30.524 1.00 20.92 ? 146  TRP C NE1 1 
ATOM   4797 C CE2 . TRP C 1 146 ? 117.544 58.276  31.037 1.00 21.81 ? 146  TRP C CE2 1 
ATOM   4798 C CE3 . TRP C 1 146 ? 115.914 59.284  32.509 1.00 16.45 ? 146  TRP C CE3 1 
ATOM   4799 C CZ2 . TRP C 1 146 ? 118.210 59.500  30.858 1.00 19.53 ? 146  TRP C CZ2 1 
ATOM   4800 C CZ3 . TRP C 1 146 ? 116.579 60.496  32.334 1.00 18.63 ? 146  TRP C CZ3 1 
ATOM   4801 C CH2 . TRP C 1 146 ? 117.714 60.592  31.514 1.00 13.53 ? 146  TRP C CH2 1 
ATOM   4802 N N   . PHE C 1 147 ? 112.778 56.252  34.611 1.00 23.30 ? 147  PHE C N   1 
ATOM   4803 C CA  . PHE C 1 147 ? 111.618 55.917  35.427 1.00 20.13 ? 147  PHE C CA  1 
ATOM   4804 C C   . PHE C 1 147 ? 110.927 54.625  35.065 1.00 24.81 ? 147  PHE C C   1 
ATOM   4805 O O   . PHE C 1 147 ? 110.367 53.956  35.924 1.00 29.55 ? 147  PHE C O   1 
ATOM   4806 C CB  . PHE C 1 147 ? 110.605 57.050  35.405 1.00 16.34 ? 147  PHE C CB  1 
ATOM   4807 C CG  . PHE C 1 147 ? 110.632 57.882  36.639 1.00 19.89 ? 147  PHE C CG  1 
ATOM   4808 C CD1 . PHE C 1 147 ? 110.078 57.396  37.822 1.00 12.78 ? 147  PHE C CD1 1 
ATOM   4809 C CD2 . PHE C 1 147 ? 111.352 59.076  36.671 1.00 17.80 ? 147  PHE C CD2 1 
ATOM   4810 C CE1 . PHE C 1 147 ? 110.251 58.085  39.027 1.00 18.77 ? 147  PHE C CE1 1 
ATOM   4811 C CE2 . PHE C 1 147 ? 111.530 59.773  37.876 1.00 17.78 ? 147  PHE C CE2 1 
ATOM   4812 C CZ  . PHE C 1 147 ? 110.981 59.276  39.056 1.00 12.19 ? 147  PHE C CZ  1 
ATOM   4813 N N   . VAL C 1 148 ? 110.976 54.264  33.794 1.00 26.15 ? 148  VAL C N   1 
ATOM   4814 C CA  . VAL C 1 148 ? 110.256 53.097  33.340 1.00 30.95 ? 148  VAL C CA  1 
ATOM   4815 C C   . VAL C 1 148 ? 111.213 51.951  32.977 1.00 33.12 ? 148  VAL C C   1 
ATOM   4816 O O   . VAL C 1 148 ? 110.782 50.820  32.743 1.00 41.75 ? 148  VAL C O   1 
ATOM   4817 C CB  . VAL C 1 148 ? 109.353 53.482  32.166 1.00 34.74 ? 148  VAL C CB  1 
ATOM   4818 C CG1 . VAL C 1 148 ? 110.186 53.707  30.925 1.00 47.19 ? 148  VAL C CG1 1 
ATOM   4819 C CG2 . VAL C 1 148 ? 108.301 52.438  31.953 1.00 36.31 ? 148  VAL C CG2 1 
ATOM   4820 N N   . GLY C 1 149 ? 112.513 52.215  33.074 1.00 33.75 ? 149  GLY C N   1 
ATOM   4821 C CA  . GLY C 1 149 ? 113.496 51.168  32.871 1.00 27.70 ? 149  GLY C CA  1 
ATOM   4822 C C   . GLY C 1 149 ? 114.810 51.696  32.338 1.00 32.91 ? 149  GLY C C   1 
ATOM   4823 O O   . GLY C 1 149 ? 115.399 52.618  32.899 1.00 32.16 ? 149  GLY C O   1 
ATOM   4824 N N   . ASP C 1 150 ? 115.278 51.098  31.249 1.00 42.43 ? 150  ASP C N   1 
ATOM   4825 C CA  . ASP C 1 150 ? 116.565 51.472  30.676 1.00 43.02 ? 150  ASP C CA  1 
ATOM   4826 C C   . ASP C 1 150 ? 116.382 52.521  29.593 1.00 42.45 ? 150  ASP C C   1 
ATOM   4827 O O   . ASP C 1 150 ? 117.315 53.252  29.272 1.00 43.61 ? 150  ASP C O   1 
ATOM   4828 C CB  . ASP C 1 150 ? 117.272 50.246  30.100 1.00 49.69 ? 150  ASP C CB  1 
ATOM   4829 C CG  . ASP C 1 150 ? 117.169 49.033  31.006 1.00 59.84 ? 150  ASP C CG  1 
ATOM   4830 O OD1 . ASP C 1 150 ? 117.259 49.198  32.244 1.00 65.93 ? 150  ASP C OD1 1 
ATOM   4831 O OD2 . ASP C 1 150 ? 116.973 47.915  30.482 1.00 62.56 ? 150  ASP C OD2 1 
ATOM   4832 N N   . LYS C 1 151 ? 115.173 52.606  29.048 1.00 36.57 ? 151  LYS C N   1 
ATOM   4833 C CA  . LYS C 1 151 ? 114.889 53.563  27.996 1.00 31.12 ? 151  LYS C CA  1 
ATOM   4834 C C   . LYS C 1 151 ? 114.186 54.805  28.532 1.00 33.59 ? 151  LYS C C   1 
ATOM   4835 O O   . LYS C 1 151 ? 113.391 54.739  29.475 1.00 31.33 ? 151  LYS C O   1 
ATOM   4836 C CB  . LYS C 1 151 ? 114.058 52.911  26.885 1.00 40.73 ? 151  LYS C CB  1 
ATOM   4837 C CG  . LYS C 1 151 ? 112.623 52.530  27.272 1.00 49.63 ? 151  LYS C CG  1 
ATOM   4838 C CD  . LYS C 1 151 ? 111.955 51.677  26.186 1.00 54.01 ? 151  LYS C CD  1 
ATOM   4839 C CE  . LYS C 1 151 ? 111.820 52.430  24.866 1.00 47.38 ? 151  LYS C CE  1 
ATOM   4840 N NZ  . LYS C 1 151 ? 110.582 53.247  24.817 1.00 50.07 ? 151  LYS C NZ  1 
ATOM   4841 N N   . LEU C 1 152 ? 114.610 55.951  28.011 1.00 30.00 ? 152  LEU C N   1 
ATOM   4842 C CA  . LEU C 1 152 ? 113.922 57.218  28.216 1.00 23.18 ? 152  LEU C CA  1 
ATOM   4843 C C   . LEU C 1 152 ? 112.520 57.149  27.578 1.00 22.58 ? 152  LEU C C   1 
ATOM   4844 O O   . LEU C 1 152 ? 112.360 56.677  26.450 1.00 29.12 ? 152  LEU C O   1 
ATOM   4845 C CB  . LEU C 1 152 ? 114.739 58.331  27.558 1.00 13.26 ? 152  LEU C CB  1 
ATOM   4846 C CG  . LEU C 1 152 ? 115.014 59.682  28.220 1.00 19.82 ? 152  LEU C CG  1 
ATOM   4847 C CD1 . LEU C 1 152 ? 115.190 60.717  27.122 1.00 12.59 ? 152  LEU C CD1 1 
ATOM   4848 C CD2 . LEU C 1 152 ? 113.889 60.090  29.152 1.00 14.43 ? 152  LEU C CD2 1 
ATOM   4849 N N   . THR C 1 153 ? 111.500 57.545  28.327 1.00 16.20 ? 153  THR C N   1 
ATOM   4850 C CA  . THR C 1 153 ? 110.155 57.656  27.775 1.00 9.70  ? 153  THR C CA  1 
ATOM   4851 C C   . THR C 1 153 ? 109.579 59.002  28.169 1.00 14.42 ? 153  THR C C   1 
ATOM   4852 O O   . THR C 1 153 ? 110.168 59.722  28.975 1.00 24.53 ? 153  THR C O   1 
ATOM   4853 C CB  . THR C 1 153 ? 109.194 56.535  28.274 1.00 10.22 ? 153  THR C CB  1 
ATOM   4854 O OG1 . THR C 1 153 ? 109.119 56.537  29.709 1.00 7.28  ? 153  THR C OG1 1 
ATOM   4855 C CG2 . THR C 1 153 ? 109.656 55.184  27.780 1.00 9.38  ? 153  THR C CG2 1 
ATOM   4856 N N   . PHE C 1 154 ? 108.405 59.320  27.635 1.00 15.15 ? 154  PHE C N   1 
ATOM   4857 C CA  . PHE C 1 154 ? 107.809 60.640  27.825 1.00 11.62 ? 154  PHE C CA  1 
ATOM   4858 C C   . PHE C 1 154 ? 107.449 60.900  29.289 1.00 12.28 ? 154  PHE C C   1 
ATOM   4859 O O   . PHE C 1 154 ? 107.281 62.042  29.704 1.00 14.32 ? 154  PHE C O   1 
ATOM   4860 C CB  . PHE C 1 154 ? 106.574 60.795  26.921 1.00 10.17 ? 154  PHE C CB  1 
ATOM   4861 C CG  . PHE C 1 154 ? 105.389 59.949  27.341 1.00 15.70 ? 154  PHE C CG  1 
ATOM   4862 C CD1 . PHE C 1 154 ? 105.313 58.607  26.989 1.00 12.68 ? 154  PHE C CD1 1 
ATOM   4863 C CD2 . PHE C 1 154 ? 104.365 60.493  28.123 1.00 18.34 ? 154  PHE C CD2 1 
ATOM   4864 C CE1 . PHE C 1 154 ? 104.243 57.817  27.412 1.00 8.40  ? 154  PHE C CE1 1 
ATOM   4865 C CE2 . PHE C 1 154 ? 103.296 59.713  28.552 1.00 9.56  ? 154  PHE C CE2 1 
ATOM   4866 C CZ  . PHE C 1 154 ? 103.235 58.372  28.196 1.00 9.99  ? 154  PHE C CZ  1 
ATOM   4867 N N   . VAL C 1 155 ? 107.358 59.830  30.070 1.00 16.06 ? 155  VAL C N   1 
ATOM   4868 C CA  . VAL C 1 155 ? 106.996 59.925  31.474 1.00 12.86 ? 155  VAL C CA  1 
ATOM   4869 C C   . VAL C 1 155 ? 108.149 60.544  32.254 1.00 15.75 ? 155  VAL C C   1 
ATOM   4870 O O   . VAL C 1 155 ? 107.945 61.187  33.284 1.00 23.83 ? 155  VAL C O   1 
ATOM   4871 C CB  . VAL C 1 155 ? 106.641 58.521  32.029 1.00 11.35 ? 155  VAL C CB  1 
ATOM   4872 C CG1 . VAL C 1 155 ? 107.708 58.011  32.964 1.00 11.51 ? 155  VAL C CG1 1 
ATOM   4873 C CG2 . VAL C 1 155 ? 105.300 58.564  32.714 1.00 13.99 ? 155  VAL C CG2 1 
ATOM   4874 N N   . ASP C 1 156 ? 109.353 60.389  31.718 1.00 12.73 ? 156  ASP C N   1 
ATOM   4875 C CA  . ASP C 1 156 ? 110.539 60.996  32.294 1.00 15.85 ? 156  ASP C CA  1 
ATOM   4876 C C   . ASP C 1 156 ? 110.503 62.521  32.141 1.00 25.04 ? 156  ASP C C   1 
ATOM   4877 O O   . ASP C 1 156 ? 111.029 63.250  32.982 1.00 36.85 ? 156  ASP C O   1 
ATOM   4878 C CB  . ASP C 1 156 ? 111.785 60.425  31.619 1.00 15.96 ? 156  ASP C CB  1 
ATOM   4879 C CG  . ASP C 1 156 ? 111.998 58.955  31.935 1.00 18.73 ? 156  ASP C CG  1 
ATOM   4880 O OD1 . ASP C 1 156 ? 112.565 58.667  33.002 1.00 14.77 ? 156  ASP C OD1 1 
ATOM   4881 O OD2 . ASP C 1 156 ? 111.614 58.088  31.122 1.00 17.46 ? 156  ASP C OD2 1 
ATOM   4882 N N   . PHE C 1 157 ? 109.809 62.998  31.112 1.00 22.22 ? 157  PHE C N   1 
ATOM   4883 C CA  . PHE C 1 157 ? 109.643 64.435  30.890 1.00 14.62 ? 157  PHE C CA  1 
ATOM   4884 C C   . PHE C 1 157 ? 108.625 65.033  31.836 1.00 18.56 ? 157  PHE C C   1 
ATOM   4885 O O   . PHE C 1 157 ? 108.719 66.206  32.203 1.00 30.20 ? 157  PHE C O   1 
ATOM   4886 C CB  . PHE C 1 157 ? 109.202 64.708  29.456 1.00 15.35 ? 157  PHE C CB  1 
ATOM   4887 C CG  . PHE C 1 157 ? 110.266 64.442  28.453 1.00 14.17 ? 157  PHE C CG  1 
ATOM   4888 C CD1 . PHE C 1 157 ? 110.749 63.156  28.270 1.00 17.86 ? 157  PHE C CD1 1 
ATOM   4889 C CD2 . PHE C 1 157 ? 110.889 65.487  27.804 1.00 14.59 ? 157  PHE C CD2 1 
ATOM   4890 C CE1 . PHE C 1 157 ? 111.848 62.918  27.473 1.00 21.72 ? 157  PHE C CE1 1 
ATOM   4891 C CE2 . PHE C 1 157 ? 111.985 65.263  27.001 1.00 17.50 ? 157  PHE C CE2 1 
ATOM   4892 C CZ  . PHE C 1 157 ? 112.472 63.975  26.838 1.00 19.39 ? 157  PHE C CZ  1 
ATOM   4893 N N   . LEU C 1 158 ? 107.613 64.241  32.172 1.00 16.53 ? 158  LEU C N   1 
ATOM   4894 C CA  . LEU C 1 158 ? 106.594 64.668  33.118 1.00 13.42 ? 158  LEU C CA  1 
ATOM   4895 C C   . LEU C 1 158 ? 107.133 64.675  34.538 1.00 11.37 ? 158  LEU C C   1 
ATOM   4896 O O   . LEU C 1 158 ? 106.895 65.614  35.289 1.00 9.80  ? 158  LEU C O   1 
ATOM   4897 C CB  . LEU C 1 158 ? 105.372 63.756  33.021 1.00 11.28 ? 158  LEU C CB  1 
ATOM   4898 C CG  . LEU C 1 158 ? 104.557 63.874  31.735 1.00 3.31  ? 158  LEU C CG  1 
ATOM   4899 C CD1 . LEU C 1 158 ? 103.427 62.879  31.768 1.00 2.00  ? 158  LEU C CD1 1 
ATOM   4900 C CD2 . LEU C 1 158 ? 104.027 65.276  31.598 1.00 2.00  ? 158  LEU C CD2 1 
ATOM   4901 N N   . ALA C 1 159 ? 107.906 63.650  34.881 1.00 16.73 ? 159  ALA C N   1 
ATOM   4902 C CA  . ALA C 1 159 ? 108.518 63.565  36.201 1.00 15.58 ? 159  ALA C CA  1 
ATOM   4903 C C   . ALA C 1 159 ? 109.499 64.708  36.440 1.00 21.15 ? 159  ALA C C   1 
ATOM   4904 O O   . ALA C 1 159 ? 109.441 65.363  37.476 1.00 24.24 ? 159  ALA C O   1 
ATOM   4905 C CB  . ALA C 1 159 ? 109.206 62.248  36.367 1.00 21.69 ? 159  ALA C CB  1 
ATOM   4906 N N   . TYR C 1 160 ? 110.303 65.028  35.427 1.00 22.87 ? 160  TYR C N   1 
ATOM   4907 C CA  . TYR C 1 160 ? 111.218 66.170  35.492 1.00 20.35 ? 160  TYR C CA  1 
ATOM   4908 C C   . TYR C 1 160 ? 110.483 67.487  35.727 1.00 17.84 ? 160  TYR C C   1 
ATOM   4909 O O   . TYR C 1 160 ? 110.846 68.246  36.608 1.00 21.28 ? 160  TYR C O   1 
ATOM   4910 C CB  . TYR C 1 160 ? 112.046 66.270  34.205 1.00 23.85 ? 160  TYR C CB  1 
ATOM   4911 C CG  . TYR C 1 160 ? 112.943 67.490  34.136 1.00 26.04 ? 160  TYR C CG  1 
ATOM   4912 C CD1 . TYR C 1 160 ? 114.158 67.529  34.822 1.00 26.53 ? 160  TYR C CD1 1 
ATOM   4913 C CD2 . TYR C 1 160 ? 112.554 68.627  33.424 1.00 22.63 ? 160  TYR C CD2 1 
ATOM   4914 C CE1 . TYR C 1 160 ? 114.955 68.677  34.809 1.00 24.71 ? 160  TYR C CE1 1 
ATOM   4915 C CE2 . TYR C 1 160 ? 113.346 69.769  33.400 1.00 13.67 ? 160  TYR C CE2 1 
ATOM   4916 C CZ  . TYR C 1 160 ? 114.538 69.789  34.099 1.00 17.16 ? 160  TYR C CZ  1 
ATOM   4917 O OH  . TYR C 1 160 ? 115.291 70.936  34.123 1.00 27.17 ? 160  TYR C OH  1 
ATOM   4918 N N   . ASP C 1 161 ? 109.474 67.766  34.910 1.00 19.90 ? 161  ASP C N   1 
ATOM   4919 C CA  . ASP C 1 161 ? 108.642 68.964  35.052 1.00 13.13 ? 161  ASP C CA  1 
ATOM   4920 C C   . ASP C 1 161 ? 108.099 69.099  36.470 1.00 10.15 ? 161  ASP C C   1 
ATOM   4921 O O   . ASP C 1 161 ? 108.224 70.151  37.090 1.00 11.34 ? 161  ASP C O   1 
ATOM   4922 C CB  . ASP C 1 161 ? 107.462 68.891  34.069 1.00 12.80 ? 161  ASP C CB  1 
ATOM   4923 C CG  . ASP C 1 161 ? 106.783 70.241  33.830 1.00 16.80 ? 161  ASP C CG  1 
ATOM   4924 O OD1 . ASP C 1 161 ? 107.056 71.232  34.544 1.00 22.63 ? 161  ASP C OD1 1 
ATOM   4925 O OD2 . ASP C 1 161 ? 105.954 70.311  32.897 1.00 32.98 ? 161  ASP C OD2 1 
ATOM   4926 N N   . VAL C 1 162 ? 107.493 68.023  36.969 1.00 14.51 ? 162  VAL C N   1 
ATOM   4927 C CA  . VAL C 1 162 ? 106.850 68.013  38.283 1.00 17.63 ? 162  VAL C CA  1 
ATOM   4928 C C   . VAL C 1 162 ? 107.876 68.228  39.396 1.00 22.26 ? 162  VAL C C   1 
ATOM   4929 O O   . VAL C 1 162 ? 107.680 69.058  40.288 1.00 24.31 ? 162  VAL C O   1 
ATOM   4930 C CB  . VAL C 1 162 ? 106.121 66.671  38.537 1.00 20.22 ? 162  VAL C CB  1 
ATOM   4931 C CG1 . VAL C 1 162 ? 105.661 66.583  39.987 1.00 21.31 ? 162  VAL C CG1 1 
ATOM   4932 C CG2 . VAL C 1 162 ? 104.935 66.523  37.591 1.00 25.22 ? 162  VAL C CG2 1 
ATOM   4933 N N   . LEU C 1 163 ? 108.975 67.480  39.323 1.00 18.82 ? 163  LEU C N   1 
ATOM   4934 C CA  . LEU C 1 163 ? 110.064 67.587  40.285 1.00 17.44 ? 163  LEU C CA  1 
ATOM   4935 C C   . LEU C 1 163 ? 110.717 68.967  40.261 1.00 21.75 ? 163  LEU C C   1 
ATOM   4936 O O   . LEU C 1 163 ? 111.087 69.519  41.294 1.00 19.70 ? 163  LEU C O   1 
ATOM   4937 C CB  . LEU C 1 163 ? 111.115 66.523  39.997 1.00 17.19 ? 163  LEU C CB  1 
ATOM   4938 C CG  . LEU C 1 163 ? 110.743 65.090  40.374 1.00 20.00 ? 163  LEU C CG  1 
ATOM   4939 C CD1 . LEU C 1 163 ? 111.993 64.203  40.298 1.00 16.37 ? 163  LEU C CD1 1 
ATOM   4940 C CD2 . LEU C 1 163 ? 110.142 65.072  41.776 1.00 16.62 ? 163  LEU C CD2 1 
ATOM   4941 N N   . ASP C 1 164 ? 110.839 69.528  39.069 1.00 25.00 ? 164  ASP C N   1 
ATOM   4942 C CA  . ASP C 1 164 ? 111.469 70.825  38.904 1.00 22.35 ? 164  ASP C CA  1 
ATOM   4943 C C   . ASP C 1 164 ? 110.627 71.859  39.627 1.00 25.77 ? 164  ASP C C   1 
ATOM   4944 O O   . ASP C 1 164 ? 111.161 72.693  40.350 1.00 32.25 ? 164  ASP C O   1 
ATOM   4945 C CB  . ASP C 1 164 ? 111.570 71.162  37.414 1.00 27.44 ? 164  ASP C CB  1 
ATOM   4946 C CG  . ASP C 1 164 ? 112.378 72.413  37.147 1.00 33.78 ? 164  ASP C CG  1 
ATOM   4947 O OD1 . ASP C 1 164 ? 113.278 72.743  37.952 1.00 34.91 ? 164  ASP C OD1 1 
ATOM   4948 O OD2 . ASP C 1 164 ? 112.118 73.053  36.106 1.00 39.66 ? 164  ASP C OD2 1 
ATOM   4949 N N   . GLN C 1 165 ? 109.308 71.702  39.538 1.00 22.83 ? 165  GLN C N   1 
ATOM   4950 C CA  . GLN C 1 165 ? 108.380 72.612  40.183 1.00 17.24 ? 165  GLN C CA  1 
ATOM   4951 C C   . GLN C 1 165 ? 108.504 72.533  41.696 1.00 17.03 ? 165  GLN C C   1 
ATOM   4952 O O   . GLN C 1 165 ? 108.424 73.548  42.382 1.00 24.56 ? 165  GLN C O   1 
ATOM   4953 C CB  . GLN C 1 165 ? 106.945 72.306  39.745 1.00 16.93 ? 165  GLN C CB  1 
ATOM   4954 C CG  . GLN C 1 165 ? 106.682 72.590  38.268 1.00 20.80 ? 165  GLN C CG  1 
ATOM   4955 C CD  . GLN C 1 165 ? 105.216 72.480  37.882 1.00 19.58 ? 165  GLN C CD  1 
ATOM   4956 O OE1 . GLN C 1 165 ? 104.370 72.172  38.720 1.00 28.05 ? 165  GLN C OE1 1 
ATOM   4957 N NE2 . GLN C 1 165 ? 104.905 72.755  36.611 1.00 27.29 ? 165  GLN C NE2 1 
ATOM   4958 N N   . GLN C 1 166 ? 108.747 71.339  42.218 1.00 18.45 ? 166  GLN C N   1 
ATOM   4959 C CA  . GLN C 1 166 ? 108.906 71.182  43.658 1.00 23.16 ? 166  GLN C CA  1 
ATOM   4960 C C   . GLN C 1 166 ? 110.237 71.768  44.094 1.00 33.33 ? 166  GLN C C   1 
ATOM   4961 O O   . GLN C 1 166 ? 110.320 72.418  45.136 1.00 43.09 ? 166  GLN C O   1 
ATOM   4962 C CB  . GLN C 1 166 ? 108.838 69.707  44.053 1.00 22.31 ? 166  GLN C CB  1 
ATOM   4963 C CG  . GLN C 1 166 ? 107.555 69.012  43.652 1.00 27.27 ? 166  GLN C CG  1 
ATOM   4964 C CD  . GLN C 1 166 ? 106.321 69.832  43.973 1.00 32.67 ? 166  GLN C CD  1 
ATOM   4965 O OE1 . GLN C 1 166 ? 106.071 70.177  45.130 1.00 30.95 ? 166  GLN C OE1 1 
ATOM   4966 N NE2 . GLN C 1 166 ? 105.547 70.160  42.943 1.00 33.26 ? 166  GLN C NE2 1 
ATOM   4967 N N   . ARG C 1 167 ? 111.251 71.605  43.244 1.00 31.44 ? 167  ARG C N   1 
ATOM   4968 C CA  . ARG C 1 167 ? 112.622 72.014  43.550 1.00 31.29 ? 167  ARG C CA  1 
ATOM   4969 C C   . ARG C 1 167 ? 112.785 73.540  43.503 1.00 36.50 ? 167  ARG C C   1 
ATOM   4970 O O   . ARG C 1 167 ? 113.603 74.108  44.226 1.00 37.26 ? 167  ARG C O   1 
ATOM   4971 C CB  . ARG C 1 167 ? 113.575 71.279  42.585 1.00 29.05 ? 167  ARG C CB  1 
ATOM   4972 C CG  . ARG C 1 167 ? 114.798 72.027  42.054 1.00 32.63 ? 167  ARG C CG  1 
ATOM   4973 C CD  . ARG C 1 167 ? 115.248 71.407  40.715 1.00 35.78 ? 167  ARG C CD  1 
ATOM   4974 N NE  . ARG C 1 167 ? 116.651 71.668  40.381 1.00 40.22 ? 167  ARG C NE  1 
ATOM   4975 C CZ  . ARG C 1 167 ? 117.167 71.595  39.152 1.00 43.26 ? 167  ARG C CZ  1 
ATOM   4976 N NH1 . ARG C 1 167 ? 116.389 71.330  38.108 1.00 42.69 ? 167  ARG C NH1 1 
ATOM   4977 N NH2 . ARG C 1 167 ? 118.464 71.815  38.957 1.00 45.13 ? 167  ARG C NH2 1 
ATOM   4978 N N   . MET C 1 168 ? 111.908 74.206  42.757 1.00 39.66 ? 168  MET C N   1 
ATOM   4979 C CA  . MET C 1 168 ? 111.890 75.665  42.726 1.00 35.80 ? 168  MET C CA  1 
ATOM   4980 C C   . MET C 1 168 ? 111.085 76.222  43.888 1.00 28.97 ? 168  MET C C   1 
ATOM   4981 O O   . MET C 1 168 ? 111.350 77.327  44.362 1.00 27.71 ? 168  MET C O   1 
ATOM   4982 C CB  . MET C 1 168 ? 111.307 76.167  41.411 1.00 35.06 ? 168  MET C CB  1 
ATOM   4983 C CG  . MET C 1 168 ? 112.080 77.325  40.819 1.00 35.39 ? 168  MET C CG  1 
ATOM   4984 S SD  . MET C 1 168 ? 112.488 77.003  39.119 1.00 34.82 ? 168  MET C SD  1 
ATOM   4985 C CE  . MET C 1 168 ? 113.667 75.664  39.313 1.00 32.94 ? 168  MET C CE  1 
ATOM   4986 N N   . PHE C 1 169 ? 110.169 75.406  44.399 1.00 31.17 ? 169  PHE C N   1 
ATOM   4987 C CA  . PHE C 1 169 ? 109.302 75.794  45.503 1.00 27.31 ? 169  PHE C CA  1 
ATOM   4988 C C   . PHE C 1 169 ? 110.037 75.725  46.835 1.00 26.23 ? 169  PHE C C   1 
ATOM   4989 O O   . PHE C 1 169 ? 110.124 76.720  47.558 1.00 34.26 ? 169  PHE C O   1 
ATOM   4990 C CB  . PHE C 1 169 ? 108.079 74.884  45.523 1.00 27.83 ? 169  PHE C CB  1 
ATOM   4991 C CG  . PHE C 1 169 ? 107.064 75.254  46.552 1.00 28.34 ? 169  PHE C CG  1 
ATOM   4992 C CD1 . PHE C 1 169 ? 106.216 76.331  46.346 1.00 30.19 ? 169  PHE C CD1 1 
ATOM   4993 C CD2 . PHE C 1 169 ? 106.889 74.459  47.686 1.00 32.89 ? 169  PHE C CD2 1 
ATOM   4994 C CE1 . PHE C 1 169 ? 105.198 76.611  47.249 1.00 34.38 ? 169  PHE C CE1 1 
ATOM   4995 C CE2 . PHE C 1 169 ? 105.878 74.725  48.601 1.00 31.65 ? 169  PHE C CE2 1 
ATOM   4996 C CZ  . PHE C 1 169 ? 105.027 75.804  48.383 1.00 38.25 ? 169  PHE C CZ  1 
ATOM   4997 N N   . VAL C 1 170 ? 110.590 74.555  47.146 1.00 26.46 ? 170  VAL C N   1 
ATOM   4998 C CA  . VAL C 1 170 ? 111.380 74.376  48.357 1.00 22.71 ? 170  VAL C CA  1 
ATOM   4999 C C   . VAL C 1 170 ? 112.691 73.660  48.033 1.00 19.15 ? 170  VAL C C   1 
ATOM   5000 O O   . VAL C 1 170 ? 112.790 72.444  48.134 1.00 20.16 ? 170  VAL C O   1 
ATOM   5001 C CB  . VAL C 1 170 ? 110.574 73.605  49.432 1.00 23.79 ? 170  VAL C CB  1 
ATOM   5002 C CG1 . VAL C 1 170 ? 110.004 72.327  48.849 1.00 20.44 ? 170  VAL C CG1 1 
ATOM   5003 C CG2 . VAL C 1 170 ? 111.442 73.323  50.648 1.00 32.47 ? 170  VAL C CG2 1 
ATOM   5004 N N   . PRO C 1 171 ? 113.712 74.423  47.610 1.00 25.05 ? 171  PRO C N   1 
ATOM   5005 C CA  . PRO C 1 171 ? 114.959 73.870  47.060 1.00 28.40 ? 171  PRO C CA  1 
ATOM   5006 C C   . PRO C 1 171 ? 115.809 73.160  48.109 1.00 32.02 ? 171  PRO C C   1 
ATOM   5007 O O   . PRO C 1 171 ? 116.692 72.371  47.780 1.00 33.61 ? 171  PRO C O   1 
ATOM   5008 C CB  . PRO C 1 171 ? 115.682 75.100  46.496 1.00 26.36 ? 171  PRO C CB  1 
ATOM   5009 C CG  . PRO C 1 171 ? 114.630 76.167  46.403 1.00 27.52 ? 171  PRO C CG  1 
ATOM   5010 C CD  . PRO C 1 171 ? 113.726 75.892  47.566 1.00 24.32 ? 171  PRO C CD  1 
ATOM   5011 N N   . ASP C 1 172 ? 115.499 73.425  49.370 1.00 31.30 ? 172  ASP C N   1 
ATOM   5012 C CA  . ASP C 1 172 ? 116.276 72.925  50.486 1.00 29.52 ? 172  ASP C CA  1 
ATOM   5013 C C   . ASP C 1 172 ? 115.743 71.593  51.033 1.00 35.59 ? 172  ASP C C   1 
ATOM   5014 O O   . ASP C 1 172 ? 116.310 71.034  51.976 1.00 38.69 ? 172  ASP C O   1 
ATOM   5015 C CB  . ASP C 1 172 ? 116.306 73.990  51.590 1.00 36.79 ? 172  ASP C CB  1 
ATOM   5016 C CG  . ASP C 1 172 ? 114.956 74.693  51.779 1.00 42.11 ? 172  ASP C CG  1 
ATOM   5017 O OD1 . ASP C 1 172 ? 114.728 75.732  51.112 1.00 46.31 ? 172  ASP C OD1 1 
ATOM   5018 O OD2 . ASP C 1 172 ? 114.148 74.236  52.624 1.00 41.77 ? 172  ASP C OD2 1 
ATOM   5019 N N   . CYS C 1 173 ? 114.659 71.095  50.438 1.00 35.26 ? 173  CYS C N   1 
ATOM   5020 C CA  . CYS C 1 173 ? 114.023 69.850  50.865 1.00 33.36 ? 173  CYS C CA  1 
ATOM   5021 C C   . CYS C 1 173 ? 114.991 68.674  50.743 1.00 34.79 ? 173  CYS C C   1 
ATOM   5022 O O   . CYS C 1 173 ? 115.511 68.395  49.663 1.00 37.42 ? 173  CYS C O   1 
ATOM   5023 C CB  . CYS C 1 173 ? 112.773 69.580  50.021 1.00 32.23 ? 173  CYS C CB  1 
ATOM   5024 S SG  . CYS C 1 173 ? 111.633 68.394  50.755 1.00 31.39 ? 173  CYS C SG  1 
ATOM   5025 N N   . PRO C 1 174 ? 115.301 68.023  51.876 1.00 34.37 ? 174  PRO C N   1 
ATOM   5026 C CA  . PRO C 1 174 ? 116.321 66.966  51.959 1.00 33.39 ? 174  PRO C CA  1 
ATOM   5027 C C   . PRO C 1 174 ? 115.960 65.707  51.168 1.00 33.00 ? 174  PRO C C   1 
ATOM   5028 O O   . PRO C 1 174 ? 116.838 64.970  50.727 1.00 30.14 ? 174  PRO C O   1 
ATOM   5029 C CB  . PRO C 1 174 ? 116.413 66.683  53.461 1.00 34.29 ? 174  PRO C CB  1 
ATOM   5030 C CG  . PRO C 1 174 ? 115.093 67.127  54.017 1.00 34.87 ? 174  PRO C CG  1 
ATOM   5031 C CD  . PRO C 1 174 ? 114.693 68.308  53.189 1.00 34.06 ? 174  PRO C CD  1 
ATOM   5032 N N   . GLU C 1 175 ? 114.660 65.473  51.004 1.00 38.00 ? 175  GLU C N   1 
ATOM   5033 C CA  . GLU C 1 175 ? 114.161 64.310  50.277 1.00 35.63 ? 175  GLU C CA  1 
ATOM   5034 C C   . GLU C 1 175 ? 114.370 64.494  48.786 1.00 33.30 ? 175  GLU C C   1 
ATOM   5035 O O   . GLU C 1 175 ? 114.140 63.570  48.007 1.00 36.82 ? 175  GLU C O   1 
ATOM   5036 C CB  . GLU C 1 175 ? 112.671 64.089  50.560 1.00 30.92 ? 175  GLU C CB  1 
ATOM   5037 C CG  . GLU C 1 175 ? 112.366 63.534  51.944 1.00 34.89 ? 175  GLU C CG  1 
ATOM   5038 C CD  . GLU C 1 175 ? 112.604 64.543  53.056 1.00 40.50 ? 175  GLU C CD  1 
ATOM   5039 O OE1 . GLU C 1 175 ? 112.349 65.750  52.834 1.00 34.79 ? 175  GLU C OE1 1 
ATOM   5040 O OE2 . GLU C 1 175 ? 113.042 64.123  54.154 1.00 45.79 ? 175  GLU C OE2 1 
ATOM   5041 N N   . LEU C 1 176 ? 114.780 65.698  48.396 1.00 28.68 ? 176  LEU C N   1 
ATOM   5042 C CA  . LEU C 1 176 ? 115.078 66.005  47.004 1.00 27.88 ? 176  LEU C CA  1 
ATOM   5043 C C   . LEU C 1 176 ? 116.504 65.641  46.651 1.00 32.37 ? 176  LEU C C   1 
ATOM   5044 O O   . LEU C 1 176 ? 116.870 65.595  45.475 1.00 32.57 ? 176  LEU C O   1 
ATOM   5045 C CB  . LEU C 1 176 ? 114.851 67.489  46.727 1.00 22.57 ? 176  LEU C CB  1 
ATOM   5046 C CG  . LEU C 1 176 ? 113.579 67.721  45.916 1.00 26.39 ? 176  LEU C CG  1 
ATOM   5047 C CD1 . LEU C 1 176 ? 113.036 69.117  46.160 1.00 31.38 ? 176  LEU C CD1 1 
ATOM   5048 C CD2 . LEU C 1 176 ? 113.874 67.478  44.448 1.00 30.22 ? 176  LEU C CD2 1 
ATOM   5049 N N   . GLN C 1 177 ? 117.334 65.508  47.675 1.00 33.32 ? 177  GLN C N   1 
ATOM   5050 C CA  . GLN C 1 177 ? 118.699 65.057  47.478 1.00 40.17 ? 177  GLN C CA  1 
ATOM   5051 C C   . GLN C 1 177 ? 118.743 63.519  47.506 1.00 38.63 ? 177  GLN C C   1 
ATOM   5052 O O   . GLN C 1 177 ? 117.894 62.870  48.128 1.00 40.10 ? 177  GLN C O   1 
ATOM   5053 C CB  . GLN C 1 177 ? 119.614 65.680  48.541 1.00 45.37 ? 177  GLN C CB  1 
ATOM   5054 C CG  . GLN C 1 177 ? 120.333 66.969  48.088 1.00 58.02 ? 177  GLN C CG  1 
ATOM   5055 C CD  . GLN C 1 177 ? 119.437 68.210  48.080 1.00 65.62 ? 177  GLN C CD  1 
ATOM   5056 O OE1 . GLN C 1 177 ? 119.533 69.063  48.968 1.00 72.16 ? 177  GLN C OE1 1 
ATOM   5057 N NE2 . GLN C 1 177 ? 118.621 68.352  47.037 1.00 63.06 ? 177  GLN C NE2 1 
ATOM   5058 N N   . GLY C 1 178 ? 119.643 62.949  46.710 1.00 33.98 ? 178  GLY C N   1 
ATOM   5059 C CA  . GLY C 1 178 ? 119.627 61.514  46.475 1.00 26.84 ? 178  GLY C CA  1 
ATOM   5060 C C   . GLY C 1 178 ? 119.385 61.157  45.014 1.00 21.77 ? 178  GLY C C   1 
ATOM   5061 O O   . GLY C 1 178 ? 119.716 61.937  44.116 1.00 14.08 ? 178  GLY C O   1 
ATOM   5062 N N   . ASN C 1 179 ? 118.767 60.002  44.768 1.00 19.08 ? 179  ASN C N   1 
ATOM   5063 C CA  . ASN C 1 179 ? 118.509 59.541  43.397 1.00 21.36 ? 179  ASN C CA  1 
ATOM   5064 C C   . ASN C 1 179 ? 117.617 60.471  42.578 1.00 22.96 ? 179  ASN C C   1 
ATOM   5065 O O   . ASN C 1 179 ? 117.716 60.504  41.354 1.00 20.17 ? 179  ASN C O   1 
ATOM   5066 C CB  . ASN C 1 179 ? 117.931 58.100  43.378 1.00 21.08 ? 179  ASN C CB  1 
ATOM   5067 C CG  . ASN C 1 179 ? 116.514 57.987  43.983 1.00 20.42 ? 179  ASN C CG  1 
ATOM   5068 O OD1 . ASN C 1 179 ? 116.057 58.843  44.740 1.00 25.36 ? 179  ASN C OD1 1 
ATOM   5069 N ND2 . ASN C 1 179 ? 115.844 56.885  43.678 1.00 13.00 ? 179  ASN C ND2 1 
ATOM   5070 N N   . LEU C 1 180 ? 116.773 61.246  43.254 1.00 24.48 ? 180  LEU C N   1 
ATOM   5071 C CA  . LEU C 1 180 ? 115.914 62.202  42.566 1.00 21.87 ? 180  LEU C CA  1 
ATOM   5072 C C   . LEU C 1 180 ? 116.683 63.421  42.078 1.00 28.37 ? 180  LEU C C   1 
ATOM   5073 O O   . LEU C 1 180 ? 116.326 64.017  41.059 1.00 24.23 ? 180  LEU C O   1 
ATOM   5074 C CB  . LEU C 1 180 ? 114.779 62.653  43.475 1.00 17.80 ? 180  LEU C CB  1 
ATOM   5075 C CG  . LEU C 1 180 ? 113.709 61.599  43.716 1.00 16.74 ? 180  LEU C CG  1 
ATOM   5076 C CD1 . LEU C 1 180 ? 112.587 62.228  44.507 1.00 12.35 ? 180  LEU C CD1 1 
ATOM   5077 C CD2 . LEU C 1 180 ? 113.218 61.039  42.391 1.00 5.26  ? 180  LEU C CD2 1 
ATOM   5078 N N   . SER C 1 181 ? 117.714 63.808  42.829 1.00 30.47 ? 181  SER C N   1 
ATOM   5079 C CA  . SER C 1 181 ? 118.618 64.881  42.419 1.00 26.44 ? 181  SER C CA  1 
ATOM   5080 C C   . SER C 1 181 ? 119.475 64.415  41.244 1.00 25.79 ? 181  SER C C   1 
ATOM   5081 O O   . SER C 1 181 ? 119.700 65.158  40.290 1.00 21.34 ? 181  SER C O   1 
ATOM   5082 C CB  . SER C 1 181 ? 119.521 65.288  43.588 1.00 30.67 ? 181  SER C CB  1 
ATOM   5083 O OG  . SER C 1 181 ? 119.540 66.694  43.765 1.00 45.01 ? 181  SER C OG  1 
ATOM   5084 N N   . GLN C 1 182 ? 119.921 63.164  41.312 1.00 29.45 ? 182  GLN C N   1 
ATOM   5085 C CA  . GLN C 1 182 ? 120.721 62.565  40.251 1.00 35.49 ? 182  GLN C CA  1 
ATOM   5086 C C   . GLN C 1 182 ? 119.902 62.480  38.976 1.00 34.77 ? 182  GLN C C   1 
ATOM   5087 O O   . GLN C 1 182 ? 120.444 62.592  37.877 1.00 42.09 ? 182  GLN C O   1 
ATOM   5088 C CB  . GLN C 1 182 ? 121.182 61.154  40.636 1.00 41.00 ? 182  GLN C CB  1 
ATOM   5089 C CG  . GLN C 1 182 ? 122.193 61.081  41.776 1.00 46.87 ? 182  GLN C CG  1 
ATOM   5090 C CD  . GLN C 1 182 ? 122.769 59.688  41.934 1.00 49.68 ? 182  GLN C CD  1 
ATOM   5091 O OE1 . GLN C 1 182 ? 123.652 59.286  41.168 1.00 57.71 ? 182  GLN C OE1 1 
ATOM   5092 N NE2 . GLN C 1 182 ? 122.208 58.908  42.863 1.00 45.83 ? 182  GLN C NE2 1 
ATOM   5093 N N   . PHE C 1 183 ? 118.597 62.263  39.122 1.00 30.90 ? 183  PHE C N   1 
ATOM   5094 C CA  . PHE C 1 183 ? 117.724 62.174  37.961 1.00 21.59 ? 183  PHE C CA  1 
ATOM   5095 C C   . PHE C 1 183 ? 117.605 63.513  37.259 1.00 21.39 ? 183  PHE C C   1 
ATOM   5096 O O   . PHE C 1 183 ? 117.692 63.580  36.038 1.00 24.05 ? 183  PHE C O   1 
ATOM   5097 C CB  . PHE C 1 183 ? 116.329 61.692  38.353 1.00 19.13 ? 183  PHE C CB  1 
ATOM   5098 C CG  . PHE C 1 183 ? 115.326 61.775  37.234 1.00 12.08 ? 183  PHE C CG  1 
ATOM   5099 C CD1 . PHE C 1 183 ? 115.505 61.044  36.063 1.00 18.70 ? 183  PHE C CD1 1 
ATOM   5100 C CD2 . PHE C 1 183 ? 114.217 62.600  37.336 1.00 10.52 ? 183  PHE C CD2 1 
ATOM   5101 C CE1 . PHE C 1 183 ? 114.587 61.135  35.006 1.00 18.28 ? 183  PHE C CE1 1 
ATOM   5102 C CE2 . PHE C 1 183 ? 113.303 62.697  36.290 1.00 9.62  ? 183  PHE C CE2 1 
ATOM   5103 C CZ  . PHE C 1 183 ? 113.488 61.961  35.122 1.00 12.09 ? 183  PHE C CZ  1 
ATOM   5104 N N   . LEU C 1 184 ? 117.380 64.574  38.025 1.00 18.87 ? 184  LEU C N   1 
ATOM   5105 C CA  . LEU C 1 184 ? 117.178 65.891  37.438 1.00 13.26 ? 184  LEU C CA  1 
ATOM   5106 C C   . LEU C 1 184 ? 118.384 66.356  36.631 1.00 23.74 ? 184  LEU C C   1 
ATOM   5107 O O   . LEU C 1 184 ? 118.247 66.770  35.477 1.00 29.45 ? 184  LEU C O   1 
ATOM   5108 C CB  . LEU C 1 184 ? 116.837 66.902  38.523 1.00 2.00  ? 184  LEU C CB  1 
ATOM   5109 C CG  . LEU C 1 184 ? 115.508 66.604  39.216 1.00 5.57  ? 184  LEU C CG  1 
ATOM   5110 C CD1 . LEU C 1 184 ? 115.197 67.705  40.199 1.00 6.90  ? 184  LEU C CD1 1 
ATOM   5111 C CD2 . LEU C 1 184 ? 114.394 66.493  38.186 1.00 14.22 ? 184  LEU C CD2 1 
ATOM   5112 N N   . GLN C 1 185 ? 119.578 66.150  37.172 1.00 36.16 ? 185  GLN C N   1 
ATOM   5113 C CA  . GLN C 1 185 ? 120.780 66.564  36.461 1.00 37.78 ? 185  GLN C CA  1 
ATOM   5114 C C   . GLN C 1 185 ? 121.128 65.663  35.271 1.00 33.30 ? 185  GLN C C   1 
ATOM   5115 O O   . GLN C 1 185 ? 121.586 66.157  34.241 1.00 40.73 ? 185  GLN C O   1 
ATOM   5116 C CB  . GLN C 1 185 ? 121.962 66.697  37.430 1.00 42.50 ? 185  GLN C CB  1 
ATOM   5117 C CG  . GLN C 1 185 ? 122.098 65.580  38.440 1.00 45.81 ? 185  GLN C CG  1 
ATOM   5118 C CD  . GLN C 1 185 ? 123.512 65.435  38.942 1.00 41.11 ? 185  GLN C CD  1 
ATOM   5119 O OE1 . GLN C 1 185 ? 123.753 64.864  40.010 1.00 44.74 ? 185  GLN C OE1 1 
ATOM   5120 N NE2 . GLN C 1 185 ? 124.467 65.879  38.135 1.00 41.14 ? 185  GLN C NE2 1 
ATOM   5121 N N   . ARG C 1 186 ? 120.804 64.372  35.376 1.00 30.91 ? 186  ARG C N   1 
ATOM   5122 C CA  . ARG C 1 186 ? 120.971 63.422  34.272 1.00 23.63 ? 186  ARG C CA  1 
ATOM   5123 C C   . ARG C 1 186 ? 120.109 63.793  33.059 1.00 24.79 ? 186  ARG C C   1 
ATOM   5124 O O   . ARG C 1 186 ? 120.526 63.627  31.909 1.00 34.47 ? 186  ARG C O   1 
ATOM   5125 C CB  . ARG C 1 186 ? 120.616 62.011  34.749 1.00 22.47 ? 186  ARG C CB  1 
ATOM   5126 C CG  . ARG C 1 186 ? 120.819 60.914  33.715 1.00 29.95 ? 186  ARG C CG  1 
ATOM   5127 C CD  . ARG C 1 186 ? 120.419 59.537  34.253 1.00 27.94 ? 186  ARG C CD  1 
ATOM   5128 N NE  . ARG C 1 186 ? 121.127 59.184  35.484 1.00 24.89 ? 186  ARG C NE  1 
ATOM   5129 C CZ  . ARG C 1 186 ? 120.522 58.923  36.638 1.00 28.58 ? 186  ARG C CZ  1 
ATOM   5130 N NH1 . ARG C 1 186 ? 119.195 58.896  36.702 1.00 27.78 ? 186  ARG C NH1 1 
ATOM   5131 N NH2 . ARG C 1 186 ? 121.240 58.711  37.736 1.00 32.61 ? 186  ARG C NH2 1 
ATOM   5132 N N   . PHE C 1 187 ? 118.908 64.300  33.327 1.00 28.43 ? 187  PHE C N   1 
ATOM   5133 C CA  . PHE C 1 187 ? 117.987 64.722  32.279 1.00 21.92 ? 187  PHE C CA  1 
ATOM   5134 C C   . PHE C 1 187 ? 118.468 66.028  31.672 1.00 21.40 ? 187  PHE C C   1 
ATOM   5135 O O   . PHE C 1 187 ? 118.369 66.233  30.466 1.00 26.98 ? 187  PHE C O   1 
ATOM   5136 C CB  . PHE C 1 187 ? 116.586 64.896  32.864 1.00 16.92 ? 187  PHE C CB  1 
ATOM   5137 C CG  . PHE C 1 187 ? 115.576 65.376  31.874 1.00 16.02 ? 187  PHE C CG  1 
ATOM   5138 C CD1 . PHE C 1 187 ? 115.423 66.736  31.621 1.00 25.35 ? 187  PHE C CD1 1 
ATOM   5139 C CD2 . PHE C 1 187 ? 114.767 64.474  31.204 1.00 9.28  ? 187  PHE C CD2 1 
ATOM   5140 C CE1 . PHE C 1 187 ? 114.479 67.189  30.714 1.00 22.34 ? 187  PHE C CE1 1 
ATOM   5141 C CE2 . PHE C 1 187 ? 113.820 64.916  30.298 1.00 14.71 ? 187  PHE C CE2 1 
ATOM   5142 C CZ  . PHE C 1 187 ? 113.675 66.279  30.052 1.00 18.06 ? 187  PHE C CZ  1 
ATOM   5143 N N   . GLU C 1 188 ? 118.977 66.913  32.527 1.00 29.59 ? 188  GLU C N   1 
ATOM   5144 C CA  . GLU C 1 188 ? 119.493 68.213  32.101 1.00 31.09 ? 188  GLU C CA  1 
ATOM   5145 C C   . GLU C 1 188 ? 120.821 68.101  31.343 1.00 28.44 ? 188  GLU C C   1 
ATOM   5146 O O   . GLU C 1 188 ? 121.195 69.008  30.598 1.00 34.20 ? 188  GLU C O   1 
ATOM   5147 C CB  . GLU C 1 188 ? 119.669 69.128  33.320 1.00 28.73 ? 188  GLU C CB  1 
ATOM   5148 C CG  . GLU C 1 188 ? 118.373 69.542  33.993 1.00 26.48 ? 188  GLU C CG  1 
ATOM   5149 C CD  . GLU C 1 188 ? 118.597 70.360  35.241 1.00 27.73 ? 188  GLU C CD  1 
ATOM   5150 O OE1 . GLU C 1 188 ? 119.521 70.041  36.014 1.00 26.64 ? 188  GLU C OE1 1 
ATOM   5151 O OE2 . GLU C 1 188 ? 117.824 71.307  35.469 1.00 35.14 ? 188  GLU C OE2 1 
ATOM   5152 N N   . ALA C 1 189 ? 121.508 66.974  31.518 1.00 26.43 ? 189  ALA C N   1 
ATOM   5153 C CA  . ALA C 1 189 ? 122.776 66.722  30.837 1.00 29.05 ? 189  ALA C CA  1 
ATOM   5154 C C   . ALA C 1 189 ? 122.590 66.097  29.456 1.00 24.60 ? 189  ALA C C   1 
ATOM   5155 O O   . ALA C 1 189 ? 123.549 65.964  28.695 1.00 26.60 ? 189  ALA C O   1 
ATOM   5156 C CB  . ALA C 1 189 ? 123.684 65.834  31.699 1.00 26.74 ? 189  ALA C CB  1 
ATOM   5157 N N   . LEU C 1 190 ? 121.361 65.712  29.128 1.00 22.54 ? 190  LEU C N   1 
ATOM   5158 C CA  . LEU C 1 190 ? 121.083 65.181  27.803 1.00 22.53 ? 190  LEU C CA  1 
ATOM   5159 C C   . LEU C 1 190 ? 121.405 66.225  26.742 1.00 28.72 ? 190  LEU C C   1 
ATOM   5160 O O   . LEU C 1 190 ? 121.075 67.400  26.890 1.00 28.15 ? 190  LEU C O   1 
ATOM   5161 C CB  . LEU C 1 190 ? 119.626 64.744  27.690 1.00 24.09 ? 190  LEU C CB  1 
ATOM   5162 C CG  . LEU C 1 190 ? 119.236 63.446  28.397 1.00 20.95 ? 190  LEU C CG  1 
ATOM   5163 C CD1 . LEU C 1 190 ? 117.771 63.165  28.115 1.00 22.74 ? 190  LEU C CD1 1 
ATOM   5164 C CD2 . LEU C 1 190 ? 120.109 62.286  27.927 1.00 20.37 ? 190  LEU C CD2 1 
ATOM   5165 N N   . GLU C 1 191 ? 122.066 65.770  25.684 1.00 36.48 ? 191  GLU C N   1 
ATOM   5166 C CA  . GLU C 1 191 ? 122.639 66.632  24.661 1.00 35.52 ? 191  GLU C CA  1 
ATOM   5167 C C   . GLU C 1 191 ? 121.694 67.735  24.179 1.00 34.06 ? 191  GLU C C   1 
ATOM   5168 O O   . GLU C 1 191 ? 122.013 68.925  24.271 1.00 36.54 ? 191  GLU C O   1 
ATOM   5169 C CB  . GLU C 1 191 ? 123.076 65.767  23.473 1.00 40.22 ? 191  GLU C CB  1 
ATOM   5170 C CG  . GLU C 1 191 ? 124.346 66.231  22.773 1.00 43.05 ? 191  GLU C CG  1 
ATOM   5171 C CD  . GLU C 1 191 ? 124.087 67.227  21.665 1.00 46.57 ? 191  GLU C CD  1 
ATOM   5172 O OE1 . GLU C 1 191 ? 123.698 66.784  20.561 1.00 43.06 ? 191  GLU C OE1 1 
ATOM   5173 O OE2 . GLU C 1 191 ? 124.291 68.442  21.900 1.00 48.01 ? 191  GLU C OE2 1 
ATOM   5174 N N   . LYS C 1 192 ? 120.516 67.338  23.711 1.00 24.54 ? 192  LYS C N   1 
ATOM   5175 C CA  . LYS C 1 192 ? 119.623 68.278  23.053 1.00 32.54 ? 192  LYS C CA  1 
ATOM   5176 C C   . LYS C 1 192 ? 118.791 69.090  24.056 1.00 29.58 ? 192  LYS C C   1 
ATOM   5177 O O   . LYS C 1 192 ? 118.282 70.165  23.732 1.00 29.81 ? 192  LYS C O   1 
ATOM   5178 C CB  . LYS C 1 192 ? 118.722 67.528  22.058 1.00 34.29 ? 192  LYS C CB  1 
ATOM   5179 C CG  . LYS C 1 192 ? 119.481 66.789  20.945 1.00 39.60 ? 192  LYS C CG  1 
ATOM   5180 C CD  . LYS C 1 192 ? 120.145 67.764  19.969 1.00 45.43 ? 192  LYS C CD  1 
ATOM   5181 C CE  . LYS C 1 192 ? 121.016 67.048  18.932 1.00 50.80 ? 192  LYS C CE  1 
ATOM   5182 N NZ  . LYS C 1 192 ? 122.094 67.918  18.338 1.00 45.34 ? 192  LYS C NZ  1 
ATOM   5183 N N   . ILE C 1 193 ? 118.728 68.611  25.295 1.00 22.81 ? 193  ILE C N   1 
ATOM   5184 C CA  . ILE C 1 193 ? 117.994 69.309  26.343 1.00 25.59 ? 193  ILE C CA  1 
ATOM   5185 C C   . ILE C 1 193 ? 118.861 70.422  26.922 1.00 28.23 ? 193  ILE C C   1 
ATOM   5186 O O   . ILE C 1 193 ? 118.391 71.546  27.098 1.00 33.03 ? 193  ILE C O   1 
ATOM   5187 C CB  . ILE C 1 193 ? 117.530 68.327  27.470 1.00 27.44 ? 193  ILE C CB  1 
ATOM   5188 C CG1 . ILE C 1 193 ? 116.245 67.620  27.041 1.00 20.94 ? 193  ILE C CG1 1 
ATOM   5189 C CG2 . ILE C 1 193 ? 117.261 69.067  28.778 1.00 25.04 ? 193  ILE C CG2 1 
ATOM   5190 C CD1 . ILE C 1 193 ? 116.471 66.356  26.246 1.00 23.09 ? 193  ILE C CD1 1 
ATOM   5191 N N   . SER C 1 194 ? 120.141 70.128  27.154 1.00 28.17 ? 194  SER C N   1 
ATOM   5192 C CA  . SER C 1 194 ? 121.053 71.127  27.705 1.00 28.70 ? 194  SER C CA  1 
ATOM   5193 C C   . SER C 1 194 ? 121.282 72.286  26.729 1.00 31.19 ? 194  SER C C   1 
ATOM   5194 O O   . SER C 1 194 ? 121.271 73.446  27.130 1.00 30.27 ? 194  SER C O   1 
ATOM   5195 C CB  . SER C 1 194 ? 122.387 70.494  28.124 1.00 29.54 ? 194  SER C CB  1 
ATOM   5196 O OG  . SER C 1 194 ? 122.669 69.308  27.403 1.00 38.65 ? 194  SER C OG  1 
ATOM   5197 N N   . ALA C 1 195 ? 121.325 71.976  25.437 1.00 27.35 ? 195  ALA C N   1 
ATOM   5198 C CA  . ALA C 1 195 ? 121.466 72.998  24.412 1.00 21.38 ? 195  ALA C CA  1 
ATOM   5199 C C   . ALA C 1 195 ? 120.224 73.878  24.368 1.00 27.14 ? 195  ALA C C   1 
ATOM   5200 O O   . ALA C 1 195 ? 120.313 75.083  24.126 1.00 38.07 ? 195  ALA C O   1 
ATOM   5201 C CB  . ALA C 1 195 ? 121.695 72.347  23.064 1.00 26.03 ? 195  ALA C CB  1 
ATOM   5202 N N   . TYR C 1 196 ? 119.065 73.275  24.624 1.00 25.87 ? 196  TYR C N   1 
ATOM   5203 C CA  . TYR C 1 196 ? 117.805 74.009  24.602 1.00 18.87 ? 196  TYR C CA  1 
ATOM   5204 C C   . TYR C 1 196 ? 117.715 74.941  25.811 1.00 17.82 ? 196  TYR C C   1 
ATOM   5205 O O   . TYR C 1 196 ? 117.194 76.054  25.708 1.00 19.80 ? 196  TYR C O   1 
ATOM   5206 C CB  . TYR C 1 196 ? 116.626 73.026  24.570 1.00 21.87 ? 196  TYR C CB  1 
ATOM   5207 C CG  . TYR C 1 196 ? 115.257 73.654  24.751 1.00 27.29 ? 196  TYR C CG  1 
ATOM   5208 C CD1 . TYR C 1 196 ? 114.836 74.727  23.950 1.00 27.36 ? 196  TYR C CD1 1 
ATOM   5209 C CD2 . TYR C 1 196 ? 114.375 73.172  25.725 1.00 19.94 ? 196  TYR C CD2 1 
ATOM   5210 C CE1 . TYR C 1 196 ? 113.570 75.309  24.126 1.00 23.30 ? 196  TYR C CE1 1 
ATOM   5211 C CE2 . TYR C 1 196 ? 113.106 73.740  25.901 1.00 18.76 ? 196  TYR C CE2 1 
ATOM   5212 C CZ  . TYR C 1 196 ? 112.713 74.808  25.104 1.00 21.71 ? 196  TYR C CZ  1 
ATOM   5213 O OH  . TYR C 1 196 ? 111.478 75.385  25.311 1.00 25.11 ? 196  TYR C OH  1 
ATOM   5214 N N   . MET C 1 197 ? 118.318 74.527  26.922 1.00 16.78 ? 197  MET C N   1 
ATOM   5215 C CA  . MET C 1 197 ? 118.330 75.345  28.134 1.00 21.95 ? 197  MET C CA  1 
ATOM   5216 C C   . MET C 1 197 ? 119.366 76.462  28.044 1.00 28.44 ? 197  MET C C   1 
ATOM   5217 O O   . MET C 1 197 ? 119.242 77.490  28.714 1.00 29.67 ? 197  MET C O   1 
ATOM   5218 C CB  . MET C 1 197 ? 118.607 74.474  29.367 1.00 27.74 ? 197  MET C CB  1 
ATOM   5219 C CG  . MET C 1 197 ? 117.466 73.524  29.748 1.00 25.64 ? 197  MET C CG  1 
ATOM   5220 S SD  . MET C 1 197 ? 117.862 72.418  31.113 1.00 23.18 ? 197  MET C SD  1 
ATOM   5221 C CE  . MET C 1 197 ? 117.169 73.279  32.493 1.00 29.21 ? 197  MET C CE  1 
ATOM   5222 N N   . ARG C 1 198 ? 120.353 76.270  27.170 1.00 37.24 ? 198  ARG C N   1 
ATOM   5223 C CA  . ARG C 1 198 ? 121.411 77.245  26.941 1.00 40.81 ? 198  ARG C CA  1 
ATOM   5224 C C   . ARG C 1 198 ? 120.969 78.269  25.893 1.00 42.49 ? 198  ARG C C   1 
ATOM   5225 O O   . ARG C 1 198 ? 121.644 79.272  25.666 1.00 48.91 ? 198  ARG C O   1 
ATOM   5226 C CB  . ARG C 1 198 ? 122.664 76.509  26.474 1.00 47.56 ? 198  ARG C CB  1 
ATOM   5227 C CG  . ARG C 1 198 ? 123.951 77.303  26.534 1.00 57.41 ? 198  ARG C CG  1 
ATOM   5228 C CD  . ARG C 1 198 ? 125.146 76.367  26.421 1.00 59.93 ? 198  ARG C CD  1 
ATOM   5229 N NE  . ARG C 1 198 ? 124.990 75.412  25.323 1.00 59.99 ? 198  ARG C NE  1 
ATOM   5230 C CZ  . ARG C 1 198 ? 124.968 74.089  25.468 1.00 59.34 ? 198  ARG C CZ  1 
ATOM   5231 N NH1 . ARG C 1 198 ? 125.181 73.536  26.659 1.00 58.33 ? 198  ARG C NH1 1 
ATOM   5232 N NH2 . ARG C 1 198 ? 124.805 73.317  24.401 1.00 57.26 ? 198  ARG C NH2 1 
ATOM   5233 N N   . SER C 1 199 ? 119.806 78.033  25.294 1.00 35.96 ? 199  SER C N   1 
ATOM   5234 C CA  . SER C 1 199 ? 119.265 78.931  24.287 1.00 28.24 ? 199  SER C CA  1 
ATOM   5235 C C   . SER C 1 199 ? 118.293 79.964  24.870 1.00 24.12 ? 199  SER C C   1 
ATOM   5236 O O   . SER C 1 199 ? 118.134 80.076  26.087 1.00 35.35 ? 199  SER C O   1 
ATOM   5237 C CB  . SER C 1 199 ? 118.558 78.122  23.202 1.00 26.79 ? 199  SER C CB  1 
ATOM   5238 O OG  . SER C 1 199 ? 117.236 77.797  23.593 1.00 34.62 ? 199  SER C OG  1 
ATOM   5239 N N   . GLY C 1 200 ? 117.652 80.725  23.986 1.00 26.67 ? 200  GLY C N   1 
ATOM   5240 C CA  . GLY C 1 200 ? 116.729 81.756  24.416 1.00 26.53 ? 200  GLY C CA  1 
ATOM   5241 C C   . GLY C 1 200 ? 115.284 81.414  24.102 1.00 35.68 ? 200  GLY C C   1 
ATOM   5242 O O   . GLY C 1 200 ? 114.410 82.284  24.186 1.00 38.30 ? 200  GLY C O   1 
ATOM   5243 N N   . ARG C 1 201 ? 115.035 80.161  23.713 1.00 34.98 ? 201  ARG C N   1 
ATOM   5244 C CA  . ARG C 1 201 ? 113.670 79.646  23.568 1.00 32.86 ? 201  ARG C CA  1 
ATOM   5245 C C   . ARG C 1 201 ? 113.134 79.150  24.906 1.00 28.44 ? 201  ARG C C   1 
ATOM   5246 O O   . ARG C 1 201 ? 111.932 78.921  25.055 1.00 29.99 ? 201  ARG C O   1 
ATOM   5247 C CB  . ARG C 1 201 ? 113.626 78.491  22.567 1.00 33.97 ? 201  ARG C CB  1 
ATOM   5248 C CG  . ARG C 1 201 ? 114.044 78.851  21.155 1.00 37.88 ? 201  ARG C CG  1 
ATOM   5249 C CD  . ARG C 1 201 ? 113.990 77.636  20.229 1.00 36.64 ? 201  ARG C CD  1 
ATOM   5250 N NE  . ARG C 1 201 ? 114.715 76.490  20.777 1.00 38.02 ? 201  ARG C NE  1 
ATOM   5251 C CZ  . ARG C 1 201 ? 116.006 76.239  20.569 1.00 37.02 ? 201  ARG C CZ  1 
ATOM   5252 N NH1 . ARG C 1 201 ? 116.754 77.074  19.856 1.00 39.26 ? 201  ARG C NH1 1 
ATOM   5253 N NH2 . ARG C 1 201 ? 116.555 75.152  21.093 1.00 36.76 ? 201  ARG C NH2 1 
ATOM   5254 N N   . PHE C 1 202 ? 114.022 79.036  25.889 1.00 24.08 ? 202  PHE C N   1 
ATOM   5255 C CA  . PHE C 1 202 ? 113.706 78.341  27.126 1.00 20.39 ? 202  PHE C CA  1 
ATOM   5256 C C   . PHE C 1 202 ? 112.957 79.189  28.142 1.00 24.16 ? 202  PHE C C   1 
ATOM   5257 O O   . PHE C 1 202 ? 113.401 80.276  28.504 1.00 30.04 ? 202  PHE C O   1 
ATOM   5258 C CB  . PHE C 1 202 ? 114.979 77.787  27.756 1.00 20.44 ? 202  PHE C CB  1 
ATOM   5259 C CG  . PHE C 1 202 ? 114.727 76.841  28.899 1.00 23.18 ? 202  PHE C CG  1 
ATOM   5260 C CD1 . PHE C 1 202 ? 114.031 75.650  28.695 1.00 24.29 ? 202  PHE C CD1 1 
ATOM   5261 C CD2 . PHE C 1 202 ? 115.202 77.127  30.174 1.00 21.79 ? 202  PHE C CD2 1 
ATOM   5262 C CE1 . PHE C 1 202 ? 113.814 74.756  29.740 1.00 24.98 ? 202  PHE C CE1 1 
ATOM   5263 C CE2 . PHE C 1 202 ? 114.993 76.244  31.226 1.00 20.29 ? 202  PHE C CE2 1 
ATOM   5264 C CZ  . PHE C 1 202 ? 114.296 75.052  31.009 1.00 23.78 ? 202  PHE C CZ  1 
ATOM   5265 N N   . MET C 1 203 ? 111.860 78.639  28.659 1.00 32.37 ? 203  MET C N   1 
ATOM   5266 C CA  . MET C 1 203 ? 111.045 79.319  29.671 1.00 36.82 ? 203  MET C CA  1 
ATOM   5267 C C   . MET C 1 203 ? 111.042 78.574  31.001 1.00 33.40 ? 203  MET C C   1 
ATOM   5268 O O   . MET C 1 203 ? 110.279 77.623  31.195 1.00 38.72 ? 203  MET C O   1 
ATOM   5269 C CB  . MET C 1 203 ? 109.598 79.458  29.209 1.00 41.61 ? 203  MET C CB  1 
ATOM   5270 C CG  . MET C 1 203 ? 109.324 80.578  28.243 1.00 49.36 ? 203  MET C CG  1 
ATOM   5271 S SD  . MET C 1 203 ? 107.545 80.699  28.000 1.00 57.86 ? 203  MET C SD  1 
ATOM   5272 C CE  . MET C 1 203 ? 107.077 81.433  29.555 1.00 55.58 ? 203  MET C CE  1 
ATOM   5273 N N   . LYS C 1 204 ? 111.870 79.037  31.930 1.00 32.94 ? 204  LYS C N   1 
ATOM   5274 C CA  . LYS C 1 204 ? 111.884 78.497  33.289 1.00 33.04 ? 204  LYS C CA  1 
ATOM   5275 C C   . LYS C 1 204 ? 110.723 79.061  34.105 1.00 31.00 ? 204  LYS C C   1 
ATOM   5276 O O   . LYS C 1 204 ? 110.452 78.599  35.213 1.00 23.66 ? 204  LYS C O   1 
ATOM   5277 C CB  . LYS C 1 204 ? 113.199 78.854  33.999 1.00 32.07 ? 204  LYS C CB  1 
ATOM   5278 C CG  . LYS C 1 204 ? 114.046 77.671  34.439 1.00 32.99 ? 204  LYS C CG  1 
ATOM   5279 C CD  . LYS C 1 204 ? 113.346 76.783  35.463 1.00 40.11 ? 204  LYS C CD  1 
ATOM   5280 C CE  . LYS C 1 204 ? 113.986 75.386  35.512 1.00 46.23 ? 204  LYS C CE  1 
ATOM   5281 N NZ  . LYS C 1 204 ? 113.690 74.546  34.294 1.00 39.96 ? 204  LYS C NZ  1 
ATOM   5282 N N   . ALA C 1 205 ? 110.091 80.110  33.585 1.00 31.97 ? 205  ALA C N   1 
ATOM   5283 C CA  . ALA C 1 205 ? 109.085 80.852  34.333 1.00 26.85 ? 205  ALA C CA  1 
ATOM   5284 C C   . ALA C 1 205 ? 108.181 81.642  33.386 1.00 30.78 ? 205  ALA C C   1 
ATOM   5285 O O   . ALA C 1 205 ? 108.576 81.959  32.260 1.00 40.13 ? 205  ALA C O   1 
ATOM   5286 C CB  . ALA C 1 205 ? 109.762 81.789  35.306 1.00 26.77 ? 205  ALA C CB  1 
ATOM   5287 N N   . PRO C 1 206 ? 106.947 81.959  33.823 1.00 27.01 ? 206  PRO C N   1 
ATOM   5288 C CA  . PRO C 1 206 ? 106.344 81.543  35.093 1.00 26.74 ? 206  PRO C CA  1 
ATOM   5289 C C   . PRO C 1 206 ? 105.679 80.171  34.989 1.00 28.78 ? 206  PRO C C   1 
ATOM   5290 O O   . PRO C 1 206 ? 105.175 79.802  33.928 1.00 28.87 ? 206  PRO C O   1 
ATOM   5291 C CB  . PRO C 1 206 ? 105.327 82.646  35.377 1.00 26.84 ? 206  PRO C CB  1 
ATOM   5292 C CG  . PRO C 1 206 ? 105.032 83.279  34.024 1.00 24.74 ? 206  PRO C CG  1 
ATOM   5293 C CD  . PRO C 1 206 ? 105.989 82.722  33.004 1.00 20.71 ? 206  PRO C CD  1 
ATOM   5294 N N   . ILE C 1 207 ? 105.710 79.409  36.082 1.00 30.77 ? 207  ILE C N   1 
ATOM   5295 C CA  . ILE C 1 207 ? 105.076 78.092  36.129 1.00 30.05 ? 207  ILE C CA  1 
ATOM   5296 C C   . ILE C 1 207 ? 103.555 78.207  36.031 1.00 29.54 ? 207  ILE C C   1 
ATOM   5297 O O   . ILE C 1 207 ? 102.893 77.432  35.336 1.00 31.56 ? 207  ILE C O   1 
ATOM   5298 C CB  . ILE C 1 207 ? 105.416 77.367  37.440 1.00 25.64 ? 207  ILE C CB  1 
ATOM   5299 C CG1 . ILE C 1 207 ? 106.916 77.100  37.510 1.00 31.68 ? 207  ILE C CG1 1 
ATOM   5300 C CG2 . ILE C 1 207 ? 104.660 76.057  37.525 1.00 29.79 ? 207  ILE C CG2 1 
ATOM   5301 C CD1 . ILE C 1 207 ? 107.395 76.698  38.878 1.00 32.49 ? 207  ILE C CD1 1 
ATOM   5302 N N   . PHE C 1 208 ? 103.015 79.204  36.718 1.00 28.82 ? 208  PHE C N   1 
ATOM   5303 C CA  . PHE C 1 208 ? 101.578 79.368  36.805 1.00 27.85 ? 208  PHE C CA  1 
ATOM   5304 C C   . PHE C 1 208 ? 101.055 80.639  36.143 1.00 37.40 ? 208  PHE C C   1 
ATOM   5305 O O   . PHE C 1 208 ? 101.801 81.590  35.860 1.00 38.26 ? 208  PHE C O   1 
ATOM   5306 C CB  . PHE C 1 208 ? 101.139 79.339  38.267 1.00 22.92 ? 208  PHE C CB  1 
ATOM   5307 C CG  . PHE C 1 208 ? 101.436 78.045  38.967 1.00 19.52 ? 208  PHE C CG  1 
ATOM   5308 C CD1 . PHE C 1 208 ? 100.894 76.851  38.505 1.00 22.35 ? 208  PHE C CD1 1 
ATOM   5309 C CD2 . PHE C 1 208 ? 102.185 78.033  40.139 1.00 15.91 ? 208  PHE C CD2 1 
ATOM   5310 C CE1 . PHE C 1 208 ? 101.081 75.658  39.207 1.00 17.47 ? 208  PHE C CE1 1 
ATOM   5311 C CE2 . PHE C 1 208 ? 102.381 76.851  40.845 1.00 17.99 ? 208  PHE C CE2 1 
ATOM   5312 C CZ  . PHE C 1 208 ? 101.822 75.659  40.378 1.00 17.63 ? 208  PHE C CZ  1 
ATOM   5313 N N   . TRP C 1 209 ? 99.744  80.641  35.930 1.00 38.47 ? 209  TRP C N   1 
ATOM   5314 C CA  . TRP C 1 209 ? 99.018  81.813  35.479 1.00 44.16 ? 209  TRP C CA  1 
ATOM   5315 C C   . TRP C 1 209 ? 99.238  82.995  36.418 1.00 37.91 ? 209  TRP C C   1 
ATOM   5316 O O   . TRP C 1 209 ? 99.548  82.820  37.593 1.00 32.43 ? 209  TRP C O   1 
ATOM   5317 C CB  . TRP C 1 209 ? 97.529  81.478  35.380 1.00 48.43 ? 209  TRP C CB  1 
ATOM   5318 C CG  . TRP C 1 209 ? 97.001  81.789  34.055 1.00 55.12 ? 209  TRP C CG  1 
ATOM   5319 C CD1 . TRP C 1 209 ? 97.413  81.237  32.875 1.00 57.92 ? 209  TRP C CD1 1 
ATOM   5320 C CD2 . TRP C 1 209 ? 96.242  82.948  33.708 1.00 59.13 ? 209  TRP C CD2 1 
ATOM   5321 N NE1 . TRP C 1 209 ? 97.010  82.015  31.819 1.00 60.84 ? 209  TRP C NE1 1 
ATOM   5322 C CE2 . TRP C 1 209 ? 96.286  83.073  32.301 1.00 60.08 ? 209  TRP C CE2 1 
ATOM   5323 C CE3 . TRP C 1 209 ? 95.555  83.914  34.452 1.00 56.78 ? 209  TRP C CE3 1 
ATOM   5324 C CZ2 . TRP C 1 209 ? 95.672  84.126  31.623 1.00 56.25 ? 209  TRP C CZ2 1 
ATOM   5325 C CZ3 . TRP C 1 209 ? 94.948  84.960  33.781 1.00 57.59 ? 209  TRP C CZ3 1 
ATOM   5326 C CH2 . TRP C 1 209 ? 95.011  85.058  32.378 1.00 57.69 ? 209  TRP C CH2 1 
ATOM   5327 N N   . TYR C 1 210 ? 99.060  84.199  35.894 1.00 38.56 ? 210  TYR C N   1 
ATOM   5328 C CA  . TYR C 1 210 ? 99.447  85.398  36.621 1.00 44.34 ? 210  TYR C CA  1 
ATOM   5329 C C   . TYR C 1 210 ? 98.552  85.657  37.831 1.00 49.18 ? 210  TYR C C   1 
ATOM   5330 O O   . TYR C 1 210 ? 98.922  86.412  38.733 1.00 53.22 ? 210  TYR C O   1 
ATOM   5331 C CB  . TYR C 1 210 ? 99.427  86.603  35.686 1.00 40.89 ? 210  TYR C CB  1 
ATOM   5332 C CG  . TYR C 1 210 ? 100.019 86.337  34.321 1.00 46.83 ? 210  TYR C CG  1 
ATOM   5333 C CD1 . TYR C 1 210 ? 101.405 86.335  34.124 1.00 45.27 ? 210  TYR C CD1 1 
ATOM   5334 C CD2 . TYR C 1 210 ? 99.190  86.181  33.205 1.00 49.55 ? 210  TYR C CD2 1 
ATOM   5335 C CE1 . TYR C 1 210 ? 101.950 86.204  32.841 1.00 44.47 ? 210  TYR C CE1 1 
ATOM   5336 C CE2 . TYR C 1 210 ? 99.723  86.048  31.917 1.00 49.93 ? 210  TYR C CE2 1 
ATOM   5337 C CZ  . TYR C 1 210 ? 101.101 86.067  31.744 1.00 48.25 ? 210  TYR C CZ  1 
ATOM   5338 O OH  . TYR C 1 210 ? 101.622 85.984  30.473 1.00 48.73 ? 210  TYR C OH  1 
ATOM   5339 N N   . THR C 1 211 ? 97.427  84.948  37.891 1.00 46.34 ? 211  THR C N   1 
ATOM   5340 C CA  . THR C 1 211 ? 96.474  85.067  38.994 1.00 46.50 ? 211  THR C CA  1 
ATOM   5341 C C   . THR C 1 211 ? 96.882  84.214  40.204 1.00 44.42 ? 211  THR C C   1 
ATOM   5342 O O   . THR C 1 211 ? 96.122  84.080  41.174 1.00 45.44 ? 211  THR C O   1 
ATOM   5343 C CB  . THR C 1 211 ? 95.069  84.644  38.525 1.00 45.56 ? 211  THR C CB  1 
ATOM   5344 O OG1 . THR C 1 211 ? 95.132  83.328  37.954 1.00 50.82 ? 211  THR C OG1 1 
ATOM   5345 C CG2 . THR C 1 211 ? 94.536  85.627  37.477 1.00 44.98 ? 211  THR C CG2 1 
ATOM   5346 N N   . ALA C 1 212 ? 98.088  83.650  40.138 1.00 43.72 ? 212  ALA C N   1 
ATOM   5347 C CA  . ALA C 1 212 ? 98.589  82.750  41.169 1.00 39.39 ? 212  ALA C CA  1 
ATOM   5348 C C   . ALA C 1 212 ? 99.255  83.508  42.307 1.00 40.95 ? 212  ALA C C   1 
ATOM   5349 O O   . ALA C 1 212 ? 99.901  84.538  42.090 1.00 41.16 ? 212  ALA C O   1 
ATOM   5350 C CB  . ALA C 1 212 ? 99.566  81.761  40.562 1.00 38.04 ? 212  ALA C CB  1 
ATOM   5351 N N   . LEU C 1 213 ? 99.123  82.957  43.513 1.00 39.06 ? 213  LEU C N   1 
ATOM   5352 C CA  . LEU C 1 213 ? 99.693  83.532  44.730 1.00 37.82 ? 213  LEU C CA  1 
ATOM   5353 C C   . LEU C 1 213 ? 101.172 83.191  44.877 1.00 34.59 ? 213  LEU C C   1 
ATOM   5354 O O   . LEU C 1 213 ? 101.888 83.815  45.663 1.00 30.25 ? 213  LEU C O   1 
ATOM   5355 C CB  . LEU C 1 213 ? 98.918  83.029  45.955 1.00 37.64 ? 213  LEU C CB  1 
ATOM   5356 C CG  . LEU C 1 213 ? 97.524  83.623  46.208 1.00 39.94 ? 213  LEU C CG  1 
ATOM   5357 C CD1 . LEU C 1 213 ? 97.663  85.114  46.488 1.00 42.31 ? 213  LEU C CD1 1 
ATOM   5358 C CD2 . LEU C 1 213 ? 96.595  83.387  45.019 1.00 33.58 ? 213  LEU C CD2 1 
ATOM   5359 N N   . TRP C 1 214 ? 101.625 82.196  44.121 1.00 32.17 ? 214  TRP C N   1 
ATOM   5360 C CA  . TRP C 1 214 ? 103.039 81.878  44.078 1.00 36.50 ? 214  TRP C CA  1 
ATOM   5361 C C   . TRP C 1 214 ? 103.520 81.650  42.645 1.00 41.78 ? 214  TRP C C   1 
ATOM   5362 O O   . TRP C 1 214 ? 102.762 81.177  41.797 1.00 37.76 ? 214  TRP C O   1 
ATOM   5363 C CB  . TRP C 1 214 ? 103.331 80.657  44.951 1.00 31.91 ? 214  TRP C CB  1 
ATOM   5364 C CG  . TRP C 1 214 ? 104.767 80.535  45.294 1.00 31.65 ? 214  TRP C CG  1 
ATOM   5365 C CD1 . TRP C 1 214 ? 105.430 81.180  46.300 1.00 41.88 ? 214  TRP C CD1 1 
ATOM   5366 C CD2 . TRP C 1 214 ? 105.758 79.819  44.554 1.00 32.44 ? 214  TRP C CD2 1 
ATOM   5367 N NE1 . TRP C 1 214 ? 106.781 80.921  46.223 1.00 40.49 ? 214  TRP C NE1 1 
ATOM   5368 C CE2 . TRP C 1 214 ? 107.009 80.085  45.163 1.00 36.84 ? 214  TRP C CE2 1 
ATOM   5369 C CE3 . TRP C 1 214 ? 105.713 78.979  43.432 1.00 35.15 ? 214  TRP C CE3 1 
ATOM   5370 C CZ2 . TRP C 1 214 ? 108.198 79.537  44.690 1.00 38.99 ? 214  TRP C CZ2 1 
ATOM   5371 C CZ3 . TRP C 1 214 ? 106.896 78.432  42.962 1.00 40.24 ? 214  TRP C CZ3 1 
ATOM   5372 C CH2 . TRP C 1 214 ? 108.124 78.714  43.592 1.00 41.74 ? 214  TRP C CH2 1 
ATOM   5373 N N   . ASN C 1 215 ? 104.751 82.089  42.375 1.00 43.77 ? 215  ASN C N   1 
ATOM   5374 C CA  . ASN C 1 215 ? 105.394 81.970  41.059 1.00 35.80 ? 215  ASN C CA  1 
ATOM   5375 C C   . ASN C 1 215 ? 106.908 82.139  41.225 1.00 39.63 ? 215  ASN C C   1 
ATOM   5376 O O   . ASN C 1 215 ? 107.389 82.553  42.288 1.00 44.13 ? 215  ASN C O   1 
ATOM   5377 C CB  . ASN C 1 215 ? 104.884 83.058  40.106 1.00 31.09 ? 215  ASN C CB  1 
ATOM   5378 C CG  . ASN C 1 215 ? 103.722 82.600  39.246 1.00 30.15 ? 215  ASN C CG  1 
ATOM   5379 O OD1 . ASN C 1 215 ? 103.894 81.796  38.327 1.00 26.61 ? 215  ASN C OD1 1 
ATOM   5380 N ND2 . ASN C 1 215 ? 102.558 83.209  39.456 1.00 35.25 ? 215  ASN C ND2 1 
ATOM   5381 N N   . ASN C 1 216 ? 107.645 81.896  40.146 1.00 36.43 ? 216  ASN C N   1 
ATOM   5382 C CA  . ASN C 1 216 ? 109.086 82.104  40.144 1.00 40.31 ? 216  ASN C CA  1 
ATOM   5383 C C   . ASN C 1 216 ? 109.504 83.320  39.320 1.00 46.34 ? 216  ASN C C   1 
ATOM   5384 O O   . ASN C 1 216 ? 110.624 83.810  39.452 1.00 52.41 ? 216  ASN C O   1 
ATOM   5385 C CB  . ASN C 1 216 ? 109.816 80.850  39.651 1.00 43.25 ? 216  ASN C CB  1 
ATOM   5386 C CG  . ASN C 1 216 ? 109.101 80.142  38.508 1.00 43.41 ? 216  ASN C CG  1 
ATOM   5387 O OD1 . ASN C 1 216 ? 109.454 79.017  38.169 1.00 45.90 ? 216  ASN C OD1 1 
ATOM   5388 N ND2 . ASN C 1 216 ? 108.155 80.817  37.865 1.00 49.51 ? 216  ASN C ND2 1 
ATOM   5389 N N   . LYS C 1 217 ? 108.612 83.767  38.441 1.00 47.10 ? 217  LYS C N   1 
ATOM   5390 C CA  . LYS C 1 217 ? 108.770 85.022  37.697 1.00 58.38 ? 217  LYS C CA  1 
ATOM   5391 C C   . LYS C 1 217 ? 107.376 85.473  37.221 1.00 63.20 ? 217  LYS C C   1 
ATOM   5392 O O   . LYS C 1 217 ? 107.264 86.103  36.141 1.00 62.50 ? 217  LYS C O   1 
ATOM   5393 C CB  . LYS C 1 217 ? 109.700 84.833  36.479 1.00 58.24 ? 217  LYS C CB  1 
ATOM   5394 C CG  . LYS C 1 217 ? 111.180 85.161  36.708 1.00 61.13 ? 217  LYS C CG  1 
ATOM   5395 C CD  . LYS C 1 217 ? 112.011 84.937  35.440 1.00 64.24 ? 217  LYS C CD  1 
ATOM   5396 C CE  . LYS C 1 217 ? 112.081 86.195  34.571 1.00 61.45 ? 217  LYS C CE  1 
ATOM   5397 N NZ  . LYS C 1 217 ? 112.352 85.892  33.134 1.00 58.36 ? 217  LYS C NZ  1 
ATOM   5398 N N   . VAL D 1 1   ? 91.664  35.168  40.104 1.00 40.46 ? 1    VAL D N   1 
ATOM   5399 C CA  . VAL D 1 1   ? 90.735  36.072  40.848 1.00 45.73 ? 1    VAL D CA  1 
ATOM   5400 C C   . VAL D 1 1   ? 91.430  37.362  41.283 1.00 43.21 ? 1    VAL D C   1 
ATOM   5401 O O   . VAL D 1 1   ? 92.498  37.327  41.894 1.00 52.19 ? 1    VAL D O   1 
ATOM   5402 C CB  . VAL D 1 1   ? 90.151  35.369  42.095 1.00 45.67 ? 1    VAL D CB  1 
ATOM   5403 C CG1 . VAL D 1 1   ? 89.124  36.268  42.782 1.00 44.33 ? 1    VAL D CG1 1 
ATOM   5404 C CG2 . VAL D 1 1   ? 89.522  34.046  41.695 1.00 51.28 ? 1    VAL D CG2 1 
ATOM   5405 N N   . VAL D 1 2   ? 90.817  38.498  40.963 1.00 33.32 ? 2    VAL D N   1 
ATOM   5406 C CA  . VAL D 1 2   ? 91.418  39.795  41.253 1.00 29.42 ? 2    VAL D CA  1 
ATOM   5407 C C   . VAL D 1 2   ? 90.620  40.539  42.309 1.00 30.36 ? 2    VAL D C   1 
ATOM   5408 O O   . VAL D 1 2   ? 89.454  40.226  42.550 1.00 35.15 ? 2    VAL D O   1 
ATOM   5409 C CB  . VAL D 1 2   ? 91.525  40.679  39.989 1.00 27.87 ? 2    VAL D CB  1 
ATOM   5410 C CG1 . VAL D 1 2   ? 91.965  39.846  38.806 1.00 30.45 ? 2    VAL D CG1 1 
ATOM   5411 C CG2 . VAL D 1 2   ? 90.205  41.362  39.702 1.00 28.76 ? 2    VAL D CG2 1 
ATOM   5412 N N   . THR D 1 3   ? 91.247  41.523  42.942 1.00 22.41 ? 3    THR D N   1 
ATOM   5413 C CA  . THR D 1 3   ? 90.553  42.308  43.943 1.00 17.38 ? 3    THR D CA  1 
ATOM   5414 C C   . THR D 1 3   ? 90.587  43.793  43.641 1.00 17.31 ? 3    THR D C   1 
ATOM   5415 O O   . THR D 1 3   ? 91.604  44.343  43.229 1.00 20.02 ? 3    THR D O   1 
ATOM   5416 C CB  . THR D 1 3   ? 91.078  42.036  45.383 1.00 20.62 ? 3    THR D CB  1 
ATOM   5417 O OG1 . THR D 1 3   ? 91.120  43.266  46.124 1.00 22.72 ? 3    THR D OG1 1 
ATOM   5418 C CG2 . THR D 1 3   ? 92.454  41.370  45.355 1.00 23.09 ? 3    THR D CG2 1 
ATOM   5419 N N   . LEU D 1 4   ? 89.420  44.407  43.766 1.00 13.83 ? 4    LEU D N   1 
ATOM   5420 C CA  . LEU D 1 4   ? 89.266  45.821  43.512 1.00 13.50 ? 4    LEU D CA  1 
ATOM   5421 C C   . LEU D 1 4   ? 88.988  46.524  44.820 1.00 14.24 ? 4    LEU D C   1 
ATOM   5422 O O   . LEU D 1 4   ? 88.002  46.234  45.495 1.00 21.43 ? 4    LEU D O   1 
ATOM   5423 C CB  . LEU D 1 4   ? 88.120  46.059  42.529 1.00 17.54 ? 4    LEU D CB  1 
ATOM   5424 C CG  . LEU D 1 4   ? 87.742  47.524  42.300 1.00 17.06 ? 4    LEU D CG  1 
ATOM   5425 C CD1 . LEU D 1 4   ? 88.954  48.301  41.813 1.00 18.12 ? 4    LEU D CD1 1 
ATOM   5426 C CD2 . LEU D 1 4   ? 86.602  47.612  41.309 1.00 21.66 ? 4    LEU D CD2 1 
ATOM   5427 N N   . GLY D 1 5   ? 89.869  47.449  45.173 1.00 15.47 ? 5    GLY D N   1 
ATOM   5428 C CA  . GLY D 1 5   ? 89.693  48.210  46.390 1.00 20.23 ? 5    GLY D CA  1 
ATOM   5429 C C   . GLY D 1 5   ? 89.208  49.611  46.110 1.00 24.85 ? 5    GLY D C   1 
ATOM   5430 O O   . GLY D 1 5   ? 89.754  50.315  45.261 1.00 23.58 ? 5    GLY D O   1 
ATOM   5431 N N   . TYR D 1 6   ? 88.186  50.016  46.853 1.00 27.69 ? 6    TYR D N   1 
ATOM   5432 C CA  . TYR D 1 6   ? 87.597  51.343  46.733 1.00 25.63 ? 6    TYR D CA  1 
ATOM   5433 C C   . TYR D 1 6   ? 86.615  51.532  47.896 1.00 26.80 ? 6    TYR D C   1 
ATOM   5434 O O   . TYR D 1 6   ? 86.368  50.597  48.658 1.00 33.07 ? 6    TYR D O   1 
ATOM   5435 C CB  . TYR D 1 6   ? 86.872  51.463  45.387 1.00 17.15 ? 6    TYR D CB  1 
ATOM   5436 C CG  . TYR D 1 6   ? 86.576  52.883  44.977 1.00 15.53 ? 6    TYR D CG  1 
ATOM   5437 C CD1 . TYR D 1 6   ? 87.603  53.807  44.836 1.00 18.22 ? 6    TYR D CD1 1 
ATOM   5438 C CD2 . TYR D 1 6   ? 85.259  53.331  44.836 1.00 15.14 ? 6    TYR D CD2 1 
ATOM   5439 C CE1 . TYR D 1 6   ? 87.339  55.147  44.584 1.00 15.85 ? 6    TYR D CE1 1 
ATOM   5440 C CE2 . TYR D 1 6   ? 84.979  54.667  44.578 1.00 19.28 ? 6    TYR D CE2 1 
ATOM   5441 C CZ  . TYR D 1 6   ? 86.027  55.575  44.463 1.00 20.81 ? 6    TYR D CZ  1 
ATOM   5442 O OH  . TYR D 1 6   ? 85.776  56.918  44.284 1.00 20.82 ? 6    TYR D OH  1 
ATOM   5443 N N   . TRP D 1 7   ? 86.089  52.745  48.056 1.00 27.71 ? 7    TRP D N   1 
ATOM   5444 C CA  . TRP D 1 7   ? 85.047  53.014  49.045 1.00 25.93 ? 7    TRP D CA  1 
ATOM   5445 C C   . TRP D 1 7   ? 83.745  52.309  48.688 1.00 27.89 ? 7    TRP D C   1 
ATOM   5446 O O   . TRP D 1 7   ? 83.561  51.866  47.556 1.00 26.29 ? 7    TRP D O   1 
ATOM   5447 C CB  . TRP D 1 7   ? 84.764  54.511  49.123 1.00 24.36 ? 7    TRP D CB  1 
ATOM   5448 C CG  . TRP D 1 7   ? 85.960  55.341  49.356 1.00 23.82 ? 7    TRP D CG  1 
ATOM   5449 C CD1 . TRP D 1 7   ? 86.530  56.199  48.478 1.00 22.48 ? 7    TRP D CD1 1 
ATOM   5450 C CD2 . TRP D 1 7   ? 86.736  55.413  50.559 1.00 28.29 ? 7    TRP D CD2 1 
ATOM   5451 N NE1 . TRP D 1 7   ? 87.613  56.805  49.050 1.00 19.57 ? 7    TRP D NE1 1 
ATOM   5452 C CE2 . TRP D 1 7   ? 87.774  56.331  50.325 1.00 23.31 ? 7    TRP D CE2 1 
ATOM   5453 C CE3 . TRP D 1 7   ? 86.650  54.793  51.814 1.00 32.30 ? 7    TRP D CE3 1 
ATOM   5454 C CZ2 . TRP D 1 7   ? 88.736  56.644  51.296 1.00 28.34 ? 7    TRP D CZ2 1 
ATOM   5455 C CZ3 . TRP D 1 7   ? 87.607  55.111  52.790 1.00 32.48 ? 7    TRP D CZ3 1 
ATOM   5456 C CH2 . TRP D 1 7   ? 88.635  56.026  52.518 1.00 28.80 ? 7    TRP D CH2 1 
ATOM   5457 N N   . ASP D 1 8   ? 82.784  52.351  49.607 1.00 35.16 ? 8    ASP D N   1 
ATOM   5458 C CA  . ASP D 1 8   ? 81.434  51.882  49.310 1.00 38.56 ? 8    ASP D CA  1 
ATOM   5459 C C   . ASP D 1 8   ? 80.590  52.982  48.665 1.00 37.56 ? 8    ASP D C   1 
ATOM   5460 O O   . ASP D 1 8   ? 79.467  53.253  49.100 1.00 42.33 ? 8    ASP D O   1 
ATOM   5461 C CB  . ASP D 1 8   ? 80.748  51.374  50.581 1.00 43.93 ? 8    ASP D CB  1 
ATOM   5462 C CG  . ASP D 1 8   ? 79.826  50.197  50.315 1.00 54.00 ? 8    ASP D CG  1 
ATOM   5463 O OD1 . ASP D 1 8   ? 79.090  50.216  49.304 1.00 62.05 ? 8    ASP D OD1 1 
ATOM   5464 O OD2 . ASP D 1 8   ? 79.843  49.240  51.116 1.00 59.95 ? 8    ASP D OD2 1 
ATOM   5465 N N   . ILE D 1 9   ? 81.172  53.662  47.677 1.00 33.64 ? 9    ILE D N   1 
ATOM   5466 C CA  . ILE D 1 9   ? 80.433  54.605  46.833 1.00 34.89 ? 9    ILE D CA  1 
ATOM   5467 C C   . ILE D 1 9   ? 80.679  54.263  45.375 1.00 31.51 ? 9    ILE D C   1 
ATOM   5468 O O   . ILE D 1 9   ? 81.481  53.385  45.063 1.00 36.02 ? 9    ILE D O   1 
ATOM   5469 C CB  . ILE D 1 9   ? 80.850  56.095  47.065 1.00 36.58 ? 9    ILE D CB  1 
ATOM   5470 C CG1 . ILE D 1 9   ? 82.348  56.276  46.799 1.00 42.02 ? 9    ILE D CG1 1 
ATOM   5471 C CG2 . ILE D 1 9   ? 80.481  56.535  48.478 1.00 31.77 ? 9    ILE D CG2 1 
ATOM   5472 C CD1 . ILE D 1 9   ? 82.794  57.710  46.692 1.00 38.18 ? 9    ILE D CD1 1 
ATOM   5473 N N   . ARG D 1 10  ? 79.975  54.956  44.489 1.00 23.57 ? 10   ARG D N   1 
ATOM   5474 C CA  . ARG D 1 10  ? 80.120  54.752  43.058 1.00 19.38 ? 10   ARG D CA  1 
ATOM   5475 C C   . ARG D 1 10  ? 81.420  55.388  42.584 1.00 22.22 ? 10   ARG D C   1 
ATOM   5476 O O   . ARG D 1 10  ? 82.348  54.678  42.188 1.00 20.77 ? 10   ARG D O   1 
ATOM   5477 C CB  . ARG D 1 10  ? 78.921  55.358  42.331 1.00 18.00 ? 10   ARG D CB  1 
ATOM   5478 C CG  . ARG D 1 10  ? 78.968  55.235  40.836 1.00 13.95 ? 10   ARG D CG  1 
ATOM   5479 C CD  . ARG D 1 10  ? 77.746  55.850  40.230 1.00 9.06  ? 10   ARG D CD  1 
ATOM   5480 N NE  . ARG D 1 10  ? 78.059  56.435  38.937 1.00 21.46 ? 10   ARG D NE  1 
ATOM   5481 C CZ  . ARG D 1 10  ? 77.173  56.611  37.964 1.00 20.70 ? 10   ARG D CZ  1 
ATOM   5482 N NH1 . ARG D 1 10  ? 75.917  56.206  38.124 1.00 16.55 ? 10   ARG D NH1 1 
ATOM   5483 N NH2 . ARG D 1 10  ? 77.545  57.171  36.821 1.00 16.36 ? 10   ARG D NH2 1 
ATOM   5484 N N   . GLY D 1 11  ? 81.503  56.714  42.695 1.00 27.23 ? 11   GLY D N   1 
ATOM   5485 C CA  . GLY D 1 11  ? 82.727  57.431  42.362 1.00 33.21 ? 11   GLY D CA  1 
ATOM   5486 C C   . GLY D 1 11  ? 83.476  56.991  41.109 1.00 32.96 ? 11   GLY D C   1 
ATOM   5487 O O   . GLY D 1 11  ? 82.871  56.712  40.071 1.00 34.34 ? 11   GLY D O   1 
ATOM   5488 N N   . LEU D 1 12  ? 84.787  56.816  41.270 1.00 32.31 ? 12   LEU D N   1 
ATOM   5489 C CA  . LEU D 1 12  ? 85.729  56.545  40.179 1.00 29.86 ? 12   LEU D CA  1 
ATOM   5490 C C   . LEU D 1 12  ? 85.743  55.086  39.716 1.00 28.14 ? 12   LEU D C   1 
ATOM   5491 O O   . LEU D 1 12  ? 86.243  54.776  38.624 1.00 34.45 ? 12   LEU D O   1 
ATOM   5492 C CB  . LEU D 1 12  ? 87.144  56.930  40.627 1.00 31.14 ? 12   LEU D CB  1 
ATOM   5493 C CG  . LEU D 1 12  ? 87.860  58.158  40.059 1.00 32.41 ? 12   LEU D CG  1 
ATOM   5494 C CD1 . LEU D 1 12  ? 86.885  59.261  39.709 1.00 33.30 ? 12   LEU D CD1 1 
ATOM   5495 C CD2 . LEU D 1 12  ? 88.874  58.638  41.079 1.00 36.15 ? 12   LEU D CD2 1 
ATOM   5496 N N   . ALA D 1 13  ? 85.254  54.191  40.570 1.00 21.66 ? 13   ALA D N   1 
ATOM   5497 C CA  . ALA D 1 13  ? 85.353  52.764  40.310 1.00 19.21 ? 13   ALA D CA  1 
ATOM   5498 C C   . ALA D 1 13  ? 84.187  52.224  39.504 1.00 20.51 ? 13   ALA D C   1 
ATOM   5499 O O   . ALA D 1 13  ? 84.205  51.058  39.120 1.00 21.60 ? 13   ALA D O   1 
ATOM   5500 C CB  . ALA D 1 13  ? 85.478  52.008  41.608 1.00 22.43 ? 13   ALA D CB  1 
ATOM   5501 N N   . HIS D 1 14  ? 83.209  53.078  39.193 1.00 22.39 ? 14   HIS D N   1 
ATOM   5502 C CA  . HIS D 1 14  ? 82.014  52.661  38.460 1.00 14.42 ? 14   HIS D CA  1 
ATOM   5503 C C   . HIS D 1 14  ? 82.373  52.083  37.097 1.00 18.81 ? 14   HIS D C   1 
ATOM   5504 O O   . HIS D 1 14  ? 81.998  50.960  36.789 1.00 20.51 ? 14   HIS D O   1 
ATOM   5505 C CB  . HIS D 1 14  ? 81.049  53.833  38.284 1.00 18.74 ? 14   HIS D CB  1 
ATOM   5506 C CG  . HIS D 1 14  ? 79.659  53.432  37.871 1.00 33.48 ? 14   HIS D CG  1 
ATOM   5507 N ND1 . HIS D 1 14  ? 78.852  52.632  38.654 1.00 37.01 ? 14   HIS D ND1 1 
ATOM   5508 C CD2 . HIS D 1 14  ? 78.903  53.809  36.814 1.00 35.09 ? 14   HIS D CD2 1 
ATOM   5509 C CE1 . HIS D 1 14  ? 77.656  52.540  38.098 1.00 32.99 ? 14   HIS D CE1 1 
ATOM   5510 N NE2 . HIS D 1 14  ? 77.657  53.244  36.981 1.00 36.93 ? 14   HIS D NE2 1 
ATOM   5511 N N   . ALA D 1 15  ? 83.190  52.798  36.333 1.00 23.45 ? 15   ALA D N   1 
ATOM   5512 C CA  . ALA D 1 15  ? 83.600  52.324  35.011 1.00 17.78 ? 15   ALA D CA  1 
ATOM   5513 C C   . ALA D 1 15  ? 84.450  51.058  35.087 1.00 18.37 ? 15   ALA D C   1 
ATOM   5514 O O   . ALA D 1 15  ? 84.401  50.212  34.193 1.00 21.23 ? 15   ALA D O   1 
ATOM   5515 C CB  . ALA D 1 15  ? 84.351  53.418  34.257 1.00 17.58 ? 15   ALA D CB  1 
ATOM   5516 N N   . ILE D 1 16  ? 85.190  50.913  36.180 1.00 15.10 ? 16   ILE D N   1 
ATOM   5517 C CA  . ILE D 1 16  ? 86.067  49.767  36.378 1.00 13.60 ? 16   ILE D CA  1 
ATOM   5518 C C   . ILE D 1 16  ? 85.235  48.534  36.669 1.00 17.11 ? 16   ILE D C   1 
ATOM   5519 O O   . ILE D 1 16  ? 85.458  47.469  36.091 1.00 16.63 ? 16   ILE D O   1 
ATOM   5520 C CB  . ILE D 1 16  ? 87.029  50.020  37.546 1.00 19.08 ? 16   ILE D CB  1 
ATOM   5521 C CG1 . ILE D 1 16  ? 87.721  51.373  37.347 1.00 22.45 ? 16   ILE D CG1 1 
ATOM   5522 C CG2 . ILE D 1 16  ? 88.054  48.903  37.632 1.00 20.65 ? 16   ILE D CG2 1 
ATOM   5523 C CD1 . ILE D 1 16  ? 88.558  51.822  38.508 1.00 25.07 ? 16   ILE D CD1 1 
ATOM   5524 N N   . ARG D 1 17  ? 84.180  48.737  37.448 1.00 22.52 ? 17   ARG D N   1 
ATOM   5525 C CA  . ARG D 1 17  ? 83.272  47.663  37.816 1.00 18.56 ? 17   ARG D CA  1 
ATOM   5526 C C   . ARG D 1 17  ? 82.469  47.159  36.615 1.00 18.11 ? 17   ARG D C   1 
ATOM   5527 O O   . ARG D 1 17  ? 82.459  45.959  36.335 1.00 22.06 ? 17   ARG D O   1 
ATOM   5528 C CB  . ARG D 1 17  ? 82.373  48.134  38.962 1.00 13.34 ? 17   ARG D CB  1 
ATOM   5529 C CG  . ARG D 1 17  ? 83.183  48.344  40.242 1.00 18.18 ? 17   ARG D CG  1 
ATOM   5530 C CD  . ARG D 1 17  ? 82.334  48.446  41.491 1.00 21.46 ? 17   ARG D CD  1 
ATOM   5531 N NE  . ARG D 1 17  ? 82.010  49.833  41.794 1.00 18.60 ? 17   ARG D NE  1 
ATOM   5532 C CZ  . ARG D 1 17  ? 82.241  50.430  42.960 1.00 19.60 ? 17   ARG D CZ  1 
ATOM   5533 N NH1 . ARG D 1 17  ? 82.774  49.767  43.982 1.00 9.16  ? 17   ARG D NH1 1 
ATOM   5534 N NH2 . ARG D 1 17  ? 81.928  51.708  43.103 1.00 25.41 ? 17   ARG D NH2 1 
ATOM   5535 N N   . LEU D 1 18  ? 81.997  48.094  35.795 1.00 17.65 ? 18   LEU D N   1 
ATOM   5536 C CA  . LEU D 1 18  ? 81.309  47.759  34.546 1.00 18.56 ? 18   LEU D CA  1 
ATOM   5537 C C   . LEU D 1 18  ? 82.220  46.981  33.595 1.00 16.60 ? 18   LEU D C   1 
ATOM   5538 O O   . LEU D 1 18  ? 81.761  46.136  32.828 1.00 15.43 ? 18   LEU D O   1 
ATOM   5539 C CB  . LEU D 1 18  ? 80.835  49.037  33.840 1.00 9.64  ? 18   LEU D CB  1 
ATOM   5540 C CG  . LEU D 1 18  ? 79.931  50.017  34.589 1.00 6.15  ? 18   LEU D CG  1 
ATOM   5541 C CD1 . LEU D 1 18  ? 79.765  51.281  33.779 1.00 5.00  ? 18   LEU D CD1 1 
ATOM   5542 C CD2 . LEU D 1 18  ? 78.582  49.385  34.851 1.00 5.05  ? 18   LEU D CD2 1 
ATOM   5543 N N   . LEU D 1 19  ? 83.502  47.329  33.619 1.00 19.53 ? 19   LEU D N   1 
ATOM   5544 C CA  . LEU D 1 19  ? 84.494  46.770  32.722 1.00 17.71 ? 19   LEU D CA  1 
ATOM   5545 C C   . LEU D 1 19  ? 84.831  45.348  33.121 1.00 20.13 ? 19   LEU D C   1 
ATOM   5546 O O   . LEU D 1 19  ? 84.897  44.452  32.279 1.00 25.20 ? 19   LEU D O   1 
ATOM   5547 C CB  . LEU D 1 19  ? 85.750  47.624  32.777 1.00 20.49 ? 19   LEU D CB  1 
ATOM   5548 C CG  . LEU D 1 19  ? 86.854  47.298  31.781 1.00 20.01 ? 19   LEU D CG  1 
ATOM   5549 C CD1 . LEU D 1 19  ? 86.330  47.433  30.359 1.00 22.56 ? 19   LEU D CD1 1 
ATOM   5550 C CD2 . LEU D 1 19  ? 88.032  48.226  32.025 1.00 19.23 ? 19   LEU D CD2 1 
ATOM   5551 N N   . LEU D 1 20  ? 85.034  45.143  34.414 1.00 21.62 ? 20   LEU D N   1 
ATOM   5552 C CA  . LEU D 1 20  ? 85.274  43.805  34.943 1.00 22.76 ? 20   LEU D CA  1 
ATOM   5553 C C   . LEU D 1 20  ? 84.111  42.864  34.645 1.00 16.34 ? 20   LEU D C   1 
ATOM   5554 O O   . LEU D 1 20  ? 84.316  41.688  34.353 1.00 19.56 ? 20   LEU D O   1 
ATOM   5555 C CB  . LEU D 1 20  ? 85.517  43.876  36.453 1.00 23.45 ? 20   LEU D CB  1 
ATOM   5556 C CG  . LEU D 1 20  ? 86.864  44.464  36.884 1.00 22.65 ? 20   LEU D CG  1 
ATOM   5557 C CD1 . LEU D 1 20  ? 86.852  44.819  38.370 1.00 18.94 ? 20   LEU D CD1 1 
ATOM   5558 C CD2 . LEU D 1 20  ? 87.963  43.461  36.560 1.00 19.16 ? 20   LEU D CD2 1 
ATOM   5559 N N   . GLU D 1 21  ? 82.896  43.406  34.685 1.00 22.54 ? 21   GLU D N   1 
ATOM   5560 C CA  . GLU D 1 21  ? 81.683  42.631  34.425 1.00 22.09 ? 21   GLU D CA  1 
ATOM   5561 C C   . GLU D 1 21  ? 81.603  42.237  32.965 1.00 22.00 ? 21   GLU D C   1 
ATOM   5562 O O   . GLU D 1 21  ? 81.366  41.074  32.632 1.00 26.80 ? 21   GLU D O   1 
ATOM   5563 C CB  . GLU D 1 21  ? 80.429  43.442  34.783 1.00 16.14 ? 21   GLU D CB  1 
ATOM   5564 C CG  . GLU D 1 21  ? 80.135  43.553  36.271 1.00 21.27 ? 21   GLU D CG  1 
ATOM   5565 C CD  . GLU D 1 21  ? 79.768  42.226  36.923 1.00 23.61 ? 21   GLU D CD  1 
ATOM   5566 O OE1 . GLU D 1 21  ? 78.980  41.460  36.331 1.00 16.00 ? 21   GLU D OE1 1 
ATOM   5567 O OE2 . GLU D 1 21  ? 80.227  41.976  38.061 1.00 25.87 ? 21   GLU D OE2 1 
ATOM   5568 N N   . TYR D 1 22  ? 81.770  43.232  32.103 1.00 19.42 ? 22   TYR D N   1 
ATOM   5569 C CA  . TYR D 1 22  ? 81.716  43.043  30.663 1.00 16.62 ? 22   TYR D CA  1 
ATOM   5570 C C   . TYR D 1 22  ? 82.749  42.029  30.179 1.00 23.99 ? 22   TYR D C   1 
ATOM   5571 O O   . TYR D 1 22  ? 82.479  41.234  29.271 1.00 29.71 ? 22   TYR D O   1 
ATOM   5572 C CB  . TYR D 1 22  ? 81.939  44.379  29.961 1.00 14.83 ? 22   TYR D CB  1 
ATOM   5573 C CG  . TYR D 1 22  ? 81.972  44.267  28.462 1.00 16.52 ? 22   TYR D CG  1 
ATOM   5574 C CD1 . TYR D 1 22  ? 80.794  44.185  27.727 1.00 9.96  ? 22   TYR D CD1 1 
ATOM   5575 C CD2 . TYR D 1 22  ? 83.186  44.168  27.778 1.00 17.40 ? 22   TYR D CD2 1 
ATOM   5576 C CE1 . TYR D 1 22  ? 80.827  44.001  26.333 1.00 9.51  ? 22   TYR D CE1 1 
ATOM   5577 C CE2 . TYR D 1 22  ? 83.228  43.988  26.391 1.00 17.40 ? 22   TYR D CE2 1 
ATOM   5578 C CZ  . TYR D 1 22  ? 82.044  43.908  25.674 1.00 9.04  ? 22   TYR D CZ  1 
ATOM   5579 O OH  . TYR D 1 22  ? 82.083  43.781  24.302 1.00 13.89 ? 22   TYR D OH  1 
ATOM   5580 N N   . THR D 1 23  ? 83.933  42.071  30.785 1.00 27.29 ? 23   THR D N   1 
ATOM   5581 C CA  . THR D 1 23  ? 85.050  41.216  30.389 1.00 29.36 ? 23   THR D CA  1 
ATOM   5582 C C   . THR D 1 23  ? 84.978  39.836  31.053 1.00 29.70 ? 23   THR D C   1 
ATOM   5583 O O   . THR D 1 23  ? 85.774  38.940  30.752 1.00 27.82 ? 23   THR D O   1 
ATOM   5584 C CB  . THR D 1 23  ? 86.397  41.894  30.749 1.00 32.88 ? 23   THR D CB  1 
ATOM   5585 O OG1 . THR D 1 23  ? 86.382  42.292  32.127 1.00 39.19 ? 23   THR D OG1 1 
ATOM   5586 C CG2 . THR D 1 23  ? 86.619  43.133  29.886 1.00 35.51 ? 23   THR D CG2 1 
ATOM   5587 N N   . GLU D 1 24  ? 83.995  39.670  31.937 1.00 34.14 ? 24   GLU D N   1 
ATOM   5588 C CA  . GLU D 1 24  ? 83.800  38.440  32.704 1.00 37.52 ? 24   GLU D CA  1 
ATOM   5589 C C   . GLU D 1 24  ? 85.039  38.045  33.503 1.00 38.33 ? 24   GLU D C   1 
ATOM   5590 O O   . GLU D 1 24  ? 85.278  36.861  33.752 1.00 41.29 ? 24   GLU D O   1 
ATOM   5591 C CB  . GLU D 1 24  ? 83.343  37.287  31.786 1.00 35.09 ? 24   GLU D CB  1 
ATOM   5592 C CG  . GLU D 1 24  ? 81.845  37.344  31.429 1.00 48.55 ? 24   GLU D CG  1 
ATOM   5593 C CD  . GLU D 1 24  ? 81.299  36.038  30.852 1.00 53.64 ? 24   GLU D CD  1 
ATOM   5594 O OE1 . GLU D 1 24  ? 80.798  35.195  31.636 1.00 59.02 ? 24   GLU D OE1 1 
ATOM   5595 O OE2 . GLU D 1 24  ? 81.309  35.885  29.609 1.00 47.73 ? 24   GLU D OE2 1 
ATOM   5596 N N   . THR D 1 25  ? 85.794  39.053  33.937 1.00 29.23 ? 25   THR D N   1 
ATOM   5597 C CA  . THR D 1 25  ? 86.921  38.841  34.832 1.00 27.80 ? 25   THR D CA  1 
ATOM   5598 C C   . THR D 1 25  ? 86.409  38.499  36.226 1.00 28.53 ? 25   THR D C   1 
ATOM   5599 O O   . THR D 1 25  ? 85.555  39.202  36.781 1.00 28.62 ? 25   THR D O   1 
ATOM   5600 C CB  . THR D 1 25  ? 87.815  40.091  34.903 1.00 26.86 ? 25   THR D CB  1 
ATOM   5601 O OG1 . THR D 1 25  ? 88.500  40.254  33.654 1.00 31.13 ? 25   THR D OG1 1 
ATOM   5602 C CG2 . THR D 1 25  ? 88.838  39.960  36.025 1.00 26.54 ? 25   THR D CG2 1 
ATOM   5603 N N   . PRO D 1 26  ? 86.838  37.347  36.761 1.00 27.64 ? 26   PRO D N   1 
ATOM   5604 C CA  . PRO D 1 26  ? 86.479  36.985  38.133 1.00 26.46 ? 26   PRO D CA  1 
ATOM   5605 C C   . PRO D 1 26  ? 87.140  37.929  39.123 1.00 25.26 ? 26   PRO D C   1 
ATOM   5606 O O   . PRO D 1 26  ? 88.359  38.091  39.114 1.00 23.22 ? 26   PRO D O   1 
ATOM   5607 C CB  . PRO D 1 26  ? 86.990  35.557  38.267 1.00 25.45 ? 26   PRO D CB  1 
ATOM   5608 C CG  . PRO D 1 26  ? 88.113  35.477  37.278 1.00 31.11 ? 26   PRO D CG  1 
ATOM   5609 C CD  . PRO D 1 26  ? 87.677  36.319  36.120 1.00 28.57 ? 26   PRO D CD  1 
ATOM   5610 N N   . TYR D 1 27  ? 86.311  38.651  39.872 1.00 22.47 ? 27   TYR D N   1 
ATOM   5611 C CA  . TYR D 1 27  ? 86.792  39.609  40.863 1.00 19.81 ? 27   TYR D CA  1 
ATOM   5612 C C   . TYR D 1 27  ? 85.991  39.591  42.160 1.00 26.91 ? 27   TYR D C   1 
ATOM   5613 O O   . TYR D 1 27  ? 84.808  39.234  42.180 1.00 28.68 ? 27   TYR D O   1 
ATOM   5614 C CB  . TYR D 1 27  ? 86.765  41.033  40.301 1.00 15.49 ? 27   TYR D CB  1 
ATOM   5615 C CG  . TYR D 1 27  ? 85.384  41.665  40.261 1.00 18.10 ? 27   TYR D CG  1 
ATOM   5616 C CD1 . TYR D 1 27  ? 84.465  41.312  39.267 1.00 22.69 ? 27   TYR D CD1 1 
ATOM   5617 C CD2 . TYR D 1 27  ? 85.012  42.652  41.183 1.00 19.00 ? 27   TYR D CD2 1 
ATOM   5618 C CE1 . TYR D 1 27  ? 83.208  41.930  39.183 1.00 18.84 ? 27   TYR D CE1 1 
ATOM   5619 C CE2 . TYR D 1 27  ? 83.761  43.279  41.110 1.00 13.88 ? 27   TYR D CE2 1 
ATOM   5620 C CZ  . TYR D 1 27  ? 82.865  42.914  40.100 1.00 17.38 ? 27   TYR D CZ  1 
ATOM   5621 O OH  . TYR D 1 27  ? 81.660  43.569  39.950 1.00 22.60 ? 27   TYR D OH  1 
ATOM   5622 N N   . GLN D 1 28  ? 86.629  40.102  43.208 1.00 30.42 ? 28   GLN D N   1 
ATOM   5623 C CA  . GLN D 1 28  ? 85.995  40.383  44.490 1.00 37.48 ? 28   GLN D CA  1 
ATOM   5624 C C   . GLN D 1 28  ? 86.198  41.869  44.785 1.00 37.29 ? 28   GLN D C   1 
ATOM   5625 O O   . GLN D 1 28  ? 87.038  42.517  44.155 1.00 40.66 ? 28   GLN D O   1 
ATOM   5626 C CB  . GLN D 1 28  ? 86.670  39.560  45.596 1.00 44.28 ? 28   GLN D CB  1 
ATOM   5627 C CG  . GLN D 1 28  ? 88.129  39.960  45.858 1.00 50.97 ? 28   GLN D CG  1 
ATOM   5628 C CD  . GLN D 1 28  ? 88.725  39.319  47.103 1.00 50.03 ? 28   GLN D CD  1 
ATOM   5629 O OE1 . GLN D 1 28  ? 89.556  38.415  47.001 1.00 51.07 ? 28   GLN D OE1 1 
ATOM   5630 N NE2 . GLN D 1 28  ? 88.381  39.852  48.276 1.00 47.90 ? 28   GLN D NE2 1 
ATOM   5631 N N   . GLU D 1 29  ? 85.533  42.369  45.825 1.00 33.28 ? 29   GLU D N   1 
ATOM   5632 C CA  . GLU D 1 29  ? 85.630  43.780  46.176 1.00 31.74 ? 29   GLU D CA  1 
ATOM   5633 C C   . GLU D 1 29  ? 85.969  44.020  47.641 1.00 33.28 ? 29   GLU D C   1 
ATOM   5634 O O   . GLU D 1 29  ? 85.291  43.525  48.546 1.00 32.62 ? 29   GLU D O   1 
ATOM   5635 C CB  . GLU D 1 29  ? 84.329  44.509  45.828 1.00 29.89 ? 29   GLU D CB  1 
ATOM   5636 C CG  . GLU D 1 29  ? 84.079  44.694  44.336 1.00 29.75 ? 29   GLU D CG  1 
ATOM   5637 C CD  . GLU D 1 29  ? 83.164  45.864  44.040 1.00 32.26 ? 29   GLU D CD  1 
ATOM   5638 O OE1 . GLU D 1 29  ? 83.601  47.017  44.238 1.00 32.92 ? 29   GLU D OE1 1 
ATOM   5639 O OE2 . GLU D 1 29  ? 82.013  45.632  43.613 1.00 38.11 ? 29   GLU D OE2 1 
ATOM   5640 N N   . ARG D 1 30  ? 87.026  44.794  47.860 1.00 35.27 ? 30   ARG D N   1 
ATOM   5641 C CA  . ARG D 1 30  ? 87.331  45.336  49.171 1.00 37.61 ? 30   ARG D CA  1 
ATOM   5642 C C   . ARG D 1 30  ? 86.750  46.742  49.285 1.00 36.50 ? 30   ARG D C   1 
ATOM   5643 O O   . ARG D 1 30  ? 87.397  47.725  48.927 1.00 41.94 ? 30   ARG D O   1 
ATOM   5644 C CB  . ARG D 1 30  ? 88.845  45.363  49.393 1.00 39.76 ? 30   ARG D CB  1 
ATOM   5645 C CG  . ARG D 1 30  ? 89.344  44.255  50.307 1.00 48.23 ? 30   ARG D CG  1 
ATOM   5646 C CD  . ARG D 1 30  ? 88.424  44.046  51.530 1.00 53.58 ? 30   ARG D CD  1 
ATOM   5647 N NE  . ARG D 1 30  ? 88.331  45.225  52.396 1.00 50.12 ? 30   ARG D NE  1 
ATOM   5648 C CZ  . ARG D 1 30  ? 89.260  45.593  53.275 1.00 49.01 ? 30   ARG D CZ  1 
ATOM   5649 N NH1 . ARG D 1 30  ? 90.384  44.898  53.389 1.00 53.20 ? 30   ARG D NH1 1 
ATOM   5650 N NH2 . ARG D 1 30  ? 89.083  46.681  54.016 1.00 44.46 ? 30   ARG D NH2 1 
ATOM   5651 N N   . ARG D 1 31  ? 85.494  46.819  49.706 1.00 35.86 ? 31   ARG D N   1 
ATOM   5652 C CA  . ARG D 1 31  ? 84.833  48.102  49.903 1.00 38.19 ? 31   ARG D CA  1 
ATOM   5653 C C   . ARG D 1 31  ? 85.202  48.687  51.268 1.00 36.55 ? 31   ARG D C   1 
ATOM   5654 O O   . ARG D 1 31  ? 85.077  48.019  52.295 1.00 43.97 ? 31   ARG D O   1 
ATOM   5655 C CB  . ARG D 1 31  ? 83.312  47.939  49.782 1.00 35.87 ? 31   ARG D CB  1 
ATOM   5656 C CG  . ARG D 1 31  ? 82.840  47.521  48.392 1.00 44.45 ? 31   ARG D CG  1 
ATOM   5657 C CD  . ARG D 1 31  ? 81.314  47.591  48.266 1.00 44.57 ? 31   ARG D CD  1 
ATOM   5658 N NE  . ARG D 1 31  ? 80.841  47.389  46.894 1.00 35.28 ? 31   ARG D NE  1 
ATOM   5659 C CZ  . ARG D 1 31  ? 80.070  48.247  46.228 1.00 36.78 ? 31   ARG D CZ  1 
ATOM   5660 N NH1 . ARG D 1 31  ? 79.784  49.435  46.744 1.00 35.69 ? 31   ARG D NH1 1 
ATOM   5661 N NH2 . ARG D 1 31  ? 79.636  47.945  45.010 1.00 41.10 ? 31   ARG D NH2 1 
ATOM   5662 N N   . TYR D 1 32  ? 85.700  49.920  51.264 1.00 31.31 ? 32   TYR D N   1 
ATOM   5663 C CA  . TYR D 1 32  ? 86.150  50.573  52.482 1.00 27.67 ? 32   TYR D CA  1 
ATOM   5664 C C   . TYR D 1 32  ? 85.052  51.455  53.056 1.00 34.73 ? 32   TYR D C   1 
ATOM   5665 O O   . TYR D 1 32  ? 84.207  51.968  52.320 1.00 35.42 ? 32   TYR D O   1 
ATOM   5666 C CB  . TYR D 1 32  ? 87.398  51.404  52.198 1.00 26.74 ? 32   TYR D CB  1 
ATOM   5667 C CG  . TYR D 1 32  ? 88.627  50.577  51.898 1.00 25.52 ? 32   TYR D CG  1 
ATOM   5668 C CD1 . TYR D 1 32  ? 88.878  50.102  50.614 1.00 28.31 ? 32   TYR D CD1 1 
ATOM   5669 C CD2 . TYR D 1 32  ? 89.526  50.244  52.905 1.00 26.82 ? 32   TYR D CD2 1 
ATOM   5670 C CE1 . TYR D 1 32  ? 90.000  49.314  50.340 1.00 24.43 ? 32   TYR D CE1 1 
ATOM   5671 C CE2 . TYR D 1 32  ? 90.645  49.455  52.646 1.00 24.98 ? 32   TYR D CE2 1 
ATOM   5672 C CZ  . TYR D 1 32  ? 90.877  48.997  51.363 1.00 26.01 ? 32   TYR D CZ  1 
ATOM   5673 O OH  . TYR D 1 32  ? 92.001  48.244  51.102 1.00 30.56 ? 32   TYR D OH  1 
ATOM   5674 N N   . LYS D 1 33  ? 85.068  51.630  54.372 1.00 36.93 ? 33   LYS D N   1 
ATOM   5675 C CA  . LYS D 1 33  ? 83.968  52.294  55.054 1.00 46.98 ? 33   LYS D CA  1 
ATOM   5676 C C   . LYS D 1 33  ? 84.438  53.476  55.902 1.00 50.85 ? 33   LYS D C   1 
ATOM   5677 O O   . LYS D 1 33  ? 85.518  53.444  56.505 1.00 54.58 ? 33   LYS D O   1 
ATOM   5678 C CB  . LYS D 1 33  ? 83.204  51.279  55.916 1.00 49.76 ? 33   LYS D CB  1 
ATOM   5679 C CG  . LYS D 1 33  ? 82.585  50.116  55.129 1.00 54.26 ? 33   LYS D CG  1 
ATOM   5680 C CD  . LYS D 1 33  ? 81.196  50.461  54.579 1.00 62.26 ? 33   LYS D CD  1 
ATOM   5681 C CE  . LYS D 1 33  ? 80.090  49.932  55.489 1.00 62.03 ? 33   LYS D CE  1 
ATOM   5682 N NZ  . LYS D 1 33  ? 79.030  49.211  54.731 1.00 60.42 ? 33   LYS D NZ  1 
ATOM   5683 N N   . ALA D 1 34  ? 83.653  54.549  55.864 1.00 48.59 ? 34   ALA D N   1 
ATOM   5684 C CA  . ALA D 1 34  ? 83.887  55.724  56.696 1.00 51.56 ? 34   ALA D CA  1 
ATOM   5685 C C   . ALA D 1 34  ? 83.159  55.585  58.038 1.00 58.27 ? 34   ALA D C   1 
ATOM   5686 O O   . ALA D 1 34  ? 82.181  54.840  58.147 1.00 58.08 ? 34   ALA D O   1 
ATOM   5687 C CB  . ALA D 1 34  ? 83.400  56.970  55.967 1.00 51.02 ? 34   ALA D CB  1 
ATOM   5688 N N   . GLY D 1 35  ? 83.635  56.305  59.052 1.00 54.98 ? 35   GLY D N   1 
ATOM   5689 C CA  . GLY D 1 35  ? 82.892  56.418  60.296 1.00 52.01 ? 35   GLY D CA  1 
ATOM   5690 C C   . GLY D 1 35  ? 81.625  57.233  60.090 1.00 54.46 ? 35   GLY D C   1 
ATOM   5691 O O   . GLY D 1 35  ? 81.387  57.742  58.990 1.00 50.92 ? 35   GLY D O   1 
ATOM   5692 N N   . PRO D 1 36  ? 80.748  57.313  61.103 1.00 53.46 ? 36   PRO D N   1 
ATOM   5693 C CA  . PRO D 1 36  ? 79.504  58.089  60.970 1.00 53.27 ? 36   PRO D CA  1 
ATOM   5694 C C   . PRO D 1 36  ? 79.709  59.611  60.909 1.00 51.22 ? 36   PRO D C   1 
ATOM   5695 O O   . PRO D 1 36  ? 80.829  60.106  61.049 1.00 50.80 ? 36   PRO D O   1 
ATOM   5696 C CB  . PRO D 1 36  ? 78.687  57.658  62.191 1.00 50.64 ? 36   PRO D CB  1 
ATOM   5697 C CG  . PRO D 1 36  ? 79.246  56.305  62.551 1.00 51.88 ? 36   PRO D CG  1 
ATOM   5698 C CD  . PRO D 1 36  ? 80.720  56.450  62.296 1.00 51.15 ? 36   PRO D CD  1 
ATOM   5699 N N   . ALA D 1 37  ? 78.619  60.335  60.657 1.00 51.36 ? 37   ALA D N   1 
ATOM   5700 C CA  . ALA D 1 37  ? 78.645  61.791  60.499 1.00 49.32 ? 37   ALA D CA  1 
ATOM   5701 C C   . ALA D 1 37  ? 78.799  62.526  61.835 1.00 49.36 ? 37   ALA D C   1 
ATOM   5702 O O   . ALA D 1 37  ? 78.297  62.061  62.865 1.00 47.14 ? 37   ALA D O   1 
ATOM   5703 C CB  . ALA D 1 37  ? 77.372  62.254  59.796 1.00 48.87 ? 37   ALA D CB  1 
ATOM   5704 N N   . PRO D 1 38  ? 79.427  63.722  61.818 1.00 52.96 ? 38   PRO D N   1 
ATOM   5705 C CA  . PRO D 1 38  ? 80.010  64.341  60.622 1.00 52.45 ? 38   PRO D CA  1 
ATOM   5706 C C   . PRO D 1 38  ? 81.509  64.077  60.447 1.00 50.35 ? 38   PRO D C   1 
ATOM   5707 O O   . PRO D 1 38  ? 82.108  64.522  59.468 1.00 55.72 ? 38   PRO D O   1 
ATOM   5708 C CB  . PRO D 1 38  ? 79.715  65.824  60.824 1.00 55.17 ? 38   PRO D CB  1 
ATOM   5709 C CG  . PRO D 1 38  ? 79.789  66.002  62.320 1.00 55.93 ? 38   PRO D CG  1 
ATOM   5710 C CD  . PRO D 1 38  ? 79.456  64.655  62.961 1.00 52.55 ? 38   PRO D CD  1 
ATOM   5711 N N   . ASP D 1 39  ? 82.084  63.298  61.362 1.00 48.39 ? 39   ASP D N   1 
ATOM   5712 C CA  . ASP D 1 39  ? 83.518  62.992  61.367 1.00 50.82 ? 39   ASP D CA  1 
ATOM   5713 C C   . ASP D 1 39  ? 83.906  62.291  60.065 1.00 52.97 ? 39   ASP D C   1 
ATOM   5714 O O   . ASP D 1 39  ? 84.830  62.713  59.368 1.00 53.41 ? 39   ASP D O   1 
ATOM   5715 C CB  . ASP D 1 39  ? 83.886  62.048  62.531 1.00 51.38 ? 39   ASP D CB  1 
ATOM   5716 C CG  . ASP D 1 39  ? 83.182  62.390  63.844 1.00 57.80 ? 39   ASP D CG  1 
ATOM   5717 O OD1 . ASP D 1 39  ? 81.946  62.589  63.852 1.00 55.89 ? 39   ASP D OD1 1 
ATOM   5718 O OD2 . ASP D 1 39  ? 83.852  62.317  64.901 1.00 59.79 ? 39   ASP D OD2 1 
ATOM   5719 N N   . PHE D 1 40  ? 83.175  61.219  59.759 1.00 58.01 ? 40   PHE D N   1 
ATOM   5720 C CA  . PHE D 1 40  ? 83.485  60.301  58.662 1.00 65.34 ? 40   PHE D CA  1 
ATOM   5721 C C   . PHE D 1 40  ? 84.892  59.699  58.732 1.00 62.93 ? 40   PHE D C   1 
ATOM   5722 O O   . PHE D 1 40  ? 85.711  59.892  57.829 1.00 62.46 ? 40   PHE D O   1 
ATOM   5723 C CB  . PHE D 1 40  ? 83.233  60.982  57.311 1.00 68.22 ? 40   PHE D CB  1 
ATOM   5724 C CG  . PHE D 1 40  ? 81.778  61.258  57.045 1.00 77.32 ? 40   PHE D CG  1 
ATOM   5725 C CD1 . PHE D 1 40  ? 80.867  60.207  56.935 1.00 79.23 ? 40   PHE D CD1 1 
ATOM   5726 C CD2 . PHE D 1 40  ? 81.304  62.566  56.994 1.00 79.77 ? 40   PHE D CD2 1 
ATOM   5727 C CE1 . PHE D 1 40  ? 79.504  60.452  56.785 1.00 80.72 ? 40   PHE D CE1 1 
ATOM   5728 C CE2 . PHE D 1 40  ? 79.941  62.823  56.843 1.00 81.81 ? 40   PHE D CE2 1 
ATOM   5729 C CZ  . PHE D 1 40  ? 79.038  61.763  56.740 1.00 80.27 ? 40   PHE D CZ  1 
ATOM   5730 N N   . ASP D 1 41  ? 85.103  58.865  59.753 1.00 61.81 ? 41   ASP D N   1 
ATOM   5731 C CA  . ASP D 1 41  ? 86.411  58.279  60.069 1.00 61.34 ? 41   ASP D CA  1 
ATOM   5732 C C   . ASP D 1 41  ? 86.940  57.397  58.934 1.00 59.06 ? 41   ASP D C   1 
ATOM   5733 O O   . ASP D 1 41  ? 86.402  56.315  58.669 1.00 64.59 ? 41   ASP D O   1 
ATOM   5734 C CB  . ASP D 1 41  ? 86.321  57.458  61.377 1.00 63.43 ? 41   ASP D CB  1 
ATOM   5735 C CG  . ASP D 1 41  ? 87.698  57.020  61.926 1.00 61.85 ? 41   ASP D CG  1 
ATOM   5736 O OD1 . ASP D 1 41  ? 88.747  57.453  61.402 1.00 61.59 ? 41   ASP D OD1 1 
ATOM   5737 O OD2 . ASP D 1 41  ? 87.727  56.243  62.909 1.00 61.55 ? 41   ASP D OD2 1 
ATOM   5738 N N   . PRO D 1 42  ? 88.068  57.806  58.322 1.00 53.47 ? 42   PRO D N   1 
ATOM   5739 C CA  . PRO D 1 42  ? 88.752  57.124  57.214 1.00 48.33 ? 42   PRO D CA  1 
ATOM   5740 C C   . PRO D 1 42  ? 89.565  55.892  57.627 1.00 47.76 ? 42   PRO D C   1 
ATOM   5741 O O   . PRO D 1 42  ? 90.217  55.269  56.786 1.00 48.86 ? 42   PRO D O   1 
ATOM   5742 C CB  . PRO D 1 42  ? 89.680  58.203  56.645 1.00 44.75 ? 42   PRO D CB  1 
ATOM   5743 C CG  . PRO D 1 42  ? 89.340  59.483  57.389 1.00 47.10 ? 42   PRO D CG  1 
ATOM   5744 C CD  . PRO D 1 42  ? 88.762  59.053  58.687 1.00 47.90 ? 42   PRO D CD  1 
ATOM   5745 N N   . SER D 1 43  ? 89.501  55.545  58.914 1.00 43.05 ? 43   SER D N   1 
ATOM   5746 C CA  . SER D 1 43  ? 90.406  54.574  59.536 1.00 38.47 ? 43   SER D CA  1 
ATOM   5747 C C   . SER D 1 43  ? 90.485  53.209  58.854 1.00 36.49 ? 43   SER D C   1 
ATOM   5748 O O   . SER D 1 43  ? 91.542  52.585  58.846 1.00 33.45 ? 43   SER D O   1 
ATOM   5749 C CB  . SER D 1 43  ? 90.042  54.383  61.018 1.00 43.40 ? 43   SER D CB  1 
ATOM   5750 O OG  . SER D 1 43  ? 88.676  54.023  61.196 1.00 40.48 ? 43   SER D OG  1 
ATOM   5751 N N   . ASP D 1 44  ? 89.360  52.733  58.327 1.00 37.51 ? 44   ASP D N   1 
ATOM   5752 C CA  . ASP D 1 44  ? 89.308  51.448  57.638 1.00 36.09 ? 44   ASP D CA  1 
ATOM   5753 C C   . ASP D 1 44  ? 90.373  51.348  56.534 1.00 39.42 ? 44   ASP D C   1 
ATOM   5754 O O   . ASP D 1 44  ? 91.043  50.320  56.408 1.00 37.21 ? 44   ASP D O   1 
ATOM   5755 C CB  . ASP D 1 44  ? 87.906  51.245  57.048 1.00 31.58 ? 44   ASP D CB  1 
ATOM   5756 C CG  . ASP D 1 44  ? 87.643  49.810  56.616 1.00 33.58 ? 44   ASP D CG  1 
ATOM   5757 O OD1 . ASP D 1 44  ? 88.440  48.904  56.947 1.00 31.78 ? 44   ASP D OD1 1 
ATOM   5758 O OD2 . ASP D 1 44  ? 86.613  49.588  55.947 1.00 36.42 ? 44   ASP D OD2 1 
ATOM   5759 N N   . TRP D 1 45  ? 90.549  52.428  55.769 1.00 38.57 ? 45   TRP D N   1 
ATOM   5760 C CA  . TRP D 1 45  ? 91.561  52.475  54.708 1.00 32.54 ? 45   TRP D CA  1 
ATOM   5761 C C   . TRP D 1 45  ? 92.944  52.871  55.214 1.00 34.42 ? 45   TRP D C   1 
ATOM   5762 O O   . TRP D 1 45  ? 93.936  52.220  54.884 1.00 35.13 ? 45   TRP D O   1 
ATOM   5763 C CB  . TRP D 1 45  ? 91.133  53.431  53.583 1.00 32.82 ? 45   TRP D CB  1 
ATOM   5764 C CG  . TRP D 1 45  ? 92.284  54.035  52.759 1.00 29.55 ? 45   TRP D CG  1 
ATOM   5765 C CD1 . TRP D 1 45  ? 92.643  55.357  52.710 1.00 29.91 ? 45   TRP D CD1 1 
ATOM   5766 C CD2 . TRP D 1 45  ? 93.071  53.376  51.746 1.00 26.97 ? 45   TRP D CD2 1 
ATOM   5767 N NE1 . TRP D 1 45  ? 93.566  55.564  51.713 1.00 28.45 ? 45   TRP D NE1 1 
ATOM   5768 C CE2 . TRP D 1 45  ? 93.843  54.370  51.103 1.00 22.92 ? 45   TRP D CE2 1 
ATOM   5769 C CE3 . TRP D 1 45  ? 93.186  52.046  51.313 1.00 28.03 ? 45   TRP D CE3 1 
ATOM   5770 C CZ2 . TRP D 1 45  ? 94.712  54.078  50.043 1.00 23.40 ? 45   TRP D CZ2 1 
ATOM   5771 C CZ3 . TRP D 1 45  ? 94.056  51.759  50.261 1.00 27.50 ? 45   TRP D CZ3 1 
ATOM   5772 C CH2 . TRP D 1 45  ? 94.804  52.772  49.639 1.00 24.98 ? 45   TRP D CH2 1 
ATOM   5773 N N   . THR D 1 46  ? 93.014  53.959  55.977 1.00 32.05 ? 46   THR D N   1 
ATOM   5774 C CA  . THR D 1 46  ? 94.297  54.515  56.402 1.00 32.80 ? 46   THR D CA  1 
ATOM   5775 C C   . THR D 1 46  ? 95.174  53.547  57.197 1.00 35.03 ? 46   THR D C   1 
ATOM   5776 O O   . THR D 1 46  ? 96.397  53.598  57.089 1.00 29.37 ? 46   THR D O   1 
ATOM   5777 C CB  . THR D 1 46  ? 94.112  55.809  57.222 1.00 34.92 ? 46   THR D CB  1 
ATOM   5778 O OG1 . THR D 1 46  ? 92.974  55.681  58.085 1.00 41.29 ? 46   THR D OG1 1 
ATOM   5779 C CG2 . THR D 1 46  ? 93.915  56.999  56.291 1.00 39.86 ? 46   THR D CG2 1 
ATOM   5780 N N   . ASN D 1 47  ? 94.557  52.615  57.924 1.00 44.07 ? 47   ASN D N   1 
ATOM   5781 C CA  . ASN D 1 47  ? 95.320  51.627  58.696 1.00 50.85 ? 47   ASN D CA  1 
ATOM   5782 C C   . ASN D 1 47  ? 95.833  50.471  57.823 1.00 46.99 ? 47   ASN D C   1 
ATOM   5783 O O   . ASN D 1 47  ? 96.536  49.583  58.302 1.00 50.09 ? 47   ASN D O   1 
ATOM   5784 C CB  . ASN D 1 47  ? 94.488  51.108  59.897 1.00 52.28 ? 47   ASN D CB  1 
ATOM   5785 C CG  . ASN D 1 47  ? 93.465  50.047  59.507 1.00 59.20 ? 47   ASN D CG  1 
ATOM   5786 O OD1 . ASN D 1 47  ? 92.496  50.325  58.795 1.00 61.91 ? 47   ASN D OD1 1 
ATOM   5787 N ND2 . ASN D 1 47  ? 93.668  48.825  59.994 1.00 64.07 ? 47   ASN D ND2 1 
ATOM   5788 N N   . GLU D 1 48  ? 95.632  50.602  56.515 1.00 45.34 ? 48   GLU D N   1 
ATOM   5789 C CA  . GLU D 1 48  ? 95.953  49.544  55.574 1.00 44.69 ? 48   GLU D CA  1 
ATOM   5790 C C   . GLU D 1 48  ? 96.642  50.111  54.336 1.00 46.49 ? 48   GLU D C   1 
ATOM   5791 O O   . GLU D 1 48  ? 97.272  49.371  53.578 1.00 50.66 ? 48   GLU D O   1 
ATOM   5792 C CB  . GLU D 1 48  ? 94.677  48.816  55.166 1.00 44.65 ? 48   GLU D CB  1 
ATOM   5793 C CG  . GLU D 1 48  ? 94.818  47.313  55.137 1.00 50.66 ? 48   GLU D CG  1 
ATOM   5794 C CD  . GLU D 1 48  ? 93.482  46.623  55.178 1.00 57.49 ? 48   GLU D CD  1 
ATOM   5795 O OE1 . GLU D 1 48  ? 92.699  46.912  56.109 1.00 58.86 ? 48   GLU D OE1 1 
ATOM   5796 O OE2 . GLU D 1 48  ? 93.197  45.827  54.257 1.00 60.77 ? 48   GLU D OE2 1 
ATOM   5797 N N   . LYS D 1 49  ? 96.560  51.431  54.168 1.00 44.51 ? 49   LYS D N   1 
ATOM   5798 C CA  . LYS D 1 49  ? 97.114  52.129  53.006 1.00 37.73 ? 49   LYS D CA  1 
ATOM   5799 C C   . LYS D 1 49  ? 98.519  51.663  52.612 1.00 38.63 ? 49   LYS D C   1 
ATOM   5800 O O   . LYS D 1 49  ? 98.810  51.497  51.424 1.00 36.17 ? 49   LYS D O   1 
ATOM   5801 C CB  . LYS D 1 49  ? 97.128  53.641  53.270 1.00 38.25 ? 49   LYS D CB  1 
ATOM   5802 C CG  . LYS D 1 49  ? 97.725  54.491  52.147 1.00 43.27 ? 49   LYS D CG  1 
ATOM   5803 C CD  . LYS D 1 49  ? 98.043  55.912  52.606 1.00 46.61 ? 49   LYS D CD  1 
ATOM   5804 C CE  . LYS D 1 49  ? 96.805  56.612  53.164 1.00 50.34 ? 49   LYS D CE  1 
ATOM   5805 N NZ  . LYS D 1 49  ? 97.096  57.925  53.829 1.00 51.89 ? 49   LYS D NZ  1 
ATOM   5806 N N   . GLU D 1 50  ? 99.347  51.353  53.607 1.00 33.93 ? 50   GLU D N   1 
ATOM   5807 C CA  . GLU D 1 50  ? 100.763 51.108  53.364 1.00 37.97 ? 50   GLU D CA  1 
ATOM   5808 C C   . GLU D 1 50  ? 101.166 49.627  53.350 1.00 41.31 ? 50   GLU D C   1 
ATOM   5809 O O   . GLU D 1 50  ? 102.194 49.265  52.765 1.00 45.63 ? 50   GLU D O   1 
ATOM   5810 C CB  . GLU D 1 50  ? 101.591 51.882  54.389 1.00 44.66 ? 50   GLU D CB  1 
ATOM   5811 C CG  . GLU D 1 50  ? 101.162 53.342  54.560 1.00 54.39 ? 50   GLU D CG  1 
ATOM   5812 C CD  . GLU D 1 50  ? 102.033 54.324  53.782 1.00 60.42 ? 50   GLU D CD  1 
ATOM   5813 O OE1 . GLU D 1 50  ? 102.206 54.153  52.549 1.00 62.54 ? 50   GLU D OE1 1 
ATOM   5814 O OE2 . GLU D 1 50  ? 102.533 55.281  54.411 1.00 63.25 ? 50   GLU D OE2 1 
ATOM   5815 N N   . LYS D 1 51  ? 100.318 48.763  53.906 1.00 38.34 ? 51   LYS D N   1 
ATOM   5816 C CA  . LYS D 1 51  ? 100.650 47.347  54.029 1.00 36.70 ? 51   LYS D CA  1 
ATOM   5817 C C   . LYS D 1 51  ? 100.213 46.511  52.826 1.00 36.47 ? 51   LYS D C   1 
ATOM   5818 O O   . LYS D 1 51  ? 100.354 45.282  52.836 1.00 39.79 ? 51   LYS D O   1 
ATOM   5819 C CB  . LYS D 1 51  ? 100.047 46.773  55.318 1.00 42.33 ? 51   LYS D CB  1 
ATOM   5820 C CG  . LYS D 1 51  ? 100.735 47.238  56.597 1.00 51.55 ? 51   LYS D CG  1 
ATOM   5821 C CD  . LYS D 1 51  ? 102.223 46.902  56.576 1.00 57.19 ? 51   LYS D CD  1 
ATOM   5822 C CE  . LYS D 1 51  ? 102.984 47.610  57.697 1.00 62.35 ? 51   LYS D CE  1 
ATOM   5823 N NZ  . LYS D 1 51  ? 104.376 47.986  57.287 1.00 63.53 ? 51   LYS D NZ  1 
ATOM   5824 N N   . LEU D 1 52  ? 99.743  47.176  51.770 1.00 32.77 ? 52   LEU D N   1 
ATOM   5825 C CA  . LEU D 1 52  ? 99.202  46.481  50.598 1.00 23.62 ? 52   LEU D CA  1 
ATOM   5826 C C   . LEU D 1 52  ? 100.264 46.209  49.551 1.00 23.43 ? 52   LEU D C   1 
ATOM   5827 O O   . LEU D 1 52  ? 100.120 45.301  48.750 1.00 25.28 ? 52   LEU D O   1 
ATOM   5828 C CB  . LEU D 1 52  ? 98.055  47.282  49.974 1.00 23.65 ? 52   LEU D CB  1 
ATOM   5829 C CG  . LEU D 1 52  ? 96.764  47.424  50.805 1.00 27.02 ? 52   LEU D CG  1 
ATOM   5830 C CD1 . LEU D 1 52  ? 95.977  48.639  50.353 1.00 21.68 ? 52   LEU D CD1 1 
ATOM   5831 C CD2 . LEU D 1 52  ? 95.907  46.172  50.689 1.00 26.39 ? 52   LEU D CD2 1 
ATOM   5832 N N   . GLY D 1 53  ? 101.364 46.951  49.605 1.00 28.78 ? 53   GLY D N   1 
ATOM   5833 C CA  . GLY D 1 53  ? 102.452 46.710  48.672 1.00 26.34 ? 53   GLY D CA  1 
ATOM   5834 C C   . GLY D 1 53  ? 102.305 47.514  47.395 1.00 22.85 ? 53   GLY D C   1 
ATOM   5835 O O   . GLY D 1 53  ? 102.973 47.246  46.388 1.00 21.09 ? 53   GLY D O   1 
ATOM   5836 N N   . LEU D 1 54  ? 101.447 48.528  47.446 1.00 27.23 ? 54   LEU D N   1 
ATOM   5837 C CA  . LEU D 1 54  ? 101.223 49.412  46.309 1.00 19.81 ? 54   LEU D CA  1 
ATOM   5838 C C   . LEU D 1 54  ? 102.388 50.388  46.158 1.00 23.32 ? 54   LEU D C   1 
ATOM   5839 O O   . LEU D 1 54  ? 102.934 50.871  47.156 1.00 30.52 ? 54   LEU D O   1 
ATOM   5840 C CB  . LEU D 1 54  ? 99.920  50.190  46.505 1.00 17.24 ? 54   LEU D CB  1 
ATOM   5841 C CG  . LEU D 1 54  ? 98.625  49.381  46.598 1.00 2.00  ? 54   LEU D CG  1 
ATOM   5842 C CD1 . LEU D 1 54  ? 97.559  50.222  47.277 1.00 3.39  ? 54   LEU D CD1 1 
ATOM   5843 C CD2 . LEU D 1 54  ? 98.184  48.940  45.207 1.00 4.93  ? 54   LEU D CD2 1 
ATOM   5844 N N   . ASP D 1 55  ? 102.746 50.687  44.910 1.00 17.46 ? 55   ASP D N   1 
ATOM   5845 C CA  . ASP D 1 55  ? 103.814 51.635  44.609 1.00 27.20 ? 55   ASP D CA  1 
ATOM   5846 C C   . ASP D 1 55  ? 103.437 53.035  45.095 1.00 24.40 ? 55   ASP D C   1 
ATOM   5847 O O   . ASP D 1 55  ? 104.222 53.711  45.761 1.00 33.07 ? 55   ASP D O   1 
ATOM   5848 C CB  . ASP D 1 55  ? 104.076 51.680  43.093 1.00 34.70 ? 55   ASP D CB  1 
ATOM   5849 C CG  . ASP D 1 55  ? 104.903 50.499  42.592 1.00 40.78 ? 55   ASP D CG  1 
ATOM   5850 O OD1 . ASP D 1 55  ? 106.086 50.377  42.979 1.00 42.25 ? 55   ASP D OD1 1 
ATOM   5851 O OD2 . ASP D 1 55  ? 104.376 49.711  41.774 1.00 51.05 ? 55   ASP D OD2 1 
ATOM   5852 N N   . PHE D 1 56  ? 102.254 53.481  44.688 1.00 23.62 ? 56   PHE D N   1 
ATOM   5853 C CA  . PHE D 1 56  ? 101.724 54.785  45.075 1.00 18.82 ? 56   PHE D CA  1 
ATOM   5854 C C   . PHE D 1 56  ? 100.314 54.583  45.610 1.00 17.85 ? 56   PHE D C   1 
ATOM   5855 O O   . PHE D 1 56  ? 99.335  54.721  44.867 1.00 16.64 ? 56   PHE D O   1 
ATOM   5856 C CB  . PHE D 1 56  ? 101.629 55.736  43.869 1.00 16.40 ? 56   PHE D CB  1 
ATOM   5857 C CG  . PHE D 1 56  ? 102.917 55.923  43.122 1.00 6.99  ? 56   PHE D CG  1 
ATOM   5858 C CD1 . PHE D 1 56  ? 103.944 56.679  43.664 1.00 6.04  ? 56   PHE D CD1 1 
ATOM   5859 C CD2 . PHE D 1 56  ? 103.118 55.301  41.897 1.00 4.10  ? 56   PHE D CD2 1 
ATOM   5860 C CE1 . PHE D 1 56  ? 105.154 56.798  43.003 1.00 15.04 ? 56   PHE D CE1 1 
ATOM   5861 C CE2 . PHE D 1 56  ? 104.323 55.413  41.234 1.00 6.74  ? 56   PHE D CE2 1 
ATOM   5862 C CZ  . PHE D 1 56  ? 105.346 56.160  41.790 1.00 10.90 ? 56   PHE D CZ  1 
ATOM   5863 N N   . PRO D 1 57  ? 100.190 54.246  46.902 1.00 17.14 ? 57   PRO D N   1 
ATOM   5864 C CA  . PRO D 1 57  ? 98.907  53.851  47.487 1.00 19.40 ? 57   PRO D CA  1 
ATOM   5865 C C   . PRO D 1 57  ? 97.797  54.871  47.265 1.00 18.07 ? 57   PRO D C   1 
ATOM   5866 O O   . PRO D 1 57  ? 97.999  56.079  47.429 1.00 20.03 ? 57   PRO D O   1 
ATOM   5867 C CB  . PRO D 1 57  ? 99.240  53.670  48.966 1.00 24.78 ? 57   PRO D CB  1 
ATOM   5868 C CG  . PRO D 1 57  ? 100.688 53.299  48.968 1.00 24.76 ? 57   PRO D CG  1 
ATOM   5869 C CD  . PRO D 1 57  ? 101.269 54.191  47.903 1.00 18.78 ? 57   PRO D CD  1 
ATOM   5870 N N   . ASN D 1 58  ? 96.628  54.363  46.885 1.00 20.55 ? 58   ASN D N   1 
ATOM   5871 C CA  . ASN D 1 58  ? 95.522  55.191  46.431 1.00 19.07 ? 58   ASN D CA  1 
ATOM   5872 C C   . ASN D 1 58  ? 94.267  54.338  46.273 1.00 17.37 ? 58   ASN D C   1 
ATOM   5873 O O   . ASN D 1 58  ? 94.327  53.109  46.328 1.00 12.71 ? 58   ASN D O   1 
ATOM   5874 C CB  . ASN D 1 58  ? 95.876  55.811  45.085 1.00 22.25 ? 58   ASN D CB  1 
ATOM   5875 C CG  . ASN D 1 58  ? 95.363  57.214  44.937 1.00 23.57 ? 58   ASN D CG  1 
ATOM   5876 O OD1 . ASN D 1 58  ? 95.546  57.838  43.892 1.00 32.90 ? 58   ASN D OD1 1 
ATOM   5877 N ND2 . ASN D 1 58  ? 94.712  57.727  45.976 1.00 25.22 ? 58   ASN D ND2 1 
ATOM   5878 N N   . LEU D 1 59  ? 93.139  54.990  46.014 1.00 16.54 ? 59   LEU D N   1 
ATOM   5879 C CA  . LEU D 1 59  ? 91.908  54.276  45.701 1.00 11.75 ? 59   LEU D CA  1 
ATOM   5880 C C   . LEU D 1 59  ? 91.255  54.892  44.480 1.00 19.13 ? 59   LEU D C   1 
ATOM   5881 O O   . LEU D 1 59  ? 90.974  56.089  44.466 1.00 22.56 ? 59   LEU D O   1 
ATOM   5882 C CB  . LEU D 1 59  ? 90.946  54.334  46.881 1.00 8.41  ? 59   LEU D CB  1 
ATOM   5883 C CG  . LEU D 1 59  ? 91.323  53.450  48.066 1.00 11.50 ? 59   LEU D CG  1 
ATOM   5884 C CD1 . LEU D 1 59  ? 90.535  53.856  49.269 1.00 3.94  ? 59   LEU D CD1 1 
ATOM   5885 C CD2 . LEU D 1 59  ? 91.065  51.997  47.725 1.00 14.05 ? 59   LEU D CD2 1 
ATOM   5886 N N   . PRO D 1 60  ? 90.949  54.073  43.458 1.00 23.00 ? 60   PRO D N   1 
ATOM   5887 C CA  . PRO D 1 60  ? 90.912  52.604  43.493 1.00 22.04 ? 60   PRO D CA  1 
ATOM   5888 C C   . PRO D 1 60  ? 92.269  51.934  43.352 1.00 19.86 ? 60   PRO D C   1 
ATOM   5889 O O   . PRO D 1 60  ? 93.215  52.518  42.826 1.00 20.34 ? 60   PRO D O   1 
ATOM   5890 C CB  . PRO D 1 60  ? 90.014  52.244  42.312 1.00 17.33 ? 60   PRO D CB  1 
ATOM   5891 C CG  . PRO D 1 60  ? 90.247  53.338  41.345 1.00 25.49 ? 60   PRO D CG  1 
ATOM   5892 C CD  . PRO D 1 60  ? 90.428  54.592  42.180 1.00 24.09 ? 60   PRO D CD  1 
ATOM   5893 N N   . TYR D 1 61  ? 92.351  50.698  43.831 1.00 16.28 ? 61   TYR D N   1 
ATOM   5894 C CA  . TYR D 1 61  ? 93.478  49.839  43.516 1.00 14.09 ? 61   TYR D CA  1 
ATOM   5895 C C   . TYR D 1 61  ? 92.961  48.548  42.912 1.00 12.65 ? 61   TYR D C   1 
ATOM   5896 O O   . TYR D 1 61  ? 91.799  48.198  43.080 1.00 19.89 ? 61   TYR D O   1 
ATOM   5897 C CB  . TYR D 1 61  ? 94.328  49.556  44.768 1.00 11.33 ? 61   TYR D CB  1 
ATOM   5898 C CG  . TYR D 1 61  ? 93.714  48.651  45.824 1.00 12.74 ? 61   TYR D CG  1 
ATOM   5899 C CD1 . TYR D 1 61  ? 93.470  47.297  45.561 1.00 13.91 ? 61   TYR D CD1 1 
ATOM   5900 C CD2 . TYR D 1 61  ? 93.547  49.103  47.137 1.00 13.91 ? 61   TYR D CD2 1 
ATOM   5901 C CE1 . TYR D 1 61  ? 93.094  46.416  46.575 1.00 13.35 ? 61   TYR D CE1 1 
ATOM   5902 C CE2 . TYR D 1 61  ? 93.178  48.224  48.169 1.00 15.50 ? 61   TYR D CE2 1 
ATOM   5903 C CZ  . TYR D 1 61  ? 92.967  46.881  47.878 1.00 19.15 ? 61   TYR D CZ  1 
ATOM   5904 O OH  . TYR D 1 61  ? 92.756  45.983  48.899 1.00 25.04 ? 61   TYR D OH  1 
ATOM   5905 N N   . LEU D 1 62  ? 93.809  47.861  42.168 1.00 14.21 ? 62   LEU D N   1 
ATOM   5906 C CA  . LEU D 1 62  ? 93.453  46.552  41.692 1.00 15.43 ? 62   LEU D CA  1 
ATOM   5907 C C   . LEU D 1 62  ? 94.637  45.643  41.913 1.00 17.70 ? 62   LEU D C   1 
ATOM   5908 O O   . LEU D 1 62  ? 95.780  46.052  41.753 1.00 17.61 ? 62   LEU D O   1 
ATOM   5909 C CB  . LEU D 1 62  ? 93.090  46.616  40.216 1.00 11.00 ? 62   LEU D CB  1 
ATOM   5910 C CG  . LEU D 1 62  ? 92.642  45.292  39.617 1.00 12.71 ? 62   LEU D CG  1 
ATOM   5911 C CD1 . LEU D 1 62  ? 91.131  45.170  39.695 1.00 21.04 ? 62   LEU D CD1 1 
ATOM   5912 C CD2 . LEU D 1 62  ? 93.120  45.203  38.200 1.00 9.72  ? 62   LEU D CD2 1 
ATOM   5913 N N   . ILE D 1 63  ? 94.357  44.441  42.391 1.00 22.75 ? 63   ILE D N   1 
ATOM   5914 C CA  . ILE D 1 63  ? 95.393  43.458  42.599 1.00 23.00 ? 63   ILE D CA  1 
ATOM   5915 C C   . ILE D 1 63  ? 95.078  42.208  41.801 1.00 23.74 ? 63   ILE D C   1 
ATOM   5916 O O   . ILE D 1 63  ? 94.019  41.611  41.975 1.00 27.25 ? 63   ILE D O   1 
ATOM   5917 C CB  . ILE D 1 63  ? 95.501  43.128  44.076 1.00 26.99 ? 63   ILE D CB  1 
ATOM   5918 C CG1 . ILE D 1 63  ? 95.885  44.393  44.845 1.00 26.12 ? 63   ILE D CG1 1 
ATOM   5919 C CG2 . ILE D 1 63  ? 96.497  42.004  44.290 1.00 27.79 ? 63   ILE D CG2 1 
ATOM   5920 C CD1 . ILE D 1 63  ? 95.626  44.309  46.329 1.00 26.50 ? 63   ILE D CD1 1 
ATOM   5921 N N   . ASP D 1 64  ? 95.944  41.902  40.837 1.00 23.47 ? 64   ASP D N   1 
ATOM   5922 C CA  . ASP D 1 64  ? 95.837  40.676  40.059 1.00 28.33 ? 64   ASP D CA  1 
ATOM   5923 C C   . ASP D 1 64  ? 97.108  39.845  40.188 1.00 25.94 ? 64   ASP D C   1 
ATOM   5924 O O   . ASP D 1 64  ? 97.980  39.870  39.319 1.00 22.44 ? 64   ASP D O   1 
ATOM   5925 C CB  . ASP D 1 64  ? 95.577  41.006  38.593 1.00 30.81 ? 64   ASP D CB  1 
ATOM   5926 C CG  . ASP D 1 64  ? 95.502  39.768  37.726 1.00 40.60 ? 64   ASP D CG  1 
ATOM   5927 O OD1 . ASP D 1 64  ? 95.174  38.684  38.262 1.00 44.80 ? 64   ASP D OD1 1 
ATOM   5928 O OD2 . ASP D 1 64  ? 95.803  39.868  36.516 1.00 48.32 ? 64   ASP D OD2 1 
ATOM   5929 N N   . GLY D 1 65  ? 97.204  39.107  41.289 1.00 26.87 ? 65   GLY D N   1 
ATOM   5930 C CA  . GLY D 1 65  ? 98.415  38.359  41.571 1.00 27.36 ? 65   GLY D CA  1 
ATOM   5931 C C   . GLY D 1 65  ? 99.519  39.265  42.074 1.00 33.82 ? 65   GLY D C   1 
ATOM   5932 O O   . GLY D 1 65  ? 99.406  39.858  43.157 1.00 29.10 ? 65   GLY D O   1 
ATOM   5933 N N   . ASP D 1 66  ? 100.559 39.414  41.258 1.00 33.47 ? 66   ASP D N   1 
ATOM   5934 C CA  . ASP D 1 66  ? 101.719 40.233  41.602 1.00 37.01 ? 66   ASP D CA  1 
ATOM   5935 C C   . ASP D 1 66  ? 101.626 41.605  40.939 1.00 33.96 ? 66   ASP D C   1 
ATOM   5936 O O   . ASP D 1 66  ? 102.466 42.479  41.166 1.00 33.26 ? 66   ASP D O   1 
ATOM   5937 C CB  . ASP D 1 66  ? 103.009 39.526  41.171 1.00 37.96 ? 66   ASP D CB  1 
ATOM   5938 C CG  . ASP D 1 66  ? 102.978 39.085  39.715 1.00 50.82 ? 66   ASP D CG  1 
ATOM   5939 O OD1 . ASP D 1 66  ? 102.230 38.134  39.390 1.00 54.52 ? 66   ASP D OD1 1 
ATOM   5940 O OD2 . ASP D 1 66  ? 103.689 39.701  38.889 1.00 60.24 ? 66   ASP D OD2 1 
ATOM   5941 N N   . VAL D 1 67  ? 100.630 41.764  40.071 1.00 32.46 ? 67   VAL D N   1 
ATOM   5942 C CA  . VAL D 1 67  ? 100.332 43.053  39.463 1.00 22.34 ? 67   VAL D CA  1 
ATOM   5943 C C   . VAL D 1 67  ? 99.458  43.829  40.439 1.00 25.60 ? 67   VAL D C   1 
ATOM   5944 O O   . VAL D 1 67  ? 98.358  43.393  40.774 1.00 28.00 ? 67   VAL D O   1 
ATOM   5945 C CB  . VAL D 1 67  ? 99.581  42.882  38.120 1.00 18.07 ? 67   VAL D CB  1 
ATOM   5946 C CG1 . VAL D 1 67  ? 99.195  44.234  37.559 1.00 17.52 ? 67   VAL D CG1 1 
ATOM   5947 C CG2 . VAL D 1 67  ? 100.453 42.138  37.127 1.00 24.32 ? 67   VAL D CG2 1 
ATOM   5948 N N   . LYS D 1 68  ? 100.009 44.908  40.990 1.00 23.17 ? 68   LYS D N   1 
ATOM   5949 C CA  . LYS D 1 68  ? 99.294  45.725  41.967 1.00 19.96 ? 68   LYS D CA  1 
ATOM   5950 C C   . LYS D 1 68  ? 99.281  47.172  41.512 1.00 18.05 ? 68   LYS D C   1 
ATOM   5951 O O   . LYS D 1 68  ? 100.312 47.847  41.543 1.00 23.24 ? 68   LYS D O   1 
ATOM   5952 C CB  . LYS D 1 68  ? 99.953  45.642  43.347 1.00 20.01 ? 68   LYS D CB  1 
ATOM   5953 C CG  . LYS D 1 68  ? 100.594 44.303  43.674 1.00 23.24 ? 68   LYS D CG  1 
ATOM   5954 C CD  . LYS D 1 68  ? 99.935  43.603  44.862 1.00 27.67 ? 68   LYS D CD  1 
ATOM   5955 C CE  . LYS D 1 68  ? 100.448 44.127  46.198 1.00 28.24 ? 68   LYS D CE  1 
ATOM   5956 N NZ  . LYS D 1 68  ? 100.363 43.110  47.295 1.00 34.65 ? 68   LYS D NZ  1 
ATOM   5957 N N   . LEU D 1 69  ? 98.109  47.650  41.109 1.00 16.95 ? 69   LEU D N   1 
ATOM   5958 C CA  . LEU D 1 69  ? 98.000  48.947  40.446 1.00 9.55  ? 69   LEU D CA  1 
ATOM   5959 C C   . LEU D 1 69  ? 97.125  49.960  41.181 1.00 10.51 ? 69   LEU D C   1 
ATOM   5960 O O   . LEU D 1 69  ? 96.215  49.599  41.926 1.00 19.54 ? 69   LEU D O   1 
ATOM   5961 C CB  . LEU D 1 69  ? 97.475  48.785  39.017 1.00 2.66  ? 69   LEU D CB  1 
ATOM   5962 C CG  . LEU D 1 69  ? 98.219  47.883  38.029 1.00 6.45  ? 69   LEU D CG  1 
ATOM   5963 C CD1 . LEU D 1 69  ? 97.275  47.512  36.920 1.00 7.85  ? 69   LEU D CD1 1 
ATOM   5964 C CD2 . LEU D 1 69  ? 99.433  48.580  37.452 1.00 11.81 ? 69   LEU D CD2 1 
ATOM   5965 N N   . THR D 1 70  ? 97.456  51.233  40.981 1.00 12.60 ? 70   THR D N   1 
ATOM   5966 C CA  . THR D 1 70  ? 96.680  52.364  41.473 1.00 15.51 ? 70   THR D CA  1 
ATOM   5967 C C   . THR D 1 70  ? 96.367  53.256  40.258 1.00 18.22 ? 70   THR D C   1 
ATOM   5968 O O   . THR D 1 70  ? 96.868  53.003  39.160 1.00 11.31 ? 70   THR D O   1 
ATOM   5969 C CB  . THR D 1 70  ? 97.479  53.171  42.571 1.00 13.48 ? 70   THR D CB  1 
ATOM   5970 O OG1 . THR D 1 70  ? 98.872  52.824  42.538 1.00 20.92 ? 70   THR D OG1 1 
ATOM   5971 C CG2 . THR D 1 70  ? 96.966  52.840  43.947 1.00 12.51 ? 70   THR D CG2 1 
ATOM   5972 N N   . GLN D 1 71  ? 95.505  54.255  40.450 1.00 18.47 ? 71   GLN D N   1 
ATOM   5973 C CA  . GLN D 1 71  ? 95.017  55.139  39.378 1.00 13.89 ? 71   GLN D CA  1 
ATOM   5974 C C   . GLN D 1 71  ? 93.987  54.486  38.455 1.00 10.78 ? 71   GLN D C   1 
ATOM   5975 O O   . GLN D 1 71  ? 94.297  53.550  37.728 1.00 16.47 ? 71   GLN D O   1 
ATOM   5976 C CB  . GLN D 1 71  ? 96.173  55.717  38.547 1.00 10.90 ? 71   GLN D CB  1 
ATOM   5977 C CG  . GLN D 1 71  ? 97.260  56.436  39.351 1.00 4.38  ? 71   GLN D CG  1 
ATOM   5978 C CD  . GLN D 1 71  ? 96.755  57.665  40.089 1.00 7.93  ? 71   GLN D CD  1 
ATOM   5979 O OE1 . GLN D 1 71  ? 96.060  58.505  39.522 1.00 13.05 ? 71   GLN D OE1 1 
ATOM   5980 N NE2 . GLN D 1 71  ? 97.115  57.775  41.366 1.00 11.14 ? 71   GLN D NE2 1 
ATOM   5981 N N   . SER D 1 72  ? 92.788  55.065  38.422 1.00 14.59 ? 72   SER D N   1 
ATOM   5982 C CA  . SER D 1 72  ? 91.646  54.510  37.696 1.00 8.25  ? 72   SER D CA  1 
ATOM   5983 C C   . SER D 1 72  ? 91.912  54.289  36.211 1.00 10.97 ? 72   SER D C   1 
ATOM   5984 O O   . SER D 1 72  ? 91.536  53.255  35.661 1.00 11.63 ? 72   SER D O   1 
ATOM   5985 C CB  . SER D 1 72  ? 90.424  55.421  37.861 1.00 12.52 ? 72   SER D CB  1 
ATOM   5986 O OG  . SER D 1 72  ? 90.422  56.497  36.929 1.00 17.94 ? 72   SER D OG  1 
ATOM   5987 N N   . ASN D 1 73  ? 92.499  55.291  35.561 1.00 12.19 ? 73   ASN D N   1 
ATOM   5988 C CA  . ASN D 1 73  ? 92.803  55.221  34.137 1.00 13.61 ? 73   ASN D CA  1 
ATOM   5989 C C   . ASN D 1 73  ? 93.763  54.078  33.853 1.00 16.69 ? 73   ASN D C   1 
ATOM   5990 O O   . ASN D 1 73  ? 93.584  53.328  32.895 1.00 23.03 ? 73   ASN D O   1 
ATOM   5991 C CB  . ASN D 1 73  ? 93.430  56.532  33.672 1.00 18.76 ? 73   ASN D CB  1 
ATOM   5992 C CG  . ASN D 1 73  ? 92.414  57.623  33.474 1.00 20.09 ? 73   ASN D CG  1 
ATOM   5993 O OD1 . ASN D 1 73  ? 91.280  57.371  33.082 1.00 20.98 ? 73   ASN D OD1 1 
ATOM   5994 N ND2 . ASN D 1 73  ? 92.818  58.853  33.745 1.00 30.60 ? 73   ASN D ND2 1 
ATOM   5995 N N   . ALA D 1 74  ? 94.766  53.940  34.713 1.00 12.18 ? 74   ALA D N   1 
ATOM   5996 C CA  . ALA D 1 74  ? 95.786  52.912  34.556 1.00 12.26 ? 74   ALA D CA  1 
ATOM   5997 C C   . ALA D 1 74  ? 95.205  51.519  34.770 1.00 14.61 ? 74   ALA D C   1 
ATOM   5998 O O   . ALA D 1 74  ? 95.620  50.544  34.134 1.00 14.35 ? 74   ALA D O   1 
ATOM   5999 C CB  . ALA D 1 74  ? 96.915  53.155  35.531 1.00 17.02 ? 74   ALA D CB  1 
ATOM   6000 N N   . ILE D 1 75  ? 94.240  51.436  35.677 1.00 18.12 ? 75   ILE D N   1 
ATOM   6001 C CA  . ILE D 1 75  ? 93.577  50.177  35.975 1.00 19.21 ? 75   ILE D CA  1 
ATOM   6002 C C   . ILE D 1 75  ? 92.754  49.757  34.770 1.00 19.26 ? 75   ILE D C   1 
ATOM   6003 O O   . ILE D 1 75  ? 92.861  48.629  34.306 1.00 31.02 ? 75   ILE D O   1 
ATOM   6004 C CB  . ILE D 1 75  ? 92.668  50.313  37.223 1.00 15.12 ? 75   ILE D CB  1 
ATOM   6005 C CG1 . ILE D 1 75  ? 93.542  50.387  38.478 1.00 9.10  ? 75   ILE D CG1 1 
ATOM   6006 C CG2 . ILE D 1 75  ? 91.678  49.150  37.299 1.00 16.04 ? 75   ILE D CG2 1 
ATOM   6007 C CD1 . ILE D 1 75  ? 92.868  50.993  39.679 1.00 21.10 ? 75   ILE D CD1 1 
ATOM   6008 N N   . LEU D 1 76  ? 92.069  50.730  34.180 1.00 22.96 ? 76   LEU D N   1 
ATOM   6009 C CA  . LEU D 1 76  ? 91.197  50.507  33.030 1.00 22.41 ? 76   LEU D CA  1 
ATOM   6010 C C   . LEU D 1 76  ? 91.982  50.037  31.819 1.00 20.75 ? 76   LEU D C   1 
ATOM   6011 O O   . LEU D 1 76  ? 91.579  49.082  31.147 1.00 13.84 ? 76   LEU D O   1 
ATOM   6012 C CB  . LEU D 1 76  ? 90.441  51.798  32.691 1.00 23.53 ? 76   LEU D CB  1 
ATOM   6013 C CG  . LEU D 1 76  ? 89.364  52.200  33.705 1.00 27.92 ? 76   LEU D CG  1 
ATOM   6014 C CD1 . LEU D 1 76  ? 89.074  53.671  33.597 1.00 23.58 ? 76   LEU D CD1 1 
ATOM   6015 C CD2 . LEU D 1 76  ? 88.102  51.389  33.464 1.00 20.82 ? 76   LEU D CD2 1 
ATOM   6016 N N   . ARG D 1 77  ? 93.138  50.661  31.591 1.00 18.79 ? 77   ARG D N   1 
ATOM   6017 C CA  . ARG D 1 77  ? 93.979  50.311  30.447 1.00 20.54 ? 77   ARG D CA  1 
ATOM   6018 C C   . ARG D 1 77  ? 94.608  48.917  30.594 1.00 19.35 ? 77   ARG D C   1 
ATOM   6019 O O   . ARG D 1 77  ? 94.842  48.231  29.599 1.00 22.95 ? 77   ARG D O   1 
ATOM   6020 C CB  . ARG D 1 77  ? 95.075  51.355  30.236 1.00 15.17 ? 77   ARG D CB  1 
ATOM   6021 C CG  . ARG D 1 77  ? 94.588  52.735  29.871 1.00 9.67  ? 77   ARG D CG  1 
ATOM   6022 C CD  . ARG D 1 77  ? 95.767  53.678  29.845 1.00 2.00  ? 77   ARG D CD  1 
ATOM   6023 N NE  . ARG D 1 77  ? 95.540  54.861  29.017 1.00 16.85 ? 77   ARG D NE  1 
ATOM   6024 C CZ  . ARG D 1 77  ? 95.896  54.971  27.738 1.00 15.73 ? 77   ARG D CZ  1 
ATOM   6025 N NH1 . ARG D 1 77  ? 96.468  53.953  27.104 1.00 17.34 ? 77   ARG D NH1 1 
ATOM   6026 N NH2 . ARG D 1 77  ? 95.684  56.104  27.088 1.00 5.50  ? 77   ARG D NH2 1 
ATOM   6027 N N   . TYR D 1 78  ? 94.822  48.475  31.830 1.00 16.75 ? 78   TYR D N   1 
ATOM   6028 C CA  . TYR D 1 78  ? 95.380  47.152  32.066 1.00 9.92  ? 78   TYR D CA  1 
ATOM   6029 C C   . TYR D 1 78  ? 94.397  46.044  31.699 1.00 18.72 ? 78   TYR D C   1 
ATOM   6030 O O   . TYR D 1 78  ? 94.791  45.046  31.093 1.00 22.67 ? 78   TYR D O   1 
ATOM   6031 C CB  . TYR D 1 78  ? 95.792  47.017  33.527 1.00 19.93 ? 78   TYR D CB  1 
ATOM   6032 C CG  . TYR D 1 78  ? 96.158  45.613  33.964 1.00 16.05 ? 78   TYR D CG  1 
ATOM   6033 C CD1 . TYR D 1 78  ? 97.444  45.115  33.763 1.00 10.90 ? 78   TYR D CD1 1 
ATOM   6034 C CD2 . TYR D 1 78  ? 95.251  44.827  34.680 1.00 17.12 ? 78   TYR D CD2 1 
ATOM   6035 C CE1 . TYR D 1 78  ? 97.821  43.886  34.269 1.00 15.00 ? 78   TYR D CE1 1 
ATOM   6036 C CE2 . TYR D 1 78  ? 95.622  43.592  35.193 1.00 20.43 ? 78   TYR D CE2 1 
ATOM   6037 C CZ  . TYR D 1 78  ? 96.912  43.128  34.985 1.00 17.35 ? 78   TYR D CZ  1 
ATOM   6038 O OH  . TYR D 1 78  ? 97.298  41.912  35.506 1.00 17.80 ? 78   TYR D OH  1 
ATOM   6039 N N   . ILE D 1 79  ? 93.133  46.190  32.096 1.00 17.50 ? 79   ILE D N   1 
ATOM   6040 C CA  . ILE D 1 79  ? 92.138  45.182  31.743 1.00 17.74 ? 79   ILE D CA  1 
ATOM   6041 C C   . ILE D 1 79  ? 91.808  45.271  30.259 1.00 18.18 ? 79   ILE D C   1 
ATOM   6042 O O   . ILE D 1 79  ? 91.596  44.252  29.609 1.00 21.35 ? 79   ILE D O   1 
ATOM   6043 C CB  . ILE D 1 79  ? 90.832  45.310  32.559 1.00 21.40 ? 79   ILE D CB  1 
ATOM   6044 C CG1 . ILE D 1 79  ? 91.143  45.375  34.057 1.00 25.64 ? 79   ILE D CG1 1 
ATOM   6045 C CG2 . ILE D 1 79  ? 89.942  44.089  32.299 1.00 19.58 ? 79   ILE D CG2 1 
ATOM   6046 C CD1 . ILE D 1 79  ? 89.968  45.817  34.899 1.00 26.75 ? 79   ILE D CD1 1 
ATOM   6047 N N   . ALA D 1 80  ? 91.845  46.484  29.715 1.00 14.40 ? 80   ALA D N   1 
ATOM   6048 C CA  . ALA D 1 80  ? 91.632  46.687  28.290 1.00 16.65 ? 80   ALA D CA  1 
ATOM   6049 C C   . ALA D 1 80  ? 92.675  45.959  27.452 1.00 23.79 ? 80   ALA D C   1 
ATOM   6050 O O   . ALA D 1 80  ? 92.330  45.345  26.446 1.00 30.89 ? 80   ALA D O   1 
ATOM   6051 C CB  . ALA D 1 80  ? 91.650  48.160  27.960 1.00 19.38 ? 80   ALA D CB  1 
ATOM   6052 N N   . ARG D 1 81  ? 93.941  46.007  27.871 1.00 18.31 ? 81   ARG D N   1 
ATOM   6053 C CA  . ARG D 1 81  ? 95.026  45.364  27.120 1.00 10.56 ? 81   ARG D CA  1 
ATOM   6054 C C   . ARG D 1 81  ? 94.855  43.843  27.075 1.00 19.83 ? 81   ARG D C   1 
ATOM   6055 O O   . ARG D 1 81  ? 95.045  43.219  26.027 1.00 27.45 ? 81   ARG D O   1 
ATOM   6056 C CB  . ARG D 1 81  ? 96.399  45.721  27.712 1.00 7.63  ? 81   ARG D CB  1 
ATOM   6057 C CG  . ARG D 1 81  ? 97.028  46.985  27.116 1.00 2.72  ? 81   ARG D CG  1 
ATOM   6058 C CD  . ARG D 1 81  ? 98.398  47.318  27.735 1.00 5.90  ? 81   ARG D CD  1 
ATOM   6059 N NE  . ARG D 1 81  ? 98.338  48.423  28.700 1.00 7.50  ? 81   ARG D NE  1 
ATOM   6060 C CZ  . ARG D 1 81  ? 98.640  48.303  29.990 1.00 10.36 ? 81   ARG D CZ  1 
ATOM   6061 N NH1 . ARG D 1 81  ? 99.155  47.177  30.450 1.00 14.66 ? 81   ARG D NH1 1 
ATOM   6062 N NH2 . ARG D 1 81  ? 98.408  49.292  30.831 1.00 11.12 ? 81   ARG D NH2 1 
ATOM   6063 N N   . LYS D 1 82  ? 94.375  43.269  28.176 1.00 26.40 ? 82   LYS D N   1 
ATOM   6064 C CA  . LYS D 1 82  ? 94.166  41.824  28.266 1.00 28.42 ? 82   LYS D CA  1 
ATOM   6065 C C   . LYS D 1 82  ? 93.038  41.351  27.356 1.00 25.07 ? 82   LYS D C   1 
ATOM   6066 O O   . LYS D 1 82  ? 92.863  40.152  27.156 1.00 34.46 ? 82   LYS D O   1 
ATOM   6067 C CB  . LYS D 1 82  ? 93.854  41.418  29.716 1.00 31.26 ? 82   LYS D CB  1 
ATOM   6068 C CG  . LYS D 1 82  ? 95.039  40.861  30.497 1.00 36.49 ? 82   LYS D CG  1 
ATOM   6069 C CD  . LYS D 1 82  ? 96.010  41.960  30.900 1.00 47.86 ? 82   LYS D CD  1 
ATOM   6070 C CE  . LYS D 1 82  ? 97.190  41.399  31.680 1.00 48.63 ? 82   LYS D CE  1 
ATOM   6071 N NZ  . LYS D 1 82  ? 98.102  40.624  30.802 1.00 43.76 ? 82   LYS D NZ  1 
ATOM   6072 N N   . HIS D 1 83  ? 92.241  42.287  26.854 1.00 21.45 ? 83   HIS D N   1 
ATOM   6073 C CA  . HIS D 1 83  ? 91.038  41.937  26.118 1.00 15.44 ? 83   HIS D CA  1 
ATOM   6074 C C   . HIS D 1 83  ? 90.896  42.768  24.847 1.00 20.08 ? 83   HIS D C   1 
ATOM   6075 O O   . HIS D 1 83  ? 89.809  42.886  24.278 1.00 24.22 ? 83   HIS D O   1 
ATOM   6076 C CB  . HIS D 1 83  ? 89.804  42.104  27.016 1.00 15.18 ? 83   HIS D CB  1 
ATOM   6077 C CG  . HIS D 1 83  ? 89.848  41.276  28.268 1.00 21.47 ? 83   HIS D CG  1 
ATOM   6078 N ND1 . HIS D 1 83  ? 89.298  40.017  28.348 1.00 18.93 ? 83   HIS D ND1 1 
ATOM   6079 C CD2 . HIS D 1 83  ? 90.332  41.555  29.504 1.00 19.04 ? 83   HIS D CD2 1 
ATOM   6080 C CE1 . HIS D 1 83  ? 89.434  39.554  29.579 1.00 22.79 ? 83   HIS D CE1 1 
ATOM   6081 N NE2 . HIS D 1 83  ? 90.058  40.469  30.301 1.00 18.14 ? 83   HIS D NE2 1 
ATOM   6082 N N   . ASN D 1 84  ? 92.005  43.356  24.418 1.00 26.06 ? 84   ASN D N   1 
ATOM   6083 C CA  . ASN D 1 84  ? 92.071  44.071  23.150 1.00 34.58 ? 84   ASN D CA  1 
ATOM   6084 C C   . ASN D 1 84  ? 91.007  45.150  22.974 1.00 29.14 ? 84   ASN D C   1 
ATOM   6085 O O   . ASN D 1 84  ? 90.427  45.304  21.905 1.00 39.00 ? 84   ASN D O   1 
ATOM   6086 C CB  . ASN D 1 84  ? 92.006  43.078  21.997 1.00 39.21 ? 84   ASN D CB  1 
ATOM   6087 C CG  . ASN D 1 84  ? 93.025  43.382  20.933 1.00 51.02 ? 84   ASN D CG  1 
ATOM   6088 O OD1 . ASN D 1 84  ? 94.087  42.758  20.882 1.00 59.56 ? 84   ASN D OD1 1 
ATOM   6089 N ND2 . ASN D 1 84  ? 92.777  44.440  20.167 1.00 51.84 ? 84   ASN D ND2 1 
ATOM   6090 N N   . MET D 1 85  ? 90.744  45.883  24.043 1.00 21.86 ? 85   MET D N   1 
ATOM   6091 C CA  . MET D 1 85  ? 89.779  46.960  24.008 1.00 19.48 ? 85   MET D CA  1 
ATOM   6092 C C   . MET D 1 85  ? 90.477  48.304  24.107 1.00 28.25 ? 85   MET D C   1 
ATOM   6093 O O   . MET D 1 85  ? 89.947  49.264  24.679 1.00 33.17 ? 85   MET D O   1 
ATOM   6094 C CB  . MET D 1 85  ? 88.785  46.784  25.132 1.00 13.53 ? 85   MET D CB  1 
ATOM   6095 C CG  . MET D 1 85  ? 87.907  45.602  24.902 1.00 14.49 ? 85   MET D CG  1 
ATOM   6096 S SD  . MET D 1 85  ? 86.856  45.308  26.289 1.00 26.19 ? 85   MET D SD  1 
ATOM   6097 C CE  . MET D 1 85  ? 86.084  46.938  26.462 1.00 26.52 ? 85   MET D CE  1 
ATOM   6098 N N   . CYS D 1 86  ? 91.709  48.333  23.605 1.00 34.32 ? 86   CYS D N   1 
ATOM   6099 C CA  . CYS D 1 86  ? 92.425  49.577  23.352 1.00 34.51 ? 86   CYS D CA  1 
ATOM   6100 C C   . CYS D 1 86  ? 92.276  49.910  21.867 1.00 31.90 ? 86   CYS D C   1 
ATOM   6101 O O   . CYS D 1 86  ? 91.573  49.207  21.127 1.00 31.70 ? 86   CYS D O   1 
ATOM   6102 C CB  . CYS D 1 86  ? 93.913  49.419  23.699 1.00 36.62 ? 86   CYS D CB  1 
ATOM   6103 S SG  . CYS D 1 86  ? 94.338  49.571  25.458 1.00 32.82 ? 86   CYS D SG  1 
ATOM   6104 N N   . GLY D 1 87  ? 92.929  50.989  21.442 1.00 23.60 ? 87   GLY D N   1 
ATOM   6105 C CA  . GLY D 1 87  ? 92.984  51.314  20.031 1.00 19.05 ? 87   GLY D CA  1 
ATOM   6106 C C   . GLY D 1 87  ? 93.791  50.292  19.254 1.00 23.01 ? 87   GLY D C   1 
ATOM   6107 O O   . GLY D 1 87  ? 94.611  49.574  19.818 1.00 21.41 ? 87   GLY D O   1 
ATOM   6108 N N   . GLU D 1 88  ? 93.513  50.190  17.963 1.00 26.43 ? 88   GLU D N   1 
ATOM   6109 C CA  . GLU D 1 88  ? 94.243  49.297  17.086 1.00 36.31 ? 88   GLU D CA  1 
ATOM   6110 C C   . GLU D 1 88  ? 95.135  50.123  16.173 1.00 36.84 ? 88   GLU D C   1 
ATOM   6111 O O   . GLU D 1 88  ? 96.354  49.974  16.191 1.00 34.76 ? 88   GLU D O   1 
ATOM   6112 C CB  . GLU D 1 88  ? 93.270  48.475  16.239 1.00 47.10 ? 88   GLU D CB  1 
ATOM   6113 C CG  . GLU D 1 88  ? 92.120  47.849  17.016 1.00 57.90 ? 88   GLU D CG  1 
ATOM   6114 C CD  . GLU D 1 88  ? 92.537  46.624  17.804 1.00 63.25 ? 88   GLU D CD  1 
ATOM   6115 O OE1 . GLU D 1 88  ? 93.317  46.771  18.772 1.00 64.60 ? 88   GLU D OE1 1 
ATOM   6116 O OE2 . GLU D 1 88  ? 92.067  45.515  17.463 1.00 64.65 ? 88   GLU D OE2 1 
ATOM   6117 N N   . THR D 1 89  ? 94.508  51.007  15.397 1.00 33.83 ? 89   THR D N   1 
ATOM   6118 C CA  . THR D 1 89  ? 95.209  51.906  14.482 1.00 27.09 ? 89   THR D CA  1 
ATOM   6119 C C   . THR D 1 89  ? 95.734  53.132  15.229 1.00 24.93 ? 89   THR D C   1 
ATOM   6120 O O   . THR D 1 89  ? 95.349  53.376  16.370 1.00 27.91 ? 89   THR D O   1 
ATOM   6121 C CB  . THR D 1 89  ? 94.268  52.383  13.343 1.00 27.89 ? 89   THR D CB  1 
ATOM   6122 O OG1 . THR D 1 89  ? 93.254  53.251  13.869 1.00 31.54 ? 89   THR D OG1 1 
ATOM   6123 C CG2 . THR D 1 89  ? 93.596  51.200  12.681 1.00 28.39 ? 89   THR D CG2 1 
ATOM   6124 N N   . GLU D 1 90  ? 96.579  53.918  14.569 1.00 23.41 ? 90   GLU D N   1 
ATOM   6125 C CA  . GLU D 1 90  ? 97.076  55.167  15.139 1.00 21.31 ? 90   GLU D CA  1 
ATOM   6126 C C   . GLU D 1 90  ? 95.938  56.142  15.423 1.00 24.45 ? 90   GLU D C   1 
ATOM   6127 O O   . GLU D 1 90  ? 95.933  56.822  16.454 1.00 26.10 ? 90   GLU D O   1 
ATOM   6128 C CB  . GLU D 1 90  ? 98.082  55.811  14.178 1.00 17.86 ? 90   GLU D CB  1 
ATOM   6129 C CG  . GLU D 1 90  ? 98.639  57.161  14.628 1.00 15.50 ? 90   GLU D CG  1 
ATOM   6130 C CD  . GLU D 1 90  ? 99.299  57.125  16.005 1.00 27.27 ? 90   GLU D CD  1 
ATOM   6131 O OE1 . GLU D 1 90  ? 100.204 56.288  16.241 1.00 32.01 ? 90   GLU D OE1 1 
ATOM   6132 O OE2 . GLU D 1 90  ? 98.930  57.969  16.847 1.00 32.15 ? 90   GLU D OE2 1 
ATOM   6133 N N   . VAL D 1 91  ? 94.971  56.193  14.510 1.00 25.11 ? 91   VAL D N   1 
ATOM   6134 C CA  . VAL D 1 91  ? 93.836  57.098  14.638 1.00 23.89 ? 91   VAL D CA  1 
ATOM   6135 C C   . VAL D 1 91  ? 92.993  56.711  15.842 1.00 24.02 ? 91   VAL D C   1 
ATOM   6136 O O   . VAL D 1 91  ? 92.621  57.563  16.652 1.00 22.86 ? 91   VAL D O   1 
ATOM   6137 C CB  . VAL D 1 91  ? 92.954  57.057  13.393 1.00 24.77 ? 91   VAL D CB  1 
ATOM   6138 C CG1 . VAL D 1 91  ? 92.047  58.264  13.372 1.00 28.01 ? 91   VAL D CG1 1 
ATOM   6139 C CG2 . VAL D 1 91  ? 93.816  57.015  12.148 1.00 28.89 ? 91   VAL D CG2 1 
ATOM   6140 N N   . GLU D 1 92  ? 92.795  55.407  16.013 1.00 22.30 ? 92   GLU D N   1 
ATOM   6141 C CA  . GLU D 1 92  ? 92.038  54.891  17.143 1.00 18.82 ? 92   GLU D CA  1 
ATOM   6142 C C   . GLU D 1 92  ? 92.720  55.227  18.470 1.00 19.78 ? 92   GLU D C   1 
ATOM   6143 O O   . GLU D 1 92  ? 92.059  55.658  19.418 1.00 19.98 ? 92   GLU D O   1 
ATOM   6144 C CB  . GLU D 1 92  ? 91.844  53.375  17.016 1.00 20.54 ? 92   GLU D CB  1 
ATOM   6145 C CG  . GLU D 1 92  ? 90.850  52.957  15.938 1.00 17.04 ? 92   GLU D CG  1 
ATOM   6146 C CD  . GLU D 1 92  ? 90.432  51.491  16.021 1.00 24.28 ? 92   GLU D CD  1 
ATOM   6147 O OE1 . GLU D 1 92  ? 90.830  50.785  16.971 1.00 25.35 ? 92   GLU D OE1 1 
ATOM   6148 O OE2 . GLU D 1 92  ? 89.648  51.050  15.153 1.00 32.62 ? 92   GLU D OE2 1 
ATOM   6149 N N   . LYS D 1 93  ? 94.048  55.125  18.503 1.00 20.39 ? 93   LYS D N   1 
ATOM   6150 C CA  . LYS D 1 93  ? 94.811  55.445  19.708 1.00 19.17 ? 93   LYS D CA  1 
ATOM   6151 C C   . LYS D 1 93  ? 94.772  56.940  20.029 1.00 20.94 ? 93   LYS D C   1 
ATOM   6152 O O   . LYS D 1 93  ? 94.634  57.333  21.189 1.00 14.91 ? 93   LYS D O   1 
ATOM   6153 C CB  . LYS D 1 93  ? 96.259  54.989  19.558 1.00 20.23 ? 93   LYS D CB  1 
ATOM   6154 C CG  . LYS D 1 93  ? 96.408  53.533  19.158 1.00 27.21 ? 93   LYS D CG  1 
ATOM   6155 C CD  . LYS D 1 93  ? 97.697  52.938  19.688 1.00 23.85 ? 93   LYS D CD  1 
ATOM   6156 C CE  . LYS D 1 93  ? 97.573  52.563  21.167 1.00 34.21 ? 93   LYS D CE  1 
ATOM   6157 N NZ  . LYS D 1 93  ? 96.620  51.438  21.418 1.00 35.59 ? 93   LYS D NZ  1 
ATOM   6158 N N   . GLN D 1 94  ? 94.851  57.773  18.999 1.00 15.93 ? 94   GLN D N   1 
ATOM   6159 C CA  . GLN D 1 94  ? 94.702  59.204  19.200 1.00 13.83 ? 94   GLN D CA  1 
ATOM   6160 C C   . GLN D 1 94  ? 93.344  59.530  19.817 1.00 18.75 ? 94   GLN D C   1 
ATOM   6161 O O   . GLN D 1 94  ? 93.261  60.359  20.722 1.00 16.31 ? 94   GLN D O   1 
ATOM   6162 C CB  . GLN D 1 94  ? 94.872  59.952  17.885 1.00 12.49 ? 94   GLN D CB  1 
ATOM   6163 C CG  . GLN D 1 94  ? 96.313  60.064  17.418 1.00 14.33 ? 94   GLN D CG  1 
ATOM   6164 C CD  . GLN D 1 94  ? 96.440  60.514  15.961 1.00 19.14 ? 94   GLN D CD  1 
ATOM   6165 O OE1 . GLN D 1 94  ? 95.696  61.386  15.493 1.00 22.25 ? 94   GLN D OE1 1 
ATOM   6166 N NE2 . GLN D 1 94  ? 97.431  59.971  15.262 1.00 15.04 ? 94   GLN D NE2 1 
ATOM   6167 N N   . ARG D 1 95  ? 92.301  58.812  19.394 1.00 28.08 ? 95   ARG D N   1 
ATOM   6168 C CA  . ARG D 1 95  ? 90.948  59.016  19.921 1.00 21.28 ? 95   ARG D CA  1 
ATOM   6169 C C   . ARG D 1 95  ? 90.839  58.573  21.380 1.00 15.44 ? 95   ARG D C   1 
ATOM   6170 O O   . ARG D 1 95  ? 90.292  59.283  22.220 1.00 24.29 ? 95   ARG D O   1 
ATOM   6171 C CB  . ARG D 1 95  ? 89.923  58.256  19.073 1.00 20.80 ? 95   ARG D CB  1 
ATOM   6172 C CG  . ARG D 1 95  ? 89.595  58.936  17.756 1.00 20.57 ? 95   ARG D CG  1 
ATOM   6173 C CD  . ARG D 1 95  ? 88.231  58.537  17.241 1.00 21.12 ? 95   ARG D CD  1 
ATOM   6174 N NE  . ARG D 1 95  ? 88.319  57.451  16.271 1.00 25.96 ? 95   ARG D NE  1 
ATOM   6175 C CZ  . ARG D 1 95  ? 88.357  57.624  14.951 1.00 30.52 ? 95   ARG D CZ  1 
ATOM   6176 N NH1 . ARG D 1 95  ? 88.374  58.850  14.440 1.00 27.19 ? 95   ARG D NH1 1 
ATOM   6177 N NH2 . ARG D 1 95  ? 88.399  56.567  14.140 1.00 34.51 ? 95   ARG D NH2 1 
ATOM   6178 N N   . VAL D 1 96  ? 91.414  57.421  21.683 1.00 8.34  ? 96   VAL D N   1 
ATOM   6179 C CA  . VAL D 1 96  ? 91.488  56.930  23.051 1.00 8.23  ? 96   VAL D CA  1 
ATOM   6180 C C   . VAL D 1 96  ? 92.147  57.946  23.983 1.00 9.96  ? 96   VAL D C   1 
ATOM   6181 O O   . VAL D 1 96  ? 91.613  58.278  25.037 1.00 17.13 ? 96   VAL D O   1 
ATOM   6182 C CB  . VAL D 1 96  ? 92.286  55.600  23.108 1.00 11.74 ? 96   VAL D CB  1 
ATOM   6183 C CG1 . VAL D 1 96  ? 92.537  55.189  24.544 1.00 11.59 ? 96   VAL D CG1 1 
ATOM   6184 C CG2 . VAL D 1 96  ? 91.539  54.508  22.374 1.00 2.00  ? 96   VAL D CG2 1 
ATOM   6185 N N   . ASP D 1 97  ? 93.301  58.453  23.573 1.00 17.26 ? 97   ASP D N   1 
ATOM   6186 C CA  . ASP D 1 97  ? 94.122  59.295  24.434 1.00 12.05 ? 97   ASP D CA  1 
ATOM   6187 C C   . ASP D 1 97  ? 93.460  60.635  24.738 1.00 12.07 ? 97   ASP D C   1 
ATOM   6188 O O   . ASP D 1 97  ? 93.588  61.168  25.837 1.00 12.79 ? 97   ASP D O   1 
ATOM   6189 C CB  . ASP D 1 97  ? 95.484  59.550  23.783 1.00 15.03 ? 97   ASP D CB  1 
ATOM   6190 C CG  . ASP D 1 97  ? 96.390  58.319  23.766 1.00 15.86 ? 97   ASP D CG  1 
ATOM   6191 O OD1 . ASP D 1 97  ? 96.056  57.264  24.357 1.00 19.55 ? 97   ASP D OD1 1 
ATOM   6192 O OD2 . ASP D 1 97  ? 97.460  58.423  23.136 1.00 19.59 ? 97   ASP D OD2 1 
ATOM   6193 N N   . VAL D 1 98  ? 92.796  61.207  23.743 1.00 15.92 ? 98   VAL D N   1 
ATOM   6194 C CA  . VAL D 1 98  ? 92.174  62.518  23.912 1.00 13.42 ? 98   VAL D CA  1 
ATOM   6195 C C   . VAL D 1 98  ? 90.930  62.401  24.782 1.00 20.55 ? 98   VAL D C   1 
ATOM   6196 O O   . VAL D 1 98  ? 90.761  63.159  25.736 1.00 22.34 ? 98   VAL D O   1 
ATOM   6197 C CB  . VAL D 1 98  ? 91.782  63.131  22.556 1.00 14.14 ? 98   VAL D CB  1 
ATOM   6198 C CG1 . VAL D 1 98  ? 91.272  64.540  22.747 1.00 6.97  ? 98   VAL D CG1 1 
ATOM   6199 C CG2 . VAL D 1 98  ? 92.975  63.127  21.620 1.00 14.04 ? 98   VAL D CG2 1 
ATOM   6200 N N   . LEU D 1 99  ? 90.105  61.395  24.500 1.00 18.13 ? 99   LEU D N   1 
ATOM   6201 C CA  . LEU D 1 99  ? 88.868  61.184  25.243 1.00 15.20 ? 99   LEU D CA  1 
ATOM   6202 C C   . LEU D 1 99  ? 89.157  60.824  26.683 1.00 13.49 ? 99   LEU D C   1 
ATOM   6203 O O   . LEU D 1 99  ? 88.499  61.304  27.589 1.00 24.88 ? 99   LEU D O   1 
ATOM   6204 C CB  . LEU D 1 99  ? 88.037  60.069  24.617 1.00 21.69 ? 99   LEU D CB  1 
ATOM   6205 C CG  . LEU D 1 99  ? 87.426  60.305  23.232 1.00 29.43 ? 99   LEU D CG  1 
ATOM   6206 C CD1 . LEU D 1 99  ? 86.891  58.981  22.701 1.00 32.66 ? 99   LEU D CD1 1 
ATOM   6207 C CD2 . LEU D 1 99  ? 86.329  61.351  23.300 1.00 26.50 ? 99   LEU D CD2 1 
ATOM   6208 N N   . GLU D 1 100 ? 90.147  59.970  26.894 1.00 17.51 ? 100  GLU D N   1 
ATOM   6209 C CA  . GLU D 1 100 ? 90.523  59.556  28.243 1.00 15.29 ? 100  GLU D CA  1 
ATOM   6210 C C   . GLU D 1 100 ? 90.785  60.767  29.126 1.00 13.73 ? 100  GLU D C   1 
ATOM   6211 O O   . GLU D 1 100 ? 90.377  60.798  30.290 1.00 23.04 ? 100  GLU D O   1 
ATOM   6212 C CB  . GLU D 1 100 ? 91.779  58.683  28.206 1.00 11.07 ? 100  GLU D CB  1 
ATOM   6213 C CG  . GLU D 1 100 ? 92.396  58.488  29.573 1.00 12.56 ? 100  GLU D CG  1 
ATOM   6214 C CD  . GLU D 1 100 ? 93.589  57.563  29.561 1.00 19.52 ? 100  GLU D CD  1 
ATOM   6215 O OE1 . GLU D 1 100 ? 94.619  57.908  28.940 1.00 24.88 ? 100  GLU D OE1 1 
ATOM   6216 O OE2 . GLU D 1 100 ? 93.515  56.513  30.231 1.00 25.33 ? 100  GLU D OE2 1 
ATOM   6217 N N   . ASN D 1 101 ? 91.453  61.762  28.547 1.00 20.50 ? 101  ASN D N   1 
ATOM   6218 C CA  . ASN D 1 101 ? 91.916  62.933  29.278 1.00 20.67 ? 101  ASN D CA  1 
ATOM   6219 C C   . ASN D 1 101 ? 90.834  64.014  29.317 1.00 18.84 ? 101  ASN D C   1 
ATOM   6220 O O   . ASN D 1 101 ? 90.608  64.636  30.355 1.00 19.76 ? 101  ASN D O   1 
ATOM   6221 C CB  . ASN D 1 101 ? 93.208  63.477  28.637 1.00 19.62 ? 101  ASN D CB  1 
ATOM   6222 C CG  . ASN D 1 101 ? 94.467  62.713  29.086 1.00 18.64 ? 101  ASN D CG  1 
ATOM   6223 O OD1 . ASN D 1 101 ? 94.979  61.843  28.370 1.00 13.59 ? 101  ASN D OD1 1 
ATOM   6224 N ND2 . ASN D 1 101 ? 94.979  63.060  30.261 1.00 7.33  ? 101  ASN D ND2 1 
ATOM   6225 N N   . HIS D 1 102 ? 90.082  64.136  28.229 1.00 14.56 ? 102  HIS D N   1 
ATOM   6226 C CA  . HIS D 1 102 ? 89.009  65.119  28.146 1.00 10.66 ? 102  HIS D CA  1 
ATOM   6227 C C   . HIS D 1 102 ? 87.867  64.782  29.104 1.00 13.96 ? 102  HIS D C   1 
ATOM   6228 O O   . HIS D 1 102 ? 87.355  65.654  29.788 1.00 13.67 ? 102  HIS D O   1 
ATOM   6229 C CB  . HIS D 1 102 ? 88.498  65.200  26.702 1.00 11.30 ? 102  HIS D CB  1 
ATOM   6230 C CG  . HIS D 1 102 ? 87.261  66.028  26.535 1.00 15.14 ? 102  HIS D CG  1 
ATOM   6231 N ND1 . HIS D 1 102 ? 87.036  67.186  27.247 1.00 15.34 ? 102  HIS D ND1 1 
ATOM   6232 C CD2 . HIS D 1 102 ? 86.198  65.885  25.710 1.00 14.68 ? 102  HIS D CD2 1 
ATOM   6233 C CE1 . HIS D 1 102 ? 85.895  67.727  26.860 1.00 19.52 ? 102  HIS D CE1 1 
ATOM   6234 N NE2 . HIS D 1 102 ? 85.367  66.956  25.928 1.00 17.62 ? 102  HIS D NE2 1 
ATOM   6235 N N   . LEU D 1 103 ? 87.503  63.506  29.171 1.00 16.90 ? 103  LEU D N   1 
ATOM   6236 C CA  . LEU D 1 103 ? 86.441  63.038  30.056 1.00 18.43 ? 103  LEU D CA  1 
ATOM   6237 C C   . LEU D 1 103 ? 86.806  63.192  31.528 1.00 24.25 ? 103  LEU D C   1 
ATOM   6238 O O   . LEU D 1 103 ? 85.934  63.387  32.376 1.00 23.73 ? 103  LEU D O   1 
ATOM   6239 C CB  . LEU D 1 103 ? 86.109  61.574  29.756 1.00 16.98 ? 103  LEU D CB  1 
ATOM   6240 C CG  . LEU D 1 103 ? 85.380  61.323  28.432 1.00 16.47 ? 103  LEU D CG  1 
ATOM   6241 C CD1 . LEU D 1 103 ? 85.362  59.835  28.128 1.00 23.59 ? 103  LEU D CD1 1 
ATOM   6242 C CD2 . LEU D 1 103 ? 83.968  61.870  28.506 1.00 19.62 ? 103  LEU D CD2 1 
ATOM   6243 N N   . MET D 1 104 ? 88.097  63.092  31.830 1.00 26.04 ? 104  MET D N   1 
ATOM   6244 C CA  . MET D 1 104 ? 88.564  63.335  33.182 1.00 17.31 ? 104  MET D CA  1 
ATOM   6245 C C   . MET D 1 104 ? 88.376  64.800  33.534 1.00 17.12 ? 104  MET D C   1 
ATOM   6246 O O   . MET D 1 104 ? 87.990  65.114  34.647 1.00 21.14 ? 104  MET D O   1 
ATOM   6247 C CB  . MET D 1 104 ? 90.026  62.945  33.315 1.00 22.88 ? 104  MET D CB  1 
ATOM   6248 C CG  . MET D 1 104 ? 90.562  63.159  34.709 1.00 29.94 ? 104  MET D CG  1 
ATOM   6249 S SD  . MET D 1 104 ? 89.612  62.231  35.920 1.00 29.20 ? 104  MET D SD  1 
ATOM   6250 C CE  . MET D 1 104 ? 90.699  60.775  36.134 1.00 16.31 ? 104  MET D CE  1 
ATOM   6251 N N   . ASP D 1 105 ? 88.576  65.688  32.561 1.00 22.07 ? 105  ASP D N   1 
ATOM   6252 C CA  . ASP D 1 105 ? 88.374  67.120  32.775 1.00 26.20 ? 105  ASP D CA  1 
ATOM   6253 C C   . ASP D 1 105 ? 86.910  67.418  33.076 1.00 25.88 ? 105  ASP D C   1 
ATOM   6254 O O   . ASP D 1 105 ? 86.602  68.186  33.981 1.00 33.50 ? 105  ASP D O   1 
ATOM   6255 C CB  . ASP D 1 105 ? 88.833  67.927  31.550 1.00 30.92 ? 105  ASP D CB  1 
ATOM   6256 C CG  . ASP D 1 105 ? 90.344  68.155  31.513 1.00 35.06 ? 105  ASP D CG  1 
ATOM   6257 O OD1 . ASP D 1 105 ? 91.045  67.804  32.482 1.00 41.99 ? 105  ASP D OD1 1 
ATOM   6258 O OD2 . ASP D 1 105 ? 90.834  68.695  30.505 1.00 35.77 ? 105  ASP D OD2 1 
ATOM   6259 N N   . LEU D 1 106 ? 86.015  66.773  32.340 1.00 22.52 ? 106  LEU D N   1 
ATOM   6260 C CA  . LEU D 1 106 ? 84.586  66.919  32.566 1.00 17.17 ? 106  LEU D CA  1 
ATOM   6261 C C   . LEU D 1 106 ? 84.201  66.359  33.922 1.00 22.94 ? 106  LEU D C   1 
ATOM   6262 O O   . LEU D 1 106 ? 83.438  66.983  34.652 1.00 32.75 ? 106  LEU D O   1 
ATOM   6263 C CB  . LEU D 1 106 ? 83.802  66.180  31.492 1.00 17.97 ? 106  LEU D CB  1 
ATOM   6264 C CG  . LEU D 1 106 ? 84.064  66.692  30.089 1.00 21.28 ? 106  LEU D CG  1 
ATOM   6265 C CD1 . LEU D 1 106 ? 83.147  65.995  29.103 1.00 22.09 ? 106  LEU D CD1 1 
ATOM   6266 C CD2 . LEU D 1 106 ? 83.845  68.194  30.075 1.00 27.61 ? 106  LEU D CD2 1 
ATOM   6267 N N   . ARG D 1 107 ? 84.698  65.165  34.235 1.00 17.58 ? 107  ARG D N   1 
ATOM   6268 C CA  . ARG D 1 107 ? 84.412  64.519  35.518 1.00 23.05 ? 107  ARG D CA  1 
ATOM   6269 C C   . ARG D 1 107 ? 84.866  65.375  36.689 1.00 24.02 ? 107  ARG D C   1 
ATOM   6270 O O   . ARG D 1 107 ? 84.120  65.548  37.652 1.00 27.83 ? 107  ARG D O   1 
ATOM   6271 C CB  . ARG D 1 107 ? 85.083  63.138  35.605 1.00 18.73 ? 107  ARG D CB  1 
ATOM   6272 C CG  . ARG D 1 107 ? 85.007  62.474  36.987 1.00 16.00 ? 107  ARG D CG  1 
ATOM   6273 C CD  . ARG D 1 107 ? 85.701  61.099  37.005 1.00 27.49 ? 107  ARG D CD  1 
ATOM   6274 N NE  . ARG D 1 107 ? 84.917  60.024  36.383 1.00 23.88 ? 107  ARG D NE  1 
ATOM   6275 C CZ  . ARG D 1 107 ? 85.247  59.409  35.245 1.00 31.91 ? 107  ARG D CZ  1 
ATOM   6276 N NH1 . ARG D 1 107 ? 86.331  59.774  34.559 1.00 23.12 ? 107  ARG D NH1 1 
ATOM   6277 N NH2 . ARG D 1 107 ? 84.479  58.435  34.774 1.00 34.45 ? 107  ARG D NH2 1 
ATOM   6278 N N   . MET D 1 108 ? 86.059  65.958  36.563 1.00 30.53 ? 108  MET D N   1 
ATOM   6279 C CA  . MET D 1 108 ? 86.668  66.767  37.622 1.00 37.77 ? 108  MET D CA  1 
ATOM   6280 C C   . MET D 1 108 ? 85.952  68.103  37.803 1.00 33.51 ? 108  MET D C   1 
ATOM   6281 O O   . MET D 1 108 ? 85.827  68.599  38.919 1.00 38.86 ? 108  MET D O   1 
ATOM   6282 C CB  . MET D 1 108 ? 88.144  67.023  37.310 1.00 36.50 ? 108  MET D CB  1 
ATOM   6283 C CG  . MET D 1 108 ? 89.029  65.809  37.470 1.00 45.16 ? 108  MET D CG  1 
ATOM   6284 S SD  . MET D 1 108 ? 89.028  65.238  39.167 1.00 49.98 ? 108  MET D SD  1 
ATOM   6285 C CE  . MET D 1 108 ? 90.299  66.330  39.857 1.00 54.69 ? 108  MET D CE  1 
ATOM   6286 N N   . ALA D 1 109 ? 85.469  68.659  36.696 1.00 30.83 ? 109  ALA D N   1 
ATOM   6287 C CA  . ALA D 1 109 ? 84.761  69.933  36.685 1.00 24.22 ? 109  ALA D CA  1 
ATOM   6288 C C   . ALA D 1 109 ? 83.419  69.815  37.403 1.00 34.93 ? 109  ALA D C   1 
ATOM   6289 O O   . ALA D 1 109 ? 82.979  70.743  38.096 1.00 39.51 ? 109  ALA D O   1 
ATOM   6290 C CB  . ALA D 1 109 ? 84.544  70.385  35.239 1.00 25.50 ? 109  ALA D CB  1 
ATOM   6291 N N   . PHE D 1 110 ? 82.766  68.671  37.218 1.00 32.39 ? 110  PHE D N   1 
ATOM   6292 C CA  . PHE D 1 110 ? 81.489  68.407  37.873 1.00 36.16 ? 110  PHE D CA  1 
ATOM   6293 C C   . PHE D 1 110 ? 81.684  68.145  39.367 1.00 35.53 ? 110  PHE D C   1 
ATOM   6294 O O   . PHE D 1 110 ? 80.917  68.637  40.192 1.00 39.80 ? 110  PHE D O   1 
ATOM   6295 C CB  . PHE D 1 110 ? 80.784  67.211  37.207 1.00 35.82 ? 110  PHE D CB  1 
ATOM   6296 C CG  . PHE D 1 110 ? 79.377  66.984  37.693 1.00 41.07 ? 110  PHE D CG  1 
ATOM   6297 C CD1 . PHE D 1 110 ? 78.443  68.020  37.675 1.00 42.01 ? 110  PHE D CD1 1 
ATOM   6298 C CD2 . PHE D 1 110 ? 79.005  65.758  38.240 1.00 44.11 ? 110  PHE D CD2 1 
ATOM   6299 C CE1 . PHE D 1 110 ? 77.162  67.844  38.202 1.00 40.70 ? 110  PHE D CE1 1 
ATOM   6300 C CE2 . PHE D 1 110 ? 77.723  65.567  38.772 1.00 40.93 ? 110  PHE D CE2 1 
ATOM   6301 C CZ  . PHE D 1 110 ? 76.801  66.614  38.752 1.00 40.63 ? 110  PHE D CZ  1 
ATOM   6302 N N   . ALA D 1 111 ? 82.743  67.411  39.701 1.00 31.10 ? 111  ALA D N   1 
ATOM   6303 C CA  . ALA D 1 111 ? 83.074  67.093  41.083 1.00 28.82 ? 111  ALA D CA  1 
ATOM   6304 C C   . ALA D 1 111 ? 83.352  68.353  41.900 1.00 36.39 ? 111  ALA D C   1 
ATOM   6305 O O   . ALA D 1 111 ? 82.831  68.508  43.004 1.00 41.60 ? 111  ALA D O   1 
ATOM   6306 C CB  . ALA D 1 111 ? 84.274  66.176  41.116 1.00 27.27 ? 111  ALA D CB  1 
ATOM   6307 N N   . ARG D 1 112 ? 84.132  69.272  41.329 1.00 38.55 ? 112  ARG D N   1 
ATOM   6308 C CA  . ARG D 1 112 ? 84.458  70.541  41.979 1.00 39.73 ? 112  ARG D CA  1 
ATOM   6309 C C   . ARG D 1 112 ? 83.189  71.269  42.380 1.00 35.83 ? 112  ARG D C   1 
ATOM   6310 O O   . ARG D 1 112 ? 83.079  71.766  43.502 1.00 40.83 ? 112  ARG D O   1 
ATOM   6311 C CB  . ARG D 1 112 ? 85.272  71.436  41.045 1.00 37.54 ? 112  ARG D CB  1 
ATOM   6312 C CG  . ARG D 1 112 ? 86.765  71.114  40.966 1.00 49.54 ? 112  ARG D CG  1 
ATOM   6313 C CD  . ARG D 1 112 ? 87.347  71.679  39.664 1.00 57.79 ? 112  ARG D CD  1 
ATOM   6314 N NE  . ARG D 1 112 ? 88.807  71.785  39.653 1.00 58.19 ? 112  ARG D NE  1 
ATOM   6315 C CZ  . ARG D 1 112 ? 89.539  71.905  38.545 1.00 57.49 ? 112  ARG D CZ  1 
ATOM   6316 N NH1 . ARG D 1 112 ? 88.961  71.816  37.349 1.00 53.74 ? 112  ARG D NH1 1 
ATOM   6317 N NH2 . ARG D 1 112 ? 90.857  72.071  38.627 1.00 53.94 ? 112  ARG D NH2 1 
ATOM   6318 N N   . LEU D 1 113 ? 82.217  71.285  41.472 1.00 31.60 ? 113  LEU D N   1 
ATOM   6319 C CA  . LEU D 1 113 ? 80.931  71.940  41.721 1.00 35.89 ? 113  LEU D CA  1 
ATOM   6320 C C   . LEU D 1 113 ? 80.192  71.306  42.895 1.00 33.47 ? 113  LEU D C   1 
ATOM   6321 O O   . LEU D 1 113 ? 79.780  71.994  43.825 1.00 38.28 ? 113  LEU D O   1 
ATOM   6322 C CB  . LEU D 1 113 ? 80.044  71.878  40.466 1.00 32.18 ? 113  LEU D CB  1 
ATOM   6323 C CG  . LEU D 1 113 ? 78.531  72.085  40.633 1.00 33.91 ? 113  LEU D CG  1 
ATOM   6324 C CD1 . LEU D 1 113 ? 78.243  73.475  41.174 1.00 35.10 ? 113  LEU D CD1 1 
ATOM   6325 C CD2 . LEU D 1 113 ? 77.827  71.884  39.300 1.00 34.95 ? 113  LEU D CD2 1 
ATOM   6326 N N   . CYS D 1 114 ? 80.054  69.988  42.850 1.00 30.60 ? 114  CYS D N   1 
ATOM   6327 C CA  . CYS D 1 114 ? 79.237  69.264  43.808 1.00 25.92 ? 114  CYS D CA  1 
ATOM   6328 C C   . CYS D 1 114 ? 79.880  69.142  45.181 1.00 29.28 ? 114  CYS D C   1 
ATOM   6329 O O   . CYS D 1 114 ? 79.229  68.733  46.137 1.00 33.15 ? 114  CYS D O   1 
ATOM   6330 C CB  . CYS D 1 114 ? 78.917  67.877  43.263 1.00 21.74 ? 114  CYS D CB  1 
ATOM   6331 S SG  . CYS D 1 114 ? 78.031  67.911  41.688 1.00 32.70 ? 114  CYS D SG  1 
ATOM   6332 N N   . TYR D 1 115 ? 81.159  69.484  45.279 1.00 33.91 ? 115  TYR D N   1 
ATOM   6333 C CA  . TYR D 1 115 ? 81.858  69.473  46.561 1.00 35.27 ? 115  TYR D CA  1 
ATOM   6334 C C   . TYR D 1 115 ? 82.011  70.870  47.171 1.00 36.14 ? 115  TYR D C   1 
ATOM   6335 O O   . TYR D 1 115 ? 82.275  71.005  48.365 1.00 39.90 ? 115  TYR D O   1 
ATOM   6336 C CB  . TYR D 1 115 ? 83.229  68.826  46.401 1.00 37.87 ? 115  TYR D CB  1 
ATOM   6337 C CG  . TYR D 1 115 ? 83.179  67.323  46.356 1.00 37.35 ? 115  TYR D CG  1 
ATOM   6338 C CD1 . TYR D 1 115 ? 82.977  66.580  47.522 1.00 43.33 ? 115  TYR D CD1 1 
ATOM   6339 C CD2 . TYR D 1 115 ? 83.342  66.636  45.153 1.00 38.77 ? 115  TYR D CD2 1 
ATOM   6340 C CE1 . TYR D 1 115 ? 82.939  65.183  47.488 1.00 43.56 ? 115  TYR D CE1 1 
ATOM   6341 C CE2 . TYR D 1 115 ? 83.304  65.245  45.106 1.00 41.06 ? 115  TYR D CE2 1 
ATOM   6342 C CZ  . TYR D 1 115 ? 83.101  64.524  46.277 1.00 43.51 ? 115  TYR D CZ  1 
ATOM   6343 O OH  . TYR D 1 115 ? 83.036  63.151  46.235 1.00 43.75 ? 115  TYR D OH  1 
ATOM   6344 N N   . SER D 1 116 ? 81.809  71.897  46.345 1.00 38.76 ? 116  SER D N   1 
ATOM   6345 C CA  . SER D 1 116 ? 81.921  73.299  46.754 1.00 38.64 ? 116  SER D CA  1 
ATOM   6346 C C   . SER D 1 116 ? 80.732  73.705  47.618 1.00 37.74 ? 116  SER D C   1 
ATOM   6347 O O   . SER D 1 116 ? 79.579  73.480  47.253 1.00 42.87 ? 116  SER D O   1 
ATOM   6348 C CB  . SER D 1 116 ? 81.982  74.203  45.507 1.00 39.60 ? 116  SER D CB  1 
ATOM   6349 O OG  . SER D 1 116 ? 82.821  75.335  45.692 1.00 45.90 ? 116  SER D OG  1 
ATOM   6350 N N   . PRO D 1 117 ? 80.998  74.310  48.781 1.00 37.10 ? 117  PRO D N   1 
ATOM   6351 C CA  . PRO D 1 117 ? 79.924  74.857  49.617 1.00 45.13 ? 117  PRO D CA  1 
ATOM   6352 C C   . PRO D 1 117 ? 79.139  75.995  48.943 1.00 47.97 ? 117  PRO D C   1 
ATOM   6353 O O   . PRO D 1 117 ? 77.938  76.161  49.187 1.00 44.48 ? 117  PRO D O   1 
ATOM   6354 C CB  . PRO D 1 117 ? 80.663  75.318  50.876 1.00 45.12 ? 117  PRO D CB  1 
ATOM   6355 C CG  . PRO D 1 117 ? 81.897  74.450  50.911 1.00 39.42 ? 117  PRO D CG  1 
ATOM   6356 C CD  . PRO D 1 117 ? 82.298  74.366  49.469 1.00 40.18 ? 117  PRO D CD  1 
ATOM   6357 N N   . ASP D 1 118 ? 79.786  76.675  47.996 1.00 49.15 ? 118  ASP D N   1 
ATOM   6358 C CA  . ASP D 1 118 ? 79.123  77.696  47.183 1.00 49.07 ? 118  ASP D CA  1 
ATOM   6359 C C   . ASP D 1 118 ? 78.383  77.054  46.004 1.00 46.27 ? 118  ASP D C   1 
ATOM   6360 O O   . ASP D 1 118 ? 78.116  77.703  44.990 1.00 42.75 ? 118  ASP D O   1 
ATOM   6361 C CB  . ASP D 1 118 ? 80.150  78.726  46.690 1.00 51.18 ? 118  ASP D CB  1 
ATOM   6362 C CG  . ASP D 1 118 ? 80.716  79.584  47.824 1.00 58.62 ? 118  ASP D CG  1 
ATOM   6363 O OD1 . ASP D 1 118 ? 80.046  80.561  48.231 1.00 58.00 ? 118  ASP D OD1 1 
ATOM   6364 O OD2 . ASP D 1 118 ? 81.829  79.279  48.314 1.00 59.34 ? 118  ASP D OD2 1 
ATOM   6365 N N   . PHE D 1 119 ? 77.964  75.805  46.212 1.00 42.64 ? 119  PHE D N   1 
ATOM   6366 C CA  . PHE D 1 119 ? 77.292  74.983  45.211 1.00 38.06 ? 119  PHE D CA  1 
ATOM   6367 C C   . PHE D 1 119 ? 76.192  75.755  44.487 1.00 42.27 ? 119  PHE D C   1 
ATOM   6368 O O   . PHE D 1 119 ? 76.253  75.931  43.266 1.00 42.18 ? 119  PHE D O   1 
ATOM   6369 C CB  . PHE D 1 119 ? 76.712  73.734  45.895 1.00 33.26 ? 119  PHE D CB  1 
ATOM   6370 C CG  . PHE D 1 119 ? 75.850  72.882  45.003 1.00 36.76 ? 119  PHE D CG  1 
ATOM   6371 C CD1 . PHE D 1 119 ? 76.412  71.887  44.215 1.00 41.71 ? 119  PHE D CD1 1 
ATOM   6372 C CD2 . PHE D 1 119 ? 74.471  73.068  44.957 1.00 40.18 ? 119  PHE D CD2 1 
ATOM   6373 C CE1 . PHE D 1 119 ? 75.613  71.090  43.391 1.00 43.29 ? 119  PHE D CE1 1 
ATOM   6374 C CE2 . PHE D 1 119 ? 73.666  72.280  44.138 1.00 37.63 ? 119  PHE D CE2 1 
ATOM   6375 C CZ  . PHE D 1 119 ? 74.238  71.289  43.354 1.00 39.62 ? 119  PHE D CZ  1 
ATOM   6376 N N   . GLU D 1 120 ? 75.253  76.300  45.263 1.00 45.83 ? 120  GLU D N   1 
ATOM   6377 C CA  . GLU D 1 120 ? 74.080  76.966  44.713 1.00 43.86 ? 120  GLU D CA  1 
ATOM   6378 C C   . GLU D 1 120 ? 74.419  78.211  43.896 1.00 47.67 ? 120  GLU D C   1 
ATOM   6379 O O   . GLU D 1 120 ? 73.779  78.480  42.879 1.00 45.98 ? 120  GLU D O   1 
ATOM   6380 C CB  . GLU D 1 120 ? 73.104  77.323  45.833 1.00 43.76 ? 120  GLU D CB  1 
ATOM   6381 C CG  . GLU D 1 120 ? 71.923  76.361  45.958 1.00 54.86 ? 120  GLU D CG  1 
ATOM   6382 C CD  . GLU D 1 120 ? 71.099  76.233  44.673 1.00 60.95 ? 120  GLU D CD  1 
ATOM   6383 O OE1 . GLU D 1 120 ? 71.092  77.175  43.843 1.00 59.84 ? 120  GLU D OE1 1 
ATOM   6384 O OE2 . GLU D 1 120 ? 70.438  75.188  44.496 1.00 60.80 ? 120  GLU D OE2 1 
ATOM   6385 N N   . LYS D 1 121 ? 75.474  78.916  44.300 1.00 52.59 ? 121  LYS D N   1 
ATOM   6386 C CA  . LYS D 1 121 ? 75.942  80.098  43.578 1.00 55.18 ? 121  LYS D CA  1 
ATOM   6387 C C   . LYS D 1 121 ? 76.605  79.732  42.253 1.00 56.71 ? 121  LYS D C   1 
ATOM   6388 O O   . LYS D 1 121 ? 76.563  80.509  41.293 1.00 60.76 ? 121  LYS D O   1 
ATOM   6389 C CB  . LYS D 1 121 ? 76.931  80.891  44.439 1.00 57.00 ? 121  LYS D CB  1 
ATOM   6390 C CG  . LYS D 1 121 ? 76.302  81.630  45.616 1.00 60.76 ? 121  LYS D CG  1 
ATOM   6391 C CD  . LYS D 1 121 ? 75.292  82.679  45.155 1.00 64.07 ? 121  LYS D CD  1 
ATOM   6392 C CE  . LYS D 1 121 ? 74.641  83.387  46.343 1.00 63.91 ? 121  LYS D CE  1 
ATOM   6393 N NZ  . LYS D 1 121 ? 73.396  84.134  45.984 1.00 62.90 ? 121  LYS D NZ  1 
ATOM   6394 N N   . LEU D 1 122 ? 77.184  78.533  42.195 1.00 55.89 ? 122  LEU D N   1 
ATOM   6395 C CA  . LEU D 1 122 ? 77.961  78.108  41.034 1.00 49.61 ? 122  LEU D CA  1 
ATOM   6396 C C   . LEU D 1 122 ? 77.143  77.298  40.022 1.00 48.92 ? 122  LEU D C   1 
ATOM   6397 O O   . LEU D 1 122 ? 77.494  77.245  38.837 1.00 50.60 ? 122  LEU D O   1 
ATOM   6398 C CB  . LEU D 1 122 ? 79.191  77.303  41.485 1.00 47.51 ? 122  LEU D CB  1 
ATOM   6399 C CG  . LEU D 1 122 ? 80.006  77.769  42.707 1.00 48.15 ? 122  LEU D CG  1 
ATOM   6400 C CD1 . LEU D 1 122 ? 81.285  76.940  42.820 1.00 44.34 ? 122  LEU D CD1 1 
ATOM   6401 C CD2 . LEU D 1 122 ? 80.342  79.258  42.615 1.00 47.12 ? 122  LEU D CD2 1 
ATOM   6402 N N   . LYS D 1 123 ? 76.006  76.762  40.467 1.00 46.25 ? 123  LYS D N   1 
ATOM   6403 C CA  . LYS D 1 123 ? 75.171  75.897  39.628 1.00 42.88 ? 123  LYS D CA  1 
ATOM   6404 C C   . LYS D 1 123 ? 74.737  76.516  38.286 1.00 40.22 ? 123  LYS D C   1 
ATOM   6405 O O   . LYS D 1 123 ? 74.918  75.905  37.225 1.00 35.41 ? 123  LYS D O   1 
ATOM   6406 C CB  . LYS D 1 123 ? 73.941  75.429  40.410 1.00 42.86 ? 123  LYS D CB  1 
ATOM   6407 C CG  . LYS D 1 123 ? 73.153  74.318  39.734 1.00 45.60 ? 123  LYS D CG  1 
ATOM   6408 C CD  . LYS D 1 123 ? 71.837  74.038  40.456 1.00 46.63 ? 123  LYS D CD  1 
ATOM   6409 C CE  . LYS D 1 123 ? 70.800  75.114  40.169 1.00 52.57 ? 123  LYS D CE  1 
ATOM   6410 N NZ  . LYS D 1 123 ? 70.333  75.820  41.405 1.00 53.45 ? 123  LYS D NZ  1 
ATOM   6411 N N   . PRO D 1 124 ? 74.223  77.758  38.305 1.00 39.50 ? 124  PRO D N   1 
ATOM   6412 C CA  . PRO D 1 124 ? 73.776  78.366  37.045 1.00 38.25 ? 124  PRO D CA  1 
ATOM   6413 C C   . PRO D 1 124 ? 74.897  78.500  36.008 1.00 37.19 ? 124  PRO D C   1 
ATOM   6414 O O   . PRO D 1 124 ? 74.683  78.251  34.823 1.00 39.79 ? 124  PRO D O   1 
ATOM   6415 C CB  . PRO D 1 124 ? 73.247  79.731  37.483 1.00 38.21 ? 124  PRO D CB  1 
ATOM   6416 C CG  . PRO D 1 124 ? 74.018  80.034  38.736 1.00 34.53 ? 124  PRO D CG  1 
ATOM   6417 C CD  . PRO D 1 124 ? 74.099  78.704  39.429 1.00 32.83 ? 124  PRO D CD  1 
ATOM   6418 N N   . ALA D 1 125 ? 76.096  78.857  36.472 1.00 37.74 ? 125  ALA D N   1 
ATOM   6419 C CA  . ALA D 1 125 ? 77.250  79.050  35.597 1.00 27.81 ? 125  ALA D CA  1 
ATOM   6420 C C   . ALA D 1 125 ? 77.626  77.757  34.891 1.00 30.53 ? 125  ALA D C   1 
ATOM   6421 O O   . ALA D 1 125 ? 77.830  77.743  33.676 1.00 40.82 ? 125  ALA D O   1 
ATOM   6422 C CB  . ALA D 1 125 ? 78.425  79.560  36.400 1.00 30.49 ? 125  ALA D CB  1 
ATOM   6423 N N   . TYR D 1 126 ? 77.647  76.661  35.647 1.00 34.71 ? 126  TYR D N   1 
ATOM   6424 C CA  . TYR D 1 126 ? 77.930  75.344  35.085 1.00 34.61 ? 126  TYR D CA  1 
ATOM   6425 C C   . TYR D 1 126 ? 76.889  74.919  34.048 1.00 37.74 ? 126  TYR D C   1 
ATOM   6426 O O   . TYR D 1 126 ? 77.239  74.424  32.976 1.00 42.33 ? 126  TYR D O   1 
ATOM   6427 C CB  . TYR D 1 126 ? 78.008  74.304  36.201 1.00 37.78 ? 126  TYR D CB  1 
ATOM   6428 C CG  . TYR D 1 126 ? 78.241  72.885  35.721 1.00 44.54 ? 126  TYR D CG  1 
ATOM   6429 C CD1 . TYR D 1 126 ? 79.418  72.527  35.053 1.00 46.53 ? 126  TYR D CD1 1 
ATOM   6430 C CD2 . TYR D 1 126 ? 77.284  71.895  35.944 1.00 43.71 ? 126  TYR D CD2 1 
ATOM   6431 C CE1 . TYR D 1 126 ? 79.633  71.215  34.626 1.00 45.21 ? 126  TYR D CE1 1 
ATOM   6432 C CE2 . TYR D 1 126 ? 77.488  70.586  35.521 1.00 39.70 ? 126  TYR D CE2 1 
ATOM   6433 C CZ  . TYR D 1 126 ? 78.661  70.250  34.872 1.00 42.95 ? 126  TYR D CZ  1 
ATOM   6434 O OH  . TYR D 1 126 ? 78.864  68.939  34.512 1.00 47.53 ? 126  TYR D OH  1 
ATOM   6435 N N   . LEU D 1 127 ? 75.620  75.188  34.340 1.00 36.49 ? 127  LEU D N   1 
ATOM   6436 C CA  . LEU D 1 127 ? 74.519  74.789  33.469 1.00 37.98 ? 127  LEU D CA  1 
ATOM   6437 C C   . LEU D 1 127 ? 74.512  75.526  32.128 1.00 42.54 ? 127  LEU D C   1 
ATOM   6438 O O   . LEU D 1 127 ? 73.847  75.103  31.174 1.00 43.82 ? 127  LEU D O   1 
ATOM   6439 C CB  . LEU D 1 127 ? 73.190  75.022  34.191 1.00 38.35 ? 127  LEU D CB  1 
ATOM   6440 C CG  . LEU D 1 127 ? 72.339  73.774  34.412 1.00 39.96 ? 127  LEU D CG  1 
ATOM   6441 C CD1 . LEU D 1 127 ? 73.097  72.775  35.274 1.00 39.80 ? 127  LEU D CD1 1 
ATOM   6442 C CD2 . LEU D 1 127 ? 71.025  74.156  35.064 1.00 41.00 ? 127  LEU D CD2 1 
ATOM   6443 N N   . GLU D 1 128 ? 75.211  76.657  32.081 1.00 44.88 ? 128  GLU D N   1 
ATOM   6444 C CA  . GLU D 1 128 ? 75.309  77.457  30.867 1.00 51.07 ? 128  GLU D CA  1 
ATOM   6445 C C   . GLU D 1 128 ? 76.322  76.839  29.914 1.00 49.41 ? 128  GLU D C   1 
ATOM   6446 O O   . GLU D 1 128 ? 76.043  76.665  28.726 1.00 46.45 ? 128  GLU D O   1 
ATOM   6447 C CB  . GLU D 1 128 ? 75.729  78.891  31.212 1.00 49.98 ? 128  GLU D CB  1 
ATOM   6448 C CG  . GLU D 1 128 ? 74.571  79.864  31.355 1.00 57.61 ? 128  GLU D CG  1 
ATOM   6449 C CD  . GLU D 1 128 ? 74.992  81.185  31.977 1.00 67.43 ? 128  GLU D CD  1 
ATOM   6450 O OE1 . GLU D 1 128 ? 75.401  82.100  31.227 1.00 69.85 ? 128  GLU D OE1 1 
ATOM   6451 O OE2 . GLU D 1 128 ? 74.919  81.306  33.221 1.00 69.13 ? 128  GLU D OE2 1 
ATOM   6452 N N   . LEU D 1 129 ? 77.496  76.505  30.445 1.00 47.15 ? 129  LEU D N   1 
ATOM   6453 C CA  . LEU D 1 129 ? 78.570  75.953  29.629 1.00 46.01 ? 129  LEU D CA  1 
ATOM   6454 C C   . LEU D 1 129 ? 78.384  74.467  29.322 1.00 48.25 ? 129  LEU D C   1 
ATOM   6455 O O   . LEU D 1 129 ? 79.049  73.926  28.433 1.00 53.89 ? 129  LEU D O   1 
ATOM   6456 C CB  . LEU D 1 129 ? 79.928  76.192  30.299 1.00 45.81 ? 129  LEU D CB  1 
ATOM   6457 C CG  . LEU D 1 129 ? 80.071  75.913  31.799 1.00 53.41 ? 129  LEU D CG  1 
ATOM   6458 C CD1 . LEU D 1 129 ? 80.372  74.427  32.039 1.00 57.27 ? 129  LEU D CD1 1 
ATOM   6459 C CD2 . LEU D 1 129 ? 81.187  76.796  32.372 1.00 54.12 ? 129  LEU D CD2 1 
ATOM   6460 N N   . LEU D 1 130 ? 77.415  73.840  29.990 1.00 39.97 ? 130  LEU D N   1 
ATOM   6461 C CA  . LEU D 1 130 ? 77.168  72.406  29.845 1.00 32.85 ? 130  LEU D CA  1 
ATOM   6462 C C   . LEU D 1 130 ? 76.701  72.005  28.447 1.00 28.30 ? 130  LEU D C   1 
ATOM   6463 O O   . LEU D 1 130 ? 77.268  71.091  27.850 1.00 37.25 ? 130  LEU D O   1 
ATOM   6464 C CB  . LEU D 1 130 ? 76.146  71.919  30.881 1.00 30.43 ? 130  LEU D CB  1 
ATOM   6465 C CG  . LEU D 1 130 ? 76.313  70.523  31.497 1.00 27.91 ? 130  LEU D CG  1 
ATOM   6466 C CD1 . LEU D 1 130 ? 74.947  70.008  31.861 1.00 33.04 ? 130  LEU D CD1 1 
ATOM   6467 C CD2 . LEU D 1 130 ? 76.983  69.548  30.555 1.00 27.06 ? 130  LEU D CD2 1 
ATOM   6468 N N   . PRO D 1 131 ? 75.628  72.630  27.933 1.00 23.90 ? 131  PRO D N   1 
ATOM   6469 C CA  . PRO D 1 131 ? 75.106  72.224  26.622 1.00 24.42 ? 131  PRO D CA  1 
ATOM   6470 C C   . PRO D 1 131 ? 76.160  72.247  25.506 1.00 25.86 ? 131  PRO D C   1 
ATOM   6471 O O   . PRO D 1 131 ? 76.146  71.414  24.590 1.00 20.02 ? 131  PRO D O   1 
ATOM   6472 C CB  . PRO D 1 131 ? 73.975  73.227  26.361 1.00 27.82 ? 131  PRO D CB  1 
ATOM   6473 C CG  . PRO D 1 131 ? 74.249  74.368  27.288 1.00 28.24 ? 131  PRO D CG  1 
ATOM   6474 C CD  . PRO D 1 131 ? 74.828  73.725  28.504 1.00 27.37 ? 131  PRO D CD  1 
ATOM   6475 N N   . GLY D 1 132 ? 77.098  73.184  25.615 1.00 31.63 ? 132  GLY D N   1 
ATOM   6476 C CA  . GLY D 1 132 ? 78.149  73.299  24.621 1.00 32.17 ? 132  GLY D CA  1 
ATOM   6477 C C   . GLY D 1 132 ? 79.123  72.146  24.702 1.00 32.89 ? 132  GLY D C   1 
ATOM   6478 O O   . GLY D 1 132 ? 79.544  71.611  23.680 1.00 33.10 ? 132  GLY D O   1 
ATOM   6479 N N   . LYS D 1 133 ? 79.466  71.749  25.923 1.00 32.44 ? 133  LYS D N   1 
ATOM   6480 C CA  . LYS D 1 133 ? 80.345  70.609  26.133 1.00 30.62 ? 133  LYS D CA  1 
ATOM   6481 C C   . LYS D 1 133 ? 79.694  69.321  25.632 1.00 30.31 ? 133  LYS D C   1 
ATOM   6482 O O   . LYS D 1 133 ? 80.321  68.554  24.903 1.00 26.17 ? 133  LYS D O   1 
ATOM   6483 C CB  . LYS D 1 133 ? 80.722  70.500  27.617 1.00 29.62 ? 133  LYS D CB  1 
ATOM   6484 C CG  . LYS D 1 133 ? 81.657  71.623  28.114 1.00 30.91 ? 133  LYS D CG  1 
ATOM   6485 C CD  . LYS D 1 133 ? 82.982  71.635  27.337 1.00 36.39 ? 133  LYS D CD  1 
ATOM   6486 C CE  . LYS D 1 133 ? 83.979  72.676  27.854 1.00 32.76 ? 133  LYS D CE  1 
ATOM   6487 N NZ  . LYS D 1 133 ? 85.255  72.686  27.051 1.00 35.09 ? 133  LYS D NZ  1 
ATOM   6488 N N   . LEU D 1 134 ? 78.391  69.181  25.882 1.00 29.09 ? 134  LEU D N   1 
ATOM   6489 C CA  . LEU D 1 134 ? 77.625  68.024  25.410 1.00 21.87 ? 134  LEU D CA  1 
ATOM   6490 C C   . LEU D 1 134 ? 77.480  68.004  23.882 1.00 23.36 ? 134  LEU D C   1 
ATOM   6491 O O   . LEU D 1 134 ? 77.447  66.937  23.279 1.00 24.59 ? 134  LEU D O   1 
ATOM   6492 C CB  . LEU D 1 134 ? 76.240  67.998  26.067 1.00 16.06 ? 134  LEU D CB  1 
ATOM   6493 C CG  . LEU D 1 134 ? 76.100  67.790  27.582 1.00 18.39 ? 134  LEU D CG  1 
ATOM   6494 C CD1 . LEU D 1 134 ? 74.624  67.868  27.974 1.00 15.53 ? 134  LEU D CD1 1 
ATOM   6495 C CD2 . LEU D 1 134 ? 76.670  66.445  27.990 1.00 24.94 ? 134  LEU D CD2 1 
ATOM   6496 N N   . ARG D 1 135 ? 77.421  69.188  23.270 1.00 29.40 ? 135  ARG D N   1 
ATOM   6497 C CA  . ARG D 1 135 ? 77.366  69.331  21.814 1.00 36.23 ? 135  ARG D CA  1 
ATOM   6498 C C   . ARG D 1 135 ? 78.689  68.915  21.150 1.00 37.89 ? 135  ARG D C   1 
ATOM   6499 O O   . ARG D 1 135 ? 78.713  68.452  20.003 1.00 36.80 ? 135  ARG D O   1 
ATOM   6500 C CB  . ARG D 1 135 ? 77.052  70.788  21.457 1.00 38.01 ? 135  ARG D CB  1 
ATOM   6501 C CG  . ARG D 1 135 ? 75.762  70.995  20.674 1.00 45.53 ? 135  ARG D CG  1 
ATOM   6502 C CD  . ARG D 1 135 ? 74.723  71.713  21.510 1.00 44.54 ? 135  ARG D CD  1 
ATOM   6503 N NE  . ARG D 1 135 ? 75.229  72.984  22.024 1.00 51.96 ? 135  ARG D NE  1 
ATOM   6504 C CZ  . ARG D 1 135 ? 74.463  73.990  22.442 1.00 51.25 ? 135  ARG D CZ  1 
ATOM   6505 N NH1 . ARG D 1 135 ? 73.139  73.867  22.461 1.00 51.50 ? 135  ARG D NH1 1 
ATOM   6506 N NH2 . ARG D 1 135 ? 75.027  75.115  22.868 1.00 48.45 ? 135  ARG D NH2 1 
ATOM   6507 N N   . GLN D 1 136 ? 79.787  69.142  21.868 1.00 36.98 ? 136  GLN D N   1 
ATOM   6508 C CA  . GLN D 1 136 ? 81.125  68.747  21.435 1.00 32.53 ? 136  GLN D CA  1 
ATOM   6509 C C   . GLN D 1 136 ? 81.169  67.233  21.237 1.00 31.93 ? 136  GLN D C   1 
ATOM   6510 O O   . GLN D 1 136 ? 81.613  66.739  20.196 1.00 27.19 ? 136  GLN D O   1 
ATOM   6511 C CB  . GLN D 1 136 ? 82.138  69.135  22.523 1.00 39.29 ? 136  GLN D CB  1 
ATOM   6512 C CG  . GLN D 1 136 ? 83.092  70.292  22.196 1.00 36.63 ? 136  GLN D CG  1 
ATOM   6513 C CD  . GLN D 1 136 ? 83.970  70.709  23.389 1.00 38.79 ? 136  GLN D CD  1 
ATOM   6514 O OE1 . GLN D 1 136 ? 84.390  71.866  23.483 1.00 42.39 ? 136  GLN D OE1 1 
ATOM   6515 N NE2 . GLN D 1 136 ? 84.248  69.763  24.301 1.00 36.81 ? 136  GLN D NE2 1 
ATOM   6516 N N   . LEU D 1 137 ? 80.745  66.524  22.283 1.00 29.13 ? 137  LEU D N   1 
ATOM   6517 C CA  . LEU D 1 137 ? 80.772  65.064  22.352 1.00 22.78 ? 137  LEU D CA  1 
ATOM   6518 C C   . LEU D 1 137 ? 79.785  64.458  21.357 1.00 24.99 ? 137  LEU D C   1 
ATOM   6519 O O   . LEU D 1 137 ? 80.011  63.368  20.833 1.00 25.76 ? 137  LEU D O   1 
ATOM   6520 C CB  . LEU D 1 137 ? 80.422  64.609  23.780 1.00 17.90 ? 137  LEU D CB  1 
ATOM   6521 C CG  . LEU D 1 137 ? 81.463  64.035  24.766 1.00 17.87 ? 137  LEU D CG  1 
ATOM   6522 C CD1 . LEU D 1 137 ? 82.879  64.316  24.323 1.00 13.04 ? 137  LEU D CD1 1 
ATOM   6523 C CD2 . LEU D 1 137 ? 81.226  64.610  26.156 1.00 14.46 ? 137  LEU D CD2 1 
ATOM   6524 N N   . SER D 1 138 ? 78.686  65.167  21.116 1.00 29.61 ? 138  SER D N   1 
ATOM   6525 C CA  . SER D 1 138 ? 77.682  64.774  20.128 1.00 28.52 ? 138  SER D CA  1 
ATOM   6526 C C   . SER D 1 138 ? 78.284  64.818  18.726 1.00 27.90 ? 138  SER D C   1 
ATOM   6527 O O   . SER D 1 138 ? 78.063  63.921  17.912 1.00 31.83 ? 138  SER D O   1 
ATOM   6528 C CB  . SER D 1 138 ? 76.491  65.736  20.202 1.00 30.26 ? 138  SER D CB  1 
ATOM   6529 O OG  . SER D 1 138 ? 75.253  65.051  20.273 1.00 39.25 ? 138  SER D OG  1 
ATOM   6530 N N   . ARG D 1 139 ? 79.065  65.864  18.465 1.00 35.80 ? 139  ARG D N   1 
ATOM   6531 C CA  . ARG D 1 139 ? 79.724  66.060  17.174 1.00 39.73 ? 139  ARG D CA  1 
ATOM   6532 C C   . ARG D 1 139 ? 80.770  64.984  16.932 1.00 35.19 ? 139  ARG D C   1 
ATOM   6533 O O   . ARG D 1 139 ? 80.814  64.375  15.863 1.00 39.54 ? 139  ARG D O   1 
ATOM   6534 C CB  . ARG D 1 139 ? 80.393  67.437  17.132 1.00 45.35 ? 139  ARG D CB  1 
ATOM   6535 C CG  . ARG D 1 139 ? 80.068  68.263  15.893 1.00 56.08 ? 139  ARG D CG  1 
ATOM   6536 C CD  . ARG D 1 139 ? 78.563  68.518  15.768 1.00 65.60 ? 139  ARG D CD  1 
ATOM   6537 N NE  . ARG D 1 139 ? 78.167  69.864  16.195 1.00 66.30 ? 139  ARG D NE  1 
ATOM   6538 C CZ  . ARG D 1 139 ? 77.217  70.128  17.092 1.00 65.75 ? 139  ARG D CZ  1 
ATOM   6539 N NH1 . ARG D 1 139 ? 76.638  69.144  17.773 1.00 60.17 ? 139  ARG D NH1 1 
ATOM   6540 N NH2 . ARG D 1 139 ? 76.878  71.387  17.344 1.00 64.80 ? 139  ARG D NH2 1 
ATOM   6541 N N   . PHE D 1 140 ? 81.546  64.690  17.970 1.00 34.95 ? 140  PHE D N   1 
ATOM   6542 C CA  . PHE D 1 140 ? 82.629  63.728  17.866 1.00 27.87 ? 140  PHE D CA  1 
ATOM   6543 C C   . PHE D 1 140 ? 82.138  62.317  17.560 1.00 27.06 ? 140  PHE D C   1 
ATOM   6544 O O   . PHE D 1 140 ? 82.595  61.695  16.606 1.00 30.35 ? 140  PHE D O   1 
ATOM   6545 C CB  . PHE D 1 140 ? 83.447  63.717  19.147 1.00 25.89 ? 140  PHE D CB  1 
ATOM   6546 C CG  . PHE D 1 140 ? 84.717  62.946  19.030 1.00 25.34 ? 140  PHE D CG  1 
ATOM   6547 C CD1 . PHE D 1 140 ? 85.738  63.405  18.217 1.00 20.73 ? 140  PHE D CD1 1 
ATOM   6548 C CD2 . PHE D 1 140 ? 84.865  61.729  19.676 1.00 23.86 ? 140  PHE D CD2 1 
ATOM   6549 C CE1 . PHE D 1 140 ? 86.888  62.661  18.043 1.00 27.08 ? 140  PHE D CE1 1 
ATOM   6550 C CE2 . PHE D 1 140 ? 86.011  60.977  19.508 1.00 30.41 ? 140  PHE D CE2 1 
ATOM   6551 C CZ  . PHE D 1 140 ? 87.026  61.444  18.688 1.00 31.00 ? 140  PHE D CZ  1 
ATOM   6552 N N   . LEU D 1 141 ? 81.206  61.827  18.371 1.00 26.80 ? 141  LEU D N   1 
ATOM   6553 C CA  . LEU D 1 141 ? 80.597  60.511  18.177 1.00 21.11 ? 141  LEU D CA  1 
ATOM   6554 C C   . LEU D 1 141 ? 79.981  60.359  16.783 1.00 19.70 ? 141  LEU D C   1 
ATOM   6555 O O   . LEU D 1 141 ? 80.199  59.352  16.113 1.00 24.28 ? 141  LEU D O   1 
ATOM   6556 C CB  . LEU D 1 141 ? 79.526  60.294  19.247 1.00 12.05 ? 141  LEU D CB  1 
ATOM   6557 C CG  . LEU D 1 141 ? 78.746  58.986  19.217 1.00 7.58  ? 141  LEU D CG  1 
ATOM   6558 C CD1 . LEU D 1 141 ? 79.708  57.819  19.204 1.00 11.09 ? 141  LEU D CD1 1 
ATOM   6559 C CD2 . LEU D 1 141 ? 77.829  58.934  20.417 1.00 2.00  ? 141  LEU D CD2 1 
ATOM   6560 N N   . GLY D 1 142 ? 79.195  61.356  16.376 1.00 25.23 ? 142  GLY D N   1 
ATOM   6561 C CA  . GLY D 1 142 ? 78.562  61.345  15.069 1.00 23.42 ? 142  GLY D CA  1 
ATOM   6562 C C   . GLY D 1 142 ? 77.532  60.244  14.903 1.00 21.49 ? 142  GLY D C   1 
ATOM   6563 O O   . GLY D 1 142 ? 76.723  59.997  15.796 1.00 18.75 ? 142  GLY D O   1 
ATOM   6564 N N   . SER D 1 143 ? 77.573  59.574  13.756 1.00 31.04 ? 143  SER D N   1 
ATOM   6565 C CA  . SER D 1 143 ? 76.704  58.430  13.495 1.00 32.56 ? 143  SER D CA  1 
ATOM   6566 C C   . SER D 1 143 ? 77.392  57.103  13.817 1.00 35.92 ? 143  SER D C   1 
ATOM   6567 O O   . SER D 1 143 ? 76.884  56.022  13.501 1.00 36.48 ? 143  SER D O   1 
ATOM   6568 C CB  . SER D 1 143 ? 76.256  58.440  12.038 1.00 32.48 ? 143  SER D CB  1 
ATOM   6569 O OG  . SER D 1 143 ? 77.378  58.428  11.178 1.00 45.63 ? 143  SER D OG  1 
ATOM   6570 N N   . ARG D 1 144 ? 78.517  57.198  14.513 1.00 35.66 ? 144  ARG D N   1 
ATOM   6571 C CA  . ARG D 1 144 ? 79.274  56.039  14.941 1.00 28.41 ? 144  ARG D CA  1 
ATOM   6572 C C   . ARG D 1 144 ? 78.494  55.215  15.965 1.00 29.71 ? 144  ARG D C   1 
ATOM   6573 O O   . ARG D 1 144 ? 77.583  55.722  16.625 1.00 30.33 ? 144  ARG D O   1 
ATOM   6574 C CB  . ARG D 1 144 ? 80.590  56.509  15.547 1.00 28.30 ? 144  ARG D CB  1 
ATOM   6575 C CG  . ARG D 1 144 ? 81.763  55.623  15.252 1.00 30.90 ? 144  ARG D CG  1 
ATOM   6576 C CD  . ARG D 1 144 ? 83.027  56.256  15.773 1.00 34.26 ? 144  ARG D CD  1 
ATOM   6577 N NE  . ARG D 1 144 ? 83.332  57.467  15.032 1.00 37.89 ? 144  ARG D NE  1 
ATOM   6578 C CZ  . ARG D 1 144 ? 83.366  58.680  15.564 1.00 37.84 ? 144  ARG D CZ  1 
ATOM   6579 N NH1 . ARG D 1 144 ? 83.187  58.849  16.869 1.00 32.76 ? 144  ARG D NH1 1 
ATOM   6580 N NH2 . ARG D 1 144 ? 83.603  59.725  14.782 1.00 39.66 ? 144  ARG D NH2 1 
ATOM   6581 N N   . SER D 1 145 ? 78.812  53.926  16.032 1.00 32.43 ? 145  SER D N   1 
ATOM   6582 C CA  . SER D 1 145 ? 78.276  53.032  17.053 1.00 33.59 ? 145  SER D CA  1 
ATOM   6583 C C   . SER D 1 145 ? 78.953  53.294  18.403 1.00 30.60 ? 145  SER D C   1 
ATOM   6584 O O   . SER D 1 145 ? 78.290  53.590  19.393 1.00 33.05 ? 145  SER D O   1 
ATOM   6585 C CB  . SER D 1 145 ? 78.476  51.574  16.603 1.00 34.46 ? 145  SER D CB  1 
ATOM   6586 O OG  . SER D 1 145 ? 78.899  50.732  17.661 1.00 39.46 ? 145  SER D OG  1 
ATOM   6587 N N   . TRP D 1 146 ? 80.282  53.261  18.409 1.00 29.68 ? 146  TRP D N   1 
ATOM   6588 C CA  . TRP D 1 146 ? 81.067  53.486  19.619 1.00 20.15 ? 146  TRP D CA  1 
ATOM   6589 C C   . TRP D 1 146 ? 81.954  54.719  19.451 1.00 19.12 ? 146  TRP D C   1 
ATOM   6590 O O   . TRP D 1 146 ? 82.014  55.303  18.375 1.00 29.32 ? 146  TRP D O   1 
ATOM   6591 C CB  . TRP D 1 146 ? 81.909  52.240  19.927 1.00 15.72 ? 146  TRP D CB  1 
ATOM   6592 C CG  . TRP D 1 146 ? 81.087  50.978  20.032 1.00 15.07 ? 146  TRP D CG  1 
ATOM   6593 C CD1 . TRP D 1 146 ? 81.181  49.867  19.238 1.00 14.44 ? 146  TRP D CD1 1 
ATOM   6594 C CD2 . TRP D 1 146 ? 79.963  50.755  20.898 1.00 15.75 ? 146  TRP D CD2 1 
ATOM   6595 N NE1 . TRP D 1 146 ? 80.173  48.980  19.541 1.00 9.66  ? 146  TRP D NE1 1 
ATOM   6596 C CE2 . TRP D 1 146 ? 79.417  49.498  20.560 1.00 12.67 ? 146  TRP D CE2 1 
ATOM   6597 C CE3 . TRP D 1 146 ? 79.354  51.506  21.917 1.00 15.41 ? 146  TRP D CE3 1 
ATOM   6598 C CZ2 . TRP D 1 146 ? 78.295  48.977  21.205 1.00 11.73 ? 146  TRP D CZ2 1 
ATOM   6599 C CZ3 . TRP D 1 146 ? 78.238  50.986  22.552 1.00 7.25  ? 146  TRP D CZ3 1 
ATOM   6600 C CH2 . TRP D 1 146 ? 77.721  49.737  22.193 1.00 12.12 ? 146  TRP D CH2 1 
ATOM   6601 N N   . PHE D 1 147 ? 82.634  55.122  20.519 1.00 23.42 ? 147  PHE D N   1 
ATOM   6602 C CA  . PHE D 1 147 ? 83.350  56.395  20.523 1.00 22.83 ? 147  PHE D CA  1 
ATOM   6603 C C   . PHE D 1 147 ? 84.677  56.433  19.755 1.00 17.21 ? 147  PHE D C   1 
ATOM   6604 O O   . PHE D 1 147 ? 85.067  57.482  19.255 1.00 25.36 ? 147  PHE D O   1 
ATOM   6605 C CB  . PHE D 1 147 ? 83.564  56.862  21.958 1.00 14.10 ? 147  PHE D CB  1 
ATOM   6606 C CG  . PHE D 1 147 ? 82.681  58.001  22.352 1.00 13.28 ? 147  PHE D CG  1 
ATOM   6607 C CD1 . PHE D 1 147 ? 82.909  59.276  21.855 1.00 13.90 ? 147  PHE D CD1 1 
ATOM   6608 C CD2 . PHE D 1 147 ? 81.582  57.794  23.173 1.00 16.06 ? 147  PHE D CD2 1 
ATOM   6609 C CE1 . PHE D 1 147 ? 82.049  60.328  22.167 1.00 18.59 ? 147  PHE D CE1 1 
ATOM   6610 C CE2 . PHE D 1 147 ? 80.716  58.839  23.491 1.00 12.99 ? 147  PHE D CE2 1 
ATOM   6611 C CZ  . PHE D 1 147 ? 80.948  60.103  22.990 1.00 16.06 ? 147  PHE D CZ  1 
ATOM   6612 N N   . VAL D 1 148 ? 85.340  55.288  19.623 1.00 11.79 ? 148  VAL D N   1 
ATOM   6613 C CA  . VAL D 1 148 ? 86.636  55.213  18.951 1.00 11.67 ? 148  VAL D CA  1 
ATOM   6614 C C   . VAL D 1 148 ? 86.534  54.569  17.562 1.00 17.58 ? 148  VAL D C   1 
ATOM   6615 O O   . VAL D 1 148 ? 87.460  54.651  16.756 1.00 20.40 ? 148  VAL D O   1 
ATOM   6616 C CB  . VAL D 1 148 ? 87.645  54.429  19.817 1.00 11.26 ? 148  VAL D CB  1 
ATOM   6617 C CG1 . VAL D 1 148 ? 89.001  54.329  19.132 1.00 2.20  ? 148  VAL D CG1 1 
ATOM   6618 C CG2 . VAL D 1 148 ? 87.783  55.109  21.160 1.00 11.97 ? 148  VAL D CG2 1 
ATOM   6619 N N   . GLY D 1 149 ? 85.384  53.976  17.268 1.00 23.20 ? 149  GLY D N   1 
ATOM   6620 C CA  . GLY D 1 149 ? 85.171  53.400  15.956 1.00 19.73 ? 149  GLY D CA  1 
ATOM   6621 C C   . GLY D 1 149 ? 84.124  52.307  15.964 1.00 29.33 ? 149  GLY D C   1 
ATOM   6622 O O   . GLY D 1 149 ? 82.992  52.497  16.421 1.00 36.92 ? 149  GLY D O   1 
ATOM   6623 N N   . ASP D 1 150 ? 84.508  51.157  15.430 1.00 28.17 ? 150  ASP D N   1 
ATOM   6624 C CA  . ASP D 1 150 ? 83.611  50.020  15.301 1.00 30.17 ? 150  ASP D CA  1 
ATOM   6625 C C   . ASP D 1 150 ? 83.633  49.198  16.580 1.00 29.02 ? 150  ASP D C   1 
ATOM   6626 O O   . ASP D 1 150 ? 82.678  48.491  16.902 1.00 31.57 ? 150  ASP D O   1 
ATOM   6627 C CB  . ASP D 1 150 ? 84.060  49.144  14.129 1.00 29.64 ? 150  ASP D CB  1 
ATOM   6628 C CG  . ASP D 1 150 ? 84.130  49.906  12.819 1.00 29.45 ? 150  ASP D CG  1 
ATOM   6629 O OD1 . ASP D 1 150 ? 83.848  51.125  12.797 1.00 23.25 ? 150  ASP D OD1 1 
ATOM   6630 O OD2 . ASP D 1 150 ? 84.424  49.262  11.789 1.00 32.22 ? 150  ASP D OD2 1 
ATOM   6631 N N   . LYS D 1 151 ? 84.769  49.243  17.262 1.00 26.67 ? 151  LYS D N   1 
ATOM   6632 C CA  . LYS D 1 151 ? 85.000  48.398  18.413 1.00 28.33 ? 151  LYS D CA  1 
ATOM   6633 C C   . LYS D 1 151 ? 84.683  49.144  19.693 1.00 32.04 ? 151  LYS D C   1 
ATOM   6634 O O   . LYS D 1 151 ? 84.989  50.332  19.830 1.00 33.79 ? 151  LYS D O   1 
ATOM   6635 C CB  . LYS D 1 151 ? 86.456  47.930  18.444 1.00 29.94 ? 151  LYS D CB  1 
ATOM   6636 C CG  . LYS D 1 151 ? 86.787  46.875  17.412 1.00 34.93 ? 151  LYS D CG  1 
ATOM   6637 C CD  . LYS D 1 151 ? 86.110  45.548  17.737 1.00 36.00 ? 151  LYS D CD  1 
ATOM   6638 C CE  . LYS D 1 151 ? 85.876  44.710  16.470 1.00 40.35 ? 151  LYS D CE  1 
ATOM   6639 N NZ  . LYS D 1 151 ? 84.538  44.962  15.831 1.00 32.51 ? 151  LYS D NZ  1 
ATOM   6640 N N   . LEU D 1 152 ? 84.050  48.433  20.621 1.00 31.26 ? 152  LEU D N   1 
ATOM   6641 C CA  . LEU D 1 152 ? 83.929  48.886  21.994 1.00 22.01 ? 152  LEU D CA  1 
ATOM   6642 C C   . LEU D 1 152 ? 85.311  48.915  22.647 1.00 23.30 ? 152  LEU D C   1 
ATOM   6643 O O   . LEU D 1 152 ? 86.121  48.009  22.444 1.00 32.05 ? 152  LEU D O   1 
ATOM   6644 C CB  . LEU D 1 152 ? 83.001  47.950  22.759 1.00 22.90 ? 152  LEU D CB  1 
ATOM   6645 C CG  . LEU D 1 152 ? 82.699  48.314  24.212 1.00 29.44 ? 152  LEU D CG  1 
ATOM   6646 C CD1 . LEU D 1 152 ? 81.858  49.565  24.291 1.00 31.00 ? 152  LEU D CD1 1 
ATOM   6647 C CD2 . LEU D 1 152 ? 81.979  47.174  24.862 1.00 22.82 ? 152  LEU D CD2 1 
ATOM   6648 N N   . THR D 1 153 ? 85.613  50.019  23.324 1.00 21.73 ? 153  THR D N   1 
ATOM   6649 C CA  . THR D 1 153 ? 86.877  50.189  24.033 1.00 17.46 ? 153  THR D CA  1 
ATOM   6650 C C   . THR D 1 153 ? 86.589  50.716  25.439 1.00 20.33 ? 153  THR D C   1 
ATOM   6651 O O   . THR D 1 153 ? 85.452  51.069  25.756 1.00 22.06 ? 153  THR D O   1 
ATOM   6652 C CB  . THR D 1 153 ? 87.788  51.188  23.303 1.00 20.11 ? 153  THR D CB  1 
ATOM   6653 O OG1 . THR D 1 153 ? 87.071  52.407  23.079 1.00 17.05 ? 153  THR D OG1 1 
ATOM   6654 C CG2 . THR D 1 153 ? 88.242  50.621  21.961 1.00 19.33 ? 153  THR D CG2 1 
ATOM   6655 N N   . PHE D 1 154 ? 87.615  50.789  26.279 1.00 19.22 ? 154  PHE D N   1 
ATOM   6656 C CA  . PHE D 1 154 ? 87.405  51.202  27.666 1.00 16.67 ? 154  PHE D CA  1 
ATOM   6657 C C   . PHE D 1 154 ? 86.947  52.656  27.782 1.00 14.53 ? 154  PHE D C   1 
ATOM   6658 O O   . PHE D 1 154 ? 86.390  53.049  28.800 1.00 24.20 ? 154  PHE D O   1 
ATOM   6659 C CB  . PHE D 1 154 ? 88.674  50.970  28.514 1.00 10.89 ? 154  PHE D CB  1 
ATOM   6660 C CG  . PHE D 1 154 ? 89.773  51.982  28.282 1.00 3.85  ? 154  PHE D CG  1 
ATOM   6661 C CD1 . PHE D 1 154 ? 90.654  51.843  27.218 1.00 2.00  ? 154  PHE D CD1 1 
ATOM   6662 C CD2 . PHE D 1 154 ? 89.919  53.070  29.129 1.00 2.25  ? 154  PHE D CD2 1 
ATOM   6663 C CE1 . PHE D 1 154 ? 91.666  52.780  27.003 1.00 2.99  ? 154  PHE D CE1 1 
ATOM   6664 C CE2 . PHE D 1 154 ? 90.930  54.010  28.921 1.00 9.05  ? 154  PHE D CE2 1 
ATOM   6665 C CZ  . PHE D 1 154 ? 91.803  53.864  27.858 1.00 2.00  ? 154  PHE D CZ  1 
ATOM   6666 N N   . VAL D 1 155 ? 87.188  53.450  26.743 1.00 11.73 ? 155  VAL D N   1 
ATOM   6667 C CA  . VAL D 1 155 ? 86.826  54.865  26.770 1.00 11.63 ? 155  VAL D CA  1 
ATOM   6668 C C   . VAL D 1 155 ? 85.321  55.027  26.700 1.00 9.23  ? 155  VAL D C   1 
ATOM   6669 O O   . VAL D 1 155 ? 84.775  56.029  27.157 1.00 10.75 ? 155  VAL D O   1 
ATOM   6670 C CB  . VAL D 1 155 ? 87.467  55.662  25.612 1.00 5.56  ? 155  VAL D CB  1 
ATOM   6671 C CG1 . VAL D 1 155 ? 88.726  56.321  26.079 1.00 2.00  ? 155  VAL D CG1 1 
ATOM   6672 C CG2 . VAL D 1 155 ? 87.790  54.753  24.466 1.00 8.36  ? 155  VAL D CG2 1 
ATOM   6673 N N   . ASP D 1 156 ? 84.658  54.004  26.172 1.00 15.90 ? 156  ASP D N   1 
ATOM   6674 C CA  . ASP D 1 156 ? 83.203  53.968  26.100 1.00 17.35 ? 156  ASP D CA  1 
ATOM   6675 C C   . ASP D 1 156 ? 82.583  53.801  27.483 1.00 13.54 ? 156  ASP D C   1 
ATOM   6676 O O   . ASP D 1 156 ? 81.487  54.298  27.745 1.00 24.74 ? 156  ASP D O   1 
ATOM   6677 C CB  . ASP D 1 156 ? 82.759  52.831  25.179 1.00 18.52 ? 156  ASP D CB  1 
ATOM   6678 C CG  . ASP D 1 156 ? 82.968  53.158  23.714 1.00 17.08 ? 156  ASP D CG  1 
ATOM   6679 O OD1 . ASP D 1 156 ? 82.238  54.032  23.201 1.00 19.07 ? 156  ASP D OD1 1 
ATOM   6680 O OD2 . ASP D 1 156 ? 83.873  52.567  23.081 1.00 20.56 ? 156  ASP D OD2 1 
ATOM   6681 N N   . PHE D 1 157 ? 83.322  53.155  28.380 1.00 12.60 ? 157  PHE D N   1 
ATOM   6682 C CA  . PHE D 1 157 ? 82.889  52.970  29.765 1.00 12.30 ? 157  PHE D CA  1 
ATOM   6683 C C   . PHE D 1 157 ? 83.056  54.243  30.587 1.00 16.50 ? 157  PHE D C   1 
ATOM   6684 O O   . PHE D 1 157 ? 82.281  54.498  31.510 1.00 14.46 ? 157  PHE D O   1 
ATOM   6685 C CB  . PHE D 1 157 ? 83.672  51.835  30.421 1.00 6.74  ? 157  PHE D CB  1 
ATOM   6686 C CG  . PHE D 1 157 ? 83.373  50.487  29.840 1.00 4.69  ? 157  PHE D CG  1 
ATOM   6687 C CD1 . PHE D 1 157 ? 83.685  50.200  28.513 1.00 8.59  ? 157  PHE D CD1 1 
ATOM   6688 C CD2 . PHE D 1 157 ? 82.796  49.501  30.620 1.00 8.55  ? 157  PHE D CD2 1 
ATOM   6689 C CE1 . PHE D 1 157 ? 83.434  48.951  27.970 1.00 11.28 ? 157  PHE D CE1 1 
ATOM   6690 C CE2 . PHE D 1 157 ? 82.535  48.244  30.090 1.00 23.36 ? 157  PHE D CE2 1 
ATOM   6691 C CZ  . PHE D 1 157 ? 82.858  47.967  28.756 1.00 16.58 ? 157  PHE D CZ  1 
ATOM   6692 N N   . LEU D 1 158 ? 84.078  55.029  30.254 1.00 19.78 ? 158  LEU D N   1 
ATOM   6693 C CA  . LEU D 1 158 ? 84.292  56.328  30.883 1.00 18.11 ? 158  LEU D CA  1 
ATOM   6694 C C   . LEU D 1 158 ? 83.254  57.320  30.389 1.00 13.88 ? 158  LEU D C   1 
ATOM   6695 O O   . LEU D 1 158 ? 82.681  58.057  31.185 1.00 18.86 ? 158  LEU D O   1 
ATOM   6696 C CB  . LEU D 1 158 ? 85.697  56.853  30.571 1.00 18.47 ? 158  LEU D CB  1 
ATOM   6697 C CG  . LEU D 1 158 ? 86.857  55.999  31.099 1.00 20.78 ? 158  LEU D CG  1 
ATOM   6698 C CD1 . LEU D 1 158 ? 88.192  56.553  30.619 1.00 17.19 ? 158  LEU D CD1 1 
ATOM   6699 C CD2 . LEU D 1 158 ? 86.810  55.941  32.613 1.00 16.17 ? 158  LEU D CD2 1 
ATOM   6700 N N   . ALA D 1 159 ? 82.989  57.301  29.081 1.00 14.75 ? 159  ALA D N   1 
ATOM   6701 C CA  . ALA D 1 159 ? 82.010  58.195  28.468 1.00 9.69  ? 159  ALA D CA  1 
ATOM   6702 C C   . ALA D 1 159 ? 80.631  57.961  29.063 1.00 19.15 ? 159  ALA D C   1 
ATOM   6703 O O   . ALA D 1 159 ? 80.005  58.889  29.565 1.00 19.69 ? 159  ALA D O   1 
ATOM   6704 C CB  . ALA D 1 159 ? 81.975  57.984  26.978 1.00 2.13  ? 159  ALA D CB  1 
ATOM   6705 N N   . TYR D 1 160 ? 80.242  56.690  29.144 1.00 23.89 ? 160  TYR D N   1 
ATOM   6706 C CA  . TYR D 1 160 ? 78.981  56.293  29.756 1.00 16.30 ? 160  TYR D CA  1 
ATOM   6707 C C   . TYR D 1 160 ? 78.860  56.801  31.183 1.00 11.97 ? 160  TYR D C   1 
ATOM   6708 O O   . TYR D 1 160 ? 77.855  57.393  31.541 1.00 25.32 ? 160  TYR D O   1 
ATOM   6709 C CB  . TYR D 1 160 ? 78.843  54.770  29.735 1.00 14.69 ? 160  TYR D CB  1 
ATOM   6710 C CG  . TYR D 1 160 ? 77.656  54.264  30.527 1.00 24.05 ? 160  TYR D CG  1 
ATOM   6711 C CD1 . TYR D 1 160 ? 76.371  54.262  29.978 1.00 26.47 ? 160  TYR D CD1 1 
ATOM   6712 C CD2 . TYR D 1 160 ? 77.800  53.864  31.854 1.00 27.63 ? 160  TYR D CD2 1 
ATOM   6713 C CE1 . TYR D 1 160 ? 75.259  53.887  30.738 1.00 22.92 ? 160  TYR D CE1 1 
ATOM   6714 C CE2 . TYR D 1 160 ? 76.699  53.483  32.621 1.00 27.90 ? 160  TYR D CE2 1 
ATOM   6715 C CZ  . TYR D 1 160 ? 75.434  53.501  32.060 1.00 28.33 ? 160  TYR D CZ  1 
ATOM   6716 O OH  . TYR D 1 160 ? 74.350  53.158  32.834 1.00 32.06 ? 160  TYR D OH  1 
ATOM   6717 N N   . ASP D 1 161 ? 79.882  56.551  31.993 1.00 17.25 ? 161  ASP D N   1 
ATOM   6718 C CA  . ASP D 1 161 ? 79.880  56.931  33.403 1.00 20.40 ? 161  ASP D CA  1 
ATOM   6719 C C   . ASP D 1 161 ? 79.739  58.443  33.573 1.00 17.48 ? 161  ASP D C   1 
ATOM   6720 O O   . ASP D 1 161 ? 78.915  58.908  34.356 1.00 23.36 ? 161  ASP D O   1 
ATOM   6721 C CB  . ASP D 1 161 ? 81.167  56.428  34.070 1.00 21.41 ? 161  ASP D CB  1 
ATOM   6722 C CG  . ASP D 1 161 ? 81.249  56.780  35.541 1.00 27.42 ? 161  ASP D CG  1 
ATOM   6723 O OD1 . ASP D 1 161 ? 80.191  56.951  36.181 1.00 35.58 ? 161  ASP D OD1 1 
ATOM   6724 O OD2 . ASP D 1 161 ? 82.379  56.865  36.069 1.00 31.75 ? 161  ASP D OD2 1 
ATOM   6725 N N   . VAL D 1 162 ? 80.475  59.185  32.752 1.00 16.41 ? 162  VAL D N   1 
ATOM   6726 C CA  . VAL D 1 162 ? 80.466  60.640  32.773 1.00 17.91 ? 162  VAL D CA  1 
ATOM   6727 C C   . VAL D 1 162 ? 79.104  61.180  32.338 1.00 27.13 ? 162  VAL D C   1 
ATOM   6728 O O   . VAL D 1 162 ? 78.526  62.042  33.009 1.00 31.14 ? 162  VAL D O   1 
ATOM   6729 C CB  . VAL D 1 162 ? 81.574  61.183  31.845 1.00 16.59 ? 162  VAL D CB  1 
ATOM   6730 C CG1 . VAL D 1 162 ? 81.360  62.662  31.535 1.00 11.89 ? 162  VAL D CG1 1 
ATOM   6731 C CG2 . VAL D 1 162 ? 82.930  60.961  32.496 1.00 18.92 ? 162  VAL D CG2 1 
ATOM   6732 N N   . LEU D 1 163 ? 78.568  60.625  31.255 1.00 25.50 ? 163  LEU D N   1 
ATOM   6733 C CA  . LEU D 1 163 ? 77.266  61.037  30.727 1.00 17.61 ? 163  LEU D CA  1 
ATOM   6734 C C   . LEU D 1 163 ? 76.120  60.634  31.645 1.00 22.75 ? 163  LEU D C   1 
ATOM   6735 O O   . LEU D 1 163 ? 75.122  61.342  31.741 1.00 22.51 ? 163  LEU D O   1 
ATOM   6736 C CB  . LEU D 1 163 ? 77.037  60.421  29.355 1.00 17.71 ? 163  LEU D CB  1 
ATOM   6737 C CG  . LEU D 1 163 ? 77.729  61.116  28.195 1.00 14.26 ? 163  LEU D CG  1 
ATOM   6738 C CD1 . LEU D 1 163 ? 77.685  60.225  26.971 1.00 5.30  ? 163  LEU D CD1 1 
ATOM   6739 C CD2 . LEU D 1 163 ? 77.040  62.437  27.934 1.00 23.48 ? 163  LEU D CD2 1 
ATOM   6740 N N   . ASP D 1 164 ? 76.276  59.496  32.316 1.00 24.23 ? 164  ASP D N   1 
ATOM   6741 C CA  . ASP D 1 164 ? 75.284  59.026  33.270 1.00 28.09 ? 164  ASP D CA  1 
ATOM   6742 C C   . ASP D 1 164 ? 75.149  60.003  34.427 1.00 31.77 ? 164  ASP D C   1 
ATOM   6743 O O   . ASP D 1 164 ? 74.043  60.326  34.838 1.00 32.39 ? 164  ASP D O   1 
ATOM   6744 C CB  . ASP D 1 164 ? 75.668  57.657  33.813 1.00 25.50 ? 164  ASP D CB  1 
ATOM   6745 C CG  . ASP D 1 164 ? 74.545  57.006  34.572 1.00 29.43 ? 164  ASP D CG  1 
ATOM   6746 O OD1 . ASP D 1 164 ? 73.381  57.425  34.390 1.00 33.41 ? 164  ASP D OD1 1 
ATOM   6747 O OD2 . ASP D 1 164 ? 74.820  56.048  35.326 1.00 35.36 ? 164  ASP D OD2 1 
ATOM   6748 N N   . GLN D 1 165 ? 76.279  60.524  34.899 1.00 32.77 ? 165  GLN D N   1 
ATOM   6749 C CA  . GLN D 1 165 ? 76.282  61.498  35.981 1.00 28.01 ? 165  GLN D CA  1 
ATOM   6750 C C   . GLN D 1 165 ? 75.604  62.802  35.571 1.00 23.67 ? 165  GLN D C   1 
ATOM   6751 O O   . GLN D 1 165 ? 74.922  63.425  36.378 1.00 25.53 ? 165  GLN D O   1 
ATOM   6752 C CB  . GLN D 1 165 ? 77.713  61.775  36.432 1.00 31.63 ? 165  GLN D CB  1 
ATOM   6753 C CG  . GLN D 1 165 ? 78.405  60.571  37.055 1.00 36.72 ? 165  GLN D CG  1 
ATOM   6754 C CD  . GLN D 1 165 ? 79.810  60.874  37.549 1.00 37.49 ? 165  GLN D CD  1 
ATOM   6755 O OE1 . GLN D 1 165 ? 80.450  60.030  38.182 1.00 38.87 ? 165  GLN D OE1 1 
ATOM   6756 N NE2 . GLN D 1 165 ? 80.293  62.083  37.272 1.00 36.08 ? 165  GLN D NE2 1 
ATOM   6757 N N   . GLN D 1 166 ? 75.776  63.200  34.312 1.00 23.43 ? 166  GLN D N   1 
ATOM   6758 C CA  . GLN D 1 166 ? 75.124  64.399  33.789 1.00 24.11 ? 166  GLN D CA  1 
ATOM   6759 C C   . GLN D 1 166 ? 73.615  64.196  33.698 1.00 26.92 ? 166  GLN D C   1 
ATOM   6760 O O   . GLN D 1 166 ? 72.842  65.078  34.058 1.00 29.89 ? 166  GLN D O   1 
ATOM   6761 C CB  . GLN D 1 166 ? 75.677  64.755  32.401 1.00 20.28 ? 166  GLN D CB  1 
ATOM   6762 C CG  . GLN D 1 166 ? 77.077  65.384  32.379 1.00 26.51 ? 166  GLN D CG  1 
ATOM   6763 C CD  . GLN D 1 166 ? 77.561  65.837  33.746 1.00 33.11 ? 166  GLN D CD  1 
ATOM   6764 O OE1 . GLN D 1 166 ? 78.487  65.251  34.326 1.00 32.33 ? 166  GLN D OE1 1 
ATOM   6765 N NE2 . GLN D 1 166 ? 76.941  66.887  34.270 1.00 35.88 ? 166  GLN D NE2 1 
ATOM   6766 N N   . ARG D 1 167 ? 73.212  63.009  33.253 1.00 29.76 ? 167  ARG D N   1 
ATOM   6767 C CA  . ARG D 1 167 ? 71.805  62.674  33.039 1.00 27.53 ? 167  ARG D CA  1 
ATOM   6768 C C   . ARG D 1 167 ? 71.057  62.541  34.372 1.00 32.81 ? 167  ARG D C   1 
ATOM   6769 O O   . ARG D 1 167 ? 69.868  62.844  34.447 1.00 32.92 ? 167  ARG D O   1 
ATOM   6770 C CB  . ARG D 1 167 ? 71.706  61.379  32.201 1.00 26.12 ? 167  ARG D CB  1 
ATOM   6771 C CG  . ARG D 1 167 ? 70.478  60.478  32.418 1.00 33.49 ? 167  ARG D CG  1 
ATOM   6772 C CD  . ARG D 1 167 ? 69.245  60.950  31.625 1.00 45.58 ? 167  ARG D CD  1 
ATOM   6773 N NE  . ARG D 1 167 ? 69.443  60.926  30.170 1.00 49.29 ? 167  ARG D NE  1 
ATOM   6774 C CZ  . ARG D 1 167 ? 68.633  61.505  29.278 1.00 45.75 ? 167  ARG D CZ  1 
ATOM   6775 N NH1 . ARG D 1 167 ? 67.542  62.154  29.673 1.00 39.86 ? 167  ARG D NH1 1 
ATOM   6776 N NH2 . ARG D 1 167 ? 68.923  61.448  27.981 1.00 42.52 ? 167  ARG D NH2 1 
ATOM   6777 N N   . MET D 1 168 ? 71.762  62.142  35.431 1.00 34.72 ? 168  MET D N   1 
ATOM   6778 C CA  . MET D 1 168 ? 71.161  62.065  36.764 1.00 31.71 ? 168  MET D CA  1 
ATOM   6779 C C   . MET D 1 168 ? 71.031  63.473  37.324 1.00 36.12 ? 168  MET D C   1 
ATOM   6780 O O   . MET D 1 168 ? 70.129  63.760  38.113 1.00 42.83 ? 168  MET D O   1 
ATOM   6781 C CB  . MET D 1 168 ? 72.025  61.229  37.715 1.00 27.15 ? 168  MET D CB  1 
ATOM   6782 C CG  . MET D 1 168 ? 72.431  59.878  37.185 1.00 29.22 ? 168  MET D CG  1 
ATOM   6783 S SD  . MET D 1 168 ? 71.436  58.557  37.831 1.00 32.04 ? 168  MET D SD  1 
ATOM   6784 C CE  . MET D 1 168 ? 72.207  58.270  39.389 1.00 22.54 ? 168  MET D CE  1 
ATOM   6785 N N   . PHE D 1 169 ? 71.932  64.348  36.884 1.00 36.17 ? 169  PHE D N   1 
ATOM   6786 C CA  . PHE D 1 169 ? 71.986  65.729  37.349 1.00 38.80 ? 169  PHE D CA  1 
ATOM   6787 C C   . PHE D 1 169 ? 70.832  66.549  36.776 1.00 37.20 ? 169  PHE D C   1 
ATOM   6788 O O   . PHE D 1 169 ? 69.993  67.072  37.512 1.00 39.34 ? 169  PHE D O   1 
ATOM   6789 C CB  . PHE D 1 169 ? 73.322  66.357  36.930 1.00 32.41 ? 169  PHE D CB  1 
ATOM   6790 C CG  . PHE D 1 169 ? 73.546  67.728  37.485 1.00 31.40 ? 169  PHE D CG  1 
ATOM   6791 C CD1 . PHE D 1 169 ? 73.501  67.954  38.859 1.00 30.50 ? 169  PHE D CD1 1 
ATOM   6792 C CD2 . PHE D 1 169 ? 73.791  68.797  36.637 1.00 32.00 ? 169  PHE D CD2 1 
ATOM   6793 C CE1 . PHE D 1 169 ? 73.697  69.231  39.386 1.00 27.61 ? 169  PHE D CE1 1 
ATOM   6794 C CE2 . PHE D 1 169 ? 73.988  70.078  37.151 1.00 35.81 ? 169  PHE D CE2 1 
ATOM   6795 C CZ  . PHE D 1 169 ? 73.941  70.293  38.533 1.00 31.45 ? 169  PHE D CZ  1 
ATOM   6796 N N   . VAL D 1 170 ? 70.825  66.679  35.454 1.00 39.81 ? 170  VAL D N   1 
ATOM   6797 C CA  . VAL D 1 170 ? 69.804  67.428  34.734 1.00 35.49 ? 170  VAL D CA  1 
ATOM   6798 C C   . VAL D 1 170 ? 69.202  66.543  33.630 1.00 37.94 ? 170  VAL D C   1 
ATOM   6799 O O   . VAL D 1 170 ? 69.609  66.601  32.463 1.00 38.35 ? 170  VAL D O   1 
ATOM   6800 C CB  . VAL D 1 170 ? 70.403  68.733  34.126 1.00 35.53 ? 170  VAL D CB  1 
ATOM   6801 C CG1 . VAL D 1 170 ? 71.626  68.421  33.258 1.00 36.78 ? 170  VAL D CG1 1 
ATOM   6802 C CG2 . VAL D 1 170 ? 69.359  69.465  33.314 1.00 37.57 ? 170  VAL D CG2 1 
ATOM   6803 N N   . PRO D 1 171 ? 68.260  65.664  34.006 1.00 36.12 ? 171  PRO D N   1 
ATOM   6804 C CA  . PRO D 1 171 ? 67.729  64.639  33.100 1.00 35.31 ? 171  PRO D CA  1 
ATOM   6805 C C   . PRO D 1 171 ? 66.967  65.233  31.918 1.00 35.58 ? 171  PRO D C   1 
ATOM   6806 O O   . PRO D 1 171 ? 66.789  64.581  30.884 1.00 36.44 ? 171  PRO D O   1 
ATOM   6807 C CB  . PRO D 1 171 ? 66.813  63.805  34.003 1.00 34.19 ? 171  PRO D CB  1 
ATOM   6808 C CG  . PRO D 1 171 ? 67.298  64.084  35.400 1.00 36.01 ? 171  PRO D CG  1 
ATOM   6809 C CD  . PRO D 1 171 ? 67.706  65.523  35.364 1.00 35.08 ? 171  PRO D CD  1 
ATOM   6810 N N   . ASP D 1 172 ? 66.583  66.497  32.058 1.00 33.43 ? 172  ASP D N   1 
ATOM   6811 C CA  . ASP D 1 172 ? 65.734  67.168  31.082 1.00 39.65 ? 172  ASP D CA  1 
ATOM   6812 C C   . ASP D 1 172 ? 66.529  67.858  29.984 1.00 43.55 ? 172  ASP D C   1 
ATOM   6813 O O   . ASP D 1 172 ? 65.937  68.439  29.069 1.00 40.53 ? 172  ASP D O   1 
ATOM   6814 C CB  . ASP D 1 172 ? 64.853  68.207  31.784 1.00 42.98 ? 172  ASP D CB  1 
ATOM   6815 C CG  . ASP D 1 172 ? 65.664  69.206  32.594 1.00 43.71 ? 172  ASP D CG  1 
ATOM   6816 O OD1 . ASP D 1 172 ? 66.158  68.820  33.672 1.00 53.77 ? 172  ASP D OD1 1 
ATOM   6817 O OD2 . ASP D 1 172 ? 65.851  70.358  32.140 1.00 40.27 ? 172  ASP D OD2 1 
ATOM   6818 N N   . CYS D 1 173 ? 67.859  67.860  30.108 1.00 44.31 ? 173  CYS D N   1 
ATOM   6819 C CA  . CYS D 1 173 ? 68.698  68.608  29.175 1.00 41.87 ? 173  CYS D CA  1 
ATOM   6820 C C   . CYS D 1 173 ? 68.545  68.087  27.765 1.00 45.43 ? 173  CYS D C   1 
ATOM   6821 O O   . CYS D 1 173 ? 68.743  66.901  27.504 1.00 44.98 ? 173  CYS D O   1 
ATOM   6822 C CB  . CYS D 1 173 ? 70.177  68.565  29.563 1.00 41.84 ? 173  CYS D CB  1 
ATOM   6823 S SG  . CYS D 1 173 ? 71.173  69.756  28.605 1.00 39.10 ? 173  CYS D SG  1 
ATOM   6824 N N   . PRO D 1 174 ? 68.176  68.976  26.834 1.00 49.32 ? 174  PRO D N   1 
ATOM   6825 C CA  . PRO D 1 174 ? 67.755  68.568  25.494 1.00 50.73 ? 174  PRO D CA  1 
ATOM   6826 C C   . PRO D 1 174 ? 68.950  68.130  24.651 1.00 47.94 ? 174  PRO D C   1 
ATOM   6827 O O   . PRO D 1 174 ? 68.810  67.330  23.724 1.00 55.65 ? 174  PRO D O   1 
ATOM   6828 C CB  . PRO D 1 174 ? 67.078  69.823  24.939 1.00 52.11 ? 174  PRO D CB  1 
ATOM   6829 C CG  . PRO D 1 174 ? 67.729  70.963  25.657 1.00 51.48 ? 174  PRO D CG  1 
ATOM   6830 C CD  . PRO D 1 174 ? 68.321  70.439  26.949 1.00 53.43 ? 174  PRO D CD  1 
ATOM   6831 N N   . GLU D 1 175 ? 70.138  68.572  25.054 1.00 41.00 ? 175  GLU D N   1 
ATOM   6832 C CA  . GLU D 1 175 ? 71.367  68.192  24.375 1.00 46.81 ? 175  GLU D CA  1 
ATOM   6833 C C   . GLU D 1 175 ? 71.805  66.775  24.755 1.00 45.80 ? 175  GLU D C   1 
ATOM   6834 O O   . GLU D 1 175 ? 72.767  66.245  24.196 1.00 44.35 ? 175  GLU D O   1 
ATOM   6835 C CB  . GLU D 1 175 ? 72.475  69.196  24.701 1.00 47.61 ? 175  GLU D CB  1 
ATOM   6836 C CG  . GLU D 1 175 ? 72.393  70.499  23.906 1.00 60.69 ? 175  GLU D CG  1 
ATOM   6837 C CD  . GLU D 1 175 ? 71.133  71.310  24.199 1.00 66.74 ? 175  GLU D CD  1 
ATOM   6838 O OE1 . GLU D 1 175 ? 71.132  72.105  25.171 1.00 65.53 ? 175  GLU D OE1 1 
ATOM   6839 O OE2 . GLU D 1 175 ? 70.148  71.165  23.441 1.00 67.88 ? 175  GLU D OE2 1 
ATOM   6840 N N   . LEU D 1 176 ? 71.085  66.165  25.695 1.00 44.14 ? 176  LEU D N   1 
ATOM   6841 C CA  . LEU D 1 176 ? 71.292  64.763  26.042 1.00 35.16 ? 176  LEU D CA  1 
ATOM   6842 C C   . LEU D 1 176 ? 70.428  63.834  25.204 1.00 37.82 ? 176  LEU D C   1 
ATOM   6843 O O   . LEU D 1 176 ? 70.656  62.626  25.196 1.00 43.15 ? 176  LEU D O   1 
ATOM   6844 C CB  . LEU D 1 176 ? 70.998  64.529  27.523 1.00 27.69 ? 176  LEU D CB  1 
ATOM   6845 C CG  . LEU D 1 176 ? 72.133  64.894  28.473 1.00 26.08 ? 176  LEU D CG  1 
ATOM   6846 C CD1 . LEU D 1 176 ? 71.616  64.981  29.893 1.00 33.71 ? 176  LEU D CD1 1 
ATOM   6847 C CD2 . LEU D 1 176 ? 73.245  63.866  28.354 1.00 30.56 ? 176  LEU D CD2 1 
ATOM   6848 N N   . GLN D 1 177 ? 69.395  64.384  24.569 1.00 36.04 ? 177  GLN D N   1 
ATOM   6849 C CA  . GLN D 1 177 ? 68.607  63.638  23.593 1.00 39.58 ? 177  GLN D CA  1 
ATOM   6850 C C   . GLN D 1 177 ? 69.259  63.671  22.214 1.00 42.31 ? 177  GLN D C   1 
ATOM   6851 O O   . GLN D 1 177 ? 69.910  64.651  21.846 1.00 48.78 ? 177  GLN D O   1 
ATOM   6852 C CB  . GLN D 1 177 ? 67.194  64.199  23.512 1.00 42.77 ? 177  GLN D CB  1 
ATOM   6853 C CG  . GLN D 1 177 ? 66.159  63.357  24.240 1.00 51.90 ? 177  GLN D CG  1 
ATOM   6854 C CD  . GLN D 1 177 ? 66.432  63.236  25.729 1.00 53.71 ? 177  GLN D CD  1 
ATOM   6855 O OE1 . GLN D 1 177 ? 66.630  64.240  26.427 1.00 56.71 ? 177  GLN D OE1 1 
ATOM   6856 N NE2 . GLN D 1 177 ? 66.416  62.005  26.231 1.00 51.74 ? 177  GLN D NE2 1 
ATOM   6857 N N   . GLY D 1 178 ? 69.094  62.585  21.464 1.00 32.08 ? 178  GLY D N   1 
ATOM   6858 C CA  . GLY D 1 178 ? 69.835  62.422  20.229 1.00 24.64 ? 178  GLY D CA  1 
ATOM   6859 C C   . GLY D 1 178 ? 70.789  61.243  20.300 1.00 29.55 ? 178  GLY D C   1 
ATOM   6860 O O   . GLY D 1 178 ? 70.518  60.260  20.998 1.00 21.73 ? 178  GLY D O   1 
ATOM   6861 N N   . ASN D 1 179 ? 71.925  61.347  19.612 1.00 29.54 ? 179  ASN D N   1 
ATOM   6862 C CA  . ASN D 1 179 ? 72.853  60.225  19.521 1.00 25.55 ? 179  ASN D CA  1 
ATOM   6863 C C   . ASN D 1 179 ? 73.524  59.923  20.852 1.00 22.17 ? 179  ASN D C   1 
ATOM   6864 O O   . ASN D 1 179 ? 73.953  58.794  21.080 1.00 33.02 ? 179  ASN D O   1 
ATOM   6865 C CB  . ASN D 1 179 ? 73.912  60.491  18.462 1.00 23.37 ? 179  ASN D CB  1 
ATOM   6866 C CG  . ASN D 1 179 ? 74.792  61.633  18.823 1.00 21.33 ? 179  ASN D CG  1 
ATOM   6867 O OD1 . ASN D 1 179 ? 74.313  62.663  19.288 1.00 22.34 ? 179  ASN D OD1 1 
ATOM   6868 N ND2 . ASN D 1 179 ? 76.094  61.435  18.705 1.00 28.47 ? 179  ASN D ND2 1 
ATOM   6869 N N   . LEU D 1 180 ? 73.546  60.909  21.748 1.00 26.18 ? 180  LEU D N   1 
ATOM   6870 C CA  . LEU D 1 180 ? 74.087  60.726  23.097 1.00 25.25 ? 180  LEU D CA  1 
ATOM   6871 C C   . LEU D 1 180 ? 73.159  59.884  23.957 1.00 27.32 ? 180  LEU D C   1 
ATOM   6872 O O   . LEU D 1 180 ? 73.610  59.143  24.832 1.00 26.61 ? 180  LEU D O   1 
ATOM   6873 C CB  . LEU D 1 180 ? 74.313  62.077  23.788 1.00 20.14 ? 180  LEU D CB  1 
ATOM   6874 C CG  . LEU D 1 180 ? 75.599  62.856  23.494 1.00 16.87 ? 180  LEU D CG  1 
ATOM   6875 C CD1 . LEU D 1 180 ? 75.754  63.963  24.519 1.00 21.52 ? 180  LEU D CD1 1 
ATOM   6876 C CD2 . LEU D 1 180 ? 76.797  61.941  23.546 1.00 10.94 ? 180  LEU D CD2 1 
ATOM   6877 N N   . SER D 1 181 ? 71.859  60.029  23.729 1.00 30.21 ? 181  SER D N   1 
ATOM   6878 C CA  . SER D 1 181 ? 70.884  59.191  24.411 1.00 33.63 ? 181  SER D CA  1 
ATOM   6879 C C   . SER D 1 181 ? 70.893  57.778  23.838 1.00 31.45 ? 181  SER D C   1 
ATOM   6880 O O   . SER D 1 181 ? 70.837  56.795  24.582 1.00 35.28 ? 181  SER D O   1 
ATOM   6881 C CB  . SER D 1 181 ? 69.483  59.791  24.300 1.00 36.08 ? 181  SER D CB  1 
ATOM   6882 O OG  . SER D 1 181 ? 69.053  60.278  25.560 1.00 43.95 ? 181  SER D OG  1 
ATOM   6883 N N   . GLN D 1 182 ? 71.063  57.676  22.526 1.00 25.28 ? 182  GLN D N   1 
ATOM   6884 C CA  . GLN D 1 182 ? 71.088  56.374  21.883 1.00 28.46 ? 182  GLN D CA  1 
ATOM   6885 C C   . GLN D 1 182 ? 72.352  55.576  22.266 1.00 31.04 ? 182  GLN D C   1 
ATOM   6886 O O   . GLN D 1 182 ? 72.310  54.343  22.340 1.00 27.56 ? 182  GLN D O   1 
ATOM   6887 C CB  . GLN D 1 182 ? 70.944  56.560  20.367 1.00 27.61 ? 182  GLN D CB  1 
ATOM   6888 C CG  . GLN D 1 182 ? 69.767  57.476  19.992 1.00 24.19 ? 182  GLN D CG  1 
ATOM   6889 C CD  . GLN D 1 182 ? 69.829  58.019  18.561 1.00 36.13 ? 182  GLN D CD  1 
ATOM   6890 O OE1 . GLN D 1 182 ? 70.642  57.576  17.730 1.00 39.35 ? 182  GLN D OE1 1 
ATOM   6891 N NE2 . GLN D 1 182 ? 68.944  58.971  18.260 1.00 35.68 ? 182  GLN D NE2 1 
ATOM   6892 N N   . PHE D 1 183 ? 73.416  56.282  22.659 1.00 25.96 ? 183  PHE D N   1 
ATOM   6893 C CA  . PHE D 1 183 ? 74.641  55.626  23.123 1.00 19.00 ? 183  PHE D CA  1 
ATOM   6894 C C   . PHE D 1 183 ? 74.440  55.034  24.505 1.00 12.68 ? 183  PHE D C   1 
ATOM   6895 O O   . PHE D 1 183 ? 74.896  53.934  24.783 1.00 18.37 ? 183  PHE D O   1 
ATOM   6896 C CB  . PHE D 1 183 ? 75.822  56.605  23.164 1.00 19.87 ? 183  PHE D CB  1 
ATOM   6897 C CG  . PHE D 1 183 ? 77.028  56.081  23.917 1.00 12.87 ? 183  PHE D CG  1 
ATOM   6898 C CD1 . PHE D 1 183 ? 77.997  55.331  23.266 1.00 14.11 ? 183  PHE D CD1 1 
ATOM   6899 C CD2 . PHE D 1 183 ? 77.172  56.317  25.284 1.00 10.50 ? 183  PHE D CD2 1 
ATOM   6900 C CE1 . PHE D 1 183 ? 79.087  54.819  23.963 1.00 20.06 ? 183  PHE D CE1 1 
ATOM   6901 C CE2 . PHE D 1 183 ? 78.253  55.804  25.991 1.00 14.08 ? 183  PHE D CE2 1 
ATOM   6902 C CZ  . PHE D 1 183 ? 79.211  55.052  25.332 1.00 19.21 ? 183  PHE D CZ  1 
ATOM   6903 N N   . LEU D 1 184 ? 73.826  55.804  25.391 1.00 14.42 ? 184  LEU D N   1 
ATOM   6904 C CA  . LEU D 1 184 ? 73.607  55.353  26.747 1.00 14.35 ? 184  LEU D CA  1 
ATOM   6905 C C   . LEU D 1 184 ? 72.766  54.083  26.793 1.00 19.01 ? 184  LEU D C   1 
ATOM   6906 O O   . LEU D 1 184 ? 73.149  53.121  27.450 1.00 27.96 ? 184  LEU D O   1 
ATOM   6907 C CB  . LEU D 1 184 ? 72.971  56.472  27.570 1.00 14.77 ? 184  LEU D CB  1 
ATOM   6908 C CG  . LEU D 1 184 ? 73.958  57.576  27.983 1.00 25.94 ? 184  LEU D CG  1 
ATOM   6909 C CD1 . LEU D 1 184 ? 73.212  58.819  28.459 1.00 20.70 ? 184  LEU D CD1 1 
ATOM   6910 C CD2 . LEU D 1 184 ? 74.881  57.056  29.077 1.00 16.66 ? 184  LEU D CD2 1 
ATOM   6911 N N   . GLN D 1 185 ? 71.698  54.031  26.002 1.00 18.69 ? 185  GLN D N   1 
ATOM   6912 C CA  . GLN D 1 185 ? 70.858  52.838  25.930 1.00 27.27 ? 185  GLN D CA  1 
ATOM   6913 C C   . GLN D 1 185 ? 71.556  51.648  25.278 1.00 27.89 ? 185  GLN D C   1 
ATOM   6914 O O   . GLN D 1 185 ? 71.379  50.508  25.707 1.00 32.10 ? 185  GLN D O   1 
ATOM   6915 C CB  . GLN D 1 185 ? 69.577  53.141  25.169 1.00 33.54 ? 185  GLN D CB  1 
ATOM   6916 C CG  . GLN D 1 185 ? 68.561  53.951  25.950 1.00 45.64 ? 185  GLN D CG  1 
ATOM   6917 C CD  . GLN D 1 185 ? 67.704  54.826  25.046 1.00 52.70 ? 185  GLN D CD  1 
ATOM   6918 O OE1 . GLN D 1 185 ? 67.293  54.411  23.954 1.00 52.40 ? 185  GLN D OE1 1 
ATOM   6919 N NE2 . GLN D 1 185 ? 67.461  56.062  25.483 1.00 52.92 ? 185  GLN D NE2 1 
ATOM   6920 N N   . ARG D 1 186 ? 72.335  51.911  24.235 1.00 23.87 ? 186  ARG D N   1 
ATOM   6921 C CA  . ARG D 1 186 ? 73.049  50.853  23.542 1.00 20.03 ? 186  ARG D CA  1 
ATOM   6922 C C   . ARG D 1 186 ? 74.106  50.183  24.412 1.00 20.79 ? 186  ARG D C   1 
ATOM   6923 O O   . ARG D 1 186 ? 74.315  48.967  24.322 1.00 28.06 ? 186  ARG D O   1 
ATOM   6924 C CB  . ARG D 1 186 ? 73.659  51.395  22.256 1.00 17.74 ? 186  ARG D CB  1 
ATOM   6925 C CG  . ARG D 1 186 ? 72.619  51.555  21.172 1.00 22.67 ? 186  ARG D CG  1 
ATOM   6926 C CD  . ARG D 1 186 ? 73.228  51.741  19.801 1.00 22.86 ? 186  ARG D CD  1 
ATOM   6927 N NE  . ARG D 1 186 ? 73.762  53.088  19.639 1.00 27.53 ? 186  ARG D NE  1 
ATOM   6928 C CZ  . ARG D 1 186 ? 75.052  53.381  19.713 1.00 26.61 ? 186  ARG D CZ  1 
ATOM   6929 N NH1 . ARG D 1 186 ? 75.940  52.403  19.820 1.00 24.97 ? 186  ARG D NH1 1 
ATOM   6930 N NH2 . ARG D 1 186 ? 75.450  54.645  19.664 1.00 28.45 ? 186  ARG D NH2 1 
ATOM   6931 N N   . PHE D 1 187 ? 74.679  50.951  25.334 1.00 16.26 ? 187  PHE D N   1 
ATOM   6932 C CA  . PHE D 1 187 ? 75.638  50.414  26.285 1.00 12.45 ? 187  PHE D CA  1 
ATOM   6933 C C   . PHE D 1 187 ? 74.909  49.575  27.322 1.00 12.84 ? 187  PHE D C   1 
ATOM   6934 O O   . PHE D 1 187 ? 75.344  48.486  27.662 1.00 25.98 ? 187  PHE D O   1 
ATOM   6935 C CB  . PHE D 1 187 ? 76.398  51.552  26.972 1.00 7.15  ? 187  PHE D CB  1 
ATOM   6936 C CG  . PHE D 1 187 ? 77.461  51.084  27.933 1.00 6.58  ? 187  PHE D CG  1 
ATOM   6937 C CD1 . PHE D 1 187 ? 78.742  50.793  27.484 1.00 2.00  ? 187  PHE D CD1 1 
ATOM   6938 C CD2 . PHE D 1 187 ? 77.187  50.971  29.299 1.00 14.00 ? 187  PHE D CD2 1 
ATOM   6939 C CE1 . PHE D 1 187 ? 79.726  50.404  28.376 1.00 5.27  ? 187  PHE D CE1 1 
ATOM   6940 C CE2 . PHE D 1 187 ? 78.174  50.585  30.197 1.00 2.00  ? 187  PHE D CE2 1 
ATOM   6941 C CZ  . PHE D 1 187 ? 79.439  50.301  29.737 1.00 2.00  ? 187  PHE D CZ  1 
ATOM   6942 N N   . GLU D 1 188 ? 73.775  50.076  27.794 1.00 16.87 ? 188  GLU D N   1 
ATOM   6943 C CA  . GLU D 1 188 ? 73.007  49.385  28.816 1.00 9.87  ? 188  GLU D CA  1 
ATOM   6944 C C   . GLU D 1 188 ? 72.311  48.151  28.265 1.00 14.59 ? 188  GLU D C   1 
ATOM   6945 O O   . GLU D 1 188 ? 71.911  47.277  29.024 1.00 24.59 ? 188  GLU D O   1 
ATOM   6946 C CB  . GLU D 1 188 ? 71.980  50.333  29.425 1.00 12.16 ? 188  GLU D CB  1 
ATOM   6947 C CG  . GLU D 1 188 ? 72.605  51.413  30.302 1.00 19.56 ? 188  GLU D CG  1 
ATOM   6948 C CD  . GLU D 1 188 ? 71.599  52.403  30.856 1.00 20.79 ? 188  GLU D CD  1 
ATOM   6949 O OE1 . GLU D 1 188 ? 70.426  52.388  30.421 1.00 24.73 ? 188  GLU D OE1 1 
ATOM   6950 O OE2 . GLU D 1 188 ? 71.996  53.224  31.710 1.00 20.54 ? 188  GLU D OE2 1 
ATOM   6951 N N   . ALA D 1 189 ? 72.232  48.052  26.939 1.00 17.55 ? 189  ALA D N   1 
ATOM   6952 C CA  . ALA D 1 189 ? 71.608  46.904  26.290 1.00 17.61 ? 189  ALA D CA  1 
ATOM   6953 C C   . ALA D 1 189 ? 72.597  45.768  26.073 1.00 23.67 ? 189  ALA D C   1 
ATOM   6954 O O   . ALA D 1 189 ? 72.199  44.670  25.671 1.00 28.86 ? 189  ALA D O   1 
ATOM   6955 C CB  . ALA D 1 189 ? 70.999  47.317  24.972 1.00 15.96 ? 189  ALA D CB  1 
ATOM   6956 N N   . LEU D 1 190 ? 73.881  46.049  26.303 1.00 23.79 ? 190  LEU D N   1 
ATOM   6957 C CA  . LEU D 1 190 ? 74.935  45.040  26.208 1.00 20.71 ? 190  LEU D CA  1 
ATOM   6958 C C   . LEU D 1 190 ? 74.651  43.903  27.180 1.00 23.17 ? 190  LEU D C   1 
ATOM   6959 O O   . LEU D 1 190 ? 74.271  44.146  28.321 1.00 28.36 ? 190  LEU D O   1 
ATOM   6960 C CB  . LEU D 1 190 ? 76.303  45.662  26.516 1.00 19.11 ? 190  LEU D CB  1 
ATOM   6961 C CG  . LEU D 1 190 ? 76.877  46.637  25.482 1.00 17.24 ? 190  LEU D CG  1 
ATOM   6962 C CD1 . LEU D 1 190 ? 78.052  47.380  26.078 1.00 9.86  ? 190  LEU D CD1 1 
ATOM   6963 C CD2 . LEU D 1 190 ? 77.304  45.900  24.222 1.00 18.15 ? 190  LEU D CD2 1 
ATOM   6964 N N   . GLU D 1 191 ? 74.826  42.666  26.721 1.00 28.23 ? 191  GLU D N   1 
ATOM   6965 C CA  . GLU D 1 191 ? 74.254  41.528  27.420 1.00 31.66 ? 191  GLU D CA  1 
ATOM   6966 C C   . GLU D 1 191 ? 74.741  41.394  28.865 1.00 23.69 ? 191  GLU D C   1 
ATOM   6967 O O   . GLU D 1 191 ? 73.926  41.376  29.782 1.00 23.37 ? 191  GLU D O   1 
ATOM   6968 C CB  . GLU D 1 191 ? 74.469  40.238  26.612 1.00 40.09 ? 191  GLU D CB  1 
ATOM   6969 C CG  . GLU D 1 191 ? 73.166  39.656  26.006 1.00 54.81 ? 191  GLU D CG  1 
ATOM   6970 C CD  . GLU D 1 191 ? 73.108  39.674  24.467 1.00 66.90 ? 191  GLU D CD  1 
ATOM   6971 O OE1 . GLU D 1 191 ? 74.055  39.171  23.810 1.00 68.41 ? 191  GLU D OE1 1 
ATOM   6972 O OE2 . GLU D 1 191 ? 72.042  40.049  23.912 1.00 63.43 ? 191  GLU D OE2 1 
ATOM   6973 N N   . LYS D 1 192 ? 76.045  41.490  29.096 1.00 19.88 ? 192  LYS D N   1 
ATOM   6974 C CA  . LYS D 1 192 ? 76.542  41.306  30.460 1.00 18.83 ? 192  LYS D CA  1 
ATOM   6975 C C   . LYS D 1 192 ? 76.501  42.568  31.304 1.00 15.91 ? 192  LYS D C   1 
ATOM   6976 O O   . LYS D 1 192 ? 76.622  42.501  32.524 1.00 13.34 ? 192  LYS D O   1 
ATOM   6977 C CB  . LYS D 1 192 ? 77.949  40.692  30.485 1.00 17.80 ? 192  LYS D CB  1 
ATOM   6978 C CG  . LYS D 1 192 ? 78.862  41.135  29.381 1.00 33.36 ? 192  LYS D CG  1 
ATOM   6979 C CD  . LYS D 1 192 ? 78.826  40.163  28.225 1.00 31.31 ? 192  LYS D CD  1 
ATOM   6980 C CE  . LYS D 1 192 ? 79.025  40.900  26.921 1.00 26.79 ? 192  LYS D CE  1 
ATOM   6981 N NZ  . LYS D 1 192 ? 77.932  41.889  26.695 1.00 28.53 ? 192  LYS D NZ  1 
ATOM   6982 N N   . ILE D 1 193 ? 76.218  43.697  30.666 1.00 19.95 ? 193  ILE D N   1 
ATOM   6983 C CA  . ILE D 1 193 ? 76.025  44.960  31.371 1.00 20.26 ? 193  ILE D CA  1 
ATOM   6984 C C   . ILE D 1 193 ? 74.597  45.014  31.903 1.00 24.79 ? 193  ILE D C   1 
ATOM   6985 O O   . ILE D 1 193 ? 74.372  45.336  33.070 1.00 32.08 ? 193  ILE D O   1 
ATOM   6986 C CB  . ILE D 1 193 ? 76.271  46.167  30.430 1.00 20.09 ? 193  ILE D CB  1 
ATOM   6987 C CG1 . ILE D 1 193 ? 77.744  46.215  30.011 1.00 32.51 ? 193  ILE D CG1 1 
ATOM   6988 C CG2 . ILE D 1 193 ? 75.865  47.459  31.097 1.00 17.49 ? 193  ILE D CG2 1 
ATOM   6989 C CD1 . ILE D 1 193 ? 78.738  46.115  31.160 1.00 28.02 ? 193  ILE D CD1 1 
ATOM   6990 N N   . SER D 1 194 ? 73.651  44.630  31.048 1.00 26.10 ? 194  SER D N   1 
ATOM   6991 C CA  . SER D 1 194 ? 72.227  44.519  31.383 1.00 21.35 ? 194  SER D CA  1 
ATOM   6992 C C   . SER D 1 194 ? 72.023  43.660  32.614 1.00 20.83 ? 194  SER D C   1 
ATOM   6993 O O   . SER D 1 194 ? 71.334  44.040  33.557 1.00 16.85 ? 194  SER D O   1 
ATOM   6994 C CB  . SER D 1 194 ? 71.469  43.858  30.223 1.00 19.07 ? 194  SER D CB  1 
ATOM   6995 O OG  . SER D 1 194 ? 70.586  44.757  29.585 1.00 31.57 ? 194  SER D OG  1 
ATOM   6996 N N   . ALA D 1 195 ? 72.557  42.450  32.549 1.00 25.47 ? 195  ALA D N   1 
ATOM   6997 C CA  . ALA D 1 195 ? 72.384  41.492  33.622 1.00 26.14 ? 195  ALA D CA  1 
ATOM   6998 C C   . ALA D 1 195 ? 73.069  41.960  34.912 1.00 28.83 ? 195  ALA D C   1 
ATOM   6999 O O   . ALA D 1 195 ? 72.606  41.648  36.000 1.00 32.99 ? 195  ALA D O   1 
ATOM   7000 C CB  . ALA D 1 195 ? 72.909  40.131  33.190 1.00 28.23 ? 195  ALA D CB  1 
ATOM   7001 N N   . TYR D 1 196 ? 74.139  42.745  34.789 1.00 32.33 ? 196  TYR D N   1 
ATOM   7002 C CA  . TYR D 1 196 ? 74.810  43.322  35.950 1.00 25.87 ? 196  TYR D CA  1 
ATOM   7003 C C   . TYR D 1 196 ? 73.882  44.334  36.607 1.00 24.41 ? 196  TYR D C   1 
ATOM   7004 O O   . TYR D 1 196 ? 73.844  44.447  37.835 1.00 28.17 ? 196  TYR D O   1 
ATOM   7005 C CB  . TYR D 1 196 ? 76.129  44.008  35.535 1.00 24.84 ? 196  TYR D CB  1 
ATOM   7006 C CG  . TYR D 1 196 ? 76.871  44.690  36.680 1.00 20.79 ? 196  TYR D CG  1 
ATOM   7007 C CD1 . TYR D 1 196 ? 77.134  44.008  37.871 1.00 14.95 ? 196  TYR D CD1 1 
ATOM   7008 C CD2 . TYR D 1 196 ? 77.254  46.031  36.595 1.00 17.98 ? 196  TYR D CD2 1 
ATOM   7009 C CE1 . TYR D 1 196 ? 77.757  44.639  38.947 1.00 16.55 ? 196  TYR D CE1 1 
ATOM   7010 C CE2 . TYR D 1 196 ? 77.871  46.679  37.674 1.00 11.87 ? 196  TYR D CE2 1 
ATOM   7011 C CZ  . TYR D 1 196 ? 78.121  45.976  38.848 1.00 16.15 ? 196  TYR D CZ  1 
ATOM   7012 O OH  . TYR D 1 196 ? 78.721  46.600  39.929 1.00 25.31 ? 196  TYR D OH  1 
ATOM   7013 N N   . MET D 1 197 ? 73.119  45.049  35.784 1.00 21.98 ? 197  MET D N   1 
ATOM   7014 C CA  . MET D 1 197 ? 72.227  46.102  36.272 1.00 25.33 ? 197  MET D CA  1 
ATOM   7015 C C   . MET D 1 197 ? 70.961  45.493  36.862 1.00 27.59 ? 197  MET D C   1 
ATOM   7016 O O   . MET D 1 197 ? 70.308  46.081  37.722 1.00 35.51 ? 197  MET D O   1 
ATOM   7017 C CB  . MET D 1 197 ? 71.865  47.059  35.132 1.00 22.72 ? 197  MET D CB  1 
ATOM   7018 C CG  . MET D 1 197 ? 73.073  47.707  34.465 1.00 27.86 ? 197  MET D CG  1 
ATOM   7019 S SD  . MET D 1 197 ? 72.727  49.265  33.618 1.00 19.75 ? 197  MET D SD  1 
ATOM   7020 C CE  . MET D 1 197 ? 74.372  49.879  33.404 1.00 23.71 ? 197  MET D CE  1 
ATOM   7021 N N   . ARG D 1 198 ? 70.667  44.277  36.415 1.00 29.05 ? 198  ARG D N   1 
ATOM   7022 C CA  . ARG D 1 198 ? 69.528  43.482  36.863 1.00 31.22 ? 198  ARG D CA  1 
ATOM   7023 C C   . ARG D 1 198 ? 69.796  42.890  38.242 1.00 30.42 ? 198  ARG D C   1 
ATOM   7024 O O   . ARG D 1 198 ? 68.890  42.377  38.891 1.00 34.60 ? 198  ARG D O   1 
ATOM   7025 C CB  . ARG D 1 198 ? 69.317  42.332  35.868 1.00 36.86 ? 198  ARG D CB  1 
ATOM   7026 C CG  . ARG D 1 198 ? 67.911  42.175  35.286 1.00 50.41 ? 198  ARG D CG  1 
ATOM   7027 C CD  . ARG D 1 198 ? 67.526  43.307  34.342 1.00 56.49 ? 198  ARG D CD  1 
ATOM   7028 N NE  . ARG D 1 198 ? 67.154  44.505  35.091 1.00 60.65 ? 198  ARG D NE  1 
ATOM   7029 C CZ  . ARG D 1 198 ? 67.819  45.657  35.044 1.00 59.34 ? 198  ARG D CZ  1 
ATOM   7030 N NH1 . ARG D 1 198 ? 68.726  45.864  34.097 1.00 60.79 ? 198  ARG D NH1 1 
ATOM   7031 N NH2 . ARG D 1 198 ? 67.520  46.637  35.892 1.00 58.77 ? 198  ARG D NH2 1 
ATOM   7032 N N   . SER D 1 199 ? 71.065  42.875  38.639 1.00 31.70 ? 199  SER D N   1 
ATOM   7033 C CA  . SER D 1 199 ? 71.490  42.171  39.844 1.00 26.63 ? 199  SER D CA  1 
ATOM   7034 C C   . SER D 1 199 ? 71.599  43.091  41.057 1.00 30.18 ? 199  SER D C   1 
ATOM   7035 O O   . SER D 1 199 ? 71.222  44.265  41.006 1.00 35.93 ? 199  SER D O   1 
ATOM   7036 C CB  . SER D 1 199 ? 72.832  41.483  39.604 1.00 23.58 ? 199  SER D CB  1 
ATOM   7037 O OG  . SER D 1 199 ? 73.896  42.412  39.714 1.00 20.23 ? 199  SER D OG  1 
ATOM   7038 N N   . GLY D 1 200 ? 72.115  42.539  42.153 1.00 27.85 ? 200  GLY D N   1 
ATOM   7039 C CA  . GLY D 1 200 ? 72.218  43.293  43.390 1.00 34.38 ? 200  GLY D CA  1 
ATOM   7040 C C   . GLY D 1 200 ? 73.634  43.722  43.718 1.00 34.96 ? 200  GLY D C   1 
ATOM   7041 O O   . GLY D 1 200 ? 73.905  44.211  44.815 1.00 38.83 ? 200  GLY D O   1 
ATOM   7042 N N   . ARG D 1 201 ? 74.538  43.516  42.766 1.00 35.09 ? 201  ARG D N   1 
ATOM   7043 C CA  . ARG D 1 201 ? 75.913  43.987  42.866 1.00 25.69 ? 201  ARG D CA  1 
ATOM   7044 C C   . ARG D 1 201 ? 75.993  45.455  42.436 1.00 25.48 ? 201  ARG D C   1 
ATOM   7045 O O   . ARG D 1 201 ? 76.972  46.150  42.727 1.00 29.63 ? 201  ARG D O   1 
ATOM   7046 C CB  . ARG D 1 201 ? 76.811  43.128  41.966 1.00 22.35 ? 201  ARG D CB  1 
ATOM   7047 C CG  . ARG D 1 201 ? 76.698  41.622  42.218 1.00 22.52 ? 201  ARG D CG  1 
ATOM   7048 C CD  . ARG D 1 201 ? 77.803  40.840  41.512 1.00 21.98 ? 201  ARG D CD  1 
ATOM   7049 N NE  . ARG D 1 201 ? 77.673  40.920  40.063 1.00 32.74 ? 201  ARG D NE  1 
ATOM   7050 C CZ  . ARG D 1 201 ? 76.960  40.078  39.318 1.00 34.86 ? 201  ARG D CZ  1 
ATOM   7051 N NH1 . ARG D 1 201 ? 76.468  38.958  39.834 1.00 32.70 ? 201  ARG D NH1 1 
ATOM   7052 N NH2 . ARG D 1 201 ? 76.828  40.310  38.022 1.00 31.59 ? 201  ARG D NH2 1 
ATOM   7053 N N   . PHE D 1 202 ? 74.906  45.945  41.843 1.00 23.67 ? 202  PHE D N   1 
ATOM   7054 C CA  . PHE D 1 202 ? 74.928  47.206  41.125 1.00 21.57 ? 202  PHE D CA  1 
ATOM   7055 C C   . PHE D 1 202 ? 74.762  48.448  42.010 1.00 29.25 ? 202  PHE D C   1 
ATOM   7056 O O   . PHE D 1 202 ? 73.804  48.565  42.782 1.00 35.91 ? 202  PHE D O   1 
ATOM   7057 C CB  . PHE D 1 202 ? 73.866  47.183  40.032 1.00 17.36 ? 202  PHE D CB  1 
ATOM   7058 C CG  . PHE D 1 202 ? 73.895  48.385  39.144 1.00 22.26 ? 202  PHE D CG  1 
ATOM   7059 C CD1 . PHE D 1 202 ? 75.064  48.740  38.479 1.00 16.66 ? 202  PHE D CD1 1 
ATOM   7060 C CD2 . PHE D 1 202 ? 72.776  49.204  39.021 1.00 17.39 ? 202  PHE D CD2 1 
ATOM   7061 C CE1 . PHE D 1 202 ? 75.115  49.890  37.704 1.00 16.38 ? 202  PHE D CE1 1 
ATOM   7062 C CE2 . PHE D 1 202 ? 72.819  50.356  38.251 1.00 15.17 ? 202  PHE D CE2 1 
ATOM   7063 C CZ  . PHE D 1 202 ? 73.988  50.701  37.588 1.00 21.06 ? 202  PHE D CZ  1 
ATOM   7064 N N   . MET D 1 203 ? 75.651  49.416  41.800 1.00 34.33 ? 203  MET D N   1 
ATOM   7065 C CA  . MET D 1 203 ? 75.711  50.618  42.617 1.00 42.33 ? 203  MET D CA  1 
ATOM   7066 C C   . MET D 1 203 ? 75.459  51.847  41.751 1.00 40.45 ? 203  MET D C   1 
ATOM   7067 O O   . MET D 1 203 ? 76.382  52.377  41.135 1.00 46.27 ? 203  MET D O   1 
ATOM   7068 C CB  . MET D 1 203 ? 77.090  50.717  43.275 1.00 49.61 ? 203  MET D CB  1 
ATOM   7069 C CG  . MET D 1 203 ? 77.124  51.527  44.560 1.00 59.15 ? 203  MET D CG  1 
ATOM   7070 S SD  . MET D 1 203 ? 76.936  50.522  46.047 1.00 67.25 ? 203  MET D SD  1 
ATOM   7071 C CE  . MET D 1 203 ? 76.744  51.811  47.304 1.00 62.43 ? 203  MET D CE  1 
ATOM   7072 N N   . LYS D 1 204 ? 74.203  52.279  41.694 1.00 41.44 ? 204  LYS D N   1 
ATOM   7073 C CA  . LYS D 1 204 ? 73.823  53.479  40.948 1.00 41.29 ? 204  LYS D CA  1 
ATOM   7074 C C   . LYS D 1 204 ? 74.073  54.750  41.778 1.00 36.79 ? 204  LYS D C   1 
ATOM   7075 O O   . LYS D 1 204 ? 74.061  55.868  41.252 1.00 32.49 ? 204  LYS D O   1 
ATOM   7076 C CB  . LYS D 1 204 ? 72.347  53.384  40.549 1.00 39.65 ? 204  LYS D CB  1 
ATOM   7077 C CG  . LYS D 1 204 ? 72.009  54.055  39.227 1.00 46.70 ? 204  LYS D CG  1 
ATOM   7078 C CD  . LYS D 1 204 ? 70.576  53.749  38.779 1.00 52.47 ? 204  LYS D CD  1 
ATOM   7079 C CE  . LYS D 1 204 ? 69.535  54.176  39.819 1.00 55.48 ? 204  LYS D CE  1 
ATOM   7080 N NZ  . LYS D 1 204 ? 68.162  54.318  39.238 1.00 53.14 ? 204  LYS D NZ  1 
ATOM   7081 N N   . ALA D 1 205 ? 74.347  54.556  43.067 1.00 37.20 ? 205  ALA D N   1 
ATOM   7082 C CA  . ALA D 1 205 ? 74.494  55.663  44.004 1.00 31.04 ? 205  ALA D CA  1 
ATOM   7083 C C   . ALA D 1 205 ? 75.233  55.234  45.271 1.00 29.10 ? 205  ALA D C   1 
ATOM   7084 O O   . ALA D 1 205 ? 75.276  54.046  45.604 1.00 24.37 ? 205  ALA D O   1 
ATOM   7085 C CB  . ALA D 1 205 ? 73.131  56.212  44.363 1.00 31.20 ? 205  ALA D CB  1 
ATOM   7086 N N   . PRO D 1 206 ? 75.804  56.206  46.013 1.00 28.79 ? 206  PRO D N   1 
ATOM   7087 C CA  . PRO D 1 206 ? 75.984  57.608  45.609 1.00 26.72 ? 206  PRO D CA  1 
ATOM   7088 C C   . PRO D 1 206 ? 77.210  57.860  44.739 1.00 27.71 ? 206  PRO D C   1 
ATOM   7089 O O   . PRO D 1 206 ? 78.251  57.221  44.912 1.00 31.58 ? 206  PRO D O   1 
ATOM   7090 C CB  . PRO D 1 206 ? 76.074  58.352  46.937 1.00 23.05 ? 206  PRO D CB  1 
ATOM   7091 C CG  . PRO D 1 206 ? 76.669  57.373  47.857 1.00 22.09 ? 206  PRO D CG  1 
ATOM   7092 C CD  . PRO D 1 206 ? 76.171  56.005  47.427 1.00 22.55 ? 206  PRO D CD  1 
ATOM   7093 N N   . ILE D 1 207 ? 77.085  58.807  43.813 1.00 26.51 ? 207  ILE D N   1 
ATOM   7094 C CA  . ILE D 1 207 ? 78.181  59.129  42.905 1.00 27.09 ? 207  ILE D CA  1 
ATOM   7095 C C   . ILE D 1 207 ? 79.344  59.734  43.677 1.00 28.57 ? 207  ILE D C   1 
ATOM   7096 O O   . ILE D 1 207 ? 80.507  59.416  43.410 1.00 24.59 ? 207  ILE D O   1 
ATOM   7097 C CB  . ILE D 1 207 ? 77.751  60.126  41.811 1.00 24.46 ? 207  ILE D CB  1 
ATOM   7098 C CG1 . ILE D 1 207 ? 76.689  59.498  40.907 1.00 30.49 ? 207  ILE D CG1 1 
ATOM   7099 C CG2 . ILE D 1 207 ? 78.951  60.516  40.974 1.00 19.78 ? 207  ILE D CG2 1 
ATOM   7100 C CD1 . ILE D 1 207 ? 75.947  60.502  40.041 1.00 27.35 ? 207  ILE D CD1 1 
ATOM   7101 N N   . PHE D 1 208 ? 79.009  60.527  44.693 1.00 25.83 ? 208  PHE D N   1 
ATOM   7102 C CA  . PHE D 1 208 ? 79.994  61.311  45.428 1.00 32.52 ? 208  PHE D CA  1 
ATOM   7103 C C   . PHE D 1 208 ? 80.145  60.899  46.883 1.00 32.91 ? 208  PHE D C   1 
ATOM   7104 O O   . PHE D 1 208 ? 79.309  60.187  47.434 1.00 40.32 ? 208  PHE D O   1 
ATOM   7105 C CB  . PHE D 1 208 ? 79.641  62.798  45.354 1.00 29.51 ? 208  PHE D CB  1 
ATOM   7106 C CG  . PHE D 1 208 ? 79.879  63.400  44.007 1.00 31.07 ? 208  PHE D CG  1 
ATOM   7107 C CD1 . PHE D 1 208 ? 81.122  63.280  43.388 1.00 34.19 ? 208  PHE D CD1 1 
ATOM   7108 C CD2 . PHE D 1 208 ? 78.848  64.024  43.320 1.00 32.71 ? 208  PHE D CD2 1 
ATOM   7109 C CE1 . PHE D 1 208 ? 81.332  63.771  42.101 1.00 33.52 ? 208  PHE D CE1 1 
ATOM   7110 C CE2 . PHE D 1 208 ? 79.043  64.518  42.033 1.00 33.12 ? 208  PHE D CE2 1 
ATOM   7111 C CZ  . PHE D 1 208 ? 80.288  64.392  41.424 1.00 35.87 ? 208  PHE D CZ  1 
ATOM   7112 N N   . TRP D 1 209 ? 81.250  61.330  47.479 1.00 37.66 ? 209  TRP D N   1 
ATOM   7113 C CA  . TRP D 1 209 ? 81.496  61.183  48.906 1.00 50.26 ? 209  TRP D CA  1 
ATOM   7114 C C   . TRP D 1 209 ? 80.381  61.874  49.676 1.00 47.76 ? 209  TRP D C   1 
ATOM   7115 O O   . TRP D 1 209 ? 79.736  62.786  49.163 1.00 52.62 ? 209  TRP D O   1 
ATOM   7116 C CB  . TRP D 1 209 ? 82.847  61.819  49.248 1.00 58.66 ? 209  TRP D CB  1 
ATOM   7117 C CG  . TRP D 1 209 ? 83.405  61.455  50.586 1.00 70.91 ? 209  TRP D CG  1 
ATOM   7118 C CD1 . TRP D 1 209 ? 83.725  62.312  51.595 1.00 75.96 ? 209  TRP D CD1 1 
ATOM   7119 C CD2 . TRP D 1 209 ? 83.814  60.153  51.018 1.00 76.81 ? 209  TRP D CD2 1 
ATOM   7120 N NE1 . TRP D 1 209 ? 84.312  61.629  52.629 1.00 78.30 ? 209  TRP D NE1 1 
ATOM   7121 C CE2 . TRP D 1 209 ? 84.381  60.302  52.303 1.00 78.79 ? 209  TRP D CE2 1 
ATOM   7122 C CE3 . TRP D 1 209 ? 83.764  58.876  50.443 1.00 79.80 ? 209  TRP D CE3 1 
ATOM   7123 C CZ2 . TRP D 1 209 ? 84.895  59.219  53.024 1.00 80.84 ? 209  TRP D CZ2 1 
ATOM   7124 C CZ3 . TRP D 1 209 ? 84.275  57.798  51.161 1.00 80.16 ? 209  TRP D CZ3 1 
ATOM   7125 C CH2 . TRP D 1 209 ? 84.833  57.979  52.437 1.00 81.05 ? 209  TRP D CH2 1 
ATOM   7126 N N   . TYR D 1 210 ? 80.179  61.467  50.922 1.00 51.10 ? 210  TYR D N   1 
ATOM   7127 C CA  . TYR D 1 210 ? 79.034  61.944  51.696 1.00 55.39 ? 210  TYR D CA  1 
ATOM   7128 C C   . TYR D 1 210 ? 79.138  63.429  52.082 1.00 51.57 ? 210  TYR D C   1 
ATOM   7129 O O   . TYR D 1 210 ? 78.139  64.051  52.447 1.00 53.75 ? 210  TYR D O   1 
ATOM   7130 C CB  . TYR D 1 210 ? 78.836  61.086  52.959 1.00 58.84 ? 210  TYR D CB  1 
ATOM   7131 C CG  . TYR D 1 210 ? 78.838  59.580  52.733 1.00 64.23 ? 210  TYR D CG  1 
ATOM   7132 C CD1 . TYR D 1 210 ? 78.300  59.016  51.571 1.00 66.31 ? 210  TYR D CD1 1 
ATOM   7133 C CD2 . TYR D 1 210 ? 79.402  58.720  53.679 1.00 69.46 ? 210  TYR D CD2 1 
ATOM   7134 C CE1 . TYR D 1 210 ? 78.333  57.632  51.354 1.00 68.28 ? 210  TYR D CE1 1 
ATOM   7135 C CE2 . TYR D 1 210 ? 79.438  57.338  53.476 1.00 73.26 ? 210  TYR D CE2 1 
ATOM   7136 C CZ  . TYR D 1 210 ? 78.906  56.799  52.312 1.00 71.82 ? 210  TYR D CZ  1 
ATOM   7137 O OH  . TYR D 1 210 ? 78.963  55.435  52.111 1.00 67.83 ? 210  TYR D OH  1 
ATOM   7138 N N   . THR D 1 211 ? 80.326  64.009  51.929 1.00 45.54 ? 211  THR D N   1 
ATOM   7139 C CA  . THR D 1 211 ? 80.530  65.427  52.213 1.00 41.16 ? 211  THR D CA  1 
ATOM   7140 C C   . THR D 1 211 ? 80.091  66.318  51.049 1.00 39.51 ? 211  THR D C   1 
ATOM   7141 O O   . THR D 1 211 ? 80.336  67.527  51.055 1.00 43.96 ? 211  THR D O   1 
ATOM   7142 C CB  . THR D 1 211 ? 82.018  65.735  52.535 1.00 42.27 ? 211  THR D CB  1 
ATOM   7143 O OG1 . THR D 1 211 ? 82.800  65.657  51.336 1.00 44.50 ? 211  THR D OG1 1 
ATOM   7144 C CG2 . THR D 1 211 ? 82.560  64.748  53.570 1.00 45.02 ? 211  THR D CG2 1 
ATOM   7145 N N   . ALA D 1 212 ? 79.471  65.714  50.040 1.00 37.45 ? 212  ALA D N   1 
ATOM   7146 C CA  . ALA D 1 212 ? 79.065  66.445  48.847 1.00 36.68 ? 212  ALA D CA  1 
ATOM   7147 C C   . ALA D 1 212 ? 77.725  67.103  49.078 1.00 39.90 ? 212  ALA D C   1 
ATOM   7148 O O   . ALA D 1 212 ? 76.874  66.558  49.776 1.00 43.59 ? 212  ALA D O   1 
ATOM   7149 C CB  . ALA D 1 212 ? 78.979  65.510  47.655 1.00 34.36 ? 212  ALA D CB  1 
ATOM   7150 N N   . LEU D 1 213 ? 77.531  68.266  48.468 1.00 43.44 ? 213  LEU D N   1 
ATOM   7151 C CA  . LEU D 1 213 ? 76.267  68.978  48.597 1.00 49.12 ? 213  LEU D CA  1 
ATOM   7152 C C   . LEU D 1 213 ? 75.244  68.563  47.536 1.00 47.51 ? 213  LEU D C   1 
ATOM   7153 O O   . LEU D 1 213 ? 74.064  68.901  47.642 1.00 54.96 ? 213  LEU D O   1 
ATOM   7154 C CB  . LEU D 1 213 ? 76.506  70.493  48.592 1.00 50.50 ? 213  LEU D CB  1 
ATOM   7155 C CG  . LEU D 1 213 ? 76.937  71.102  49.939 1.00 49.73 ? 213  LEU D CG  1 
ATOM   7156 C CD1 . LEU D 1 213 ? 78.223  70.450  50.428 1.00 54.45 ? 213  LEU D CD1 1 
ATOM   7157 C CD2 . LEU D 1 213 ? 77.148  72.601  49.786 1.00 53.38 ? 213  LEU D CD2 1 
ATOM   7158 N N   . TRP D 1 214 ? 75.675  67.728  46.591 1.00 45.25 ? 214  TRP D N   1 
ATOM   7159 C CA  . TRP D 1 214 ? 74.750  67.043  45.690 1.00 46.80 ? 214  TRP D CA  1 
ATOM   7160 C C   . TRP D 1 214 ? 75.047  65.545  45.595 1.00 47.59 ? 214  TRP D C   1 
ATOM   7161 O O   . TRP D 1 214 ? 76.200  65.121  45.651 1.00 48.66 ? 214  TRP D O   1 
ATOM   7162 C CB  . TRP D 1 214 ? 74.786  67.663  44.289 1.00 45.35 ? 214  TRP D CB  1 
ATOM   7163 C CG  . TRP D 1 214 ? 73.712  67.134  43.388 1.00 48.96 ? 214  TRP D CG  1 
ATOM   7164 C CD1 . TRP D 1 214 ? 72.408  67.526  43.363 1.00 52.27 ? 214  TRP D CD1 1 
ATOM   7165 C CD2 . TRP D 1 214 ? 73.810  66.013  42.496 1.00 47.59 ? 214  TRP D CD2 1 
ATOM   7166 N NE1 . TRP D 1 214 ? 71.681  66.706  42.534 1.00 52.12 ? 214  TRP D NE1 1 
ATOM   7167 C CE2 . TRP D 1 214 ? 72.517  65.767  41.990 1.00 50.49 ? 214  TRP D CE2 1 
ATOM   7168 C CE3 . TRP D 1 214 ? 74.863  65.187  42.085 1.00 46.77 ? 214  TRP D CE3 1 
ATOM   7169 C CZ2 . TRP D 1 214 ? 72.244  64.725  41.101 1.00 53.03 ? 214  TRP D CZ2 1 
ATOM   7170 C CZ3 . TRP D 1 214 ? 74.592  64.152  41.201 1.00 49.99 ? 214  TRP D CZ3 1 
ATOM   7171 C CH2 . TRP D 1 214 ? 73.290  63.930  40.721 1.00 52.04 ? 214  TRP D CH2 1 
ATOM   7172 N N   . ASN D 1 215 ? 73.981  64.756  45.480 1.00 49.83 ? 215  ASN D N   1 
ATOM   7173 C CA  . ASN D 1 215 ? 74.076  63.310  45.303 1.00 46.60 ? 215  ASN D CA  1 
ATOM   7174 C C   . ASN D 1 215 ? 72.739  62.747  44.820 1.00 50.57 ? 215  ASN D C   1 
ATOM   7175 O O   . ASN D 1 215 ? 71.735  63.461  44.754 1.00 51.63 ? 215  ASN D O   1 
ATOM   7176 C CB  . ASN D 1 215 ? 74.478  62.640  46.619 1.00 44.93 ? 215  ASN D CB  1 
ATOM   7177 C CG  . ASN D 1 215 ? 75.855  62.030  46.560 1.00 44.10 ? 215  ASN D CG  1 
ATOM   7178 O OD1 . ASN D 1 215 ? 76.713  62.322  47.394 1.00 42.92 ? 215  ASN D OD1 1 
ATOM   7179 N ND2 . ASN D 1 215 ? 76.084  61.190  45.557 1.00 43.28 ? 215  ASN D ND2 1 
ATOM   7180 N N   . ASN D 1 216 ? 72.742  61.459  44.496 1.00 47.91 ? 216  ASN D N   1 
ATOM   7181 C CA  . ASN D 1 216 ? 71.550  60.754  44.027 1.00 47.08 ? 216  ASN D CA  1 
ATOM   7182 C C   . ASN D 1 216 ? 70.965  59.833  45.103 1.00 45.79 ? 216  ASN D C   1 
ATOM   7183 O O   . ASN D 1 216 ? 69.793  59.454  45.043 1.00 48.33 ? 216  ASN D O   1 
ATOM   7184 C CB  . ASN D 1 216 ? 71.870  59.949  42.755 1.00 44.55 ? 216  ASN D CB  1 
ATOM   7185 C CG  . ASN D 1 216 ? 73.292  59.354  42.743 1.00 45.82 ? 216  ASN D CG  1 
ATOM   7186 O OD1 . ASN D 1 216 ? 73.749  58.861  41.714 1.00 39.04 ? 216  ASN D OD1 1 
ATOM   7187 N ND2 . ASN D 1 216 ? 73.957  59.337  43.892 1.00 46.43 ? 216  ASN D ND2 1 
ATOM   7188 N N   . LYS D 1 217 ? 71.803  59.456  46.065 1.00 53.25 ? 217  LYS D N   1 
ATOM   7189 C CA  . LYS D 1 217 ? 71.365  58.761  47.275 1.00 69.34 ? 217  LYS D CA  1 
ATOM   7190 C C   . LYS D 1 217 ? 72.371  58.985  48.429 1.00 74.08 ? 217  LYS D C   1 
ATOM   7191 O O   . LYS D 1 217 ? 72.836  57.997  49.052 1.00 75.42 ? 217  LYS D O   1 
ATOM   7192 C CB  . LYS D 1 217 ? 71.154  57.257  46.992 1.00 70.96 ? 217  LYS D CB  1 
ATOM   7193 C CG  . LYS D 1 217 ? 69.744  56.895  46.508 1.00 77.77 ? 217  LYS D CG  1 
ATOM   7194 C CD  . LYS D 1 217 ? 69.723  55.590  45.718 1.00 80.09 ? 217  LYS D CD  1 
ATOM   7195 C CE  . LYS D 1 217 ? 68.356  55.343  45.089 1.00 81.12 ? 217  LYS D CE  1 
ATOM   7196 N NZ  . LYS D 1 217 ? 67.312  54.916  46.079 1.00 80.22 ? 217  LYS D NZ  1 
HETATM 7197 S S   . EPY E 2 .   ? 56.221  36.104  71.620 1.00 36.74 ? 220  EPY A S   1 
HETATM 7198 C C2A . EPY E 2 .   ? 55.702  34.078  73.146 1.00 29.03 ? 220  EPY A C2A 1 
HETATM 7199 C C3A . EPY E 2 .   ? 54.585  33.741  74.239 1.00 28.25 ? 220  EPY A C3A 1 
HETATM 7200 N N4A . EPY E 2 .   ? 54.357  32.451  74.345 1.00 29.50 ? 220  EPY A N4A 1 
HETATM 7201 C C1A . EPY E 2 .   ? 55.934  35.564  72.949 1.00 36.06 ? 220  EPY A C1A 1 
HETATM 7202 C C5A . EPY E 2 .   ? 55.348  31.466  74.872 1.00 32.01 ? 220  EPY A C5A 1 
HETATM 7203 C C6A . EPY E 2 .   ? 54.726  30.257  75.461 1.00 32.25 ? 220  EPY A C6A 1 
HETATM 7204 O O6A . EPY E 2 .   ? 53.502  30.125  75.491 1.00 25.13 ? 220  EPY A O6A 1 
HETATM 7205 O O3A . EPY E 2 .   ? 53.825  34.575  74.714 1.00 32.91 ? 220  EPY A O3A 1 
HETATM 7206 O O7A . EPY E 2 .   ? 55.427  29.332  75.950 1.00 44.06 ? 220  EPY A O7A 1 
HETATM 7207 O O6B . EPY E 2 .   ? 54.532  32.669  65.255 1.00 33.67 ? 220  EPY A O6B 1 
HETATM 7208 C C6B . EPY E 2 .   ? 54.381  32.348  66.498 1.00 29.96 ? 220  EPY A C6B 1 
HETATM 7209 O O7B . EPY E 2 .   ? 53.352  32.552  67.087 1.00 34.82 ? 220  EPY A O7B 1 
HETATM 7210 C C5B . EPY E 2 .   ? 55.590  31.652  67.232 1.00 26.09 ? 220  EPY A C5B 1 
HETATM 7211 N N5B . EPY E 2 .   ? 56.708  31.402  66.187 1.00 28.93 ? 220  EPY A N5B 1 
HETATM 7212 C C4B . EPY E 2 .   ? 56.212  32.497  68.377 1.00 30.38 ? 220  EPY A C4B 1 
HETATM 7213 C C3B . EPY E 2 .   ? 55.259  32.838  69.517 1.00 30.88 ? 220  EPY A C3B 1 
HETATM 7214 C C2B . EPY E 2 .   ? 55.994  33.454  70.736 1.00 31.83 ? 220  EPY A C2B 1 
HETATM 7215 O O2B . EPY E 2 .   ? 57.142  33.797  70.675 1.00 29.17 ? 220  EPY A O2B 1 
HETATM 7216 N N1B . EPY E 2 .   ? 55.182  33.528  71.958 1.00 33.38 ? 220  EPY A N1B 1 
HETATM 7217 C C1C . EPY E 2 .   ? 57.549  36.641  72.193 1.00 44.52 ? 220  EPY A C1C 1 
HETATM 7218 C C3C . EPY E 2 .   ? 57.553  37.472  73.493 1.00 40.70 ? 220  EPY A C3C 1 
HETATM 7219 O O2C . EPY E 2 .   ? 58.672  38.153  73.959 1.00 46.84 ? 220  EPY A O2C 1 
HETATM 7220 C C2C . EPY E 2 .   ? 58.486  37.260  71.295 1.00 47.46 ? 220  EPY A C2C 1 
HETATM 7221 O O3C . EPY E 2 .   ? 59.797  37.861  71.375 1.00 47.24 ? 220  EPY A O3C 1 
HETATM 7222 C C4C . EPY E 2 .   ? 59.694  38.624  70.207 1.00 40.58 ? 220  EPY A C4C 1 
HETATM 7223 C C9C . EPY E 2 .   ? 59.606  40.034  70.342 1.00 34.80 ? 220  EPY A C9C 1 
HETATM 7224 C C8C . EPY E 2 .   ? 59.491  40.862  69.195 1.00 43.98 ? 220  EPY A C8C 1 
HETATM 7225 C C7C . EPY E 2 .   ? 59.472  40.272  67.903 1.00 46.28 ? 220  EPY A C7C 1 
HETATM 7226 C C6C . EPY E 2 .   ? 59.566  38.874  67.778 1.00 38.21 ? 220  EPY A C6C 1 
HETATM 7227 C C5C . EPY E 2 .   ? 59.681  38.056  68.916 1.00 33.98 ? 220  EPY A C5C 1 
HETATM 7228 N N8C . EPY E 2 .   ? 59.408  41.014  66.818 1.00 51.96 ? 220  EPY A N8C 1 
HETATM 7229 O O8C . EPY E 2 .   ? 59.168  40.619  65.680 1.00 55.57 ? 220  EPY A O8C 1 
HETATM 7230 O O9C . EPY E 2 .   ? 59.554  42.197  66.996 1.00 51.62 ? 220  EPY A O9C 1 
HETATM 7231 S S   . EPY F 2 .   ? 72.426  27.218  59.063 1.00 47.66 ? 221  EPY B S   1 
HETATM 7232 C C2A . EPY F 2 .   ? 72.702  29.625  57.489 1.00 33.16 ? 221  EPY B C2A 1 
HETATM 7233 C C3A . EPY F 2 .   ? 73.796  30.235  56.652 1.00 30.94 ? 221  EPY B C3A 1 
HETATM 7234 N N4A . EPY F 2 .   ? 73.687  31.274  55.855 1.00 21.78 ? 221  EPY B N4A 1 
HETATM 7235 C C1A . EPY F 2 .   ? 72.268  28.198  57.856 1.00 34.42 ? 221  EPY B C1A 1 
HETATM 7236 C C5A . EPY F 2 .   ? 73.502  32.678  56.331 1.00 32.01 ? 221  EPY B C5A 1 
HETATM 7237 C C6A . EPY F 2 .   ? 74.001  33.698  55.378 1.00 37.33 ? 221  EPY B C6A 1 
HETATM 7238 O O6A . EPY F 2 .   ? 74.513  33.367  54.309 1.00 30.32 ? 221  EPY B O6A 1 
HETATM 7239 O O3A . EPY F 2 .   ? 74.727  29.444  56.562 1.00 38.50 ? 221  EPY B O3A 1 
HETATM 7240 O O7A . EPY F 2 .   ? 73.917  34.927  55.634 1.00 40.01 ? 221  EPY B O7A 1 
HETATM 7241 O O6B . EPY F 2 .   ? 64.906  28.645  56.332 1.00 33.29 ? 221  EPY B O6B 1 
HETATM 7242 C C6B . EPY F 2 .   ? 65.993  29.280  56.043 1.00 28.40 ? 221  EPY B C6B 1 
HETATM 7243 O O7B . EPY F 2 .   ? 66.698  28.952  55.124 1.00 31.23 ? 221  EPY B O7B 1 
HETATM 7244 C C5B . EPY F 2 .   ? 66.375  30.530  56.925 1.00 27.03 ? 221  EPY B C5B 1 
HETATM 7245 N N5B . EPY F 2 .   ? 65.218  30.781  57.927 1.00 27.96 ? 221  EPY B N5B 1 
HETATM 7246 C C4B . EPY F 2 .   ? 67.672  30.350  57.759 1.00 27.43 ? 221  EPY B C4B 1 
HETATM 7247 C C3B . EPY F 2 .   ? 68.935  30.102  56.940 1.00 30.94 ? 221  EPY B C3B 1 
HETATM 7248 C C2B . EPY F 2 .   ? 70.208  30.038  57.824 1.00 36.07 ? 221  EPY B C2B 1 
HETATM 7249 O O2B . EPY F 2 .   ? 70.145  29.987  59.021 1.00 40.24 ? 221  EPY B O2B 1 
HETATM 7250 N N1B . EPY F 2 .   ? 71.348  30.056  57.165 1.00 33.81 ? 221  EPY B N1B 1 
HETATM 7251 C C1C . EPY F 2 .   ? 73.268  27.616  60.356 1.00 47.29 ? 221  EPY B C1C 1 
HETATM 7252 C C3C . EPY F 2 .   ? 74.783  27.407  60.410 1.00 42.13 ? 221  EPY B C3C 1 
HETATM 7253 O O2C . EPY F 2 .   ? 75.429  26.796  61.496 1.00 51.47 ? 221  EPY B O2C 1 
HETATM 7254 C C2C . EPY F 2 .   ? 72.846  26.392  61.017 1.00 42.94 ? 221  EPY B C2C 1 
HETATM 7255 O O3C . EPY F 2 .   ? 72.673  26.295  62.415 1.00 36.87 ? 221  EPY B O3C 1 
HETATM 7256 C C4C . EPY F 2 .   ? 71.620  25.418  62.695 1.00 38.70 ? 221  EPY B C4C 1 
HETATM 7257 C C9C . EPY F 2 .   ? 71.861  24.028  62.550 1.00 36.21 ? 221  EPY B C9C 1 
HETATM 7258 C C8C . EPY F 2 .   ? 70.830  23.088  62.813 1.00 40.35 ? 221  EPY B C8C 1 
HETATM 7259 C C7C . EPY F 2 .   ? 69.553  23.546  63.227 1.00 46.37 ? 221  EPY B C7C 1 
HETATM 7260 C C6C . EPY F 2 .   ? 69.324  24.927  63.373 1.00 40.39 ? 221  EPY B C6C 1 
HETATM 7261 C C5C . EPY F 2 .   ? 70.347  25.856  63.115 1.00 39.26 ? 221  EPY B C5C 1 
HETATM 7262 N N8C . EPY F 2 .   ? 68.541  22.680  63.515 1.00 53.57 ? 221  EPY B N8C 1 
HETATM 7263 O O8C . EPY F 2 .   ? 67.507  23.037  64.069 1.00 50.06 ? 221  EPY B O8C 1 
HETATM 7264 O O9C . EPY F 2 .   ? 68.649  21.524  63.194 1.00 59.64 ? 221  EPY B O9C 1 
HETATM 7265 S S   . EPY G 2 .   ? 95.848  75.732  31.463 1.00 36.21 ? 222  EPY C S   1 
HETATM 7266 C C2A . EPY G 2 .   ? 93.717  76.042  30.024 1.00 25.42 ? 222  EPY C C2A 1 
HETATM 7267 C C3A . EPY G 2 .   ? 93.336  76.978  28.934 1.00 27.59 ? 222  EPY C C3A 1 
HETATM 7268 N N4A . EPY G 2 .   ? 92.533  76.642  27.950 1.00 32.02 ? 222  EPY C N4A 1 
HETATM 7269 C C1A . EPY G 2 .   ? 95.063  76.261  30.401 1.00 35.12 ? 222  EPY C C1A 1 
HETATM 7270 C C5A . EPY G 2 .   ? 91.095  76.281  28.130 1.00 34.34 ? 222  EPY C C5A 1 
HETATM 7271 C C6A . EPY G 2 .   ? 90.265  76.534  26.928 1.00 35.47 ? 222  EPY C C6A 1 
HETATM 7272 O O6A . EPY G 2 .   ? 90.782  76.664  25.818 1.00 43.54 ? 222  EPY C O6A 1 
HETATM 7273 O O3A . EPY G 2 .   ? 93.995  78.010  28.910 1.00 33.22 ? 222  EPY C O3A 1 
HETATM 7274 O O7A . EPY G 2 .   ? 89.011  76.626  27.006 1.00 42.23 ? 222  EPY C O7A 1 
HETATM 7275 O O6B . EPY G 2 .   ? 96.124  68.449  30.000 1.00 26.31 ? 222  EPY C O6B 1 
HETATM 7276 C C6B . EPY G 2 .   ? 95.434  69.396  29.457 1.00 25.38 ? 222  EPY C C6B 1 
HETATM 7277 O O7B . EPY G 2 .   ? 95.869  70.064  28.555 1.00 22.63 ? 222  EPY C O7B 1 
HETATM 7278 C C5B . EPY G 2 .   ? 93.975  69.650  29.997 1.00 20.40 ? 222  EPY C C5B 1 
HETATM 7279 N N5B . EPY G 2 .   ? 93.656  68.555  31.049 1.00 20.15 ? 222  EPY C N5B 1 
HETATM 7280 C C4B . EPY G 2 .   ? 93.784  71.025  30.694 1.00 14.75 ? 222  EPY C C4B 1 
HETATM 7281 C C3B . EPY G 2 .   ? 94.044  72.238  29.807 1.00 18.90 ? 222  EPY C C3B 1 
HETATM 7282 C C2B . EPY G 2 .   ? 93.733  73.575  30.530 1.00 24.62 ? 222  EPY C C2B 1 
HETATM 7283 O O2B . EPY G 2 .   ? 93.514  73.620  31.709 1.00 33.87 ? 222  EPY C O2B 1 
HETATM 7284 N N1B . EPY G 2 .   ? 93.716  74.639  29.755 1.00 22.95 ? 222  EPY C N1B 1 
HETATM 7285 C C1C . EPY G 2 .   ? 96.135  76.658  32.655 1.00 37.91 ? 222  EPY C C1C 1 
HETATM 7286 C C3C . EPY G 2 .   ? 96.681  75.850  33.685 1.00 42.27 ? 222  EPY C C3C 1 
HETATM 7287 O O2C . EPY G 2 .   ? 97.223  76.108  34.928 1.00 46.16 ? 222  EPY C O2C 1 
HETATM 7288 C C2C . EPY G 2 .   ? 94.934  77.311  33.195 1.00 37.77 ? 222  EPY C C2C 1 
HETATM 7289 O O3C . EPY G 2 .   ? 95.003  78.702  33.381 1.00 42.85 ? 222  EPY C O3C 1 
HETATM 7290 C C4C . EPY G 2 .   ? 94.193  79.493  32.729 1.00 40.78 ? 222  EPY C C4C 1 
HETATM 7291 C C9C . EPY G 2 .   ? 93.129  80.129  33.417 1.00 40.19 ? 222  EPY C C9C 1 
HETATM 7292 C C8C . EPY G 2 .   ? 92.213  80.960  32.719 1.00 43.99 ? 222  EPY C C8C 1 
HETATM 7293 C C7C . EPY G 2 .   ? 92.370  81.159  31.323 1.00 46.06 ? 222  EPY C C7C 1 
HETATM 7294 C C6C . EPY G 2 .   ? 93.434  80.528  30.647 1.00 43.81 ? 222  EPY C C6C 1 
HETATM 7295 C C5C . EPY G 2 .   ? 94.384  79.668  31.384 1.00 42.67 ? 222  EPY C C5C 1 
HETATM 7296 N N8C . EPY G 2 .   ? 91.472  81.953  30.619 1.00 54.15 ? 222  EPY C N8C 1 
HETATM 7297 O O8C . EPY G 2 .   ? 90.505  82.498  31.143 1.00 56.77 ? 222  EPY C O8C 1 
HETATM 7298 O O9C . EPY G 2 .   ? 91.659  82.125  29.439 1.00 53.63 ? 222  EPY C O9C 1 
HETATM 7299 S S   . EPY H 2 .   ? 88.265  59.068  45.078 1.00 51.20 ? 223  EPY D S   1 
HETATM 7300 C C2A . EPY H 2 .   ? 90.390  58.910  46.526 1.00 36.02 ? 223  EPY D C2A 1 
HETATM 7301 C C3A . EPY H 2 .   ? 90.745  58.029  47.741 1.00 36.41 ? 223  EPY D C3A 1 
HETATM 7302 N N4A . EPY H 2 .   ? 92.007  57.890  48.081 1.00 33.39 ? 223  EPY D N4A 1 
HETATM 7303 C C1A . EPY H 2 .   ? 89.183  58.445  46.061 1.00 44.19 ? 223  EPY D C1A 1 
HETATM 7304 C C5A . EPY H 2 .   ? 92.813  58.951  48.757 1.00 34.57 ? 223  EPY D C5A 1 
HETATM 7305 C C6A . EPY H 2 .   ? 93.935  58.418  49.565 1.00 30.06 ? 223  EPY D C6A 1 
HETATM 7306 O O6A . EPY H 2 .   ? 94.140  57.206  49.641 1.00 28.52 ? 223  EPY D O6A 1 
HETATM 7307 O O3A . EPY H 2 .   ? 89.891  57.216  48.073 1.00 43.40 ? 223  EPY D O3A 1 
HETATM 7308 O O7A . EPY H 2 .   ? 94.707  59.186  50.197 1.00 35.69 ? 223  EPY D O7A 1 
HETATM 7309 O O6B . EPY H 2 .   ? 92.426  58.124  38.863 1.00 32.79 ? 223  EPY D O6B 1 
HETATM 7310 C C6B . EPY H 2 .   ? 92.735  58.013  40.111 1.00 34.40 ? 223  EPY D C6B 1 
HETATM 7311 O O7B . EPY H 2 .   ? 92.650  56.966  40.698 1.00 31.53 ? 223  EPY D O7B 1 
HETATM 7312 C C5B . EPY H 2 .   ? 93.254  59.300  40.862 1.00 30.77 ? 223  EPY D C5B 1 
HETATM 7313 N N5B . EPY H 2 .   ? 93.382  60.442  39.820 1.00 34.60 ? 223  EPY D N5B 1 
HETATM 7314 C C4B . EPY H 2 .   ? 92.310  59.808  41.985 1.00 30.30 ? 223  EPY D C4B 1 
HETATM 7315 C C3B . EPY H 2 .   ? 92.472  59.251  43.404 1.00 31.77 ? 223  EPY D C3B 1 
HETATM 7316 C C2B . EPY H 2 .   ? 91.205  59.422  44.258 1.00 34.30 ? 223  EPY D C2B 1 
HETATM 7317 O O2B . EPY H 2 .   ? 90.305  60.031  44.005 1.00 42.97 ? 223  EPY D O2B 1 
HETATM 7318 N N1B . EPY H 2 .   ? 91.152  58.705  45.360 1.00 31.82 ? 223  EPY D N1B 1 
HETATM 7319 C C1C . EPY H 2 .   ? 87.696  60.303  45.716 1.00 41.68 ? 223  EPY D C1C 1 
HETATM 7320 C C3C . EPY H 2 .   ? 86.221  60.093  45.777 1.00 39.32 ? 223  EPY D C3C 1 
HETATM 7321 O O2C . EPY H 2 .   ? 85.346  61.191  45.817 1.00 42.68 ? 223  EPY D O2C 1 
HETATM 7322 C C2C . EPY H 2 .   ? 88.383  60.406  47.061 1.00 42.64 ? 223  EPY D C2C 1 
HETATM 7323 O O3C . EPY H 2 .   ? 87.655  61.059  48.082 1.00 40.58 ? 223  EPY D O3C 1 
HETATM 7324 C C4C . EPY H 2 .   ? 87.996  60.955  49.373 1.00 42.55 ? 223  EPY D C4C 1 
HETATM 7325 C C9C . EPY H 2 .   ? 88.063  62.119  50.295 1.00 44.40 ? 223  EPY D C9C 1 
HETATM 7326 C C8C . EPY H 2 .   ? 88.357  62.002  51.573 1.00 45.22 ? 223  EPY D C8C 1 
HETATM 7327 C C7C . EPY H 2 .   ? 88.666  60.727  52.123 1.00 44.90 ? 223  EPY D C7C 1 
HETATM 7328 C C6C . EPY H 2 .   ? 88.635  59.588  51.296 1.00 40.51 ? 223  EPY D C6C 1 
HETATM 7329 C C5C . EPY H 2 .   ? 88.298  59.698  49.937 1.00 44.15 ? 223  EPY D C5C 1 
HETATM 7330 N N8C . EPY H 2 .   ? 89.033  60.608  53.430 1.00 54.17 ? 223  EPY D N8C 1 
HETATM 7331 O O8C . EPY H 2 .   ? 89.122  61.582  54.173 1.00 46.93 ? 223  EPY D O8C 1 
HETATM 7332 O O9C . EPY H 2 .   ? 89.238  59.513  53.891 1.00 54.69 ? 223  EPY D O9C 1 
HETATM 7333 O O   . HOH I 3 .   ? 48.594  27.930  52.943 1.00 39.05 ? 2012 HOH A O   1 
HETATM 7334 O O   . HOH I 3 .   ? 31.962  26.537  68.661 1.00 32.57 ? 2015 HOH A O   1 
HETATM 7335 O O   . HOH I 3 .   ? 58.921  30.441  71.311 1.00 29.85 ? 2017 HOH A O   1 
HETATM 7336 O O   . HOH I 3 .   ? 40.591  59.006  58.864 1.00 39.70 ? 2034 HOH A O   1 
HETATM 7337 O O   . HOH I 3 .   ? 60.504  34.618  74.202 1.00 37.87 ? 2049 HOH A O   1 
HETATM 7338 O O   . HOH I 3 .   ? 57.218  50.198  44.708 1.00 38.88 ? 2050 HOH A O   1 
HETATM 7339 O O   . HOH I 3 .   ? 55.822  55.776  62.870 1.00 38.59 ? 2051 HOH A O   1 
HETATM 7340 O O   . HOH I 3 .   ? 64.196  43.226  83.827 1.00 39.22 ? 2055 HOH A O   1 
HETATM 7341 O O   . HOH I 3 .   ? 57.218  52.987  41.913 1.00 43.99 ? 2058 HOH A O   1 
HETATM 7342 O O   . HOH I 3 .   ? 68.401  37.473  81.969 1.00 36.16 ? 2061 HOH A O   1 
HETATM 7343 O O   . HOH I 3 .   ? 58.645  30.107  83.890 1.00 37.26 ? 2064 HOH A O   1 
HETATM 7344 O O   . HOH I 3 .   ? 79.547  45.089  67.061 1.00 38.67 ? 2065 HOH A O   1 
HETATM 7345 O O   . HOH I 3 .   ? 73.911  56.703  67.124 1.00 34.24 ? 2074 HOH A O   1 
HETATM 7346 O O   . HOH I 3 .   ? 35.262  22.585  61.526 1.00 46.84 ? 2075 HOH A O   1 
HETATM 7347 O O   . HOH I 3 .   ? 36.284  44.620  68.458 1.00 40.63 ? 2080 HOH A O   1 
HETATM 7348 O O   . HOH I 3 .   ? 35.193  32.090  80.678 1.00 40.75 ? 2082 HOH A O   1 
HETATM 7349 O O   . HOH I 3 .   ? 34.889  57.170  67.061 1.00 44.88 ? 2083 HOH A O   1 
HETATM 7350 O O   . HOH I 3 .   ? 43.262  48.804  79.635 1.00 47.24 ? 2088 HOH A O   1 
HETATM 7351 O O   . HOH I 3 .   ? 50.240  48.804  75.444 1.00 42.08 ? 2090 HOH A O   1 
HETATM 7352 O O   . HOH I 3 .   ? 57.170  49.025  35.631 1.00 41.77 ? 2099 HOH A O   1 
HETATM 7353 O O   . HOH I 3 .   ? 86.575  38.929  75.458 1.00 45.71 ? 2104 HOH A O   1 
HETATM 7354 O O   . HOH I 3 .   ? 78.151  43.226  55.884 1.00 46.52 ? 2108 HOH A O   1 
HETATM 7355 O O   . HOH I 3 .   ? 64.196  68.325  51.693 1.00 40.76 ? 2126 HOH A O   1 
HETATM 7356 O O   . HOH I 3 .   ? 47.502  57.719  65.515 1.00 40.93 ? 2140 HOH A O   1 
HETATM 7357 O O   . HOH I 3 .   ? 50.513  54.320  76.779 1.00 48.17 ? 2141 HOH A O   1 
HETATM 7358 O O   . HOH I 3 .   ? 36.297  53.146  56.398 1.00 44.52 ? 2142 HOH A O   1 
HETATM 7359 O O   . HOH I 3 .   ? 66.961  33.353  84.017 1.00 39.64 ? 2143 HOH A O   1 
HETATM 7360 O O   . HOH I 3 .   ? 58.613  27.888  79.635 1.00 39.65 ? 2148 HOH A O   1 
HETATM 7361 O O   . HOH I 3 .   ? 33.461  57.161  60.591 1.00 42.96 ? 2149 HOH A O   1 
HETATM 7362 O O   . HOH I 3 .   ? 88.025  45.910  79.141 1.00 45.34 ? 2150 HOH A O   1 
HETATM 7363 O O   . HOH J 3 .   ? 46.041  7.084   58.511 1.00 35.82 ? 2002 HOH B O   1 
HETATM 7364 O O   . HOH J 3 .   ? 52.257  16.753  79.610 1.00 41.87 ? 2007 HOH B O   1 
HETATM 7365 O O   . HOH J 3 .   ? 52.052  25.654  49.818 1.00 23.30 ? 2008 HOH B O   1 
HETATM 7366 O O   . HOH J 3 .   ? 75.162  14.280  46.150 1.00 41.25 ? 2009 HOH B O   1 
HETATM 7367 O O   . HOH J 3 .   ? 44.613  4.271   57.313 1.00 41.96 ? 2010 HOH B O   1 
HETATM 7368 O O   . HOH J 3 .   ? 79.564  14.260  51.592 1.00 49.31 ? 2014 HOH B O   1 
HETATM 7369 O O   . HOH J 3 .   ? 65.581  19.604  57.391 1.00 36.21 ? 2022 HOH B O   1 
HETATM 7370 O O   . HOH J 3 .   ? 72.434  37.758  60.081 1.00 46.18 ? 2033 HOH B O   1 
HETATM 7371 O O   . HOH J 3 .   ? 77.825  26.664  41.859 1.00 37.05 ? 2035 HOH B O   1 
HETATM 7372 O O   . HOH J 3 .   ? 63.190  23.612  57.418 1.00 37.11 ? 2037 HOH B O   1 
HETATM 7373 O O   . HOH J 3 .   ? 57.350  18.936  37.485 1.00 42.63 ? 2038 HOH B O   1 
HETATM 7374 O O   . HOH J 3 .   ? 77.637  29.940  59.688 1.00 40.85 ? 2039 HOH B O   1 
HETATM 7375 O O   . HOH J 3 .   ? 66.987  30.677  33.531 1.00 41.03 ? 2042 HOH B O   1 
HETATM 7376 O O   . HOH J 3 .   ? 78.151  33.465  57.282 1.00 36.98 ? 2043 HOH B O   1 
HETATM 7377 O O   . HOH J 3 .   ? 62.800  5.578   74.047 1.00 44.71 ? 2044 HOH B O   1 
HETATM 7378 O O   . HOH J 3 .   ? 65.591  9.761   40.516 1.00 38.12 ? 2052 HOH B O   1 
HETATM 7379 O O   . HOH J 3 .   ? 91.980  26.673  47.462 1.00 44.96 ? 2057 HOH B O   1 
HETATM 7380 O O   . HOH J 3 .   ? 83.733  15.338  72.650 1.00 43.32 ? 2063 HOH B O   1 
HETATM 7381 O O   . HOH J 3 .   ? 78.151  6.972   67.061 1.00 37.61 ? 2067 HOH B O   1 
HETATM 7382 O O   . HOH J 3 .   ? 65.591  23.705  85.224 1.00 41.93 ? 2071 HOH B O   1 
HETATM 7383 O O   . HOH J 3 .   ? 88.201  35.785  54.015 1.00 46.42 ? 2092 HOH B O   1 
HETATM 7384 O O   . HOH J 3 .   ? 72.769  38.901  44.450 1.00 50.82 ? 2093 HOH B O   1 
HETATM 7385 O O   . HOH J 3 .   ? 68.382  15.338  85.224 1.00 43.76 ? 2096 HOH B O   1 
HETATM 7386 O O   . HOH J 3 .   ? 79.428  16.323  47.031 1.00 41.04 ? 2103 HOH B O   1 
HETATM 7387 O O   . HOH J 3 .   ? 62.800  18.127  37.722 1.00 33.54 ? 2105 HOH B O   1 
HETATM 7388 O O   . HOH J 3 .   ? 72.569  34.860  83.827 1.00 32.42 ? 2107 HOH B O   1 
HETATM 7389 O O   . HOH J 3 .   ? 65.591  30.677  86.621 1.00 46.51 ? 2109 HOH B O   1 
HETATM 7390 O O   . HOH J 3 .   ? 72.411  33.625  36.464 1.00 47.00 ? 2113 HOH B O   1 
HETATM 7391 O O   . HOH J 3 .   ? 90.711  39.043  69.856 1.00 42.10 ? 2116 HOH B O   1 
HETATM 7392 O O   . HOH J 3 .   ? 79.547  7.046   71.416 1.00 43.60 ? 2117 HOH B O   1 
HETATM 7393 O O   . HOH J 3 .   ? 66.987  11.155  43.310 1.00 34.37 ? 2119 HOH B O   1 
HETATM 7394 O O   . HOH J 3 .   ? 76.756  33.465  81.032 1.00 40.70 ? 2120 HOH B O   1 
HETATM 7395 O O   . HOH J 3 .   ? 80.942  33.465  82.430 1.00 39.14 ? 2121 HOH B O   1 
HETATM 7396 O O   . HOH J 3 .   ? 86.524  32.071  41.913 1.00 36.46 ? 2124 HOH B O   1 
HETATM 7397 O O   . HOH J 3 .   ? 64.285  9.802   82.274 1.00 50.40 ? 2127 HOH B O   1 
HETATM 7398 O O   . HOH J 3 .   ? 69.899  34.887  86.005 1.00 43.22 ? 2130 HOH B O   1 
HETATM 7399 O O   . HOH J 3 .   ? 72.470  33.257  60.502 1.00 43.42 ? 2137 HOH B O   1 
HETATM 7400 O O   . HOH J 3 .   ? 82.397  30.802  40.690 1.00 48.86 ? 2138 HOH B O   1 
HETATM 7401 O O   . HOH J 3 .   ? 84.015  11.305  57.142 1.00 50.77 ? 2144 HOH B O   1 
HETATM 7402 O O   . HOH J 3 .   ? 79.571  1.331   66.686 1.00 41.71 ? 2151 HOH B O   1 
HETATM 7403 O O   . HOH J 3 .   ? 89.316  33.465  67.061 1.00 43.23 ? 2152 HOH B O   1 
HETATM 7404 O O   . HOH J 3 .   ? 61.404  25.099  88.018 1.00 47.80 ? 2155 HOH B O   1 
HETATM 7405 O O   . HOH K 3 .   ? 106.229 87.447  39.164 1.00 36.73 ? 2001 HOH C O   1 
HETATM 7406 O O   . HOH K 3 .   ? 100.520 55.604  23.705 1.00 33.24 ? 2003 HOH C O   1 
HETATM 7407 O O   . HOH K 3 .   ? 92.103  80.920  38.995 1.00 31.67 ? 2004 HOH C O   1 
HETATM 7408 O O   . HOH K 3 .   ? 103.640 80.821  10.696 1.00 40.87 ? 2013 HOH C O   1 
HETATM 7409 O O   . HOH K 3 .   ? 124.178 65.555  16.775 1.00 37.08 ? 2016 HOH C O   1 
HETATM 7410 O O   . HOH K 3 .   ? 103.195 83.579  18.083 1.00 41.03 ? 2018 HOH C O   1 
HETATM 7411 O O   . HOH K 3 .   ? 110.300 43.354  31.677 1.00 43.98 ? 2023 HOH C O   1 
HETATM 7412 O O   . HOH K 3 .   ? 93.311  69.152  44.758 1.00 33.95 ? 2025 HOH C O   1 
HETATM 7413 O O   . HOH K 3 .   ? 107.674 84.664  23.659 1.00 41.52 ? 2026 HOH C O   1 
HETATM 7414 O O   . HOH K 3 .   ? 92.302  65.417  14.185 1.00 29.81 ? 2028 HOH C O   1 
HETATM 7415 O O   . HOH K 3 .   ? 114.997 61.464  19.539 1.00 41.77 ? 2029 HOH C O   1 
HETATM 7416 O O   . HOH K 3 .   ? 98.591  80.715  15.495 1.00 43.37 ? 2030 HOH C O   1 
HETATM 7417 O O   . HOH K 3 .   ? 104.312 69.858  6.958  1.00 38.73 ? 2031 HOH C O   1 
HETATM 7418 O O   . HOH K 3 .   ? 101.855 72.230  11.034 1.00 38.17 ? 2032 HOH C O   1 
HETATM 7419 O O   . HOH K 3 .   ? 108.692 84.848  30.482 1.00 46.68 ? 2036 HOH C O   1 
HETATM 7420 O O   . HOH K 3 .   ? 94.898  61.353  36.325 1.00 36.18 ? 2040 HOH C O   1 
HETATM 7421 O O   . HOH K 3 .   ? 93.502  62.747  33.531 1.00 36.80 ? 2041 HOH C O   1 
HETATM 7422 O O   . HOH K 3 .   ? 122.809 50.198  40.516 1.00 34.65 ? 2046 HOH C O   1 
HETATM 7423 O O   . HOH K 3 .   ? 87.700  83.426  49.012 1.00 46.52 ? 2054 HOH C O   1 
HETATM 7424 O O   . HOH K 3 .   ? 87.920  100.396 37.722 1.00 38.18 ? 2056 HOH C O   1 
HETATM 7425 O O   . HOH K 3 .   ? 99.084  96.213  37.722 1.00 35.79 ? 2060 HOH C O   1 
HETATM 7426 O O   . HOH K 3 .   ? 107.458 93.424  39.119 1.00 44.88 ? 2066 HOH C O   1 
HETATM 7427 O O   . HOH K 3 .   ? 99.084  68.325  58.679 1.00 40.65 ? 2070 HOH C O   1 
HETATM 7428 O O   . HOH K 3 .   ? 93.502  61.353  8.383  1.00 38.12 ? 2072 HOH C O   1 
HETATM 7429 O O   . HOH K 3 .   ? 96.293  86.452  50.296 1.00 42.64 ? 2073 HOH C O   1 
HETATM 7430 O O   . HOH K 3 .   ? 86.524  104.579 34.928 1.00 53.11 ? 2077 HOH C O   1 
HETATM 7431 O O   . HOH K 3 .   ? 107.458 82.269  18.162 1.00 43.76 ? 2078 HOH C O   1 
HETATM 7432 O O   . HOH K 3 .   ? 89.297  97.714  40.390 1.00 49.80 ? 2084 HOH C O   1 
HETATM 7433 O O   . HOH K 3 .   ? 95.485  91.757  51.600 1.00 39.82 ? 2094 HOH C O   1 
HETATM 7434 O O   . HOH K 3 .   ? 101.876 44.620  20.957 1.00 33.84 ? 2095 HOH C O   1 
HETATM 7435 O O   . HOH K 3 .   ? 124.204 61.353  32.134 1.00 30.69 ? 2098 HOH C O   1 
HETATM 7436 O O   . HOH K 3 .   ? 111.644 82.269  26.545 1.00 43.53 ? 2100 HOH C O   1 
HETATM 7437 O O   . HOH K 3 .   ? 107.449 65.822  11.439 1.00 40.06 ? 2101 HOH C O   1 
HETATM 7438 O O   . HOH K 3 .   ? 121.548 72.577  32.065 1.00 31.51 ? 2102 HOH C O   1 
HETATM 7439 O O   . HOH K 3 .   ? 115.554 86.149  34.898 1.00 44.16 ? 2111 HOH C O   1 
HETATM 7440 O O   . HOH K 3 .   ? 90.719  94.891  28.371 1.00 47.68 ? 2112 HOH C O   1 
HETATM 7441 O O   . HOH K 3 .   ? 102.744 98.809  30.475 1.00 38.99 ? 2114 HOH C O   1 
HETATM 7442 O O   . HOH K 3 .   ? 83.655  67.679  15.368 1.00 50.67 ? 2115 HOH C O   1 
HETATM 7443 O O   . HOH K 3 .   ? 100.480 90.635  32.134 1.00 43.93 ? 2118 HOH C O   1 
HETATM 7444 O O   . HOH K 3 .   ? 101.986 82.622  15.351 1.00 34.66 ? 2122 HOH C O   1 
HETATM 7445 O O   . HOH K 3 .   ? 90.711  83.663  12.574 1.00 43.98 ? 2123 HOH C O   1 
HETATM 7446 O O   . HOH K 3 .   ? 110.249 50.198  43.310 1.00 39.54 ? 2125 HOH C O   1 
HETATM 7447 O O   . HOH K 3 .   ? 103.271 89.241  37.722 1.00 27.73 ? 2128 HOH C O   1 
HETATM 7448 O O   . HOH K 3 .   ? 100.480 94.818  27.942 1.00 38.93 ? 2129 HOH C O   1 
HETATM 7449 O O   . HOH K 3 .   ? 89.320  70.017  6.971  1.00 38.21 ? 2132 HOH C O   1 
HETATM 7450 O O   . HOH K 3 .   ? 96.299  84.947  11.250 1.00 45.01 ? 2134 HOH C O   1 
HETATM 7451 O O   . HOH K 3 .   ? 90.488  65.396  4.975  1.00 48.94 ? 2147 HOH C O   1 
HETATM 7452 O O   . HOH K 3 .   ? 86.524  83.663  11.645 1.00 45.18 ? 2154 HOH C O   1 
HETATM 7453 O O   . HOH K 3 .   ? 87.883  82.220  30.572 1.00 46.23 ? 2157 HOH C O   1 
HETATM 7454 O O   . HOH K 3 .   ? 89.383  80.880  33.652 1.00 36.97 ? 2158 HOH C O   1 
HETATM 7455 O O   . HOH L 3 .   ? 70.852  46.711  42.097 1.00 26.44 ? 2005 HOH D O   1 
HETATM 7456 O O   . HOH L 3 .   ? 76.604  51.792  55.843 1.00 36.22 ? 2006 HOH D O   1 
HETATM 7457 O O   . HOH L 3 .   ? 87.863  69.751  28.145 1.00 36.30 ? 2011 HOH D O   1 
HETATM 7458 O O   . HOH L 3 .   ? 71.096  57.114  31.876 1.00 19.39 ? 2019 HOH D O   1 
HETATM 7459 O O   . HOH L 3 .   ? 89.404  46.081  12.916 1.00 42.83 ? 2020 HOH D O   1 
HETATM 7460 O O   . HOH L 3 .   ? 80.986  58.533  11.188 1.00 34.26 ? 2021 HOH D O   1 
HETATM 7461 O O   . HOH L 3 .   ? 65.568  55.254  43.429 1.00 43.36 ? 2024 HOH D O   1 
HETATM 7462 O O   . HOH L 3 .   ? 65.659  42.932  39.154 1.00 31.87 ? 2027 HOH D O   1 
HETATM 7463 O O   . HOH L 3 .   ? 82.338  78.086  36.325 1.00 40.15 ? 2045 HOH D O   1 
HETATM 7464 O O   . HOH L 3 .   ? 62.628  65.843  33.609 1.00 33.06 ? 2047 HOH D O   1 
HETATM 7465 O O   . HOH L 3 .   ? 87.034  68.291  46.569 1.00 41.44 ? 2048 HOH D O   1 
HETATM 7466 O O   . HOH L 3 .   ? 75.360  65.536  15.368 1.00 30.78 ? 2053 HOH D O   1 
HETATM 7467 O O   . HOH L 3 .   ? 65.606  75.175  33.428 1.00 49.16 ? 2059 HOH D O   1 
HETATM 7468 O O   . HOH L 3 .   ? 80.942  87.846  43.310 1.00 30.97 ? 2062 HOH D O   1 
HETATM 7469 O O   . HOH L 3 .   ? 83.733  52.987  64.267 1.00 41.75 ? 2068 HOH D O   1 
HETATM 7470 O O   . HOH L 3 .   ? 88.953  64.828  53.173 1.00 36.39 ? 2069 HOH D O   1 
HETATM 7471 O O   . HOH L 3 .   ? 83.733  85.058  40.516 1.00 43.03 ? 2076 HOH D O   1 
HETATM 7472 O O   . HOH L 3 .   ? 89.316  44.620  19.560 1.00 42.42 ? 2079 HOH D O   1 
HETATM 7473 O O   . HOH L 3 .   ? 99.084  57.170  61.473 1.00 36.88 ? 2081 HOH D O   1 
HETATM 7474 O O   . HOH L 3 .   ? 87.920  47.409  67.061 1.00 46.44 ? 2085 HOH D O   1 
HETATM 7475 O O   . HOH L 3 .   ? 86.056  71.114  32.134 1.00 38.26 ? 2086 HOH D O   1 
HETATM 7476 O O   . HOH L 3 .   ? 62.800  50.198  22.354 1.00 38.81 ? 2087 HOH D O   1 
HETATM 7477 O O   . HOH L 3 .   ? 79.547  32.071  33.531 1.00 48.10 ? 2089 HOH D O   1 
HETATM 7478 O O   . HOH L 3 .   ? 80.942  41.832  44.708 1.00 38.52 ? 2091 HOH D O   1 
HETATM 7479 O O   . HOH L 3 .   ? 79.547  66.931  8.383  1.00 41.41 ? 2097 HOH D O   1 
HETATM 7480 O O   . HOH L 3 .   ? 61.404  61.353  20.957 1.00 37.22 ? 2106 HOH D O   1 
HETATM 7481 O O   . HOH L 3 .   ? 91.891  62.861  55.870 1.00 34.92 ? 2110 HOH D O   1 
HETATM 7482 O O   . HOH L 3 .   ? 97.689  48.804  12.574 1.00 36.04 ? 2131 HOH D O   1 
HETATM 7483 O O   . HOH L 3 .   ? 69.157  66.990  54.479 1.00 44.85 ? 2133 HOH D O   1 
HETATM 7484 O O   . HOH L 3 .   ? 75.360  64.142  50.296 1.00 43.82 ? 2135 HOH D O   1 
HETATM 7485 O O   . HOH L 3 .   ? 76.913  67.316  3.780  1.00 45.99 ? 2136 HOH D O   1 
HETATM 7486 O O   . HOH L 3 .   ? 64.700  70.388  37.959 1.00 46.27 ? 2139 HOH D O   1 
HETATM 7487 O O   . HOH L 3 .   ? 82.338  73.903  37.722 1.00 41.70 ? 2145 HOH D O   1 
HETATM 7488 O O   . HOH L 3 .   ? 85.129  72.508  45.636 1.00 40.68 ? 2146 HOH D O   1 
HETATM 7489 O O   . HOH L 3 .   ? 67.089  57.345  33.123 1.00 41.08 ? 2153 HOH D O   1 
HETATM 7490 O O   . HOH L 3 .   ? 76.721  54.373  50.661 1.00 47.70 ? 2156 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   1   VAL VAL A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   TYR 6   6   6   TYR TYR A . n 
A 1 7   TRP 7   7   7   TRP TRP A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  HIS 14  14  14  HIS HIS A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  TYR 22  22  22  TYR TYR A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  PRO 26  26  26  PRO PRO A . n 
A 1 27  TYR 27  27  27  TYR TYR A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  TYR 32  32  32  TYR TYR A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  PHE 40  40  40  PHE PHE A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  TRP 45  45  45  TRP TRP A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  PHE 56  56  56  PHE PHE A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  TYR 78  78  78  TYR TYR A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  HIS 83  83  83  HIS HIS A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  CYS 86  86  86  CYS CYS A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  THR 89  89  89  THR THR A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  GLN 94  94  94  GLN GLN A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 HIS 102 102 102 HIS HIS A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 MET 104 104 104 MET MET A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 MET 108 108 108 MET MET A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 CYS 114 114 114 CYS CYS A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 PRO 117 117 117 PRO PRO A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 TYR 126 126 126 TYR TYR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 ARG 135 135 135 ARG ARG A . n 
A 1 136 GLN 136 136 136 GLN GLN A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 TRP 146 146 146 TRP TRP A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 PHE 154 154 154 PHE PHE A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ASP 164 164 164 ASP ASP A . n 
A 1 165 GLN 165 165 165 GLN GLN A . n 
A 1 166 GLN 166 166 166 GLN GLN A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 MET 168 168 168 MET MET A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 PRO 171 171 171 PRO PRO A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 CYS 173 173 173 CYS CYS A . n 
A 1 174 PRO 174 174 174 PRO PRO A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 GLN 177 177 177 GLN GLN A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 PHE 183 183 183 PHE PHE A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 ARG 186 186 186 ARG ARG A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 SER 194 194 194 SER SER A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 TYR 196 196 196 TYR TYR A . n 
A 1 197 MET 197 197 197 MET MET A . n 
A 1 198 ARG 198 198 198 ARG ARG A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 ARG 201 201 201 ARG ARG A . n 
A 1 202 PHE 202 202 202 PHE PHE A . n 
A 1 203 MET 203 203 203 MET MET A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 TRP 209 209 209 TRP TRP A . n 
A 1 210 TYR 210 210 210 TYR TYR A . n 
A 1 211 THR 211 211 211 THR THR A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 TRP 214 214 214 TRP TRP A . n 
A 1 215 ASN 215 215 215 ASN ASN A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 LYS 217 217 217 LYS LYS A . n 
A 1 218 LYS 218 218 ?   ?   ?   A . n 
A 1 219 GLU 219 219 ?   ?   ?   A . n 
B 1 1   VAL 1   1   1   VAL VAL B . n 
B 1 2   VAL 2   2   2   VAL VAL B . n 
B 1 3   THR 3   3   3   THR THR B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   GLY 5   5   5   GLY GLY B . n 
B 1 6   TYR 6   6   6   TYR TYR B . n 
B 1 7   TRP 7   7   7   TRP TRP B . n 
B 1 8   ASP 8   8   8   ASP ASP B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  ARG 10  10  10  ARG ARG B . n 
B 1 11  GLY 11  11  11  GLY GLY B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  HIS 14  14  14  HIS HIS B . n 
B 1 15  ALA 15  15  15  ALA ALA B . n 
B 1 16  ILE 16  16  16  ILE ILE B . n 
B 1 17  ARG 17  17  17  ARG ARG B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  LEU 19  19  19  LEU LEU B . n 
B 1 20  LEU 20  20  20  LEU LEU B . n 
B 1 21  GLU 21  21  21  GLU GLU B . n 
B 1 22  TYR 22  22  22  TYR TYR B . n 
B 1 23  THR 23  23  23  THR THR B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  THR 25  25  25  THR THR B . n 
B 1 26  PRO 26  26  26  PRO PRO B . n 
B 1 27  TYR 27  27  27  TYR TYR B . n 
B 1 28  GLN 28  28  28  GLN GLN B . n 
B 1 29  GLU 29  29  29  GLU GLU B . n 
B 1 30  ARG 30  30  30  ARG ARG B . n 
B 1 31  ARG 31  31  31  ARG ARG B . n 
B 1 32  TYR 32  32  32  TYR TYR B . n 
B 1 33  LYS 33  33  33  LYS LYS B . n 
B 1 34  ALA 34  34  34  ALA ALA B . n 
B 1 35  GLY 35  35  35  GLY GLY B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  ALA 37  37  37  ALA ALA B . n 
B 1 38  PRO 38  38  38  PRO PRO B . n 
B 1 39  ASP 39  39  39  ASP ASP B . n 
B 1 40  PHE 40  40  40  PHE PHE B . n 
B 1 41  ASP 41  41  41  ASP ASP B . n 
B 1 42  PRO 42  42  42  PRO PRO B . n 
B 1 43  SER 43  43  43  SER SER B . n 
B 1 44  ASP 44  44  44  ASP ASP B . n 
B 1 45  TRP 45  45  45  TRP TRP B . n 
B 1 46  THR 46  46  46  THR THR B . n 
B 1 47  ASN 47  47  47  ASN ASN B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  GLU 50  50  50  GLU GLU B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  GLY 53  53  53  GLY GLY B . n 
B 1 54  LEU 54  54  54  LEU LEU B . n 
B 1 55  ASP 55  55  55  ASP ASP B . n 
B 1 56  PHE 56  56  56  PHE PHE B . n 
B 1 57  PRO 57  57  57  PRO PRO B . n 
B 1 58  ASN 58  58  58  ASN ASN B . n 
B 1 59  LEU 59  59  59  LEU LEU B . n 
B 1 60  PRO 60  60  60  PRO PRO B . n 
B 1 61  TYR 61  61  61  TYR TYR B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  ILE 63  63  63  ILE ILE B . n 
B 1 64  ASP 64  64  64  ASP ASP B . n 
B 1 65  GLY 65  65  65  GLY GLY B . n 
B 1 66  ASP 66  66  66  ASP ASP B . n 
B 1 67  VAL 67  67  67  VAL VAL B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  THR 70  70  70  THR THR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  ALA 74  74  74  ALA ALA B . n 
B 1 75  ILE 75  75  75  ILE ILE B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  ARG 77  77  77  ARG ARG B . n 
B 1 78  TYR 78  78  78  TYR TYR B . n 
B 1 79  ILE 79  79  79  ILE ILE B . n 
B 1 80  ALA 80  80  80  ALA ALA B . n 
B 1 81  ARG 81  81  81  ARG ARG B . n 
B 1 82  LYS 82  82  82  LYS LYS B . n 
B 1 83  HIS 83  83  83  HIS HIS B . n 
B 1 84  ASN 84  84  84  ASN ASN B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  CYS 86  86  86  CYS CYS B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  GLU 88  88  88  GLU GLU B . n 
B 1 89  THR 89  89  89  THR THR B . n 
B 1 90  GLU 90  90  90  GLU GLU B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  LYS 93  93  93  LYS LYS B . n 
B 1 94  GLN 94  94  94  GLN GLN B . n 
B 1 95  ARG 95  95  95  ARG ARG B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  VAL 98  98  98  VAL VAL B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 ASN 101 101 101 ASN ASN B . n 
B 1 102 HIS 102 102 102 HIS HIS B . n 
B 1 103 LEU 103 103 103 LEU LEU B . n 
B 1 104 MET 104 104 104 MET MET B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 LEU 106 106 106 LEU LEU B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 MET 108 108 108 MET MET B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 PHE 110 110 110 PHE PHE B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 ARG 112 112 112 ARG ARG B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 CYS 114 114 114 CYS CYS B . n 
B 1 115 TYR 115 115 115 TYR TYR B . n 
B 1 116 SER 116 116 116 SER SER B . n 
B 1 117 PRO 117 117 117 PRO PRO B . n 
B 1 118 ASP 118 118 118 ASP ASP B . n 
B 1 119 PHE 119 119 119 PHE PHE B . n 
B 1 120 GLU 120 120 120 GLU GLU B . n 
B 1 121 LYS 121 121 121 LYS LYS B . n 
B 1 122 LEU 122 122 122 LEU LEU B . n 
B 1 123 LYS 123 123 123 LYS LYS B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 TYR 126 126 126 TYR TYR B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 GLU 128 128 128 GLU GLU B . n 
B 1 129 LEU 129 129 129 LEU LEU B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 PRO 131 131 131 PRO PRO B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 LYS 133 133 133 LYS LYS B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 ARG 135 135 135 ARG ARG B . n 
B 1 136 GLN 136 136 136 GLN GLN B . n 
B 1 137 LEU 137 137 137 LEU LEU B . n 
B 1 138 SER 138 138 138 SER SER B . n 
B 1 139 ARG 139 139 139 ARG ARG B . n 
B 1 140 PHE 140 140 140 PHE PHE B . n 
B 1 141 LEU 141 141 141 LEU LEU B . n 
B 1 142 GLY 142 142 142 GLY GLY B . n 
B 1 143 SER 143 143 143 SER SER B . n 
B 1 144 ARG 144 144 144 ARG ARG B . n 
B 1 145 SER 145 145 145 SER SER B . n 
B 1 146 TRP 146 146 146 TRP TRP B . n 
B 1 147 PHE 147 147 147 PHE PHE B . n 
B 1 148 VAL 148 148 148 VAL VAL B . n 
B 1 149 GLY 149 149 149 GLY GLY B . n 
B 1 150 ASP 150 150 150 ASP ASP B . n 
B 1 151 LYS 151 151 151 LYS LYS B . n 
B 1 152 LEU 152 152 152 LEU LEU B . n 
B 1 153 THR 153 153 153 THR THR B . n 
B 1 154 PHE 154 154 154 PHE PHE B . n 
B 1 155 VAL 155 155 155 VAL VAL B . n 
B 1 156 ASP 156 156 156 ASP ASP B . n 
B 1 157 PHE 157 157 157 PHE PHE B . n 
B 1 158 LEU 158 158 158 LEU LEU B . n 
B 1 159 ALA 159 159 159 ALA ALA B . n 
B 1 160 TYR 160 160 160 TYR TYR B . n 
B 1 161 ASP 161 161 161 ASP ASP B . n 
B 1 162 VAL 162 162 162 VAL VAL B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 ASP 164 164 164 ASP ASP B . n 
B 1 165 GLN 165 165 165 GLN GLN B . n 
B 1 166 GLN 166 166 166 GLN GLN B . n 
B 1 167 ARG 167 167 167 ARG ARG B . n 
B 1 168 MET 168 168 168 MET MET B . n 
B 1 169 PHE 169 169 169 PHE PHE B . n 
B 1 170 VAL 170 170 170 VAL VAL B . n 
B 1 171 PRO 171 171 171 PRO PRO B . n 
B 1 172 ASP 172 172 172 ASP ASP B . n 
B 1 173 CYS 173 173 173 CYS CYS B . n 
B 1 174 PRO 174 174 174 PRO PRO B . n 
B 1 175 GLU 175 175 175 GLU GLU B . n 
B 1 176 LEU 176 176 176 LEU LEU B . n 
B 1 177 GLN 177 177 177 GLN GLN B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 ASN 179 179 179 ASN ASN B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 SER 181 181 181 SER SER B . n 
B 1 182 GLN 182 182 182 GLN GLN B . n 
B 1 183 PHE 183 183 183 PHE PHE B . n 
B 1 184 LEU 184 184 184 LEU LEU B . n 
B 1 185 GLN 185 185 185 GLN GLN B . n 
B 1 186 ARG 186 186 186 ARG ARG B . n 
B 1 187 PHE 187 187 187 PHE PHE B . n 
B 1 188 GLU 188 188 188 GLU GLU B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 GLU 191 191 191 GLU GLU B . n 
B 1 192 LYS 192 192 192 LYS LYS B . n 
B 1 193 ILE 193 193 193 ILE ILE B . n 
B 1 194 SER 194 194 194 SER SER B . n 
B 1 195 ALA 195 195 195 ALA ALA B . n 
B 1 196 TYR 196 196 196 TYR TYR B . n 
B 1 197 MET 197 197 197 MET MET B . n 
B 1 198 ARG 198 198 198 ARG ARG B . n 
B 1 199 SER 199 199 199 SER SER B . n 
B 1 200 GLY 200 200 200 GLY GLY B . n 
B 1 201 ARG 201 201 201 ARG ARG B . n 
B 1 202 PHE 202 202 202 PHE PHE B . n 
B 1 203 MET 203 203 203 MET MET B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 ALA 205 205 205 ALA ALA B . n 
B 1 206 PRO 206 206 206 PRO PRO B . n 
B 1 207 ILE 207 207 207 ILE ILE B . n 
B 1 208 PHE 208 208 208 PHE PHE B . n 
B 1 209 TRP 209 209 209 TRP TRP B . n 
B 1 210 TYR 210 210 210 TYR TYR B . n 
B 1 211 THR 211 211 211 THR THR B . n 
B 1 212 ALA 212 212 212 ALA ALA B . n 
B 1 213 LEU 213 213 213 LEU LEU B . n 
B 1 214 TRP 214 214 214 TRP TRP B . n 
B 1 215 ASN 215 215 215 ASN ASN B . n 
B 1 216 ASN 216 216 216 ASN ASN B . n 
B 1 217 LYS 217 217 217 LYS LYS B . n 
B 1 218 LYS 218 218 ?   ?   ?   B . n 
B 1 219 GLU 219 219 ?   ?   ?   B . n 
C 1 1   VAL 1   1   1   VAL VAL C . n 
C 1 2   VAL 2   2   2   VAL VAL C . n 
C 1 3   THR 3   3   3   THR THR C . n 
C 1 4   LEU 4   4   4   LEU LEU C . n 
C 1 5   GLY 5   5   5   GLY GLY C . n 
C 1 6   TYR 6   6   6   TYR TYR C . n 
C 1 7   TRP 7   7   7   TRP TRP C . n 
C 1 8   ASP 8   8   8   ASP ASP C . n 
C 1 9   ILE 9   9   9   ILE ILE C . n 
C 1 10  ARG 10  10  10  ARG ARG C . n 
C 1 11  GLY 11  11  11  GLY GLY C . n 
C 1 12  LEU 12  12  12  LEU LEU C . n 
C 1 13  ALA 13  13  13  ALA ALA C . n 
C 1 14  HIS 14  14  14  HIS HIS C . n 
C 1 15  ALA 15  15  15  ALA ALA C . n 
C 1 16  ILE 16  16  16  ILE ILE C . n 
C 1 17  ARG 17  17  17  ARG ARG C . n 
C 1 18  LEU 18  18  18  LEU LEU C . n 
C 1 19  LEU 19  19  19  LEU LEU C . n 
C 1 20  LEU 20  20  20  LEU LEU C . n 
C 1 21  GLU 21  21  21  GLU GLU C . n 
C 1 22  TYR 22  22  22  TYR TYR C . n 
C 1 23  THR 23  23  23  THR THR C . n 
C 1 24  GLU 24  24  24  GLU GLU C . n 
C 1 25  THR 25  25  25  THR THR C . n 
C 1 26  PRO 26  26  26  PRO PRO C . n 
C 1 27  TYR 27  27  27  TYR TYR C . n 
C 1 28  GLN 28  28  28  GLN GLN C . n 
C 1 29  GLU 29  29  29  GLU GLU C . n 
C 1 30  ARG 30  30  30  ARG ARG C . n 
C 1 31  ARG 31  31  31  ARG ARG C . n 
C 1 32  TYR 32  32  32  TYR TYR C . n 
C 1 33  LYS 33  33  33  LYS LYS C . n 
C 1 34  ALA 34  34  34  ALA ALA C . n 
C 1 35  GLY 35  35  35  GLY GLY C . n 
C 1 36  PRO 36  36  36  PRO PRO C . n 
C 1 37  ALA 37  37  37  ALA ALA C . n 
C 1 38  PRO 38  38  38  PRO PRO C . n 
C 1 39  ASP 39  39  39  ASP ASP C . n 
C 1 40  PHE 40  40  40  PHE PHE C . n 
C 1 41  ASP 41  41  41  ASP ASP C . n 
C 1 42  PRO 42  42  42  PRO PRO C . n 
C 1 43  SER 43  43  43  SER SER C . n 
C 1 44  ASP 44  44  44  ASP ASP C . n 
C 1 45  TRP 45  45  45  TRP TRP C . n 
C 1 46  THR 46  46  46  THR THR C . n 
C 1 47  ASN 47  47  47  ASN ASN C . n 
C 1 48  GLU 48  48  48  GLU GLU C . n 
C 1 49  LYS 49  49  49  LYS LYS C . n 
C 1 50  GLU 50  50  50  GLU GLU C . n 
C 1 51  LYS 51  51  51  LYS LYS C . n 
C 1 52  LEU 52  52  52  LEU LEU C . n 
C 1 53  GLY 53  53  53  GLY GLY C . n 
C 1 54  LEU 54  54  54  LEU LEU C . n 
C 1 55  ASP 55  55  55  ASP ASP C . n 
C 1 56  PHE 56  56  56  PHE PHE C . n 
C 1 57  PRO 57  57  57  PRO PRO C . n 
C 1 58  ASN 58  58  58  ASN ASN C . n 
C 1 59  LEU 59  59  59  LEU LEU C . n 
C 1 60  PRO 60  60  60  PRO PRO C . n 
C 1 61  TYR 61  61  61  TYR TYR C . n 
C 1 62  LEU 62  62  62  LEU LEU C . n 
C 1 63  ILE 63  63  63  ILE ILE C . n 
C 1 64  ASP 64  64  64  ASP ASP C . n 
C 1 65  GLY 65  65  65  GLY GLY C . n 
C 1 66  ASP 66  66  66  ASP ASP C . n 
C 1 67  VAL 67  67  67  VAL VAL C . n 
C 1 68  LYS 68  68  68  LYS LYS C . n 
C 1 69  LEU 69  69  69  LEU LEU C . n 
C 1 70  THR 70  70  70  THR THR C . n 
C 1 71  GLN 71  71  71  GLN GLN C . n 
C 1 72  SER 72  72  72  SER SER C . n 
C 1 73  ASN 73  73  73  ASN ASN C . n 
C 1 74  ALA 74  74  74  ALA ALA C . n 
C 1 75  ILE 75  75  75  ILE ILE C . n 
C 1 76  LEU 76  76  76  LEU LEU C . n 
C 1 77  ARG 77  77  77  ARG ARG C . n 
C 1 78  TYR 78  78  78  TYR TYR C . n 
C 1 79  ILE 79  79  79  ILE ILE C . n 
C 1 80  ALA 80  80  80  ALA ALA C . n 
C 1 81  ARG 81  81  81  ARG ARG C . n 
C 1 82  LYS 82  82  82  LYS LYS C . n 
C 1 83  HIS 83  83  83  HIS HIS C . n 
C 1 84  ASN 84  84  84  ASN ASN C . n 
C 1 85  MET 85  85  85  MET MET C . n 
C 1 86  CYS 86  86  86  CYS CYS C . n 
C 1 87  GLY 87  87  87  GLY GLY C . n 
C 1 88  GLU 88  88  88  GLU GLU C . n 
C 1 89  THR 89  89  89  THR THR C . n 
C 1 90  GLU 90  90  90  GLU GLU C . n 
C 1 91  VAL 91  91  91  VAL VAL C . n 
C 1 92  GLU 92  92  92  GLU GLU C . n 
C 1 93  LYS 93  93  93  LYS LYS C . n 
C 1 94  GLN 94  94  94  GLN GLN C . n 
C 1 95  ARG 95  95  95  ARG ARG C . n 
C 1 96  VAL 96  96  96  VAL VAL C . n 
C 1 97  ASP 97  97  97  ASP ASP C . n 
C 1 98  VAL 98  98  98  VAL VAL C . n 
C 1 99  LEU 99  99  99  LEU LEU C . n 
C 1 100 GLU 100 100 100 GLU GLU C . n 
C 1 101 ASN 101 101 101 ASN ASN C . n 
C 1 102 HIS 102 102 102 HIS HIS C . n 
C 1 103 LEU 103 103 103 LEU LEU C . n 
C 1 104 MET 104 104 104 MET MET C . n 
C 1 105 ASP 105 105 105 ASP ASP C . n 
C 1 106 LEU 106 106 106 LEU LEU C . n 
C 1 107 ARG 107 107 107 ARG ARG C . n 
C 1 108 MET 108 108 108 MET MET C . n 
C 1 109 ALA 109 109 109 ALA ALA C . n 
C 1 110 PHE 110 110 110 PHE PHE C . n 
C 1 111 ALA 111 111 111 ALA ALA C . n 
C 1 112 ARG 112 112 112 ARG ARG C . n 
C 1 113 LEU 113 113 113 LEU LEU C . n 
C 1 114 CYS 114 114 114 CYS CYS C . n 
C 1 115 TYR 115 115 115 TYR TYR C . n 
C 1 116 SER 116 116 116 SER SER C . n 
C 1 117 PRO 117 117 117 PRO PRO C . n 
C 1 118 ASP 118 118 118 ASP ASP C . n 
C 1 119 PHE 119 119 119 PHE PHE C . n 
C 1 120 GLU 120 120 120 GLU GLU C . n 
C 1 121 LYS 121 121 121 LYS LYS C . n 
C 1 122 LEU 122 122 122 LEU LEU C . n 
C 1 123 LYS 123 123 123 LYS LYS C . n 
C 1 124 PRO 124 124 124 PRO PRO C . n 
C 1 125 ALA 125 125 125 ALA ALA C . n 
C 1 126 TYR 126 126 126 TYR TYR C . n 
C 1 127 LEU 127 127 127 LEU LEU C . n 
C 1 128 GLU 128 128 128 GLU GLU C . n 
C 1 129 LEU 129 129 129 LEU LEU C . n 
C 1 130 LEU 130 130 130 LEU LEU C . n 
C 1 131 PRO 131 131 131 PRO PRO C . n 
C 1 132 GLY 132 132 132 GLY GLY C . n 
C 1 133 LYS 133 133 133 LYS LYS C . n 
C 1 134 LEU 134 134 134 LEU LEU C . n 
C 1 135 ARG 135 135 135 ARG ARG C . n 
C 1 136 GLN 136 136 136 GLN GLN C . n 
C 1 137 LEU 137 137 137 LEU LEU C . n 
C 1 138 SER 138 138 138 SER SER C . n 
C 1 139 ARG 139 139 139 ARG ARG C . n 
C 1 140 PHE 140 140 140 PHE PHE C . n 
C 1 141 LEU 141 141 141 LEU LEU C . n 
C 1 142 GLY 142 142 142 GLY GLY C . n 
C 1 143 SER 143 143 143 SER SER C . n 
C 1 144 ARG 144 144 144 ARG ARG C . n 
C 1 145 SER 145 145 145 SER SER C . n 
C 1 146 TRP 146 146 146 TRP TRP C . n 
C 1 147 PHE 147 147 147 PHE PHE C . n 
C 1 148 VAL 148 148 148 VAL VAL C . n 
C 1 149 GLY 149 149 149 GLY GLY C . n 
C 1 150 ASP 150 150 150 ASP ASP C . n 
C 1 151 LYS 151 151 151 LYS LYS C . n 
C 1 152 LEU 152 152 152 LEU LEU C . n 
C 1 153 THR 153 153 153 THR THR C . n 
C 1 154 PHE 154 154 154 PHE PHE C . n 
C 1 155 VAL 155 155 155 VAL VAL C . n 
C 1 156 ASP 156 156 156 ASP ASP C . n 
C 1 157 PHE 157 157 157 PHE PHE C . n 
C 1 158 LEU 158 158 158 LEU LEU C . n 
C 1 159 ALA 159 159 159 ALA ALA C . n 
C 1 160 TYR 160 160 160 TYR TYR C . n 
C 1 161 ASP 161 161 161 ASP ASP C . n 
C 1 162 VAL 162 162 162 VAL VAL C . n 
C 1 163 LEU 163 163 163 LEU LEU C . n 
C 1 164 ASP 164 164 164 ASP ASP C . n 
C 1 165 GLN 165 165 165 GLN GLN C . n 
C 1 166 GLN 166 166 166 GLN GLN C . n 
C 1 167 ARG 167 167 167 ARG ARG C . n 
C 1 168 MET 168 168 168 MET MET C . n 
C 1 169 PHE 169 169 169 PHE PHE C . n 
C 1 170 VAL 170 170 170 VAL VAL C . n 
C 1 171 PRO 171 171 171 PRO PRO C . n 
C 1 172 ASP 172 172 172 ASP ASP C . n 
C 1 173 CYS 173 173 173 CYS CYS C . n 
C 1 174 PRO 174 174 174 PRO PRO C . n 
C 1 175 GLU 175 175 175 GLU GLU C . n 
C 1 176 LEU 176 176 176 LEU LEU C . n 
C 1 177 GLN 177 177 177 GLN GLN C . n 
C 1 178 GLY 178 178 178 GLY GLY C . n 
C 1 179 ASN 179 179 179 ASN ASN C . n 
C 1 180 LEU 180 180 180 LEU LEU C . n 
C 1 181 SER 181 181 181 SER SER C . n 
C 1 182 GLN 182 182 182 GLN GLN C . n 
C 1 183 PHE 183 183 183 PHE PHE C . n 
C 1 184 LEU 184 184 184 LEU LEU C . n 
C 1 185 GLN 185 185 185 GLN GLN C . n 
C 1 186 ARG 186 186 186 ARG ARG C . n 
C 1 187 PHE 187 187 187 PHE PHE C . n 
C 1 188 GLU 188 188 188 GLU GLU C . n 
C 1 189 ALA 189 189 189 ALA ALA C . n 
C 1 190 LEU 190 190 190 LEU LEU C . n 
C 1 191 GLU 191 191 191 GLU GLU C . n 
C 1 192 LYS 192 192 192 LYS LYS C . n 
C 1 193 ILE 193 193 193 ILE ILE C . n 
C 1 194 SER 194 194 194 SER SER C . n 
C 1 195 ALA 195 195 195 ALA ALA C . n 
C 1 196 TYR 196 196 196 TYR TYR C . n 
C 1 197 MET 197 197 197 MET MET C . n 
C 1 198 ARG 198 198 198 ARG ARG C . n 
C 1 199 SER 199 199 199 SER SER C . n 
C 1 200 GLY 200 200 200 GLY GLY C . n 
C 1 201 ARG 201 201 201 ARG ARG C . n 
C 1 202 PHE 202 202 202 PHE PHE C . n 
C 1 203 MET 203 203 203 MET MET C . n 
C 1 204 LYS 204 204 204 LYS LYS C . n 
C 1 205 ALA 205 205 205 ALA ALA C . n 
C 1 206 PRO 206 206 206 PRO PRO C . n 
C 1 207 ILE 207 207 207 ILE ILE C . n 
C 1 208 PHE 208 208 208 PHE PHE C . n 
C 1 209 TRP 209 209 209 TRP TRP C . n 
C 1 210 TYR 210 210 210 TYR TYR C . n 
C 1 211 THR 211 211 211 THR THR C . n 
C 1 212 ALA 212 212 212 ALA ALA C . n 
C 1 213 LEU 213 213 213 LEU LEU C . n 
C 1 214 TRP 214 214 214 TRP TRP C . n 
C 1 215 ASN 215 215 215 ASN ASN C . n 
C 1 216 ASN 216 216 216 ASN ASN C . n 
C 1 217 LYS 217 217 217 LYS LYS C . n 
C 1 218 LYS 218 218 ?   ?   ?   C . n 
C 1 219 GLU 219 219 ?   ?   ?   C . n 
D 1 1   VAL 1   1   1   VAL VAL D . n 
D 1 2   VAL 2   2   2   VAL VAL D . n 
D 1 3   THR 3   3   3   THR THR D . n 
D 1 4   LEU 4   4   4   LEU LEU D . n 
D 1 5   GLY 5   5   5   GLY GLY D . n 
D 1 6   TYR 6   6   6   TYR TYR D . n 
D 1 7   TRP 7   7   7   TRP TRP D . n 
D 1 8   ASP 8   8   8   ASP ASP D . n 
D 1 9   ILE 9   9   9   ILE ILE D . n 
D 1 10  ARG 10  10  10  ARG ARG D . n 
D 1 11  GLY 11  11  11  GLY GLY D . n 
D 1 12  LEU 12  12  12  LEU LEU D . n 
D 1 13  ALA 13  13  13  ALA ALA D . n 
D 1 14  HIS 14  14  14  HIS HIS D . n 
D 1 15  ALA 15  15  15  ALA ALA D . n 
D 1 16  ILE 16  16  16  ILE ILE D . n 
D 1 17  ARG 17  17  17  ARG ARG D . n 
D 1 18  LEU 18  18  18  LEU LEU D . n 
D 1 19  LEU 19  19  19  LEU LEU D . n 
D 1 20  LEU 20  20  20  LEU LEU D . n 
D 1 21  GLU 21  21  21  GLU GLU D . n 
D 1 22  TYR 22  22  22  TYR TYR D . n 
D 1 23  THR 23  23  23  THR THR D . n 
D 1 24  GLU 24  24  24  GLU GLU D . n 
D 1 25  THR 25  25  25  THR THR D . n 
D 1 26  PRO 26  26  26  PRO PRO D . n 
D 1 27  TYR 27  27  27  TYR TYR D . n 
D 1 28  GLN 28  28  28  GLN GLN D . n 
D 1 29  GLU 29  29  29  GLU GLU D . n 
D 1 30  ARG 30  30  30  ARG ARG D . n 
D 1 31  ARG 31  31  31  ARG ARG D . n 
D 1 32  TYR 32  32  32  TYR TYR D . n 
D 1 33  LYS 33  33  33  LYS LYS D . n 
D 1 34  ALA 34  34  34  ALA ALA D . n 
D 1 35  GLY 35  35  35  GLY GLY D . n 
D 1 36  PRO 36  36  36  PRO PRO D . n 
D 1 37  ALA 37  37  37  ALA ALA D . n 
D 1 38  PRO 38  38  38  PRO PRO D . n 
D 1 39  ASP 39  39  39  ASP ASP D . n 
D 1 40  PHE 40  40  40  PHE PHE D . n 
D 1 41  ASP 41  41  41  ASP ASP D . n 
D 1 42  PRO 42  42  42  PRO PRO D . n 
D 1 43  SER 43  43  43  SER SER D . n 
D 1 44  ASP 44  44  44  ASP ASP D . n 
D 1 45  TRP 45  45  45  TRP TRP D . n 
D 1 46  THR 46  46  46  THR THR D . n 
D 1 47  ASN 47  47  47  ASN ASN D . n 
D 1 48  GLU 48  48  48  GLU GLU D . n 
D 1 49  LYS 49  49  49  LYS LYS D . n 
D 1 50  GLU 50  50  50  GLU GLU D . n 
D 1 51  LYS 51  51  51  LYS LYS D . n 
D 1 52  LEU 52  52  52  LEU LEU D . n 
D 1 53  GLY 53  53  53  GLY GLY D . n 
D 1 54  LEU 54  54  54  LEU LEU D . n 
D 1 55  ASP 55  55  55  ASP ASP D . n 
D 1 56  PHE 56  56  56  PHE PHE D . n 
D 1 57  PRO 57  57  57  PRO PRO D . n 
D 1 58  ASN 58  58  58  ASN ASN D . n 
D 1 59  LEU 59  59  59  LEU LEU D . n 
D 1 60  PRO 60  60  60  PRO PRO D . n 
D 1 61  TYR 61  61  61  TYR TYR D . n 
D 1 62  LEU 62  62  62  LEU LEU D . n 
D 1 63  ILE 63  63  63  ILE ILE D . n 
D 1 64  ASP 64  64  64  ASP ASP D . n 
D 1 65  GLY 65  65  65  GLY GLY D . n 
D 1 66  ASP 66  66  66  ASP ASP D . n 
D 1 67  VAL 67  67  67  VAL VAL D . n 
D 1 68  LYS 68  68  68  LYS LYS D . n 
D 1 69  LEU 69  69  69  LEU LEU D . n 
D 1 70  THR 70  70  70  THR THR D . n 
D 1 71  GLN 71  71  71  GLN GLN D . n 
D 1 72  SER 72  72  72  SER SER D . n 
D 1 73  ASN 73  73  73  ASN ASN D . n 
D 1 74  ALA 74  74  74  ALA ALA D . n 
D 1 75  ILE 75  75  75  ILE ILE D . n 
D 1 76  LEU 76  76  76  LEU LEU D . n 
D 1 77  ARG 77  77  77  ARG ARG D . n 
D 1 78  TYR 78  78  78  TYR TYR D . n 
D 1 79  ILE 79  79  79  ILE ILE D . n 
D 1 80  ALA 80  80  80  ALA ALA D . n 
D 1 81  ARG 81  81  81  ARG ARG D . n 
D 1 82  LYS 82  82  82  LYS LYS D . n 
D 1 83  HIS 83  83  83  HIS HIS D . n 
D 1 84  ASN 84  84  84  ASN ASN D . n 
D 1 85  MET 85  85  85  MET MET D . n 
D 1 86  CYS 86  86  86  CYS CYS D . n 
D 1 87  GLY 87  87  87  GLY GLY D . n 
D 1 88  GLU 88  88  88  GLU GLU D . n 
D 1 89  THR 89  89  89  THR THR D . n 
D 1 90  GLU 90  90  90  GLU GLU D . n 
D 1 91  VAL 91  91  91  VAL VAL D . n 
D 1 92  GLU 92  92  92  GLU GLU D . n 
D 1 93  LYS 93  93  93  LYS LYS D . n 
D 1 94  GLN 94  94  94  GLN GLN D . n 
D 1 95  ARG 95  95  95  ARG ARG D . n 
D 1 96  VAL 96  96  96  VAL VAL D . n 
D 1 97  ASP 97  97  97  ASP ASP D . n 
D 1 98  VAL 98  98  98  VAL VAL D . n 
D 1 99  LEU 99  99  99  LEU LEU D . n 
D 1 100 GLU 100 100 100 GLU GLU D . n 
D 1 101 ASN 101 101 101 ASN ASN D . n 
D 1 102 HIS 102 102 102 HIS HIS D . n 
D 1 103 LEU 103 103 103 LEU LEU D . n 
D 1 104 MET 104 104 104 MET MET D . n 
D 1 105 ASP 105 105 105 ASP ASP D . n 
D 1 106 LEU 106 106 106 LEU LEU D . n 
D 1 107 ARG 107 107 107 ARG ARG D . n 
D 1 108 MET 108 108 108 MET MET D . n 
D 1 109 ALA 109 109 109 ALA ALA D . n 
D 1 110 PHE 110 110 110 PHE PHE D . n 
D 1 111 ALA 111 111 111 ALA ALA D . n 
D 1 112 ARG 112 112 112 ARG ARG D . n 
D 1 113 LEU 113 113 113 LEU LEU D . n 
D 1 114 CYS 114 114 114 CYS CYS D . n 
D 1 115 TYR 115 115 115 TYR TYR D . n 
D 1 116 SER 116 116 116 SER SER D . n 
D 1 117 PRO 117 117 117 PRO PRO D . n 
D 1 118 ASP 118 118 118 ASP ASP D . n 
D 1 119 PHE 119 119 119 PHE PHE D . n 
D 1 120 GLU 120 120 120 GLU GLU D . n 
D 1 121 LYS 121 121 121 LYS LYS D . n 
D 1 122 LEU 122 122 122 LEU LEU D . n 
D 1 123 LYS 123 123 123 LYS LYS D . n 
D 1 124 PRO 124 124 124 PRO PRO D . n 
D 1 125 ALA 125 125 125 ALA ALA D . n 
D 1 126 TYR 126 126 126 TYR TYR D . n 
D 1 127 LEU 127 127 127 LEU LEU D . n 
D 1 128 GLU 128 128 128 GLU GLU D . n 
D 1 129 LEU 129 129 129 LEU LEU D . n 
D 1 130 LEU 130 130 130 LEU LEU D . n 
D 1 131 PRO 131 131 131 PRO PRO D . n 
D 1 132 GLY 132 132 132 GLY GLY D . n 
D 1 133 LYS 133 133 133 LYS LYS D . n 
D 1 134 LEU 134 134 134 LEU LEU D . n 
D 1 135 ARG 135 135 135 ARG ARG D . n 
D 1 136 GLN 136 136 136 GLN GLN D . n 
D 1 137 LEU 137 137 137 LEU LEU D . n 
D 1 138 SER 138 138 138 SER SER D . n 
D 1 139 ARG 139 139 139 ARG ARG D . n 
D 1 140 PHE 140 140 140 PHE PHE D . n 
D 1 141 LEU 141 141 141 LEU LEU D . n 
D 1 142 GLY 142 142 142 GLY GLY D . n 
D 1 143 SER 143 143 143 SER SER D . n 
D 1 144 ARG 144 144 144 ARG ARG D . n 
D 1 145 SER 145 145 145 SER SER D . n 
D 1 146 TRP 146 146 146 TRP TRP D . n 
D 1 147 PHE 147 147 147 PHE PHE D . n 
D 1 148 VAL 148 148 148 VAL VAL D . n 
D 1 149 GLY 149 149 149 GLY GLY D . n 
D 1 150 ASP 150 150 150 ASP ASP D . n 
D 1 151 LYS 151 151 151 LYS LYS D . n 
D 1 152 LEU 152 152 152 LEU LEU D . n 
D 1 153 THR 153 153 153 THR THR D . n 
D 1 154 PHE 154 154 154 PHE PHE D . n 
D 1 155 VAL 155 155 155 VAL VAL D . n 
D 1 156 ASP 156 156 156 ASP ASP D . n 
D 1 157 PHE 157 157 157 PHE PHE D . n 
D 1 158 LEU 158 158 158 LEU LEU D . n 
D 1 159 ALA 159 159 159 ALA ALA D . n 
D 1 160 TYR 160 160 160 TYR TYR D . n 
D 1 161 ASP 161 161 161 ASP ASP D . n 
D 1 162 VAL 162 162 162 VAL VAL D . n 
D 1 163 LEU 163 163 163 LEU LEU D . n 
D 1 164 ASP 164 164 164 ASP ASP D . n 
D 1 165 GLN 165 165 165 GLN GLN D . n 
D 1 166 GLN 166 166 166 GLN GLN D . n 
D 1 167 ARG 167 167 167 ARG ARG D . n 
D 1 168 MET 168 168 168 MET MET D . n 
D 1 169 PHE 169 169 169 PHE PHE D . n 
D 1 170 VAL 170 170 170 VAL VAL D . n 
D 1 171 PRO 171 171 171 PRO PRO D . n 
D 1 172 ASP 172 172 172 ASP ASP D . n 
D 1 173 CYS 173 173 173 CYS CYS D . n 
D 1 174 PRO 174 174 174 PRO PRO D . n 
D 1 175 GLU 175 175 175 GLU GLU D . n 
D 1 176 LEU 176 176 176 LEU LEU D . n 
D 1 177 GLN 177 177 177 GLN GLN D . n 
D 1 178 GLY 178 178 178 GLY GLY D . n 
D 1 179 ASN 179 179 179 ASN ASN D . n 
D 1 180 LEU 180 180 180 LEU LEU D . n 
D 1 181 SER 181 181 181 SER SER D . n 
D 1 182 GLN 182 182 182 GLN GLN D . n 
D 1 183 PHE 183 183 183 PHE PHE D . n 
D 1 184 LEU 184 184 184 LEU LEU D . n 
D 1 185 GLN 185 185 185 GLN GLN D . n 
D 1 186 ARG 186 186 186 ARG ARG D . n 
D 1 187 PHE 187 187 187 PHE PHE D . n 
D 1 188 GLU 188 188 188 GLU GLU D . n 
D 1 189 ALA 189 189 189 ALA ALA D . n 
D 1 190 LEU 190 190 190 LEU LEU D . n 
D 1 191 GLU 191 191 191 GLU GLU D . n 
D 1 192 LYS 192 192 192 LYS LYS D . n 
D 1 193 ILE 193 193 193 ILE ILE D . n 
D 1 194 SER 194 194 194 SER SER D . n 
D 1 195 ALA 195 195 195 ALA ALA D . n 
D 1 196 TYR 196 196 196 TYR TYR D . n 
D 1 197 MET 197 197 197 MET MET D . n 
D 1 198 ARG 198 198 198 ARG ARG D . n 
D 1 199 SER 199 199 199 SER SER D . n 
D 1 200 GLY 200 200 200 GLY GLY D . n 
D 1 201 ARG 201 201 201 ARG ARG D . n 
D 1 202 PHE 202 202 202 PHE PHE D . n 
D 1 203 MET 203 203 203 MET MET D . n 
D 1 204 LYS 204 204 204 LYS LYS D . n 
D 1 205 ALA 205 205 205 ALA ALA D . n 
D 1 206 PRO 206 206 206 PRO PRO D . n 
D 1 207 ILE 207 207 207 ILE ILE D . n 
D 1 208 PHE 208 208 208 PHE PHE D . n 
D 1 209 TRP 209 209 209 TRP TRP D . n 
D 1 210 TYR 210 210 210 TYR TYR D . n 
D 1 211 THR 211 211 211 THR THR D . n 
D 1 212 ALA 212 212 212 ALA ALA D . n 
D 1 213 LEU 213 213 213 LEU LEU D . n 
D 1 214 TRP 214 214 214 TRP TRP D . n 
D 1 215 ASN 215 215 215 ASN ASN D . n 
D 1 216 ASN 216 216 216 ASN ASN D . n 
D 1 217 LYS 217 217 217 LYS LYS D . n 
D 1 218 LYS 218 218 ?   ?   ?   D . n 
D 1 219 GLU 219 219 ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J 
2 1 C,D,G,H,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-08-30 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .     ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_1             165 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_2             165 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.381 
_pdbx_validate_rmsd_bond.bond_target_value         1.235 
_pdbx_validate_rmsd_bond.bond_deviation            0.146 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.022 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CG B ARG 107 ? ? CD B ARG 107 ? ? NE B ARG 107 ? ? 124.45 111.80 12.65  2.10 N 
2 1 CD B ARG 107 ? ? NE B ARG 107 ? ? CZ B ARG 107 ? ? 109.28 123.60 -14.32 1.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 8   ? ? -86.32  48.03  
2  1 ARG A 10  ? ? -74.07  -70.24 
3  1 GLN A 71  ? ? 75.69   119.64 
4  1 ASP A 118 ? ? -79.51  24.67  
5  1 ASP B 8   ? ? -83.72  45.01  
6  1 ARG B 10  ? ? -67.17  -70.48 
7  1 GLN B 71  ? ? 77.69   119.87 
8  1 GLN C 71  ? ? 78.59   118.59 
9  1 GLU C 88  ? ? -105.94 -63.13 
10 1 ASP D 8   ? ? -85.76  46.40  
11 1 GLN D 71  ? ? 74.81   119.13 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 6   ? ? 0.087 'SIDE CHAIN' 
2 1 TYR A 32  ? ? 0.071 'SIDE CHAIN' 
3 1 ARG B 107 ? ? 0.318 'SIDE CHAIN' 
4 1 ARG B 198 ? ? 0.072 'SIDE CHAIN' 
5 1 TYR D 61  ? ? 0.087 'SIDE CHAIN' 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C1C ? A EPY 220 ? 'WRONG HAND' . 
2 1 C1C ? B EPY 221 ? 'WRONG HAND' . 
3 1 C1C ? C EPY 222 ? 'WRONG HAND' . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 218 ? A LYS 218 
2 1 Y 1 A GLU 219 ? A GLU 219 
3 1 Y 1 B LYS 218 ? B LYS 218 
4 1 Y 1 B GLU 219 ? B GLU 219 
5 1 Y 1 C LYS 218 ? C LYS 218 
6 1 Y 1 C GLU 219 ? C GLU 219 
7 1 Y 1 D LYS 218 ? D LYS 218 
8 1 Y 1 D GLU 219 ? D GLU 219 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1-HYDROXY-2-S-GLUTATHIONYL-3-PARA-NITROPHENOXY-PROPANE EPY 
3 water                                                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 EPY 1  220  218  EPY EPX A . 
F 2 EPY 1  221  218  EPY EPX B . 
G 2 EPY 1  222  218  EPY EPX C . 
H 2 EPY 1  223  218  EPY EPX D . 
I 3 HOH 1  2012 2012 HOH HOH A . 
I 3 HOH 2  2015 2015 HOH HOH A . 
I 3 HOH 3  2017 2017 HOH HOH A . 
I 3 HOH 4  2034 2034 HOH HOH A . 
I 3 HOH 5  2049 2049 HOH HOH A . 
I 3 HOH 6  2050 2050 HOH HOH A . 
I 3 HOH 7  2051 2051 HOH HOH A . 
I 3 HOH 8  2055 2055 HOH HOH A . 
I 3 HOH 9  2058 2058 HOH HOH A . 
I 3 HOH 10 2061 2061 HOH HOH A . 
I 3 HOH 11 2064 2064 HOH HOH A . 
I 3 HOH 12 2065 2065 HOH HOH A . 
I 3 HOH 13 2074 2074 HOH HOH A . 
I 3 HOH 14 2075 2075 HOH HOH A . 
I 3 HOH 15 2080 2080 HOH HOH A . 
I 3 HOH 16 2082 2082 HOH HOH A . 
I 3 HOH 17 2083 2083 HOH HOH A . 
I 3 HOH 18 2088 2088 HOH HOH A . 
I 3 HOH 19 2090 2090 HOH HOH A . 
I 3 HOH 20 2099 2099 HOH HOH A . 
I 3 HOH 21 2104 2104 HOH HOH A . 
I 3 HOH 22 2108 2108 HOH HOH A . 
I 3 HOH 23 2126 2126 HOH HOH A . 
I 3 HOH 24 2140 2140 HOH HOH A . 
I 3 HOH 25 2141 2141 HOH HOH A . 
I 3 HOH 26 2142 2142 HOH HOH A . 
I 3 HOH 27 2143 2143 HOH HOH A . 
I 3 HOH 28 2148 2148 HOH HOH A . 
I 3 HOH 29 2149 2149 HOH HOH A . 
I 3 HOH 30 2150 2150 HOH HOH A . 
J 3 HOH 1  2002 2002 HOH HOH B . 
J 3 HOH 2  2007 2007 HOH HOH B . 
J 3 HOH 3  2008 2008 HOH HOH B . 
J 3 HOH 4  2009 2009 HOH HOH B . 
J 3 HOH 5  2010 2010 HOH HOH B . 
J 3 HOH 6  2014 2014 HOH HOH B . 
J 3 HOH 7  2022 2022 HOH HOH B . 
J 3 HOH 8  2033 2033 HOH HOH B . 
J 3 HOH 9  2035 2035 HOH HOH B . 
J 3 HOH 10 2037 2037 HOH HOH B . 
J 3 HOH 11 2038 2038 HOH HOH B . 
J 3 HOH 12 2039 2039 HOH HOH B . 
J 3 HOH 13 2042 2042 HOH HOH B . 
J 3 HOH 14 2043 2043 HOH HOH B . 
J 3 HOH 15 2044 2044 HOH HOH B . 
J 3 HOH 16 2052 2052 HOH HOH B . 
J 3 HOH 17 2057 2057 HOH HOH B . 
J 3 HOH 18 2063 2063 HOH HOH B . 
J 3 HOH 19 2067 2067 HOH HOH B . 
J 3 HOH 20 2071 2071 HOH HOH B . 
J 3 HOH 21 2092 2092 HOH HOH B . 
J 3 HOH 22 2093 2093 HOH HOH B . 
J 3 HOH 23 2096 2096 HOH HOH B . 
J 3 HOH 24 2103 2103 HOH HOH B . 
J 3 HOH 25 2105 2105 HOH HOH B . 
J 3 HOH 26 2107 2107 HOH HOH B . 
J 3 HOH 27 2109 2109 HOH HOH B . 
J 3 HOH 28 2113 2113 HOH HOH B . 
J 3 HOH 29 2116 2116 HOH HOH B . 
J 3 HOH 30 2117 2117 HOH HOH B . 
J 3 HOH 31 2119 2119 HOH HOH B . 
J 3 HOH 32 2120 2120 HOH HOH B . 
J 3 HOH 33 2121 2121 HOH HOH B . 
J 3 HOH 34 2124 2124 HOH HOH B . 
J 3 HOH 35 2127 2127 HOH HOH B . 
J 3 HOH 36 2130 2130 HOH HOH B . 
J 3 HOH 37 2137 2137 HOH HOH B . 
J 3 HOH 38 2138 2138 HOH HOH B . 
J 3 HOH 39 2144 2144 HOH HOH B . 
J 3 HOH 40 2151 2151 HOH HOH B . 
J 3 HOH 41 2152 2152 HOH HOH B . 
J 3 HOH 42 2155 2155 HOH HOH B . 
K 3 HOH 1  2001 2001 HOH HOH C . 
K 3 HOH 2  2003 2003 HOH HOH C . 
K 3 HOH 3  2004 2004 HOH HOH C . 
K 3 HOH 4  2013 2013 HOH HOH C . 
K 3 HOH 5  2016 2016 HOH HOH C . 
K 3 HOH 6  2018 2018 HOH HOH C . 
K 3 HOH 7  2023 2023 HOH HOH C . 
K 3 HOH 8  2025 2025 HOH HOH C . 
K 3 HOH 9  2026 2026 HOH HOH C . 
K 3 HOH 10 2028 2028 HOH HOH C . 
K 3 HOH 11 2029 2029 HOH HOH C . 
K 3 HOH 12 2030 2030 HOH HOH C . 
K 3 HOH 13 2031 2031 HOH HOH C . 
K 3 HOH 14 2032 2032 HOH HOH C . 
K 3 HOH 15 2036 2036 HOH HOH C . 
K 3 HOH 16 2040 2040 HOH HOH C . 
K 3 HOH 17 2041 2041 HOH HOH C . 
K 3 HOH 18 2046 2046 HOH HOH C . 
K 3 HOH 19 2054 2054 HOH HOH C . 
K 3 HOH 20 2056 2056 HOH HOH C . 
K 3 HOH 21 2060 2060 HOH HOH C . 
K 3 HOH 22 2066 2066 HOH HOH C . 
K 3 HOH 23 2070 2070 HOH HOH C . 
K 3 HOH 24 2072 2072 HOH HOH C . 
K 3 HOH 25 2073 2073 HOH HOH C . 
K 3 HOH 26 2077 2077 HOH HOH C . 
K 3 HOH 27 2078 2078 HOH HOH C . 
K 3 HOH 28 2084 2084 HOH HOH C . 
K 3 HOH 29 2094 2094 HOH HOH C . 
K 3 HOH 30 2095 2095 HOH HOH C . 
K 3 HOH 31 2098 2098 HOH HOH C . 
K 3 HOH 32 2100 2100 HOH HOH C . 
K 3 HOH 33 2101 2101 HOH HOH C . 
K 3 HOH 34 2102 2102 HOH HOH C . 
K 3 HOH 35 2111 2111 HOH HOH C . 
K 3 HOH 36 2112 2112 HOH HOH C . 
K 3 HOH 37 2114 2114 HOH HOH C . 
K 3 HOH 38 2115 2115 HOH HOH C . 
K 3 HOH 39 2118 2118 HOH HOH C . 
K 3 HOH 40 2122 2122 HOH HOH C . 
K 3 HOH 41 2123 2123 HOH HOH C . 
K 3 HOH 42 2125 2125 HOH HOH C . 
K 3 HOH 43 2128 2128 HOH HOH C . 
K 3 HOH 44 2129 2129 HOH HOH C . 
K 3 HOH 45 2132 2132 HOH HOH C . 
K 3 HOH 46 2134 2134 HOH HOH C . 
K 3 HOH 47 2147 2147 HOH HOH C . 
K 3 HOH 48 2154 2154 HOH HOH C . 
K 3 HOH 49 2157 2157 HOH HOH C . 
K 3 HOH 50 2158 2158 HOH HOH C . 
L 3 HOH 1  2005 2005 HOH HOH D . 
L 3 HOH 2  2006 2006 HOH HOH D . 
L 3 HOH 3  2011 2011 HOH HOH D . 
L 3 HOH 4  2019 2019 HOH HOH D . 
L 3 HOH 5  2020 2020 HOH HOH D . 
L 3 HOH 6  2021 2021 HOH HOH D . 
L 3 HOH 7  2024 2024 HOH HOH D . 
L 3 HOH 8  2027 2027 HOH HOH D . 
L 3 HOH 9  2045 2045 HOH HOH D . 
L 3 HOH 10 2047 2047 HOH HOH D . 
L 3 HOH 11 2048 2048 HOH HOH D . 
L 3 HOH 12 2053 2053 HOH HOH D . 
L 3 HOH 13 2059 2059 HOH HOH D . 
L 3 HOH 14 2062 2062 HOH HOH D . 
L 3 HOH 15 2068 2068 HOH HOH D . 
L 3 HOH 16 2069 2069 HOH HOH D . 
L 3 HOH 17 2076 2076 HOH HOH D . 
L 3 HOH 18 2079 2079 HOH HOH D . 
L 3 HOH 19 2081 2081 HOH HOH D . 
L 3 HOH 20 2085 2085 HOH HOH D . 
L 3 HOH 21 2086 2086 HOH HOH D . 
L 3 HOH 22 2087 2087 HOH HOH D . 
L 3 HOH 23 2089 2089 HOH HOH D . 
L 3 HOH 24 2091 2091 HOH HOH D . 
L 3 HOH 25 2097 2097 HOH HOH D . 
L 3 HOH 26 2106 2106 HOH HOH D . 
L 3 HOH 27 2110 2110 HOH HOH D . 
L 3 HOH 28 2131 2131 HOH HOH D . 
L 3 HOH 29 2133 2133 HOH HOH D . 
L 3 HOH 30 2135 2135 HOH HOH D . 
L 3 HOH 31 2136 2136 HOH HOH D . 
L 3 HOH 32 2139 2139 HOH HOH D . 
L 3 HOH 33 2145 2145 HOH HOH D . 
L 3 HOH 34 2146 2146 HOH HOH D . 
L 3 HOH 35 2153 2153 HOH HOH D . 
L 3 HOH 36 2156 2156 HOH HOH D . 
#