data_1C7C
# 
_entry.id   1C7C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1C7C         
RCSB  RCSB001424   
WWPDB D_1000001424 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1C7B 'DEOXYHEMOGLOBIN RHB1.0' unspecified 
PDB 1C7D 'DEOXYHEMOGLOBIN RHB1.2' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1C7C 
_pdbx_database_status.recvd_initial_deposition_date   2000-02-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Brucker, E.A.' 
_audit_author.pdbx_ordinal   1 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Genetically crosslinked hemoglobin: a structural study.'                                              
'Acta Crystallogr.,Sect.D' 56  812 816 2000 ABCRE6 DK 0907-4449 0766 ? 10930828 10.1107/S0907444900006557       
1       'Structures of a Hemoglobin-Based Blood Substitute: Insights Into the Function of Allosteric Proteins' Structure 5   227 
237 1997 STRUE6 UK 0969-2126 2005 ? ?        '10.1016/S0969-2126(97)00181-0' 
2       'A Human Recombinant Haemoglobin Designed for Use as a Blood Substitute'                               Nature 356 258 260 
1992 NATUAS UK 0028-0836 0006 ? ?        10.1038/356258a0                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Brucker, E.A.'       1  ? 
1       'Kroeger, K.S.'       2  ? 
1       'Kundrot, C.E.'       3  ? 
2       'Looker, D.'          4  ? 
2       'Abbot-Brown, D.'     5  ? 
2       'Cozart, P.'          6  ? 
2       'Durfee, S.'          7  ? 
2       'Hoffman, S.'         8  ? 
2       'Mathews, A.J.'       9  ? 
2       'Miller-Roehrich, J.' 10 ? 
2       'Shoemaker, S.'       11 ? 
2       'Trimble, S.'         12 ? 
2       'Fermi, G.'           13 ? 
2       'Komiyama, N.H.'      14 ? 
2       'Nagai, K.'           15 ? 
2       'Stetler, G.L.'       16 ? 
# 
_cell.entry_id           1C7C 
_cell.length_a           63.204 
_cell.length_b           83.357 
_cell.length_c           54.003 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.07 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1C7C 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (DEOXYHEMOGLOBIN (ALPHA CHAIN))' 30371.846 1   ? V1M,142G  ? ? 
2 polymer     man 'PROTEIN (DEOXYHEMOGLOBIN (BETA CHAIN))'  15937.343 2   ? V1M,N108K ? ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'         616.487   4   ? ?         ? ? 
4 water       nat water                                     18.015    322 ? ?         ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNAL
SALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYRGVLSPADKTNVKAAWGKVG
AHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNF
KLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
;
;MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNAL
SALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYRGVLSPADKTNVKAAWGKVG
AHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNF
KLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
;
A   ? 
2 'polypeptide(L)' no no 
;MHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDN
LKGTFATLSELHCDKLHVDPENFRLLGKVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
;
;MHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDN
LKGTFATLSELHCDKLHVDPENFRLLGKVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   SER n 
1 4   PRO n 
1 5   ALA n 
1 6   ASP n 
1 7   LYS n 
1 8   THR n 
1 9   ASN n 
1 10  VAL n 
1 11  LYS n 
1 12  ALA n 
1 13  ALA n 
1 14  TRP n 
1 15  GLY n 
1 16  LYS n 
1 17  VAL n 
1 18  GLY n 
1 19  ALA n 
1 20  HIS n 
1 21  ALA n 
1 22  GLY n 
1 23  GLU n 
1 24  TYR n 
1 25  GLY n 
1 26  ALA n 
1 27  GLU n 
1 28  ALA n 
1 29  LEU n 
1 30  GLU n 
1 31  ARG n 
1 32  MET n 
1 33  PHE n 
1 34  LEU n 
1 35  SER n 
1 36  PHE n 
1 37  PRO n 
1 38  THR n 
1 39  THR n 
1 40  LYS n 
1 41  THR n 
1 42  TYR n 
1 43  PHE n 
1 44  PRO n 
1 45  HIS n 
1 46  PHE n 
1 47  ASP n 
1 48  LEU n 
1 49  SER n 
1 50  HIS n 
1 51  GLY n 
1 52  SER n 
1 53  ALA n 
1 54  GLN n 
1 55  VAL n 
1 56  LYS n 
1 57  GLY n 
1 58  HIS n 
1 59  GLY n 
1 60  LYS n 
1 61  LYS n 
1 62  VAL n 
1 63  ALA n 
1 64  ASP n 
1 65  ALA n 
1 66  LEU n 
1 67  THR n 
1 68  ASN n 
1 69  ALA n 
1 70  VAL n 
1 71  ALA n 
1 72  HIS n 
1 73  VAL n 
1 74  ASP n 
1 75  ASP n 
1 76  MET n 
1 77  PRO n 
1 78  ASN n 
1 79  ALA n 
1 80  LEU n 
1 81  SER n 
1 82  ALA n 
1 83  LEU n 
1 84  SER n 
1 85  ASP n 
1 86  LEU n 
1 87  HIS n 
1 88  ALA n 
1 89  HIS n 
1 90  LYS n 
1 91  LEU n 
1 92  ARG n 
1 93  VAL n 
1 94  ASP n 
1 95  PRO n 
1 96  VAL n 
1 97  ASN n 
1 98  PHE n 
1 99  LYS n 
1 100 LEU n 
1 101 LEU n 
1 102 SER n 
1 103 HIS n 
1 104 CYS n 
1 105 LEU n 
1 106 LEU n 
1 107 VAL n 
1 108 THR n 
1 109 LEU n 
1 110 ALA n 
1 111 ALA n 
1 112 HIS n 
1 113 LEU n 
1 114 PRO n 
1 115 ALA n 
1 116 GLU n 
1 117 PHE n 
1 118 THR n 
1 119 PRO n 
1 120 ALA n 
1 121 VAL n 
1 122 HIS n 
1 123 ALA n 
1 124 SER n 
1 125 LEU n 
1 126 ASP n 
1 127 LYS n 
1 128 PHE n 
1 129 LEU n 
1 130 ALA n 
1 131 SER n 
1 132 VAL n 
1 133 SER n 
1 134 THR n 
1 135 VAL n 
1 136 LEU n 
1 137 THR n 
1 138 SER n 
1 139 LYS n 
1 140 TYR n 
1 141 ARG n 
1 142 GLY n 
1 143 VAL n 
1 144 LEU n 
1 145 SER n 
1 146 PRO n 
1 147 ALA n 
1 148 ASP n 
1 149 LYS n 
1 150 THR n 
1 151 ASN n 
1 152 VAL n 
1 153 LYS n 
1 154 ALA n 
1 155 ALA n 
1 156 TRP n 
1 157 GLY n 
1 158 LYS n 
1 159 VAL n 
1 160 GLY n 
1 161 ALA n 
1 162 HIS n 
1 163 ALA n 
1 164 GLY n 
1 165 GLU n 
1 166 TYR n 
1 167 GLY n 
1 168 ALA n 
1 169 GLU n 
1 170 ALA n 
1 171 LEU n 
1 172 GLU n 
1 173 ARG n 
1 174 MET n 
1 175 PHE n 
1 176 LEU n 
1 177 SER n 
1 178 PHE n 
1 179 PRO n 
1 180 THR n 
1 181 THR n 
1 182 LYS n 
1 183 THR n 
1 184 TYR n 
1 185 PHE n 
1 186 PRO n 
1 187 HIS n 
1 188 PHE n 
1 189 ASP n 
1 190 LEU n 
1 191 SER n 
1 192 HIS n 
1 193 GLY n 
1 194 SER n 
1 195 ALA n 
1 196 GLN n 
1 197 VAL n 
1 198 LYS n 
1 199 GLY n 
1 200 HIS n 
1 201 GLY n 
1 202 LYS n 
1 203 LYS n 
1 204 VAL n 
1 205 ALA n 
1 206 ASP n 
1 207 ALA n 
1 208 LEU n 
1 209 THR n 
1 210 ASN n 
1 211 ALA n 
1 212 VAL n 
1 213 ALA n 
1 214 HIS n 
1 215 VAL n 
1 216 ASP n 
1 217 ASP n 
1 218 MET n 
1 219 PRO n 
1 220 ASN n 
1 221 ALA n 
1 222 LEU n 
1 223 SER n 
1 224 ALA n 
1 225 LEU n 
1 226 SER n 
1 227 ASP n 
1 228 LEU n 
1 229 HIS n 
1 230 ALA n 
1 231 HIS n 
1 232 LYS n 
1 233 LEU n 
1 234 ARG n 
1 235 VAL n 
1 236 ASP n 
1 237 PRO n 
1 238 VAL n 
1 239 ASN n 
1 240 PHE n 
1 241 LYS n 
1 242 LEU n 
1 243 LEU n 
1 244 SER n 
1 245 HIS n 
1 246 CYS n 
1 247 LEU n 
1 248 LEU n 
1 249 VAL n 
1 250 THR n 
1 251 LEU n 
1 252 ALA n 
1 253 ALA n 
1 254 HIS n 
1 255 LEU n 
1 256 PRO n 
1 257 ALA n 
1 258 GLU n 
1 259 PHE n 
1 260 THR n 
1 261 PRO n 
1 262 ALA n 
1 263 VAL n 
1 264 HIS n 
1 265 ALA n 
1 266 SER n 
1 267 LEU n 
1 268 ASP n 
1 269 LYS n 
1 270 PHE n 
1 271 LEU n 
1 272 ALA n 
1 273 SER n 
1 274 VAL n 
1 275 SER n 
1 276 THR n 
1 277 VAL n 
1 278 LEU n 
1 279 THR n 
1 280 SER n 
1 281 LYS n 
1 282 TYR n 
1 283 ARG n 
2 1   MET n 
2 2   HIS n 
2 3   LEU n 
2 4   THR n 
2 5   PRO n 
2 6   GLU n 
2 7   GLU n 
2 8   LYS n 
2 9   SER n 
2 10  ALA n 
2 11  VAL n 
2 12  THR n 
2 13  ALA n 
2 14  LEU n 
2 15  TRP n 
2 16  GLY n 
2 17  LYS n 
2 18  VAL n 
2 19  ASN n 
2 20  VAL n 
2 21  ASP n 
2 22  GLU n 
2 23  VAL n 
2 24  GLY n 
2 25  GLY n 
2 26  GLU n 
2 27  ALA n 
2 28  LEU n 
2 29  GLY n 
2 30  ARG n 
2 31  LEU n 
2 32  LEU n 
2 33  VAL n 
2 34  VAL n 
2 35  TYR n 
2 36  PRO n 
2 37  TRP n 
2 38  THR n 
2 39  GLN n 
2 40  ARG n 
2 41  PHE n 
2 42  PHE n 
2 43  GLU n 
2 44  SER n 
2 45  PHE n 
2 46  GLY n 
2 47  ASP n 
2 48  LEU n 
2 49  SER n 
2 50  THR n 
2 51  PRO n 
2 52  ASP n 
2 53  ALA n 
2 54  VAL n 
2 55  MET n 
2 56  GLY n 
2 57  ASN n 
2 58  PRO n 
2 59  LYS n 
2 60  VAL n 
2 61  LYS n 
2 62  ALA n 
2 63  HIS n 
2 64  GLY n 
2 65  LYS n 
2 66  LYS n 
2 67  VAL n 
2 68  LEU n 
2 69  GLY n 
2 70  ALA n 
2 71  PHE n 
2 72  SER n 
2 73  ASP n 
2 74  GLY n 
2 75  LEU n 
2 76  ALA n 
2 77  HIS n 
2 78  LEU n 
2 79  ASP n 
2 80  ASN n 
2 81  LEU n 
2 82  LYS n 
2 83  GLY n 
2 84  THR n 
2 85  PHE n 
2 86  ALA n 
2 87  THR n 
2 88  LEU n 
2 89  SER n 
2 90  GLU n 
2 91  LEU n 
2 92  HIS n 
2 93  CYS n 
2 94  ASP n 
2 95  LYS n 
2 96  LEU n 
2 97  HIS n 
2 98  VAL n 
2 99  ASP n 
2 100 PRO n 
2 101 GLU n 
2 102 ASN n 
2 103 PHE n 
2 104 ARG n 
2 105 LEU n 
2 106 LEU n 
2 107 GLY n 
2 108 LYS n 
2 109 VAL n 
2 110 LEU n 
2 111 VAL n 
2 112 CYS n 
2 113 VAL n 
2 114 LEU n 
2 115 ALA n 
2 116 HIS n 
2 117 HIS n 
2 118 PHE n 
2 119 GLY n 
2 120 LYS n 
2 121 GLU n 
2 122 PHE n 
2 123 THR n 
2 124 PRO n 
2 125 PRO n 
2 126 VAL n 
2 127 GLN n 
2 128 ALA n 
2 129 ALA n 
2 130 TYR n 
2 131 GLN n 
2 132 LYS n 
2 133 VAL n 
2 134 VAL n 
2 135 ALA n 
2 136 GLY n 
2 137 VAL n 
2 138 ALA n 
2 139 ASN n 
2 140 ALA n 
2 141 LEU n 
2 142 ALA n 
2 143 HIS n 
2 144 LYS n 
2 145 TYR n 
2 146 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1   141 human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? 'RED BLOOD CELL' ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample ? 143 283 human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? 'RED BLOOD CELL' ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ?   ?   human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? 'RED BLOOD CELL' ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 HBA_HUMAN UNP 1 P69905 ? ? ? 
2 HBB_HUMAN UNP 2 P68871 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1C7C A 1   ? 141 ? P69905 1 ? 141 ? 1   141 
2 1 1C7C A 143 ? 283 ? P69905 1 ? 141 ? 143 283 
3 2 1C7C B 1   ? 146 ? P68871 1 ? 146 ? 1   146 
4 2 1C7C D 1   ? 146 ? P68871 1 ? 146 ? 1   146 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1C7C MET A 1   ? UNP P69905 VAL 1   ENGINEERED       1   1 
1 1C7C GLY A 142 ? UNP P69905 ?   ?   'SEE REMARK 999' 142 2 
3 1C7C MET B 1   ? UNP P68871 VAL 1   ENGINEERED       1   3 
3 1C7C LYS B 108 ? UNP P68871 ASN 108 ENGINEERED       108 4 
4 1C7C MET D 1   ? UNP P68871 VAL 1   ENGINEERED       1   5 
4 1C7C LYS D 108 ? UNP P68871 ASN 108 ENGINEERED       108 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1C7C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.85 
_exptl_crystal.density_percent_sol   33.6 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PERUTZ, J.CRYST.GROWTH 2(1968)54-56, pH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           295 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1998-06-15 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1C7C 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            1.80 
_reflns.number_obs                   45597 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89.0 
_reflns.pdbx_Rmerge_I_obs            0.049 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        33.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.15 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.90 
_reflns_shell.percent_possible_all   94.1 
_reflns_shell.Rmerge_I_obs           0.247 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    9.26 
_reflns_shell.pdbx_redundancy        3.20 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1C7C 
_refine.ls_number_reflns_obs                     44592 
_refine.ls_number_reflns_all                     44592 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    87.0 
_refine.ls_R_factor_obs                          0.1753 
_refine.ls_R_factor_all                          0.1764 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.2266 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.71 
_refine.ls_number_reflns_R_free                  4332 
_refine.ls_number_parameters                     19547 
_refine.ls_number_restraints                     23037 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER, J.MOL.BIOL. 91(1973)201-228' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1ABY 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1C7C 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      0 
_refine_analyze.occupancy_sum_hydrogen          0. 
_refine_analyze.occupancy_sum_non_hydrogen      4875.50 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4392 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         172 
_refine_hist.number_atoms_solvent             322 
_refine_hist.number_atoms_total               4886 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.004 ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.041 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.041 ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.017 ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1C7C 
_pdbx_refine.R_factor_all_no_cutoff                      0.1764 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1753 
_pdbx_refine.free_R_factor_no_cutoff                     0.2266 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     9.71 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            4332 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.168 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1668 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.2153 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   4.789 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          1951 
_pdbx_refine.number_reflns_obs_4sig_cutoff               40740 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1C7C 
_struct.title                     'DEOXY RHB1.1 (RECOMBINANT HEMOGLOBIN)' 
_struct.pdbx_descriptor           'DEOXYHEMOGLOBIN (ALPHA CHAIN)/DEOXYHEMOGLOBIN (BETA CHAIN)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1C7C 
_struct_keywords.pdbx_keywords   'OXYGEN STORAGE/TRANSPORT' 
_struct_keywords.text            'HEME, OXYGEN DELIVERY VEHICLE, BLOOD SUBSTITUTE, OXYGEN STORAGE-TRANSPORT COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 3   ? GLY A 18  ? SER A 3   GLY A 18  1 ? 16 
HELX_P HELX_P2  2  HIS A 20  ? PHE A 36  ? HIS A 20  PHE A 36  1 ? 17 
HELX_P HELX_P3  3  PRO A 37  ? PHE A 43  ? PRO A 37  PHE A 43  5 ? 7  
HELX_P HELX_P4  4  SER A 52  ? HIS A 72  ? SER A 52  HIS A 72  1 ? 21 
HELX_P HELX_P5  5  ASP A 75  ? LEU A 80  ? ASP A 75  LEU A 80  1 ? 6  
HELX_P HELX_P6  6  LEU A 80  ? LYS A 90  ? LEU A 80  LYS A 90  1 ? 11 
HELX_P HELX_P7  7  PRO A 95  ? LEU A 113 ? PRO A 95  LEU A 113 1 ? 19 
HELX_P HELX_P8  8  THR A 118 ? THR A 137 ? THR A 118 THR A 137 1 ? 20 
HELX_P HELX_P9  9  SER A 145 ? GLY A 160 ? SER A 145 GLY A 160 1 ? 16 
HELX_P HELX_P10 10 HIS A 162 ? PHE A 178 ? HIS A 162 PHE A 178 1 ? 17 
HELX_P HELX_P11 11 PRO A 179 ? PHE A 185 ? PRO A 179 PHE A 185 5 ? 7  
HELX_P HELX_P12 12 SER A 194 ? HIS A 214 ? SER A 194 HIS A 214 1 ? 21 
HELX_P HELX_P13 13 ASP A 217 ? LEU A 222 ? ASP A 217 LEU A 222 1 ? 6  
HELX_P HELX_P14 14 LEU A 222 ? LYS A 232 ? LEU A 222 LYS A 232 1 ? 11 
HELX_P HELX_P15 15 PRO A 237 ? LEU A 255 ? PRO A 237 LEU A 255 1 ? 19 
HELX_P HELX_P16 16 THR A 260 ? SER A 280 ? THR A 260 SER A 280 1 ? 21 
HELX_P HELX_P17 17 THR B 4   ? GLY B 16  ? THR B 4   GLY B 16  1 ? 13 
HELX_P HELX_P18 18 ASN B 19  ? TYR B 35  ? ASN B 19  TYR B 35  1 ? 17 
HELX_P HELX_P19 19 PRO B 36  ? PHE B 42  ? PRO B 36  PHE B 42  5 ? 7  
HELX_P HELX_P20 20 PHE B 42  ? GLY B 46  ? PHE B 42  GLY B 46  5 ? 5  
HELX_P HELX_P21 21 THR B 50  ? ASN B 57  ? THR B 50  ASN B 57  1 ? 8  
HELX_P HELX_P22 22 ASN B 57  ? LEU B 75  ? ASN B 57  LEU B 75  1 ? 19 
HELX_P HELX_P23 23 ALA B 76  ? ASP B 79  ? ALA B 76  ASP B 79  5 ? 4  
HELX_P HELX_P24 24 ASN B 80  ? LYS B 95  ? ASN B 80  LYS B 95  1 ? 16 
HELX_P HELX_P25 25 PRO B 100 ? GLY B 119 ? PRO B 100 GLY B 119 1 ? 20 
HELX_P HELX_P26 26 LYS B 120 ? PHE B 122 ? LYS B 120 PHE B 122 5 ? 3  
HELX_P HELX_P27 27 THR B 123 ? HIS B 143 ? THR B 123 HIS B 143 1 ? 21 
HELX_P HELX_P28 28 THR C 4   ? GLY C 16  ? THR D 4   GLY D 16  1 ? 13 
HELX_P HELX_P29 29 ASN C 19  ? TYR C 35  ? ASN D 19  TYR D 35  1 ? 17 
HELX_P HELX_P30 30 PRO C 36  ? PHE C 42  ? PRO D 36  PHE D 42  5 ? 7  
HELX_P HELX_P31 31 PHE C 42  ? GLY C 46  ? PHE D 42  GLY D 46  5 ? 5  
HELX_P HELX_P32 32 THR C 50  ? ASN C 57  ? THR D 50  ASN D 57  1 ? 8  
HELX_P HELX_P33 33 ASN C 57  ? LEU C 75  ? ASN D 57  LEU D 75  1 ? 19 
HELX_P HELX_P34 34 ASN C 80  ? LYS C 95  ? ASN D 80  LYS D 95  1 ? 16 
HELX_P HELX_P35 35 PRO C 100 ? GLY C 119 ? PRO D 100 GLY D 119 1 ? 20 
HELX_P HELX_P36 36 LYS C 120 ? PHE C 122 ? LYS D 120 PHE D 122 5 ? 3  
HELX_P HELX_P37 37 THR C 123 ? ALA C 142 ? THR D 123 ALA D 142 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? D HEM . FE ? ? ? 1_555 A HIS 87  NE2 ? ? A HEM 284 A HIS 87  1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc2 metalc ? ? E HEM . FE ? ? ? 1_555 A HIS 229 NE2 ? ? A HEM 285 A HIS 229 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc3 metalc ? ? F HEM . FE ? ? ? 1_555 B HIS 92  NE2 ? ? B HEM 147 B HIS 92  1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc4 metalc ? ? G HEM . FE ? ? ? 1_555 C HIS 92  NE2 ? ? D HEM 147 D HIS 92  1_555 ? ? ? ? ? ? ? 2.152 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE HEM A 284' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM A 285' 
AC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE HEM B 147' 
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE HEM D 147' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 TYR A 42  ? TYR A 42   . ? 1_555 ? 
2  AC1 15 PHE A 43  ? PHE A 43   . ? 1_555 ? 
3  AC1 15 HIS A 45  ? HIS A 45   . ? 1_555 ? 
4  AC1 15 HIS A 58  ? HIS A 58   . ? 1_555 ? 
5  AC1 15 LYS A 61  ? LYS A 61   . ? 1_555 ? 
6  AC1 15 LEU A 83  ? LEU A 83   . ? 1_555 ? 
7  AC1 15 LEU A 86  ? LEU A 86   . ? 1_555 ? 
8  AC1 15 HIS A 87  ? HIS A 87   . ? 1_555 ? 
9  AC1 15 LEU A 91  ? LEU A 91   . ? 1_555 ? 
10 AC1 15 VAL A 93  ? VAL A 93   . ? 1_555 ? 
11 AC1 15 ASN A 97  ? ASN A 97   . ? 1_555 ? 
12 AC1 15 PHE A 98  ? PHE A 98   . ? 1_555 ? 
13 AC1 15 LEU A 136 ? LEU A 136  . ? 1_555 ? 
14 AC1 15 HOH H .   ? HOH A 1043 . ? 1_555 ? 
15 AC1 15 HOH H .   ? HOH A 1208 . ? 1_555 ? 
16 AC2 17 TYR A 184 ? TYR A 184  . ? 1_555 ? 
17 AC2 17 PHE A 185 ? PHE A 185  . ? 1_555 ? 
18 AC2 17 HIS A 187 ? HIS A 187  . ? 1_555 ? 
19 AC2 17 HIS A 200 ? HIS A 200  . ? 1_555 ? 
20 AC2 17 LYS A 203 ? LYS A 203  . ? 1_555 ? 
21 AC2 17 LEU A 225 ? LEU A 225  . ? 1_555 ? 
22 AC2 17 LEU A 228 ? LEU A 228  . ? 1_555 ? 
23 AC2 17 HIS A 229 ? HIS A 229  . ? 1_555 ? 
24 AC2 17 LEU A 233 ? LEU A 233  . ? 1_555 ? 
25 AC2 17 VAL A 235 ? VAL A 235  . ? 1_555 ? 
26 AC2 17 ASN A 239 ? ASN A 239  . ? 1_555 ? 
27 AC2 17 PHE A 240 ? PHE A 240  . ? 1_555 ? 
28 AC2 17 LEU A 243 ? LEU A 243  . ? 1_555 ? 
29 AC2 17 LEU A 278 ? LEU A 278  . ? 1_555 ? 
30 AC2 17 HOH H .   ? HOH A 1049 . ? 1_555 ? 
31 AC2 17 HOH H .   ? HOH A 1180 . ? 1_555 ? 
32 AC2 17 HOH H .   ? HOH A 1244 . ? 1_555 ? 
33 AC3 12 ALA A 53  ? ALA A 53   . ? 1_556 ? 
34 AC3 12 PHE B 41  ? PHE B 41   . ? 1_555 ? 
35 AC3 12 PHE B 42  ? PHE B 42   . ? 1_555 ? 
36 AC3 12 HIS B 63  ? HIS B 63   . ? 1_555 ? 
37 AC3 12 VAL B 67  ? VAL B 67   . ? 1_555 ? 
38 AC3 12 LEU B 91  ? LEU B 91   . ? 1_555 ? 
39 AC3 12 HIS B 92  ? HIS B 92   . ? 1_555 ? 
40 AC3 12 ASN B 102 ? ASN B 102  . ? 1_555 ? 
41 AC3 12 PHE B 103 ? PHE B 103  . ? 1_555 ? 
42 AC3 12 LEU B 141 ? LEU B 141  . ? 1_555 ? 
43 AC3 12 HOH I .   ? HOH B 1069 . ? 1_555 ? 
44 AC3 12 HOH I .   ? HOH B 1274 . ? 1_555 ? 
45 AC4 10 HIS C 63  ? HIS D 63   . ? 1_555 ? 
46 AC4 10 VAL C 67  ? VAL D 67   . ? 1_555 ? 
47 AC4 10 LEU C 91  ? LEU D 91   . ? 1_555 ? 
48 AC4 10 HIS C 92  ? HIS D 92   . ? 1_555 ? 
49 AC4 10 LEU C 96  ? LEU D 96   . ? 1_555 ? 
50 AC4 10 ASN C 102 ? ASN D 102  . ? 1_555 ? 
51 AC4 10 PHE C 103 ? PHE D 103  . ? 1_555 ? 
52 AC4 10 LEU C 106 ? LEU D 106  . ? 1_555 ? 
53 AC4 10 LEU C 141 ? LEU D 141  . ? 1_555 ? 
54 AC4 10 HOH J .   ? HOH D 1267 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1C7C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1C7C 
_atom_sites.fract_transf_matrix[1][1]   0.015822 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002526 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011997 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018752 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 20.413  30.050  44.665 1.00 53.42  ? 1    MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 20.787  30.116  43.244 1.00 58.28  ? 1    MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 22.301  30.141  43.118 1.00 49.13  ? 1    MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 23.025  30.154  44.122 1.00 41.93  ? 1    MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 20.127  31.362  42.662 1.00 61.59  ? 1    MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 20.991  32.465  42.123 1.00 61.03  ? 1    MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 21.817  33.530  43.306 1.00 83.94  ? 1    MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 21.429  32.765  44.922 1.00 71.90  ? 1    MET A CE  1 
ATOM   9    N  N   . LEU A 1 2   ? 22.826  30.109  41.893 1.00 39.15  ? 2    LEU A N   1 
ATOM   10   C  CA  . LEU A 1 2   ? 24.277  30.084  41.718 1.00 27.93  ? 2    LEU A CA  1 
ATOM   11   C  C   . LEU A 1 2   ? 24.946  31.261  42.416 1.00 31.19  ? 2    LEU A C   1 
ATOM   12   O  O   . LEU A 1 2   ? 24.824  32.414  42.005 1.00 38.92  ? 2    LEU A O   1 
ATOM   13   C  CB  . LEU A 1 2   ? 24.634  30.073  40.230 1.00 31.30  ? 2    LEU A CB  1 
ATOM   14   C  CG  . LEU A 1 2   ? 24.280  28.778  39.491 1.00 37.71  ? 2    LEU A CG  1 
ATOM   15   C  CD1 . LEU A 1 2   ? 24.744  28.834  38.043 1.00 46.56  ? 2    LEU A CD1 1 
ATOM   16   C  CD2 . LEU A 1 2   ? 24.881  27.575  40.200 1.00 26.89  ? 2    LEU A CD2 1 
ATOM   17   N  N   . SER A 1 3   ? 25.666  30.961  43.489 1.00 36.86  ? 3    SER A N   1 
ATOM   18   C  CA  . SER A 1 3   ? 26.472  31.986  44.158 1.00 40.17  ? 3    SER A CA  1 
ATOM   19   C  C   . SER A 1 3   ? 27.736  32.237  43.348 1.00 39.50  ? 3    SER A C   1 
ATOM   20   O  O   . SER A 1 3   ? 28.038  31.471  42.423 1.00 29.59  ? 3    SER A O   1 
ATOM   21   C  CB  . SER A 1 3   ? 26.769  31.540  45.587 1.00 37.77  ? 3    SER A CB  1 
ATOM   22   O  OG  . SER A 1 3   ? 27.866  30.646  45.644 1.00 39.19  ? 3    SER A OG  1 
ATOM   23   N  N   . PRO A 1 4   ? 28.482  33.298  43.630 1.00 42.39  ? 4    PRO A N   1 
ATOM   24   C  CA  . PRO A 1 4   ? 29.714  33.553  42.874 1.00 35.13  ? 4    PRO A CA  1 
ATOM   25   C  C   . PRO A 1 4   ? 30.753  32.468  43.119 1.00 24.65  ? 4    PRO A C   1 
ATOM   26   O  O   . PRO A 1 4   ? 31.581  32.148  42.266 1.00 28.83  ? 4    PRO A O   1 
ATOM   27   C  CB  . PRO A 1 4   ? 30.214  34.896  43.418 1.00 32.79  ? 4    PRO A CB  1 
ATOM   28   C  CG  . PRO A 1 4   ? 29.045  35.495  44.118 1.00 34.40  ? 4    PRO A CG  1 
ATOM   29   C  CD  . PRO A 1 4   ? 28.234  34.338  44.641 1.00 43.68  ? 4    PRO A CD  1 
ATOM   30   N  N   . ALA A 1 5   ? 30.724  31.858  44.308 1.00 22.76  ? 5    ALA A N   1 
ATOM   31   C  CA  . ALA A 1 5   ? 31.679  30.774  44.557 1.00 25.20  ? 5    ALA A CA  1 
ATOM   32   C  C   . ALA A 1 5   ? 31.289  29.553  43.730 1.00 26.66  ? 5    ALA A C   1 
ATOM   33   O  O   . ALA A 1 5   ? 32.145  28.822  43.241 1.00 26.54  ? 5    ALA A O   1 
ATOM   34   C  CB  . ALA A 1 5   ? 31.737  30.433  46.039 1.00 30.75  ? 5    ALA A CB  1 
ATOM   35   N  N   . ASP A 1 6   ? 29.984  29.334  43.566 1.00 22.45  ? 6    ASP A N   1 
ATOM   36   C  CA  . ASP A 1 6   ? 29.522  28.281  42.666 1.00 21.96  ? 6    ASP A CA  1 
ATOM   37   C  C   . ASP A 1 6   ? 30.053  28.515  41.256 1.00 24.47  ? 6    ASP A C   1 
ATOM   38   O  O   . ASP A 1 6   ? 30.548  27.608  40.594 1.00 26.61  ? 6    ASP A O   1 
ATOM   39   C  CB  . ASP A 1 6   ? 27.994  28.222  42.586 1.00 23.90  ? 6    ASP A CB  1 
ATOM   40   C  CG  . ASP A 1 6   ? 27.324  27.612  43.798 1.00 24.02  ? 6    ASP A CG  1 
ATOM   41   O  OD1 . ASP A 1 6   ? 27.919  26.719  44.435 1.00 24.46  ? 6    ASP A OD1 1 
ATOM   42   O  OD2 . ASP A 1 6   ? 26.173  28.024  44.093 1.00 27.50  ? 6    ASP A OD2 1 
ATOM   43   N  N   . LYS A 1 7   ? 29.899  29.754  40.792 1.00 24.02  ? 7    LYS A N   1 
ATOM   44   C  CA  . LYS A 1 7   ? 30.341  30.097  39.446 1.00 29.08  ? 7    LYS A CA  1 
ATOM   45   C  C   . LYS A 1 7   ? 31.835  29.861  39.282 1.00 30.10  ? 7    LYS A C   1 
ATOM   46   O  O   . LYS A 1 7   ? 32.302  29.349  38.263 1.00 24.67  ? 7    LYS A O   1 
ATOM   47   C  CB  . LYS A 1 7   ? 29.985  31.558  39.138 1.00 30.18  ? 7    LYS A CB  1 
ATOM   48   C  CG  . LYS A 1 7   ? 28.494  31.846  39.178 1.00 34.49  ? 7    LYS A CG  1 
ATOM   49   C  CD  . LYS A 1 7   ? 28.195  33.331  39.030 1.00 36.06  ? 7    LYS A CD  1 
ATOM   50   C  CE  . LYS A 1 7   ? 26.696  33.583  38.975 1.00 39.83  ? 7    LYS A CE  1 
ATOM   51   N  NZ  . LYS A 1 7   ? 26.358  34.993  39.322 1.00 41.81  ? 7    LYS A NZ  1 
ATOM   52   N  N   . THR A 1 8   ? 32.617  30.238  40.295 1.00 31.73  ? 8    THR A N   1 
ATOM   53   C  CA  . THR A 1 8   ? 34.060  30.017  40.239 1.00 27.24  ? 8    THR A CA  1 
ATOM   54   C  C   . THR A 1 8   ? 34.411  28.538  40.118 1.00 24.66  ? 8    THR A C   1 
ATOM   55   O  O   . THR A 1 8   ? 35.274  28.139  39.333 1.00 32.34  ? 8    THR A O   1 
ATOM   56   C  CB  . THR A 1 8   ? 34.760  30.589  41.490 1.00 37.24  ? 8    THR A CB  1 
ATOM   57   O  OG1 . THR A 1 8   ? 34.563  32.006  41.528 1.00 40.46  ? 8    THR A OG1 1 
ATOM   58   C  CG2 . THR A 1 8   ? 36.255  30.328  41.410 1.00 44.68  ? 8    THR A CG2 1 
ATOM   59   N  N   . ASN A 1 9   ? 33.727  27.719  40.904 1.00 18.72  ? 9    ASN A N   1 
ATOM   60   C  CA  . ASN A 1 9   ? 33.920  26.275  40.904 1.00 21.36  ? 9    ASN A CA  1 
ATOM   61   C  C   . ASN A 1 9   ? 33.600  25.677  39.542 1.00 25.79  ? 9    ASN A C   1 
ATOM   62   O  O   . ASN A 1 9   ? 34.333  24.861  38.989 1.00 29.37  ? 9    ASN A O   1 
ATOM   63   C  CB  . ASN A 1 9   ? 33.030  25.637  41.980 1.00 24.96  ? 9    ASN A CB  1 
ATOM   64   C  CG  . ASN A 1 9   ? 33.569  25.841  43.385 1.00 30.39  ? 9    ASN A CG  1 
ATOM   65   O  OD1 . ASN A 1 9   ? 34.767  26.049  43.583 1.00 29.32  ? 9    ASN A OD1 1 
ATOM   66   N  ND2 . ASN A 1 9   ? 32.687  25.772  44.375 1.00 23.56  ? 9    ASN A ND2 1 
ATOM   67   N  N   . VAL A 1 10  ? 32.454  26.068  38.971 1.00 25.01  ? 10   VAL A N   1 
ATOM   68   C  CA  . VAL A 1 10  ? 32.111  25.517  37.659 1.00 26.17  ? 10   VAL A CA  1 
ATOM   69   C  C   . VAL A 1 10  ? 33.117  25.944  36.597 1.00 25.39  ? 10   VAL A C   1 
ATOM   70   O  O   . VAL A 1 10  ? 33.545  25.126  35.778 1.00 29.70  ? 10   VAL A O   1 
ATOM   71   C  CB  . VAL A 1 10  ? 30.700  25.957  37.228 1.00 27.23  ? 10   VAL A CB  1 
ATOM   72   C  CG1 . VAL A 1 10  ? 30.399  25.436  35.832 1.00 26.16  ? 10   VAL A CG1 1 
ATOM   73   C  CG2 . VAL A 1 10  ? 29.673  25.473  38.237 1.00 24.32  ? 10   VAL A CG2 1 
ATOM   74   N  N   . LYS A 1 11  ? 33.504  27.220  36.606 1.00 21.28  ? 11   LYS A N   1 
ATOM   75   C  CA  . LYS A 1 11  ? 34.483  27.695  35.627 1.00 22.15  ? 11   LYS A CA  1 
ATOM   76   C  C   . LYS A 1 11  ? 35.771  26.888  35.700 1.00 29.40  ? 11   LYS A C   1 
ATOM   77   O  O   . LYS A 1 11  ? 36.328  26.453  34.689 1.00 25.15  ? 11   LYS A O   1 
ATOM   78   C  CB  . LYS A 1 11  ? 34.769  29.182  35.827 1.00 23.87  ? 11   LYS A CB  1 
ATOM   79   C  CG  . LYS A 1 11  ? 33.710  30.071  35.186 1.00 37.90  ? 11   LYS A CG  1 
ATOM   80   C  CD  . LYS A 1 11  ? 33.811  31.498  35.698 1.00 49.12  ? 11   LYS A CD  1 
ATOM   81   C  CE  . LYS A 1 11  ? 32.583  32.311  35.314 1.00 63.37  ? 11   LYS A CE  1 
ATOM   82   N  NZ  . LYS A 1 11  ? 32.777  33.043  34.021 1.00 81.82  ? 11   LYS A NZ  1 
ATOM   83   N  N   . ALA A 1 12  ? 36.265  26.667  36.918 1.00 33.33  ? 12   ALA A N   1 
ATOM   84   C  CA  . ALA A 1 12  ? 37.523  25.927  37.037 1.00 36.42  ? 12   ALA A CA  1 
ATOM   85   C  C   . ALA A 1 12  ? 37.365  24.495  36.550 1.00 38.52  ? 12   ALA A C   1 
ATOM   86   O  O   . ALA A 1 12  ? 38.198  23.953  35.818 1.00 30.21  ? 12   ALA A O   1 
ATOM   87   C  CB  . ALA A 1 12  ? 38.007  25.974  38.475 1.00 36.47  ? 12   ALA A CB  1 
ATOM   88   N  N   . ALA A 1 13  ? 36.263  23.855  36.956 1.00 28.23  ? 13   ALA A N   1 
ATOM   89   C  CA  . ALA A 1 13  ? 36.053  22.469  36.557 1.00 20.98  ? 13   ALA A CA  1 
ATOM   90   C  C   . ALA A 1 13  ? 35.968  22.335  35.037 1.00 26.82  ? 13   ALA A C   1 
ATOM   91   O  O   . ALA A 1 13  ? 36.604  21.473  34.428 1.00 30.48  ? 13   ALA A O   1 
ATOM   92   C  CB  . ALA A 1 13  ? 34.803  21.920  37.227 1.00 23.56  ? 13   ALA A CB  1 
ATOM   93   N  N   . TRP A 1 14  ? 35.156  23.188  34.421 1.00 25.26  ? 14   TRP A N   1 
ATOM   94   C  CA  . TRP A 1 14  ? 34.923  23.128  32.987 1.00 22.27  ? 14   TRP A CA  1 
ATOM   95   C  C   . TRP A 1 14  ? 36.162  23.525  32.192 1.00 31.00  ? 14   TRP A C   1 
ATOM   96   O  O   . TRP A 1 14  ? 36.321  23.150  31.030 1.00 37.52  ? 14   TRP A O   1 
ATOM   97   C  CB  . TRP A 1 14  ? 33.751  24.037  32.598 1.00 32.04  ? 14   TRP A CB  1 
ATOM   98   C  CG  . TRP A 1 14  ? 33.109  23.624  31.308 1.00 31.72  ? 14   TRP A CG  1 
ATOM   99   C  CD1 . TRP A 1 14  ? 33.179  24.278  30.113 1.00 32.65  ? 14   TRP A CD1 1 
ATOM   100  C  CD2 . TRP A 1 14  ? 32.305  22.459  31.089 1.00 29.87  ? 14   TRP A CD2 1 
ATOM   101  N  NE1 . TRP A 1 14  ? 32.462  23.593  29.161 1.00 33.25  ? 14   TRP A NE1 1 
ATOM   102  C  CE2 . TRP A 1 14  ? 31.918  22.473  29.733 1.00 42.20  ? 14   TRP A CE2 1 
ATOM   103  C  CE3 . TRP A 1 14  ? 31.874  21.409  31.902 1.00 44.13  ? 14   TRP A CE3 1 
ATOM   104  C  CZ2 . TRP A 1 14  ? 31.120  21.479  29.168 1.00 41.04  ? 14   TRP A CZ2 1 
ATOM   105  C  CZ3 . TRP A 1 14  ? 31.083  20.425  31.339 1.00 47.77  ? 14   TRP A CZ3 1 
ATOM   106  C  CH2 . TRP A 1 14  ? 30.713  20.463  29.992 1.00 47.69  ? 14   TRP A CH2 1 
ATOM   107  N  N   . GLY A 1 15  ? 37.041  24.299  32.826 1.00 31.49  ? 15   GLY A N   1 
ATOM   108  C  CA  . GLY A 1 15  ? 38.276  24.708  32.172 1.00 31.70  ? 15   GLY A CA  1 
ATOM   109  C  C   . GLY A 1 15  ? 39.208  23.513  32.046 1.00 38.45  ? 15   GLY A C   1 
ATOM   110  O  O   . GLY A 1 15  ? 39.842  23.325  31.017 1.00 36.84  ? 15   GLY A O   1 
ATOM   111  N  N   . LYS A 1 16  ? 39.257  22.711  33.105 1.00 44.32  ? 16   LYS A N   1 
ATOM   112  C  CA  . LYS A 1 16  ? 39.988  21.452  33.102 1.00 40.98  ? 16   LYS A CA  1 
ATOM   113  C  C   . LYS A 1 16  ? 39.406  20.485  32.075 1.00 38.92  ? 16   LYS A C   1 
ATOM   114  O  O   . LYS A 1 16  ? 40.141  19.762  31.400 1.00 48.83  ? 16   LYS A O   1 
ATOM   115  C  CB  . LYS A 1 16  ? 39.967  20.840  34.505 1.00 48.75  ? 16   LYS A CB  1 
ATOM   116  C  CG  . LYS A 1 16  ? 40.534  19.433  34.579 1.00 57.40  ? 16   LYS A CG  1 
ATOM   117  C  CD  . LYS A 1 16  ? 41.987  19.381  34.136 1.00 56.96  ? 16   LYS A CD  1 
ATOM   118  C  CE  . LYS A 1 16  ? 42.360  17.999  33.622 1.00 57.49  ? 16   LYS A CE  1 
ATOM   119  N  NZ  . LYS A 1 16  ? 43.520  17.425  34.362 1.00 67.09  ? 16   LYS A NZ  1 
ATOM   120  N  N   . VAL A 1 17  ? 38.084  20.461  31.944 1.00 35.97  ? 17   VAL A N   1 
ATOM   121  C  CA  . VAL A 1 17  ? 37.440  19.682  30.883 1.00 30.38  ? 17   VAL A CA  1 
ATOM   122  C  C   . VAL A 1 17  ? 38.067  20.059  29.544 1.00 35.39  ? 17   VAL A C   1 
ATOM   123  O  O   . VAL A 1 17  ? 38.518  19.221  28.766 1.00 30.30  ? 17   VAL A O   1 
ATOM   124  C  CB  . VAL A 1 17  ? 35.921  19.927  30.843 1.00 31.51  ? 17   VAL A CB  1 
ATOM   125  C  CG1 . VAL A 1 17  ? 35.385  19.642  29.449 1.00 37.03  ? 17   VAL A CG1 1 
ATOM   126  C  CG2 . VAL A 1 17  ? 35.190  19.093  31.891 1.00 22.25  ? 17   VAL A CG2 1 
ATOM   127  N  N   . GLY A 1 18  ? 38.127  21.366  29.299 1.00 37.47  ? 18   GLY A N   1 
ATOM   128  C  CA  . GLY A 1 18  ? 38.888  21.895  28.186 1.00 46.31  ? 18   GLY A CA  1 
ATOM   129  C  C   . GLY A 1 18  ? 38.520  21.314  26.841 1.00 41.14  ? 18   GLY A C   1 
ATOM   130  O  O   . GLY A 1 18  ? 37.374  21.409  26.407 1.00 29.61  ? 18   GLY A O   1 
ATOM   131  N  N   . ALA A 1 19  ? 39.485  20.715  26.144 1.00 31.43  ? 19   ALA A N   1 
ATOM   132  C  CA  . ALA A 1 19  ? 39.249  20.266  24.778 1.00 37.33  ? 19   ALA A CA  1 
ATOM   133  C  C   . ALA A 1 19  ? 38.554  18.912  24.733 1.00 34.94  ? 19   ALA A C   1 
ATOM   134  O  O   . ALA A 1 19  ? 38.249  18.410  23.647 1.00 31.05  ? 19   ALA A O   1 
ATOM   135  C  CB  . ALA A 1 19  ? 40.563  20.209  24.011 1.00 56.80  ? 19   ALA A CB  1 
ATOM   136  N  N   . HIS A 1 20  ? 38.301  18.328  25.904 1.00 26.02  ? 20   HIS A N   1 
ATOM   137  C  CA  . HIS A 1 20  ? 37.621  17.044  25.963 1.00 25.51  ? 20   HIS A CA  1 
ATOM   138  C  C   . HIS A 1 20  ? 36.103  17.166  26.061 1.00 31.02  ? 20   HIS A C   1 
ATOM   139  O  O   . HIS A 1 20  ? 35.449  16.126  26.185 1.00 25.27  ? 20   HIS A O   1 
ATOM   140  C  CB  . HIS A 1 20  ? 38.126  16.238  27.169 1.00 26.20  ? 20   HIS A CB  1 
ATOM   141  C  CG  . HIS A 1 20  ? 39.591  15.938  27.047 1.00 37.42  ? 20   HIS A CG  1 
ATOM   142  N  ND1 . HIS A 1 20  ? 40.076  15.009  26.156 1.00 37.21  ? 20   HIS A ND1 1 
ATOM   143  C  CD2 . HIS A 1 20  ? 40.670  16.454  27.676 1.00 46.98  ? 20   HIS A CD2 1 
ATOM   144  C  CE1 . HIS A 1 20  ? 41.393  14.952  26.250 1.00 43.49  ? 20   HIS A CE1 1 
ATOM   145  N  NE2 . HIS A 1 20  ? 41.778  15.820  27.169 1.00 49.25  ? 20   HIS A NE2 1 
ATOM   146  N  N   . ALA A 1 21  ? 35.552  18.368  26.030 1.00 32.51  ? 21   ALA A N   1 
ATOM   147  C  CA  . ALA A 1 21  ? 34.124  18.595  26.235 1.00 33.00  ? 21   ALA A CA  1 
ATOM   148  C  C   . ALA A 1 21  ? 33.265  17.674  25.373 1.00 37.61  ? 21   ALA A C   1 
ATOM   149  O  O   . ALA A 1 21  ? 32.365  16.993  25.873 1.00 25.18  ? 21   ALA A O   1 
ATOM   150  C  CB  . ALA A 1 21  ? 33.773  20.050  25.961 1.00 36.94  ? 21   ALA A CB  1 
ATOM   151  N  N   . GLY A 1 22  ? 33.553  17.643  24.075 1.00 33.05  ? 22   GLY A N   1 
ATOM   152  C  CA  . GLY A 1 22  ? 32.850  16.806  23.130 1.00 28.86  ? 22   GLY A CA  1 
ATOM   153  C  C   . GLY A 1 22  ? 32.853  15.333  23.457 1.00 30.59  ? 22   GLY A C   1 
ATOM   154  O  O   . GLY A 1 22  ? 31.801  14.688  23.466 1.00 25.68  ? 22   GLY A O   1 
ATOM   155  N  N   . GLU A 1 23  ? 34.028  14.780  23.726 1.00 22.86  ? 23   GLU A N   1 
ATOM   156  C  CA  . GLU A 1 23  ? 34.182  13.382  24.093 1.00 21.01  ? 23   GLU A CA  1 
ATOM   157  C  C   . GLU A 1 23  ? 33.417  13.056  25.367 1.00 24.75  ? 23   GLU A C   1 
ATOM   158  O  O   . GLU A 1 23  ? 32.769  12.016  25.513 1.00 21.23  ? 23   GLU A O   1 
ATOM   159  C  CB  . GLU A 1 23  ? 35.672  13.081  24.286 1.00 24.28  ? 23   GLU A CB  1 
ATOM   160  C  CG  . GLU A 1 23  ? 35.987  11.757  24.956 1.00 35.22  ? 23   GLU A CG  1 
ATOM   161  C  CD  . GLU A 1 23  ? 37.395  11.266  24.670 1.00 61.40  ? 23   GLU A CD  1 
ATOM   162  O  OE1 . GLU A 1 23  ? 38.167  12.005  24.019 1.00 93.11  ? 23   GLU A OE1 1 
ATOM   163  O  OE2 . GLU A 1 23  ? 37.743  10.140  25.087 1.00 61.54  ? 23   GLU A OE2 1 
ATOM   164  N  N   . TYR A 1 24  ? 33.493  13.953  26.354 1.00 23.16  ? 24   TYR A N   1 
ATOM   165  C  CA  . TYR A 1 24  ? 32.759  13.684  27.590 1.00 18.26  ? 24   TYR A CA  1 
ATOM   166  C  C   . TYR A 1 24  ? 31.250  13.790  27.373 1.00 17.37  ? 24   TYR A C   1 
ATOM   167  O  O   . TYR A 1 24  ? 30.481  13.050  27.990 1.00 17.96  ? 24   TYR A O   1 
ATOM   168  C  CB  . TYR A 1 24  ? 33.157  14.641  28.710 1.00 23.36  ? 24   TYR A CB  1 
ATOM   169  C  CG  . TYR A 1 24  ? 34.608  14.521  29.133 1.00 23.80  ? 24   TYR A CG  1 
ATOM   170  C  CD1 . TYR A 1 24  ? 35.424  13.530  28.605 1.00 15.98  ? 24   TYR A CD1 1 
ATOM   171  C  CD2 . TYR A 1 24  ? 35.126  15.422  30.058 1.00 26.26  ? 24   TYR A CD2 1 
ATOM   172  C  CE1 . TYR A 1 24  ? 36.752  13.434  29.000 1.00 21.99  ? 24   TYR A CE1 1 
ATOM   173  C  CE2 . TYR A 1 24  ? 36.453  15.327  30.449 1.00 22.22  ? 24   TYR A CE2 1 
ATOM   174  C  CZ  . TYR A 1 24  ? 37.244  14.336  29.918 1.00 27.27  ? 24   TYR A CZ  1 
ATOM   175  O  OH  . TYR A 1 24  ? 38.561  14.255  30.315 1.00 32.00  ? 24   TYR A OH  1 
ATOM   176  N  N   . GLY A 1 25  ? 30.840  14.714  26.513 1.00 18.65  ? 25   GLY A N   1 
ATOM   177  C  CA  . GLY A 1 25  ? 29.431  14.828  26.150 1.00 20.03  ? 25   GLY A CA  1 
ATOM   178  C  C   . GLY A 1 25  ? 28.926  13.554  25.504 1.00 16.86  ? 25   GLY A C   1 
ATOM   179  O  O   . GLY A 1 25  ? 27.827  13.075  25.791 1.00 16.87  ? 25   GLY A O   1 
ATOM   180  N  N   . ALA A 1 26  ? 29.715  12.956  24.609 1.00 16.82  ? 26   ALA A N   1 
ATOM   181  C  CA  . ALA A 1 26  ? 29.334  11.670  24.035 1.00 21.09  ? 26   ALA A CA  1 
ATOM   182  C  C   . ALA A 1 26  ? 29.277  10.558  25.074 1.00 18.73  ? 26   ALA A C   1 
ATOM   183  O  O   . ALA A 1 26  ? 28.411  9.676   25.043 1.00 17.25  ? 26   ALA A O   1 
ATOM   184  C  CB  . ALA A 1 26  ? 30.313  11.281  22.932 1.00 28.57  ? 26   ALA A CB  1 
ATOM   185  N  N   . GLU A 1 27  ? 30.223  10.560  26.008 1.00 16.54  ? 27   GLU A N   1 
ATOM   186  C  CA  . GLU A 1 27  ? 30.225  9.531   27.050 1.00 16.04  ? 27   GLU A CA  1 
ATOM   187  C  C   . GLU A 1 27  ? 29.013  9.659   27.963 1.00 12.95  ? 27   GLU A C   1 
ATOM   188  O  O   . GLU A 1 27  ? 28.369  8.669   28.314 1.00 15.60  ? 27   GLU A O   1 
ATOM   189  C  CB  . GLU A 1 27  ? 31.527  9.629   27.857 1.00 17.68  ? 27   GLU A CB  1 
ATOM   190  C  CG  . GLU A 1 27  ? 31.674  8.560   28.924 1.00 17.71  ? 27   GLU A CG  1 
ATOM   191  C  CD  . GLU A 1 27  ? 32.923  8.719   29.771 1.00 28.08  ? 27   GLU A CD  1 
ATOM   192  O  OE1 . GLU A 1 27  ? 33.958  9.193   29.251 1.00 22.59  ? 27   GLU A OE1 1 
ATOM   193  O  OE2 . GLU A 1 27  ? 32.884  8.366   30.968 1.00 22.17  ? 27   GLU A OE2 1 
ATOM   194  N  N   . ALA A 1 28  ? 28.682  10.884  28.343 1.00 16.03  ? 28   ALA A N   1 
ATOM   195  C  CA  . ALA A 1 28  ? 27.500  11.151  29.156 1.00 18.25  ? 28   ALA A CA  1 
ATOM   196  C  C   . ALA A 1 28  ? 26.232  10.609  28.506 1.00 21.61  ? 28   ALA A C   1 
ATOM   197  O  O   . ALA A 1 28  ? 25.390  10.010  29.176 1.00 13.54  ? 28   ALA A O   1 
ATOM   198  C  CB  . ALA A 1 28  ? 27.379  12.651  29.392 1.00 21.29  ? 28   ALA A CB  1 
ATOM   199  N  N   . LEU A 1 29  ? 26.073  10.811  27.198 1.00 16.97  ? 29   LEU A N   1 
ATOM   200  C  CA  . LEU A 1 29  ? 24.904  10.270  26.505 1.00 13.03  ? 29   LEU A CA  1 
ATOM   201  C  C   . LEU A 1 29  ? 24.879  8.754   26.534 1.00 15.79  ? 29   LEU A C   1 
ATOM   202  O  O   . LEU A 1 29  ? 23.842  8.131   26.793 1.00 19.37  ? 29   LEU A O   1 
ATOM   203  C  CB  . LEU A 1 29  ? 24.897  10.791  25.058 1.00 14.34  ? 29   LEU A CB  1 
ATOM   204  C  CG  . LEU A 1 29  ? 24.690  12.297  24.901 1.00 17.07  ? 29   LEU A CG  1 
ATOM   205  C  CD1 . LEU A 1 29  ? 24.957  12.736  23.467 1.00 28.22  ? 29   LEU A CD1 1 
ATOM   206  C  CD2 . LEU A 1 29  ? 23.277  12.704  25.306 1.00 23.34  ? 29   LEU A CD2 1 
ATOM   207  N  N   . GLU A 1 30  ? 26.024  8.138   26.248 1.00 15.86  ? 30   GLU A N   1 
ATOM   208  C  CA  . GLU A 1 30  ? 26.127  6.691   26.230 1.00 16.64  ? 30   GLU A CA  1 
ATOM   209  C  C   . GLU A 1 30  ? 25.740  6.119   27.592 1.00 20.87  ? 30   GLU A C   1 
ATOM   210  O  O   . GLU A 1 30  ? 25.010  5.140   27.675 1.00 18.08  ? 30   GLU A O   1 
ATOM   211  C  CB  . GLU A 1 30  ? 27.539  6.223   25.869 1.00 14.07  ? 30   GLU A CB  1 
ATOM   212  C  CG  . GLU A 1 30  ? 27.716  4.726   26.056 1.00 27.88  ? 30   GLU A CG  1 
ATOM   213  C  CD  . GLU A 1 30  ? 28.856  4.168   25.222 1.00 44.53  ? 30   GLU A CD  1 
ATOM   214  O  OE1 . GLU A 1 30  ? 29.940  4.787   25.213 1.00 62.28  ? 30   GLU A OE1 1 
ATOM   215  O  OE2 . GLU A 1 30  ? 28.653  3.114   24.584 1.00 42.88  ? 30   GLU A OE2 1 
ATOM   216  N  N   . ARG A 1 31  ? 26.262  6.758   28.637 1.00 15.66  ? 31   ARG A N   1 
ATOM   217  C  CA  . ARG A 1 31  ? 25.919  6.349   29.999 1.00 16.81  ? 31   ARG A CA  1 
ATOM   218  C  C   . ARG A 1 31  ? 24.408  6.453   30.192 1.00 16.24  ? 31   ARG A C   1 
ATOM   219  O  O   . ARG A 1 31  ? 23.802  5.570   30.803 1.00 15.47  ? 31   ARG A O   1 
ATOM   220  C  CB  . ARG A 1 31  ? 26.669  7.174   31.054 1.00 13.58  ? 31   ARG A CB  1 
ATOM   221  C  CG  . ARG A 1 31  ? 28.165  6.827   31.114 1.00 12.11  ? 31   ARG A CG  1 
ATOM   222  C  CD  . ARG A 1 31  ? 28.879  7.760   32.102 1.00 18.33  ? 31   ARG A CD  1 
ATOM   223  N  NE  . ARG A 1 31  ? 30.308  7.438   32.172 1.00 18.26  ? 31   ARG A NE  1 
ATOM   224  C  CZ  . ARG A 1 31  ? 30.808  6.409   32.845 1.00 16.72  ? 31   ARG A CZ  1 
ATOM   225  N  NH1 . ARG A 1 31  ? 30.046  5.574   33.546 1.00 14.68  ? 31   ARG A NH1 1 
ATOM   226  N  NH2 . ARG A 1 31  ? 32.123  6.210   32.815 1.00 16.90  ? 31   ARG A NH2 1 
ATOM   227  N  N   . MET A 1 32  ? 23.815  7.517   29.672 1.00 12.50  ? 32   MET A N   1 
ATOM   228  C  CA  . MET A 1 32  ? 22.376  7.741   29.875 1.00 11.37  ? 32   MET A CA  1 
ATOM   229  C  C   . MET A 1 32  ? 21.540  6.707   29.147 1.00 15.61  ? 32   MET A C   1 
ATOM   230  O  O   . MET A 1 32  ? 20.591  6.117   29.669 1.00 14.61  ? 32   MET A O   1 
ATOM   231  C  CB  . MET A 1 32  ? 21.995  9.150   29.397 1.00 11.02  ? 32   MET A CB  1 
ATOM   232  C  CG  . MET A 1 32  ? 20.501  9.438   29.578 1.00 13.95  ? 32   MET A CG  1 
ATOM   233  S  SD  . MET A 1 32  ? 20.043  11.062  28.934 1.00 17.31  ? 32   MET A SD  1 
ATOM   234  C  CE  . MET A 1 32  ? 20.245  10.784  27.185 1.00 15.19  ? 32   MET A CE  1 
ATOM   235  N  N   . PHE A 1 33  ? 21.870  6.450   27.876 1.00 14.77  ? 33   PHE A N   1 
ATOM   236  C  CA  . PHE A 1 33  ? 21.085  5.443   27.162 1.00 15.63  ? 33   PHE A CA  1 
ATOM   237  C  C   . PHE A 1 33  ? 21.164  4.072   27.804 1.00 16.35  ? 33   PHE A C   1 
ATOM   238  O  O   . PHE A 1 33  ? 20.204  3.292   27.736 1.00 17.23  ? 33   PHE A O   1 
ATOM   239  C  CB  . PHE A 1 33  ? 21.538  5.321   25.701 1.00 13.98  ? 33   PHE A CB  1 
ATOM   240  C  CG  . PHE A 1 33  ? 21.390  6.609   24.914 1.00 12.30  ? 33   PHE A CG  1 
ATOM   241  C  CD1 . PHE A 1 33  ? 20.322  7.457   25.096 1.00 15.17  ? 33   PHE A CD1 1 
ATOM   242  C  CD2 . PHE A 1 33  ? 22.362  6.937   23.972 1.00 21.04  ? 33   PHE A CD2 1 
ATOM   243  C  CE1 . PHE A 1 33  ? 20.206  8.623   24.354 1.00 19.84  ? 33   PHE A CE1 1 
ATOM   244  C  CE2 . PHE A 1 33  ? 22.258  8.104   23.237 1.00 21.12  ? 33   PHE A CE2 1 
ATOM   245  C  CZ  . PHE A 1 33  ? 21.185  8.946   23.430 1.00 16.37  ? 33   PHE A CZ  1 
ATOM   246  N  N   . LEU A 1 34  ? 22.318  3.748   28.393 1.00 13.49  ? 34   LEU A N   1 
ATOM   247  C  CA  . LEU A 1 34  ? 22.479  2.435   28.995 1.00 13.10  ? 34   LEU A CA  1 
ATOM   248  C  C   . LEU A 1 34  ? 21.775  2.345   30.350 1.00 15.79  ? 34   LEU A C   1 
ATOM   249  O  O   . LEU A 1 34  ? 21.168  1.320   30.660 1.00 19.05  ? 34   LEU A O   1 
ATOM   250  C  CB  . LEU A 1 34  ? 23.971  2.145   29.205 1.00 17.27  ? 34   LEU A CB  1 
ATOM   251  C  CG  . LEU A 1 34  ? 24.725  1.562   28.009 1.00 27.82  ? 34   LEU A CG  1 
ATOM   252  C  CD1 . LEU A 1 34  ? 26.204  1.405   28.337 1.00 19.55  ? 34   LEU A CD1 1 
ATOM   253  C  CD2 . LEU A 1 34  ? 24.139  0.223   27.589 1.00 24.86  ? 34   LEU A CD2 1 
ATOM   254  N  N   . SER A 1 35  ? 21.879  3.384   31.171 1.00 16.20  ? 35   SER A N   1 
ATOM   255  C  CA  . SER A 1 35  ? 21.389  3.347   32.545 1.00 17.08  ? 35   SER A CA  1 
ATOM   256  C  C   . SER A 1 35  ? 19.896  3.671   32.650 1.00 19.27  ? 35   SER A C   1 
ATOM   257  O  O   . SER A 1 35  ? 19.216  3.209   33.570 1.00 21.82  ? 35   SER A O   1 
ATOM   258  C  CB  . SER A 1 35  ? 22.123  4.342   33.447 1.00 15.99  ? 35   SER A CB  1 
ATOM   259  O  OG  . SER A 1 35  ? 23.505  4.021   33.527 1.00 22.27  ? 35   SER A OG  1 
ATOM   260  N  N   . PHE A 1 36  ? 19.438  4.494   31.721 1.00 14.23  ? 36   PHE A N   1 
ATOM   261  C  CA  . PHE A 1 36  ? 18.064  4.952   31.659 1.00 16.22  ? 36   PHE A CA  1 
ATOM   262  C  C   . PHE A 1 36  ? 17.512  4.744   30.244 1.00 12.15  ? 36   PHE A C   1 
ATOM   263  O  O   . PHE A 1 36  ? 17.376  5.712   29.509 1.00 15.84  ? 36   PHE A O   1 
ATOM   264  C  CB  . PHE A 1 36  ? 17.982  6.444   32.022 1.00 15.37  ? 36   PHE A CB  1 
ATOM   265  C  CG  . PHE A 1 36  ? 18.665  6.717   33.363 1.00 17.70  ? 36   PHE A CG  1 
ATOM   266  C  CD1 . PHE A 1 36  ? 18.092  6.275   34.536 1.00 22.90  ? 36   PHE A CD1 1 
ATOM   267  C  CD2 . PHE A 1 36  ? 19.879  7.386   33.404 1.00 19.29  ? 36   PHE A CD2 1 
ATOM   268  C  CE1 . PHE A 1 36  ? 18.715  6.481   35.755 1.00 29.71  ? 36   PHE A CE1 1 
ATOM   269  C  CE2 . PHE A 1 36  ? 20.504  7.604   34.620 1.00 25.16  ? 36   PHE A CE2 1 
ATOM   270  C  CZ  . PHE A 1 36  ? 19.928  7.138   35.787 1.00 27.00  ? 36   PHE A CZ  1 
ATOM   271  N  N   . PRO A 1 37  ? 17.179  3.507   29.922 1.00 15.89  ? 37   PRO A N   1 
ATOM   272  C  CA  . PRO A 1 37  ? 16.773  3.164   28.560 1.00 19.64  ? 37   PRO A CA  1 
ATOM   273  C  C   . PRO A 1 37  ? 15.553  3.933   28.067 1.00 16.80  ? 37   PRO A C   1 
ATOM   274  O  O   . PRO A 1 37  ? 15.361  4.092   26.855 1.00 17.14  ? 37   PRO A O   1 
ATOM   275  C  CB  . PRO A 1 37  ? 16.446  1.677   28.639 1.00 19.49  ? 37   PRO A CB  1 
ATOM   276  C  CG  . PRO A 1 37  ? 16.762  1.204   30.004 1.00 22.15  ? 37   PRO A CG  1 
ATOM   277  C  CD  . PRO A 1 37  ? 17.158  2.366   30.851 1.00 20.10  ? 37   PRO A CD  1 
ATOM   278  N  N   . THR A 1 38  ? 14.704  4.428   28.966 1.00 14.82  ? 38   THR A N   1 
ATOM   279  C  CA  . THR A 1 38  ? 13.543  5.175   28.463 1.00 16.01  ? 38   THR A CA  1 
ATOM   280  C  C   . THR A 1 38  ? 13.966  6.429   27.718 1.00 15.78  ? 38   THR A C   1 
ATOM   281  O  O   . THR A 1 38  ? 13.237  6.957   26.884 1.00 17.27  ? 38   THR A O   1 
ATOM   282  C  CB  . THR A 1 38  ? 12.572  5.556   29.593 1.00 17.42  ? 38   THR A CB  1 
ATOM   283  O  OG1 . THR A 1 38  ? 13.259  6.389   30.528 1.00 18.01  ? 38   THR A OG1 1 
ATOM   284  C  CG2 . THR A 1 38  ? 12.086  4.315   30.327 1.00 20.50  ? 38   THR A CG2 1 
ATOM   285  N  N   . THR A 1 39  ? 15.179  6.935   27.955 1.00 16.58  ? 39   THR A N   1 
ATOM   286  C  CA  . THR A 1 39  ? 15.610  8.128   27.225 1.00 14.88  ? 39   THR A CA  1 
ATOM   287  C  C   . THR A 1 39  ? 15.885  7.849   25.746 1.00 12.93  ? 39   THR A C   1 
ATOM   288  O  O   . THR A 1 39  ? 15.919  8.807   24.974 1.00 15.10  ? 39   THR A O   1 
ATOM   289  C  CB  . THR A 1 39  ? 16.857  8.755   27.872 1.00 15.60  ? 39   THR A CB  1 
ATOM   290  O  OG1 . THR A 1 39  ? 17.920  7.784   27.882 1.00 14.98  ? 39   THR A OG1 1 
ATOM   291  C  CG2 . THR A 1 39  ? 16.582  9.079   29.337 1.00 16.02  ? 39   THR A CG2 1 
ATOM   292  N  N   . LYS A 1 40  ? 16.008  6.584   25.368 1.00 12.57  ? 40   LYS A N   1 
ATOM   293  C  CA  . LYS A 1 40  ? 16.197  6.234   23.961 1.00 11.89  ? 40   LYS A CA  1 
ATOM   294  C  C   . LYS A 1 40  ? 14.939  6.516   23.154 1.00 19.76  ? 40   LYS A C   1 
ATOM   295  O  O   . LYS A 1 40  ? 14.959  6.550   21.922 1.00 17.12  ? 40   LYS A O   1 
ATOM   296  C  CB  . LYS A 1 40  ? 16.616  4.763   23.807 1.00 14.11  ? 40   LYS A CB  1 
ATOM   297  C  CG  . LYS A 1 40  ? 17.939  4.472   24.507 1.00 17.05  ? 40   LYS A CG  1 
ATOM   298  C  CD  . LYS A 1 40  ? 18.454  3.090   24.171 1.00 25.72  ? 40   LYS A CD  1 
ATOM   299  C  CE  . LYS A 1 40  ? 17.569  1.982   24.711 1.00 20.44  ? 40   LYS A CE  1 
ATOM   300  N  NZ  . LYS A 1 40  ? 18.144  0.637   24.371 1.00 22.10  ? 40   LYS A NZ  1 
ATOM   301  N  N   . THR A 1 41  ? 13.804  6.702   23.836 1.00 15.48  ? 41   THR A N   1 
ATOM   302  C  CA  . THR A 1 41  ? 12.580  6.956   23.085 1.00 14.72  ? 41   THR A CA  1 
ATOM   303  C  C   . THR A 1 41  ? 12.649  8.278   22.328 1.00 21.16  ? 41   THR A C   1 
ATOM   304  O  O   . THR A 1 41  ? 11.857  8.459   21.396 1.00 17.19  ? 41   THR A O   1 
ATOM   305  C  CB  . THR A 1 41  ? 11.312  6.955   23.972 1.00 15.45  ? 41   THR A CB  1 
ATOM   306  O  OG1 . THR A 1 41  ? 11.354  8.005   24.942 1.00 15.89  ? 41   THR A OG1 1 
ATOM   307  C  CG2 . THR A 1 41  ? 11.188  5.641   24.723 1.00 21.46  ? 41   THR A CG2 1 
ATOM   308  N  N   . TYR A 1 42  ? 13.546  9.197   22.683 1.00 13.88  ? 42   TYR A N   1 
ATOM   309  C  CA  . TYR A 1 42  ? 13.692  10.476  22.009 1.00 14.60  ? 42   TYR A CA  1 
ATOM   310  C  C   . TYR A 1 42  ? 14.633  10.430  20.806 1.00 16.89  ? 42   TYR A C   1 
ATOM   311  O  O   . TYR A 1 42  ? 14.756  11.439  20.098 1.00 17.94  ? 42   TYR A O   1 
ATOM   312  C  CB  . TYR A 1 42  ? 14.185  11.540  23.016 1.00 14.89  ? 42   TYR A CB  1 
ATOM   313  C  CG  . TYR A 1 42  ? 13.093  11.790  24.051 1.00 16.64  ? 42   TYR A CG  1 
ATOM   314  C  CD1 . TYR A 1 42  ? 12.003  12.576  23.707 1.00 20.71  ? 42   TYR A CD1 1 
ATOM   315  C  CD2 . TYR A 1 42  ? 13.150  11.243  25.327 1.00 16.62  ? 42   TYR A CD2 1 
ATOM   316  C  CE1 . TYR A 1 42  ? 10.985  12.823  24.614 1.00 21.39  ? 42   TYR A CE1 1 
ATOM   317  C  CE2 . TYR A 1 42  ? 12.126  11.490  26.241 1.00 13.43  ? 42   TYR A CE2 1 
ATOM   318  C  CZ  . TYR A 1 42  ? 11.056  12.271  25.874 1.00 14.81  ? 42   TYR A CZ  1 
ATOM   319  O  OH  . TYR A 1 42  ? 10.036  12.536  26.768 1.00 16.16  ? 42   TYR A OH  1 
ATOM   320  N  N   . PHE A 1 43  ? 15.315  9.309   20.605 1.00 17.20  ? 43   PHE A N   1 
ATOM   321  C  CA  . PHE A 1 43  ? 16.300  9.183   19.535 1.00 19.62  ? 43   PHE A CA  1 
ATOM   322  C  C   . PHE A 1 43  ? 16.086  7.972   18.642 1.00 16.66  ? 43   PHE A C   1 
ATOM   323  O  O   . PHE A 1 43  ? 17.051  7.262   18.307 1.00 18.39  ? 43   PHE A O   1 
ATOM   324  C  CB  . PHE A 1 43  ? 17.707  9.079   20.136 1.00 15.86  ? 43   PHE A CB  1 
ATOM   325  C  CG  . PHE A 1 43  ? 18.086  10.259  21.014 1.00 26.78  ? 43   PHE A CG  1 
ATOM   326  C  CD1 . PHE A 1 43  ? 17.700  10.275  22.347 1.00 22.44  ? 43   PHE A CD1 1 
ATOM   327  C  CD2 . PHE A 1 43  ? 18.814  11.324  20.514 1.00 25.08  ? 43   PHE A CD2 1 
ATOM   328  C  CE1 . PHE A 1 43  ? 18.049  11.351  23.139 1.00 19.30  ? 43   PHE A CE1 1 
ATOM   329  C  CE2 . PHE A 1 43  ? 19.166  12.400  21.309 1.00 26.34  ? 43   PHE A CE2 1 
ATOM   330  C  CZ  . PHE A 1 43  ? 18.779  12.406  22.644 1.00 18.16  ? 43   PHE A CZ  1 
ATOM   331  N  N   . PRO A 1 44  ? 14.874  7.702   18.193 1.00 14.13  ? 44   PRO A N   1 
ATOM   332  C  CA  . PRO A 1 44  ? 14.699  6.459   17.423 1.00 18.20  ? 44   PRO A CA  1 
ATOM   333  C  C   . PRO A 1 44  ? 15.280  6.631   16.020 1.00 21.08  ? 44   PRO A C   1 
ATOM   334  O  O   . PRO A 1 44  ? 15.440  5.665   15.278 1.00 24.79  ? 44   PRO A O   1 
ATOM   335  C  CB  . PRO A 1 44  ? 13.176  6.321   17.393 1.00 22.09  ? 44   PRO A CB  1 
ATOM   336  C  CG  . PRO A 1 44  ? 12.710  7.742   17.329 1.00 22.28  ? 44   PRO A CG  1 
ATOM   337  C  CD  . PRO A 1 44  ? 13.625  8.475   18.281 1.00 21.52  ? 44   PRO A CD  1 
ATOM   338  N  N   . HIS A 1 45  ? 15.608  7.869   15.673 1.00 18.14  ? 45   HIS A N   1 
ATOM   339  C  CA  . HIS A 1 45  ? 16.218  8.232   14.406 1.00 18.39  ? 45   HIS A CA  1 
ATOM   340  C  C   . HIS A 1 45  ? 17.744  8.245   14.430 1.00 26.65  ? 45   HIS A C   1 
ATOM   341  O  O   . HIS A 1 45  ? 18.364  8.621   13.422 1.00 23.62  ? 45   HIS A O   1 
ATOM   342  C  CB  . HIS A 1 45  ? 15.724  9.606   13.934 1.00 20.98  ? 45   HIS A CB  1 
ATOM   343  C  CG  . HIS A 1 45  ? 16.067  10.742  14.847 1.00 23.39  ? 45   HIS A CG  1 
ATOM   344  N  ND1 . HIS A 1 45  ? 15.673  10.758  16.172 1.00 25.52  ? 45   HIS A ND1 1 
ATOM   345  C  CD2 . HIS A 1 45  ? 16.734  11.899  14.648 1.00 23.06  ? 45   HIS A CD2 1 
ATOM   346  C  CE1 . HIS A 1 45  ? 16.102  11.871  16.740 1.00 24.90  ? 45   HIS A CE1 1 
ATOM   347  N  NE2 . HIS A 1 45  ? 16.749  12.590  15.836 1.00 21.43  ? 45   HIS A NE2 1 
ATOM   348  N  N   . PHE A 1 46  ? 18.377  7.852   15.532 1.00 19.38  ? 46   PHE A N   1 
ATOM   349  C  CA  . PHE A 1 46  ? 19.824  7.703   15.579 1.00 19.94  ? 46   PHE A CA  1 
ATOM   350  C  C   . PHE A 1 46  ? 20.240  6.232   15.596 1.00 21.80  ? 46   PHE A C   1 
ATOM   351  O  O   . PHE A 1 46  ? 19.556  5.405   16.193 1.00 17.84  ? 46   PHE A O   1 
ATOM   352  C  CB  . PHE A 1 46  ? 20.442  8.299   16.844 1.00 17.20  ? 46   PHE A CB  1 
ATOM   353  C  CG  . PHE A 1 46  ? 20.643  9.799   16.880 1.00 20.26  ? 46   PHE A CG  1 
ATOM   354  C  CD1 . PHE A 1 46  ? 20.002  10.641  15.995 1.00 22.58  ? 46   PHE A CD1 1 
ATOM   355  C  CD2 . PHE A 1 46  ? 21.499  10.348  17.826 1.00 23.83  ? 46   PHE A CD2 1 
ATOM   356  C  CE1 . PHE A 1 46  ? 20.201  12.010  16.054 1.00 22.08  ? 46   PHE A CE1 1 
ATOM   357  C  CE2 . PHE A 1 46  ? 21.702  11.714  17.893 1.00 25.50  ? 46   PHE A CE2 1 
ATOM   358  C  CZ  . PHE A 1 46  ? 21.061  12.546  16.991 1.00 26.42  ? 46   PHE A CZ  1 
ATOM   359  N  N   . ASP A 1 47  ? 21.394  5.985   14.992 1.00 25.96  ? 47   ASP A N   1 
ATOM   360  C  CA  . ASP A 1 47  ? 22.217  4.828   15.313 1.00 27.08  ? 47   ASP A CA  1 
ATOM   361  C  C   . ASP A 1 47  ? 22.815  5.061   16.701 1.00 18.35  ? 47   ASP A C   1 
ATOM   362  O  O   . ASP A 1 47  ? 23.662  5.938   16.856 1.00 23.48  ? 47   ASP A O   1 
ATOM   363  C  CB  . ASP A 1 47  ? 23.343  4.619   14.304 1.00 31.02  ? 47   ASP A CB  1 
ATOM   364  C  CG  . ASP A 1 47  ? 24.143  3.355   14.554 1.00 30.90  ? 47   ASP A CG  1 
ATOM   365  O  OD1 . ASP A 1 47  ? 23.762  2.563   15.436 1.00 32.15  ? 47   ASP A OD1 1 
ATOM   366  O  OD2 . ASP A 1 47  ? 25.159  3.135   13.861 1.00 31.69  ? 47   ASP A OD2 1 
ATOM   367  N  N   . LEU A 1 48  ? 22.318  4.314   17.675 1.00 21.72  ? 48   LEU A N   1 
ATOM   368  C  CA  . LEU A 1 48  ? 22.766  4.477   19.050 1.00 22.71  ? 48   LEU A CA  1 
ATOM   369  C  C   . LEU A 1 48  ? 23.878  3.510   19.407 1.00 29.68  ? 48   LEU A C   1 
ATOM   370  O  O   . LEU A 1 48  ? 24.207  3.347   20.585 1.00 31.21  ? 48   LEU A O   1 
ATOM   371  C  CB  . LEU A 1 48  ? 21.558  4.280   19.983 1.00 21.66  ? 48   LEU A CB  1 
ATOM   372  C  CG  . LEU A 1 48  ? 20.561  5.451   19.878 1.00 23.88  ? 48   LEU A CG  1 
ATOM   373  C  CD1 . LEU A 1 48  ? 19.364  5.222   20.784 1.00 30.43  ? 48   LEU A CD1 1 
ATOM   374  C  CD2 . LEU A 1 48  ? 21.262  6.761   20.180 1.00 26.97  ? 48   LEU A CD2 1 
ATOM   375  N  N   . SER A 1 49  ? 24.471  2.870   18.400 1.00 24.17  ? 49   SER A N   1 
ATOM   376  C  CA  . SER A 1 49  ? 25.604  1.984   18.700 1.00 28.46  ? 49   SER A CA  1 
ATOM   377  C  C   . SER A 1 49  ? 26.775  2.775   19.265 1.00 32.42  ? 49   SER A C   1 
ATOM   378  O  O   . SER A 1 49  ? 26.963  3.970   19.015 1.00 26.77  ? 49   SER A O   1 
ATOM   379  C  CB  . SER A 1 49  ? 26.022  1.190   17.462 1.00 24.96  ? 49   SER A CB  1 
ATOM   380  O  OG  . SER A 1 49  ? 26.785  1.989   16.577 1.00 46.42  ? 49   SER A OG  1 
ATOM   381  N  N   . HIS A 1 50  ? 27.600  2.084   20.059 1.00 26.90  ? 50   HIS A N   1 
ATOM   382  C  CA  . HIS A 1 50  ? 28.777  2.720   20.632 1.00 29.12  ? 50   HIS A CA  1 
ATOM   383  C  C   . HIS A 1 50  ? 29.659  3.349   19.561 1.00 28.00  ? 50   HIS A C   1 
ATOM   384  O  O   . HIS A 1 50  ? 29.974  2.706   18.559 1.00 35.67  ? 50   HIS A O   1 
ATOM   385  C  CB  . HIS A 1 50  ? 29.603  1.694   21.421 1.00 34.05  ? 50   HIS A CB  1 
ATOM   386  C  CG  . HIS A 1 50  ? 30.875  2.260   21.975 1.00 31.31  ? 50   HIS A CG  1 
ATOM   387  N  ND1 . HIS A 1 50  ? 30.899  3.146   23.030 1.00 30.93  ? 50   HIS A ND1 1 
ATOM   388  C  CD2 . HIS A 1 50  ? 32.167  2.072   21.622 1.00 41.59  ? 50   HIS A CD2 1 
ATOM   389  C  CE1 . HIS A 1 50  ? 32.147  3.482   23.303 1.00 39.00  ? 50   HIS A CE1 1 
ATOM   390  N  NE2 . HIS A 1 50  ? 32.939  2.842   22.461 1.00 42.38  ? 50   HIS A NE2 1 
ATOM   391  N  N   . GLY A 1 51  ? 30.078  4.584   19.767 1.00 25.91  ? 51   GLY A N   1 
ATOM   392  C  CA  . GLY A 1 51  ? 30.999  5.283   18.895 1.00 34.47  ? 51   GLY A CA  1 
ATOM   393  C  C   . GLY A 1 51  ? 30.381  5.844   17.635 1.00 35.14  ? 51   GLY A C   1 
ATOM   394  O  O   . GLY A 1 51  ? 31.090  6.320   16.741 1.00 25.49  ? 51   GLY A O   1 
ATOM   395  N  N   . SER A 1 52  ? 29.055  5.806   17.513 1.00 25.20  ? 52   SER A N   1 
ATOM   396  C  CA  . SER A 1 52  ? 28.427  6.238   16.262 1.00 24.98  ? 52   SER A CA  1 
ATOM   397  C  C   . SER A 1 52  ? 28.607  7.727   16.034 1.00 23.38  ? 52   SER A C   1 
ATOM   398  O  O   . SER A 1 52  ? 28.671  8.520   16.975 1.00 24.29  ? 52   SER A O   1 
ATOM   399  C  CB  . SER A 1 52  ? 26.944  5.852   16.263 1.00 30.35  ? 52   SER A CB  1 
ATOM   400  O  OG  . SER A 1 52  ? 26.172  6.842   16.918 1.00 25.87  ? 52   SER A OG  1 
ATOM   401  N  N   . ALA A 1 53  ? 28.693  8.142   14.766 1.00 21.82  ? 53   ALA A N   1 
ATOM   402  C  CA  . ALA A 1 53  ? 28.966  9.543   14.477 1.00 22.42  ? 53   ALA A CA  1 
ATOM   403  C  C   . ALA A 1 53  ? 27.834  10.437  14.965 1.00 16.36  ? 53   ALA A C   1 
ATOM   404  O  O   . ALA A 1 53  ? 28.048  11.599  15.305 1.00 23.48  ? 53   ALA A O   1 
ATOM   405  C  CB  . ALA A 1 53  ? 29.201  9.748   12.980 1.00 23.59  ? 53   ALA A CB  1 
ATOM   406  N  N   . GLN A 1 54  ? 26.617  9.893   14.975 1.00 19.10  ? 54   GLN A N   1 
ATOM   407  C  CA  . GLN A 1 54  ? 25.472  10.703  15.388 1.00 14.68  ? 54   GLN A CA  1 
ATOM   408  C  C   . GLN A 1 54  ? 25.560  11.021  16.880 1.00 19.22  ? 54   GLN A C   1 
ATOM   409  O  O   . GLN A 1 54  ? 25.257  12.146  17.268 1.00 23.30  ? 54   GLN A O   1 
ATOM   410  C  CB  . GLN A 1 54  ? 24.156  9.994   15.075 1.00 23.10  ? 54   GLN A CB  1 
ATOM   411  C  CG  . GLN A 1 54  ? 23.762  10.058  13.596 1.00 20.02  ? 54   GLN A CG  1 
ATOM   412  C  CD  . GLN A 1 54  ? 22.720  9.003   13.273 1.00 24.11  ? 54   GLN A CD  1 
ATOM   413  O  OE1 . GLN A 1 54  ? 22.906  7.834   13.598 1.00 23.36  ? 54   GLN A OE1 1 
ATOM   414  N  NE2 . GLN A 1 54  ? 21.608  9.397   12.659 1.00 24.02  ? 54   GLN A NE2 1 
ATOM   415  N  N   . VAL A 1 55  ? 25.966  10.027  17.664 1.00 21.96  ? 55   VAL A N   1 
ATOM   416  C  CA  . VAL A 1 55  ? 26.097  10.216  19.118 1.00 19.14  ? 55   VAL A CA  1 
ATOM   417  C  C   . VAL A 1 55  ? 27.276  11.114  19.433 1.00 20.33  ? 55   VAL A C   1 
ATOM   418  O  O   . VAL A 1 55  ? 27.200  12.024  20.266 1.00 25.67  ? 55   VAL A O   1 
ATOM   419  C  CB  . VAL A 1 55  ? 26.199  8.851   19.815 1.00 24.87  ? 55   VAL A CB  1 
ATOM   420  C  CG1 . VAL A 1 55  ? 26.679  8.982   21.252 1.00 30.12  ? 55   VAL A CG1 1 
ATOM   421  C  CG2 . VAL A 1 55  ? 24.845  8.143   19.780 1.00 24.02  ? 55   VAL A CG2 1 
ATOM   422  N  N   . LYS A 1 56  ? 28.388  10.934  18.725 1.00 23.00  ? 56   LYS A N   1 
ATOM   423  C  CA  . LYS A 1 56  ? 29.536  11.817  18.867 1.00 21.74  ? 56   LYS A CA  1 
ATOM   424  C  C   . LYS A 1 56  ? 29.230  13.263  18.505 1.00 24.79  ? 56   LYS A C   1 
ATOM   425  O  O   . LYS A 1 56  ? 29.602  14.202  19.216 1.00 20.55  ? 56   LYS A O   1 
ATOM   426  C  CB  . LYS A 1 56  ? 30.693  11.308  17.992 1.00 21.67  ? 56   LYS A CB  1 
ATOM   427  C  CG  . LYS A 1 56  ? 31.386  10.073  18.546 1.00 34.86  ? 56   LYS A CG  1 
ATOM   428  C  CD  . LYS A 1 56  ? 32.703  9.835   17.817 1.00 44.96  ? 56   LYS A CD  1 
ATOM   429  C  CE  . LYS A 1 56  ? 33.354  8.547   18.302 1.00 56.86  ? 56   LYS A CE  1 
ATOM   430  N  NZ  . LYS A 1 56  ? 33.237  7.453   17.289 1.00 64.21  ? 56   LYS A NZ  1 
ATOM   431  N  N   . GLY A 1 57  ? 28.564  13.488  17.374 1.00 19.61  ? 57   GLY A N   1 
ATOM   432  C  CA  . GLY A 1 57  ? 28.244  14.852  16.967 1.00 23.51  ? 57   GLY A CA  1 
ATOM   433  C  C   . GLY A 1 57  ? 27.240  15.478  17.919 1.00 23.32  ? 57   GLY A C   1 
ATOM   434  O  O   . GLY A 1 57  ? 27.320  16.668  18.212 1.00 19.32  ? 57   GLY A O   1 
ATOM   435  N  N   . HIS A 1 58  ? 26.303  14.660  18.403 1.00 20.75  ? 58   HIS A N   1 
ATOM   436  C  CA  . HIS A 1 58  ? 25.324  15.211  19.341 1.00 22.93  ? 58   HIS A CA  1 
ATOM   437  C  C   . HIS A 1 58  ? 26.010  15.560  20.658 1.00 22.31  ? 58   HIS A C   1 
ATOM   438  O  O   . HIS A 1 58  ? 25.766  16.621  21.246 1.00 22.97  ? 58   HIS A O   1 
ATOM   439  C  CB  . HIS A 1 58  ? 24.157  14.234  19.534 1.00 20.71  ? 58   HIS A CB  1 
ATOM   440  C  CG  . HIS A 1 58  ? 23.061  14.861  20.350 1.00 23.20  ? 58   HIS A CG  1 
ATOM   441  N  ND1 . HIS A 1 58  ? 22.465  16.048  19.984 1.00 27.95  ? 58   HIS A ND1 1 
ATOM   442  C  CD2 . HIS A 1 58  ? 22.481  14.499  21.519 1.00 23.34  ? 58   HIS A CD2 1 
ATOM   443  C  CE1 . HIS A 1 58  ? 21.559  16.384  20.885 1.00 26.72  ? 58   HIS A CE1 1 
ATOM   444  N  NE2 . HIS A 1 58  ? 21.542  15.455  21.825 1.00 26.94  ? 58   HIS A NE2 1 
ATOM   445  N  N   . GLY A 1 59  ? 26.916  14.695  21.117 1.00 18.79  ? 59   GLY A N   1 
ATOM   446  C  CA  . GLY A 1 59  ? 27.672  15.017  22.324 1.00 19.14  ? 59   GLY A CA  1 
ATOM   447  C  C   . GLY A 1 59  ? 28.409  16.338  22.242 1.00 19.65  ? 59   GLY A C   1 
ATOM   448  O  O   . GLY A 1 59  ? 28.436  17.103  23.210 1.00 20.34  ? 59   GLY A O   1 
ATOM   449  N  N   . LYS A 1 60  ? 29.033  16.623  21.104 1.00 23.86  ? 60   LYS A N   1 
ATOM   450  C  CA  . LYS A 1 60  ? 29.748  17.868  20.855 1.00 17.11  ? 60   LYS A CA  1 
ATOM   451  C  C   . LYS A 1 60  ? 28.811  19.074  20.882 1.00 16.78  ? 60   LYS A C   1 
ATOM   452  O  O   . LYS A 1 60  ? 29.157  20.138  21.387 1.00 23.64  ? 60   LYS A O   1 
ATOM   453  C  CB  . LYS A 1 60  ? 30.437  17.829  19.483 1.00 23.94  ? 60   LYS A CB  1 
ATOM   454  C  CG  . LYS A 1 60  ? 31.662  16.925  19.438 1.00 39.46  ? 60   LYS A CG  1 
ATOM   455  C  CD  . LYS A 1 60  ? 32.641  17.393  18.372 1.00 56.15  ? 60   LYS A CD  1 
ATOM   456  C  CE  . LYS A 1 60  ? 32.434  18.869  18.058 1.00 63.35  ? 60   LYS A CE  1 
ATOM   457  N  NZ  . LYS A 1 60  ? 32.685  19.731  19.248 1.00 69.52  ? 60   LYS A NZ  1 
ATOM   458  N  N   . LYS A 1 61  ? 27.610  18.893  20.335 1.00 18.51  ? 61   LYS A N   1 
ATOM   459  C  CA  . LYS A 1 61  ? 26.630  19.973  20.368 1.00 21.94  ? 61   LYS A CA  1 
ATOM   460  C  C   . LYS A 1 61  ? 26.196  20.268  21.802 1.00 17.18  ? 61   LYS A C   1 
ATOM   461  O  O   . LYS A 1 61  ? 26.080  21.438  22.180 1.00 16.42  ? 61   LYS A O   1 
ATOM   462  C  CB  . LYS A 1 61  ? 25.412  19.635  19.509 1.00 21.92  ? 61   LYS A CB  1 
ATOM   463  C  CG  . LYS A 1 61  ? 25.629  19.888  18.022 1.00 35.43  ? 61   LYS A CG  1 
ATOM   464  C  CD  . LYS A 1 61  ? 24.843  18.882  17.194 1.00 37.03  ? 61   LYS A CD  1 
ATOM   465  C  CE  . LYS A 1 61  ? 24.223  19.531  15.968 1.00 44.31  ? 61   LYS A CE  1 
ATOM   466  N  NZ  . LYS A 1 61  ? 23.114  18.702  15.413 1.00 49.77  ? 61   LYS A NZ  1 
ATOM   467  N  N   . VAL A 1 62  ? 25.952  19.210  22.567 1.00 17.10  ? 62   VAL A N   1 
ATOM   468  C  CA  . VAL A 1 62  ? 25.570  19.382  23.978 1.00 18.93  ? 62   VAL A CA  1 
ATOM   469  C  C   . VAL A 1 62  ? 26.695  20.052  24.748 1.00 22.01  ? 62   VAL A C   1 
ATOM   470  O  O   . VAL A 1 62  ? 26.515  21.017  25.499 1.00 17.65  ? 62   VAL A O   1 
ATOM   471  C  CB  . VAL A 1 62  ? 25.207  18.017  24.597 1.00 18.55  ? 62   VAL A CB  1 
ATOM   472  C  CG1 . VAL A 1 62  ? 25.070  18.095  26.105 1.00 27.06  ? 62   VAL A CG1 1 
ATOM   473  C  CG2 . VAL A 1 62  ? 23.909  17.518  23.973 1.00 23.92  ? 62   VAL A CG2 1 
ATOM   474  N  N   . ALA A 1 63  ? 27.912  19.554  24.552 1.00 20.88  ? 63   ALA A N   1 
ATOM   475  C  CA  . ALA A 1 63  ? 29.058  20.124  25.269 1.00 28.62  ? 63   ALA A CA  1 
ATOM   476  C  C   . ALA A 1 63  ? 29.295  21.583  24.908 1.00 26.98  ? 63   ALA A C   1 
ATOM   477  O  O   . ALA A 1 63  ? 29.577  22.386  25.806 1.00 24.62  ? 63   ALA A O   1 
ATOM   478  C  CB  . ALA A 1 63  ? 30.311  19.299  25.016 1.00 35.18  ? 63   ALA A CB  1 
ATOM   479  N  N   . ASP A 1 64  ? 29.171  21.952  23.633 1.00 24.78  ? 64   ASP A N   1 
ATOM   480  C  CA  . ASP A 1 64  ? 29.334  23.352  23.245 1.00 30.01  ? 64   ASP A CA  1 
ATOM   481  C  C   . ASP A 1 64  ? 28.300  24.238  23.948 1.00 24.74  ? 64   ASP A C   1 
ATOM   482  O  O   . ASP A 1 64  ? 28.602  25.353  24.383 1.00 20.39  ? 64   ASP A O   1 
ATOM   483  C  CB  . ASP A 1 64  ? 29.230  23.528  21.736 1.00 31.05  ? 64   ASP A CB  1 
ATOM   484  C  CG  . ASP A 1 64  ? 30.401  23.139  20.873 1.00 35.74  ? 64   ASP A CG  1 
ATOM   485  O  OD1 . ASP A 1 64  ? 31.548  22.951  21.327 1.00 39.08  ? 64   ASP A OD1 1 
ATOM   486  O  OD2 . ASP A 1 64  ? 30.188  23.001  19.642 1.00 41.05  ? 64   ASP A OD2 1 
ATOM   487  N  N   . ALA A 1 65  ? 27.058  23.763  24.052 1.00 19.24  ? 65   ALA A N   1 
ATOM   488  C  CA  . ALA A 1 65  ? 25.989  24.536  24.675 1.00 14.65  ? 65   ALA A CA  1 
ATOM   489  C  C   . ALA A 1 65  ? 26.280  24.777  26.161 1.00 18.14  ? 65   ALA A C   1 
ATOM   490  O  O   . ALA A 1 65  ? 26.067  25.880  26.651 1.00 20.67  ? 65   ALA A O   1 
ATOM   491  C  CB  . ALA A 1 65  ? 24.655  23.838  24.503 1.00 19.54  ? 65   ALA A CB  1 
ATOM   492  N  N   . LEU A 1 66  ? 26.776  23.754  26.847 1.00 16.47  ? 66   LEU A N   1 
ATOM   493  C  CA  . LEU A 1 66  ? 27.270  23.879  28.209 1.00 16.33  ? 66   LEU A CA  1 
ATOM   494  C  C   . LEU A 1 66  ? 28.422  24.882  28.302 1.00 18.88  ? 66   LEU A C   1 
ATOM   495  O  O   . LEU A 1 66  ? 28.399  25.704  29.219 1.00 19.50  ? 66   LEU A O   1 
ATOM   496  C  CB  . LEU A 1 66  ? 27.741  22.532  28.761 1.00 17.67  ? 66   LEU A CB  1 
ATOM   497  C  CG  . LEU A 1 66  ? 26.615  21.508  28.977 1.00 26.95  ? 66   LEU A CG  1 
ATOM   498  C  CD1 . LEU A 1 66  ? 27.179  20.203  29.516 1.00 25.86  ? 66   LEU A CD1 1 
ATOM   499  C  CD2 . LEU A 1 66  ? 25.556  22.095  29.901 1.00 28.20  ? 66   LEU A CD2 1 
ATOM   500  N  N   . THR A 1 67  ? 29.380  24.812  27.382 1.00 18.74  ? 67   THR A N   1 
ATOM   501  C  CA  . THR A 1 67  ? 30.451  25.808  27.339 1.00 20.47  ? 67   THR A CA  1 
ATOM   502  C  C   . THR A 1 67  ? 29.900  27.222  27.243 1.00 19.96  ? 67   THR A C   1 
ATOM   503  O  O   . THR A 1 67  ? 30.344  28.133  27.955 1.00 27.42  ? 67   THR A O   1 
ATOM   504  C  CB  . THR A 1 67  ? 31.397  25.546  26.151 1.00 29.88  ? 67   THR A CB  1 
ATOM   505  O  OG1 . THR A 1 67  ? 32.011  24.264  26.327 1.00 25.32  ? 67   THR A OG1 1 
ATOM   506  C  CG2 . THR A 1 67  ? 32.538  26.553  26.104 1.00 28.99  ? 67   THR A CG2 1 
ATOM   507  N  N   . ASN A 1 68  ? 28.939  27.433  26.360 1.00 19.60  ? 68   ASN A N   1 
ATOM   508  C  CA  . ASN A 1 68  ? 28.258  28.719  26.225 1.00 25.35  ? 68   ASN A CA  1 
ATOM   509  C  C   . ASN A 1 68  ? 27.640  29.136  27.554 1.00 27.55  ? 68   ASN A C   1 
ATOM   510  O  O   . ASN A 1 68  ? 27.715  30.298  27.966 1.00 23.29  ? 68   ASN A O   1 
ATOM   511  C  CB  . ASN A 1 68  ? 27.183  28.623  25.140 1.00 26.36  ? 68   ASN A CB  1 
ATOM   512  C  CG  . ASN A 1 68  ? 26.459  29.929  24.888 1.00 33.49  ? 68   ASN A CG  1 
ATOM   513  O  OD1 . ASN A 1 68  ? 27.055  30.999  24.976 1.00 35.36  ? 68   ASN A OD1 1 
ATOM   514  N  ND2 . ASN A 1 68  ? 25.175  29.854  24.560 1.00 37.48  ? 68   ASN A ND2 1 
ATOM   515  N  N   . ALA A 1 69  ? 27.031  28.162  28.236 1.00 20.37  ? 69   ALA A N   1 
ATOM   516  C  CA  . ALA A 1 69  ? 26.400  28.426  29.525 1.00 20.90  ? 69   ALA A CA  1 
ATOM   517  C  C   . ALA A 1 69  ? 27.413  28.808  30.600 1.00 22.20  ? 69   ALA A C   1 
ATOM   518  O  O   . ALA A 1 69  ? 27.150  29.674  31.438 1.00 26.53  ? 69   ALA A O   1 
ATOM   519  C  CB  . ALA A 1 69  ? 25.595  27.215  29.985 1.00 24.22  ? 69   ALA A CB  1 
ATOM   520  N  N   . VAL A 1 70  ? 28.570  28.163  30.586 1.00 20.21  ? 70   VAL A N   1 
ATOM   521  C  CA  . VAL A 1 70  ? 29.583  28.457  31.600 1.00 20.80  ? 70   VAL A CA  1 
ATOM   522  C  C   . VAL A 1 70  ? 30.140  29.864  31.403 1.00 28.89  ? 70   VAL A C   1 
ATOM   523  O  O   . VAL A 1 70  ? 30.418  30.574  32.370 1.00 34.17  ? 70   VAL A O   1 
ATOM   524  C  CB  . VAL A 1 70  ? 30.725  27.434  31.606 1.00 19.30  ? 70   VAL A CB  1 
ATOM   525  C  CG1 . VAL A 1 70  ? 31.853  27.885  32.525 1.00 23.44  ? 70   VAL A CG1 1 
ATOM   526  C  CG2 . VAL A 1 70  ? 30.207  26.067  32.053 1.00 23.55  ? 70   VAL A CG2 1 
ATOM   527  N  N   . ALA A 1 71  ? 30.268  30.256  30.147 1.00 21.50  ? 71   ALA A N   1 
ATOM   528  C  CA  . ALA A 1 71  ? 30.849  31.542  29.786 1.00 33.98  ? 71   ALA A CA  1 
ATOM   529  C  C   . ALA A 1 71  ? 29.852  32.681  29.960 1.00 39.98  ? 71   ALA A C   1 
ATOM   530  O  O   . ALA A 1 71  ? 30.244  33.848  30.041 1.00 41.33  ? 71   ALA A O   1 
ATOM   531  C  CB  . ALA A 1 71  ? 31.360  31.495  28.353 1.00 56.78  ? 71   ALA A CB  1 
ATOM   532  N  N   . HIS A 1 72  ? 28.568  32.347  30.025 1.00 29.97  ? 72   HIS A N   1 
ATOM   533  C  CA  . HIS A 1 72  ? 27.533  33.349  30.257 1.00 29.09  ? 72   HIS A CA  1 
ATOM   534  C  C   . HIS A 1 72  ? 26.708  33.001  31.490 1.00 31.98  ? 72   HIS A C   1 
ATOM   535  O  O   . HIS A 1 72  ? 25.489  33.170  31.512 1.00 29.77  ? 72   HIS A O   1 
ATOM   536  C  CB  . HIS A 1 72  ? 26.639  33.483  29.021 1.00 30.47  ? 72   HIS A CB  1 
ATOM   537  C  CG  . HIS A 1 72  ? 27.427  33.760  27.779 1.00 38.98  ? 72   HIS A CG  1 
ATOM   538  N  ND1 . HIS A 1 72  ? 27.839  35.024  27.423 1.00 45.57  ? 72   HIS A ND1 1 
ATOM   539  C  CD2 . HIS A 1 72  ? 27.891  32.932  26.816 1.00 37.92  ? 72   HIS A CD2 1 
ATOM   540  C  CE1 . HIS A 1 72  ? 28.518  34.964  26.290 1.00 42.04  ? 72   HIS A CE1 1 
ATOM   541  N  NE2 . HIS A 1 72  ? 28.561  33.702  25.897 1.00 43.42  ? 72   HIS A NE2 1 
ATOM   542  N  N   . VAL A 1 73  ? 27.400  32.514  32.516 1.00 22.89  ? 73   VAL A N   1 
ATOM   543  C  CA  . VAL A 1 73  ? 26.759  32.051  33.738 1.00 29.13  ? 73   VAL A CA  1 
ATOM   544  C  C   . VAL A 1 73  ? 25.835  33.108  34.317 1.00 38.82  ? 73   VAL A C   1 
ATOM   545  O  O   . VAL A 1 73  ? 24.821  32.796  34.942 1.00 40.80  ? 73   VAL A O   1 
ATOM   546  C  CB  . VAL A 1 73  ? 27.810  31.606  34.772 1.00 37.72  ? 73   VAL A CB  1 
ATOM   547  C  CG1 . VAL A 1 73  ? 28.142  32.727  35.739 1.00 34.78  ? 73   VAL A CG1 1 
ATOM   548  C  CG2 . VAL A 1 73  ? 27.318  30.370  35.510 1.00 51.20  ? 73   VAL A CG2 1 
ATOM   549  N  N   . ASP A 1 74  ? 26.134  34.390  34.110 1.00 43.23  ? 74   ASP A N   1 
ATOM   550  C  CA  . ASP A 1 74  ? 25.288  35.422  34.716 1.00 49.04  ? 74   ASP A CA  1 
ATOM   551  C  C   . ASP A 1 74  ? 24.066  35.752  33.873 1.00 41.25  ? 74   ASP A C   1 
ATOM   552  O  O   . ASP A 1 74  ? 23.122  36.391  34.345 1.00 44.73  ? 74   ASP A O   1 
ATOM   553  C  CB  . ASP A 1 74  ? 26.124  36.682  34.971 1.00 59.46  ? 74   ASP A CB  1 
ATOM   554  C  CG  . ASP A 1 74  ? 27.208  36.435  36.006 1.00 64.92  ? 74   ASP A CG  1 
ATOM   555  O  OD1 . ASP A 1 74  ? 26.859  36.162  37.173 1.00 42.52  ? 74   ASP A OD1 1 
ATOM   556  O  OD2 . ASP A 1 74  ? 28.406  36.504  35.660 1.00 82.80  ? 74   ASP A OD2 1 
ATOM   557  N  N   . ASP A 1 75  ? 24.053  35.324  32.614 1.00 37.06  ? 75   ASP A N   1 
ATOM   558  C  CA  . ASP A 1 75  ? 22.935  35.636  31.730 1.00 39.44  ? 75   ASP A CA  1 
ATOM   559  C  C   . ASP A 1 75  ? 22.442  34.396  30.991 1.00 31.07  ? 75   ASP A C   1 
ATOM   560  O  O   . ASP A 1 75  ? 22.259  34.445  29.770 1.00 28.24  ? 75   ASP A O   1 
ATOM   561  C  CB  . ASP A 1 75  ? 23.360  36.708  30.721 1.00 37.39  ? 75   ASP A CB  1 
ATOM   562  C  CG  . ASP A 1 75  ? 22.188  37.310  29.972 1.00 51.94  ? 75   ASP A CG  1 
ATOM   563  O  OD1 . ASP A 1 75  ? 21.145  37.582  30.607 1.00 45.43  ? 75   ASP A OD1 1 
ATOM   564  O  OD2 . ASP A 1 75  ? 22.315  37.514  28.745 1.00 50.53  ? 75   ASP A OD2 1 
ATOM   565  N  N   . MET A 1 76  ? 22.249  33.312  31.727 1.00 26.68  ? 76   MET A N   1 
ATOM   566  C  CA  . MET A 1 76  ? 21.897  32.020  31.146 1.00 25.20  ? 76   MET A CA  1 
ATOM   567  C  C   . MET A 1 76  ? 20.607  32.012  30.345 1.00 32.86  ? 76   MET A C   1 
ATOM   568  O  O   . MET A 1 76  ? 20.599  31.461  29.231 1.00 31.56  ? 76   MET A O   1 
ATOM   569  C  CB  . MET A 1 76  ? 21.842  30.950  32.250 1.00 36.21  ? 76   MET A CB  1 
ATOM   570  C  CG  . MET A 1 76  ? 23.201  30.299  32.484 1.00 44.43  ? 76   MET A CG  1 
ATOM   571  S  SD  . MET A 1 76  ? 23.097  28.676  33.265 1.00 45.23  ? 76   MET A SD  1 
ATOM   572  C  CE  . MET A 1 76  ? 21.369  28.289  32.997 1.00 31.24  ? 76   MET A CE  1 
ATOM   573  N  N   . PRO A 1 77  ? 19.504  32.553  30.851 1.00 31.55  ? 77   PRO A N   1 
ATOM   574  C  CA  . PRO A 1 77  ? 18.270  32.555  30.051 1.00 34.33  ? 77   PRO A CA  1 
ATOM   575  C  C   . PRO A 1 77  ? 18.484  33.208  28.696 1.00 33.06  ? 77   PRO A C   1 
ATOM   576  O  O   . PRO A 1 77  ? 17.901  32.835  27.677 1.00 27.04  ? 77   PRO A O   1 
ATOM   577  C  CB  . PRO A 1 77  ? 17.293  33.365  30.907 1.00 38.63  ? 77   PRO A CB  1 
ATOM   578  C  CG  . PRO A 1 77  ? 17.792  33.168  32.303 1.00 33.13  ? 77   PRO A CG  1 
ATOM   579  C  CD  . PRO A 1 77  ? 19.295  33.155  32.178 1.00 27.93  ? 77   PRO A CD  1 
ATOM   580  N  N   . ASN A 1 78  ? 19.362  34.214  28.647 1.00 34.93  ? 78   ASN A N   1 
ATOM   581  C  CA  . ASN A 1 78  ? 19.566  34.856  27.346 1.00 30.06  ? 78   ASN A CA  1 
ATOM   582  C  C   . ASN A 1 78  ? 20.494  34.032  26.474 1.00 30.26  ? 78   ASN A C   1 
ATOM   583  O  O   . ASN A 1 78  ? 20.288  33.865  25.269 1.00 31.86  ? 78   ASN A O   1 
ATOM   584  C  CB  . ASN A 1 78  ? 20.093  36.279  27.542 1.00 36.38  ? 78   ASN A CB  1 
ATOM   585  C  CG  . ASN A 1 78  ? 18.953  37.284  27.528 1.00 48.20  ? 78   ASN A CG  1 
ATOM   586  O  OD1 . ASN A 1 78  ? 17.993  37.118  26.772 1.00 56.78  ? 78   ASN A OD1 1 
ATOM   587  N  ND2 . ASN A 1 78  ? 19.056  38.308  28.366 1.00 69.44  ? 78   ASN A ND2 1 
ATOM   588  N  N   . ALA A 1 79  ? 21.539  33.473  27.085 1.00 30.47  ? 79   ALA A N   1 
ATOM   589  C  CA  . ALA A 1 79  ? 22.503  32.741  26.267 1.00 33.23  ? 79   ALA A CA  1 
ATOM   590  C  C   . ALA A 1 79  ? 21.876  31.491  25.655 1.00 34.96  ? 79   ALA A C   1 
ATOM   591  O  O   . ALA A 1 79  ? 22.285  31.078  24.567 1.00 31.02  ? 79   ALA A O   1 
ATOM   592  C  CB  . ALA A 1 79  ? 23.728  32.385  27.092 1.00 39.11  ? 79   ALA A CB  1 
ATOM   593  N  N   . LEU A 1 80  ? 20.907  30.883  26.336 1.00 29.72  ? 80   LEU A N   1 
ATOM   594  C  CA  . LEU A 1 80  ? 20.341  29.612  25.868 1.00 26.01  ? 80   LEU A CA  1 
ATOM   595  C  C   . LEU A 1 80  ? 18.931  29.775  25.314 1.00 27.62  ? 80   LEU A C   1 
ATOM   596  O  O   . LEU A 1 80  ? 18.171  28.817  25.167 1.00 21.75  ? 80   LEU A O   1 
ATOM   597  C  CB  . LEU A 1 80  ? 20.352  28.597  27.019 1.00 30.41  ? 80   LEU A CB  1 
ATOM   598  C  CG  . LEU A 1 80  ? 21.728  28.152  27.530 1.00 28.02  ? 80   LEU A CG  1 
ATOM   599  C  CD1 . LEU A 1 80  ? 21.595  27.004  28.518 1.00 27.48  ? 80   LEU A CD1 1 
ATOM   600  C  CD2 . LEU A 1 80  ? 22.623  27.745  26.369 1.00 30.56  ? 80   LEU A CD2 1 
ATOM   601  N  N   . SER A 1 81  ? 18.532  30.996  24.980 1.00 22.30  ? 81   SER A N   1 
ATOM   602  C  CA  . SER A 1 81  ? 17.183  31.323  24.558 1.00 27.77  ? 81   SER A CA  1 
ATOM   603  C  C   . SER A 1 81  ? 16.715  30.508  23.355 1.00 28.03  ? 81   SER A C   1 
ATOM   604  O  O   . SER A 1 81  ? 15.574  30.035  23.324 1.00 26.81  ? 81   SER A O   1 
ATOM   605  C  CB  . SER A 1 81  ? 17.114  32.822  24.224 1.00 32.24  ? 81   SER A CB  1 
ATOM   606  O  OG  . SER A 1 81  ? 15.770  33.186  23.937 1.00 54.17  ? 81   SER A OG  1 
ATOM   607  N  N   . ALA A 1 82  ? 17.592  30.361  22.372 1.00 22.91  ? 82   ALA A N   1 
ATOM   608  C  CA  . ALA A 1 82  ? 17.336  29.572  21.176 1.00 29.99  ? 82   ALA A CA  1 
ATOM   609  C  C   . ALA A 1 82  ? 17.093  28.099  21.507 1.00 30.73  ? 82   ALA A C   1 
ATOM   610  O  O   . ALA A 1 82  ? 16.155  27.491  20.989 1.00 23.22  ? 82   ALA A O   1 
ATOM   611  C  CB  . ALA A 1 82  ? 18.497  29.708  20.200 1.00 41.13  ? 82   ALA A CB  1 
ATOM   612  N  N   . LEU A 1 83  ? 17.933  27.528  22.362 1.00 20.82  ? 83   LEU A N   1 
ATOM   613  C  CA  . LEU A 1 83  ? 17.821  26.127  22.776 1.00 19.47  ? 83   LEU A CA  1 
ATOM   614  C  C   . LEU A 1 83  ? 16.593  25.870  23.630 1.00 17.17  ? 83   LEU A C   1 
ATOM   615  O  O   . LEU A 1 83  ? 15.974  24.813  23.560 1.00 23.02  ? 83   LEU A O   1 
ATOM   616  C  CB  . LEU A 1 83  ? 19.078  25.742  23.569 1.00 22.55  ? 83   LEU A CB  1 
ATOM   617  C  CG  . LEU A 1 83  ? 20.293  25.395  22.705 1.00 36.28  ? 83   LEU A CG  1 
ATOM   618  C  CD1 . LEU A 1 83  ? 21.519  25.159  23.576 1.00 43.40  ? 83   LEU A CD1 1 
ATOM   619  C  CD2 . LEU A 1 83  ? 19.988  24.184  21.839 1.00 29.84  ? 83   LEU A CD2 1 
ATOM   620  N  N   . SER A 1 84  ? 16.220  26.845  24.458 1.00 18.01  ? 84   SER A N   1 
ATOM   621  C  CA  . SER A 1 84  ? 15.003  26.715  25.259 1.00 18.62  ? 84   SER A CA  1 
ATOM   622  C  C   . SER A 1 84  ? 13.786  26.712  24.343 1.00 25.77  ? 84   SER A C   1 
ATOM   623  O  O   . SER A 1 84  ? 12.853  25.938  24.555 1.00 22.84  ? 84   SER A O   1 
ATOM   624  C  CB  . SER A 1 84  ? 14.896  27.835  26.293 1.00 26.37  ? 84   SER A CB  1 
ATOM   625  O  OG  . SER A 1 84  ? 13.652  27.786  26.966 1.00 52.61  ? 84   SER A OG  1 
ATOM   626  N  N   . ASP A 1 85  ? 13.802  27.555  23.314 1.00 20.93  ? 85   ASP A N   1 
ATOM   627  C  CA  . ASP A 1 85  ? 12.702  27.556  22.352 1.00 22.16  ? 85   ASP A CA  1 
ATOM   628  C  C   . ASP A 1 85  ? 12.553  26.197  21.677 1.00 24.59  ? 85   ASP A C   1 
ATOM   629  O  O   . ASP A 1 85  ? 11.460  25.647  21.609 1.00 22.63  ? 85   ASP A O   1 
ATOM   630  C  CB  . ASP A 1 85  ? 12.922  28.623  21.274 1.00 31.21  ? 85   ASP A CB  1 
ATOM   631  C  CG  . ASP A 1 85  ? 12.487  30.003  21.724 1.00 46.90  ? 85   ASP A CG  1 
ATOM   632  O  OD1 . ASP A 1 85  ? 11.471  30.101  22.443 1.00 51.52  ? 85   ASP A OD1 1 
ATOM   633  O  OD2 . ASP A 1 85  ? 13.167  30.987  21.356 1.00 63.38  ? 85   ASP A OD2 1 
ATOM   634  N  N   . LEU A 1 86  ? 13.661  25.677  21.163 1.00 20.31  ? 86   LEU A N   1 
ATOM   635  C  CA  . LEU A 1 86  ? 13.720  24.409  20.460 1.00 22.42  ? 86   LEU A CA  1 
ATOM   636  C  C   . LEU A 1 86  ? 13.207  23.235  21.278 1.00 23.43  ? 86   LEU A C   1 
ATOM   637  O  O   . LEU A 1 86  ? 12.488  22.341  20.803 1.00 20.30  ? 86   LEU A O   1 
ATOM   638  C  CB  . LEU A 1 86  ? 15.184  24.147  20.057 1.00 21.82  ? 86   LEU A CB  1 
ATOM   639  C  CG  . LEU A 1 86  ? 15.417  22.827  19.316 1.00 31.14  ? 86   LEU A CG  1 
ATOM   640  C  CD1 . LEU A 1 86  ? 14.681  22.813  17.985 1.00 34.82  ? 86   LEU A CD1 1 
ATOM   641  C  CD2 . LEU A 1 86  ? 16.905  22.578  19.126 1.00 31.63  ? 86   LEU A CD2 1 
ATOM   642  N  N   . HIS A 1 87  ? 13.558  23.194  22.575 1.00 18.91  ? 87   HIS A N   1 
ATOM   643  C  CA  . HIS A 1 87  ? 13.101  22.003  23.315 1.00 19.53  ? 87   HIS A CA  1 
ATOM   644  C  C   . HIS A 1 87  ? 11.626  22.152  23.693 1.00 17.73  ? 87   HIS A C   1 
ATOM   645  O  O   . HIS A 1 87  ? 10.879  21.180  23.703 1.00 23.07  ? 87   HIS A O   1 
ATOM   646  C  CB  . HIS A 1 87  ? 13.979  21.773  24.543 1.00 18.12  ? 87   HIS A CB  1 
ATOM   647  C  CG  . HIS A 1 87  ? 15.324  21.181  24.222 1.00 17.34  ? 87   HIS A CG  1 
ATOM   648  N  ND1 . HIS A 1 87  ? 16.375  21.922  23.735 1.00 17.57  ? 87   HIS A ND1 1 
ATOM   649  C  CD2 . HIS A 1 87  ? 15.783  19.915  24.313 1.00 16.96  ? 87   HIS A CD2 1 
ATOM   650  C  CE1 . HIS A 1 87  ? 17.419  21.121  23.553 1.00 17.49  ? 87   HIS A CE1 1 
ATOM   651  N  NE2 . HIS A 1 87  ? 17.092  19.886  23.900 1.00 18.33  ? 87   HIS A NE2 1 
ATOM   652  N  N   . ALA A 1 88  ? 11.212  23.376  23.989 1.00 17.64  ? 88   ALA A N   1 
ATOM   653  C  CA  . ALA A 1 88  ? 9.834   23.701  24.333 1.00 21.42  ? 88   ALA A CA  1 
ATOM   654  C  C   . ALA A 1 88  ? 8.845   23.489  23.197 1.00 24.88  ? 88   ALA A C   1 
ATOM   655  O  O   . ALA A 1 88  ? 7.774   22.905  23.407 1.00 25.53  ? 88   ALA A O   1 
ATOM   656  C  CB  . ALA A 1 88  ? 9.756   25.157  24.797 1.00 24.41  ? 88   ALA A CB  1 
ATOM   657  N  N   . HIS A 1 89  ? 9.166   23.981  22.003 1.00 26.30  ? 89   HIS A N   1 
ATOM   658  C  CA  . HIS A 1 89  ? 8.192   23.968  20.910 1.00 25.90  ? 89   HIS A CA  1 
ATOM   659  C  C   . HIS A 1 89  ? 8.391   22.855  19.898 1.00 30.20  ? 89   HIS A C   1 
ATOM   660  O  O   . HIS A 1 89  ? 7.423   22.506  19.207 1.00 29.34  ? 89   HIS A O   1 
ATOM   661  C  CB  . HIS A 1 89  ? 8.233   25.332  20.194 1.00 26.17  ? 89   HIS A CB  1 
ATOM   662  C  CG  . HIS A 1 89  ? 8.061   26.431  21.206 1.00 39.79  ? 89   HIS A CG  1 
ATOM   663  N  ND1 . HIS A 1 89  ? 7.113   26.337  22.205 1.00 47.31  ? 89   HIS A ND1 1 
ATOM   664  C  CD2 . HIS A 1 89  ? 8.698   27.600  21.404 1.00 45.86  ? 89   HIS A CD2 1 
ATOM   665  C  CE1 . HIS A 1 89  ? 7.166   27.413  22.967 1.00 47.96  ? 89   HIS A CE1 1 
ATOM   666  N  NE2 . HIS A 1 89  ? 8.121   28.197  22.502 1.00 50.69  ? 89   HIS A NE2 1 
ATOM   667  N  N   . LYS A 1 90  ? 9.588   22.287  19.766 1.00 24.27  ? 90   LYS A N   1 
ATOM   668  C  CA  . LYS A 1 90  ? 9.803   21.280  18.727 1.00 28.03  ? 90   LYS A CA  1 
ATOM   669  C  C   . LYS A 1 90  ? 10.123  19.915  19.311 1.00 29.00  ? 90   LYS A C   1 
ATOM   670  O  O   . LYS A 1 90  ? 9.389   18.953  19.066 1.00 27.06  ? 90   LYS A O   1 
ATOM   671  C  CB  . LYS A 1 90  ? 10.897  21.714  17.749 1.00 28.00  ? 90   LYS A CB  1 
ATOM   672  C  CG  . LYS A 1 90  ? 10.649  23.093  17.158 1.00 32.92  ? 90   LYS A CG  1 
ATOM   673  C  CD  . LYS A 1 90  ? 10.750  23.097  15.644 1.00 46.51  ? 90   LYS A CD  1 
ATOM   674  C  CE  . LYS A 1 90  ? 10.310  24.439  15.071 1.00 52.73  ? 90   LYS A CE  1 
ATOM   675  N  NZ  . LYS A 1 90  ? 11.353  25.037  14.190 1.00 69.37  ? 90   LYS A NZ  1 
ATOM   676  N  N   . LEU A 1 91  ? 11.189  19.804  20.099 1.00 17.36  ? 91   LEU A N   1 
ATOM   677  C  CA  . LEU A 1 91  ? 11.585  18.487  20.596 1.00 18.82  ? 91   LEU A CA  1 
ATOM   678  C  C   . LEU A 1 91  ? 10.659  17.970  21.697 1.00 14.30  ? 91   LEU A C   1 
ATOM   679  O  O   . LEU A 1 91  ? 10.333  16.783  21.701 1.00 17.06  ? 91   LEU A O   1 
ATOM   680  C  CB  . LEU A 1 91  ? 13.038  18.543  21.088 1.00 17.22  ? 91   LEU A CB  1 
ATOM   681  C  CG  . LEU A 1 91  ? 14.047  19.013  20.023 1.00 23.20  ? 91   LEU A CG  1 
ATOM   682  C  CD1 . LEU A 1 91  ? 15.376  19.356  20.677 1.00 22.09  ? 91   LEU A CD1 1 
ATOM   683  C  CD2 . LEU A 1 91  ? 14.233  17.956  18.950 1.00 23.43  ? 91   LEU A CD2 1 
ATOM   684  N  N   . ARG A 1 92  ? 10.238  18.848  22.585 1.00 18.23  ? 92   ARG A N   1 
ATOM   685  C  CA  . ARG A 1 92  ? 9.245   18.574  23.612 1.00 18.12  ? 92   ARG A CA  1 
ATOM   686  C  C   . ARG A 1 92  ? 9.573   17.333  24.429 1.00 25.43  ? 92   ARG A C   1 
ATOM   687  O  O   . ARG A 1 92  ? 8.742   16.464  24.698 1.00 16.91  ? 92   ARG A O   1 
ATOM   688  C  CB  . ARG A 1 92  ? 7.869   18.430  22.957 1.00 17.38  ? 92   ARG A CB  1 
ATOM   689  C  CG  . ARG A 1 92  ? 7.434   19.709  22.250 1.00 26.32  ? 92   ARG A CG  1 
ATOM   690  C  CD  . ARG A 1 92  ? 7.214   19.402  20.770 1.00 38.12  ? 92   ARG A CD  1 
ATOM   691  N  NE  . ARG A 1 92  ? 5.821   19.533  20.416 1.00 42.87  ? 92   ARG A NE  1 
ATOM   692  C  CZ  . ARG A 1 92  ? 5.224   19.115  19.313 1.00 33.40  ? 92   ARG A CZ  1 
ATOM   693  N  NH1 . ARG A 1 92  ? 5.881   18.485  18.356 1.00 27.31  ? 92   ARG A NH1 1 
ATOM   694  N  NH2 . ARG A 1 92  ? 3.926   19.352  19.216 1.00 24.88  ? 92   ARG A NH2 1 
ATOM   695  N  N   . VAL A 1 93  ? 10.835  17.278  24.842 1.00 17.07  ? 93   VAL A N   1 
ATOM   696  C  CA  . VAL A 1 93  ? 11.310  16.248  25.754 1.00 17.18  ? 93   VAL A CA  1 
ATOM   697  C  C   . VAL A 1 93  ? 10.744  16.451  27.154 1.00 16.13  ? 93   VAL A C   1 
ATOM   698  O  O   . VAL A 1 93  ? 10.861  17.573  27.668 1.00 16.69  ? 93   VAL A O   1 
ATOM   699  C  CB  . VAL A 1 93  ? 12.854  16.323  25.852 1.00 19.05  ? 93   VAL A CB  1 
ATOM   700  C  CG1 . VAL A 1 93  ? 13.370  15.316  26.864 1.00 23.64  ? 93   VAL A CG1 1 
ATOM   701  C  CG2 . VAL A 1 93  ? 13.471  16.084  24.481 1.00 19.34  ? 93   VAL A CG2 1 
ATOM   702  N  N   . ASP A 1 94  ? 10.190  15.417  27.772 1.00 19.77  ? 94   ASP A N   1 
ATOM   703  C  CA  . ASP A 1 94  ? 9.644   15.566  29.125 1.00 13.92  ? 94   ASP A CA  1 
ATOM   704  C  C   . ASP A 1 94  ? 10.728  16.039  30.086 1.00 11.89  ? 94   ASP A C   1 
ATOM   705  O  O   . ASP A 1 94  ? 11.839  15.514  30.106 1.00 14.77  ? 94   ASP A O   1 
ATOM   706  C  CB  . ASP A 1 94  ? 9.031   14.261  29.648 1.00 14.13  ? 94   ASP A CB  1 
ATOM   707  C  CG  . ASP A 1 94  ? 8.209   14.523  30.903 1.00 17.30  ? 94   ASP A CG  1 
ATOM   708  O  OD1 . ASP A 1 94  ? 8.760   14.515  32.014 1.00 18.75  ? 94   ASP A OD1 1 
ATOM   709  O  OD2 . ASP A 1 94  ? 6.997   14.774  30.765 1.00 23.12  ? 94   ASP A OD2 1 
ATOM   710  N  N   . PRO A 1 95  ? 10.391  17.048  30.874 1.00 16.59  ? 95   PRO A N   1 
ATOM   711  C  CA  . PRO A 1 95  ? 11.354  17.656  31.787 1.00 21.44  ? 95   PRO A CA  1 
ATOM   712  C  C   . PRO A 1 95  ? 12.013  16.660  32.724 1.00 20.69  ? 95   PRO A C   1 
ATOM   713  O  O   . PRO A 1 95  ? 13.140  16.940  33.142 1.00 19.57  ? 95   PRO A O   1 
ATOM   714  C  CB  . PRO A 1 95  ? 10.506  18.655  32.580 1.00 26.45  ? 95   PRO A CB  1 
ATOM   715  C  CG  . PRO A 1 95  ? 9.404   19.005  31.632 1.00 30.60  ? 95   PRO A CG  1 
ATOM   716  C  CD  . PRO A 1 95  ? 9.077   17.713  30.928 1.00 17.75  ? 95   PRO A CD  1 
ATOM   717  N  N   . VAL A 1 96  ? 11.397  15.530  33.075 1.00 17.68  ? 96   VAL A N   1 
ATOM   718  C  CA  . VAL A 1 96  ? 12.089  14.606  33.966 1.00 15.66  ? 96   VAL A CA  1 
ATOM   719  C  C   . VAL A 1 96  ? 13.405  14.103  33.393 1.00 17.06  ? 96   VAL A C   1 
ATOM   720  O  O   . VAL A 1 96  ? 14.289  13.711  34.161 1.00 19.43  ? 96   VAL A O   1 
ATOM   721  C  CB  . VAL A 1 96  ? 11.256  13.357  34.345 1.00 21.96  ? 96   VAL A CB  1 
ATOM   722  C  CG1 . VAL A 1 96  ? 9.924   13.744  34.949 1.00 24.91  ? 96   VAL A CG1 1 
ATOM   723  C  CG2 . VAL A 1 96  ? 11.073  12.459  33.132 1.00 31.09  ? 96   VAL A CG2 1 
ATOM   724  N  N   . ASN A 1 97  ? 13.543  14.061  32.069 1.00 13.59  ? 97   ASN A N   1 
ATOM   725  C  CA  . ASN A 1 97  ? 14.740  13.492  31.464 1.00 13.90  ? 97   ASN A CA  1 
ATOM   726  C  C   . ASN A 1 97  ? 15.967  14.374  31.661 1.00 17.62  ? 97   ASN A C   1 
ATOM   727  O  O   . ASN A 1 97  ? 17.090  13.871  31.588 1.00 15.02  ? 97   ASN A O   1 
ATOM   728  C  CB  . ASN A 1 97  ? 14.508  13.252  29.962 1.00 15.39  ? 97   ASN A CB  1 
ATOM   729  C  CG  . ASN A 1 97  ? 13.464  12.172  29.724 1.00 16.18  ? 97   ASN A CG  1 
ATOM   730  O  OD1 . ASN A 1 97  ? 13.755  10.984  29.872 1.00 18.99  ? 97   ASN A OD1 1 
ATOM   731  N  ND2 . ASN A 1 97  ? 12.241  12.574  29.400 1.00 16.71  ? 97   ASN A ND2 1 
ATOM   732  N  N   . PHE A 1 98  ? 15.787  15.672  31.895 1.00 16.36  ? 98   PHE A N   1 
ATOM   733  C  CA  . PHE A 1 98  ? 16.953  16.538  32.089 1.00 15.00  ? 98   PHE A CA  1 
ATOM   734  C  C   . PHE A 1 98  ? 17.732  16.155  33.344 1.00 16.94  ? 98   PHE A C   1 
ATOM   735  O  O   . PHE A 1 98  ? 18.972  16.222  33.376 1.00 18.58  ? 98   PHE A O   1 
ATOM   736  C  CB  . PHE A 1 98  ? 16.561  18.022  32.119 1.00 12.86  ? 98   PHE A CB  1 
ATOM   737  C  CG  . PHE A 1 98  ? 16.028  18.508  30.773 1.00 16.31  ? 98   PHE A CG  1 
ATOM   738  C  CD1 . PHE A 1 98  ? 14.679  18.399  30.484 1.00 23.88  ? 98   PHE A CD1 1 
ATOM   739  C  CD2 . PHE A 1 98  ? 16.849  19.074  29.821 1.00 24.34  ? 98   PHE A CD2 1 
ATOM   740  C  CE1 . PHE A 1 98  ? 14.171  18.848  29.273 1.00 26.45  ? 98   PHE A CE1 1 
ATOM   741  C  CE2 . PHE A 1 98  ? 16.364  19.503  28.599 1.00 24.13  ? 98   PHE A CE2 1 
ATOM   742  C  CZ  . PHE A 1 98  ? 15.015  19.387  28.324 1.00 19.55  ? 98   PHE A CZ  1 
ATOM   743  N  N   . LYS A 1 99  ? 17.033  15.733  34.384 1.00 13.64  ? 99   LYS A N   1 
ATOM   744  C  CA  . LYS A 1 99  ? 17.667  15.248  35.605 1.00 14.40  ? 99   LYS A CA  1 
ATOM   745  C  C   . LYS A 1 99  ? 18.521  14.014  35.335 1.00 20.89  ? 99   LYS A C   1 
ATOM   746  O  O   . LYS A 1 99  ? 19.571  13.837  35.964 1.00 15.81  ? 99   LYS A O   1 
ATOM   747  C  CB  . LYS A 1 99  ? 16.605  14.958  36.671 1.00 20.44  ? 99   LYS A CB  1 
ATOM   748  C  CG  . LYS A 1 99  ? 15.949  16.210  37.230 1.00 35.31  ? 99   LYS A CG  1 
ATOM   749  C  CD  . LYS A 1 99  ? 14.589  15.924  37.850 1.00 40.38  ? 99   LYS A CD  1 
ATOM   750  C  CE  . LYS A 1 99  ? 14.168  17.057  38.779 1.00 37.14  ? 99   LYS A CE  1 
ATOM   751  N  NZ  . LYS A 1 99  ? 12.967  17.789  38.285 1.00 65.70  ? 99   LYS A NZ  1 
ATOM   752  N  N   . LEU A 1 100 ? 18.073  13.173  34.395 1.00 17.87  ? 100  LEU A N   1 
ATOM   753  C  CA  . LEU A 1 100 ? 18.792  11.957  34.055 1.00 12.21  ? 100  LEU A CA  1 
ATOM   754  C  C   . LEU A 1 100 ? 20.089  12.275  33.318 1.00 16.64  ? 100  LEU A C   1 
ATOM   755  O  O   . LEU A 1 100 ? 21.138  11.723  33.658 1.00 14.95  ? 100  LEU A O   1 
ATOM   756  C  CB  . LEU A 1 100 ? 17.918  11.013  33.221 1.00 13.28  ? 100  LEU A CB  1 
ATOM   757  C  CG  . LEU A 1 100 ? 16.601  10.621  33.895 1.00 19.30  ? 100  LEU A CG  1 
ATOM   758  C  CD1 . LEU A 1 100 ? 15.815  9.633   33.041 1.00 16.92  ? 100  LEU A CD1 1 
ATOM   759  C  CD2 . LEU A 1 100 ? 16.905  10.019  35.265 1.00 18.98  ? 100  LEU A CD2 1 
ATOM   760  N  N   . LEU A 1 101 ? 20.041  13.166  32.330 1.00 14.20  ? 101  LEU A N   1 
ATOM   761  C  CA  . LEU A 1 101 ? 21.280  13.532  31.641 1.00 12.89  ? 101  LEU A CA  1 
ATOM   762  C  C   . LEU A 1 101 ? 22.236  14.291  32.563 1.00 16.57  ? 101  LEU A C   1 
ATOM   763  O  O   . LEU A 1 101 ? 23.456  14.098  32.465 1.00 16.89  ? 101  LEU A O   1 
ATOM   764  C  CB  . LEU A 1 101 ? 21.015  14.372  30.391 1.00 13.71  ? 101  LEU A CB  1 
ATOM   765  C  CG  . LEU A 1 101 ? 22.267  14.731  29.574 1.00 18.85  ? 101  LEU A CG  1 
ATOM   766  C  CD1 . LEU A 1 101 ? 22.994  13.464  29.135 1.00 21.96  ? 101  LEU A CD1 1 
ATOM   767  C  CD2 . LEU A 1 101 ? 21.912  15.603  28.373 1.00 19.17  ? 101  LEU A CD2 1 
ATOM   768  N  N   . SER A 1 102 ? 21.699  15.151  33.426 1.00 13.73  ? 102  SER A N   1 
ATOM   769  C  CA  . SER A 1 102 ? 22.546  15.876  34.374 1.00 13.58  ? 102  SER A CA  1 
ATOM   770  C  C   . SER A 1 102 ? 23.325  14.902  35.250 1.00 17.18  ? 102  SER A C   1 
ATOM   771  O  O   . SER A 1 102 ? 24.516  15.121  35.495 1.00 12.92  ? 102  SER A O   1 
ATOM   772  C  CB  . SER A 1 102 ? 21.710  16.814  35.258 1.00 17.66  ? 102  SER A CB  1 
ATOM   773  O  OG  . SER A 1 102 ? 21.128  17.823  34.434 1.00 21.03  ? 102  SER A OG  1 
ATOM   774  N  N   . HIS A 1 103 ? 22.646  13.855  35.716 1.00 13.16  ? 103  HIS A N   1 
ATOM   775  C  CA  . HIS A 1 103 ? 23.314  12.883  36.584 1.00 13.73  ? 103  HIS A CA  1 
ATOM   776  C  C   . HIS A 1 103 ? 24.439  12.190  35.822 1.00 17.30  ? 103  HIS A C   1 
ATOM   777  O  O   . HIS A 1 103 ? 25.538  11.986  36.331 1.00 15.05  ? 103  HIS A O   1 
ATOM   778  C  CB  . HIS A 1 103 ? 22.343  11.846  37.125 1.00 14.60  ? 103  HIS A CB  1 
ATOM   779  C  CG  . HIS A 1 103 ? 22.960  10.688  37.849 1.00 15.47  ? 103  HIS A CG  1 
ATOM   780  N  ND1 . HIS A 1 103 ? 23.562  10.800  39.078 1.00 13.83  ? 103  HIS A ND1 1 
ATOM   781  C  CD2 . HIS A 1 103 ? 23.036  9.373   37.543 1.00 17.36  ? 103  HIS A CD2 1 
ATOM   782  C  CE1 . HIS A 1 103 ? 23.996  9.629   39.494 1.00 15.69  ? 103  HIS A CE1 1 
ATOM   783  N  NE2 . HIS A 1 103 ? 23.687  8.736   38.566 1.00 18.52  ? 103  HIS A NE2 1 
ATOM   784  N  N   . CYS A 1 104 ? 24.155  11.798  34.582 1.00 12.63  ? 104  CYS A N   1 
ATOM   785  C  CA  . CYS A 1 104 ? 25.167  11.105  33.780 1.00 14.83  ? 104  CYS A CA  1 
ATOM   786  C  C   . CYS A 1 104 ? 26.318  12.027  33.421 1.00 14.36  ? 104  CYS A C   1 
ATOM   787  O  O   . CYS A 1 104 ? 27.462  11.574  33.369 1.00 14.79  ? 104  CYS A O   1 
ATOM   788  C  CB  . CYS A 1 104 ? 24.520  10.502  32.521 1.00 16.45  ? 104  CYS A CB  1 
ATOM   789  S  SG  . CYS A 1 104 ? 23.421  9.112   32.906 1.00 17.26  ? 104  CYS A SG  1 
ATOM   790  N  N   . LEU A 1 105 ? 26.048  13.321  33.195 1.00 15.17  ? 105  LEU A N   1 
ATOM   791  C  CA  . LEU A 1 105 ? 27.151  14.262  33.000 1.00 16.34  ? 105  LEU A CA  1 
ATOM   792  C  C   . LEU A 1 105 ? 28.006  14.367  34.267 1.00 15.00  ? 105  LEU A C   1 
ATOM   793  O  O   . LEU A 1 105 ? 29.237  14.447  34.201 1.00 17.62  ? 105  LEU A O   1 
ATOM   794  C  CB  . LEU A 1 105 ? 26.646  15.665  32.649 1.00 20.05  ? 105  LEU A CB  1 
ATOM   795  C  CG  . LEU A 1 105 ? 26.281  15.956  31.197 1.00 28.43  ? 105  LEU A CG  1 
ATOM   796  C  CD1 . LEU A 1 105 ? 25.600  17.310  31.062 1.00 21.78  ? 105  LEU A CD1 1 
ATOM   797  C  CD2 . LEU A 1 105 ? 27.506  15.902  30.300 1.00 22.60  ? 105  LEU A CD2 1 
ATOM   798  N  N   . LEU A 1 106 ? 27.351  14.401  35.425 1.00 9.76   ? 106  LEU A N   1 
ATOM   799  C  CA  . LEU A 1 106 ? 28.099  14.453  36.688 1.00 17.75  ? 106  LEU A CA  1 
ATOM   800  C  C   . LEU A 1 106 ? 28.958  13.214  36.901 1.00 21.32  ? 106  LEU A C   1 
ATOM   801  O  O   . LEU A 1 106 ? 30.104  13.306  37.359 1.00 20.44  ? 106  LEU A O   1 
ATOM   802  C  CB  . LEU A 1 106 ? 27.128  14.614  37.860 1.00 17.25  ? 106  LEU A CB  1 
ATOM   803  C  CG  . LEU A 1 106 ? 26.738  16.016  38.306 1.00 33.72  ? 106  LEU A CG  1 
ATOM   804  C  CD1 . LEU A 1 106 ? 25.802  15.947  39.508 1.00 32.21  ? 106  LEU A CD1 1 
ATOM   805  C  CD2 . LEU A 1 106 ? 27.965  16.856  38.631 1.00 27.05  ? 106  LEU A CD2 1 
ATOM   806  N  N   . VAL A 1 107 ? 28.428  12.029  36.572 1.00 14.11  ? 107  VAL A N   1 
ATOM   807  C  CA  . VAL A 1 107 ? 29.239  10.810  36.683 1.00 12.56  ? 107  VAL A CA  1 
ATOM   808  C  C   . VAL A 1 107 ? 30.440  10.821  35.745 1.00 13.93  ? 107  VAL A C   1 
ATOM   809  O  O   . VAL A 1 107 ? 31.551  10.392  36.078 1.00 12.85  ? 107  VAL A O   1 
ATOM   810  C  CB  . VAL A 1 107 ? 28.364  9.571   36.399 1.00 11.74  ? 107  VAL A CB  1 
ATOM   811  C  CG1 . VAL A 1 107 ? 29.197  8.304   36.356 1.00 15.53  ? 107  VAL A CG1 1 
ATOM   812  C  CG2 . VAL A 1 107 ? 27.281  9.480   37.477 1.00 18.64  ? 107  VAL A CG2 1 
ATOM   813  N  N   . THR A 1 108 ? 30.229  11.320  34.531 1.00 16.50  ? 108  THR A N   1 
ATOM   814  C  CA  . THR A 1 108 ? 31.297  11.449  33.548 1.00 13.09  ? 108  THR A CA  1 
ATOM   815  C  C   . THR A 1 108 ? 32.394  12.375  34.043 1.00 13.54  ? 108  THR A C   1 
ATOM   816  O  O   . THR A 1 108 ? 33.587  12.065  33.995 1.00 17.44  ? 108  THR A O   1 
ATOM   817  C  CB  . THR A 1 108 ? 30.755  11.956  32.198 1.00 19.31  ? 108  THR A CB  1 
ATOM   818  O  OG1 . THR A 1 108 ? 29.715  11.068  31.760 1.00 14.49  ? 108  THR A OG1 1 
ATOM   819  C  CG2 . THR A 1 108 ? 31.864  11.912  31.146 1.00 16.70  ? 108  THR A CG2 1 
ATOM   820  N  N   . LEU A 1 109 ? 32.005  13.528  34.592 1.00 17.14  ? 109  LEU A N   1 
ATOM   821  C  CA  . LEU A 1 109 ? 33.061  14.396  35.119 1.00 19.68  ? 109  LEU A CA  1 
ATOM   822  C  C   . LEU A 1 109 ? 33.777  13.772  36.302 1.00 18.63  ? 109  LEU A C   1 
ATOM   823  O  O   . LEU A 1 109 ? 35.003  13.875  36.432 1.00 18.67  ? 109  LEU A O   1 
ATOM   824  C  CB  . LEU A 1 109 ? 32.439  15.736  35.508 1.00 19.39  ? 109  LEU A CB  1 
ATOM   825  C  CG  . LEU A 1 109 ? 31.728  16.452  34.355 1.00 20.80  ? 109  LEU A CG  1 
ATOM   826  C  CD1 . LEU A 1 109 ? 31.080  17.726  34.872 1.00 29.52  ? 109  LEU A CD1 1 
ATOM   827  C  CD2 . LEU A 1 109 ? 32.712  16.736  33.231 1.00 33.04  ? 109  LEU A CD2 1 
ATOM   828  N  N   . ALA A 1 110 ? 33.031  13.124  37.198 1.00 17.07  ? 110  ALA A N   1 
ATOM   829  C  CA  . ALA A 1 110 ? 33.709  12.485  38.334 1.00 17.62  ? 110  ALA A CA  1 
ATOM   830  C  C   . ALA A 1 110 ? 34.767  11.492  37.883 1.00 18.82  ? 110  ALA A C   1 
ATOM   831  O  O   . ALA A 1 110 ? 35.874  11.413  38.429 1.00 15.29  ? 110  ALA A O   1 
ATOM   832  C  CB  . ALA A 1 110 ? 32.697  11.798  39.237 1.00 15.05  ? 110  ALA A CB  1 
ATOM   833  N  N   . ALA A 1 111 ? 34.429  10.702  36.871 1.00 13.48  ? 111  ALA A N   1 
ATOM   834  C  CA  . ALA A 1 111 ? 35.308  9.662   36.371 1.00 18.24  ? 111  ALA A CA  1 
ATOM   835  C  C   . ALA A 1 111 ? 36.541  10.251  35.684 1.00 20.33  ? 111  ALA A C   1 
ATOM   836  O  O   . ALA A 1 111 ? 37.548  9.558   35.540 1.00 20.12  ? 111  ALA A O   1 
ATOM   837  C  CB  . ALA A 1 111 ? 34.552  8.733   35.422 1.00 19.48  ? 111  ALA A CB  1 
ATOM   838  N  N   . HIS A 1 112 ? 36.486  11.509  35.267 1.00 18.05  ? 112  HIS A N   1 
ATOM   839  C  CA  . HIS A 1 112 ? 37.579  12.085  34.485 1.00 21.66  ? 112  HIS A CA  1 
ATOM   840  C  C   . HIS A 1 112 ? 38.338  13.181  35.225 1.00 19.48  ? 112  HIS A C   1 
ATOM   841  O  O   . HIS A 1 112 ? 39.412  13.596  34.780 1.00 23.29  ? 112  HIS A O   1 
ATOM   842  C  CB  . HIS A 1 112 ? 37.032  12.659  33.170 1.00 16.59  ? 112  HIS A CB  1 
ATOM   843  C  CG  . HIS A 1 112 ? 36.713  11.639  32.124 1.00 19.38  ? 112  HIS A CG  1 
ATOM   844  N  ND1 . HIS A 1 112 ? 37.689  10.976  31.410 1.00 22.35  ? 112  HIS A ND1 1 
ATOM   845  C  CD2 . HIS A 1 112 ? 35.531  11.178  31.646 1.00 21.07  ? 112  HIS A CD2 1 
ATOM   846  C  CE1 . HIS A 1 112 ? 37.128  10.145  30.552 1.00 24.70  ? 112  HIS A CE1 1 
ATOM   847  N  NE2 . HIS A 1 112 ? 35.816  10.249  30.672 1.00 20.79  ? 112  HIS A NE2 1 
ATOM   848  N  N   . LEU A 1 113 ? 37.812  13.673  36.338 1.00 19.82  ? 113  LEU A N   1 
ATOM   849  C  CA  . LEU A 1 113 ? 38.455  14.759  37.068 1.00 20.00  ? 113  LEU A CA  1 
ATOM   850  C  C   . LEU A 1 113 ? 38.744  14.344  38.510 1.00 16.28  ? 113  LEU A C   1 
ATOM   851  O  O   . LEU A 1 113 ? 38.116  14.878  39.426 1.00 27.18  ? 113  LEU A O   1 
ATOM   852  C  CB  . LEU A 1 113 ? 37.600  16.016  37.128 1.00 23.35  ? 113  LEU A CB  1 
ATOM   853  C  CG  . LEU A 1 113 ? 36.899  16.527  35.879 1.00 25.31  ? 113  LEU A CG  1 
ATOM   854  C  CD1 . LEU A 1 113 ? 35.835  17.553  36.255 1.00 29.66  ? 113  LEU A CD1 1 
ATOM   855  C  CD2 . LEU A 1 113 ? 37.903  17.127  34.905 1.00 34.45  ? 113  LEU A CD2 1 
ATOM   856  N  N   . PRO A 1 114 ? 39.662  13.423  38.734 1.00 20.62  ? 114  PRO A N   1 
ATOM   857  C  CA  . PRO A 1 114 ? 39.881  12.970  40.115 1.00 18.90  ? 114  PRO A CA  1 
ATOM   858  C  C   . PRO A 1 114 ? 40.294  14.122  41.025 1.00 23.70  ? 114  PRO A C   1 
ATOM   859  O  O   . PRO A 1 114 ? 39.793  14.247  42.142 1.00 20.83  ? 114  PRO A O   1 
ATOM   860  C  CB  . PRO A 1 114 ? 41.013  11.961  40.002 1.00 17.55  ? 114  PRO A CB  1 
ATOM   861  C  CG  . PRO A 1 114 ? 41.563  12.075  38.622 1.00 16.97  ? 114  PRO A CG  1 
ATOM   862  C  CD  . PRO A 1 114 ? 40.538  12.758  37.763 1.00 23.00  ? 114  PRO A CD  1 
ATOM   863  N  N   . ALA A 1 115 ? 41.222  14.964  40.586 1.00 22.43  ? 115  ALA A N   1 
ATOM   864  C  CA  . ALA A 1 115 ? 41.748  15.990  41.492 1.00 22.54  ? 115  ALA A CA  1 
ATOM   865  C  C   . ALA A 1 115 ? 40.727  17.085  41.745 1.00 20.60  ? 115  ALA A C   1 
ATOM   866  O  O   . ALA A 1 115 ? 40.664  17.654  42.842 1.00 22.25  ? 115  ALA A O   1 
ATOM   867  C  CB  . ALA A 1 115 ? 43.048  16.562  40.934 1.00 20.85  ? 115  ALA A CB  1 
ATOM   868  N  N   . GLU A 1 116 ? 39.917  17.402  40.735 1.00 14.56  ? 116  GLU A N   1 
ATOM   869  C  CA  . GLU A 1 116 ? 39.048  18.577  40.819 1.00 16.64  ? 116  GLU A CA  1 
ATOM   870  C  C   . GLU A 1 116 ? 37.693  18.293  41.457 1.00 19.45  ? 116  GLU A C   1 
ATOM   871  O  O   . GLU A 1 116 ? 37.055  19.237  41.931 1.00 21.84  ? 116  GLU A O   1 
ATOM   872  C  CB  . GLU A 1 116 ? 38.791  19.135  39.414 1.00 17.49  ? 116  GLU A CB  1 
ATOM   873  C  CG  . GLU A 1 116 ? 39.995  19.758  38.729 1.00 24.76  ? 116  GLU A CG  1 
ATOM   874  C  CD  . GLU A 1 116 ? 40.973  18.744  38.180 1.00 29.89  ? 116  GLU A CD  1 
ATOM   875  O  OE1 . GLU A 1 116 ? 40.614  17.557  38.043 1.00 28.38  ? 116  GLU A OE1 1 
ATOM   876  O  OE2 . GLU A 1 116 ? 42.127  19.125  37.882 1.00 33.82  ? 116  GLU A OE2 1 
ATOM   877  N  N   . PHE A 1 117 ? 37.222  17.055  41.414 1.00 18.24  ? 117  PHE A N   1 
ATOM   878  C  CA  . PHE A 1 117 ? 35.837  16.766  41.804 1.00 24.86  ? 117  PHE A CA  1 
ATOM   879  C  C   . PHE A 1 117 ? 35.688  16.622  43.314 1.00 17.86  ? 117  PHE A C   1 
ATOM   880  O  O   . PHE A 1 117 ? 35.377  15.535  43.800 1.00 17.12  ? 117  PHE A O   1 
ATOM   881  C  CB  . PHE A 1 117 ? 35.357  15.500  41.098 1.00 20.46  ? 117  PHE A CB  1 
ATOM   882  C  CG  . PHE A 1 117 ? 33.848  15.298  41.077 1.00 16.40  ? 117  PHE A CG  1 
ATOM   883  C  CD1 . PHE A 1 117 ? 33.053  16.010  40.198 1.00 25.39  ? 117  PHE A CD1 1 
ATOM   884  C  CD2 . PHE A 1 117 ? 33.257  14.399  41.945 1.00 15.20  ? 117  PHE A CD2 1 
ATOM   885  C  CE1 . PHE A 1 117 ? 31.680  15.821  40.177 1.00 23.83  ? 117  PHE A CE1 1 
ATOM   886  C  CE2 . PHE A 1 117 ? 31.883  14.197  41.929 1.00 20.63  ? 117  PHE A CE2 1 
ATOM   887  C  CZ  . PHE A 1 117 ? 31.102  14.921  41.051 1.00 22.58  ? 117  PHE A CZ  1 
ATOM   888  N  N   . THR A 1 118 ? 35.900  17.713  44.035 1.00 17.00  ? 118  THR A N   1 
ATOM   889  C  CA  . THR A 1 118 ? 35.827  17.738  45.497 1.00 18.68  ? 118  THR A CA  1 
ATOM   890  C  C   . THR A 1 118 ? 34.362  17.819  45.912 1.00 17.27  ? 118  THR A C   1 
ATOM   891  O  O   . THR A 1 118 ? 33.522  18.025  45.034 1.00 18.67  ? 118  THR A O   1 
ATOM   892  C  CB  . THR A 1 118 ? 36.599  18.947  46.050 1.00 19.22  ? 118  THR A CB  1 
ATOM   893  O  OG1 . THR A 1 118 ? 35.925  20.163  45.702 1.00 25.27  ? 118  THR A OG1 1 
ATOM   894  C  CG2 . THR A 1 118 ? 37.984  19.048  45.411 1.00 23.93  ? 118  THR A CG2 1 
ATOM   895  N  N   . PRO A 1 119 ? 34.028  17.645  47.182 1.00 19.65  ? 119  PRO A N   1 
ATOM   896  C  CA  . PRO A 1 119 ? 32.635  17.808  47.618 1.00 20.46  ? 119  PRO A CA  1 
ATOM   897  C  C   . PRO A 1 119 ? 32.033  19.142  47.213 1.00 18.40  ? 119  PRO A C   1 
ATOM   898  O  O   . PRO A 1 119 ? 30.887  19.194  46.754 1.00 17.77  ? 119  PRO A O   1 
ATOM   899  C  CB  . PRO A 1 119 ? 32.728  17.692  49.145 1.00 16.59  ? 119  PRO A CB  1 
ATOM   900  C  CG  . PRO A 1 119 ? 33.934  16.841  49.371 1.00 15.04  ? 119  PRO A CG  1 
ATOM   901  C  CD  . PRO A 1 119 ? 34.901  17.218  48.286 1.00 16.72  ? 119  PRO A CD  1 
ATOM   902  N  N   . ALA A 1 120 ? 32.763  20.242  47.374 1.00 17.33  ? 120  ALA A N   1 
ATOM   903  C  CA  . ALA A 1 120 ? 32.146  21.545  47.091 1.00 19.13  ? 120  ALA A CA  1 
ATOM   904  C  C   . ALA A 1 120 ? 31.927  21.774  45.606 1.00 16.45  ? 120  ALA A C   1 
ATOM   905  O  O   . ALA A 1 120 ? 30.926  22.361  45.181 1.00 20.43  ? 120  ALA A O   1 
ATOM   906  C  CB  . ALA A 1 120 ? 32.994  22.655  47.702 1.00 24.16  ? 120  ALA A CB  1 
ATOM   907  N  N   . VAL A 1 121 ? 32.860  21.325  44.787 1.00 16.88  ? 121  VAL A N   1 
ATOM   908  C  CA  . VAL A 1 121 ? 32.748  21.376  43.331 1.00 14.82  ? 121  VAL A CA  1 
ATOM   909  C  C   . VAL A 1 121 ? 31.600  20.488  42.866 1.00 19.84  ? 121  VAL A C   1 
ATOM   910  O  O   . VAL A 1 121 ? 30.802  20.884  42.020 1.00 19.97  ? 121  VAL A O   1 
ATOM   911  C  CB  . VAL A 1 121 ? 34.078  20.961  42.683 1.00 18.92  ? 121  VAL A CB  1 
ATOM   912  C  CG1 . VAL A 1 121 ? 33.937  20.669  41.194 1.00 20.41  ? 121  VAL A CG1 1 
ATOM   913  C  CG2 . VAL A 1 121 ? 35.119  22.050  42.925 1.00 18.37  ? 121  VAL A CG2 1 
ATOM   914  N  N   . HIS A 1 122 ? 31.512  19.281  43.419 1.00 13.18  ? 122  HIS A N   1 
ATOM   915  C  CA  . HIS A 1 122 ? 30.366  18.402  43.168 1.00 15.65  ? 122  HIS A CA  1 
ATOM   916  C  C   . HIS A 1 122 ? 29.069  19.159  43.433 1.00 19.94  ? 122  HIS A C   1 
ATOM   917  O  O   . HIS A 1 122 ? 28.170  19.164  42.584 1.00 17.14  ? 122  HIS A O   1 
ATOM   918  C  CB  . HIS A 1 122 ? 30.488  17.141  44.006 1.00 17.09  ? 122  HIS A CB  1 
ATOM   919  C  CG  . HIS A 1 122 ? 29.439  16.080  43.928 1.00 18.21  ? 122  HIS A CG  1 
ATOM   920  N  ND1 . HIS A 1 122 ? 29.618  14.878  44.589 1.00 16.70  ? 122  HIS A ND1 1 
ATOM   921  C  CD2 . HIS A 1 122 ? 28.220  15.979  43.347 1.00 16.14  ? 122  HIS A CD2 1 
ATOM   922  C  CE1 . HIS A 1 122 ? 28.575  14.095  44.395 1.00 20.71  ? 122  HIS A CE1 1 
ATOM   923  N  NE2 . HIS A 1 122 ? 27.702  14.738  43.635 1.00 13.83  ? 122  HIS A NE2 1 
ATOM   924  N  N   . ALA A 1 123 ? 28.941  19.788  44.594 1.00 15.21  ? 123  ALA A N   1 
ATOM   925  C  CA  . ALA A 1 123 ? 27.743  20.548  44.932 1.00 17.38  ? 123  ALA A CA  1 
ATOM   926  C  C   . ALA A 1 123 ? 27.499  21.632  43.883 1.00 18.00  ? 123  ALA A C   1 
ATOM   927  O  O   . ALA A 1 123 ? 26.377  21.791  43.403 1.00 19.05  ? 123  ALA A O   1 
ATOM   928  C  CB  . ALA A 1 123 ? 27.857  21.160  46.316 1.00 16.78  ? 123  ALA A CB  1 
ATOM   929  N  N   . SER A 1 124 ? 28.549  22.369  43.522 1.00 15.92  ? 124  SER A N   1 
ATOM   930  C  CA  . SER A 1 124 ? 28.399  23.494  42.599 1.00 18.73  ? 124  SER A CA  1 
ATOM   931  C  C   . SER A 1 124 ? 27.982  23.027  41.203 1.00 17.64  ? 124  SER A C   1 
ATOM   932  O  O   . SER A 1 124 ? 27.177  23.652  40.521 1.00 18.46  ? 124  SER A O   1 
ATOM   933  C  CB  . SER A 1 124 ? 29.720  24.266  42.507 1.00 19.49  ? 124  SER A CB  1 
ATOM   934  O  OG  . SER A 1 124 ? 29.976  25.002  43.695 1.00 18.62  ? 124  SER A OG  1 
ATOM   935  N  N   . LEU A 1 125 ? 28.555  21.910  40.758 1.00 14.82  ? 125  LEU A N   1 
ATOM   936  C  CA  . LEU A 1 125 ? 28.259  21.405  39.421 1.00 21.19  ? 125  LEU A CA  1 
ATOM   937  C  C   . LEU A 1 125 ? 26.818  20.901  39.352 1.00 19.31  ? 125  LEU A C   1 
ATOM   938  O  O   . LEU A 1 125 ? 26.138  21.107  38.348 1.00 16.24  ? 125  LEU A O   1 
ATOM   939  C  CB  . LEU A 1 125 ? 29.245  20.303  39.050 1.00 16.58  ? 125  LEU A CB  1 
ATOM   940  C  CG  . LEU A 1 125 ? 30.669  20.717  38.658 1.00 20.21  ? 125  LEU A CG  1 
ATOM   941  C  CD1 . LEU A 1 125 ? 31.588  19.495  38.624 1.00 18.83  ? 125  LEU A CD1 1 
ATOM   942  C  CD2 . LEU A 1 125 ? 30.653  21.414  37.309 1.00 22.54  ? 125  LEU A CD2 1 
ATOM   943  N  N   . ASP A 1 126 ? 26.346  20.273  40.430 1.00 18.42  ? 126  ASP A N   1 
ATOM   944  C  CA  . ASP A 1 126 ? 24.968  19.785  40.469 1.00 17.68  ? 126  ASP A CA  1 
ATOM   945  C  C   . ASP A 1 126 ? 23.986  20.948  40.376 1.00 16.15  ? 126  ASP A C   1 
ATOM   946  O  O   . ASP A 1 126 ? 22.982  20.891  39.655 1.00 17.48  ? 126  ASP A O   1 
ATOM   947  C  CB  . ASP A 1 126 ? 24.734  18.979  41.749 1.00 15.67  ? 126  ASP A CB  1 
ATOM   948  C  CG  . ASP A 1 126 ? 23.472  18.148  41.683 1.00 23.55  ? 126  ASP A CG  1 
ATOM   949  O  OD1 . ASP A 1 126 ? 23.448  17.202  40.866 1.00 26.25  ? 126  ASP A OD1 1 
ATOM   950  O  OD2 . ASP A 1 126 ? 22.524  18.453  42.431 1.00 25.11  ? 126  ASP A OD2 1 
ATOM   951  N  N   . LYS A 1 127 ? 24.276  22.027  41.101 1.00 14.08  ? 127  LYS A N   1 
ATOM   952  C  CA  . LYS A 1 127 ? 23.447  23.212  41.063 1.00 14.95  ? 127  LYS A CA  1 
ATOM   953  C  C   . LYS A 1 127 ? 23.425  23.833  39.668 1.00 22.23  ? 127  LYS A C   1 
ATOM   954  O  O   . LYS A 1 127 ? 22.365  24.260  39.208 1.00 19.07  ? 127  LYS A O   1 
ATOM   955  C  CB  . LYS A 1 127 ? 23.937  24.272  42.060 1.00 20.21  ? 127  LYS A CB  1 
ATOM   956  C  CG  . LYS A 1 127 ? 23.651  23.865  43.501 1.00 19.57  ? 127  LYS A CG  1 
ATOM   957  C  CD  . LYS A 1 127 ? 24.019  24.972  44.460 1.00 23.27  ? 127  LYS A CD  1 
ATOM   958  C  CE  . LYS A 1 127 ? 23.361  26.297  44.103 1.00 24.69  ? 127  LYS A CE  1 
ATOM   959  N  NZ  . LYS A 1 127 ? 23.853  27.369  45.026 1.00 36.15  ? 127  LYS A NZ  1 
ATOM   960  N  N   . PHE A 1 128 ? 24.592  23.875  39.042 1.00 16.18  ? 128  PHE A N   1 
ATOM   961  C  CA  . PHE A 1 128 ? 24.748  24.463  37.715 1.00 15.12  ? 128  PHE A CA  1 
ATOM   962  C  C   . PHE A 1 128 ? 23.897  23.697  36.709 1.00 19.83  ? 128  PHE A C   1 
ATOM   963  O  O   . PHE A 1 128 ? 23.157  24.285  35.922 1.00 16.70  ? 128  PHE A O   1 
ATOM   964  C  CB  . PHE A 1 128 ? 26.218  24.442  37.294 1.00 15.65  ? 128  PHE A CB  1 
ATOM   965  C  CG  . PHE A 1 128 ? 26.446  24.757  35.819 1.00 13.38  ? 128  PHE A CG  1 
ATOM   966  C  CD1 . PHE A 1 128 ? 26.193  26.048  35.364 1.00 22.65  ? 128  PHE A CD1 1 
ATOM   967  C  CD2 . PHE A 1 128 ? 26.885  23.812  34.924 1.00 24.18  ? 128  PHE A CD2 1 
ATOM   968  C  CE1 . PHE A 1 128 ? 26.379  26.368  34.030 1.00 30.49  ? 128  PHE A CE1 1 
ATOM   969  C  CE2 . PHE A 1 128 ? 27.081  24.124  33.586 1.00 31.40  ? 128  PHE A CE2 1 
ATOM   970  C  CZ  . PHE A 1 128 ? 26.833  25.408  33.140 1.00 22.80  ? 128  PHE A CZ  1 
ATOM   971  N  N   . LEU A 1 129 ? 24.000  22.369  36.756 1.00 17.49  ? 129  LEU A N   1 
ATOM   972  C  CA  . LEU A 1 129 ? 23.249  21.563  35.790 1.00 14.25  ? 129  LEU A CA  1 
ATOM   973  C  C   . LEU A 1 129 ? 21.755  21.678  36.038 1.00 18.28  ? 129  LEU A C   1 
ATOM   974  O  O   . LEU A 1 129 ? 20.956  21.705  35.097 1.00 19.12  ? 129  LEU A O   1 
ATOM   975  C  CB  . LEU A 1 129 ? 23.710  20.100  35.850 1.00 14.32  ? 129  LEU A CB  1 
ATOM   976  C  CG  . LEU A 1 129 ? 25.142  19.867  35.350 1.00 18.34  ? 129  LEU A CG  1 
ATOM   977  C  CD1 . LEU A 1 129 ? 25.631  18.477  35.712 1.00 26.54  ? 129  LEU A CD1 1 
ATOM   978  C  CD2 . LEU A 1 129 ? 25.206  20.092  33.845 1.00 23.77  ? 129  LEU A CD2 1 
ATOM   979  N  N   . ALA A 1 130 ? 21.357  21.774  37.305 1.00 14.81  ? 130  ALA A N   1 
ATOM   980  C  CA  . ALA A 1 130 ? 19.950  22.024  37.627 1.00 18.89  ? 130  ALA A CA  1 
ATOM   981  C  C   . ALA A 1 130 ? 19.455  23.350  37.065 1.00 22.97  ? 130  ALA A C   1 
ATOM   982  O  O   . ALA A 1 130 ? 18.340  23.469  36.543 1.00 19.41  ? 130  ALA A O   1 
ATOM   983  C  CB  . ALA A 1 130 ? 19.744  21.992  39.135 1.00 19.42  ? 130  ALA A CB  1 
ATOM   984  N  N   . SER A 1 131 ? 20.284  24.389  37.154 1.00 17.85  ? 131  SER A N   1 
ATOM   985  C  CA  . SER A 1 131 ? 19.891  25.690  36.625 1.00 21.74  ? 131  SER A CA  1 
ATOM   986  C  C   . SER A 1 131 ? 19.769  25.632  35.106 1.00 23.47  ? 131  SER A C   1 
ATOM   987  O  O   . SER A 1 131 ? 18.812  26.178  34.558 1.00 21.79  ? 131  SER A O   1 
ATOM   988  C  CB  . SER A 1 131 ? 20.893  26.771  37.036 1.00 25.97  ? 131  SER A CB  1 
ATOM   989  O  OG  . SER A 1 131 ? 20.976  26.851  38.450 1.00 36.33  ? 131  SER A OG  1 
ATOM   990  N  N   . VAL A 1 132 ? 20.713  24.946  34.458 1.00 16.37  ? 132  VAL A N   1 
ATOM   991  C  CA  . VAL A 1 132 ? 20.635  24.793  32.996 1.00 14.34  ? 132  VAL A CA  1 
ATOM   992  C  C   . VAL A 1 132 ? 19.326  24.092  32.629 1.00 16.12  ? 132  VAL A C   1 
ATOM   993  O  O   . VAL A 1 132 ? 18.613  24.527  31.717 1.00 21.17  ? 132  VAL A O   1 
ATOM   994  C  CB  . VAL A 1 132 ? 21.840  24.021  32.451 1.00 21.43  ? 132  VAL A CB  1 
ATOM   995  C  CG1 . VAL A 1 132 ? 21.658  23.614  30.993 1.00 20.92  ? 132  VAL A CG1 1 
ATOM   996  C  CG2 . VAL A 1 132 ? 23.114  24.849  32.623 1.00 20.73  ? 132  VAL A CG2 1 
ATOM   997  N  N   . SER A 1 133 ? 19.005  23.026  33.351 1.00 17.13  ? 133  SER A N   1 
ATOM   998  C  CA  . SER A 1 133 ? 17.788  22.253  33.080 1.00 14.38  ? 133  SER A CA  1 
ATOM   999  C  C   . SER A 1 133 ? 16.540  23.112  33.233 1.00 25.30  ? 133  SER A C   1 
ATOM   1000 O  O   . SER A 1 133 ? 15.614  23.024  32.423 1.00 20.13  ? 133  SER A O   1 
ATOM   1001 C  CB  . SER A 1 133 ? 17.721  21.044  34.012 1.00 17.00  ? 133  SER A CB  1 
ATOM   1002 O  OG  . SER A 1 133 ? 18.750  20.128  33.671 1.00 22.21  ? 133  SER A OG  1 
ATOM   1003 N  N   . THR A 1 134 ? 16.531  23.929  34.278 1.00 18.90  ? 134  THR A N   1 
ATOM   1004 C  CA  . THR A 1 134 ? 15.454  24.865  34.540 1.00 23.51  ? 134  THR A CA  1 
ATOM   1005 C  C   . THR A 1 134 ? 15.301  25.861  33.400 1.00 19.56  ? 134  THR A C   1 
ATOM   1006 O  O   . THR A 1 134 ? 14.183  26.158  32.992 1.00 20.79  ? 134  THR A O   1 
ATOM   1007 C  CB  . THR A 1 134 ? 15.706  25.643  35.851 1.00 21.48  ? 134  THR A CB  1 
ATOM   1008 O  OG1 . THR A 1 134 ? 15.571  24.748  36.962 1.00 25.30  ? 134  THR A OG1 1 
ATOM   1009 C  CG2 . THR A 1 134 ? 14.678  26.749  36.011 1.00 29.17  ? 134  THR A CG2 1 
ATOM   1010 N  N   . VAL A 1 135 ? 16.405  26.397  32.885 1.00 18.26  ? 135  VAL A N   1 
ATOM   1011 C  CA  . VAL A 1 135 ? 16.304  27.370  31.791 1.00 19.81  ? 135  VAL A CA  1 
ATOM   1012 C  C   . VAL A 1 135 ? 15.789  26.706  30.523 1.00 22.22  ? 135  VAL A C   1 
ATOM   1013 O  O   . VAL A 1 135 ? 14.981  27.266  29.778 1.00 21.38  ? 135  VAL A O   1 
ATOM   1014 C  CB  . VAL A 1 135 ? 17.656  28.054  31.518 1.00 25.84  ? 135  VAL A CB  1 
ATOM   1015 C  CG1 . VAL A 1 135 ? 17.628  28.852  30.221 1.00 29.61  ? 135  VAL A CG1 1 
ATOM   1016 C  CG2 . VAL A 1 135 ? 18.025  28.954  32.690 1.00 24.88  ? 135  VAL A CG2 1 
ATOM   1017 N  N   . LEU A 1 136 ? 16.244  25.483  30.269 1.00 19.28  ? 136  LEU A N   1 
ATOM   1018 C  CA  . LEU A 1 136 ? 15.850  24.784  29.051 1.00 21.67  ? 136  LEU A CA  1 
ATOM   1019 C  C   . LEU A 1 136 ? 14.390  24.354  29.073 1.00 21.20  ? 136  LEU A C   1 
ATOM   1020 O  O   . LEU A 1 136 ? 13.791  24.078  28.034 1.00 22.60  ? 136  LEU A O   1 
ATOM   1021 C  CB  . LEU A 1 136 ? 16.764  23.566  28.830 1.00 20.20  ? 136  LEU A CB  1 
ATOM   1022 C  CG  . LEU A 1 136 ? 18.165  23.917  28.310 1.00 23.73  ? 136  LEU A CG  1 
ATOM   1023 C  CD1 . LEU A 1 136 ? 19.033  22.674  28.195 1.00 29.23  ? 136  LEU A CD1 1 
ATOM   1024 C  CD2 . LEU A 1 136 ? 18.064  24.646  26.979 1.00 30.38  ? 136  LEU A CD2 1 
ATOM   1025 N  N   . THR A 1 137 ? 13.797  24.269  30.260 1.00 19.70  ? 137  THR A N   1 
ATOM   1026 C  CA  . THR A 1 137 ? 12.397  23.851  30.304 1.00 24.99  ? 137  THR A CA  1 
ATOM   1027 C  C   . THR A 1 137 ? 11.486  25.035  30.609 1.00 19.39  ? 137  THR A C   1 
ATOM   1028 O  O   . THR A 1 137 ? 10.290  24.818  30.777 1.00 23.60  ? 137  THR A O   1 
ATOM   1029 C  CB  . THR A 1 137 ? 12.135  22.749  31.346 1.00 17.69  ? 137  THR A CB  1 
ATOM   1030 O  OG1 . THR A 1 137 ? 12.623  23.142  32.630 1.00 24.07  ? 137  THR A OG1 1 
ATOM   1031 C  CG2 . THR A 1 137 ? 12.892  21.471  30.997 1.00 19.22  ? 137  THR A CG2 1 
ATOM   1032 N  N   . SER A 1 138 ? 12.043  26.242  30.697 1.00 18.65  ? 138  SER A N   1 
ATOM   1033 C  CA  . SER A 1 138 ? 11.282  27.390  31.176 1.00 20.95  ? 138  SER A CA  1 
ATOM   1034 C  C   . SER A 1 138 ? 10.217  27.853  30.198 1.00 22.48  ? 138  SER A C   1 
ATOM   1035 O  O   . SER A 1 138 ? 9.308   28.605  30.562 1.00 26.87  ? 138  SER A O   1 
ATOM   1036 C  CB  . SER A 1 138 ? 12.221  28.564  31.492 1.00 24.27  ? 138  SER A CB  1 
ATOM   1037 O  OG  . SER A 1 138 ? 12.937  28.980  30.344 1.00 29.09  ? 138  SER A OG  1 
ATOM   1038 N  N   . LYS A 1 139 ? 10.288  27.451  28.927 1.00 21.08  ? 139  LYS A N   1 
ATOM   1039 C  CA  . LYS A 1 139 ? 9.251   27.923  28.006 1.00 22.86  ? 139  LYS A CA  1 
ATOM   1040 C  C   . LYS A 1 139 ? 8.260   26.816  27.654 1.00 22.85  ? 139  LYS A C   1 
ATOM   1041 O  O   . LYS A 1 139 ? 7.463   27.006  26.736 1.00 19.22  ? 139  LYS A O   1 
ATOM   1042 C  CB  . LYS A 1 139 ? 9.879   28.472  26.725 1.00 23.64  ? 139  LYS A CB  1 
ATOM   1043 C  CG  . LYS A 1 139 ? 10.755  29.692  26.933 1.00 23.29  ? 139  LYS A CG  1 
ATOM   1044 C  CD  . LYS A 1 139 ? 11.371  30.154  25.619 1.00 34.89  ? 139  LYS A CD  1 
ATOM   1045 C  CE  . LYS A 1 139 ? 12.319  31.322  25.844 1.00 41.99  ? 139  LYS A CE  1 
ATOM   1046 N  NZ  . LYS A 1 139 ? 13.522  31.245  24.973 1.00 38.18  ? 139  LYS A NZ  1 
ATOM   1047 N  N   . TYR A 1 140 ? 8.312   25.683  28.349 1.00 19.04  ? 140  TYR A N   1 
ATOM   1048 C  CA  . TYR A 1 140 ? 7.392   24.592  28.026 1.00 19.29  ? 140  TYR A CA  1 
ATOM   1049 C  C   . TYR A 1 140 ? 5.948   25.064  28.243 1.00 22.26  ? 140  TYR A C   1 
ATOM   1050 O  O   . TYR A 1 140 ? 5.089   24.692  27.450 1.00 23.32  ? 140  TYR A O   1 
ATOM   1051 C  CB  . TYR A 1 140 ? 7.662   23.350  28.868 1.00 16.76  ? 140  TYR A CB  1 
ATOM   1052 C  CG  . TYR A 1 140 ? 8.755   22.459  28.320 1.00 21.85  ? 140  TYR A CG  1 
ATOM   1053 C  CD1 . TYR A 1 140 ? 10.007  22.932  27.947 1.00 18.66  ? 140  TYR A CD1 1 
ATOM   1054 C  CD2 . TYR A 1 140 ? 8.522   21.095  28.187 1.00 26.59  ? 140  TYR A CD2 1 
ATOM   1055 C  CE1 . TYR A 1 140 ? 10.980  22.069  27.450 1.00 16.77  ? 140  TYR A CE1 1 
ATOM   1056 C  CE2 . TYR A 1 140 ? 9.481   20.237  27.695 1.00 26.24  ? 140  TYR A CE2 1 
ATOM   1057 C  CZ  . TYR A 1 140 ? 10.717  20.731  27.324 1.00 20.09  ? 140  TYR A CZ  1 
ATOM   1058 O  OH  . TYR A 1 140 ? 11.662  19.852  26.842 1.00 19.48  ? 140  TYR A OH  1 
ATOM   1059 N  N   . ARG A 1 141 ? 5.780   25.835  29.309 1.00 22.31  ? 141  ARG A N   1 
ATOM   1060 C  CA  . ARG A 1 141 ? 4.534   26.451  29.721 1.00 42.41  ? 141  ARG A CA  1 
ATOM   1061 C  C   . ARG A 1 141 ? 4.720   27.933  30.056 1.00 36.19  ? 141  ARG A C   1 
ATOM   1062 O  O   . ARG A 1 141 ? 3.722   28.654  30.088 1.00 39.77  ? 141  ARG A O   1 
ATOM   1063 C  CB  . ARG A 1 141 ? 3.929   25.737  30.934 1.00 40.33  ? 141  ARG A CB  1 
ATOM   1064 C  CG  . ARG A 1 141 ? 3.732   24.245  30.746 1.00 27.03  ? 141  ARG A CG  1 
ATOM   1065 C  CD  . ARG A 1 141 ? 2.690   23.709  31.715 1.00 20.46  ? 141  ARG A CD  1 
ATOM   1066 N  NE  . ARG A 1 141 ? 3.160   23.729  33.103 1.00 23.49  ? 141  ARG A NE  1 
ATOM   1067 C  CZ  . ARG A 1 141 ? 2.474   23.121  34.067 1.00 29.31  ? 141  ARG A CZ  1 
ATOM   1068 N  NH1 . ARG A 1 141 ? 1.347   22.485  33.753 1.00 21.29  ? 141  ARG A NH1 1 
ATOM   1069 N  NH2 . ARG A 1 141 ? 2.889   23.131  35.325 1.00 25.92  ? 141  ARG A NH2 1 
ATOM   1070 N  N   . GLY A 1 142 ? 5.952   28.360  30.295 1.00 41.23  ? 142  GLY A N   1 
ATOM   1071 C  CA  . GLY A 1 142 ? 6.331   29.742  30.502 1.00 35.59  ? 142  GLY A CA  1 
ATOM   1072 C  C   . GLY A 1 142 ? 5.877   30.375  31.796 1.00 39.24  ? 142  GLY A C   1 
ATOM   1073 O  O   . GLY A 1 142 ? 5.350   29.711  32.691 1.00 40.93  ? 142  GLY A O   1 
ATOM   1074 N  N   . VAL A 1 143 ? 6.076   31.687  31.921 1.00 34.01  ? 143  VAL A N   1 
ATOM   1075 C  CA  . VAL A 1 143 ? 5.659   32.444  33.100 1.00 41.31  ? 143  VAL A CA  1 
ATOM   1076 C  C   . VAL A 1 143 ? 4.151   32.466  33.271 1.00 25.54  ? 143  VAL A C   1 
ATOM   1077 O  O   . VAL A 1 143 ? 3.403   32.078  32.367 1.00 35.62  ? 143  VAL A O   1 
ATOM   1078 C  CB  . VAL A 1 143 ? 6.176   33.896  32.999 1.00 53.14  ? 143  VAL A CB  1 
ATOM   1079 C  CG1 . VAL A 1 143 ? 6.144   34.588  34.352 1.00 78.18  ? 143  VAL A CG1 1 
ATOM   1080 C  CG2 . VAL A 1 143 ? 7.585   33.911  32.423 1.00 58.20  ? 143  VAL A CG2 1 
ATOM   1081 N  N   . LEU A 1 144 ? 3.646   32.933  34.418 1.00 26.42  ? 144  LEU A N   1 
ATOM   1082 C  CA  . LEU A 1 144 ? 2.190   33.089  34.508 1.00 25.84  ? 144  LEU A CA  1 
ATOM   1083 C  C   . LEU A 1 144 ? 1.738   34.250  33.619 1.00 26.58  ? 144  LEU A C   1 
ATOM   1084 O  O   . LEU A 1 144 ? 2.091   35.400  33.886 1.00 25.95  ? 144  LEU A O   1 
ATOM   1085 C  CB  . LEU A 1 144 ? 1.733   33.347  35.939 1.00 28.62  ? 144  LEU A CB  1 
ATOM   1086 C  CG  . LEU A 1 144 ? 2.008   32.267  36.982 1.00 29.75  ? 144  LEU A CG  1 
ATOM   1087 C  CD1 . LEU A 1 144 ? 1.854   32.837  38.389 1.00 27.34  ? 144  LEU A CD1 1 
ATOM   1088 C  CD2 . LEU A 1 144 ? 1.105   31.059  36.783 1.00 23.27  ? 144  LEU A CD2 1 
ATOM   1089 N  N   . SER A 1 145 ? 0.973   33.966  32.582 1.00 27.50  ? 145  SER A N   1 
ATOM   1090 C  CA  . SER A 1 145 ? 0.423   34.994  31.696 1.00 26.72  ? 145  SER A CA  1 
ATOM   1091 C  C   . SER A 1 145 ? -0.703  35.773  32.348 1.00 27.95  ? 145  SER A C   1 
ATOM   1092 O  O   . SER A 1 145 ? -1.252  35.391  33.384 1.00 21.07  ? 145  SER A O   1 
ATOM   1093 C  CB  . SER A 1 145 ? -0.060  34.309  30.405 1.00 22.92  ? 145  SER A CB  1 
ATOM   1094 O  OG  . SER A 1 145 ? -1.301  33.662  30.645 1.00 30.82  ? 145  SER A OG  1 
ATOM   1095 N  N   . PRO A 1 146 ? -1.126  36.909  31.786 1.00 25.81  ? 146  PRO A N   1 
ATOM   1096 C  CA  . PRO A 1 146 ? -2.240  37.630  32.406 1.00 23.27  ? 146  PRO A CA  1 
ATOM   1097 C  C   . PRO A 1 146 ? -3.498  36.769  32.391 1.00 19.82  ? 146  PRO A C   1 
ATOM   1098 O  O   . PRO A 1 146 ? -4.323  36.886  33.296 1.00 21.94  ? 146  PRO A O   1 
ATOM   1099 C  CB  . PRO A 1 146 ? -2.431  38.855  31.511 1.00 32.83  ? 146  PRO A CB  1 
ATOM   1100 C  CG  . PRO A 1 146 ? -1.164  38.970  30.731 1.00 35.27  ? 146  PRO A CG  1 
ATOM   1101 C  CD  . PRO A 1 146 ? -0.628  37.572  30.577 1.00 29.47  ? 146  PRO A CD  1 
ATOM   1102 N  N   . ALA A 1 147 ? -3.649  35.906  31.377 1.00 19.61  ? 147  ALA A N   1 
ATOM   1103 C  CA  . ALA A 1 147 ? -4.812  35.022  31.408 1.00 22.54  ? 147  ALA A CA  1 
ATOM   1104 C  C   . ALA A 1 147 ? -4.721  34.027  32.571 1.00 23.70  ? 147  ALA A C   1 
ATOM   1105 O  O   . ALA A 1 147 ? -5.750  33.730  33.186 1.00 17.18  ? 147  ALA A O   1 
ATOM   1106 C  CB  . ALA A 1 147 ? -5.008  34.270  30.109 1.00 23.85  ? 147  ALA A CB  1 
ATOM   1107 N  N   . ASP A 1 148 ? -3.538  33.507  32.855 1.00 23.96  ? 148  ASP A N   1 
ATOM   1108 C  CA  . ASP A 1 148 ? -3.366  32.605  33.990 1.00 19.59  ? 148  ASP A CA  1 
ATOM   1109 C  C   . ASP A 1 148 ? -3.727  33.323  35.288 1.00 17.92  ? 148  ASP A C   1 
ATOM   1110 O  O   . ASP A 1 148 ? -4.451  32.796  36.126 1.00 19.48  ? 148  ASP A O   1 
ATOM   1111 C  CB  . ASP A 1 148 ? -1.932  32.099  34.115 1.00 22.96  ? 148  ASP A CB  1 
ATOM   1112 C  CG  . ASP A 1 148 ? -1.500  31.144  33.025 1.00 22.34  ? 148  ASP A CG  1 
ATOM   1113 O  OD1 . ASP A 1 148 ? -2.283  30.247  32.642 1.00 22.39  ? 148  ASP A OD1 1 
ATOM   1114 O  OD2 . ASP A 1 148 ? -0.351  31.294  32.562 1.00 24.01  ? 148  ASP A OD2 1 
ATOM   1115 N  N   . LYS A 1 149 ? -3.182  34.531  35.444 1.00 17.81  ? 149  LYS A N   1 
ATOM   1116 C  CA  . LYS A 1 149 ? -3.422  35.259  36.688 1.00 19.92  ? 149  LYS A CA  1 
ATOM   1117 C  C   . LYS A 1 149 ? -4.901  35.514  36.929 1.00 22.00  ? 149  LYS A C   1 
ATOM   1118 O  O   . LYS A 1 149 ? -5.375  35.410  38.060 1.00 16.44  ? 149  LYS A O   1 
ATOM   1119 C  CB  . LYS A 1 149 ? -2.649  36.585  36.685 1.00 27.75  ? 149  LYS A CB  1 
ATOM   1120 C  CG  . LYS A 1 149 ? -1.159  36.373  36.951 1.00 32.91  ? 149  LYS A CG  1 
ATOM   1121 C  CD  . LYS A 1 149 ? -0.371  37.660  36.768 1.00 36.34  ? 149  LYS A CD  1 
ATOM   1122 C  CE  . LYS A 1 149 ? 0.949   37.390  36.061 1.00 37.50  ? 149  LYS A CE  1 
ATOM   1123 N  NZ  . LYS A 1 149 ? 1.925   38.488  36.315 1.00 40.11  ? 149  LYS A NZ  1 
ATOM   1124 N  N   . THR A 1 150 ? -5.608  35.846  35.852 1.00 19.07  ? 150  THR A N   1 
ATOM   1125 C  CA  . THR A 1 150 ? -7.055  36.031  35.879 1.00 17.53  ? 150  THR A CA  1 
ATOM   1126 C  C   . THR A 1 150 ? -7.762  34.744  36.285 1.00 18.68  ? 150  THR A C   1 
ATOM   1127 O  O   . THR A 1 150 ? -8.613  34.724  37.179 1.00 19.78  ? 150  THR A O   1 
ATOM   1128 C  CB  . THR A 1 150 ? -7.534  36.499  34.487 1.00 25.81  ? 150  THR A CB  1 
ATOM   1129 O  OG1 . THR A 1 150 ? -6.930  37.771  34.213 1.00 29.71  ? 150  THR A OG1 1 
ATOM   1130 C  CG2 . THR A 1 150 ? -9.037  36.700  34.450 1.00 23.43  ? 150  THR A CG2 1 
ATOM   1131 N  N   . ASN A 1 151 ? -7.399  33.632  35.652 1.00 20.57  ? 151  ASN A N   1 
ATOM   1132 C  CA  . ASN A 1 151 ? -8.011  32.339  35.980 1.00 17.46  ? 151  ASN A CA  1 
ATOM   1133 C  C   . ASN A 1 151 ? -7.749  31.975  37.440 1.00 21.05  ? 151  ASN A C   1 
ATOM   1134 O  O   . ASN A 1 151 ? -8.649  31.506  38.133 1.00 21.65  ? 151  ASN A O   1 
ATOM   1135 C  CB  . ASN A 1 151 ? -7.475  31.243  35.066 1.00 18.46  ? 151  ASN A CB  1 
ATOM   1136 C  CG  . ASN A 1 151 ? -8.034  31.274  33.656 1.00 21.47  ? 151  ASN A CG  1 
ATOM   1137 O  OD1 . ASN A 1 151 ? -9.096  31.843  33.394 1.00 22.99  ? 151  ASN A OD1 1 
ATOM   1138 N  ND2 . ASN A 1 151 ? -7.322  30.656  32.724 1.00 19.97  ? 151  ASN A ND2 1 
ATOM   1139 N  N   . VAL A 1 152 ? -6.525  32.182  37.925 1.00 18.13  ? 152  VAL A N   1 
ATOM   1140 C  CA  . VAL A 1 152 ? -6.221  31.820  39.312 1.00 17.53  ? 152  VAL A CA  1 
ATOM   1141 C  C   . VAL A 1 152 ? -7.023  32.664  40.292 1.00 20.38  ? 152  VAL A C   1 
ATOM   1142 O  O   . VAL A 1 152 ? -7.642  32.139  41.220 1.00 23.84  ? 152  VAL A O   1 
ATOM   1143 C  CB  . VAL A 1 152 ? -4.718  31.937  39.611 1.00 19.42  ? 152  VAL A CB  1 
ATOM   1144 C  CG1 . VAL A 1 152 ? -4.426  31.677  41.082 1.00 23.95  ? 152  VAL A CG1 1 
ATOM   1145 C  CG2 . VAL A 1 152 ? -3.956  30.936  38.740 1.00 18.35  ? 152  VAL A CG2 1 
ATOM   1146 N  N   . LYS A 1 153 ? -7.050  33.982  40.084 1.00 24.54  ? 153  LYS A N   1 
ATOM   1147 C  CA  . LYS A 1 153 ? -7.816  34.851  40.979 1.00 20.95  ? 153  LYS A CA  1 
ATOM   1148 C  C   . LYS A 1 153 ? -9.302  34.543  40.932 1.00 23.51  ? 153  LYS A C   1 
ATOM   1149 O  O   . LYS A 1 153 ? -9.995  34.578  41.955 1.00 26.45  ? 153  LYS A O   1 
ATOM   1150 C  CB  . LYS A 1 153 ? -7.555  36.318  40.650 1.00 20.37  ? 153  LYS A CB  1 
ATOM   1151 C  CG  . LYS A 1 153 ? -6.126  36.763  40.942 1.00 21.62  ? 153  LYS A CG  1 
ATOM   1152 C  CD  . LYS A 1 153 ? -6.002  38.276  40.867 1.00 36.87  ? 153  LYS A CD  1 
ATOM   1153 C  CE  . LYS A 1 153 ? -4.849  38.708  39.978 1.00 49.27  ? 153  LYS A CE  1 
ATOM   1154 N  NZ  . LYS A 1 153 ? -4.782  37.919  38.716 1.00 71.91  ? 153  LYS A NZ  1 
ATOM   1155 N  N   . ALA A 1 154 ? -9.819  34.207  39.751 1.00 29.92  ? 154  ALA A N   1 
ATOM   1156 C  CA  . ALA A 1 154 ? -11.229 33.826  39.675 1.00 25.72  ? 154  ALA A CA  1 
ATOM   1157 C  C   . ALA A 1 154 ? -11.498 32.563  40.485 1.00 28.69  ? 154  ALA A C   1 
ATOM   1158 O  O   . ALA A 1 154 ? -12.426 32.558  41.295 1.00 25.15  ? 154  ALA A O   1 
ATOM   1159 C  CB  . ALA A 1 154 ? -11.679 33.647  38.236 1.00 29.56  ? 154  ALA A CB  1 
ATOM   1160 N  N   . ALA A 1 155 ? -10.725 31.495  40.273 1.00 20.50  ? 155  ALA A N   1 
ATOM   1161 C  CA  . ALA A 1 155 ? -11.001 30.257  40.997 1.00 19.61  ? 155  ALA A CA  1 
ATOM   1162 C  C   . ALA A 1 155 ? -10.845 30.414  42.503 1.00 22.28  ? 155  ALA A C   1 
ATOM   1163 O  O   . ALA A 1 155 ? -11.622 29.890  43.304 1.00 22.10  ? 155  ALA A O   1 
ATOM   1164 C  CB  . ALA A 1 155 ? -10.094 29.132  40.514 1.00 29.17  ? 155  ALA A CB  1 
ATOM   1165 N  N   . TRP A 1 156 ? -9.791  31.120  42.917 1.00 23.41  ? 156  TRP A N   1 
ATOM   1166 C  CA  . TRP A 1 156 ? -9.549  31.259  44.353 1.00 23.65  ? 156  TRP A CA  1 
ATOM   1167 C  C   . TRP A 1 156 ? -10.592 32.146  45.014 1.00 24.66  ? 156  TRP A C   1 
ATOM   1168 O  O   . TRP A 1 156 ? -11.001 31.899  46.153 1.00 31.87  ? 156  TRP A O   1 
ATOM   1169 C  CB  . TRP A 1 156 ? -8.130  31.792  44.598 1.00 28.25  ? 156  TRP A CB  1 
ATOM   1170 C  CG  . TRP A 1 156 ? -7.637  31.423  45.966 1.00 24.21  ? 156  TRP A CG  1 
ATOM   1171 C  CD1 . TRP A 1 156 ? -7.552  32.235  47.061 1.00 24.70  ? 156  TRP A CD1 1 
ATOM   1172 C  CD2 . TRP A 1 156 ? -7.162  30.137  46.376 1.00 31.50  ? 156  TRP A CD2 1 
ATOM   1173 N  NE1 . TRP A 1 156 ? -7.047  31.525  48.131 1.00 25.14  ? 156  TRP A NE1 1 
ATOM   1174 C  CE2 . TRP A 1 156 ? -6.804  30.238  47.735 1.00 29.79  ? 156  TRP A CE2 1 
ATOM   1175 C  CE3 . TRP A 1 156 ? -7.012  28.913  45.713 1.00 38.61  ? 156  TRP A CE3 1 
ATOM   1176 C  CZ2 . TRP A 1 156 ? -6.299  29.155  48.454 1.00 27.29  ? 156  TRP A CZ2 1 
ATOM   1177 C  CZ3 . TRP A 1 156 ? -6.510  27.842  46.430 1.00 42.88  ? 156  TRP A CZ3 1 
ATOM   1178 C  CH2 . TRP A 1 156 ? -6.160  27.973  47.781 1.00 38.27  ? 156  TRP A CH2 1 
ATOM   1179 N  N   . GLY A 1 157 ? -11.058 33.173  44.311 1.00 25.67  ? 157  GLY A N   1 
ATOM   1180 C  CA  . GLY A 1 157 ? -12.178 33.969  44.769 1.00 28.28  ? 157  GLY A CA  1 
ATOM   1181 C  C   . GLY A 1 157 ? -13.388 33.104  45.085 1.00 37.74  ? 157  GLY A C   1 
ATOM   1182 O  O   . GLY A 1 157 ? -14.046 33.302  46.105 1.00 32.15  ? 157  GLY A O   1 
ATOM   1183 N  N   . LYS A 1 158 ? -13.690 32.144  44.213 1.00 27.95  ? 158  LYS A N   1 
ATOM   1184 C  CA  . LYS A 1 158 ? -14.807 31.233  44.422 1.00 34.85  ? 158  LYS A CA  1 
ATOM   1185 C  C   . LYS A 1 158 ? -14.554 30.313  45.612 1.00 35.22  ? 158  LYS A C   1 
ATOM   1186 O  O   . LYS A 1 158 ? -15.487 29.848  46.267 1.00 38.14  ? 158  LYS A O   1 
ATOM   1187 C  CB  . LYS A 1 158 ? -15.063 30.426  43.143 1.00 37.11  ? 158  LYS A CB  1 
ATOM   1188 C  CG  . LYS A 1 158 ? -16.302 29.548  43.209 1.00 47.12  ? 158  LYS A CG  1 
ATOM   1189 C  CD  . LYS A 1 158 ? -17.575 30.340  42.957 1.00 51.43  ? 158  LYS A CD  1 
ATOM   1190 C  CE  . LYS A 1 158 ? -18.808 29.455  43.073 1.00 51.29  ? 158  LYS A CE  1 
ATOM   1191 N  NZ  . LYS A 1 158 ? -19.228 29.270  44.490 1.00 49.48  ? 158  LYS A NZ  1 
ATOM   1192 N  N   . VAL A 1 159 ? -13.286 30.053  45.915 1.00 28.04  ? 159  VAL A N   1 
ATOM   1193 C  CA  . VAL A 1 159 ? -12.933 29.255  47.087 1.00 32.28  ? 159  VAL A CA  1 
ATOM   1194 C  C   . VAL A 1 159 ? -13.333 30.017  48.348 1.00 38.10  ? 159  VAL A C   1 
ATOM   1195 O  O   . VAL A 1 159 ? -14.019 29.483  49.219 1.00 32.27  ? 159  VAL A O   1 
ATOM   1196 C  CB  . VAL A 1 159 ? -11.435 28.907  47.138 1.00 27.76  ? 159  VAL A CB  1 
ATOM   1197 C  CG1 . VAL A 1 159 ? -11.035 28.463  48.535 1.00 26.63  ? 159  VAL A CG1 1 
ATOM   1198 C  CG2 . VAL A 1 159 ? -11.100 27.819  46.124 1.00 29.43  ? 159  VAL A CG2 1 
ATOM   1199 N  N   . GLY A 1 160 ? -12.917 31.280  48.414 1.00 48.20  ? 160  GLY A N   1 
ATOM   1200 C  CA  . GLY A 1 160 ? -13.394 32.216  49.415 1.00 33.56  ? 160  GLY A CA  1 
ATOM   1201 C  C   . GLY A 1 160 ? -13.151 31.767  50.838 1.00 28.56  ? 160  GLY A C   1 
ATOM   1202 O  O   . GLY A 1 160 ? -12.031 31.423  51.226 1.00 33.84  ? 160  GLY A O   1 
ATOM   1203 N  N   . ALA A 1 161 ? -14.205 31.773  51.650 1.00 29.28  ? 161  ALA A N   1 
ATOM   1204 C  CA  . ALA A 1 161 ? -14.090 31.397  53.052 1.00 32.00  ? 161  ALA A CA  1 
ATOM   1205 C  C   . ALA A 1 161 ? -13.874 29.905  53.246 1.00 29.80  ? 161  ALA A C   1 
ATOM   1206 O  O   . ALA A 1 161 ? -13.582 29.460  54.360 1.00 39.14  ? 161  ALA A O   1 
ATOM   1207 C  CB  . ALA A 1 161 ? -15.323 31.849  53.828 1.00 38.69  ? 161  ALA A CB  1 
ATOM   1208 N  N   . HIS A 1 162 ? -13.990 29.090  52.201 1.00 29.56  ? 162  HIS A N   1 
ATOM   1209 C  CA  . HIS A 1 162 ? -13.789 27.656  52.408 1.00 32.78  ? 162  HIS A CA  1 
ATOM   1210 C  C   . HIS A 1 162 ? -12.320 27.268  52.250 1.00 30.53  ? 162  HIS A C   1 
ATOM   1211 O  O   . HIS A 1 162 ? -11.998 26.080  52.329 1.00 24.92  ? 162  HIS A O   1 
ATOM   1212 C  CB  . HIS A 1 162 ? -14.608 26.833  51.409 1.00 29.01  ? 162  HIS A CB  1 
ATOM   1213 C  CG  . HIS A 1 162 ? -16.076 27.090  51.468 1.00 30.60  ? 162  HIS A CG  1 
ATOM   1214 N  ND1 . HIS A 1 162 ? -16.861 26.672  52.517 1.00 37.92  ? 162  HIS A ND1 1 
ATOM   1215 C  CD2 . HIS A 1 162 ? -16.905 27.715  50.599 1.00 36.86  ? 162  HIS A CD2 1 
ATOM   1216 C  CE1 . HIS A 1 162 ? -18.114 27.033  52.304 1.00 46.35  ? 162  HIS A CE1 1 
ATOM   1217 N  NE2 . HIS A 1 162 ? -18.165 27.668  51.145 1.00 50.77  ? 162  HIS A NE2 1 
ATOM   1218 N  N   . ALA A 1 163 ? -11.472 28.256  52.003 1.00 27.79  ? 163  ALA A N   1 
ATOM   1219 C  CA  . ALA A 1 163 ? -10.047 28.003  51.779 1.00 23.21  ? 163  ALA A CA  1 
ATOM   1220 C  C   . ALA A 1 163 ? -9.451  27.102  52.850 1.00 24.04  ? 163  ALA A C   1 
ATOM   1221 O  O   . ALA A 1 163 ? -8.765  26.127  52.527 1.00 24.21  ? 163  ALA A O   1 
ATOM   1222 C  CB  . ALA A 1 163 ? -9.304  29.327  51.676 1.00 31.08  ? 163  ALA A CB  1 
ATOM   1223 N  N   . GLY A 1 164 ? -9.724  27.356  54.130 1.00 26.23  ? 164  GLY A N   1 
ATOM   1224 C  CA  . GLY A 1 164 ? -9.224  26.541  55.219 1.00 26.63  ? 164  GLY A CA  1 
ATOM   1225 C  C   . GLY A 1 164 ? -9.641  25.083  55.190 1.00 34.49  ? 164  GLY A C   1 
ATOM   1226 O  O   . GLY A 1 164 ? -8.799  24.189  55.323 1.00 24.75  ? 164  GLY A O   1 
ATOM   1227 N  N   . GLU A 1 165 ? -10.934 24.825  55.048 1.00 19.82  ? 165  GLU A N   1 
ATOM   1228 C  CA  . GLU A 1 165 ? -11.538 23.517  54.845 1.00 22.36  ? 165  GLU A CA  1 
ATOM   1229 C  C   . GLU A 1 165 ? -10.869 22.757  53.700 1.00 24.55  ? 165  GLU A C   1 
ATOM   1230 O  O   . GLU A 1 165 ? -10.589 21.570  53.808 1.00 19.42  ? 165  GLU A O   1 
ATOM   1231 C  CB  . GLU A 1 165 ? -13.016 23.710  54.494 1.00 25.72  ? 165  GLU A CB  1 
ATOM   1232 C  CG  . GLU A 1 165 ? -13.982 22.640  54.946 1.00 45.40  ? 165  GLU A CG  1 
ATOM   1233 C  CD  . GLU A 1 165 ? -15.419 23.141  54.938 1.00 63.01  ? 165  GLU A CD  1 
ATOM   1234 O  OE1 . GLU A 1 165 ? -15.660 24.246  54.399 1.00 62.68  ? 165  GLU A OE1 1 
ATOM   1235 O  OE2 . GLU A 1 165 ? -16.301 22.436  55.471 1.00 79.52  ? 165  GLU A OE2 1 
ATOM   1236 N  N   . TYR A 1 166 ? -10.639 23.439  52.579 1.00 22.60  ? 166  TYR A N   1 
ATOM   1237 C  CA  . TYR A 1 166 ? -10.049 22.809  51.405 1.00 21.58  ? 166  TYR A CA  1 
ATOM   1238 C  C   . TYR A 1 166 ? -8.573  22.498  51.625 1.00 17.86  ? 166  TYR A C   1 
ATOM   1239 O  O   . TYR A 1 166 ? -8.055  21.490  51.144 1.00 15.15  ? 166  TYR A O   1 
ATOM   1240 C  CB  . TYR A 1 166 ? -10.193 23.705  50.173 1.00 18.32  ? 166  TYR A CB  1 
ATOM   1241 C  CG  . TYR A 1 166 ? -11.626 23.894  49.722 1.00 20.92  ? 166  TYR A CG  1 
ATOM   1242 C  CD1 . TYR A 1 166 ? -12.675 23.275  50.387 1.00 22.39  ? 166  TYR A CD1 1 
ATOM   1243 C  CD2 . TYR A 1 166 ? -11.902 24.713  48.630 1.00 24.71  ? 166  TYR A CD2 1 
ATOM   1244 C  CE1 . TYR A 1 166 ? -13.984 23.451  49.981 1.00 24.85  ? 166  TYR A CE1 1 
ATOM   1245 C  CE2 . TYR A 1 166 ? -13.215 24.888  48.223 1.00 29.57  ? 166  TYR A CE2 1 
ATOM   1246 C  CZ  . TYR A 1 166 ? -14.238 24.261  48.896 1.00 27.00  ? 166  TYR A CZ  1 
ATOM   1247 O  OH  . TYR A 1 166 ? -15.543 24.445  48.478 1.00 30.53  ? 166  TYR A OH  1 
ATOM   1248 N  N   . GLY A 1 167 ? -7.903  23.361  52.389 1.00 16.35  ? 167  GLY A N   1 
ATOM   1249 C  CA  . GLY A 1 167 ? -6.517  23.049  52.747 1.00 22.56  ? 167  GLY A CA  1 
ATOM   1250 C  C   . GLY A 1 167 ? -6.424  21.786  53.577 1.00 22.96  ? 167  GLY A C   1 
ATOM   1251 O  O   . GLY A 1 167 ? -5.540  20.948  53.392 1.00 19.39  ? 167  GLY A O   1 
ATOM   1252 N  N   . ALA A 1 168 ? -7.350  21.577  54.512 1.00 18.31  ? 168  ALA A N   1 
ATOM   1253 C  CA  . ALA A 1 168 ? -7.317  20.375  55.330 1.00 19.52  ? 168  ALA A CA  1 
ATOM   1254 C  C   . ALA A 1 168 ? -7.636  19.134  54.502 1.00 20.41  ? 168  ALA A C   1 
ATOM   1255 O  O   . ALA A 1 168 ? -7.040  18.077  54.694 1.00 16.11  ? 168  ALA A O   1 
ATOM   1256 C  CB  . ALA A 1 168 ? -8.286  20.458  56.498 1.00 17.80  ? 168  ALA A CB  1 
ATOM   1257 N  N   . GLU A 1 169 ? -8.603  19.265  53.597 1.00 15.20  ? 169  GLU A N   1 
ATOM   1258 C  CA  . GLU A 1 169 ? -8.952  18.141  52.742 1.00 19.79  ? 169  GLU A CA  1 
ATOM   1259 C  C   . GLU A 1 169 ? -7.747  17.720  51.897 1.00 12.86  ? 169  GLU A C   1 
ATOM   1260 O  O   . GLU A 1 169 ? -7.499  16.532  51.717 1.00 14.07  ? 169  GLU A O   1 
ATOM   1261 C  CB  . GLU A 1 169 ? -10.116 18.519  51.812 1.00 15.60  ? 169  GLU A CB  1 
ATOM   1262 C  CG  . GLU A 1 169 ? -10.537 17.323  50.955 1.00 15.27  ? 169  GLU A CG  1 
ATOM   1263 C  CD  . GLU A 1 169 ? -11.804 17.617  50.164 1.00 20.46  ? 169  GLU A CD  1 
ATOM   1264 O  OE1 . GLU A 1 169 ? -12.700 18.298  50.711 1.00 16.53  ? 169  GLU A OE1 1 
ATOM   1265 O  OE2 . GLU A 1 169 ? -11.877 17.194  48.996 1.00 20.38  ? 169  GLU A OE2 1 
ATOM   1266 N  N   . ALA A 1 170 ? -7.031  18.706  51.378 1.00 13.91  ? 170  ALA A N   1 
ATOM   1267 C  CA  . ALA A 1 170 ? -5.893  18.429  50.495 1.00 16.06  ? 170  ALA A CA  1 
ATOM   1268 C  C   . ALA A 1 170 ? -4.803  17.676  51.243 1.00 12.63  ? 170  ALA A C   1 
ATOM   1269 O  O   . ALA A 1 170 ? -4.195  16.725  50.735 1.00 14.76  ? 170  ALA A O   1 
ATOM   1270 C  CB  . ALA A 1 170 ? -5.363  19.732  49.908 1.00 15.55  ? 170  ALA A CB  1 
ATOM   1271 N  N   . LEU A 1 171 ? -4.548  18.109  52.481 1.00 14.77  ? 171  LEU A N   1 
ATOM   1272 C  CA  . LEU A 1 171 ? -3.592  17.380  53.324 1.00 16.45  ? 171  LEU A CA  1 
ATOM   1273 C  C   . LEU A 1 171 ? -4.017  15.941  53.547 1.00 11.27  ? 171  LEU A C   1 
ATOM   1274 O  O   . LEU A 1 171 ? -3.233  14.995  53.418 1.00 14.75  ? 171  LEU A O   1 
ATOM   1275 C  CB  . LEU A 1 171 ? -3.451  18.081  54.684 1.00 15.86  ? 171  LEU A CB  1 
ATOM   1276 C  CG  . LEU A 1 171 ? -2.758  19.449  54.604 1.00 19.64  ? 171  LEU A CG  1 
ATOM   1277 C  CD1 . LEU A 1 171 ? -2.839  20.171  55.933 1.00 26.67  ? 171  LEU A CD1 1 
ATOM   1278 C  CD2 . LEU A 1 171 ? -1.312  19.257  54.161 1.00 16.77  ? 171  LEU A CD2 1 
ATOM   1279 N  N   . GLU A 1 172 ? -5.289  15.755  53.915 1.00 13.91  ? 172  GLU A N   1 
ATOM   1280 C  CA  . GLU A 1 172 ? -5.820  14.420  54.136 1.00 14.75  ? 172  GLU A CA  1 
ATOM   1281 C  C   . GLU A 1 172 ? -5.701  13.557  52.885 1.00 16.88  ? 172  GLU A C   1 
ATOM   1282 O  O   . GLU A 1 172 ? -5.365  12.377  52.976 1.00 16.38  ? 172  GLU A O   1 
ATOM   1283 C  CB  . GLU A 1 172 ? -7.284  14.463  54.608 1.00 15.28  ? 172  GLU A CB  1 
ATOM   1284 C  CG  . GLU A 1 172 ? -7.850  13.063  54.842 1.00 21.83  ? 172  GLU A CG  1 
ATOM   1285 C  CD  . GLU A 1 172 ? -9.252  13.113  55.432 1.00 31.38  ? 172  GLU A CD  1 
ATOM   1286 O  OE1 . GLU A 1 172 ? -9.931  14.150  55.302 1.00 37.25  ? 172  GLU A OE1 1 
ATOM   1287 O  OE2 . GLU A 1 172 ? -9.681  12.107  56.033 1.00 40.79  ? 172  GLU A OE2 1 
ATOM   1288 N  N   . ARG A 1 173 ? -5.972  14.122  51.713 1.00 13.01  ? 173  ARG A N   1 
ATOM   1289 C  CA  . ARG A 1 173 ? -5.837  13.376  50.465 1.00 11.65  ? 173  ARG A CA  1 
ATOM   1290 C  C   . ARG A 1 173 ? -4.373  12.972  50.260 1.00 12.82  ? 173  ARG A C   1 
ATOM   1291 O  O   . ARG A 1 173 ? -4.075  11.852  49.843 1.00 14.60  ? 173  ARG A O   1 
ATOM   1292 C  CB  . ARG A 1 173 ? -6.321  14.213  49.278 1.00 14.43  ? 173  ARG A CB  1 
ATOM   1293 C  CG  . ARG A 1 173 ? -7.839  14.382  49.235 1.00 12.83  ? 173  ARG A CG  1 
ATOM   1294 C  CD  . ARG A 1 173 ? -8.272  15.294  48.088 1.00 12.48  ? 173  ARG A CD  1 
ATOM   1295 N  NE  . ARG A 1 173 ? -9.732  15.420  48.063 1.00 14.01  ? 173  ARG A NE  1 
ATOM   1296 C  CZ  . ARG A 1 173 ? -10.580 14.489  47.647 1.00 17.76  ? 173  ARG A CZ  1 
ATOM   1297 N  NH1 . ARG A 1 173 ? -10.152 13.322  47.179 1.00 14.71  ? 173  ARG A NH1 1 
ATOM   1298 N  NH2 . ARG A 1 173 ? -11.885 14.740  47.689 1.00 16.79  ? 173  ARG A NH2 1 
ATOM   1299 N  N   . MET A 1 174 ? -3.485  13.909  50.571 1.00 13.55  ? 174  MET A N   1 
ATOM   1300 C  CA  . MET A 1 174 ? -2.048  13.651  50.440 1.00 9.45   ? 174  MET A CA  1 
ATOM   1301 C  C   . MET A 1 174 ? -1.592  12.538  51.373 1.00 8.39   ? 174  MET A C   1 
ATOM   1302 O  O   . MET A 1 174 ? -0.853  11.642  50.936 1.00 11.51  ? 174  MET A O   1 
ATOM   1303 C  CB  . MET A 1 174 ? -1.235  14.919  50.723 1.00 11.66  ? 174  MET A CB  1 
ATOM   1304 C  CG  . MET A 1 174 ? 0.260   14.758  50.467 1.00 14.65  ? 174  MET A CG  1 
ATOM   1305 S  SD  . MET A 1 174 ? 1.215   16.228  50.866 1.00 17.87  ? 174  MET A SD  1 
ATOM   1306 C  CE  . MET A 1 174 ? 0.998   16.414  52.621 1.00 15.08  ? 174  MET A CE  1 
ATOM   1307 N  N   . PHE A 1 175 ? -1.940  12.629  52.655 1.00 11.29  ? 175  PHE A N   1 
ATOM   1308 C  CA  . PHE A 1 175 ? -1.514  11.608  53.618 1.00 17.77  ? 175  PHE A CA  1 
ATOM   1309 C  C   . PHE A 1 175 ? -2.010  10.221  53.254 1.00 14.29  ? 175  PHE A C   1 
ATOM   1310 O  O   . PHE A 1 175 ? -1.319  9.207   53.431 1.00 14.91  ? 175  PHE A O   1 
ATOM   1311 C  CB  . PHE A 1 175 ? -2.003  11.993  55.023 1.00 14.85  ? 175  PHE A CB  1 
ATOM   1312 C  CG  . PHE A 1 175 ? -1.370  13.249  55.576 1.00 15.93  ? 175  PHE A CG  1 
ATOM   1313 C  CD1 . PHE A 1 175 ? -0.017  13.503  55.385 1.00 18.85  ? 175  PHE A CD1 1 
ATOM   1314 C  CD2 . PHE A 1 175 ? -2.126  14.167  56.287 1.00 17.83  ? 175  PHE A CD2 1 
ATOM   1315 C  CE1 . PHE A 1 175 ? 0.564   14.639  55.906 1.00 18.41  ? 175  PHE A CE1 1 
ATOM   1316 C  CE2 . PHE A 1 175 ? -1.546  15.298  56.819 1.00 19.11  ? 175  PHE A CE2 1 
ATOM   1317 C  CZ  . PHE A 1 175 ? -0.196  15.537  56.639 1.00 21.85  ? 175  PHE A CZ  1 
ATOM   1318 N  N   . LEU A 1 176 ? -3.240  10.132  52.715 1.00 12.40  ? 176  LEU A N   1 
ATOM   1319 C  CA  . LEU A 1 176 ? -3.725  8.816   52.319 1.00 15.95  ? 176  LEU A CA  1 
ATOM   1320 C  C   . LEU A 1 176 ? -3.109  8.321   51.015 1.00 15.86  ? 176  LEU A C   1 
ATOM   1321 O  O   . LEU A 1 176 ? -2.774  7.135   50.927 1.00 17.76  ? 176  LEU A O   1 
ATOM   1322 C  CB  . LEU A 1 176 ? -5.254  8.822   52.176 1.00 21.82  ? 176  LEU A CB  1 
ATOM   1323 C  CG  . LEU A 1 176 ? -6.050  9.119   53.449 1.00 22.79  ? 176  LEU A CG  1 
ATOM   1324 C  CD1 . LEU A 1 176 ? -7.543  9.125   53.136 1.00 19.10  ? 176  LEU A CD1 1 
ATOM   1325 C  CD2 . LEU A 1 176 ? -5.719  8.113   54.539 1.00 30.32  ? 176  LEU A CD2 1 
ATOM   1326 N  N   . SER A 1 177 ? -2.972  9.175   50.015 1.00 16.02  ? 177  SER A N   1 
ATOM   1327 C  CA  . SER A 1 177 ? -2.544  8.759   48.680 1.00 14.88  ? 177  SER A CA  1 
ATOM   1328 C  C   . SER A 1 177 ? -1.036  8.539   48.572 1.00 15.29  ? 177  SER A C   1 
ATOM   1329 O  O   . SER A 1 177 ? -0.582  7.705   47.786 1.00 13.86  ? 177  SER A O   1 
ATOM   1330 C  CB  . SER A 1 177 ? -2.972  9.805   47.650 1.00 19.53  ? 177  SER A CB  1 
ATOM   1331 O  OG  . SER A 1 177 ? -4.383  9.795   47.477 1.00 21.88  ? 177  SER A OG  1 
ATOM   1332 N  N   . PHE A 1 178 ? -0.282  9.305   49.350 1.00 13.71  ? 178  PHE A N   1 
ATOM   1333 C  CA  . PHE A 1 178 ? 1.182   9.289   49.322 1.00 13.28  ? 178  PHE A CA  1 
ATOM   1334 C  C   . PHE A 1 178 ? 1.725   9.208   50.752 1.00 16.46  ? 178  PHE A C   1 
ATOM   1335 O  O   . PHE A 1 178 ? 2.134   10.223  51.320 1.00 14.85  ? 178  PHE A O   1 
ATOM   1336 C  CB  . PHE A 1 178 ? 1.689   10.578  48.663 1.00 11.55  ? 178  PHE A CB  1 
ATOM   1337 C  CG  . PHE A 1 178 ? 1.076   10.829  47.292 1.00 13.89  ? 178  PHE A CG  1 
ATOM   1338 C  CD1 . PHE A 1 178 ? 1.392   9.992   46.232 1.00 22.03  ? 178  PHE A CD1 1 
ATOM   1339 C  CD2 . PHE A 1 178 ? 0.183   11.868  47.095 1.00 17.22  ? 178  PHE A CD2 1 
ATOM   1340 C  CE1 . PHE A 1 178 ? 0.812   10.182  44.985 1.00 23.23  ? 178  PHE A CE1 1 
ATOM   1341 C  CE2 . PHE A 1 178 ? -0.405  12.071  45.856 1.00 20.37  ? 178  PHE A CE2 1 
ATOM   1342 C  CZ  . PHE A 1 178 ? -0.089  11.224  44.811 1.00 22.82  ? 178  PHE A CZ  1 
ATOM   1343 N  N   . PRO A 1 179 ? 1.672   8.017   51.332 1.00 19.15  ? 179  PRO A N   1 
ATOM   1344 C  CA  . PRO A 1 179 ? 1.970   7.829   52.757 1.00 16.25  ? 179  PRO A CA  1 
ATOM   1345 C  C   . PRO A 1 179 ? 3.363   8.287   53.168 1.00 14.47  ? 179  PRO A C   1 
ATOM   1346 O  O   . PRO A 1 179 ? 3.614   8.568   54.345 1.00 18.02  ? 179  PRO A O   1 
ATOM   1347 C  CB  . PRO A 1 179 ? 1.855   6.312   52.949 1.00 22.20  ? 179  PRO A CB  1 
ATOM   1348 C  CG  . PRO A 1 179 ? 0.993   5.837   51.833 1.00 27.28  ? 179  PRO A CG  1 
ATOM   1349 C  CD  . PRO A 1 179 ? 1.261   6.765   50.679 1.00 18.13  ? 179  PRO A CD  1 
ATOM   1350 N  N   . THR A 1 180 ? 4.291   8.376   52.217 1.00 12.92  ? 180  THR A N   1 
ATOM   1351 C  CA  . THR A 1 180 ? 5.623   8.823   52.626 1.00 12.62  ? 180  THR A CA  1 
ATOM   1352 C  C   . THR A 1 180 ? 5.585   10.244  53.158 1.00 20.35  ? 180  THR A C   1 
ATOM   1353 O  O   . THR A 1 180 ? 6.495   10.642  53.895 1.00 18.82  ? 180  THR A O   1 
ATOM   1354 C  CB  . THR A 1 180 ? 6.629   8.715   51.458 1.00 17.08  ? 180  THR A CB  1 
ATOM   1355 O  OG1 . THR A 1 180 ? 6.141   9.462   50.342 1.00 17.12  ? 180  THR A OG1 1 
ATOM   1356 C  CG2 . THR A 1 180 ? 6.754   7.261   51.027 1.00 19.40  ? 180  THR A CG2 1 
ATOM   1357 N  N   . THR A 1 181 ? 4.550   11.022  52.828 1.00 15.63  ? 181  THR A N   1 
ATOM   1358 C  CA  . THR A 1 181 ? 4.557   12.413  53.271 1.00 7.12   ? 181  THR A CA  1 
ATOM   1359 C  C   . THR A 1 181 ? 4.295   12.477  54.776 1.00 12.09  ? 181  THR A C   1 
ATOM   1360 O  O   . THR A 1 181 ? 4.554   13.517  55.371 1.00 15.66  ? 181  THR A O   1 
ATOM   1361 C  CB  . THR A 1 181 ? 3.507   13.300  52.577 1.00 12.35  ? 181  THR A CB  1 
ATOM   1362 O  OG1 . THR A 1 181 ? 2.203   12.700  52.667 1.00 15.12  ? 181  THR A OG1 1 
ATOM   1363 C  CG2 . THR A 1 181 ? 3.846   13.427  51.093 1.00 16.01  ? 181  THR A CG2 1 
ATOM   1364 N  N   . LYS A 1 182 ? 3.793   11.374  55.315 1.00 14.01  ? 182  LYS A N   1 
ATOM   1365 C  CA  . LYS A 1 182 ? 3.490   11.375  56.757 1.00 15.05  ? 182  LYS A CA  1 
ATOM   1366 C  C   . LYS A 1 182 ? 4.769   11.441  57.593 1.00 15.32  ? 182  LYS A C   1 
ATOM   1367 O  O   . LYS A 1 182 ? 4.716   11.730  58.791 1.00 17.14  ? 182  LYS A O   1 
ATOM   1368 C  CB  . LYS A 1 182 ? 2.694   10.126  57.134 1.00 12.02  ? 182  LYS A CB  1 
ATOM   1369 C  CG  . LYS A 1 182 ? 1.280   10.106  56.576 1.00 17.82  ? 182  LYS A CG  1 
ATOM   1370 C  CD  . LYS A 1 182 ? 0.412   9.078   57.282 1.00 27.31  ? 182  LYS A CD  1 
ATOM   1371 C  CE  . LYS A 1 182 ? 0.899   7.665   57.022 1.00 27.50  ? 182  LYS A CE  1 
ATOM   1372 N  NZ  . LYS A 1 182 ? -0.188  6.660   57.225 1.00 21.34  ? 182  LYS A NZ  1 
ATOM   1373 N  N   . THR A 1 183 ? 5.917   11.166  56.979 1.00 15.20  ? 183  THR A N   1 
ATOM   1374 C  CA  . THR A 1 183 ? 7.176   11.186  57.731 1.00 12.87  ? 183  THR A CA  1 
ATOM   1375 C  C   . THR A 1 183 ? 7.538   12.574  58.246 1.00 20.24  ? 183  THR A C   1 
ATOM   1376 O  O   . THR A 1 183 ? 8.380   12.705  59.144 1.00 20.26  ? 183  THR A O   1 
ATOM   1377 C  CB  . THR A 1 183 ? 8.353   10.679  56.869 1.00 12.92  ? 183  THR A CB  1 
ATOM   1378 O  OG1 . THR A 1 183 ? 8.495   11.494  55.708 1.00 16.67  ? 183  THR A OG1 1 
ATOM   1379 C  CG2 . THR A 1 183 ? 8.105   9.255   56.391 1.00 13.62  ? 183  THR A CG2 1 
ATOM   1380 N  N   . TYR A 1 184 ? 6.940   13.639  57.726 1.00 14.29  ? 184  TYR A N   1 
ATOM   1381 C  CA  . TYR A 1 184 ? 7.239   14.990  58.162 1.00 19.08  ? 184  TYR A CA  1 
ATOM   1382 C  C   . TYR A 1 184 ? 6.357   15.445  59.324 1.00 16.65  ? 184  TYR A C   1 
ATOM   1383 O  O   . TYR A 1 184 ? 6.598   16.504  59.890 1.00 16.52  ? 184  TYR A O   1 
ATOM   1384 C  CB  . TYR A 1 184 ? 7.089   15.961  56.981 1.00 16.48  ? 184  TYR A CB  1 
ATOM   1385 C  CG  . TYR A 1 184 ? 8.149   15.659  55.935 1.00 13.95  ? 184  TYR A CG  1 
ATOM   1386 C  CD1 . TYR A 1 184 ? 9.438   16.147  56.138 1.00 14.23  ? 184  TYR A CD1 1 
ATOM   1387 C  CD2 . TYR A 1 184 ? 7.872   14.904  54.810 1.00 15.12  ? 184  TYR A CD2 1 
ATOM   1388 C  CE1 . TYR A 1 184 ? 10.435  15.892  55.216 1.00 18.40  ? 184  TYR A CE1 1 
ATOM   1389 C  CE2 . TYR A 1 184 ? 8.868   14.643  53.881 1.00 15.76  ? 184  TYR A CE2 1 
ATOM   1390 C  CZ  . TYR A 1 184 ? 10.135  15.138  54.097 1.00 15.01  ? 184  TYR A CZ  1 
ATOM   1391 O  OH  . TYR A 1 184 ? 11.132  14.894  53.190 1.00 17.49  ? 184  TYR A OH  1 
ATOM   1392 N  N   . PHE A 1 185 ? 5.367   14.635  59.690 1.00 15.95  ? 185  PHE A N   1 
ATOM   1393 C  CA  . PHE A 1 185 ? 4.423   14.991  60.742 1.00 15.75  ? 185  PHE A CA  1 
ATOM   1394 C  C   . PHE A 1 185 ? 4.340   13.928  61.822 1.00 23.46  ? 185  PHE A C   1 
ATOM   1395 O  O   . PHE A 1 185 ? 3.241   13.471  62.171 1.00 21.18  ? 185  PHE A O   1 
ATOM   1396 C  CB  . PHE A 1 185 ? 3.026   15.212  60.130 1.00 17.18  ? 185  PHE A CB  1 
ATOM   1397 C  CG  . PHE A 1 185 ? 2.973   16.335  59.103 1.00 18.02  ? 185  PHE A CG  1 
ATOM   1398 C  CD1 . PHE A 1 185 ? 3.201   16.085  57.762 1.00 23.06  ? 185  PHE A CD1 1 
ATOM   1399 C  CD2 . PHE A 1 185 ? 2.690   17.636  59.482 1.00 18.36  ? 185  PHE A CD2 1 
ATOM   1400 C  CE1 . PHE A 1 185 ? 3.155   17.090  56.816 1.00 15.42  ? 185  PHE A CE1 1 
ATOM   1401 C  CE2 . PHE A 1 185 ? 2.661   18.656  58.549 1.00 19.72  ? 185  PHE A CE2 1 
ATOM   1402 C  CZ  . PHE A 1 185 ? 2.900   18.392  57.215 1.00 17.45  ? 185  PHE A CZ  1 
ATOM   1403 N  N   . PRO A 1 186 ? 5.455   13.485  62.392 1.00 23.29  ? 186  PRO A N   1 
ATOM   1404 C  CA  . PRO A 1 186 ? 5.340   12.426  63.409 1.00 27.62  ? 186  PRO A CA  1 
ATOM   1405 C  C   . PRO A 1 186 ? 4.687   12.935  64.691 1.00 23.99  ? 186  PRO A C   1 
ATOM   1406 O  O   . PRO A 1 186 ? 4.197   12.149  65.509 1.00 29.88  ? 186  PRO A O   1 
ATOM   1407 C  CB  . PRO A 1 186 ? 6.799   12.018  63.631 1.00 22.19  ? 186  PRO A CB  1 
ATOM   1408 C  CG  . PRO A 1 186 ? 7.577   13.257  63.337 1.00 22.90  ? 186  PRO A CG  1 
ATOM   1409 C  CD  . PRO A 1 186 ? 6.857   13.877  62.170 1.00 18.82  ? 186  PRO A CD  1 
ATOM   1410 N  N   . HIS A 1 187 ? 4.630   14.250  64.850 1.00 18.05  ? 187  HIS A N   1 
ATOM   1411 C  CA  . HIS A 1 187 ? 4.072   14.852  66.057 1.00 24.92  ? 187  HIS A CA  1 
ATOM   1412 C  C   . HIS A 1 187 ? 2.587   15.180  65.937 1.00 30.58  ? 187  HIS A C   1 
ATOM   1413 O  O   . HIS A 1 187 ? 2.011   15.714  66.893 1.00 34.08  ? 187  HIS A O   1 
ATOM   1414 C  CB  . HIS A 1 187 ? 4.858   16.119  66.408 1.00 24.77  ? 187  HIS A CB  1 
ATOM   1415 C  CG  . HIS A 1 187 ? 4.946   17.111  65.292 1.00 29.26  ? 187  HIS A CG  1 
ATOM   1416 N  ND1 . HIS A 1 187 ? 5.407   16.783  64.035 1.00 34.89  ? 187  HIS A ND1 1 
ATOM   1417 C  CD2 . HIS A 1 187 ? 4.626   18.422  65.233 1.00 35.42  ? 187  HIS A CD2 1 
ATOM   1418 C  CE1 . HIS A 1 187 ? 5.367   17.849  63.256 1.00 31.60  ? 187  HIS A CE1 1 
ATOM   1419 N  NE2 . HIS A 1 187 ? 4.899   18.864  63.962 1.00 31.54  ? 187  HIS A NE2 1 
ATOM   1420 N  N   . PHE A 1 188 ? 1.974   14.870  64.801 1.00 24.72  ? 188  PHE A N   1 
ATOM   1421 C  CA  . PHE A 1 188 ? 0.560   15.114  64.554 1.00 17.24  ? 188  PHE A CA  1 
ATOM   1422 C  C   . PHE A 1 188 ? -0.292  13.871  64.746 1.00 17.60  ? 188  PHE A C   1 
ATOM   1423 O  O   . PHE A 1 188 ? 0.152   12.755  64.488 1.00 25.43  ? 188  PHE A O   1 
ATOM   1424 C  CB  . PHE A 1 188 ? 0.349   15.563  63.096 1.00 20.93  ? 188  PHE A CB  1 
ATOM   1425 C  CG  . PHE A 1 188 ? 0.509   17.047  62.854 1.00 22.53  ? 188  PHE A CG  1 
ATOM   1426 C  CD1 . PHE A 1 188 ? 1.433   17.782  63.573 1.00 36.25  ? 188  PHE A CD1 1 
ATOM   1427 C  CD2 . PHE A 1 188 ? -0.270  17.688  61.903 1.00 28.09  ? 188  PHE A CD2 1 
ATOM   1428 C  CE1 . PHE A 1 188 ? 1.595   19.135  63.359 1.00 32.51  ? 188  PHE A CE1 1 
ATOM   1429 C  CE2 . PHE A 1 188 ? -0.123  19.044  61.690 1.00 26.12  ? 188  PHE A CE2 1 
ATOM   1430 C  CZ  . PHE A 1 188 ? 0.796   19.768  62.425 1.00 32.81  ? 188  PHE A CZ  1 
ATOM   1431 N  N   . ASP A 1 189 ? -1.531  14.081  65.182 1.00 24.16  ? 189  ASP A N   1 
ATOM   1432 C  CA  . ASP A 1 189 ? -2.589  13.100  65.012 1.00 20.48  ? 189  ASP A CA  1 
ATOM   1433 C  C   . ASP A 1 189 ? -3.124  13.253  63.589 1.00 21.41  ? 189  ASP A C   1 
ATOM   1434 O  O   . ASP A 1 189 ? -3.643  14.308  63.239 1.00 21.52  ? 189  ASP A O   1 
ATOM   1435 C  CB  . ASP A 1 189 ? -3.717  13.304  66.023 1.00 20.91  ? 189  ASP A CB  1 
ATOM   1436 C  CG  . ASP A 1 189 ? -4.765  12.212  65.980 1.00 33.93  ? 189  ASP A CG  1 
ATOM   1437 O  OD1 . ASP A 1 189 ? -4.947  11.557  64.935 1.00 30.51  ? 189  ASP A OD1 1 
ATOM   1438 O  OD2 . ASP A 1 189 ? -5.425  11.993  67.023 1.00 31.14  ? 189  ASP A OD2 1 
ATOM   1439 N  N   . LEU A 1 190 ? -2.955  12.223  62.767 1.00 22.61  ? 190  LEU A N   1 
ATOM   1440 C  CA  . LEU A 1 190 ? -3.266  12.367  61.344 1.00 26.29  ? 190  LEU A CA  1 
ATOM   1441 C  C   . LEU A 1 190 ? -4.601  11.731  61.013 1.00 26.78  ? 190  LEU A C   1 
ATOM   1442 O  O   . LEU A 1 190 ? -4.982  11.588  59.848 1.00 33.73  ? 190  LEU A O   1 
ATOM   1443 C  CB  . LEU A 1 190 ? -2.140  11.739  60.511 1.00 23.81  ? 190  LEU A CB  1 
ATOM   1444 C  CG  . LEU A 1 190 ? -0.800  12.463  60.570 1.00 23.30  ? 190  LEU A CG  1 
ATOM   1445 C  CD1 . LEU A 1 190 ? 0.263   11.697  59.792 1.00 25.26  ? 190  LEU A CD1 1 
ATOM   1446 C  CD2 . LEU A 1 190 ? -0.930  13.892  60.052 1.00 20.77  ? 190  LEU A CD2 1 
ATOM   1447 N  N   . SER A 1 191 ? -5.342  11.343  62.057 1.00 26.44  ? 191  SER A N   1 
ATOM   1448 C  CA  . SER A 1 191 ? -6.619  10.685  61.765 1.00 28.05  ? 191  SER A CA  1 
ATOM   1449 C  C   . SER A 1 191 ? -7.618  11.665  61.172 1.00 25.92  ? 191  SER A C   1 
ATOM   1450 O  O   . SER A 1 191 ? -7.506  12.888  61.259 1.00 24.95  ? 191  SER A O   1 
ATOM   1451 C  CB  . SER A 1 191 ? -7.186  10.003  63.009 1.00 30.03  ? 191  SER A CB  1 
ATOM   1452 O  OG  . SER A 1 191 ? -7.572  10.952  63.975 1.00 31.67  ? 191  SER A OG  1 
ATOM   1453 N  N   . HIS A 1 192 ? -8.630  11.096  60.514 1.00 29.09  ? 192  HIS A N   1 
ATOM   1454 C  CA  . HIS A 1 192 ? -9.633  11.931  59.856 1.00 26.79  ? 192  HIS A CA  1 
ATOM   1455 C  C   . HIS A 1 192 ? -10.282 12.864  60.863 1.00 24.88  ? 192  HIS A C   1 
ATOM   1456 O  O   . HIS A 1 192 ? -10.694 12.401  61.928 1.00 25.33  ? 192  HIS A O   1 
ATOM   1457 C  CB  . HIS A 1 192 ? -10.692 11.031  59.202 1.00 33.27  ? 192  HIS A CB  1 
ATOM   1458 C  CG  . HIS A 1 192 ? -11.834 11.826  58.645 1.00 22.79  ? 192  HIS A CG  1 
ATOM   1459 N  ND1 . HIS A 1 192 ? -11.655 12.777  57.669 1.00 30.09  ? 192  HIS A ND1 1 
ATOM   1460 C  CD2 . HIS A 1 192 ? -13.156 11.836  58.934 1.00 30.26  ? 192  HIS A CD2 1 
ATOM   1461 C  CE1 . HIS A 1 192 ? -12.815 13.333  57.366 1.00 34.84  ? 192  HIS A CE1 1 
ATOM   1462 N  NE2 . HIS A 1 192 ? -13.743 12.775  58.122 1.00 34.59  ? 192  HIS A NE2 1 
ATOM   1463 N  N   . GLY A 1 193 ? -10.393 14.160  60.597 1.00 30.64  ? 193  GLY A N   1 
ATOM   1464 C  CA  . GLY A 1 193 ? -11.068 15.022  61.559 1.00 27.73  ? 193  GLY A CA  1 
ATOM   1465 C  C   . GLY A 1 193 ? -10.133 15.699  62.537 1.00 31.25  ? 193  GLY A C   1 
ATOM   1466 O  O   . GLY A 1 193 ? -10.537 16.608  63.273 1.00 29.92  ? 193  GLY A O   1 
ATOM   1467 N  N   . SER A 1 194 ? -8.873  15.271  62.570 1.00 24.17  ? 194  SER A N   1 
ATOM   1468 C  CA  . SER A 1 194 ? -7.910  15.846  63.505 1.00 21.71  ? 194  SER A CA  1 
ATOM   1469 C  C   . SER A 1 194 ? -7.847  17.361  63.412 1.00 19.93  ? 194  SER A C   1 
ATOM   1470 O  O   . SER A 1 194 ? -7.703  17.940  62.333 1.00 19.71  ? 194  SER A O   1 
ATOM   1471 C  CB  . SER A 1 194 ? -6.509  15.277  63.236 1.00 32.31  ? 194  SER A CB  1 
ATOM   1472 O  OG  . SER A 1 194 ? -5.506  16.104  63.805 1.00 22.62  ? 194  SER A OG  1 
ATOM   1473 N  N   . ALA A 1 195 ? -7.924  18.003  64.571 1.00 20.71  ? 195  ALA A N   1 
ATOM   1474 C  CA  . ALA A 1 195 ? -7.804  19.447  64.689 1.00 26.76  ? 195  ALA A CA  1 
ATOM   1475 C  C   . ALA A 1 195 ? -6.406  19.923  64.329 1.00 19.23  ? 195  ALA A C   1 
ATOM   1476 O  O   . ALA A 1 195 ? -6.196  21.088  63.991 1.00 18.15  ? 195  ALA A O   1 
ATOM   1477 C  CB  . ALA A 1 195 ? -8.193  19.891  66.096 1.00 24.78  ? 195  ALA A CB  1 
ATOM   1478 N  N   . GLN A 1 196 ? -5.402  19.042  64.402 1.00 20.65  ? 196  GLN A N   1 
ATOM   1479 C  CA  . GLN A 1 196 ? -4.058  19.500  64.036 1.00 21.88  ? 196  GLN A CA  1 
ATOM   1480 C  C   . GLN A 1 196 ? -3.959  19.653  62.520 1.00 19.43  ? 196  GLN A C   1 
ATOM   1481 O  O   . GLN A 1 196 ? -3.327  20.577  62.030 1.00 21.81  ? 196  GLN A O   1 
ATOM   1482 C  CB  . GLN A 1 196 ? -2.987  18.527  64.527 1.00 19.66  ? 196  GLN A CB  1 
ATOM   1483 C  CG  . GLN A 1 196 ? -2.895  18.492  66.047 1.00 30.75  ? 196  GLN A CG  1 
ATOM   1484 C  CD  . GLN A 1 196 ? -1.909  17.434  66.516 1.00 27.78  ? 196  GLN A CD  1 
ATOM   1485 O  OE1 . GLN A 1 196 ? -2.179  16.244  66.401 1.00 28.72  ? 196  GLN A OE1 1 
ATOM   1486 N  NE2 . GLN A 1 196 ? -0.778  17.887  67.035 1.00 43.29  ? 196  GLN A NE2 1 
ATOM   1487 N  N   . VAL A 1 197 ? -4.615  18.736  61.823 1.00 19.05  ? 197  VAL A N   1 
ATOM   1488 C  CA  . VAL A 1 197 ? -4.640  18.786  60.362 1.00 19.64  ? 197  VAL A CA  1 
ATOM   1489 C  C   . VAL A 1 197 ? -5.447  19.987  59.898 1.00 14.56  ? 197  VAL A C   1 
ATOM   1490 O  O   . VAL A 1 197 ? -5.075  20.708  58.974 1.00 19.43  ? 197  VAL A O   1 
ATOM   1491 C  CB  . VAL A 1 197 ? -5.234  17.488  59.794 1.00 17.61  ? 197  VAL A CB  1 
ATOM   1492 C  CG1 . VAL A 1 197 ? -5.289  17.526  58.273 1.00 18.07  ? 197  VAL A CG1 1 
ATOM   1493 C  CG2 . VAL A 1 197 ? -4.411  16.298  60.272 1.00 21.61  ? 197  VAL A CG2 1 
ATOM   1494 N  N   . LYS A 1 198 ? -6.574  20.231  60.570 1.00 21.09  ? 198  LYS A N   1 
ATOM   1495 C  CA  . LYS A 1 198 ? -7.408  21.363  60.171 1.00 19.72  ? 198  LYS A CA  1 
ATOM   1496 C  C   . LYS A 1 198 ? -6.694  22.688  60.401 1.00 22.76  ? 198  LYS A C   1 
ATOM   1497 O  O   . LYS A 1 198 ? -6.764  23.586  59.561 1.00 19.72  ? 198  LYS A O   1 
ATOM   1498 C  CB  . LYS A 1 198 ? -8.732  21.348  60.936 1.00 23.82  ? 198  LYS A CB  1 
ATOM   1499 C  CG  . LYS A 1 198 ? -9.633  20.173  60.599 1.00 44.49  ? 198  LYS A CG  1 
ATOM   1500 C  CD  . LYS A 1 198 ? -11.059 20.416  61.071 1.00 53.66  ? 198  LYS A CD  1 
ATOM   1501 C  CE  . LYS A 1 198 ? -11.252 19.918  62.504 1.00 61.43  ? 198  LYS A CE  1 
ATOM   1502 N  NZ  . LYS A 1 198 ? -12.651 20.178  62.979 1.00 83.70  ? 198  LYS A NZ  1 
ATOM   1503 N  N   . GLY A 1 199 ? -6.012  22.826  61.536 1.00 23.92  ? 199  GLY A N   1 
ATOM   1504 C  CA  . GLY A 1 199 ? -5.276  24.041  61.849 1.00 21.08  ? 199  GLY A CA  1 
ATOM   1505 C  C   . GLY A 1 199 ? -4.137  24.258  60.867 1.00 21.55  ? 199  GLY A C   1 
ATOM   1506 O  O   . GLY A 1 199 ? -3.828  25.371  60.449 1.00 19.65  ? 199  GLY A O   1 
ATOM   1507 N  N   . HIS A 1 200 ? -3.495  23.153  60.477 1.00 20.94  ? 200  HIS A N   1 
ATOM   1508 C  CA  . HIS A 1 200 ? -2.401  23.275  59.522 1.00 18.33  ? 200  HIS A CA  1 
ATOM   1509 C  C   . HIS A 1 200 ? -2.938  23.583  58.125 1.00 19.15  ? 200  HIS A C   1 
ATOM   1510 O  O   . HIS A 1 200 ? -2.387  24.406  57.396 1.00 15.88  ? 200  HIS A O   1 
ATOM   1511 C  CB  . HIS A 1 200 ? -1.565  21.998  59.509 1.00 17.22  ? 200  HIS A CB  1 
ATOM   1512 C  CG  . HIS A 1 200 ? -0.338  22.162  58.671 1.00 19.22  ? 200  HIS A CG  1 
ATOM   1513 N  ND1 . HIS A 1 200 ? 0.597   23.140  58.930 1.00 26.48  ? 200  HIS A ND1 1 
ATOM   1514 C  CD2 . HIS A 1 200 ? 0.086   21.517  57.567 1.00 19.27  ? 200  HIS A CD2 1 
ATOM   1515 C  CE1 . HIS A 1 200 ? 1.559   23.073  58.031 1.00 25.72  ? 200  HIS A CE1 1 
ATOM   1516 N  NE2 . HIS A 1 200 ? 1.275   22.092  57.192 1.00 23.85  ? 200  HIS A NE2 1 
ATOM   1517 N  N   . GLY A 1 201 ? -4.019  22.915  57.737 1.00 17.23  ? 201  GLY A N   1 
ATOM   1518 C  CA  . GLY A 1 201 ? -4.616  23.205  56.430 1.00 20.86  ? 201  GLY A CA  1 
ATOM   1519 C  C   . GLY A 1 201 ? -4.951  24.676  56.286 1.00 15.02  ? 201  GLY A C   1 
ATOM   1520 O  O   . GLY A 1 201 ? -4.830  25.285  55.222 1.00 15.79  ? 201  GLY A O   1 
ATOM   1521 N  N   . LYS A 1 202 ? -5.410  25.289  57.379 1.00 18.04  ? 202  LYS A N   1 
ATOM   1522 C  CA  . LYS A 1 202 ? -5.769  26.704  57.321 1.00 17.75  ? 202  LYS A CA  1 
ATOM   1523 C  C   . LYS A 1 202 ? -4.523  27.554  57.137 1.00 16.95  ? 202  LYS A C   1 
ATOM   1524 O  O   . LYS A 1 202 ? -4.515  28.562  56.440 1.00 19.31  ? 202  LYS A O   1 
ATOM   1525 C  CB  . LYS A 1 202 ? -6.527  27.113  58.589 1.00 22.29  ? 202  LYS A CB  1 
ATOM   1526 C  CG  . LYS A 1 202 ? -6.670  28.614  58.766 1.00 36.11  ? 202  LYS A CG  1 
ATOM   1527 C  CD  . LYS A 1 202 ? -7.508  29.215  57.647 1.00 44.92  ? 202  LYS A CD  1 
ATOM   1528 C  CE  . LYS A 1 202 ? -7.980  30.618  57.999 1.00 43.94  ? 202  LYS A CE  1 
ATOM   1529 N  NZ  . LYS A 1 202 ? -8.614  31.291  56.831 1.00 49.83  ? 202  LYS A NZ  1 
ATOM   1530 N  N   . LYS A 1 203 ? -3.426  27.140  57.774 1.00 20.70  ? 203  LYS A N   1 
ATOM   1531 C  CA  . LYS A 1 203 ? -2.194  27.903  57.596 1.00 20.53  ? 203  LYS A CA  1 
ATOM   1532 C  C   . LYS A 1 203 ? -1.729  27.826  56.143 1.00 19.04  ? 203  LYS A C   1 
ATOM   1533 O  O   . LYS A 1 203 ? -1.293  28.825  55.582 1.00 16.82  ? 203  LYS A O   1 
ATOM   1534 C  CB  . LYS A 1 203 ? -1.086  27.386  58.510 1.00 22.36  ? 203  LYS A CB  1 
ATOM   1535 C  CG  . LYS A 1 203 ? -1.260  27.785  59.973 1.00 28.50  ? 203  LYS A CG  1 
ATOM   1536 C  CD  . LYS A 1 203 ? -0.002  27.444  60.757 1.00 33.57  ? 203  LYS A CD  1 
ATOM   1537 C  CE  . LYS A 1 203 ? -0.265  27.496  62.255 1.00 44.90  ? 203  LYS A CE  1 
ATOM   1538 N  NZ  . LYS A 1 203 ? -0.124  26.145  62.870 1.00 66.56  ? 203  LYS A NZ  1 
ATOM   1539 N  N   . VAL A 1 204 ? -1.804  26.630  55.571 1.00 19.31  ? 204  VAL A N   1 
ATOM   1540 C  CA  . VAL A 1 204 ? -1.371  26.428  54.184 1.00 18.47  ? 204  VAL A CA  1 
ATOM   1541 C  C   . VAL A 1 204 ? -2.249  27.222  53.222 1.00 15.12  ? 204  VAL A C   1 
ATOM   1542 O  O   . VAL A 1 204 ? -1.779  27.869  52.290 1.00 14.45  ? 204  VAL A O   1 
ATOM   1543 C  CB  . VAL A 1 204 ? -1.412  24.933  53.819 1.00 20.19  ? 204  VAL A CB  1 
ATOM   1544 C  CG1 . VAL A 1 204 ? -1.255  24.704  52.322 1.00 21.27  ? 204  VAL A CG1 1 
ATOM   1545 C  CG2 . VAL A 1 204 ? -0.337  24.146  54.556 1.00 18.62  ? 204  VAL A CG2 1 
ATOM   1546 N  N   . ALA A 1 205 ? -3.557  27.185  53.461 1.00 14.42  ? 205  ALA A N   1 
ATOM   1547 C  CA  . ALA A 1 205 ? -4.520  27.905  52.631 1.00 23.72  ? 205  ALA A CA  1 
ATOM   1548 C  C   . ALA A 1 205 ? -4.315  29.414  52.721 1.00 17.49  ? 205  ALA A C   1 
ATOM   1549 O  O   . ALA A 1 205 ? -4.290  30.095  51.694 1.00 18.20  ? 205  ALA A O   1 
ATOM   1550 C  CB  . ALA A 1 205 ? -5.941  27.523  53.030 1.00 25.17  ? 205  ALA A CB  1 
ATOM   1551 N  N   . ASP A 1 206 ? -4.154  29.906  53.945 1.00 19.47  ? 206  ASP A N   1 
ATOM   1552 C  CA  . ASP A 1 206 ? -3.882  31.325  54.178 1.00 25.39  ? 206  ASP A CA  1 
ATOM   1553 C  C   . ASP A 1 206 ? -2.643  31.778  53.422 1.00 17.00  ? 206  ASP A C   1 
ATOM   1554 O  O   . ASP A 1 206 ? -2.578  32.877  52.870 1.00 18.56  ? 206  ASP A O   1 
ATOM   1555 C  CB  . ASP A 1 206 ? -3.694  31.599  55.675 1.00 23.87  ? 206  ASP A CB  1 
ATOM   1556 C  CG  . ASP A 1 206 ? -5.002  31.636  56.435 1.00 30.05  ? 206  ASP A CG  1 
ATOM   1557 O  OD1 . ASP A 1 206 ? -6.055  31.412  55.809 1.00 30.37  ? 206  ASP A OD1 1 
ATOM   1558 O  OD2 . ASP A 1 206 ? -4.972  31.878  57.660 1.00 28.22  ? 206  ASP A OD2 1 
ATOM   1559 N  N   . ALA A 1 207 ? -1.620  30.911  53.380 1.00 19.22  ? 207  ALA A N   1 
ATOM   1560 C  CA  . ALA A 1 207 ? -0.405  31.277  52.656 1.00 23.45  ? 207  ALA A CA  1 
ATOM   1561 C  C   . ALA A 1 207 ? -0.661  31.326  51.156 1.00 19.14  ? 207  ALA A C   1 
ATOM   1562 O  O   . ALA A 1 207 ? -0.116  32.179  50.455 1.00 22.91  ? 207  ALA A O   1 
ATOM   1563 C  CB  . ALA A 1 207 ? 0.741   30.330  52.983 1.00 18.86  ? 207  ALA A CB  1 
ATOM   1564 N  N   . LEU A 1 208 ? -1.492  30.417  50.646 1.00 14.14  ? 208  LEU A N   1 
ATOM   1565 C  CA  . LEU A 1 208 ? -1.820  30.425  49.224 1.00 12.97  ? 208  LEU A CA  1 
ATOM   1566 C  C   . LEU A 1 208 ? -2.630  31.660  48.862 1.00 16.98  ? 208  LEU A C   1 
ATOM   1567 O  O   . LEU A 1 208 ? -2.498  32.258  47.797 1.00 21.86  ? 208  LEU A O   1 
ATOM   1568 C  CB  . LEU A 1 208 ? -2.623  29.158  48.869 1.00 14.45  ? 208  LEU A CB  1 
ATOM   1569 C  CG  . LEU A 1 208 ? -1.737  27.909  48.797 1.00 18.44  ? 208  LEU A CG  1 
ATOM   1570 C  CD1 . LEU A 1 208 ? -2.565  26.651  48.602 1.00 30.11  ? 208  LEU A CD1 1 
ATOM   1571 C  CD2 . LEU A 1 208 ? -0.714  28.091  47.679 1.00 19.04  ? 208  LEU A CD2 1 
ATOM   1572 N  N   . THR A 1 209 ? -3.495  32.048  49.797 1.00 15.69  ? 209  THR A N   1 
ATOM   1573 C  CA  . THR A 1 209 ? -4.267  33.271  49.622 1.00 19.80  ? 209  THR A CA  1 
ATOM   1574 C  C   . THR A 1 209 ? -3.360  34.483  49.498 1.00 20.43  ? 209  THR A C   1 
ATOM   1575 O  O   . THR A 1 209 ? -3.622  35.362  48.670 1.00 23.46  ? 209  THR A O   1 
ATOM   1576 C  CB  . THR A 1 209 ? -5.245  33.477  50.800 1.00 21.63  ? 209  THR A CB  1 
ATOM   1577 O  OG1 . THR A 1 209 ? -6.191  32.401  50.812 1.00 23.10  ? 209  THR A OG1 1 
ATOM   1578 C  CG2 . THR A 1 209 ? -6.024  34.766  50.612 1.00 29.82  ? 209  THR A CG2 1 
ATOM   1579 N  N   . ASN A 1 210 ? -2.314  34.544  50.310 1.00 21.29  ? 210  ASN A N   1 
ATOM   1580 C  CA  . ASN A 1 210 ? -1.347  35.633  50.263 1.00 19.22  ? 210  ASN A CA  1 
ATOM   1581 C  C   . ASN A 1 210 ? -0.563  35.630  48.953 1.00 29.04  ? 210  ASN A C   1 
ATOM   1582 O  O   . ASN A 1 210 ? -0.216  36.671  48.397 1.00 25.53  ? 210  ASN A O   1 
ATOM   1583 C  CB  . ASN A 1 210 ? -0.327  35.504  51.405 1.00 23.07  ? 210  ASN A CB  1 
ATOM   1584 C  CG  . ASN A 1 210 ? 0.578   36.725  51.462 1.00 36.09  ? 210  ASN A CG  1 
ATOM   1585 O  OD1 . ASN A 1 210 ? 0.102   37.853  51.326 1.00 54.05  ? 210  ASN A OD1 1 
ATOM   1586 N  ND2 . ASN A 1 210 ? 1.871   36.508  51.662 1.00 42.82  ? 210  ASN A ND2 1 
ATOM   1587 N  N   . ALA A 1 211 ? -0.270  34.412  48.495 1.00 19.39  ? 211  ALA A N   1 
ATOM   1588 C  CA  . ALA A 1 211 ? 0.446   34.235  47.241 1.00 20.32  ? 211  ALA A CA  1 
ATOM   1589 C  C   . ALA A 1 211 ? -0.388  34.692  46.055 1.00 19.09  ? 211  ALA A C   1 
ATOM   1590 O  O   . ALA A 1 211 ? 0.138   35.275  45.106 1.00 23.33  ? 211  ALA A O   1 
ATOM   1591 C  CB  . ALA A 1 211 ? 0.854   32.772  47.055 1.00 18.74  ? 211  ALA A CB  1 
ATOM   1592 N  N   . VAL A 1 212 ? -1.689  34.405  46.080 1.00 20.06  ? 212  VAL A N   1 
ATOM   1593 C  CA  . VAL A 1 212 ? -2.559  34.881  45.001 1.00 22.42  ? 212  VAL A CA  1 
ATOM   1594 C  C   . VAL A 1 212 ? -2.632  36.410  45.015 1.00 25.42  ? 212  VAL A C   1 
ATOM   1595 O  O   . VAL A 1 212 ? -2.626  37.061  43.967 1.00 26.69  ? 212  VAL A O   1 
ATOM   1596 C  CB  . VAL A 1 212 ? -3.974  34.299  45.113 1.00 20.07  ? 212  VAL A CB  1 
ATOM   1597 C  CG1 . VAL A 1 212 ? -4.907  34.931  44.090 1.00 20.84  ? 212  VAL A CG1 1 
ATOM   1598 C  CG2 . VAL A 1 212 ? -3.971  32.781  44.929 1.00 17.24  ? 212  VAL A CG2 1 
ATOM   1599 N  N   . ALA A 1 213 ? -2.683  36.990  46.207 1.00 25.40  ? 213  ALA A N   1 
ATOM   1600 C  CA  . ALA A 1 213 ? -2.807  38.440  46.359 1.00 28.92  ? 213  ALA A CA  1 
ATOM   1601 C  C   . ALA A 1 213 ? -1.547  39.165  45.907 1.00 31.18  ? 213  ALA A C   1 
ATOM   1602 O  O   . ALA A 1 213 ? -1.552  40.363  45.603 1.00 32.12  ? 213  ALA A O   1 
ATOM   1603 C  CB  . ALA A 1 213 ? -3.116  38.786  47.810 1.00 27.95  ? 213  ALA A CB  1 
ATOM   1604 N  N   . HIS A 1 214 ? -0.448  38.427  45.880 1.00 22.36  ? 214  HIS A N   1 
ATOM   1605 C  CA  . HIS A 1 214 ? 0.869   38.959  45.554 1.00 28.29  ? 214  HIS A CA  1 
ATOM   1606 C  C   . HIS A 1 214 ? 1.496   38.233  44.375 1.00 29.63  ? 214  HIS A C   1 
ATOM   1607 O  O   . HIS A 1 214 ? 2.710   38.022  44.325 1.00 28.63  ? 214  HIS A O   1 
ATOM   1608 C  CB  . HIS A 1 214 ? 1.796   38.811  46.767 1.00 34.13  ? 214  HIS A CB  1 
ATOM   1609 C  CG  . HIS A 1 214 ? 1.371   39.632  47.941 1.00 38.60  ? 214  HIS A CG  1 
ATOM   1610 N  ND1 . HIS A 1 214 ? 1.756   40.945  48.102 1.00 38.84  ? 214  HIS A ND1 1 
ATOM   1611 C  CD2 . HIS A 1 214 ? 0.591   39.334  49.001 1.00 34.58  ? 214  HIS A CD2 1 
ATOM   1612 C  CE1 . HIS A 1 214 ? 1.235   41.420  49.219 1.00 45.40  ? 214  HIS A CE1 1 
ATOM   1613 N  NE2 . HIS A 1 214 ? 0.526   40.461  49.786 1.00 47.82  ? 214  HIS A NE2 1 
ATOM   1614 N  N   . VAL A 1 215 ? 0.653   37.817  43.433 1.00 32.54  ? 215  VAL A N   1 
ATOM   1615 C  CA  . VAL A 1 215 ? 1.103   36.905  42.393 1.00 28.24  ? 215  VAL A CA  1 
ATOM   1616 C  C   . VAL A 1 215 ? 2.248   37.471  41.567 1.00 39.42  ? 215  VAL A C   1 
ATOM   1617 O  O   . VAL A 1 215 ? 2.976   36.723  40.905 1.00 37.95  ? 215  VAL A O   1 
ATOM   1618 C  CB  . VAL A 1 215 ? -0.077  36.491  41.489 1.00 33.96  ? 215  VAL A CB  1 
ATOM   1619 C  CG1 . VAL A 1 215 ? -0.370  37.556  40.445 1.00 42.46  ? 215  VAL A CG1 1 
ATOM   1620 C  CG2 . VAL A 1 215 ? 0.207   35.146  40.836 1.00 29.60  ? 215  VAL A CG2 1 
ATOM   1621 N  N   . ASP A 1 216 ? 2.462   38.782  41.590 1.00 43.32  ? 216  ASP A N   1 
ATOM   1622 C  CA  . ASP A 1 216 ? 3.528   39.378  40.785 1.00 40.26  ? 216  ASP A CA  1 
ATOM   1623 C  C   . ASP A 1 216 ? 4.778   39.642  41.618 1.00 41.86  ? 216  ASP A C   1 
ATOM   1624 O  O   . ASP A 1 216 ? 5.822   40.023  41.088 1.00 42.22  ? 216  ASP A O   1 
ATOM   1625 C  CB  . ASP A 1 216 ? 3.048   40.686  40.153 1.00 43.58  ? 216  ASP A CB  1 
ATOM   1626 C  CG  . ASP A 1 216 ? 2.033   40.461  39.050 1.00 40.54  ? 216  ASP A CG  1 
ATOM   1627 O  OD1 . ASP A 1 216 ? 2.450   40.364  37.879 1.00 69.03  ? 216  ASP A OD1 1 
ATOM   1628 O  OD2 . ASP A 1 216 ? 0.824   40.380  39.350 1.00 63.23  ? 216  ASP A OD2 1 
ATOM   1629 N  N   . ASP A 1 217 ? 4.639   39.436  42.919 1.00 35.19  ? 217  ASP A N   1 
ATOM   1630 C  CA  . ASP A 1 217 ? 5.692   39.602  43.902 1.00 32.64  ? 217  ASP A CA  1 
ATOM   1631 C  C   . ASP A 1 217 ? 5.726   38.428  44.873 1.00 33.92  ? 217  ASP A C   1 
ATOM   1632 O  O   . ASP A 1 217 ? 5.856   38.608  46.083 1.00 32.48  ? 217  ASP A O   1 
ATOM   1633 C  CB  . ASP A 1 217 ? 5.485   40.897  44.696 1.00 44.15  ? 217  ASP A CB  1 
ATOM   1634 C  CG  . ASP A 1 217 ? 6.694   41.210  45.562 1.00 52.58  ? 217  ASP A CG  1 
ATOM   1635 O  OD1 . ASP A 1 217 ? 7.799   41.331  44.987 1.00 36.07  ? 217  ASP A OD1 1 
ATOM   1636 O  OD2 . ASP A 1 217 ? 6.524   41.313  46.794 1.00 73.26  ? 217  ASP A OD2 1 
ATOM   1637 N  N   . MET A 1 218 ? 5.579   37.219  44.336 1.00 39.05  ? 218  MET A N   1 
ATOM   1638 C  CA  . MET A 1 218 ? 5.526   36.031  45.182 1.00 29.59  ? 218  MET A CA  1 
ATOM   1639 C  C   . MET A 1 218 ? 6.805   35.766  45.954 1.00 24.36  ? 218  MET A C   1 
ATOM   1640 O  O   . MET A 1 218 ? 6.708   35.418  47.145 1.00 22.10  ? 218  MET A O   1 
ATOM   1641 C  CB  . MET A 1 218 ? 5.114   34.809  44.338 1.00 26.48  ? 218  MET A CB  1 
ATOM   1642 C  CG  . MET A 1 218 ? 3.608   34.753  44.114 1.00 29.69  ? 218  MET A CG  1 
ATOM   1643 S  SD  . MET A 1 218 ? 3.006   33.124  43.618 1.00 34.95  ? 218  MET A SD  1 
ATOM   1644 C  CE  . MET A 1 218 ? 4.046   32.776  42.206 1.00 39.20  ? 218  MET A CE  1 
ATOM   1645 N  N   . PRO A 1 219 ? 8.001   35.873  45.390 1.00 25.00  ? 219  PRO A N   1 
ATOM   1646 C  CA  . PRO A 1 219 ? 9.211   35.638  46.198 1.00 23.43  ? 219  PRO A CA  1 
ATOM   1647 C  C   . PRO A 1 219 ? 9.287   36.455  47.470 1.00 25.43  ? 219  PRO A C   1 
ATOM   1648 O  O   . PRO A 1 219 ? 9.709   35.950  48.515 1.00 26.40  ? 219  PRO A O   1 
ATOM   1649 C  CB  . PRO A 1 219 ? 10.343  36.047  45.247 1.00 30.99  ? 219  PRO A CB  1 
ATOM   1650 C  CG  . PRO A 1 219 ? 9.784   35.668  43.908 1.00 29.76  ? 219  PRO A CG  1 
ATOM   1651 C  CD  . PRO A 1 219 ? 8.351   36.148  43.982 1.00 23.04  ? 219  PRO A CD  1 
ATOM   1652 N  N   . ASN A 1 220 ? 8.901   37.733  47.457 1.00 26.38  ? 220  ASN A N   1 
ATOM   1653 C  CA  . ASN A 1 220 ? 9.041   38.470  48.716 1.00 34.92  ? 220  ASN A CA  1 
ATOM   1654 C  C   . ASN A 1 220 ? 7.925   38.110  49.686 1.00 26.98  ? 220  ASN A C   1 
ATOM   1655 O  O   . ASN A 1 220 ? 8.138   37.963  50.896 1.00 26.61  ? 220  ASN A O   1 
ATOM   1656 C  CB  . ASN A 1 220 ? 9.076   39.982  48.468 1.00 35.45  ? 220  ASN A CB  1 
ATOM   1657 C  CG  . ASN A 1 220 ? 9.145   40.738  49.786 1.00 33.13  ? 220  ASN A CG  1 
ATOM   1658 O  OD1 . ASN A 1 220 ? 10.158  40.697  50.485 1.00 32.45  ? 220  ASN A OD1 1 
ATOM   1659 N  ND2 . ASN A 1 220 ? 8.064   41.422  50.133 1.00 34.86  ? 220  ASN A ND2 1 
ATOM   1660 N  N   . ALA A 1 221 ? 6.708   37.950  49.173 1.00 24.74  ? 221  ALA A N   1 
ATOM   1661 C  CA  . ALA A 1 221 ? 5.581   37.640  50.051 1.00 22.35  ? 221  ALA A CA  1 
ATOM   1662 C  C   . ALA A 1 221 ? 5.772   36.302  50.759 1.00 29.38  ? 221  ALA A C   1 
ATOM   1663 O  O   . ALA A 1 221 ? 5.294   36.112  51.878 1.00 28.18  ? 221  ALA A O   1 
ATOM   1664 C  CB  . ALA A 1 221 ? 4.275   37.615  49.271 1.00 25.46  ? 221  ALA A CB  1 
ATOM   1665 N  N   . LEU A 1 222 ? 6.465   35.381  50.093 1.00 20.88  ? 222  LEU A N   1 
ATOM   1666 C  CA  . LEU A 1 222 ? 6.637   34.040  50.640 1.00 18.16  ? 222  LEU A CA  1 
ATOM   1667 C  C   . LEU A 1 222 ? 8.003   33.848  51.284 1.00 23.58  ? 222  LEU A C   1 
ATOM   1668 O  O   . LEU A 1 222 ? 8.398   32.736  51.642 1.00 21.90  ? 222  LEU A O   1 
ATOM   1669 C  CB  . LEU A 1 222 ? 6.428   33.017  49.520 1.00 22.72  ? 222  LEU A CB  1 
ATOM   1670 C  CG  . LEU A 1 222 ? 4.991   32.828  49.024 1.00 26.88  ? 222  LEU A CG  1 
ATOM   1671 C  CD1 . LEU A 1 222 ? 4.923   31.687  48.018 1.00 30.05  ? 222  LEU A CD1 1 
ATOM   1672 C  CD2 . LEU A 1 222 ? 4.044   32.571  50.183 1.00 30.44  ? 222  LEU A CD2 1 
ATOM   1673 N  N   . SER A 1 223 ? 8.766   34.921  51.462 1.00 18.25  ? 223  SER A N   1 
ATOM   1674 C  CA  . SER A 1 223 ? 10.158  34.807  51.868 1.00 23.37  ? 223  SER A CA  1 
ATOM   1675 C  C   . SER A 1 223 ? 10.389  34.120  53.200 1.00 17.30  ? 223  SER A C   1 
ATOM   1676 O  O   . SER A 1 223 ? 11.296  33.290  53.332 1.00 21.75  ? 223  SER A O   1 
ATOM   1677 C  CB  . SER A 1 223 ? 10.764  36.229  51.958 1.00 24.89  ? 223  SER A CB  1 
ATOM   1678 O  OG  . SER A 1 223 ? 12.163  36.062  52.183 1.00 30.87  ? 223  SER A OG  1 
ATOM   1679 N  N   . ALA A 1 224 ? 9.608   34.470  54.228 1.00 20.06  ? 224  ALA A N   1 
ATOM   1680 C  CA  . ALA A 1 224 ? 9.763   33.799  55.524 1.00 20.07  ? 224  ALA A CA  1 
ATOM   1681 C  C   . ALA A 1 224 ? 9.445   32.317  55.438 1.00 20.28  ? 224  ALA A C   1 
ATOM   1682 O  O   . ALA A 1 224 ? 10.052  31.476  56.106 1.00 22.80  ? 224  ALA A O   1 
ATOM   1683 C  CB  . ALA A 1 224 ? 8.892   34.477  56.570 1.00 24.24  ? 224  ALA A CB  1 
ATOM   1684 N  N   . LEU A 1 225 ? 8.460   31.958  54.607 1.00 18.49  ? 225  LEU A N   1 
ATOM   1685 C  CA  . LEU A 1 225 ? 8.124   30.553  54.418 1.00 19.78  ? 225  LEU A CA  1 
ATOM   1686 C  C   . LEU A 1 225 ? 9.185   29.786  53.635 1.00 16.09  ? 225  LEU A C   1 
ATOM   1687 O  O   . LEU A 1 225 ? 9.427   28.601  53.894 1.00 21.40  ? 225  LEU A O   1 
ATOM   1688 C  CB  . LEU A 1 225 ? 6.783   30.425  53.678 1.00 26.05  ? 225  LEU A CB  1 
ATOM   1689 C  CG  . LEU A 1 225 ? 5.511   30.653  54.488 1.00 31.33  ? 225  LEU A CG  1 
ATOM   1690 C  CD1 . LEU A 1 225 ? 4.291   30.414  53.606 1.00 31.08  ? 225  LEU A CD1 1 
ATOM   1691 C  CD2 . LEU A 1 225 ? 5.472   29.747  55.705 1.00 40.94  ? 225  LEU A CD2 1 
ATOM   1692 N  N   . SER A 1 226 ? 9.811   30.433  52.652 1.00 16.89  ? 226  SER A N   1 
ATOM   1693 C  CA  . SER A 1 226 ? 10.931  29.819  51.947 1.00 20.62  ? 226  SER A CA  1 
ATOM   1694 C  C   . SER A 1 226 ? 12.080  29.536  52.907 1.00 18.18  ? 226  SER A C   1 
ATOM   1695 O  O   . SER A 1 226 ? 12.672  28.457  52.868 1.00 16.25  ? 226  SER A O   1 
ATOM   1696 C  CB  . SER A 1 226 ? 11.422  30.714  50.803 1.00 23.62  ? 226  SER A CB  1 
ATOM   1697 O  OG  . SER A 1 226 ? 10.398  30.915  49.854 1.00 32.22  ? 226  SER A OG  1 
ATOM   1698 N  N   . ASP A 1 227 ? 12.376  30.500  53.775 1.00 25.43  ? 227  ASP A N   1 
ATOM   1699 C  CA  . ASP A 1 227 ? 13.407  30.342  54.795 1.00 18.97  ? 227  ASP A CA  1 
ATOM   1700 C  C   . ASP A 1 227 ? 13.090  29.149  55.682 1.00 17.74  ? 227  ASP A C   1 
ATOM   1701 O  O   . ASP A 1 227 ? 13.901  28.284  55.976 1.00 23.06  ? 227  ASP A O   1 
ATOM   1702 C  CB  . ASP A 1 227 ? 13.474  31.577  55.697 1.00 24.76  ? 227  ASP A CB  1 
ATOM   1703 C  CG  . ASP A 1 227 ? 14.094  32.788  55.042 1.00 36.28  ? 227  ASP A CG  1 
ATOM   1704 O  OD1 . ASP A 1 227 ? 14.693  32.623  53.959 1.00 30.71  ? 227  ASP A OD1 1 
ATOM   1705 O  OD2 . ASP A 1 227 ? 13.976  33.888  55.630 1.00 29.88  ? 227  ASP A OD2 1 
ATOM   1706 N  N   . LEU A 1 228 ? 11.831  29.111  56.125 1.00 17.74  ? 228  LEU A N   1 
ATOM   1707 C  CA  . LEU A 1 228 ? 11.418  28.084  57.059 1.00 20.52  ? 228  LEU A CA  1 
ATOM   1708 C  C   . LEU A 1 228 ? 11.493  26.680  56.481 1.00 19.19  ? 228  LEU A C   1 
ATOM   1709 O  O   . LEU A 1 228 ? 11.891  25.732  57.158 1.00 18.02  ? 228  LEU A O   1 
ATOM   1710 C  CB  . LEU A 1 228 ? 9.971   28.370  57.499 1.00 21.89  ? 228  LEU A CB  1 
ATOM   1711 C  CG  . LEU A 1 228 ? 9.427   27.394  58.548 1.00 24.99  ? 228  LEU A CG  1 
ATOM   1712 C  CD1 . LEU A 1 228 ? 10.268  27.467  59.815 1.00 33.20  ? 228  LEU A CD1 1 
ATOM   1713 C  CD2 . LEU A 1 228 ? 7.967   27.693  58.844 1.00 28.51  ? 228  LEU A CD2 1 
ATOM   1714 N  N   . HIS A 1 229 ? 11.078  26.520  55.223 1.00 16.95  ? 229  HIS A N   1 
ATOM   1715 C  CA  . HIS A 1 229 ? 11.110  25.171  54.648 1.00 16.44  ? 229  HIS A CA  1 
ATOM   1716 C  C   . HIS A 1 229 ? 12.538  24.749  54.326 1.00 14.25  ? 229  HIS A C   1 
ATOM   1717 O  O   . HIS A 1 229 ? 12.934  23.601  54.497 1.00 17.17  ? 229  HIS A O   1 
ATOM   1718 C  CB  . HIS A 1 229 ? 10.218  25.127  53.391 1.00 14.89  ? 229  HIS A CB  1 
ATOM   1719 C  CG  . HIS A 1 229 ? 8.779   25.004  53.823 1.00 12.40  ? 229  HIS A CG  1 
ATOM   1720 N  ND1 . HIS A 1 229 ? 8.018   26.063  54.254 1.00 17.10  ? 229  HIS A ND1 1 
ATOM   1721 C  CD2 . HIS A 1 229 ? 7.995   23.904  53.930 1.00 13.24  ? 229  HIS A CD2 1 
ATOM   1722 C  CE1 . HIS A 1 229 ? 6.803   25.621  54.581 1.00 13.24  ? 229  HIS A CE1 1 
ATOM   1723 N  NE2 . HIS A 1 229 ? 6.772   24.313  54.396 1.00 11.38  ? 229  HIS A NE2 1 
ATOM   1724 N  N   . ALA A 1 230 ? 13.345  25.706  53.887 1.00 15.60  ? 230  ALA A N   1 
ATOM   1725 C  CA  . ALA A 1 230 ? 14.706  25.424  53.456 1.00 17.93  ? 230  ALA A CA  1 
ATOM   1726 C  C   . ALA A 1 230 ? 15.652  25.146  54.616 1.00 22.60  ? 230  ALA A C   1 
ATOM   1727 O  O   . ALA A 1 230 ? 16.485  24.243  54.538 1.00 23.93  ? 230  ALA A O   1 
ATOM   1728 C  CB  . ALA A 1 230 ? 15.199  26.608  52.627 1.00 20.20  ? 230  ALA A CB  1 
ATOM   1729 N  N   . HIS A 1 231 ? 15.542  25.909  55.702 1.00 21.95  ? 231  HIS A N   1 
ATOM   1730 C  CA  . HIS A 1 231 ? 16.545  25.864  56.755 1.00 23.69  ? 231  HIS A CA  1 
ATOM   1731 C  C   . HIS A 1 231 ? 16.108  25.187  58.040 1.00 29.57  ? 231  HIS A C   1 
ATOM   1732 O  O   . HIS A 1 231 ? 16.983  24.740  58.795 1.00 26.75  ? 231  HIS A O   1 
ATOM   1733 C  CB  . HIS A 1 231 ? 17.000  27.313  57.030 1.00 26.95  ? 231  HIS A CB  1 
ATOM   1734 C  CG  . HIS A 1 231 ? 17.468  27.926  55.737 1.00 28.97  ? 231  HIS A CG  1 
ATOM   1735 N  ND1 . HIS A 1 231 ? 18.403  27.305  54.940 1.00 34.49  ? 231  HIS A ND1 1 
ATOM   1736 C  CD2 . HIS A 1 231 ? 17.132  29.065  55.100 1.00 33.44  ? 231  HIS A CD2 1 
ATOM   1737 C  CE1 . HIS A 1 231 ? 18.631  28.044  53.869 1.00 36.65  ? 231  HIS A CE1 1 
ATOM   1738 N  NE2 . HIS A 1 231 ? 17.869  29.119  53.942 1.00 33.52  ? 231  HIS A NE2 1 
ATOM   1739 N  N   . LYS A 1 232 ? 14.806  25.099  58.299 1.00 22.92  ? 232  LYS A N   1 
ATOM   1740 C  CA  . LYS A 1 232 ? 14.297  24.383  59.460 1.00 17.47  ? 232  LYS A CA  1 
ATOM   1741 C  C   . LYS A 1 232 ? 13.606  23.079  59.087 1.00 27.12  ? 232  LYS A C   1 
ATOM   1742 O  O   . LYS A 1 232 ? 14.122  22.002  59.392 1.00 24.79  ? 232  LYS A O   1 
ATOM   1743 C  CB  . LYS A 1 232 ? 13.362  25.281  60.274 1.00 25.63  ? 232  LYS A CB  1 
ATOM   1744 C  CG  . LYS A 1 232 ? 14.040  26.512  60.850 1.00 47.04  ? 232  LYS A CG  1 
ATOM   1745 C  CD  . LYS A 1 232 ? 13.312  27.043  62.076 1.00 58.15  ? 232  LYS A CD  1 
ATOM   1746 C  CE  . LYS A 1 232 ? 14.016  28.266  62.642 1.00 62.31  ? 232  LYS A CE  1 
ATOM   1747 N  NZ  . LYS A 1 232 ? 13.362  28.774  63.879 1.00 71.35  ? 232  LYS A NZ  1 
ATOM   1748 N  N   . LEU A 1 233 ? 12.450  23.159  58.432 1.00 16.77  ? 233  LEU A N   1 
ATOM   1749 C  CA  . LEU A 1 233 ? 11.651  21.963  58.181 1.00 15.62  ? 233  LEU A CA  1 
ATOM   1750 C  C   . LEU A 1 233 ? 12.352  20.991  57.236 1.00 18.65  ? 233  LEU A C   1 
ATOM   1751 O  O   . LEU A 1 233 ? 12.364  19.797  57.491 1.00 22.07  ? 233  LEU A O   1 
ATOM   1752 C  CB  . LEU A 1 233 ? 10.299  22.364  57.594 1.00 20.38  ? 233  LEU A CB  1 
ATOM   1753 C  CG  . LEU A 1 233 ? 9.536   23.436  58.387 1.00 18.62  ? 233  LEU A CG  1 
ATOM   1754 C  CD1 . LEU A 1 233 ? 8.321   23.873  57.596 1.00 19.24  ? 233  LEU A CD1 1 
ATOM   1755 C  CD2 . LEU A 1 233 ? 9.163   22.912  59.766 1.00 21.13  ? 233  LEU A CD2 1 
ATOM   1756 N  N   . ARG A 1 234 ? 12.890  21.542  56.158 1.00 19.45  ? 234  ARG A N   1 
ATOM   1757 C  CA  . ARG A 1 234 ? 13.781  20.800  55.272 1.00 21.34  ? 234  ARG A CA  1 
ATOM   1758 C  C   . ARG A 1 234 ? 13.080  19.626  54.601 1.00 21.08  ? 234  ARG A C   1 
ATOM   1759 O  O   . ARG A 1 234 ? 13.633  18.530  54.547 1.00 17.33  ? 234  ARG A O   1 
ATOM   1760 C  CB  . ARG A 1 234 ? 14.991  20.331  56.087 1.00 20.58  ? 234  ARG A CB  1 
ATOM   1761 C  CG  . ARG A 1 234 ? 16.052  21.420  56.252 1.00 22.16  ? 234  ARG A CG  1 
ATOM   1762 C  CD  . ARG A 1 234 ? 17.171  20.867  57.122 1.00 31.64  ? 234  ARG A CD  1 
ATOM   1763 N  NE  . ARG A 1 234 ? 18.190  21.839  57.469 1.00 49.80  ? 234  ARG A NE  1 
ATOM   1764 C  CZ  . ARG A 1 234 ? 18.948  21.771  58.560 1.00 50.39  ? 234  ARG A CZ  1 
ATOM   1765 N  NH1 . ARG A 1 234 ? 18.801  20.771  59.414 1.00 32.28  ? 234  ARG A NH1 1 
ATOM   1766 N  NH2 . ARG A 1 234 ? 19.851  22.720  58.773 1.00 66.63  ? 234  ARG A NH2 1 
ATOM   1767 N  N   . VAL A 1 235 ? 11.868  19.879  54.114 1.00 14.81  ? 235  VAL A N   1 
ATOM   1768 C  CA  . VAL A 1 235 ? 11.060  18.931  53.367 1.00 15.09  ? 235  VAL A CA  1 
ATOM   1769 C  C   . VAL A 1 235 ? 11.645  18.662  51.990 1.00 16.00  ? 235  VAL A C   1 
ATOM   1770 O  O   . VAL A 1 235 ? 11.923  19.606  51.251 1.00 16.32  ? 235  VAL A O   1 
ATOM   1771 C  CB  . VAL A 1 235 ? 9.641   19.524  53.156 1.00 19.73  ? 235  VAL A CB  1 
ATOM   1772 C  CG1 . VAL A 1 235 ? 8.814   18.586  52.294 1.00 21.43  ? 235  VAL A CG1 1 
ATOM   1773 C  CG2 . VAL A 1 235 ? 9.002   19.779  54.507 1.00 23.41  ? 235  VAL A CG2 1 
ATOM   1774 N  N   . ASP A 1 236 ? 11.828  17.399  51.597 1.00 16.37  ? 236  ASP A N   1 
ATOM   1775 C  CA  . ASP A 1 236 ? 12.373  17.166  50.254 1.00 14.27  ? 236  ASP A CA  1 
ATOM   1776 C  C   . ASP A 1 236 ? 11.488  17.779  49.178 1.00 14.45  ? 236  ASP A C   1 
ATOM   1777 O  O   . ASP A 1 236 ? 10.266  17.646  49.193 1.00 16.55  ? 236  ASP A O   1 
ATOM   1778 C  CB  . ASP A 1 236 ? 12.547  15.670  49.980 1.00 14.54  ? 236  ASP A CB  1 
ATOM   1779 C  CG  . ASP A 1 236 ? 13.418  15.439  48.755 1.00 22.37  ? 236  ASP A CG  1 
ATOM   1780 O  OD1 . ASP A 1 236 ? 12.928  15.637  47.626 1.00 19.62  ? 236  ASP A OD1 1 
ATOM   1781 O  OD2 . ASP A 1 236 ? 14.590  15.061  48.935 1.00 23.02  ? 236  ASP A OD2 1 
ATOM   1782 N  N   . PRO A 1 237 ? 12.112  18.483  48.240 1.00 19.46  ? 237  PRO A N   1 
ATOM   1783 C  CA  . PRO A 1 237 ? 11.377  19.205  47.195 1.00 18.84  ? 237  PRO A CA  1 
ATOM   1784 C  C   . PRO A 1 237 ? 10.367  18.358  46.439 1.00 14.56  ? 237  PRO A C   1 
ATOM   1785 O  O   . PRO A 1 237 ? 9.360   18.887  45.960 1.00 17.29  ? 237  PRO A O   1 
ATOM   1786 C  CB  . PRO A 1 237 ? 12.507  19.666  46.262 1.00 25.02  ? 237  PRO A CB  1 
ATOM   1787 C  CG  . PRO A 1 237 ? 13.665  19.838  47.193 1.00 26.37  ? 237  PRO A CG  1 
ATOM   1788 C  CD  . PRO A 1 237 ? 13.575  18.677  48.146 1.00 20.51  ? 237  PRO A CD  1 
ATOM   1789 N  N   . VAL A 1 238 ? 10.600  17.054  46.309 1.00 19.11  ? 238  VAL A N   1 
ATOM   1790 C  CA  . VAL A 1 238 ? 9.663   16.209  45.573 1.00 18.78  ? 238  VAL A CA  1 
ATOM   1791 C  C   . VAL A 1 238 ? 8.268   16.263  46.177 1.00 17.85  ? 238  VAL A C   1 
ATOM   1792 O  O   . VAL A 1 238 ? 7.254   16.139  45.473 1.00 15.84  ? 238  VAL A O   1 
ATOM   1793 C  CB  . VAL A 1 238 ? 10.151  14.743  45.483 1.00 18.55  ? 238  VAL A CB  1 
ATOM   1794 C  CG1 . VAL A 1 238 ? 11.553  14.741  44.880 1.00 31.23  ? 238  VAL A CG1 1 
ATOM   1795 C  CG2 . VAL A 1 238 ? 10.130  14.028  46.819 1.00 24.54  ? 238  VAL A CG2 1 
ATOM   1796 N  N   . ASN A 1 239 ? 8.184   16.472  47.495 1.00 12.02  ? 239  ASN A N   1 
ATOM   1797 C  CA  . ASN A 1 239 ? 6.889   16.453  48.154 1.00 13.27  ? 239  ASN A CA  1 
ATOM   1798 C  C   . ASN A 1 239 ? 5.995   17.620  47.778 1.00 15.16  ? 239  ASN A C   1 
ATOM   1799 O  O   . ASN A 1 239 ? 4.770   17.539  47.880 1.00 13.84  ? 239  ASN A O   1 
ATOM   1800 C  CB  . ASN A 1 239 ? 7.052   16.414  49.685 1.00 15.58  ? 239  ASN A CB  1 
ATOM   1801 C  CG  . ASN A 1 239 ? 7.723   15.107  50.084 1.00 15.26  ? 239  ASN A CG  1 
ATOM   1802 O  OD1 . ASN A 1 239 ? 7.055   14.070  50.137 1.00 16.64  ? 239  ASN A OD1 1 
ATOM   1803 N  ND2 . ASN A 1 239 ? 9.030   15.200  50.307 1.00 15.40  ? 239  ASN A ND2 1 
ATOM   1804 N  N   . PHE A 1 240 ? 6.551   18.742  47.330 1.00 13.77  ? 240  PHE A N   1 
ATOM   1805 C  CA  . PHE A 1 240 ? 5.644   19.831  46.976 1.00 15.73  ? 240  PHE A CA  1 
ATOM   1806 C  C   . PHE A 1 240 ? 4.756   19.505  45.780 1.00 16.17  ? 240  PHE A C   1 
ATOM   1807 O  O   . PHE A 1 240 ? 3.618   19.981  45.684 1.00 15.67  ? 240  PHE A O   1 
ATOM   1808 C  CB  . PHE A 1 240 ? 6.468   21.094  46.695 1.00 13.25  ? 240  PHE A CB  1 
ATOM   1809 C  CG  . PHE A 1 240 ? 7.091   21.634  47.977 1.00 17.96  ? 240  PHE A CG  1 
ATOM   1810 C  CD1 . PHE A 1 240 ? 8.316   21.152  48.413 1.00 22.86  ? 240  PHE A CD1 1 
ATOM   1811 C  CD2 . PHE A 1 240 ? 6.442   22.599  48.722 1.00 21.56  ? 240  PHE A CD2 1 
ATOM   1812 C  CE1 . PHE A 1 240 ? 8.895   21.656  49.569 1.00 24.97  ? 240  PHE A CE1 1 
ATOM   1813 C  CE2 . PHE A 1 240 ? 7.027   23.115  49.864 1.00 19.82  ? 240  PHE A CE2 1 
ATOM   1814 C  CZ  . PHE A 1 240 ? 8.251   22.644  50.293 1.00 20.13  ? 240  PHE A CZ  1 
ATOM   1815 N  N   . LYS A 1 241 ? 5.259   18.715  44.839 1.00 14.42  ? 241  LYS A N   1 
ATOM   1816 C  CA  . LYS A 1 241 ? 4.452   18.283  43.703 1.00 18.19  ? 241  LYS A CA  1 
ATOM   1817 C  C   . LYS A 1 241 ? 3.267   17.442  44.161 1.00 15.90  ? 241  LYS A C   1 
ATOM   1818 O  O   . LYS A 1 241 ? 2.196   17.483  43.553 1.00 17.92  ? 241  LYS A O   1 
ATOM   1819 C  CB  . LYS A 1 241 ? 5.291   17.471  42.711 1.00 20.66  ? 241  LYS A CB  1 
ATOM   1820 C  CG  . LYS A 1 241 ? 6.509   18.203  42.169 1.00 35.56  ? 241  LYS A CG  1 
ATOM   1821 C  CD  . LYS A 1 241 ? 7.556   17.222  41.662 1.00 45.71  ? 241  LYS A CD  1 
ATOM   1822 C  CE  . LYS A 1 241 ? 8.771   17.912  41.075 1.00 42.90  ? 241  LYS A CE  1 
ATOM   1823 N  NZ  . LYS A 1 241 ? 8.457   19.251  40.503 1.00 34.71  ? 241  LYS A NZ  1 
ATOM   1824 N  N   . LEU A 1 242 ? 3.439   16.649  45.217 1.00 13.00  ? 242  LEU A N   1 
ATOM   1825 C  CA  . LEU A 1 242 ? 2.361   15.772  45.678 1.00 10.30  ? 242  LEU A CA  1 
ATOM   1826 C  C   . LEU A 1 242 ? 1.261   16.577  46.354 1.00 14.10  ? 242  LEU A C   1 
ATOM   1827 O  O   . LEU A 1 242 ? 0.068   16.356  46.140 1.00 14.56  ? 242  LEU A O   1 
ATOM   1828 C  CB  . LEU A 1 242 ? 2.923   14.729  46.648 1.00 11.88  ? 242  LEU A CB  1 
ATOM   1829 C  CG  . LEU A 1 242 ? 4.143   13.947  46.138 1.00 18.81  ? 242  LEU A CG  1 
ATOM   1830 C  CD1 . LEU A 1 242 ? 4.725   13.040  47.206 1.00 14.83  ? 242  LEU A CD1 1 
ATOM   1831 C  CD2 . LEU A 1 242 ? 3.737   13.158  44.901 1.00 20.92  ? 242  LEU A CD2 1 
ATOM   1832 N  N   . LEU A 1 243 ? 1.651   17.554  47.186 1.00 12.48  ? 243  LEU A N   1 
ATOM   1833 C  CA  . LEU A 1 243 ? 0.595   18.393  47.759 1.00 10.13  ? 243  LEU A CA  1 
ATOM   1834 C  C   . LEU A 1 243 ? -0.082  19.219  46.667 1.00 16.45  ? 243  LEU A C   1 
ATOM   1835 O  O   . LEU A 1 243 ? -1.302  19.415  46.736 1.00 15.77  ? 243  LEU A O   1 
ATOM   1836 C  CB  . LEU A 1 243 ? 1.130   19.303  48.856 1.00 12.11  ? 243  LEU A CB  1 
ATOM   1837 C  CG  . LEU A 1 243 ? 0.135   20.299  49.463 1.00 13.37  ? 243  LEU A CG  1 
ATOM   1838 C  CD1 . LEU A 1 243 ? -1.041  19.559  50.088 1.00 19.16  ? 243  LEU A CD1 1 
ATOM   1839 C  CD2 . LEU A 1 243 ? 0.820   21.169  50.505 1.00 23.87  ? 243  LEU A CD2 1 
ATOM   1840 N  N   . SER A 1 244 ? 0.666   19.699  45.669 1.00 15.17  ? 244  SER A N   1 
ATOM   1841 C  CA  . SER A 1 244 ? 0.053   20.498  44.608 1.00 13.30  ? 244  SER A CA  1 
ATOM   1842 C  C   . SER A 1 244 ? -1.009  19.691  43.874 1.00 16.79  ? 244  SER A C   1 
ATOM   1843 O  O   . SER A 1 244 ? -2.103  20.185  43.589 1.00 13.99  ? 244  SER A O   1 
ATOM   1844 C  CB  . SER A 1 244 ? 1.106   20.997  43.604 1.00 14.30  ? 244  SER A CB  1 
ATOM   1845 O  OG  . SER A 1 244 ? 2.030   21.856  44.272 1.00 17.89  ? 244  SER A OG  1 
ATOM   1846 N  N   . HIS A 1 245 ? -0.685  18.437  43.560 1.00 17.81  ? 245  HIS A N   1 
ATOM   1847 C  CA  . HIS A 1 245 ? -1.671  17.569  42.897 1.00 10.98  ? 245  HIS A CA  1 
ATOM   1848 C  C   . HIS A 1 245 ? -2.907  17.408  43.758 1.00 11.42  ? 245  HIS A C   1 
ATOM   1849 O  O   . HIS A 1 245 ? -4.048  17.495  43.297 1.00 10.14  ? 245  HIS A O   1 
ATOM   1850 C  CB  . HIS A 1 245 ? -1.014  16.220  42.608 1.00 13.17  ? 245  HIS A CB  1 
ATOM   1851 C  CG  . HIS A 1 245 ? -1.949  15.126  42.192 1.00 13.25  ? 245  HIS A CG  1 
ATOM   1852 N  ND1 . HIS A 1 245 ? -2.645  15.158  40.998 1.00 12.26  ? 245  HIS A ND1 1 
ATOM   1853 C  CD2 . HIS A 1 245 ? -2.316  13.987  42.815 1.00 13.70  ? 245  HIS A CD2 1 
ATOM   1854 C  CE1 . HIS A 1 245 ? -3.386  14.063  40.913 1.00 14.35  ? 245  HIS A CE1 1 
ATOM   1855 N  NE2 . HIS A 1 245 ? -3.216  13.327  42.004 1.00 14.10  ? 245  HIS A NE2 1 
ATOM   1856 N  N   . CYS A 1 246 ? -2.711  17.173  45.054 1.00 11.50  ? 246  CYS A N   1 
ATOM   1857 C  CA  . CYS A 1 246 ? -3.840  16.990  45.960 1.00 16.12  ? 246  CYS A CA  1 
ATOM   1858 C  C   . CYS A 1 246 ? -4.666  18.253  46.163 1.00 12.79  ? 246  CYS A C   1 
ATOM   1859 O  O   . CYS A 1 246 ? -5.873  18.143  46.344 1.00 13.17  ? 246  CYS A O   1 
ATOM   1860 C  CB  . CYS A 1 246 ? -3.348  16.465  47.322 1.00 15.67  ? 246  CYS A CB  1 
ATOM   1861 S  SG  . CYS A 1 246 ? -2.838  14.726  47.177 1.00 15.52  ? 246  CYS A SG  1 
ATOM   1862 N  N   . LEU A 1 247 ? -4.059  19.434  46.142 1.00 11.37  ? 247  LEU A N   1 
ATOM   1863 C  CA  . LEU A 1 247 ? -4.827  20.677  46.104 1.00 14.51  ? 247  LEU A CA  1 
ATOM   1864 C  C   . LEU A 1 247 ? -5.645  20.782  44.816 1.00 16.82  ? 247  LEU A C   1 
ATOM   1865 O  O   . LEU A 1 247 ? -6.809  21.206  44.854 1.00 15.08  ? 247  LEU A O   1 
ATOM   1866 C  CB  . LEU A 1 247 ? -3.884  21.880  46.191 1.00 17.85  ? 247  LEU A CB  1 
ATOM   1867 C  CG  . LEU A 1 247 ? -3.307  22.176  47.582 1.00 27.62  ? 247  LEU A CG  1 
ATOM   1868 C  CD1 . LEU A 1 247 ? -2.004  22.956  47.442 1.00 20.75  ? 247  LEU A CD1 1 
ATOM   1869 C  CD2 . LEU A 1 247 ? -4.327  22.918  48.430 1.00 28.87  ? 247  LEU A CD2 1 
ATOM   1870 N  N   . LEU A 1 248 ? -5.037  20.414  43.683 1.00 12.02  ? 248  LEU A N   1 
ATOM   1871 C  CA  . LEU A 1 248 ? -5.813  20.455  42.440 1.00 14.39  ? 248  LEU A CA  1 
ATOM   1872 C  C   . LEU A 1 248 ? -7.010  19.506  42.486 1.00 17.18  ? 248  LEU A C   1 
ATOM   1873 O  O   . LEU A 1 248 ? -8.113  19.870  42.060 1.00 17.04  ? 248  LEU A O   1 
ATOM   1874 C  CB  . LEU A 1 248 ? -4.963  20.097  41.238 1.00 14.48  ? 248  LEU A CB  1 
ATOM   1875 C  CG  . LEU A 1 248 ? -4.185  21.113  40.428 1.00 33.78  ? 248  LEU A CG  1 
ATOM   1876 C  CD1 . LEU A 1 248 ? -3.734  20.467  39.117 1.00 27.14  ? 248  LEU A CD1 1 
ATOM   1877 C  CD2 . LEU A 1 248 ? -4.987  22.372  40.145 1.00 27.01  ? 248  LEU A CD2 1 
ATOM   1878 N  N   . VAL A 1 249 ? -6.815  18.295  43.000 1.00 13.17  ? 249  VAL A N   1 
ATOM   1879 C  CA  . VAL A 1 249 ? -7.917  17.338  43.115 1.00 13.63  ? 249  VAL A CA  1 
ATOM   1880 C  C   . VAL A 1 249 ? -9.024  17.861  44.025 1.00 16.73  ? 249  VAL A C   1 
ATOM   1881 O  O   . VAL A 1 249 ? -10.222 17.710  43.769 1.00 15.32  ? 249  VAL A O   1 
ATOM   1882 C  CB  . VAL A 1 249 ? -7.414  15.962  43.600 1.00 17.51  ? 249  VAL A CB  1 
ATOM   1883 C  CG1 . VAL A 1 249 ? -8.579  15.047  43.938 1.00 17.09  ? 249  VAL A CG1 1 
ATOM   1884 C  CG2 . VAL A 1 249 ? -6.535  15.298  42.542 1.00 14.87  ? 249  VAL A CG2 1 
ATOM   1885 N  N   . THR A 1 250 ? -8.640  18.532  45.105 1.00 15.31  ? 250  THR A N   1 
ATOM   1886 C  CA  . THR A 1 250 ? -9.608  19.144  46.015 1.00 15.19  ? 250  THR A CA  1 
ATOM   1887 C  C   . THR A 1 250 ? -10.401 20.226  45.306 1.00 16.93  ? 250  THR A C   1 
ATOM   1888 O  O   . THR A 1 250 ? -11.628 20.294  45.405 1.00 17.24  ? 250  THR A O   1 
ATOM   1889 C  CB  . THR A 1 250 ? -8.878  19.715  47.249 1.00 15.05  ? 250  THR A CB  1 
ATOM   1890 O  OG1 . THR A 1 250 ? -8.222  18.613  47.901 1.00 15.89  ? 250  THR A OG1 1 
ATOM   1891 C  CG2 . THR A 1 250 ? -9.858  20.303  48.258 1.00 11.69  ? 250  THR A CG2 1 
ATOM   1892 N  N   . LEU A 1 251 ? -9.705  21.105  44.577 1.00 13.32  ? 251  LEU A N   1 
ATOM   1893 C  CA  . LEU A 1 251 ? -10.458 22.148  43.868 1.00 14.39  ? 251  LEU A CA  1 
ATOM   1894 C  C   . LEU A 1 251 ? -11.387 21.543  42.826 1.00 21.37  ? 251  LEU A C   1 
ATOM   1895 O  O   . LEU A 1 251 ? -12.540 21.968  42.716 1.00 21.95  ? 251  LEU A O   1 
ATOM   1896 C  CB  . LEU A 1 251 ? -9.489  23.142  43.229 1.00 14.91  ? 251  LEU A CB  1 
ATOM   1897 C  CG  . LEU A 1 251 ? -8.557  23.857  44.217 1.00 23.02  ? 251  LEU A CG  1 
ATOM   1898 C  CD1 . LEU A 1 251 ? -7.455  24.612  43.488 1.00 25.62  ? 251  LEU A CD1 1 
ATOM   1899 C  CD2 . LEU A 1 251 ? -9.352  24.797  45.108 1.00 23.61  ? 251  LEU A CD2 1 
ATOM   1900 N  N   . ALA A 1 252 ? -10.921 20.534  42.085 1.00 17.30  ? 252  ALA A N   1 
ATOM   1901 C  CA  . ALA A 1 252 ? -11.769 19.883  41.090 1.00 17.02  ? 252  ALA A CA  1 
ATOM   1902 C  C   . ALA A 1 252 ? -13.042 19.331  41.719 1.00 20.52  ? 252  ALA A C   1 
ATOM   1903 O  O   . ALA A 1 252 ? -14.128 19.464  41.138 1.00 19.53  ? 252  ALA A O   1 
ATOM   1904 C  CB  . ALA A 1 252 ? -11.028 18.763  40.370 1.00 17.59  ? 252  ALA A CB  1 
ATOM   1905 N  N   . ALA A 1 253 ? -12.902 18.718  42.894 1.00 14.15  ? 253  ALA A N   1 
ATOM   1906 C  CA  . ALA A 1 253 ? -14.047 18.110  43.559 1.00 16.65  ? 253  ALA A CA  1 
ATOM   1907 C  C   . ALA A 1 253 ? -15.026 19.127  44.131 1.00 17.25  ? 253  ALA A C   1 
ATOM   1908 O  O   . ALA A 1 253 ? -16.141 18.742  44.492 1.00 21.34  ? 253  ALA A O   1 
ATOM   1909 C  CB  . ALA A 1 253 ? -13.604 17.190  44.699 1.00 20.15  ? 253  ALA A CB  1 
ATOM   1910 N  N   . HIS A 1 254 ? -14.631 20.385  44.261 1.00 15.09  ? 254  HIS A N   1 
ATOM   1911 C  CA  . HIS A 1 254 ? -15.485 21.386  44.891 1.00 22.37  ? 254  HIS A CA  1 
ATOM   1912 C  C   . HIS A 1 254 ? -15.949 22.447  43.892 1.00 20.85  ? 254  HIS A C   1 
ATOM   1913 O  O   . HIS A 1 254 ? -16.895 23.168  44.214 1.00 25.38  ? 254  HIS A O   1 
ATOM   1914 C  CB  . HIS A 1 254 ? -14.779 22.079  46.066 1.00 21.49  ? 254  HIS A CB  1 
ATOM   1915 C  CG  . HIS A 1 254 ? -14.681 21.243  47.298 1.00 18.54  ? 254  HIS A CG  1 
ATOM   1916 N  ND1 . HIS A 1 254 ? -15.717 21.070  48.185 1.00 23.47  ? 254  HIS A ND1 1 
ATOM   1917 C  CD2 . HIS A 1 254 ? -13.651 20.496  47.789 1.00 19.33  ? 254  HIS A CD2 1 
ATOM   1918 C  CE1 . HIS A 1 254 ? -15.330 20.272  49.169 1.00 28.50  ? 254  HIS A CE1 1 
ATOM   1919 N  NE2 . HIS A 1 254 ? -14.071 19.912  48.955 1.00 20.00  ? 254  HIS A NE2 1 
ATOM   1920 N  N   . LEU A 1 255 ? -15.309 22.544  42.740 1.00 22.78  ? 255  LEU A N   1 
ATOM   1921 C  CA  . LEU A 1 255 ? -15.553 23.578  41.747 1.00 23.86  ? 255  LEU A CA  1 
ATOM   1922 C  C   . LEU A 1 255 ? -15.989 22.992  40.408 1.00 22.17  ? 255  LEU A C   1 
ATOM   1923 O  O   . LEU A 1 255 ? -15.254 23.100  39.425 1.00 39.17  ? 255  LEU A O   1 
ATOM   1924 C  CB  . LEU A 1 255 ? -14.278 24.391  41.509 1.00 27.82  ? 255  LEU A CB  1 
ATOM   1925 C  CG  . LEU A 1 255 ? -13.986 25.530  42.482 1.00 33.15  ? 255  LEU A CG  1 
ATOM   1926 C  CD1 . LEU A 1 255 ? -12.549 26.011  42.304 1.00 51.80  ? 255  LEU A CD1 1 
ATOM   1927 C  CD2 . LEU A 1 255 ? -14.951 26.685  42.290 1.00 31.87  ? 255  LEU A CD2 1 
ATOM   1928 N  N   . PRO A 1 256 ? -17.155 22.365  40.339 1.00 24.07  ? 256  PRO A N   1 
ATOM   1929 C  CA  . PRO A 1 256 ? -17.567 21.677  39.109 1.00 28.80  ? 256  PRO A CA  1 
ATOM   1930 C  C   . PRO A 1 256 ? -17.644 22.608  37.906 1.00 30.93  ? 256  PRO A C   1 
ATOM   1931 O  O   . PRO A 1 256 ? -17.266 22.223  36.793 1.00 47.29  ? 256  PRO A O   1 
ATOM   1932 C  CB  . PRO A 1 256 ? -18.949 21.118  39.466 1.00 25.41  ? 256  PRO A CB  1 
ATOM   1933 C  CG  . PRO A 1 256 ? -19.420 21.981  40.592 1.00 32.48  ? 256  PRO A CG  1 
ATOM   1934 C  CD  . PRO A 1 256 ? -18.178 22.267  41.397 1.00 28.89  ? 256  PRO A CD  1 
ATOM   1935 N  N   . ALA A 1 257 ? -18.103 23.843  38.083 1.00 27.92  ? 257  ALA A N   1 
ATOM   1936 C  CA  . ALA A 1 257 ? -18.242 24.746  36.945 1.00 27.59  ? 257  ALA A CA  1 
ATOM   1937 C  C   . ALA A 1 257 ? -16.956 25.503  36.634 1.00 19.80  ? 257  ALA A C   1 
ATOM   1938 O  O   . ALA A 1 257 ? -16.650 25.711  35.456 1.00 25.46  ? 257  ALA A O   1 
ATOM   1939 C  CB  . ALA A 1 257 ? -19.393 25.719  37.182 1.00 35.00  ? 257  ALA A CB  1 
ATOM   1940 N  N   . GLU A 1 258 ? -16.214 25.906  37.652 1.00 21.02  ? 258  GLU A N   1 
ATOM   1941 C  CA  . GLU A 1 258 ? -15.006 26.708  37.502 1.00 27.17  ? 258  GLU A CA  1 
ATOM   1942 C  C   . GLU A 1 258 ? -13.802 25.916  36.999 1.00 23.85  ? 258  GLU A C   1 
ATOM   1943 O  O   . GLU A 1 258 ? -12.931 26.486  36.328 1.00 25.57  ? 258  GLU A O   1 
ATOM   1944 C  CB  . GLU A 1 258 ? -14.632 27.354  38.842 1.00 36.29  ? 258  GLU A CB  1 
ATOM   1945 C  CG  . GLU A 1 258 ? -15.544 28.506  39.237 1.00 48.90  ? 258  GLU A CG  1 
ATOM   1946 C  CD  . GLU A 1 258 ? -16.840 28.034  39.869 1.00 47.57  ? 258  GLU A CD  1 
ATOM   1947 O  OE1 . GLU A 1 258 ? -16.916 26.867  40.305 1.00 37.85  ? 258  GLU A OE1 1 
ATOM   1948 O  OE2 . GLU A 1 258 ? -17.786 28.845  39.928 1.00 48.96  ? 258  GLU A OE2 1 
ATOM   1949 N  N   . PHE A 1 259 ? -13.732 24.626  37.292 1.00 19.64  ? 259  PHE A N   1 
ATOM   1950 C  CA  . PHE A 1 259 ? -12.535 23.842  36.936 1.00 22.22  ? 259  PHE A CA  1 
ATOM   1951 C  C   . PHE A 1 259 ? -12.518 23.396  35.481 1.00 18.41  ? 259  PHE A C   1 
ATOM   1952 O  O   . PHE A 1 259 ? -12.521 22.203  35.167 1.00 21.25  ? 259  PHE A O   1 
ATOM   1953 C  CB  . PHE A 1 259 ? -12.430 22.643  37.882 1.00 18.00  ? 259  PHE A CB  1 
ATOM   1954 C  CG  . PHE A 1 259 ? -11.059 21.976  37.921 1.00 18.58  ? 259  PHE A CG  1 
ATOM   1955 C  CD1 . PHE A 1 259 ? -10.003 22.579  38.576 1.00 25.45  ? 259  PHE A CD1 1 
ATOM   1956 C  CD2 . PHE A 1 259 ? -10.842 20.754  37.306 1.00 18.74  ? 259  PHE A CD2 1 
ATOM   1957 C  CE1 . PHE A 1 259 ? -8.754  21.984  38.616 1.00 29.29  ? 259  PHE A CE1 1 
ATOM   1958 C  CE2 . PHE A 1 259 ? -9.601  20.148  37.343 1.00 23.38  ? 259  PHE A CE2 1 
ATOM   1959 C  CZ  . PHE A 1 259 ? -8.555  20.757  38.009 1.00 22.61  ? 259  PHE A CZ  1 
ATOM   1960 N  N   . THR A 1 260 ? -12.476 24.332  34.543 1.00 14.41  ? 260  THR A N   1 
ATOM   1961 C  CA  . THR A 1 260 ? -12.339 24.053  33.118 1.00 17.35  ? 260  THR A CA  1 
ATOM   1962 C  C   . THR A 1 260 ? -10.929 23.604  32.757 1.00 18.13  ? 260  THR A C   1 
ATOM   1963 O  O   . THR A 1 260 ? -9.983  23.730  33.544 1.00 18.01  ? 260  THR A O   1 
ATOM   1964 C  CB  . THR A 1 260 ? -12.708 25.313  32.309 1.00 24.76  ? 260  THR A CB  1 
ATOM   1965 O  OG1 . THR A 1 260 ? -11.711 26.320  32.503 1.00 25.34  ? 260  THR A OG1 1 
ATOM   1966 C  CG2 . THR A 1 260 ? -14.013 25.920  32.815 1.00 27.84  ? 260  THR A CG2 1 
ATOM   1967 N  N   . PRO A 1 261 ? -10.716 23.059  31.569 1.00 18.58  ? 261  PRO A N   1 
ATOM   1968 C  CA  . PRO A 1 261 ? -9.340  22.728  31.171 1.00 17.86  ? 261  PRO A CA  1 
ATOM   1969 C  C   . PRO A 1 261 ? -8.393  23.915  31.233 1.00 18.47  ? 261  PRO A C   1 
ATOM   1970 O  O   . PRO A 1 261 ? -7.236  23.788  31.662 1.00 19.40  ? 261  PRO A O   1 
ATOM   1971 C  CB  . PRO A 1 261 ? -9.511  22.219  29.735 1.00 21.35  ? 261  PRO A CB  1 
ATOM   1972 C  CG  . PRO A 1 261 ? -10.913 21.681  29.721 1.00 23.81  ? 261  PRO A CG  1 
ATOM   1973 C  CD  . PRO A 1 261 ? -11.701 22.663  30.552 1.00 17.95  ? 261  PRO A CD  1 
ATOM   1974 N  N   . ALA A 1 262 ? -8.819  25.111  30.826 1.00 21.26  ? 262  ALA A N   1 
ATOM   1975 C  CA  . ALA A 1 262 ? -7.904  26.253  30.860 1.00 19.16  ? 262  ALA A CA  1 
ATOM   1976 C  C   . ALA A 1 262 ? -7.545  26.642  32.291 1.00 19.77  ? 262  ALA A C   1 
ATOM   1977 O  O   . ALA A 1 262 ? -6.406  26.978  32.612 1.00 20.35  ? 262  ALA A O   1 
ATOM   1978 C  CB  . ALA A 1 262 ? -8.525  27.447  30.144 1.00 23.72  ? 262  ALA A CB  1 
ATOM   1979 N  N   . VAL A 1 263 ? -8.542  26.610  33.170 1.00 14.08  ? 263  VAL A N   1 
ATOM   1980 C  CA  . VAL A 1 263 ? -8.322  26.993  34.570 1.00 16.68  ? 263  VAL A CA  1 
ATOM   1981 C  C   . VAL A 1 263 ? -7.495  25.927  35.278 1.00 17.29  ? 263  VAL A C   1 
ATOM   1982 O  O   . VAL A 1 263 ? -6.632  26.236  36.098 1.00 17.93  ? 263  VAL A O   1 
ATOM   1983 C  CB  . VAL A 1 263 ? -9.658  27.238  35.290 1.00 18.02  ? 263  VAL A CB  1 
ATOM   1984 C  CG1 . VAL A 1 263 ? -9.504  27.175  36.805 1.00 20.70  ? 263  VAL A CG1 1 
ATOM   1985 C  CG2 . VAL A 1 263 ? -10.231 28.594  34.891 1.00 19.00  ? 263  VAL A CG2 1 
ATOM   1986 N  N   . HIS A 1 264 ? -7.735  24.661  34.948 1.00 17.03  ? 264  HIS A N   1 
ATOM   1987 C  CA  . HIS A 1 264 ? -6.859  23.563  35.381 1.00 16.97  ? 264  HIS A CA  1 
ATOM   1988 C  C   . HIS A 1 264 ? -5.412  23.852  35.007 1.00 14.98  ? 264  HIS A C   1 
ATOM   1989 O  O   . HIS A 1 264 ? -4.504  23.742  35.836 1.00 18.11  ? 264  HIS A O   1 
ATOM   1990 C  CB  . HIS A 1 264 ? -7.358  22.268  34.755 1.00 17.83  ? 264  HIS A CB  1 
ATOM   1991 C  CG  . HIS A 1 264 ? -6.674  20.983  35.081 1.00 17.24  ? 264  HIS A CG  1 
ATOM   1992 N  ND1 . HIS A 1 264 ? -7.225  19.784  34.675 1.00 14.70  ? 264  HIS A ND1 1 
ATOM   1993 C  CD2 . HIS A 1 264 ? -5.549  20.647  35.754 1.00 16.78  ? 264  HIS A CD2 1 
ATOM   1994 C  CE1 . HIS A 1 264 ? -6.465  18.776  35.068 1.00 19.90  ? 264  HIS A CE1 1 
ATOM   1995 N  NE2 . HIS A 1 264 ? -5.437  19.275  35.726 1.00 16.31  ? 264  HIS A NE2 1 
ATOM   1996 N  N   . ALA A 1 265 ? -5.131  24.208  33.754 1.00 14.60  ? 265  ALA A N   1 
ATOM   1997 C  CA  . ALA A 1 265 ? -3.745  24.468  33.359 1.00 15.88  ? 265  ALA A CA  1 
ATOM   1998 C  C   . ALA A 1 265 ? -3.136  25.631  34.130 1.00 17.88  ? 265  ALA A C   1 
ATOM   1999 O  O   . ALA A 1 265 ? -2.011  25.559  34.629 1.00 17.51  ? 265  ALA A O   1 
ATOM   2000 C  CB  . ALA A 1 265 ? -3.689  24.725  31.859 1.00 13.95  ? 265  ALA A CB  1 
ATOM   2001 N  N   . SER A 1 266 ? -3.892  26.723  34.248 1.00 13.95  ? 266  SER A N   1 
ATOM   2002 C  CA  . SER A 1 266 ? -3.409  27.898  34.966 1.00 13.58  ? 266  SER A CA  1 
ATOM   2003 C  C   . SER A 1 266 ? -3.138  27.584  36.430 1.00 14.17  ? 266  SER A C   1 
ATOM   2004 O  O   . SER A 1 266 ? -2.187  28.115  37.012 1.00 15.84  ? 266  SER A O   1 
ATOM   2005 C  CB  . SER A 1 266 ? -4.405  29.059  34.873 1.00 15.66  ? 266  SER A CB  1 
ATOM   2006 O  OG  . SER A 1 266 ? -4.602  29.466  33.528 1.00 18.09  ? 266  SER A OG  1 
ATOM   2007 N  N   . LEU A 1 267 ? -3.979  26.756  37.048 1.00 11.83  ? 267  LEU A N   1 
ATOM   2008 C  CA  . LEU A 1 267 ? -3.755  26.461  38.461 1.00 16.12  ? 267  LEU A CA  1 
ATOM   2009 C  C   . LEU A 1 267 ? -2.515  25.587  38.629 1.00 15.55  ? 267  LEU A C   1 
ATOM   2010 O  O   . LEU A 1 267 ? -1.771  25.715  39.602 1.00 14.41  ? 267  LEU A O   1 
ATOM   2011 C  CB  . LEU A 1 267 ? -4.970  25.766  39.072 1.00 14.59  ? 267  LEU A CB  1 
ATOM   2012 C  CG  . LEU A 1 267 ? -6.142  26.687  39.433 1.00 21.48  ? 267  LEU A CG  1 
ATOM   2013 C  CD1 . LEU A 1 267 ? -7.383  25.864  39.746 1.00 17.84  ? 267  LEU A CD1 1 
ATOM   2014 C  CD2 . LEU A 1 267 ? -5.760  27.603  40.583 1.00 22.62  ? 267  LEU A CD2 1 
ATOM   2015 N  N   . ASP A 1 268 ? -2.306  24.663  37.689 1.00 14.13  ? 268  ASP A N   1 
ATOM   2016 C  CA  . ASP A 1 268 ? -1.140  23.781  37.804 1.00 13.85  ? 268  ASP A CA  1 
ATOM   2017 C  C   . ASP A 1 268 ? 0.135   24.594  37.625 1.00 18.08  ? 268  ASP A C   1 
ATOM   2018 O  O   . ASP A 1 268 ? 1.120   24.381  38.327 1.00 16.66  ? 268  ASP A O   1 
ATOM   2019 C  CB  . ASP A 1 268 ? -1.236  22.631  36.812 1.00 15.63  ? 268  ASP A CB  1 
ATOM   2020 C  CG  . ASP A 1 268 ? -0.220  21.529  37.067 1.00 18.39  ? 268  ASP A CG  1 
ATOM   2021 O  OD1 . ASP A 1 268 ? -0.271  20.899  38.137 1.00 24.12  ? 268  ASP A OD1 1 
ATOM   2022 O  OD2 . ASP A 1 268 ? 0.654   21.327  36.211 1.00 26.37  ? 268  ASP A OD2 1 
ATOM   2023 N  N   . LYS A 1 269 ? 0.134   25.564  36.710 1.00 14.68  ? 269  LYS A N   1 
ATOM   2024 C  CA  . LYS A 1 269 ? 1.288   26.450  36.579 1.00 14.21  ? 269  LYS A CA  1 
ATOM   2025 C  C   . LYS A 1 269 ? 1.469   27.302  37.834 1.00 15.89  ? 269  LYS A C   1 
ATOM   2026 O  O   . LYS A 1 269 ? 2.586   27.540  38.293 1.00 15.58  ? 269  LYS A O   1 
ATOM   2027 C  CB  . LYS A 1 269 ? 1.120   27.379  35.375 1.00 16.04  ? 269  LYS A CB  1 
ATOM   2028 C  CG  . LYS A 1 269 ? 1.328   26.740  34.015 1.00 23.42  ? 269  LYS A CG  1 
ATOM   2029 C  CD  . LYS A 1 269 ? 0.900   27.687  32.892 1.00 22.18  ? 269  LYS A CD  1 
ATOM   2030 C  CE  . LYS A 1 269 ? 1.714   28.968  32.914 1.00 29.90  ? 269  LYS A CE  1 
ATOM   2031 N  NZ  . LYS A 1 269 ? 1.631   29.705  31.620 1.00 27.64  ? 269  LYS A NZ  1 
ATOM   2032 N  N   . PHE A 1 270 ? 0.364   27.793  38.398 1.00 15.56  ? 270  PHE A N   1 
ATOM   2033 C  CA  . PHE A 1 270 ? 0.492   28.592  39.625 1.00 15.20  ? 270  PHE A CA  1 
ATOM   2034 C  C   . PHE A 1 270 ? 1.065   27.763  40.759 1.00 18.97  ? 270  PHE A C   1 
ATOM   2035 O  O   . PHE A 1 270 ? 2.005   28.181  41.432 1.00 15.63  ? 270  PHE A O   1 
ATOM   2036 C  CB  . PHE A 1 270 ? -0.853  29.194  40.012 1.00 16.87  ? 270  PHE A CB  1 
ATOM   2037 C  CG  . PHE A 1 270 ? -0.914  29.831  41.390 1.00 16.50  ? 270  PHE A CG  1 
ATOM   2038 C  CD1 . PHE A 1 270 ? -0.270  31.031  41.638 1.00 22.44  ? 270  PHE A CD1 1 
ATOM   2039 C  CD2 . PHE A 1 270 ? -1.628  29.225  42.413 1.00 20.65  ? 270  PHE A CD2 1 
ATOM   2040 C  CE1 . PHE A 1 270 ? -0.340  31.615  42.890 1.00 22.28  ? 270  PHE A CE1 1 
ATOM   2041 C  CE2 . PHE A 1 270 ? -1.696  29.800  43.671 1.00 21.65  ? 270  PHE A CE2 1 
ATOM   2042 C  CZ  . PHE A 1 270 ? -1.051  31.000  43.899 1.00 22.85  ? 270  PHE A CZ  1 
ATOM   2043 N  N   . LEU A 1 271 ? 0.552   26.547  40.993 1.00 14.18  ? 271  LEU A N   1 
ATOM   2044 C  CA  . LEU A 1 271 ? 1.139   25.820  42.129 1.00 13.97  ? 271  LEU A CA  1 
ATOM   2045 C  C   . LEU A 1 271 ? 2.576   25.389  41.895 1.00 17.15  ? 271  LEU A C   1 
ATOM   2046 O  O   . LEU A 1 271 ? 3.365   25.266  42.841 1.00 17.68  ? 271  LEU A O   1 
ATOM   2047 C  CB  . LEU A 1 271 ? 0.275   24.614  42.487 1.00 14.05  ? 271  LEU A CB  1 
ATOM   2048 C  CG  . LEU A 1 271 ? -1.157  24.969  42.915 1.00 16.99  ? 271  LEU A CG  1 
ATOM   2049 C  CD1 . LEU A 1 271 ? -1.996  23.708  42.922 1.00 18.57  ? 271  LEU A CD1 1 
ATOM   2050 C  CD2 . LEU A 1 271 ? -1.151  25.669  44.265 1.00 28.02  ? 271  LEU A CD2 1 
ATOM   2051 N  N   . ALA A 1 272 ? 2.978   25.151  40.647 1.00 15.39  ? 272  ALA A N   1 
ATOM   2052 C  CA  . ALA A 1 272 ? 4.391   24.872  40.393 1.00 14.43  ? 272  ALA A CA  1 
ATOM   2053 C  C   . ALA A 1 272 ? 5.248   26.098  40.692 1.00 23.91  ? 272  ALA A C   1 
ATOM   2054 O  O   . ALA A 1 272 ? 6.405   25.996  41.116 1.00 18.83  ? 272  ALA A O   1 
ATOM   2055 C  CB  . ALA A 1 272 ? 4.592   24.407  38.952 1.00 16.37  ? 272  ALA A CB  1 
ATOM   2056 N  N   . SER A 1 273 ? 4.698   27.290  40.446 1.00 17.08  ? 273  SER A N   1 
ATOM   2057 C  CA  . SER A 1 273 ? 5.478   28.497  40.733 1.00 17.91  ? 273  SER A CA  1 
ATOM   2058 C  C   . SER A 1 273 ? 5.632   28.694  42.239 1.00 18.98  ? 273  SER A C   1 
ATOM   2059 O  O   . SER A 1 273 ? 6.690   29.088  42.725 1.00 18.70  ? 273  SER A O   1 
ATOM   2060 C  CB  . SER A 1 273 ? 4.838   29.749  40.129 1.00 23.84  ? 273  SER A CB  1 
ATOM   2061 O  OG  . SER A 1 273 ? 4.318   29.507  38.839 1.00 38.66  ? 273  SER A OG  1 
ATOM   2062 N  N   . VAL A 1 274 ? 4.554   28.447  42.968 1.00 13.87  ? 274  VAL A N   1 
ATOM   2063 C  CA  . VAL A 1 274 ? 4.621   28.520  44.430 1.00 18.82  ? 274  VAL A CA  1 
ATOM   2064 C  C   . VAL A 1 274 ? 5.635   27.517  44.959 1.00 19.80  ? 274  VAL A C   1 
ATOM   2065 O  O   . VAL A 1 274 ? 6.449   27.821  45.838 1.00 14.01  ? 274  VAL A O   1 
ATOM   2066 C  CB  . VAL A 1 274 ? 3.234   28.277  45.044 1.00 19.60  ? 274  VAL A CB  1 
ATOM   2067 C  CG1 . VAL A 1 274 ? 3.311   28.170  46.557 1.00 23.89  ? 274  VAL A CG1 1 
ATOM   2068 C  CG2 . VAL A 1 274 ? 2.300   29.410  44.623 1.00 18.26  ? 274  VAL A CG2 1 
ATOM   2069 N  N   . SER A 1 275 ? 5.596   26.302  44.398 1.00 16.68  ? 275  SER A N   1 
ATOM   2070 C  CA  . SER A 1 275 ? 6.543   25.266  44.801 1.00 16.23  ? 275  SER A CA  1 
ATOM   2071 C  C   . SER A 1 275 ? 7.983   25.670  44.520 1.00 15.51  ? 275  SER A C   1 
ATOM   2072 O  O   . SER A 1 275 ? 8.874   25.441  45.339 1.00 15.80  ? 275  SER A O   1 
ATOM   2073 C  CB  . SER A 1 275 ? 6.192   23.938  44.114 1.00 17.40  ? 275  SER A CB  1 
ATOM   2074 O  OG  . SER A 1 275 ? 4.930   23.477  44.599 1.00 21.49  ? 275  SER A OG  1 
ATOM   2075 N  N   . THR A 1 276 ? 8.235   26.271  43.370 1.00 16.30  ? 276  THR A N   1 
ATOM   2076 C  CA  . THR A 1 276 ? 9.560   26.787  43.042 1.00 20.95  ? 276  THR A CA  1 
ATOM   2077 C  C   . THR A 1 276 ? 10.060  27.808  44.053 1.00 22.82  ? 276  THR A C   1 
ATOM   2078 O  O   . THR A 1 276 ? 11.185  27.715  44.543 1.00 18.76  ? 276  THR A O   1 
ATOM   2079 C  CB  . THR A 1 276 ? 9.519   27.429  41.638 1.00 18.29  ? 276  THR A CB  1 
ATOM   2080 O  OG1 . THR A 1 276 ? 9.306   26.358  40.715 1.00 20.46  ? 276  THR A OG1 1 
ATOM   2081 C  CG2 . THR A 1 276 ? 10.833  28.102  41.293 1.00 22.99  ? 276  THR A CG2 1 
ATOM   2082 N  N   . VAL A 1 277 ? 9.215   28.786  44.366 1.00 16.03  ? 277  VAL A N   1 
ATOM   2083 C  CA  . VAL A 1 277 ? 9.588   29.828  45.330 1.00 16.10  ? 277  VAL A CA  1 
ATOM   2084 C  C   . VAL A 1 277 ? 9.902   29.207  46.681 1.00 18.72  ? 277  VAL A C   1 
ATOM   2085 O  O   . VAL A 1 277 ? 10.888  29.569  47.335 1.00 15.98  ? 277  VAL A O   1 
ATOM   2086 C  CB  . VAL A 1 277 ? 8.454   30.866  45.458 1.00 18.50  ? 277  VAL A CB  1 
ATOM   2087 C  CG1 . VAL A 1 277 ? 8.622   31.697  46.721 1.00 18.18  ? 277  VAL A CG1 1 
ATOM   2088 C  CG2 . VAL A 1 277 ? 8.397   31.751  44.218 1.00 20.04  ? 277  VAL A CG2 1 
ATOM   2089 N  N   . LEU A 1 278 ? 9.076   28.260  47.123 1.00 15.51  ? 278  LEU A N   1 
ATOM   2090 C  CA  . LEU A 1 278 ? 9.266   27.657  48.438 1.00 21.07  ? 278  LEU A CA  1 
ATOM   2091 C  C   . LEU A 1 278 ? 10.542  26.822  48.519 1.00 25.74  ? 278  LEU A C   1 
ATOM   2092 O  O   . LEU A 1 278 ? 11.062  26.608  49.621 1.00 20.07  ? 278  LEU A O   1 
ATOM   2093 C  CB  . LEU A 1 278 ? 8.063   26.797  48.851 1.00 20.31  ? 278  LEU A CB  1 
ATOM   2094 C  CG  . LEU A 1 278 ? 6.796   27.572  49.225 1.00 19.68  ? 278  LEU A CG  1 
ATOM   2095 C  CD1 . LEU A 1 278 ? 5.722   26.641  49.772 1.00 25.58  ? 278  LEU A CD1 1 
ATOM   2096 C  CD2 . LEU A 1 278 ? 7.109   28.677  50.218 1.00 29.40  ? 278  LEU A CD2 1 
ATOM   2097 N  N   . THR A 1 279 ? 11.064  26.345  47.393 1.00 18.26  ? 279  THR A N   1 
ATOM   2098 C  CA  . THR A 1 279 ? 12.293  25.541  47.461 1.00 16.33  ? 279  THR A CA  1 
ATOM   2099 C  C   . THR A 1 279 ? 13.516  26.310  46.982 1.00 17.87  ? 279  THR A C   1 
ATOM   2100 O  O   . THR A 1 279 ? 14.625  25.771  46.885 1.00 20.71  ? 279  THR A O   1 
ATOM   2101 C  CB  . THR A 1 279 ? 12.108  24.231  46.671 1.00 20.95  ? 279  THR A CB  1 
ATOM   2102 O  OG1 . THR A 1 279 ? 11.815  24.482  45.290 1.00 19.10  ? 279  THR A OG1 1 
ATOM   2103 C  CG2 . THR A 1 279 ? 10.896  23.474  47.210 1.00 24.55  ? 279  THR A CG2 1 
ATOM   2104 N  N   . SER A 1 280 ? 13.344  27.601  46.696 1.00 14.02  ? 280  SER A N   1 
ATOM   2105 C  CA  . SER A 1 280 ? 14.393  28.379  46.048 1.00 19.73  ? 280  SER A CA  1 
ATOM   2106 C  C   . SER A 1 280 ? 15.610  28.574  46.934 1.00 26.26  ? 280  SER A C   1 
ATOM   2107 O  O   . SER A 1 280 ? 16.712  28.848  46.449 1.00 23.46  ? 280  SER A O   1 
ATOM   2108 C  CB  . SER A 1 280 ? 13.853  29.737  45.591 1.00 21.32  ? 280  SER A CB  1 
ATOM   2109 O  OG  . SER A 1 280 ? 13.208  30.430  46.641 1.00 29.40  ? 280  SER A OG  1 
ATOM   2110 N  N   . LYS A 1 281 ? 15.438  28.443  48.247 1.00 21.45  ? 281  LYS A N   1 
ATOM   2111 C  CA  . LYS A 1 281 ? 16.578  28.752  49.114 1.00 20.68  ? 281  LYS A CA  1 
ATOM   2112 C  C   . LYS A 1 281 ? 17.192  27.494  49.699 1.00 26.20  ? 281  LYS A C   1 
ATOM   2113 O  O   . LYS A 1 281 ? 17.990  27.543  50.636 1.00 19.56  ? 281  LYS A O   1 
ATOM   2114 C  CB  . LYS A 1 281 ? 16.125  29.708  50.218 1.00 23.04  ? 281  LYS A CB  1 
ATOM   2115 C  CG  . LYS A 1 281 ? 15.542  31.013  49.685 1.00 24.37  ? 281  LYS A CG  1 
ATOM   2116 C  CD  . LYS A 1 281 ? 15.530  32.075  50.769 1.00 37.65  ? 281  LYS A CD  1 
ATOM   2117 C  CE  . LYS A 1 281 ? 15.139  33.441  50.223 1.00 44.38  ? 281  LYS A CE  1 
ATOM   2118 N  NZ  . LYS A 1 281 ? 13.742  33.783  50.625 1.00 54.92  ? 281  LYS A NZ  1 
ATOM   2119 N  N   . TYR A 1 282 ? 16.832  26.340  49.134 1.00 17.16  ? 282  TYR A N   1 
ATOM   2120 C  CA  . TYR A 1 282 ? 17.308  25.091  49.721 1.00 16.99  ? 282  TYR A CA  1 
ATOM   2121 C  C   . TYR A 1 282 ? 18.824  24.935  49.616 1.00 20.85  ? 282  TYR A C   1 
ATOM   2122 O  O   . TYR A 1 282 ? 19.452  24.383  50.523 1.00 24.56  ? 282  TYR A O   1 
ATOM   2123 C  CB  . TYR A 1 282 ? 16.588  23.909  49.060 1.00 16.30  ? 282  TYR A CB  1 
ATOM   2124 C  CG  . TYR A 1 282 ? 15.329  23.465  49.772 1.00 17.66  ? 282  TYR A CG  1 
ATOM   2125 C  CD1 . TYR A 1 282 ? 14.293  24.350  50.049 1.00 16.89  ? 282  TYR A CD1 1 
ATOM   2126 C  CD2 . TYR A 1 282 ? 15.149  22.144  50.170 1.00 20.60  ? 282  TYR A CD2 1 
ATOM   2127 C  CE1 . TYR A 1 282 ? 13.139  23.943  50.700 1.00 14.22  ? 282  TYR A CE1 1 
ATOM   2128 C  CE2 . TYR A 1 282 ? 13.997  21.734  50.817 1.00 21.72  ? 282  TYR A CE2 1 
ATOM   2129 C  CZ  . TYR A 1 282 ? 12.984  22.638  51.084 1.00 12.96  ? 282  TYR A CZ  1 
ATOM   2130 O  OH  . TYR A 1 282 ? 11.841  22.213  51.730 1.00 14.84  ? 282  TYR A OH  1 
ATOM   2131 N  N   . ARG A 1 283 ? 19.385  25.406  48.517 1.00 23.90  ? 283  ARG A N   1 
ATOM   2132 C  CA  . ARG A 1 283 ? 20.772  25.190  48.141 1.00 38.87  ? 283  ARG A CA  1 
ATOM   2133 C  C   . ARG A 1 283 ? 21.467  26.475  47.691 1.00 38.79  ? 283  ARG A C   1 
ATOM   2134 O  O   . ARG A 1 283 ? 22.669  26.632  47.923 1.00 37.65  ? 283  ARG A O   1 
ATOM   2135 C  CB  . ARG A 1 283 ? 20.845  24.206  46.965 1.00 36.83  ? 283  ARG A CB  1 
ATOM   2136 C  CG  . ARG A 1 283 ? 20.750  22.746  47.348 1.00 38.42  ? 283  ARG A CG  1 
ATOM   2137 C  CD  . ARG A 1 283 ? 21.590  21.905  46.398 1.00 36.91  ? 283  ARG A CD  1 
ATOM   2138 N  NE  . ARG A 1 283 ? 21.007  21.864  45.052 1.00 26.93  ? 283  ARG A NE  1 
ATOM   2139 C  CZ  . ARG A 1 283 ? 21.384  20.911  44.198 1.00 30.57  ? 283  ARG A CZ  1 
ATOM   2140 N  NH1 . ARG A 1 283 ? 22.284  20.031  44.617 1.00 18.81  ? 283  ARG A NH1 1 
ATOM   2141 N  NH2 . ARG A 1 283 ? 20.867  20.859  42.980 1.00 27.26  ? 283  ARG A NH2 1 
ATOM   2142 O  OXT . ARG A 1 283 ? 20.769  27.286  47.046 1.00 41.15  ? 283  ARG A OXT 1 
ATOM   2143 N  N   . MET B 2 1   ? 15.713  -9.038  42.999 1.00 69.05  ? 1    MET B N   1 
ATOM   2144 C  CA  . MET B 2 1   ? 16.376  -8.240  41.969 1.00 73.57  ? 1    MET B CA  1 
ATOM   2145 C  C   . MET B 2 1   ? 16.904  -9.120  40.845 1.00 77.68  ? 1    MET B C   1 
ATOM   2146 O  O   . MET B 2 1   ? 17.818  -9.927  41.027 1.00 77.92  ? 1    MET B O   1 
ATOM   2147 C  CB  . MET B 2 1   ? 17.503  -7.417  42.597 1.00 67.11  ? 1    MET B CB  1 
ATOM   2148 C  CG  . MET B 2 1   ? 18.377  -6.660  41.616 1.00 67.13  ? 1    MET B CG  1 
ATOM   2149 S  SD  . MET B 2 1   ? 18.468  -4.891  41.980 1.00 40.67  ? 1    MET B SD  1 
ATOM   2150 C  CE  . MET B 2 1   ? 16.970  -4.338  41.156 1.00 54.60  ? 1    MET B CE  1 
ATOM   2151 N  N   . HIS B 2 2   ? 16.324  -8.982  39.650 1.00 77.04  ? 2    HIS B N   1 
ATOM   2152 C  CA  . HIS B 2 2   ? 16.841  -9.738  38.514 1.00 73.08  ? 2    HIS B CA  1 
ATOM   2153 C  C   . HIS B 2 2   ? 17.865  -8.914  37.736 1.00 59.34  ? 2    HIS B C   1 
ATOM   2154 O  O   . HIS B 2 2   ? 17.527  -8.051  36.929 1.00 54.12  ? 2    HIS B O   1 
ATOM   2155 C  CB  . HIS B 2 2   ? 15.731  -10.195 37.565 1.00 83.63  ? 2    HIS B CB  1 
ATOM   2156 C  CG  . HIS B 2 2   ? 16.230  -10.410 36.165 1.00 93.19  ? 2    HIS B CG  1 
ATOM   2157 N  ND1 . HIS B 2 2   ? 15.949  -9.546  35.130 1.00 97.48  ? 2    HIS B ND1 1 
ATOM   2158 C  CD2 . HIS B 2 2   ? 17.007  -11.381 35.632 1.00 95.68  ? 2    HIS B CD2 1 
ATOM   2159 C  CE1 . HIS B 2 2   ? 16.520  -9.976  34.019 1.00 95.92  ? 2    HIS B CE1 1 
ATOM   2160 N  NE2 . HIS B 2 2   ? 17.170  -11.093 34.298 1.00 96.50  ? 2    HIS B NE2 1 
ATOM   2161 N  N   . LEU B 2 3   ? 19.131  -9.201  38.004 1.00 43.93  ? 3    LEU B N   1 
ATOM   2162 C  CA  . LEU B 2 3   ? 20.235  -8.715  37.184 1.00 33.04  ? 3    LEU B CA  1 
ATOM   2163 C  C   . LEU B 2 3   ? 20.737  -9.879  36.336 1.00 39.85  ? 3    LEU B C   1 
ATOM   2164 O  O   . LEU B 2 3   ? 20.528  -11.033 36.728 1.00 38.32  ? 3    LEU B O   1 
ATOM   2165 C  CB  . LEU B 2 3   ? 21.345  -8.158  38.074 1.00 32.96  ? 3    LEU B CB  1 
ATOM   2166 C  CG  . LEU B 2 3   ? 20.900  -7.101  39.090 1.00 35.16  ? 3    LEU B CG  1 
ATOM   2167 C  CD1 . LEU B 2 3   ? 21.636  -7.274  40.411 1.00 48.26  ? 3    LEU B CD1 1 
ATOM   2168 C  CD2 . LEU B 2 3   ? 21.115  -5.703  38.529 1.00 42.96  ? 3    LEU B CD2 1 
ATOM   2169 N  N   . THR B 2 4   ? 21.366  -9.613  35.197 1.00 34.97  ? 4    THR B N   1 
ATOM   2170 C  CA  . THR B 2 4   ? 21.941  -10.728 34.442 1.00 37.75  ? 4    THR B CA  1 
ATOM   2171 C  C   . THR B 2 4   ? 23.157  -11.236 35.206 1.00 41.64  ? 4    THR B C   1 
ATOM   2172 O  O   . THR B 2 4   ? 23.695  -10.513 36.050 1.00 38.15  ? 4    THR B O   1 
ATOM   2173 C  CB  . THR B 2 4   ? 22.344  -10.324 33.016 1.00 39.25  ? 4    THR B CB  1 
ATOM   2174 O  OG1 . THR B 2 4   ? 23.207  -9.179  33.071 1.00 42.05  ? 4    THR B OG1 1 
ATOM   2175 C  CG2 . THR B 2 4   ? 21.134  -9.912  32.193 1.00 35.61  ? 4    THR B CG2 1 
ATOM   2176 N  N   . PRO B 2 5   ? 23.596  -12.461 34.963 1.00 36.25  ? 5    PRO B N   1 
ATOM   2177 C  CA  . PRO B 2 5   ? 24.825  -12.929 35.616 1.00 35.61  ? 5    PRO B CA  1 
ATOM   2178 C  C   . PRO B 2 5   ? 26.005  -12.021 35.287 1.00 32.67  ? 5    PRO B C   1 
ATOM   2179 O  O   . PRO B 2 5   ? 26.884  -11.857 36.138 1.00 36.56  ? 5    PRO B O   1 
ATOM   2180 C  CB  . PRO B 2 5   ? 25.025  -14.327 35.029 1.00 41.98  ? 5    PRO B CB  1 
ATOM   2181 C  CG  . PRO B 2 5   ? 23.649  -14.750 34.623 1.00 39.77  ? 5    PRO B CG  1 
ATOM   2182 C  CD  . PRO B 2 5   ? 22.977  -13.499 34.124 1.00 35.43  ? 5    PRO B CD  1 
ATOM   2183 N  N   . GLU B 2 6   ? 26.025  -11.431 34.094 1.00 28.68  ? 6    GLU B N   1 
ATOM   2184 C  CA  . GLU B 2 6   ? 27.085  -10.505 33.709 1.00 35.31  ? 6    GLU B CA  1 
ATOM   2185 C  C   . GLU B 2 6   ? 27.070  -9.266  34.603 1.00 35.66  ? 6    GLU B C   1 
ATOM   2186 O  O   . GLU B 2 6   ? 28.115  -8.781  35.030 1.00 29.96  ? 6    GLU B O   1 
ATOM   2187 C  CB  . GLU B 2 6   ? 26.952  -10.064 32.248 1.00 34.63  ? 6    GLU B CB  1 
ATOM   2188 C  CG  . GLU B 2 6   ? 26.614  -11.186 31.284 1.00 48.78  ? 6    GLU B CG  1 
ATOM   2189 C  CD  . GLU B 2 6   ? 25.157  -11.201 30.865 1.00 52.44  ? 6    GLU B CD  1 
ATOM   2190 O  OE1 . GLU B 2 6   ? 24.524  -12.273 30.964 1.00 51.53  ? 6    GLU B OE1 1 
ATOM   2191 O  OE2 . GLU B 2 6   ? 24.640  -10.148 30.433 1.00 68.96  ? 6    GLU B OE2 1 
ATOM   2192 N  N   . GLU B 2 7   ? 25.869  -8.759  34.866 1.00 33.58  ? 7    GLU B N   1 
ATOM   2193 C  CA  . GLU B 2 7   ? 25.712  -7.571  35.703 1.00 29.77  ? 7    GLU B CA  1 
ATOM   2194 C  C   . GLU B 2 7   ? 26.092  -7.882  37.143 1.00 28.96  ? 7    GLU B C   1 
ATOM   2195 O  O   . GLU B 2 7   ? 26.731  -7.089  37.835 1.00 24.52  ? 7    GLU B O   1 
ATOM   2196 C  CB  . GLU B 2 7   ? 24.275  -7.055  35.613 1.00 27.07  ? 7    GLU B CB  1 
ATOM   2197 C  CG  . GLU B 2 7   ? 23.892  -6.557  34.225 1.00 33.70  ? 7    GLU B CG  1 
ATOM   2198 C  CD  . GLU B 2 7   ? 22.534  -5.886  34.196 1.00 41.75  ? 7    GLU B CD  1 
ATOM   2199 O  OE1 . GLU B 2 7   ? 21.529  -6.549  34.534 1.00 40.91  ? 7    GLU B OE1 1 
ATOM   2200 O  OE2 . GLU B 2 7   ? 22.468  -4.687  33.843 1.00 61.74  ? 7    GLU B OE2 1 
ATOM   2201 N  N   . LYS B 2 8   ? 25.691  -9.059  37.622 1.00 28.06  ? 8    LYS B N   1 
ATOM   2202 C  CA  . LYS B 2 8   ? 26.028  -9.434  38.992 1.00 21.65  ? 8    LYS B CA  1 
ATOM   2203 C  C   . LYS B 2 8   ? 27.538  -9.476  39.186 1.00 23.51  ? 8    LYS B C   1 
ATOM   2204 O  O   . LYS B 2 8   ? 28.084  -8.997  40.176 1.00 25.75  ? 8    LYS B O   1 
ATOM   2205 C  CB  . LYS B 2 8   ? 25.443  -10.810 39.327 1.00 26.40  ? 8    LYS B CB  1 
ATOM   2206 C  CG  . LYS B 2 8   ? 23.946  -10.813 39.591 1.00 40.92  ? 8    LYS B CG  1 
ATOM   2207 C  CD  . LYS B 2 8   ? 23.576  -11.930 40.563 1.00 51.08  ? 8    LYS B CD  1 
ATOM   2208 C  CE  . LYS B 2 8   ? 22.247  -12.567 40.168 1.00 58.50  ? 8    LYS B CE  1 
ATOM   2209 N  NZ  . LYS B 2 8   ? 21.756  -13.506 41.218 1.00 56.13  ? 8    LYS B NZ  1 
ATOM   2210 N  N   . SER B 2 9   ? 28.236  -10.104 38.238 1.00 24.81  ? 9    SER B N   1 
ATOM   2211 C  CA  . SER B 2 9   ? 29.682  -10.249 38.387 1.00 23.76  ? 9    SER B CA  1 
ATOM   2212 C  C   . SER B 2 9   ? 30.386  -8.896  38.370 1.00 21.37  ? 9    SER B C   1 
ATOM   2213 O  O   . SER B 2 9   ? 31.356  -8.705  39.109 1.00 31.46  ? 9    SER B O   1 
ATOM   2214 C  CB  . SER B 2 9   ? 30.251  -11.158 37.294 1.00 40.25  ? 9    SER B CB  1 
ATOM   2215 O  OG  . SER B 2 9   ? 29.898  -12.510 37.541 1.00 47.62  ? 9    SER B OG  1 
ATOM   2216 N  N   . ALA B 2 10  ? 29.896  -7.995  37.531 1.00 21.26  ? 10   ALA B N   1 
ATOM   2217 C  CA  . ALA B 2 10  ? 30.453  -6.650  37.412 1.00 30.95  ? 10   ALA B CA  1 
ATOM   2218 C  C   . ALA B 2 10  ? 30.282  -5.860  38.708 1.00 30.70  ? 10   ALA B C   1 
ATOM   2219 O  O   . ALA B 2 10  ? 31.189  -5.169  39.172 1.00 31.64  ? 10   ALA B O   1 
ATOM   2220 C  CB  . ALA B 2 10  ? 29.803  -5.926  36.240 1.00 32.96  ? 10   ALA B CB  1 
ATOM   2221 N  N   . VAL B 2 11  ? 29.109  -5.984  39.324 1.00 22.70  ? 11   VAL B N   1 
ATOM   2222 C  CA  . VAL B 2 11  ? 28.860  -5.329  40.602 1.00 16.12  ? 11   VAL B CA  1 
ATOM   2223 C  C   . VAL B 2 11  ? 29.767  -5.909  41.684 1.00 21.96  ? 11   VAL B C   1 
ATOM   2224 O  O   . VAL B 2 11  ? 30.441  -5.165  42.392 1.00 21.87  ? 11   VAL B O   1 
ATOM   2225 C  CB  . VAL B 2 11  ? 27.377  -5.445  40.987 1.00 25.88  ? 11   VAL B CB  1 
ATOM   2226 C  CG1 . VAL B 2 11  ? 27.165  -5.074  42.444 1.00 32.61  ? 11   VAL B CG1 1 
ATOM   2227 C  CG2 . VAL B 2 11  ? 26.536  -4.554  40.075 1.00 20.70  ? 11   VAL B CG2 1 
ATOM   2228 N  N   . THR B 2 12  ? 29.796  -7.227  41.782 1.00 20.54  ? 12   THR B N   1 
ATOM   2229 C  CA  . THR B 2 12  ? 30.572  -7.980  42.746 1.00 21.24  ? 12   THR B CA  1 
ATOM   2230 C  C   . THR B 2 12  ? 32.066  -7.721  42.607 1.00 22.93  ? 12   THR B C   1 
ATOM   2231 O  O   . THR B 2 12  ? 32.765  -7.527  43.598 1.00 26.14  ? 12   THR B O   1 
ATOM   2232 C  CB  . THR B 2 12  ? 30.351  -9.501  42.570 1.00 27.24  ? 12   THR B CB  1 
ATOM   2233 O  OG1 . THR B 2 12  ? 29.028  -9.834  43.007 1.00 43.66  ? 12   THR B OG1 1 
ATOM   2234 C  CG2 . THR B 2 12  ? 31.322  -10.273 43.445 1.00 53.29  ? 12   THR B CG2 1 
ATOM   2235 N  N   . ALA B 2 13  ? 32.554  -7.750  41.374 1.00 24.11  ? 13   ALA B N   1 
ATOM   2236 C  CA  . ALA B 2 13  ? 33.991  -7.596  41.146 1.00 29.94  ? 13   ALA B CA  1 
ATOM   2237 C  C   . ALA B 2 13  ? 34.491  -6.239  41.614 1.00 34.60  ? 13   ALA B C   1 
ATOM   2238 O  O   . ALA B 2 13  ? 35.541  -6.105  42.241 1.00 29.17  ? 13   ALA B O   1 
ATOM   2239 C  CB  . ALA B 2 13  ? 34.293  -7.795  39.665 1.00 25.27  ? 13   ALA B CB  1 
ATOM   2240 N  N   . LEU B 2 14  ? 33.740  -5.182  41.299 1.00 24.41  ? 14   LEU B N   1 
ATOM   2241 C  CA  . LEU B 2 14  ? 34.170  -3.851  41.720 1.00 19.42  ? 14   LEU B CA  1 
ATOM   2242 C  C   . LEU B 2 14  ? 34.060  -3.696  43.234 1.00 16.11  ? 14   LEU B C   1 
ATOM   2243 O  O   . LEU B 2 14  ? 34.919  -3.055  43.850 1.00 18.64  ? 14   LEU B O   1 
ATOM   2244 C  CB  . LEU B 2 14  ? 33.345  -2.786  41.001 1.00 22.69  ? 14   LEU B CB  1 
ATOM   2245 C  CG  . LEU B 2 14  ? 33.763  -1.324  41.116 1.00 30.58  ? 14   LEU B CG  1 
ATOM   2246 C  CD1 . LEU B 2 14  ? 35.029  -1.047  40.330 1.00 27.97  ? 14   LEU B CD1 1 
ATOM   2247 C  CD2 . LEU B 2 14  ? 32.635  -0.411  40.636 1.00 27.39  ? 14   LEU B CD2 1 
ATOM   2248 N  N   . TRP B 2 15  ? 33.007  -4.247  43.836 1.00 21.11  ? 15   TRP B N   1 
ATOM   2249 C  CA  . TRP B 2 15  ? 32.774  -3.998  45.258 1.00 24.60  ? 15   TRP B CA  1 
ATOM   2250 C  C   . TRP B 2 15  ? 33.876  -4.614  46.114 1.00 25.37  ? 15   TRP B C   1 
ATOM   2251 O  O   . TRP B 2 15  ? 34.123  -4.177  47.240 1.00 21.89  ? 15   TRP B O   1 
ATOM   2252 C  CB  . TRP B 2 15  ? 31.404  -4.499  45.721 1.00 21.11  ? 15   TRP B CB  1 
ATOM   2253 C  CG  . TRP B 2 15  ? 31.026  -3.953  47.072 1.00 20.08  ? 15   TRP B CG  1 
ATOM   2254 C  CD1 . TRP B 2 15  ? 31.045  -4.606  48.274 1.00 18.86  ? 15   TRP B CD1 1 
ATOM   2255 C  CD2 . TRP B 2 15  ? 30.559  -2.628  47.350 1.00 22.54  ? 15   TRP B CD2 1 
ATOM   2256 N  NE1 . TRP B 2 15  ? 30.626  -3.767  49.279 1.00 21.14  ? 15   TRP B NE1 1 
ATOM   2257 C  CE2 . TRP B 2 15  ? 30.320  -2.544  48.737 1.00 20.22  ? 15   TRP B CE2 1 
ATOM   2258 C  CE3 . TRP B 2 15  ? 30.322  -1.503  46.550 1.00 22.63  ? 15   TRP B CE3 1 
ATOM   2259 C  CZ2 . TRP B 2 15  ? 29.854  -1.376  49.348 1.00 22.67  ? 15   TRP B CZ2 1 
ATOM   2260 C  CZ3 . TRP B 2 15  ? 29.865  -0.347  47.159 1.00 27.43  ? 15   TRP B CZ3 1 
ATOM   2261 C  CH2 . TRP B 2 15  ? 29.637  -0.292  48.541 1.00 27.56  ? 15   TRP B CH2 1 
ATOM   2262 N  N   . GLY B 2 16  ? 34.550  -5.614  45.551 1.00 23.08  ? 16   GLY B N   1 
ATOM   2263 C  CA  . GLY B 2 16  ? 35.658  -6.255  46.232 1.00 24.60  ? 16   GLY B CA  1 
ATOM   2264 C  C   . GLY B 2 16  ? 36.854  -5.340  46.399 1.00 30.08  ? 16   GLY B C   1 
ATOM   2265 O  O   . GLY B 2 16  ? 37.753  -5.654  47.179 1.00 23.26  ? 16   GLY B O   1 
ATOM   2266 N  N   . LYS B 2 17  ? 36.873  -4.226  45.682 1.00 20.54  ? 17   LYS B N   1 
ATOM   2267 C  CA  . LYS B 2 17  ? 37.966  -3.271  45.716 1.00 18.93  ? 17   LYS B CA  1 
ATOM   2268 C  C   . LYS B 2 17  ? 37.665  -2.050  46.577 1.00 23.36  ? 17   LYS B C   1 
ATOM   2269 O  O   . LYS B 2 17  ? 38.497  -1.142  46.706 1.00 26.55  ? 17   LYS B O   1 
ATOM   2270 C  CB  . LYS B 2 17  ? 38.268  -2.790  44.287 1.00 23.26  ? 17   LYS B CB  1 
ATOM   2271 C  CG  . LYS B 2 17  ? 38.710  -3.919  43.357 1.00 27.09  ? 17   LYS B CG  1 
ATOM   2272 C  CD  . LYS B 2 17  ? 39.094  -3.349  41.998 1.00 34.62  ? 17   LYS B CD  1 
ATOM   2273 C  CE  . LYS B 2 17  ? 39.263  -4.452  40.965 1.00 45.10  ? 17   LYS B CE  1 
ATOM   2274 N  NZ  . LYS B 2 17  ? 39.990  -3.968  39.756 1.00 68.56  ? 17   LYS B NZ  1 
ATOM   2275 N  N   . VAL B 2 18  ? 36.466  -2.030  47.145 1.00 20.59  ? 18   VAL B N   1 
ATOM   2276 C  CA  . VAL B 2 18  ? 35.971  -0.877  47.889 1.00 16.61  ? 18   VAL B CA  1 
ATOM   2277 C  C   . VAL B 2 18  ? 36.369  -0.947  49.358 1.00 24.52  ? 18   VAL B C   1 
ATOM   2278 O  O   . VAL B 2 18  ? 36.209  -1.959  50.033 1.00 22.62  ? 18   VAL B O   1 
ATOM   2279 C  CB  . VAL B 2 18  ? 34.443  -0.770  47.772 1.00 21.55  ? 18   VAL B CB  1 
ATOM   2280 C  CG1 . VAL B 2 18  ? 33.857  0.138   48.843 1.00 22.79  ? 18   VAL B CG1 1 
ATOM   2281 C  CG2 . VAL B 2 18  ? 34.080  -0.255  46.378 1.00 25.79  ? 18   VAL B CG2 1 
ATOM   2282 N  N   . ASN B 2 19  ? 36.884  0.167   49.865 1.00 19.66  ? 19   ASN B N   1 
ATOM   2283 C  CA  . ASN B 2 19  ? 37.057  0.297   51.312 1.00 22.48  ? 19   ASN B CA  1 
ATOM   2284 C  C   . ASN B 2 19  ? 35.725  0.806   51.859 1.00 21.68  ? 19   ASN B C   1 
ATOM   2285 O  O   . ASN B 2 19  ? 35.379  1.968   51.677 1.00 22.80  ? 19   ASN B O   1 
ATOM   2286 C  CB  . ASN B 2 19  ? 38.219  1.228   51.630 1.00 30.04  ? 19   ASN B CB  1 
ATOM   2287 C  CG  . ASN B 2 19  ? 38.460  1.432   53.110 1.00 31.24  ? 19   ASN B CG  1 
ATOM   2288 O  OD1 . ASN B 2 19  ? 37.546  1.320   53.924 1.00 23.60  ? 19   ASN B OD1 1 
ATOM   2289 N  ND2 . ASN B 2 19  ? 39.704  1.733   53.466 1.00 34.63  ? 19   ASN B ND2 1 
ATOM   2290 N  N   . VAL B 2 20  ? 34.958  -0.105  52.453 1.00 22.14  ? 20   VAL B N   1 
ATOM   2291 C  CA  . VAL B 2 20  ? 33.595  0.245   52.853 1.00 20.22  ? 20   VAL B CA  1 
ATOM   2292 C  C   . VAL B 2 20  ? 33.584  1.413   53.822 1.00 20.29  ? 20   VAL B C   1 
ATOM   2293 O  O   . VAL B 2 20  ? 32.796  2.356   53.713 1.00 24.44  ? 20   VAL B O   1 
ATOM   2294 C  CB  . VAL B 2 20  ? 32.885  -0.970  53.478 1.00 25.53  ? 20   VAL B CB  1 
ATOM   2295 C  CG1 . VAL B 2 20  ? 31.532  -0.553  54.039 1.00 33.28  ? 20   VAL B CG1 1 
ATOM   2296 C  CG2 . VAL B 2 20  ? 32.724  -2.073  52.443 1.00 26.51  ? 20   VAL B CG2 1 
ATOM   2297 N  N   . ASP B 2 21  ? 34.487  1.415   54.800 1.00 25.17  ? 21   ASP B N   1 
ATOM   2298 C  CA  . ASP B 2 21  ? 34.466  2.526   55.755 1.00 25.68  ? 21   ASP B CA  1 
ATOM   2299 C  C   . ASP B 2 21  ? 34.828  3.849   55.101 1.00 28.92  ? 21   ASP B C   1 
ATOM   2300 O  O   . ASP B 2 21  ? 34.249  4.886   55.439 1.00 28.18  ? 21   ASP B O   1 
ATOM   2301 C  CB  . ASP B 2 21  ? 35.408  2.228   56.924 1.00 37.23  ? 21   ASP B CB  1 
ATOM   2302 C  CG  . ASP B 2 21  ? 34.727  1.361   57.971 1.00 46.33  ? 21   ASP B CG  1 
ATOM   2303 O  OD1 . ASP B 2 21  ? 33.686  0.750   57.643 1.00 57.54  ? 21   ASP B OD1 1 
ATOM   2304 O  OD2 . ASP B 2 21  ? 35.235  1.300   59.115 1.00 82.22  ? 21   ASP B OD2 1 
ATOM   2305 N  N   . GLU B 2 22  ? 35.770  3.863   54.153 1.00 25.76  ? 22   GLU B N   1 
ATOM   2306 C  CA  . GLU B 2 22  ? 36.126  5.152   53.549 1.00 31.99  ? 22   GLU B CA  1 
ATOM   2307 C  C   . GLU B 2 22  ? 35.053  5.641   52.584 1.00 25.39  ? 22   GLU B C   1 
ATOM   2308 O  O   . GLU B 2 22  ? 34.717  6.827   52.541 1.00 22.88  ? 22   GLU B O   1 
ATOM   2309 C  CB  . GLU B 2 22  ? 37.460  5.062   52.803 1.00 38.73  ? 22   GLU B CB  1 
ATOM   2310 C  CG  . GLU B 2 22  ? 37.433  5.754   51.450 1.00 43.36  ? 22   GLU B CG  1 
ATOM   2311 C  CD  . GLU B 2 22  ? 38.793  5.770   50.781 1.00 59.96  ? 22   GLU B CD  1 
ATOM   2312 O  OE1 . GLU B 2 22  ? 39.231  4.712   50.280 1.00 42.90  ? 22   GLU B OE1 1 
ATOM   2313 O  OE2 . GLU B 2 22  ? 39.427  6.849   50.763 1.00 91.80  ? 22   GLU B OE2 1 
ATOM   2314 N  N   . VAL B 2 23  ? 34.523  4.709   51.790 1.00 19.68  ? 23   VAL B N   1 
ATOM   2315 C  CA  . VAL B 2 23  ? 33.519  5.094   50.796 1.00 22.15  ? 23   VAL B CA  1 
ATOM   2316 C  C   . VAL B 2 23  ? 32.209  5.447   51.490 1.00 18.63  ? 23   VAL B C   1 
ATOM   2317 O  O   . VAL B 2 23  ? 31.468  6.315   51.029 1.00 17.77  ? 23   VAL B O   1 
ATOM   2318 C  CB  . VAL B 2 23  ? 33.300  3.990   49.746 1.00 29.14  ? 23   VAL B CB  1 
ATOM   2319 C  CG1 . VAL B 2 23  ? 32.041  4.241   48.938 1.00 22.22  ? 23   VAL B CG1 1 
ATOM   2320 C  CG2 . VAL B 2 23  ? 34.510  3.900   48.818 1.00 30.98  ? 23   VAL B CG2 1 
ATOM   2321 N  N   . GLY B 2 24  ? 31.924  4.784   52.604 1.00 18.66  ? 24   GLY B N   1 
ATOM   2322 C  CA  . GLY B 2 24  ? 30.700  5.076   53.353 1.00 16.17  ? 24   GLY B CA  1 
ATOM   2323 C  C   . GLY B 2 24  ? 30.732  6.474   53.937 1.00 19.08  ? 24   GLY B C   1 
ATOM   2324 O  O   . GLY B 2 24  ? 29.757  7.220   53.832 1.00 20.81  ? 24   GLY B O   1 
ATOM   2325 N  N   . GLY B 2 25  ? 31.858  6.854   54.543 1.00 16.83  ? 25   GLY B N   1 
ATOM   2326 C  CA  . GLY B 2 25  ? 32.014  8.208   55.057 1.00 20.08  ? 25   GLY B CA  1 
ATOM   2327 C  C   . GLY B 2 25  ? 31.964  9.264   53.970 1.00 20.44  ? 25   GLY B C   1 
ATOM   2328 O  O   . GLY B 2 25  ? 31.375  10.336  54.145 1.00 20.58  ? 25   GLY B O   1 
ATOM   2329 N  N   . GLU B 2 26  ? 32.575  8.987   52.827 1.00 18.42  ? 26   GLU B N   1 
ATOM   2330 C  CA  . GLU B 2 26  ? 32.595  9.891   51.693 1.00 19.96  ? 26   GLU B CA  1 
ATOM   2331 C  C   . GLU B 2 26  ? 31.184  10.067  51.127 1.00 20.60  ? 26   GLU B C   1 
ATOM   2332 O  O   . GLU B 2 26  ? 30.760  11.196  50.871 1.00 18.96  ? 26   GLU B O   1 
ATOM   2333 C  CB  . GLU B 2 26  ? 33.527  9.394   50.585 1.00 20.60  ? 26   GLU B CB  1 
ATOM   2334 C  CG  . GLU B 2 26  ? 33.285  10.099  49.257 1.00 45.08  ? 26   GLU B CG  1 
ATOM   2335 C  CD  . GLU B 2 26  ? 34.511  10.813  48.728 1.00 52.47  ? 26   GLU B CD  1 
ATOM   2336 O  OE1 . GLU B 2 26  ? 35.439  10.108  48.280 1.00 58.37  ? 26   GLU B OE1 1 
ATOM   2337 O  OE2 . GLU B 2 26  ? 34.552  12.063  48.754 1.00 38.35  ? 26   GLU B OE2 1 
ATOM   2338 N  N   . ALA B 2 27  ? 30.473  8.958   50.950 1.00 15.18  ? 27   ALA B N   1 
ATOM   2339 C  CA  . ALA B 2 27  ? 29.128  9.031   50.378 1.00 19.20  ? 27   ALA B CA  1 
ATOM   2340 C  C   . ALA B 2 27  ? 28.179  9.798   51.288 1.00 17.00  ? 27   ALA B C   1 
ATOM   2341 O  O   . ALA B 2 27  ? 27.390  10.653  50.854 1.00 17.60  ? 27   ALA B O   1 
ATOM   2342 C  CB  . ALA B 2 27  ? 28.596  7.634   50.097 1.00 17.35  ? 27   ALA B CB  1 
ATOM   2343 N  N   . LEU B 2 28  ? 28.227  9.508   52.592 1.00 14.59  ? 28   LEU B N   1 
ATOM   2344 C  CA  . LEU B 2 28  ? 27.311  10.244  53.469 1.00 16.29  ? 28   LEU B CA  1 
ATOM   2345 C  C   . LEU B 2 28  ? 27.706  11.703  53.593 1.00 15.32  ? 28   LEU B C   1 
ATOM   2346 O  O   . LEU B 2 28  ? 26.840  12.590  53.654 1.00 17.98  ? 28   LEU B O   1 
ATOM   2347 C  CB  . LEU B 2 28  ? 27.203  9.580   54.845 1.00 16.85  ? 28   LEU B CB  1 
ATOM   2348 C  CG  . LEU B 2 28  ? 25.984  9.985   55.680 1.00 30.08  ? 28   LEU B CG  1 
ATOM   2349 C  CD1 . LEU B 2 28  ? 24.697  9.467   55.044 1.00 21.13  ? 28   LEU B CD1 1 
ATOM   2350 C  CD2 . LEU B 2 28  ? 26.110  9.485   57.107 1.00 30.57  ? 28   LEU B CD2 1 
ATOM   2351 N  N   . GLY B 2 29  ? 28.996  12.016  53.642 1.00 13.71  ? 29   GLY B N   1 
ATOM   2352 C  CA  . GLY B 2 29  ? 29.370  13.430  53.738 1.00 15.27  ? 29   GLY B CA  1 
ATOM   2353 C  C   . GLY B 2 29  ? 28.966  14.207  52.503 1.00 18.39  ? 29   GLY B C   1 
ATOM   2354 O  O   . GLY B 2 29  ? 28.437  15.320  52.559 1.00 17.68  ? 29   GLY B O   1 
ATOM   2355 N  N   . ARG B 2 30  ? 29.190  13.632  51.317 1.00 13.81  ? 30   ARG B N   1 
ATOM   2356 C  CA  . ARG B 2 30  ? 28.759  14.330  50.102 1.00 16.79  ? 30   ARG B CA  1 
ATOM   2357 C  C   . ARG B 2 30  ? 27.242  14.475  50.038 1.00 18.76  ? 30   ARG B C   1 
ATOM   2358 O  O   . ARG B 2 30  ? 26.742  15.474  49.521 1.00 15.33  ? 30   ARG B O   1 
ATOM   2359 C  CB  . ARG B 2 30  ? 29.243  13.554  48.873 1.00 16.73  ? 30   ARG B CB  1 
ATOM   2360 C  CG  . ARG B 2 30  ? 30.750  13.651  48.698 1.00 17.27  ? 30   ARG B CG  1 
ATOM   2361 C  CD  . ARG B 2 30  ? 31.172  13.190  47.305 1.00 12.25  ? 30   ARG B CD  1 
ATOM   2362 N  NE  . ARG B 2 30  ? 32.636  13.300  47.215 1.00 21.31  ? 30   ARG B NE  1 
ATOM   2363 C  CZ  . ARG B 2 30  ? 33.271  14.015  46.294 1.00 26.22  ? 30   ARG B CZ  1 
ATOM   2364 N  NH1 . ARG B 2 30  ? 32.586  14.689  45.384 1.00 24.70  ? 30   ARG B NH1 1 
ATOM   2365 N  NH2 . ARG B 2 30  ? 34.599  14.042  46.303 1.00 18.14  ? 30   ARG B NH2 1 
ATOM   2366 N  N   . LEU B 2 31  ? 26.495  13.489  50.539 1.00 15.52  ? 31   LEU B N   1 
ATOM   2367 C  CA  . LEU B 2 31  ? 25.039  13.664  50.599 1.00 17.93  ? 31   LEU B CA  1 
ATOM   2368 C  C   . LEU B 2 31  ? 24.652  14.918  51.379 1.00 19.95  ? 31   LEU B C   1 
ATOM   2369 O  O   . LEU B 2 31  ? 23.832  15.740  50.948 1.00 16.63  ? 31   LEU B O   1 
ATOM   2370 C  CB  . LEU B 2 31  ? 24.384  12.445  51.261 1.00 11.18  ? 31   LEU B CB  1 
ATOM   2371 C  CG  . LEU B 2 31  ? 22.862  12.571  51.437 1.00 14.61  ? 31   LEU B CG  1 
ATOM   2372 C  CD1 . LEU B 2 31  ? 22.193  12.412  50.079 1.00 17.44  ? 31   LEU B CD1 1 
ATOM   2373 C  CD2 . LEU B 2 31  ? 22.356  11.538  52.432 1.00 21.98  ? 31   LEU B CD2 1 
ATOM   2374 N  N   . LEU B 2 32  ? 25.255  15.065  52.563 1.00 19.82  ? 32   LEU B N   1 
ATOM   2375 C  CA  . LEU B 2 32  ? 24.968  16.211  53.417 1.00 19.46  ? 32   LEU B CA  1 
ATOM   2376 C  C   . LEU B 2 32  ? 25.471  17.519  52.834 1.00 16.21  ? 32   LEU B C   1 
ATOM   2377 O  O   . LEU B 2 32  ? 24.890  18.571  53.119 1.00 18.12  ? 32   LEU B O   1 
ATOM   2378 C  CB  . LEU B 2 32  ? 25.569  15.995  54.812 1.00 18.89  ? 32   LEU B CB  1 
ATOM   2379 C  CG  . LEU B 2 32  ? 25.090  14.735  55.541 1.00 21.70  ? 32   LEU B CG  1 
ATOM   2380 C  CD1 . LEU B 2 32  ? 25.790  14.610  56.891 1.00 28.44  ? 32   LEU B CD1 1 
ATOM   2381 C  CD2 . LEU B 2 32  ? 23.584  14.735  55.686 1.00 34.09  ? 32   LEU B CD2 1 
ATOM   2382 N  N   . VAL B 2 33  ? 26.518  17.512  52.009 1.00 15.95  ? 33   VAL B N   1 
ATOM   2383 C  CA  . VAL B 2 33  ? 27.003  18.742  51.383 1.00 13.07  ? 33   VAL B CA  1 
ATOM   2384 C  C   . VAL B 2 33  ? 26.184  19.101  50.147 1.00 18.25  ? 33   VAL B C   1 
ATOM   2385 O  O   . VAL B 2 33  ? 25.829  20.264  49.942 1.00 17.40  ? 33   VAL B O   1 
ATOM   2386 C  CB  . VAL B 2 33  ? 28.488  18.590  50.977 1.00 17.09  ? 33   VAL B CB  1 
ATOM   2387 C  CG1 . VAL B 2 33  ? 28.943  19.712  50.067 1.00 17.74  ? 33   VAL B CG1 1 
ATOM   2388 C  CG2 . VAL B 2 33  ? 29.364  18.544  52.231 1.00 18.75  ? 33   VAL B CG2 1 
ATOM   2389 N  N   . VAL B 2 34  ? 25.892  18.113  49.299 1.00 16.10  ? 34   VAL B N   1 
ATOM   2390 C  CA  . VAL B 2 34  ? 25.275  18.407  48.006 1.00 15.05  ? 34   VAL B CA  1 
ATOM   2391 C  C   . VAL B 2 34  ? 23.770  18.654  48.132 1.00 17.25  ? 34   VAL B C   1 
ATOM   2392 O  O   . VAL B 2 34  ? 23.226  19.472  47.386 1.00 17.37  ? 34   VAL B O   1 
ATOM   2393 C  CB  . VAL B 2 34  ? 25.558  17.250  47.027 1.00 22.44  ? 34   VAL B CB  1 
ATOM   2394 C  CG1 . VAL B 2 34  ? 24.843  17.467  45.708 1.00 17.16  ? 34   VAL B CG1 1 
ATOM   2395 C  CG2 . VAL B 2 34  ? 27.066  17.125  46.800 1.00 20.09  ? 34   VAL B CG2 1 
ATOM   2396 N  N   . TYR B 2 35  ? 23.123  17.953  49.053 1.00 13.76  ? 35   TYR B N   1 
ATOM   2397 C  CA  . TYR B 2 35  ? 21.683  18.043  49.302 1.00 13.69  ? 35   TYR B CA  1 
ATOM   2398 C  C   . TYR B 2 35  ? 21.465  18.359  50.781 1.00 11.41  ? 35   TYR B C   1 
ATOM   2399 O  O   . TYR B 2 35  ? 21.139  17.482  51.580 1.00 16.37  ? 35   TYR B O   1 
ATOM   2400 C  CB  . TYR B 2 35  ? 20.962  16.744  48.926 1.00 12.89  ? 35   TYR B CB  1 
ATOM   2401 C  CG  . TYR B 2 35  ? 21.257  16.296  47.508 1.00 14.23  ? 35   TYR B CG  1 
ATOM   2402 C  CD1 . TYR B 2 35  ? 20.743  17.026  46.440 1.00 17.53  ? 35   TYR B CD1 1 
ATOM   2403 C  CD2 . TYR B 2 35  ? 22.044  15.191  47.229 1.00 18.56  ? 35   TYR B CD2 1 
ATOM   2404 C  CE1 . TYR B 2 35  ? 20.997  16.649  45.136 1.00 27.19  ? 35   TYR B CE1 1 
ATOM   2405 C  CE2 . TYR B 2 35  ? 22.304  14.812  45.923 1.00 22.13  ? 35   TYR B CE2 1 
ATOM   2406 C  CZ  . TYR B 2 35  ? 21.780  15.545  44.881 1.00 23.62  ? 35   TYR B CZ  1 
ATOM   2407 O  OH  . TYR B 2 35  ? 22.024  15.192  43.575 1.00 29.58  ? 35   TYR B OH  1 
ATOM   2408 N  N   . PRO B 2 36  ? 21.728  19.607  51.150 1.00 15.57  ? 36   PRO B N   1 
ATOM   2409 C  CA  . PRO B 2 36  ? 21.903  19.931  52.567 1.00 18.70  ? 36   PRO B CA  1 
ATOM   2410 C  C   . PRO B 2 36  ? 20.658  19.691  53.411 1.00 20.43  ? 36   PRO B C   1 
ATOM   2411 O  O   . PRO B 2 36  ? 20.737  19.630  54.643 1.00 17.23  ? 36   PRO B O   1 
ATOM   2412 C  CB  . PRO B 2 36  ? 22.254  21.419  52.573 1.00 23.48  ? 36   PRO B CB  1 
ATOM   2413 C  CG  . PRO B 2 36  ? 22.124  21.923  51.186 1.00 22.64  ? 36   PRO B CG  1 
ATOM   2414 C  CD  . PRO B 2 36  ? 21.923  20.762  50.268 1.00 20.84  ? 36   PRO B CD  1 
ATOM   2415 N  N   . TRP B 2 37  ? 19.496  19.569  52.776 1.00 22.59  ? 37   TRP B N   1 
ATOM   2416 C  CA  . TRP B 2 37  ? 18.275  19.395  53.564 1.00 17.22  ? 37   TRP B CA  1 
ATOM   2417 C  C   . TRP B 2 37  ? 18.269  18.037  54.249 1.00 18.13  ? 37   TRP B C   1 
ATOM   2418 O  O   . TRP B 2 37  ? 17.550  17.803  55.223 1.00 15.27  ? 37   TRP B O   1 
ATOM   2419 C  CB  . TRP B 2 37  ? 17.064  19.623  52.678 1.00 20.52  ? 37   TRP B CB  1 
ATOM   2420 C  CG  . TRP B 2 37  ? 16.942  18.835  51.417 1.00 19.15  ? 37   TRP B CG  1 
ATOM   2421 C  CD1 . TRP B 2 37  ? 16.339  17.611  51.272 1.00 17.91  ? 37   TRP B CD1 1 
ATOM   2422 C  CD2 . TRP B 2 37  ? 17.414  19.195  50.111 1.00 17.45  ? 37   TRP B CD2 1 
ATOM   2423 N  NE1 . TRP B 2 37  ? 16.417  17.193  49.965 1.00 21.93  ? 37   TRP B NE1 1 
ATOM   2424 C  CE2 . TRP B 2 37  ? 17.069  18.151  49.235 1.00 15.59  ? 37   TRP B CE2 1 
ATOM   2425 C  CE3 . TRP B 2 37  ? 18.100  20.305  49.605 1.00 21.12  ? 37   TRP B CE3 1 
ATOM   2426 C  CZ2 . TRP B 2 37  ? 17.382  18.181  47.875 1.00 17.12  ? 37   TRP B CZ2 1 
ATOM   2427 C  CZ3 . TRP B 2 37  ? 18.409  20.336  48.258 1.00 24.47  ? 37   TRP B CZ3 1 
ATOM   2428 C  CH2 . TRP B 2 37  ? 18.051  19.284  47.412 1.00 18.03  ? 37   TRP B CH2 1 
ATOM   2429 N  N   . THR B 2 38  ? 19.121  17.120  53.782 1.00 17.21  ? 38   THR B N   1 
ATOM   2430 C  CA  . THR B 2 38  ? 19.240  15.828  54.438 1.00 15.53  ? 38   THR B CA  1 
ATOM   2431 C  C   . THR B 2 38  ? 19.943  15.914  55.795 1.00 16.85  ? 38   THR B C   1 
ATOM   2432 O  O   . THR B 2 38  ? 19.969  14.908  56.513 1.00 18.07  ? 38   THR B O   1 
ATOM   2433 C  CB  . THR B 2 38  ? 20.017  14.814  53.579 1.00 17.09  ? 38   THR B CB  1 
ATOM   2434 O  OG1 . THR B 2 38  ? 21.320  15.347  53.323 1.00 16.48  ? 38   THR B OG1 1 
ATOM   2435 C  CG2 . THR B 2 38  ? 19.321  14.617  52.246 1.00 17.91  ? 38   THR B CG2 1 
ATOM   2436 N  N   . GLN B 2 39  ? 20.502  17.071  56.131 1.00 18.52  ? 39   GLN B N   1 
ATOM   2437 C  CA  . GLN B 2 39  ? 21.098  17.251  57.453 1.00 17.18  ? 39   GLN B CA  1 
ATOM   2438 C  C   . GLN B 2 39  ? 20.035  17.268  58.549 1.00 21.39  ? 39   GLN B C   1 
ATOM   2439 O  O   . GLN B 2 39  ? 20.397  17.218  59.729 1.00 25.75  ? 39   GLN B O   1 
ATOM   2440 C  CB  . GLN B 2 39  ? 21.911  18.544  57.532 1.00 15.01  ? 39   GLN B CB  1 
ATOM   2441 C  CG  . GLN B 2 39  ? 23.049  18.621  56.524 1.00 21.78  ? 39   GLN B CG  1 
ATOM   2442 C  CD  . GLN B 2 39  ? 23.721  19.982  56.540 1.00 33.00  ? 39   GLN B CD  1 
ATOM   2443 O  OE1 . GLN B 2 39  ? 23.506  20.782  57.449 1.00 25.97  ? 39   GLN B OE1 1 
ATOM   2444 N  NE2 . GLN B 2 39  ? 24.529  20.244  55.525 1.00 26.69  ? 39   GLN B NE2 1 
ATOM   2445 N  N   . ARG B 2 40  ? 18.761  17.320  58.177 1.00 18.21  ? 40   ARG B N   1 
ATOM   2446 C  CA  . ARG B 2 40  ? 17.686  17.412  59.160 1.00 24.39  ? 40   ARG B CA  1 
ATOM   2447 C  C   . ARG B 2 40  ? 17.699  16.269  60.161 1.00 23.27  ? 40   ARG B C   1 
ATOM   2448 O  O   . ARG B 2 40  ? 17.156  16.425  61.260 1.00 23.90  ? 40   ARG B O   1 
ATOM   2449 C  CB  . ARG B 2 40  ? 16.316  17.528  58.467 1.00 16.35  ? 40   ARG B CB  1 
ATOM   2450 C  CG  . ARG B 2 40  ? 15.715  16.229  57.974 1.00 20.57  ? 40   ARG B CG  1 
ATOM   2451 C  CD  . ARG B 2 40  ? 14.562  16.448  57.002 1.00 22.42  ? 40   ARG B CD  1 
ATOM   2452 N  NE  . ARG B 2 40  ? 13.427  17.127  57.607 1.00 27.61  ? 40   ARG B NE  1 
ATOM   2453 C  CZ  . ARG B 2 40  ? 12.521  16.599  58.417 1.00 30.60  ? 40   ARG B CZ  1 
ATOM   2454 N  NH1 . ARG B 2 40  ? 12.597  15.319  58.751 1.00 29.69  ? 40   ARG B NH1 1 
ATOM   2455 N  NH2 . ARG B 2 40  ? 11.530  17.351  58.894 1.00 24.45  ? 40   ARG B NH2 1 
ATOM   2456 N  N   . PHE B 2 41  ? 18.291  15.127  59.848 1.00 17.00  ? 41   PHE B N   1 
ATOM   2457 C  CA  . PHE B 2 41  ? 18.281  13.961  60.725 1.00 17.36  ? 41   PHE B CA  1 
ATOM   2458 C  C   . PHE B 2 41  ? 19.461  13.914  61.685 1.00 23.12  ? 41   PHE B C   1 
ATOM   2459 O  O   . PHE B 2 41  ? 19.526  13.055  62.562 1.00 26.61  ? 41   PHE B O   1 
ATOM   2460 C  CB  . PHE B 2 41  ? 18.333  12.671  59.880 1.00 15.11  ? 41   PHE B CB  1 
ATOM   2461 C  CG  . PHE B 2 41  ? 17.174  12.604  58.891 1.00 21.98  ? 41   PHE B CG  1 
ATOM   2462 C  CD1 . PHE B 2 41  ? 15.903  12.304  59.343 1.00 21.99  ? 41   PHE B CD1 1 
ATOM   2463 C  CD2 . PHE B 2 41  ? 17.377  12.865  57.544 1.00 22.27  ? 41   PHE B CD2 1 
ATOM   2464 C  CE1 . PHE B 2 41  ? 14.822  12.274  58.471 1.00 21.57  ? 41   PHE B CE1 1 
ATOM   2465 C  CE2 . PHE B 2 41  ? 16.306  12.820  56.667 1.00 28.50  ? 41   PHE B CE2 1 
ATOM   2466 C  CZ  . PHE B 2 41  ? 15.037  12.511  57.124 1.00 23.08  ? 41   PHE B CZ  1 
ATOM   2467 N  N   . PHE B 2 42  ? 20.415  14.808  61.486 1.00 20.63  ? 42   PHE B N   1 
ATOM   2468 C  CA  . PHE B 2 42  ? 21.758  14.623  62.017 1.00 26.57  ? 42   PHE B CA  1 
ATOM   2469 C  C   . PHE B 2 42  ? 22.220  15.773  62.899 1.00 26.76  ? 42   PHE B C   1 
ATOM   2470 O  O   . PHE B 2 42  ? 23.423  15.923  63.138 1.00 27.84  ? 42   PHE B O   1 
ATOM   2471 C  CB  . PHE B 2 42  ? 22.720  14.440  60.828 1.00 22.14  ? 42   PHE B CB  1 
ATOM   2472 C  CG  . PHE B 2 42  ? 22.394  13.177  60.041 1.00 20.97  ? 42   PHE B CG  1 
ATOM   2473 C  CD1 . PHE B 2 42  ? 22.520  11.930  60.629 1.00 22.36  ? 42   PHE B CD1 1 
ATOM   2474 C  CD2 . PHE B 2 42  ? 21.956  13.258  58.729 1.00 21.48  ? 42   PHE B CD2 1 
ATOM   2475 C  CE1 . PHE B 2 42  ? 22.210  10.768  59.938 1.00 25.37  ? 42   PHE B CE1 1 
ATOM   2476 C  CE2 . PHE B 2 42  ? 21.650  12.104  58.031 1.00 20.12  ? 42   PHE B CE2 1 
ATOM   2477 C  CZ  . PHE B 2 42  ? 21.770  10.861  58.626 1.00 26.67  ? 42   PHE B CZ  1 
ATOM   2478 N  N   . GLU B 2 43  ? 21.261  16.557  63.386 1.00 26.46  ? 43   GLU B N   1 
ATOM   2479 C  CA  . GLU B 2 43  ? 21.552  17.705  64.235 1.00 33.19  ? 43   GLU B CA  1 
ATOM   2480 C  C   . GLU B 2 43  ? 22.280  17.299  65.509 1.00 28.06  ? 43   GLU B C   1 
ATOM   2481 O  O   . GLU B 2 43  ? 22.901  18.124  66.180 1.00 44.01  ? 43   GLU B O   1 
ATOM   2482 C  CB  . GLU B 2 43  ? 20.263  18.454  64.589 1.00 44.73  ? 43   GLU B CB  1 
ATOM   2483 C  CG  . GLU B 2 43  ? 19.880  19.527  63.579 1.00 60.01  ? 43   GLU B CG  1 
ATOM   2484 C  CD  . GLU B 2 43  ? 20.720  19.475  62.317 1.00 68.45  ? 43   GLU B CD  1 
ATOM   2485 O  OE1 . GLU B 2 43  ? 21.707  20.245  62.222 1.00 83.25  ? 43   GLU B OE1 1 
ATOM   2486 O  OE2 . GLU B 2 43  ? 20.396  18.666  61.412 1.00 58.52  ? 43   GLU B OE2 1 
ATOM   2487 N  N   . SER B 2 44  ? 22.221  16.021  65.883 1.00 27.37  ? 44   SER B N   1 
ATOM   2488 C  CA  . SER B 2 44  ? 22.946  15.643  67.100 1.00 34.66  ? 44   SER B CA  1 
ATOM   2489 C  C   . SER B 2 44  ? 24.420  15.390  66.810 1.00 42.10  ? 44   SER B C   1 
ATOM   2490 O  O   . SER B 2 44  ? 25.169  15.102  67.740 1.00 32.34  ? 44   SER B O   1 
ATOM   2491 C  CB  . SER B 2 44  ? 22.321  14.406  67.741 1.00 36.70  ? 44   SER B CB  1 
ATOM   2492 O  OG  . SER B 2 44  ? 22.679  13.212  67.071 1.00 32.30  ? 44   SER B OG  1 
ATOM   2493 N  N   . PHE B 2 45  ? 24.829  15.477  65.548 1.00 34.53  ? 45   PHE B N   1 
ATOM   2494 C  CA  . PHE B 2 45  ? 26.159  15.063  65.132 1.00 25.65  ? 45   PHE B CA  1 
ATOM   2495 C  C   . PHE B 2 45  ? 27.185  16.176  65.281 1.00 22.07  ? 45   PHE B C   1 
ATOM   2496 O  O   . PHE B 2 45  ? 28.352  15.969  64.940 1.00 43.98  ? 45   PHE B O   1 
ATOM   2497 C  CB  . PHE B 2 45  ? 26.164  14.595  63.674 1.00 24.91  ? 45   PHE B CB  1 
ATOM   2498 C  CG  . PHE B 2 45  ? 25.625  13.202  63.431 1.00 21.06  ? 45   PHE B CG  1 
ATOM   2499 C  CD1 . PHE B 2 45  ? 24.722  12.610  64.292 1.00 35.34  ? 45   PHE B CD1 1 
ATOM   2500 C  CD2 . PHE B 2 45  ? 26.041  12.492  62.312 1.00 28.17  ? 45   PHE B CD2 1 
ATOM   2501 C  CE1 . PHE B 2 45  ? 24.243  11.332  64.052 1.00 34.20  ? 45   PHE B CE1 1 
ATOM   2502 C  CE2 . PHE B 2 45  ? 25.576  11.217  62.068 1.00 31.26  ? 45   PHE B CE2 1 
ATOM   2503 C  CZ  . PHE B 2 45  ? 24.673  10.634  62.942 1.00 33.20  ? 45   PHE B CZ  1 
ATOM   2504 N  N   . GLY B 2 46  ? 26.782  17.344  65.766 1.00 32.44  ? 46   GLY B N   1 
ATOM   2505 C  CA  . GLY B 2 46  ? 27.728  18.430  65.955 1.00 30.37  ? 46   GLY B CA  1 
ATOM   2506 C  C   . GLY B 2 46  ? 27.845  19.342  64.751 1.00 29.43  ? 46   GLY B C   1 
ATOM   2507 O  O   . GLY B 2 46  ? 26.834  19.644  64.118 1.00 40.38  ? 46   GLY B O   1 
ATOM   2508 N  N   . ASP B 2 47  ? 29.064  19.775  64.448 1.00 26.35  ? 47   ASP B N   1 
ATOM   2509 C  CA  . ASP B 2 47  ? 29.354  20.795  63.455 1.00 25.30  ? 47   ASP B CA  1 
ATOM   2510 C  C   . ASP B 2 47  ? 29.221  20.291  62.016 1.00 32.54  ? 47   ASP B C   1 
ATOM   2511 O  O   . ASP B 2 47  ? 29.972  19.411  61.585 1.00 25.53  ? 47   ASP B O   1 
ATOM   2512 C  CB  . ASP B 2 47  ? 30.767  21.339  63.674 1.00 34.79  ? 47   ASP B CB  1 
ATOM   2513 C  CG  . ASP B 2 47  ? 31.160  22.449  62.725 1.00 39.91  ? 47   ASP B CG  1 
ATOM   2514 O  OD1 . ASP B 2 47  ? 30.267  23.062  62.105 1.00 46.64  ? 47   ASP B OD1 1 
ATOM   2515 O  OD2 . ASP B 2 47  ? 32.378  22.703  62.603 1.00 43.96  ? 47   ASP B OD2 1 
ATOM   2516 N  N   . LEU B 2 48  ? 28.268  20.885  61.307 1.00 21.40  ? 48   LEU B N   1 
ATOM   2517 C  CA  . LEU B 2 48  ? 28.031  20.641  59.891 1.00 27.93  ? 48   LEU B CA  1 
ATOM   2518 C  C   . LEU B 2 48  ? 28.094  21.931  59.081 1.00 35.07  ? 48   LEU B C   1 
ATOM   2519 O  O   . LEU B 2 48  ? 27.459  22.062  58.029 1.00 30.71  ? 48   LEU B O   1 
ATOM   2520 C  CB  . LEU B 2 48  ? 26.674  19.961  59.703 1.00 20.35  ? 48   LEU B CB  1 
ATOM   2521 C  CG  . LEU B 2 48  ? 26.408  18.691  60.511 1.00 23.34  ? 48   LEU B CG  1 
ATOM   2522 C  CD1 . LEU B 2 48  ? 24.957  18.256  60.365 1.00 26.43  ? 48   LEU B CD1 1 
ATOM   2523 C  CD2 . LEU B 2 48  ? 27.349  17.569  60.108 1.00 23.98  ? 48   LEU B CD2 1 
ATOM   2524 N  N   . SER B 2 49  ? 28.855  22.909  59.566 1.00 32.82  ? 49   SER B N   1 
ATOM   2525 C  CA  . SER B 2 49  ? 28.752  24.269  59.045 1.00 39.09  ? 49   SER B CA  1 
ATOM   2526 C  C   . SER B 2 49  ? 29.411  24.480  57.693 1.00 35.13  ? 49   SER B C   1 
ATOM   2527 O  O   . SER B 2 49  ? 28.968  25.333  56.912 1.00 41.20  ? 49   SER B O   1 
ATOM   2528 C  CB  . SER B 2 49  ? 29.338  25.253  60.068 1.00 40.82  ? 49   SER B CB  1 
ATOM   2529 O  OG  . SER B 2 49  ? 30.726  25.022  60.223 1.00 40.66  ? 49   SER B OG  1 
ATOM   2530 N  N   . THR B 2 50  ? 30.471  23.749  57.376 1.00 32.26  ? 50   THR B N   1 
ATOM   2531 C  CA  . THR B 2 50  ? 31.114  23.875  56.065 1.00 27.16  ? 50   THR B CA  1 
ATOM   2532 C  C   . THR B 2 50  ? 31.307  22.494  55.452 1.00 26.34  ? 50   THR B C   1 
ATOM   2533 O  O   . THR B 2 50  ? 31.235  21.500  56.184 1.00 24.62  ? 50   THR B O   1 
ATOM   2534 C  CB  . THR B 2 50  ? 32.467  24.592  56.183 1.00 36.03  ? 50   THR B CB  1 
ATOM   2535 O  OG1 . THR B 2 50  ? 33.386  23.778  56.929 1.00 36.04  ? 50   THR B OG1 1 
ATOM   2536 C  CG2 . THR B 2 50  ? 32.309  25.898  56.948 1.00 47.18  ? 50   THR B CG2 1 
ATOM   2537 N  N   . PRO B 2 51  ? 31.550  22.399  54.152 1.00 32.59  ? 51   PRO B N   1 
ATOM   2538 C  CA  . PRO B 2 51  ? 31.845  21.083  53.564 1.00 29.19  ? 51   PRO B CA  1 
ATOM   2539 C  C   . PRO B 2 51  ? 32.989  20.401  54.301 1.00 30.94  ? 51   PRO B C   1 
ATOM   2540 O  O   . PRO B 2 51  ? 32.953  19.203  54.575 1.00 27.18  ? 51   PRO B O   1 
ATOM   2541 C  CB  . PRO B 2 51  ? 32.254  21.422  52.129 1.00 28.95  ? 51   PRO B CB  1 
ATOM   2542 C  CG  . PRO B 2 51  ? 31.563  22.716  51.844 1.00 31.83  ? 51   PRO B CG  1 
ATOM   2543 C  CD  . PRO B 2 51  ? 31.535  23.467  53.142 1.00 32.38  ? 51   PRO B CD  1 
ATOM   2544 N  N   . ASP B 2 52  ? 34.029  21.171  54.634 1.00 35.06  ? 52   ASP B N   1 
ATOM   2545 C  CA  . ASP B 2 52  ? 35.154  20.583  55.360 1.00 26.73  ? 52   ASP B CA  1 
ATOM   2546 C  C   . ASP B 2 52  ? 34.699  20.031  56.703 1.00 26.95  ? 52   ASP B C   1 
ATOM   2547 O  O   . ASP B 2 52  ? 35.178  18.976  57.106 1.00 27.14  ? 52   ASP B O   1 
ATOM   2548 C  CB  . ASP B 2 52  ? 36.256  21.618  55.579 1.00 31.38  ? 52   ASP B CB  1 
ATOM   2549 C  CG  . ASP B 2 52  ? 36.943  21.991  54.280 1.00 45.17  ? 52   ASP B CG  1 
ATOM   2550 O  OD1 . ASP B 2 52  ? 37.432  21.075  53.589 1.00 45.34  ? 52   ASP B OD1 1 
ATOM   2551 O  OD2 . ASP B 2 52  ? 36.975  23.200  53.968 1.00 81.19  ? 52   ASP B OD2 1 
ATOM   2552 N  N   . ALA B 2 53  ? 33.790  20.732  57.383 1.00 22.42  ? 53   ALA B N   1 
ATOM   2553 C  CA  . ALA B 2 53  ? 33.378  20.269  58.710 1.00 23.19  ? 53   ALA B CA  1 
ATOM   2554 C  C   . ALA B 2 53  ? 32.549  18.996  58.604 1.00 21.53  ? 53   ALA B C   1 
ATOM   2555 O  O   . ALA B 2 53  ? 32.701  18.093  59.422 1.00 22.07  ? 53   ALA B O   1 
ATOM   2556 C  CB  . ALA B 2 53  ? 32.592  21.329  59.461 1.00 26.34  ? 53   ALA B CB  1 
ATOM   2557 N  N   . VAL B 2 54  ? 31.682  18.952  57.599 1.00 23.09  ? 54   VAL B N   1 
ATOM   2558 C  CA  . VAL B 2 54  ? 30.906  17.739  57.339 1.00 21.33  ? 54   VAL B CA  1 
ATOM   2559 C  C   . VAL B 2 54  ? 31.828  16.563  57.049 1.00 23.06  ? 54   VAL B C   1 
ATOM   2560 O  O   . VAL B 2 54  ? 31.724  15.492  57.652 1.00 22.96  ? 54   VAL B O   1 
ATOM   2561 C  CB  . VAL B 2 54  ? 29.956  17.923  56.135 1.00 20.68  ? 54   VAL B CB  1 
ATOM   2562 C  CG1 . VAL B 2 54  ? 29.234  16.625  55.812 1.00 22.41  ? 54   VAL B CG1 1 
ATOM   2563 C  CG2 . VAL B 2 54  ? 28.957  19.045  56.379 1.00 23.87  ? 54   VAL B CG2 1 
ATOM   2564 N  N   . MET B 2 55  ? 32.742  16.744  56.093 1.00 25.52  ? 55   MET B N   1 
ATOM   2565 C  CA  . MET B 2 55  ? 33.543  15.605  55.644 1.00 26.34  ? 55   MET B CA  1 
ATOM   2566 C  C   . MET B 2 55  ? 34.462  15.100  56.751 1.00 30.01  ? 55   MET B C   1 
ATOM   2567 O  O   . MET B 2 55  ? 34.841  13.930  56.763 1.00 27.68  ? 55   MET B O   1 
ATOM   2568 C  CB  . MET B 2 55  ? 34.362  15.955  54.400 1.00 22.36  ? 55   MET B CB  1 
ATOM   2569 C  CG  . MET B 2 55  ? 33.546  16.455  53.221 1.00 20.70  ? 55   MET B CG  1 
ATOM   2570 S  SD  . MET B 2 55  ? 32.290  15.318  52.631 1.00 25.51  ? 55   MET B SD  1 
ATOM   2571 C  CE  . MET B 2 55  ? 33.264  13.913  52.100 1.00 25.93  ? 55   MET B CE  1 
ATOM   2572 N  N   . GLY B 2 56  ? 34.813  15.987  57.677 1.00 26.01  ? 56   GLY B N   1 
ATOM   2573 C  CA  . GLY B 2 56  ? 35.704  15.649  58.770 1.00 23.07  ? 56   GLY B CA  1 
ATOM   2574 C  C   . GLY B 2 56  ? 35.011  15.259  60.059 1.00 24.84  ? 56   GLY B C   1 
ATOM   2575 O  O   . GLY B 2 56  ? 35.682  14.914  61.034 1.00 29.85  ? 56   GLY B O   1 
ATOM   2576 N  N   . ASN B 2 57  ? 33.688  15.320  60.085 1.00 23.13  ? 57   ASN B N   1 
ATOM   2577 C  CA  . ASN B 2 57  ? 32.892  14.989  61.257 1.00 21.92  ? 57   ASN B CA  1 
ATOM   2578 C  C   . ASN B 2 57  ? 32.979  13.508  61.585 1.00 20.65  ? 57   ASN B C   1 
ATOM   2579 O  O   . ASN B 2 57  ? 32.568  12.695  60.755 1.00 21.70  ? 57   ASN B O   1 
ATOM   2580 C  CB  . ASN B 2 57  ? 31.432  15.382  61.018 1.00 23.45  ? 57   ASN B CB  1 
ATOM   2581 C  CG  . ASN B 2 57  ? 30.626  15.318  62.305 1.00 19.84  ? 57   ASN B CG  1 
ATOM   2582 O  OD1 . ASN B 2 57  ? 30.515  14.251  62.897 1.00 25.52  ? 57   ASN B OD1 1 
ATOM   2583 N  ND2 . ASN B 2 57  ? 30.074  16.449  62.716 1.00 26.50  ? 57   ASN B ND2 1 
ATOM   2584 N  N   . PRO B 2 58  ? 33.485  13.129  62.751 1.00 21.30  ? 58   PRO B N   1 
ATOM   2585 C  CA  . PRO B 2 58  ? 33.626  11.705  63.064 1.00 21.48  ? 58   PRO B CA  1 
ATOM   2586 C  C   . PRO B 2 58  ? 32.274  11.015  63.176 1.00 20.88  ? 58   PRO B C   1 
ATOM   2587 O  O   . PRO B 2 58  ? 32.177  9.813   62.940 1.00 20.43  ? 58   PRO B O   1 
ATOM   2588 C  CB  . PRO B 2 58  ? 34.369  11.676  64.398 1.00 27.23  ? 58   PRO B CB  1 
ATOM   2589 C  CG  . PRO B 2 58  ? 34.233  13.043  64.970 1.00 30.95  ? 58   PRO B CG  1 
ATOM   2590 C  CD  . PRO B 2 58  ? 33.943  13.993  63.848 1.00 31.01  ? 58   PRO B CD  1 
ATOM   2591 N  N   . LYS B 2 59  ? 31.220  11.748  63.515 1.00 23.64  ? 59   LYS B N   1 
ATOM   2592 C  CA  . LYS B 2 59  ? 29.910  11.102  63.631 1.00 27.44  ? 59   LYS B CA  1 
ATOM   2593 C  C   . LYS B 2 59  ? 29.320  10.822  62.254 1.00 25.29  ? 59   LYS B C   1 
ATOM   2594 O  O   . LYS B 2 59  ? 28.700  9.779   62.025 1.00 24.13  ? 59   LYS B O   1 
ATOM   2595 C  CB  . LYS B 2 59  ? 28.990  11.969  64.482 1.00 37.41  ? 59   LYS B CB  1 
ATOM   2596 C  CG  . LYS B 2 59  ? 29.324  11.946  65.968 1.00 32.07  ? 59   LYS B CG  1 
ATOM   2597 C  CD  . LYS B 2 59  ? 28.520  12.992  66.721 1.00 49.87  ? 59   LYS B CD  1 
ATOM   2598 C  CE  . LYS B 2 59  ? 27.940  12.423  68.009 1.00 62.75  ? 59   LYS B CE  1 
ATOM   2599 N  NZ  . LYS B 2 59  ? 26.691  13.126  68.417 1.00 51.35  ? 59   LYS B NZ  1 
ATOM   2600 N  N   . VAL B 2 60  ? 29.532  11.739  61.312 1.00 18.56  ? 60   VAL B N   1 
ATOM   2601 C  CA  . VAL B 2 60  ? 29.133  11.475  59.924 1.00 23.02  ? 60   VAL B CA  1 
ATOM   2602 C  C   . VAL B 2 60  ? 29.871  10.281  59.343 1.00 25.60  ? 60   VAL B C   1 
ATOM   2603 O  O   . VAL B 2 60  ? 29.328  9.358   58.724 1.00 23.82  ? 60   VAL B O   1 
ATOM   2604 C  CB  . VAL B 2 60  ? 29.374  12.738  59.072 1.00 25.19  ? 60   VAL B CB  1 
ATOM   2605 C  CG1 . VAL B 2 60  ? 29.243  12.441  57.585 1.00 21.76  ? 60   VAL B CG1 1 
ATOM   2606 C  CG2 . VAL B 2 60  ? 28.401  13.832  59.489 1.00 31.45  ? 60   VAL B CG2 1 
ATOM   2607 N  N   . LYS B 2 61  ? 31.195  10.234  59.542 1.00 17.49  ? 61   LYS B N   1 
ATOM   2608 C  CA  . LYS B 2 61  ? 31.931  9.073   59.061 1.00 21.16  ? 61   LYS B CA  1 
ATOM   2609 C  C   . LYS B 2 61  ? 31.427  7.778   59.688 1.00 19.65  ? 61   LYS B C   1 
ATOM   2610 O  O   . LYS B 2 61  ? 31.341  6.745   59.010 1.00 21.65  ? 61   LYS B O   1 
ATOM   2611 C  CB  . LYS B 2 61  ? 33.428  9.254   59.337 1.00 27.82  ? 61   LYS B CB  1 
ATOM   2612 C  CG  . LYS B 2 61  ? 34.066  10.380  58.534 1.00 36.85  ? 61   LYS B CG  1 
ATOM   2613 C  CD  . LYS B 2 61  ? 35.528  10.568  58.917 1.00 44.89  ? 61   LYS B CD  1 
ATOM   2614 C  CE  . LYS B 2 61  ? 36.232  9.233   59.093 1.00 51.38  ? 61   LYS B CE  1 
ATOM   2615 N  NZ  . LYS B 2 61  ? 36.384  8.502   57.802 1.00 60.10  ? 61   LYS B NZ  1 
ATOM   2616 N  N   . ALA B 2 62  ? 31.092  7.799   60.981 1.00 17.26  ? 62   ALA B N   1 
ATOM   2617 C  CA  . ALA B 2 62  ? 30.680  6.551   61.625 1.00 22.48  ? 62   ALA B CA  1 
ATOM   2618 C  C   . ALA B 2 62  ? 29.338  6.060   61.093 1.00 27.25  ? 62   ALA B C   1 
ATOM   2619 O  O   . ALA B 2 62  ? 29.105  4.860   60.933 1.00 22.58  ? 62   ALA B O   1 
ATOM   2620 C  CB  . ALA B 2 62  ? 30.589  6.720   63.134 1.00 30.09  ? 62   ALA B CB  1 
ATOM   2621 N  N   . HIS B 2 63  ? 28.450  7.023   60.855 1.00 21.19  ? 63   HIS B N   1 
ATOM   2622 C  CA  . HIS B 2 63  ? 27.140  6.666   60.316 1.00 23.46  ? 63   HIS B CA  1 
ATOM   2623 C  C   . HIS B 2 63  ? 27.303  6.173   58.884 1.00 20.32  ? 63   HIS B C   1 
ATOM   2624 O  O   . HIS B 2 63  ? 26.641  5.215   58.485 1.00 20.47  ? 63   HIS B O   1 
ATOM   2625 C  CB  . HIS B 2 63  ? 26.163  7.841   60.405 1.00 23.31  ? 63   HIS B CB  1 
ATOM   2626 C  CG  . HIS B 2 63  ? 24.761  7.380   60.114 1.00 27.20  ? 63   HIS B CG  1 
ATOM   2627 N  ND1 . HIS B 2 63  ? 24.125  6.455   60.911 1.00 30.95  ? 63   HIS B ND1 1 
ATOM   2628 C  CD2 . HIS B 2 63  ? 23.907  7.662   59.107 1.00 23.60  ? 63   HIS B CD2 1 
ATOM   2629 C  CE1 . HIS B 2 63  ? 22.925  6.212   60.414 1.00 28.18  ? 63   HIS B CE1 1 
ATOM   2630 N  NE2 . HIS B 2 63  ? 22.755  6.937   59.321 1.00 25.07  ? 63   HIS B NE2 1 
ATOM   2631 N  N   . GLY B 2 64  ? 28.211  6.783   58.132 1.00 18.15  ? 64   GLY B N   1 
ATOM   2632 C  CA  . GLY B 2 64  ? 28.493  6.346   56.770 1.00 21.79  ? 64   GLY B CA  1 
ATOM   2633 C  C   . GLY B 2 64  ? 28.938  4.901   56.704 1.00 21.54  ? 64   GLY B C   1 
ATOM   2634 O  O   . GLY B 2 64  ? 28.532  4.136   55.828 1.00 20.08  ? 64   GLY B O   1 
ATOM   2635 N  N   . LYS B 2 65  ? 29.783  4.509   57.655 1.00 24.96  ? 65   LYS B N   1 
ATOM   2636 C  CA  . LYS B 2 65  ? 30.280  3.143   57.739 1.00 21.18  ? 65   LYS B CA  1 
ATOM   2637 C  C   . LYS B 2 65  ? 29.150  2.168   58.049 1.00 19.76  ? 65   LYS B C   1 
ATOM   2638 O  O   . LYS B 2 65  ? 29.117  1.060   57.505 1.00 23.96  ? 65   LYS B O   1 
ATOM   2639 C  CB  . LYS B 2 65  ? 31.365  3.044   58.812 1.00 36.71  ? 65   LYS B CB  1 
ATOM   2640 C  CG  . LYS B 2 65  ? 31.452  1.692   59.500 1.00 44.49  ? 65   LYS B CG  1 
ATOM   2641 C  CD  . LYS B 2 65  ? 32.324  1.783   60.747 1.00 53.05  ? 65   LYS B CD  1 
ATOM   2642 C  CE  . LYS B 2 65  ? 32.727  0.405   61.246 1.00 49.32  ? 65   LYS B CE  1 
ATOM   2643 N  NZ  . LYS B 2 65  ? 33.689  -0.256  60.318 1.00 52.32  ? 65   LYS B NZ  1 
ATOM   2644 N  N   . LYS B 2 66  ? 28.246  2.595   58.922 1.00 22.82  ? 66   LYS B N   1 
ATOM   2645 C  CA  . LYS B 2 66  ? 27.099  1.782   59.305 1.00 19.17  ? 66   LYS B CA  1 
ATOM   2646 C  C   . LYS B 2 66  ? 26.159  1.537   58.128 1.00 20.34  ? 66   LYS B C   1 
ATOM   2647 O  O   . LYS B 2 66  ? 25.725  0.412   57.854 1.00 17.70  ? 66   LYS B O   1 
ATOM   2648 C  CB  . LYS B 2 66  ? 26.337  2.468   60.446 1.00 21.68  ? 66   LYS B CB  1 
ATOM   2649 C  CG  . LYS B 2 66  ? 25.192  1.622   60.987 1.00 35.13  ? 66   LYS B CG  1 
ATOM   2650 C  CD  . LYS B 2 66  ? 24.575  2.225   62.235 1.00 49.09  ? 66   LYS B CD  1 
ATOM   2651 C  CE  . LYS B 2 66  ? 25.617  2.888   63.127 1.00 55.49  ? 66   LYS B CE  1 
ATOM   2652 N  NZ  . LYS B 2 66  ? 24.999  3.931   64.002 1.00 57.31  ? 66   LYS B NZ  1 
ATOM   2653 N  N   . VAL B 2 67  ? 25.836  2.639   57.453 1.00 14.73  ? 67   VAL B N   1 
ATOM   2654 C  CA  . VAL B 2 67  ? 24.919  2.581   56.320 1.00 20.59  ? 67   VAL B CA  1 
ATOM   2655 C  C   . VAL B 2 67  ? 25.499  1.745   55.199 1.00 19.34  ? 67   VAL B C   1 
ATOM   2656 O  O   . VAL B 2 67  ? 24.846  0.851   54.661 1.00 16.76  ? 67   VAL B O   1 
ATOM   2657 C  CB  . VAL B 2 67  ? 24.616  4.020   55.840 1.00 21.48  ? 67   VAL B CB  1 
ATOM   2658 C  CG1 . VAL B 2 67  ? 24.043  4.020   54.440 1.00 18.80  ? 67   VAL B CG1 1 
ATOM   2659 C  CG2 . VAL B 2 67  ? 23.691  4.697   56.846 1.00 22.14  ? 67   VAL B CG2 1 
ATOM   2660 N  N   . LEU B 2 68  ? 26.757  2.002   54.834 1.00 15.09  ? 68   LEU B N   1 
ATOM   2661 C  CA  . LEU B 2 68  ? 27.321  1.259   53.712 1.00 11.95  ? 68   LEU B CA  1 
ATOM   2662 C  C   . LEU B 2 68  ? 27.659  -0.175  54.097 1.00 16.94  ? 68   LEU B C   1 
ATOM   2663 O  O   . LEU B 2 68  ? 27.750  -1.060  53.249 1.00 21.26  ? 68   LEU B O   1 
ATOM   2664 C  CB  . LEU B 2 68  ? 28.560  1.975   53.163 1.00 21.12  ? 68   LEU B CB  1 
ATOM   2665 C  CG  . LEU B 2 68  ? 28.607  2.076   51.634 1.00 31.23  ? 68   LEU B CG  1 
ATOM   2666 C  CD1 . LEU B 2 68  ? 27.558  3.062   51.145 1.00 44.68  ? 68   LEU B CD1 1 
ATOM   2667 C  CD2 . LEU B 2 68  ? 29.989  2.471   51.141 1.00 45.20  ? 68   LEU B CD2 1 
ATOM   2668 N  N   . GLY B 2 69  ? 27.840  -0.430  55.395 1.00 17.87  ? 69   GLY B N   1 
ATOM   2669 C  CA  . GLY B 2 69  ? 28.050  -1.806  55.832 1.00 18.70  ? 69   GLY B CA  1 
ATOM   2670 C  C   . GLY B 2 69  ? 26.798  -2.630  55.590 1.00 19.91  ? 69   GLY B C   1 
ATOM   2671 O  O   . GLY B 2 69  ? 26.855  -3.787  55.183 1.00 18.88  ? 69   GLY B O   1 
ATOM   2672 N  N   . ALA B 2 70  ? 25.637  -2.023  55.834 1.00 21.40  ? 70   ALA B N   1 
ATOM   2673 C  CA  . ALA B 2 70  ? 24.370  -2.703  55.596 1.00 19.86  ? 70   ALA B CA  1 
ATOM   2674 C  C   . ALA B 2 70  ? 24.121  -2.874  54.100 1.00 20.17  ? 70   ALA B C   1 
ATOM   2675 O  O   . ALA B 2 70  ? 23.611  -3.904  53.650 1.00 20.37  ? 70   ALA B O   1 
ATOM   2676 C  CB  . ALA B 2 70  ? 23.229  -1.924  56.234 1.00 24.65  ? 70   ALA B CB  1 
ATOM   2677 N  N   . PHE B 2 71  ? 24.469  -1.842  53.338 1.00 18.78  ? 71   PHE B N   1 
ATOM   2678 C  CA  . PHE B 2 71  ? 24.400  -1.901  51.881 1.00 22.14  ? 71   PHE B CA  1 
ATOM   2679 C  C   . PHE B 2 71  ? 25.238  -3.071  51.364 1.00 20.61  ? 71   PHE B C   1 
ATOM   2680 O  O   . PHE B 2 71  ? 24.809  -3.897  50.558 1.00 17.99  ? 71   PHE B O   1 
ATOM   2681 C  CB  . PHE B 2 71  ? 24.910  -0.587  51.300 1.00 18.15  ? 71   PHE B CB  1 
ATOM   2682 C  CG  . PHE B 2 71  ? 24.863  -0.498  49.787 1.00 22.74  ? 71   PHE B CG  1 
ATOM   2683 C  CD1 . PHE B 2 71  ? 23.691  -0.132  49.138 1.00 24.46  ? 71   PHE B CD1 1 
ATOM   2684 C  CD2 . PHE B 2 71  ? 25.991  -0.774  49.034 1.00 21.74  ? 71   PHE B CD2 1 
ATOM   2685 C  CE1 . PHE B 2 71  ? 23.666  -0.050  47.754 1.00 23.70  ? 71   PHE B CE1 1 
ATOM   2686 C  CE2 . PHE B 2 71  ? 25.975  -0.698  47.653 1.00 22.44  ? 71   PHE B CE2 1 
ATOM   2687 C  CZ  . PHE B 2 71  ? 24.799  -0.332  47.019 1.00 28.76  ? 71   PHE B CZ  1 
ATOM   2688 N  N   . SER B 2 72  ? 26.464  -3.131  51.870 1.00 18.99  ? 72   SER B N   1 
ATOM   2689 C  CA  . SER B 2 72  ? 27.447  -4.141  51.488 1.00 20.76  ? 72   SER B CA  1 
ATOM   2690 C  C   . SER B 2 72  ? 26.949  -5.547  51.756 1.00 27.33  ? 72   SER B C   1 
ATOM   2691 O  O   . SER B 2 72  ? 27.007  -6.440  50.901 1.00 26.33  ? 72   SER B O   1 
ATOM   2692 C  CB  . SER B 2 72  ? 28.762  -3.870  52.231 1.00 21.36  ? 72   SER B CB  1 
ATOM   2693 O  OG  . SER B 2 72  ? 29.773  -4.794  51.893 1.00 31.58  ? 72   SER B OG  1 
ATOM   2694 N  N   . ASP B 2 73  ? 26.420  -5.783  52.961 1.00 22.50  ? 73   ASP B N   1 
ATOM   2695 C  CA  . ASP B 2 73  ? 25.890  -7.138  53.192 1.00 30.95  ? 73   ASP B CA  1 
ATOM   2696 C  C   . ASP B 2 73  ? 24.659  -7.370  52.327 1.00 29.28  ? 73   ASP B C   1 
ATOM   2697 O  O   . ASP B 2 73  ? 24.274  -8.504  52.029 1.00 32.10  ? 73   ASP B O   1 
ATOM   2698 C  CB  . ASP B 2 73  ? 25.615  -7.356  54.673 1.00 31.56  ? 73   ASP B CB  1 
ATOM   2699 C  CG  . ASP B 2 73  ? 26.822  -7.238  55.582 1.00 41.30  ? 73   ASP B CG  1 
ATOM   2700 O  OD1 . ASP B 2 73  ? 27.984  -7.245  55.121 1.00 34.47  ? 73   ASP B OD1 1 
ATOM   2701 O  OD2 . ASP B 2 73  ? 26.616  -7.134  56.815 1.00 37.30  ? 73   ASP B OD2 1 
ATOM   2702 N  N   . GLY B 2 74  ? 23.997  -6.313  51.844 1.00 27.53  ? 74   GLY B N   1 
ATOM   2703 C  CA  . GLY B 2 74  ? 22.832  -6.518  50.990 1.00 19.85  ? 74   GLY B CA  1 
ATOM   2704 C  C   . GLY B 2 74  ? 23.219  -7.074  49.627 1.00 26.89  ? 74   GLY B C   1 
ATOM   2705 O  O   . GLY B 2 74  ? 22.445  -7.749  48.954 1.00 28.46  ? 74   GLY B O   1 
ATOM   2706 N  N   . LEU B 2 75  ? 24.437  -6.786  49.198 1.00 20.82  ? 75   LEU B N   1 
ATOM   2707 C  CA  . LEU B 2 75  ? 24.949  -7.168  47.890 1.00 23.16  ? 75   LEU B CA  1 
ATOM   2708 C  C   . LEU B 2 75  ? 25.125  -8.672  47.779 1.00 23.03  ? 75   LEU B C   1 
ATOM   2709 O  O   . LEU B 2 75  ? 25.230  -9.237  46.693 1.00 32.01  ? 75   LEU B O   1 
ATOM   2710 C  CB  . LEU B 2 75  ? 26.279  -6.453  47.631 1.00 22.57  ? 75   LEU B CB  1 
ATOM   2711 C  CG  . LEU B 2 75  ? 26.164  -4.949  47.383 1.00 29.86  ? 75   LEU B CG  1 
ATOM   2712 C  CD1 . LEU B 2 75  ? 27.500  -4.371  46.937 1.00 49.98  ? 75   LEU B CD1 1 
ATOM   2713 C  CD2 . LEU B 2 75  ? 25.073  -4.656  46.362 1.00 39.75  ? 75   LEU B CD2 1 
ATOM   2714 N  N   . ALA B 2 76  ? 25.142  -9.339  48.929 1.00 27.86  ? 76   ALA B N   1 
ATOM   2715 C  CA  . ALA B 2 76  ? 25.204  -10.794 48.954 1.00 22.51  ? 76   ALA B CA  1 
ATOM   2716 C  C   . ALA B 2 76  ? 23.824  -11.415 48.764 1.00 26.57  ? 76   ALA B C   1 
ATOM   2717 O  O   . ALA B 2 76  ? 23.704  -12.639 48.690 1.00 31.66  ? 76   ALA B O   1 
ATOM   2718 C  CB  . ALA B 2 76  ? 25.791  -11.290 50.270 1.00 37.82  ? 76   ALA B CB  1 
ATOM   2719 N  N   . HIS B 2 77  ? 22.804  -10.574 48.707 1.00 25.46  ? 77   HIS B N   1 
ATOM   2720 C  CA  . HIS B 2 77  ? 21.433  -11.059 48.622 1.00 26.80  ? 77   HIS B CA  1 
ATOM   2721 C  C   . HIS B 2 77  ? 20.646  -10.373 47.512 1.00 26.66  ? 77   HIS B C   1 
ATOM   2722 O  O   . HIS B 2 77  ? 19.487  -10.017 47.718 1.00 22.98  ? 77   HIS B O   1 
ATOM   2723 C  CB  . HIS B 2 77  ? 20.714  -10.829 49.955 1.00 30.54  ? 77   HIS B CB  1 
ATOM   2724 C  CG  . HIS B 2 77  ? 21.336  -11.640 51.052 1.00 36.33  ? 77   HIS B CG  1 
ATOM   2725 N  ND1 . HIS B 2 77  ? 22.037  -11.078 52.091 1.00 37.20  ? 77   HIS B ND1 1 
ATOM   2726 C  CD2 . HIS B 2 77  ? 21.368  -12.980 51.240 1.00 34.22  ? 77   HIS B CD2 1 
ATOM   2727 C  CE1 . HIS B 2 77  ? 22.467  -12.040 52.889 1.00 39.89  ? 77   HIS B CE1 1 
ATOM   2728 N  NE2 . HIS B 2 77  ? 22.077  -13.201 52.398 1.00 36.60  ? 77   HIS B NE2 1 
ATOM   2729 N  N   . LEU B 2 78  ? 21.286  -10.220 46.359 1.00 24.50  ? 78   LEU B N   1 
ATOM   2730 C  CA  . LEU B 2 78  ? 20.666  -9.474  45.271 1.00 27.37  ? 78   LEU B CA  1 
ATOM   2731 C  C   . LEU B 2 78  ? 19.352  -10.110 44.831 1.00 31.50  ? 78   LEU B C   1 
ATOM   2732 O  O   . LEU B 2 78  ? 18.482  -9.405  44.308 1.00 30.44  ? 78   LEU B O   1 
ATOM   2733 C  CB  . LEU B 2 78  ? 21.647  -9.346  44.105 1.00 27.45  ? 78   LEU B CB  1 
ATOM   2734 C  CG  . LEU B 2 78  ? 22.831  -8.399  44.309 1.00 39.95  ? 78   LEU B CG  1 
ATOM   2735 C  CD1 . LEU B 2 78  ? 23.803  -8.500  43.141 1.00 39.67  ? 78   LEU B CD1 1 
ATOM   2736 C  CD2 . LEU B 2 78  ? 22.360  -6.963  44.488 1.00 39.48  ? 78   LEU B CD2 1 
ATOM   2737 N  N   . ASP B 2 79  ? 19.159  -11.415 45.033 1.00 26.81  ? 79   ASP B N   1 
ATOM   2738 C  CA  . ASP B 2 79  ? 17.904  -12.031 44.597 1.00 33.98  ? 79   ASP B CA  1 
ATOM   2739 C  C   . ASP B 2 79  ? 16.814  -11.933 45.652 1.00 31.57  ? 79   ASP B C   1 
ATOM   2740 O  O   . ASP B 2 79  ? 15.707  -12.454 45.487 1.00 31.86  ? 79   ASP B O   1 
ATOM   2741 C  CB  . ASP B 2 79  ? 18.117  -13.500 44.219 1.00 42.19  ? 79   ASP B CB  1 
ATOM   2742 C  CG  . ASP B 2 79  ? 19.054  -13.641 43.035 1.00 52.38  ? 79   ASP B CG  1 
ATOM   2743 O  OD1 . ASP B 2 79  ? 18.720  -13.096 41.964 1.00 49.02  ? 79   ASP B OD1 1 
ATOM   2744 O  OD2 . ASP B 2 79  ? 20.111  -14.286 43.193 1.00 89.47  ? 79   ASP B OD2 1 
ATOM   2745 N  N   . ASN B 2 80  ? 17.102  -11.253 46.761 1.00 28.08  ? 80   ASN B N   1 
ATOM   2746 C  CA  . ASN B 2 80  ? 16.075  -11.138 47.799 1.00 27.34  ? 80   ASN B CA  1 
ATOM   2747 C  C   . ASN B 2 80  ? 16.236  -9.838  48.572 1.00 29.04  ? 80   ASN B C   1 
ATOM   2748 O  O   . ASN B 2 80  ? 16.385  -9.862  49.793 1.00 23.67  ? 80   ASN B O   1 
ATOM   2749 C  CB  . ASN B 2 80  ? 16.159  -12.350 48.728 1.00 25.33  ? 80   ASN B CB  1 
ATOM   2750 C  CG  . ASN B 2 80  ? 15.102  -12.356 49.812 1.00 32.01  ? 80   ASN B CG  1 
ATOM   2751 O  OD1 . ASN B 2 80  ? 13.926  -12.080 49.557 1.00 38.61  ? 80   ASN B OD1 1 
ATOM   2752 N  ND2 . ASN B 2 80  ? 15.518  -12.670 51.030 1.00 32.48  ? 80   ASN B ND2 1 
ATOM   2753 N  N   . LEU B 2 81  ? 16.225  -8.700  47.877 1.00 21.25  ? 81   LEU B N   1 
ATOM   2754 C  CA  . LEU B 2 81  ? 16.507  -7.441  48.577 1.00 24.31  ? 81   LEU B CA  1 
ATOM   2755 C  C   . LEU B 2 81  ? 15.369  -7.061  49.509 1.00 24.36  ? 81   LEU B C   1 
ATOM   2756 O  O   . LEU B 2 81  ? 15.573  -6.551  50.614 1.00 22.10  ? 81   LEU B O   1 
ATOM   2757 C  CB  . LEU B 2 81  ? 16.787  -6.309  47.589 1.00 21.09  ? 81   LEU B CB  1 
ATOM   2758 C  CG  . LEU B 2 81  ? 18.089  -6.400  46.787 1.00 29.92  ? 81   LEU B CG  1 
ATOM   2759 C  CD1 . LEU B 2 81  ? 18.140  -5.358  45.681 1.00 38.00  ? 81   LEU B CD1 1 
ATOM   2760 C  CD2 . LEU B 2 81  ? 19.293  -6.261  47.705 1.00 36.85  ? 81   LEU B CD2 1 
ATOM   2761 N  N   . LYS B 2 82  ? 14.135  -7.299  49.064 1.00 26.94  ? 82   LYS B N   1 
ATOM   2762 C  CA  . LYS B 2 82  ? 12.988  -6.925  49.895 1.00 23.70  ? 82   LYS B CA  1 
ATOM   2763 C  C   . LYS B 2 82  ? 13.047  -7.603  51.250 1.00 20.13  ? 82   LYS B C   1 
ATOM   2764 O  O   . LYS B 2 82  ? 12.872  -6.986  52.305 1.00 23.52  ? 82   LYS B O   1 
ATOM   2765 C  CB  . LYS B 2 82  ? 11.691  -7.279  49.168 1.00 27.38  ? 82   LYS B CB  1 
ATOM   2766 C  CG  . LYS B 2 82  ? 11.116  -6.125  48.358 1.00 30.09  ? 82   LYS B CG  1 
ATOM   2767 C  CD  . LYS B 2 82  ? 9.614   -6.310  48.176 1.00 41.47  ? 82   LYS B CD  1 
ATOM   2768 C  CE  . LYS B 2 82  ? 9.184   -6.021  46.748 1.00 48.93  ? 82   LYS B CE  1 
ATOM   2769 N  NZ  . LYS B 2 82  ? 7.995   -5.123  46.694 1.00 49.84  ? 82   LYS B NZ  1 
ATOM   2770 N  N   . GLY B 2 83  ? 13.327  -8.911  51.255 1.00 27.44  ? 83   GLY B N   1 
ATOM   2771 C  CA  . GLY B 2 83  ? 13.337  -9.636  52.520 1.00 32.47  ? 83   GLY B CA  1 
ATOM   2772 C  C   . GLY B 2 83  ? 14.514  -9.281  53.406 1.00 25.16  ? 83   GLY B C   1 
ATOM   2773 O  O   . GLY B 2 83  ? 14.395  -9.194  54.633 1.00 32.98  ? 83   GLY B O   1 
ATOM   2774 N  N   . THR B 2 84  ? 15.667  -9.091  52.786 1.00 21.41  ? 84   THR B N   1 
ATOM   2775 C  CA  . THR B 2 84  ? 16.869  -8.649  53.470 1.00 28.15  ? 84   THR B CA  1 
ATOM   2776 C  C   . THR B 2 84  ? 16.680  -7.315  54.176 1.00 24.83  ? 84   THR B C   1 
ATOM   2777 O  O   . THR B 2 84  ? 17.322  -7.054  55.194 1.00 30.95  ? 84   THR B O   1 
ATOM   2778 C  CB  . THR B 2 84  ? 18.036  -8.523  52.465 1.00 29.09  ? 84   THR B CB  1 
ATOM   2779 O  OG1 . THR B 2 84  ? 18.274  -9.811  51.875 1.00 29.86  ? 84   THR B OG1 1 
ATOM   2780 C  CG2 . THR B 2 84  ? 19.311  -8.107  53.178 1.00 34.92  ? 84   THR B CG2 1 
ATOM   2781 N  N   . PHE B 2 85  ? 15.820  -6.447  53.650 1.00 17.03  ? 85   PHE B N   1 
ATOM   2782 C  CA  . PHE B 2 85  ? 15.784  -5.073  54.168 1.00 18.91  ? 85   PHE B CA  1 
ATOM   2783 C  C   . PHE B 2 85  ? 14.455  -4.748  54.839 1.00 22.65  ? 85   PHE B C   1 
ATOM   2784 O  O   . PHE B 2 85  ? 14.198  -3.596  55.196 1.00 20.56  ? 85   PHE B O   1 
ATOM   2785 C  CB  . PHE B 2 85  ? 16.057  -4.077  53.036 1.00 20.04  ? 85   PHE B CB  1 
ATOM   2786 C  CG  . PHE B 2 85  ? 17.528  -3.950  52.667 1.00 21.51  ? 85   PHE B CG  1 
ATOM   2787 C  CD1 . PHE B 2 85  ? 18.433  -3.407  53.563 1.00 30.14  ? 85   PHE B CD1 1 
ATOM   2788 C  CD2 . PHE B 2 85  ? 18.000  -4.377  51.440 1.00 28.32  ? 85   PHE B CD2 1 
ATOM   2789 C  CE1 . PHE B 2 85  ? 19.772  -3.295  53.226 1.00 31.40  ? 85   PHE B CE1 1 
ATOM   2790 C  CE2 . PHE B 2 85  ? 19.332  -4.265  51.084 1.00 25.38  ? 85   PHE B CE2 1 
ATOM   2791 C  CZ  . PHE B 2 85  ? 20.225  -3.727  51.997 1.00 23.30  ? 85   PHE B CZ  1 
ATOM   2792 N  N   . ALA B 2 86  ? 13.612  -5.759  54.980 1.00 26.69  ? 86   ALA B N   1 
ATOM   2793 C  CA  . ALA B 2 86  ? 12.262  -5.621  55.506 1.00 25.89  ? 86   ALA B CA  1 
ATOM   2794 C  C   . ALA B 2 86  ? 12.233  -4.938  56.863 1.00 19.31  ? 86   ALA B C   1 
ATOM   2795 O  O   . ALA B 2 86  ? 11.531  -3.953  57.094 1.00 22.24  ? 86   ALA B O   1 
ATOM   2796 C  CB  . ALA B 2 86  ? 11.607  -6.998  55.613 1.00 24.77  ? 86   ALA B CB  1 
ATOM   2797 N  N   . THR B 2 87  ? 12.993  -5.471  57.819 1.00 20.36  ? 87   THR B N   1 
ATOM   2798 C  CA  . THR B 2 87  ? 12.930  -4.882  59.159 1.00 23.56  ? 87   THR B CA  1 
ATOM   2799 C  C   . THR B 2 87  ? 13.562  -3.497  59.167 1.00 19.36  ? 87   THR B C   1 
ATOM   2800 O  O   . THR B 2 87  ? 13.112  -2.594  59.870 1.00 24.04  ? 87   THR B O   1 
ATOM   2801 C  CB  . THR B 2 87  ? 13.611  -5.779  60.209 1.00 39.23  ? 87   THR B CB  1 
ATOM   2802 O  OG1 . THR B 2 87  ? 12.984  -7.075  60.237 1.00 33.60  ? 87   THR B OG1 1 
ATOM   2803 C  CG2 . THR B 2 87  ? 13.436  -5.175  61.595 1.00 37.00  ? 87   THR B CG2 1 
ATOM   2804 N  N   . LEU B 2 88  ? 14.611  -3.283  58.386 1.00 16.46  ? 88   LEU B N   1 
ATOM   2805 C  CA  . LEU B 2 88  ? 15.185  -1.932  58.302 1.00 23.09  ? 88   LEU B CA  1 
ATOM   2806 C  C   . LEU B 2 88  ? 14.220  -0.936  57.671 1.00 17.87  ? 88   LEU B C   1 
ATOM   2807 O  O   . LEU B 2 88  ? 14.172  0.259   57.988 1.00 17.92  ? 88   LEU B O   1 
ATOM   2808 C  CB  . LEU B 2 88  ? 16.481  -1.989  57.495 1.00 23.41  ? 88   LEU B CB  1 
ATOM   2809 C  CG  . LEU B 2 88  ? 17.791  -2.236  58.243 1.00 30.32  ? 88   LEU B CG  1 
ATOM   2810 C  CD1 . LEU B 2 88  ? 18.965  -2.154  57.272 1.00 27.04  ? 88   LEU B CD1 1 
ATOM   2811 C  CD2 . LEU B 2 88  ? 17.992  -1.245  59.379 1.00 27.33  ? 88   LEU B CD2 1 
ATOM   2812 N  N   . SER B 2 89  ? 13.414  -1.414  56.721 1.00 17.37  ? 89   SER B N   1 
ATOM   2813 C  CA  . SER B 2 89  ? 12.401  -0.550  56.110 1.00 22.63  ? 89   SER B CA  1 
ATOM   2814 C  C   . SER B 2 89  ? 11.418  -0.063  57.175 1.00 22.59  ? 89   SER B C   1 
ATOM   2815 O  O   . SER B 2 89  ? 11.121  1.134   57.288 1.00 13.62  ? 89   SER B O   1 
ATOM   2816 C  CB  . SER B 2 89  ? 11.684  -1.319  54.992 1.00 15.61  ? 89   SER B CB  1 
ATOM   2817 O  OG  . SER B 2 89  ? 10.643  -0.563  54.400 1.00 17.63  ? 89   SER B OG  1 
ATOM   2818 N  N   . GLU B 2 90  ? 10.905  -1.008  57.969 1.00 20.12  ? 90   GLU B N   1 
ATOM   2819 C  CA  . GLU B 2 90  ? 9.946   -0.639  59.009 1.00 22.86  ? 90   GLU B CA  1 
ATOM   2820 C  C   . GLU B 2 90  ? 10.562  0.323   60.014 1.00 15.74  ? 90   GLU B C   1 
ATOM   2821 O  O   . GLU B 2 90  ? 9.926   1.260   60.507 1.00 20.46  ? 90   GLU B O   1 
ATOM   2822 C  CB  . GLU B 2 90  ? 9.391   -1.841  59.773 1.00 26.77  ? 90   GLU B CB  1 
ATOM   2823 C  CG  . GLU B 2 90  ? 8.813   -2.970  58.943 1.00 36.21  ? 90   GLU B CG  1 
ATOM   2824 C  CD  . GLU B 2 90  ? 8.310   -4.115  59.809 1.00 44.23  ? 90   GLU B CD  1 
ATOM   2825 O  OE1 . GLU B 2 90  ? 8.161   -3.921  61.035 1.00 57.97  ? 90   GLU B OE1 1 
ATOM   2826 O  OE2 . GLU B 2 90  ? 8.072   -5.214  59.269 1.00 46.60  ? 90   GLU B OE2 1 
ATOM   2827 N  N   . LEU B 2 91  ? 11.843  0.111   60.333 1.00 13.80  ? 91   LEU B N   1 
ATOM   2828 C  CA  . LEU B 2 91  ? 12.454  1.018   61.305 1.00 19.39  ? 91   LEU B CA  1 
ATOM   2829 C  C   . LEU B 2 91  ? 12.607  2.420   60.744 1.00 17.62  ? 91   LEU B C   1 
ATOM   2830 O  O   . LEU B 2 91  ? 12.427  3.424   61.433 1.00 16.15  ? 91   LEU B O   1 
ATOM   2831 C  CB  . LEU B 2 91  ? 13.823  0.471   61.714 1.00 21.03  ? 91   LEU B CB  1 
ATOM   2832 C  CG  . LEU B 2 91  ? 14.666  1.376   62.618 1.00 26.08  ? 91   LEU B CG  1 
ATOM   2833 C  CD1 . LEU B 2 91  ? 14.312  1.158   64.083 1.00 32.81  ? 91   LEU B CD1 1 
ATOM   2834 C  CD2 . LEU B 2 91  ? 16.146  1.108   62.397 1.00 26.16  ? 91   LEU B CD2 1 
ATOM   2835 N  N   . HIS B 2 92  ? 12.983  2.509   59.463 1.00 15.15  ? 92   HIS B N   1 
ATOM   2836 C  CA  . HIS B 2 92  ? 13.172  3.855   58.918 1.00 14.70  ? 92   HIS B CA  1 
ATOM   2837 C  C   . HIS B 2 92  ? 11.843  4.594   58.820 1.00 17.49  ? 92   HIS B C   1 
ATOM   2838 O  O   . HIS B 2 92  ? 11.782  5.814   58.925 1.00 14.09  ? 92   HIS B O   1 
ATOM   2839 C  CB  . HIS B 2 92  ? 13.860  3.768   57.553 1.00 14.73  ? 92   HIS B CB  1 
ATOM   2840 C  CG  . HIS B 2 92  ? 15.353  3.669   57.657 1.00 19.92  ? 92   HIS B CG  1 
ATOM   2841 N  ND1 . HIS B 2 92  ? 15.998  2.496   57.959 1.00 19.31  ? 92   HIS B ND1 1 
ATOM   2842 C  CD2 . HIS B 2 92  ? 16.323  4.602   57.475 1.00 18.43  ? 92   HIS B CD2 1 
ATOM   2843 C  CE1 . HIS B 2 92  ? 17.305  2.708   57.976 1.00 21.49  ? 92   HIS B CE1 1 
ATOM   2844 N  NE2 . HIS B 2 92  ? 17.532  3.977   57.683 1.00 18.91  ? 92   HIS B NE2 1 
ATOM   2845 N  N   . CYS B 2 93  ? 10.752  3.869   58.627 1.00 15.73  ? 93   CYS B N   1 
ATOM   2846 C  CA  . CYS B 2 93  ? 9.438   4.502   58.552 1.00 12.81  ? 93   CYS B CA  1 
ATOM   2847 C  C   . CYS B 2 93  ? 8.889   4.826   59.944 1.00 17.92  ? 93   CYS B C   1 
ATOM   2848 O  O   . CYS B 2 93  ? 8.650   5.995   60.238 1.00 15.92  ? 93   CYS B O   1 
ATOM   2849 C  CB  . CYS B 2 93  ? 8.461   3.591   57.810 1.00 14.28  ? 93   CYS B CB  1 
ATOM   2850 S  SG  . CYS B 2 93  ? 6.764   4.225   57.804 1.00 19.70  ? 93   CYS B SG  1 
ATOM   2851 N  N   . ASP B 2 94  ? 8.704   3.807   60.768 1.00 21.43  ? 94   ASP B N   1 
ATOM   2852 C  CA  . ASP B 2 94  ? 7.975   3.910   62.029 1.00 21.81  ? 94   ASP B CA  1 
ATOM   2853 C  C   . ASP B 2 94  ? 8.733   4.681   63.101 1.00 21.29  ? 94   ASP B C   1 
ATOM   2854 O  O   . ASP B 2 94  ? 8.130   5.420   63.882 1.00 30.84  ? 94   ASP B O   1 
ATOM   2855 C  CB  . ASP B 2 94  ? 7.659   2.504   62.547 1.00 22.98  ? 94   ASP B CB  1 
ATOM   2856 C  CG  . ASP B 2 94  ? 6.656   1.762   61.686 1.00 34.88  ? 94   ASP B CG  1 
ATOM   2857 O  OD1 . ASP B 2 94  ? 5.936   2.406   60.893 1.00 31.50  ? 94   ASP B OD1 1 
ATOM   2858 O  OD2 . ASP B 2 94  ? 6.583   0.519   61.816 1.00 30.14  ? 94   ASP B OD2 1 
ATOM   2859 N  N   . LYS B 2 95  ? 10.044  4.496   63.189 1.00 15.90  ? 95   LYS B N   1 
ATOM   2860 C  CA  . LYS B 2 95  ? 10.848  5.079   64.249 1.00 18.78  ? 95   LYS B CA  1 
ATOM   2861 C  C   . LYS B 2 95  ? 11.677  6.272   63.790 1.00 20.76  ? 95   LYS B C   1 
ATOM   2862 O  O   . LYS B 2 95  ? 11.737  7.269   64.499 1.00 18.57  ? 95   LYS B O   1 
ATOM   2863 C  CB  . LYS B 2 95  ? 11.765  4.009   64.851 1.00 17.91  ? 95   LYS B CB  1 
ATOM   2864 C  CG  . LYS B 2 95  ? 11.033  3.000   65.726 1.00 25.78  ? 95   LYS B CG  1 
ATOM   2865 C  CD  . LYS B 2 95  ? 10.191  3.697   66.790 1.00 32.67  ? 95   LYS B CD  1 
ATOM   2866 C  CE  . LYS B 2 95  ? 9.087   2.788   67.305 1.00 40.53  ? 95   LYS B CE  1 
ATOM   2867 N  NZ  . LYS B 2 95  ? 8.147   3.502   68.213 1.00 51.53  ? 95   LYS B NZ  1 
ATOM   2868 N  N   . LEU B 2 96  ? 12.313  6.221   62.622 1.00 15.52  ? 96   LEU B N   1 
ATOM   2869 C  CA  . LEU B 2 96  ? 13.252  7.252   62.200 1.00 15.83  ? 96   LEU B CA  1 
ATOM   2870 C  C   . LEU B 2 96  ? 12.623  8.332   61.324 1.00 17.80  ? 96   LEU B C   1 
ATOM   2871 O  O   . LEU B 2 96  ? 13.169  9.426   61.158 1.00 16.89  ? 96   LEU B O   1 
ATOM   2872 C  CB  . LEU B 2 96  ? 14.421  6.576   61.455 1.00 20.30  ? 96   LEU B CB  1 
ATOM   2873 C  CG  . LEU B 2 96  ? 15.150  5.492   62.268 1.00 16.76  ? 96   LEU B CG  1 
ATOM   2874 C  CD1 . LEU B 2 96  ? 16.178  4.755   61.425 1.00 15.45  ? 96   LEU B CD1 1 
ATOM   2875 C  CD2 . LEU B 2 96  ? 15.798  6.127   63.492 1.00 20.22  ? 96   LEU B CD2 1 
ATOM   2876 N  N   . HIS B 2 97  ? 11.447  8.090   60.773 1.00 15.72  ? 97   HIS B N   1 
ATOM   2877 C  CA  . HIS B 2 97  ? 10.729  9.048   59.939 1.00 20.54  ? 97   HIS B CA  1 
ATOM   2878 C  C   . HIS B 2 97  ? 11.566  9.615   58.799 1.00 16.62  ? 97   HIS B C   1 
ATOM   2879 O  O   . HIS B 2 97  ? 11.581  10.823  58.557 1.00 14.33  ? 97   HIS B O   1 
ATOM   2880 C  CB  . HIS B 2 97  ? 10.178  10.206  60.786 1.00 24.63  ? 97   HIS B CB  1 
ATOM   2881 C  CG  . HIS B 2 97  ? 9.562   9.668   62.042 1.00 19.94  ? 97   HIS B CG  1 
ATOM   2882 N  ND1 . HIS B 2 97  ? 8.414   8.906   62.046 1.00 19.91  ? 97   HIS B ND1 1 
ATOM   2883 C  CD2 . HIS B 2 97  ? 9.971   9.767   63.326 1.00 23.05  ? 97   HIS B CD2 1 
ATOM   2884 C  CE1 . HIS B 2 97  ? 8.123   8.560   63.282 1.00 20.92  ? 97   HIS B CE1 1 
ATOM   2885 N  NE2 . HIS B 2 97  ? 9.053   9.074   64.069 1.00 25.38  ? 97   HIS B NE2 1 
ATOM   2886 N  N   . VAL B 2 98  ? 12.242  8.718   58.086 1.00 14.12  ? 98   VAL B N   1 
ATOM   2887 C  CA  . VAL B 2 98  ? 13.063  9.125   56.947 1.00 10.55  ? 98   VAL B CA  1 
ATOM   2888 C  C   . VAL B 2 98  ? 12.274  9.017   55.642 1.00 11.02  ? 98   VAL B C   1 
ATOM   2889 O  O   . VAL B 2 98  ? 11.900  7.921   55.226 1.00 15.21  ? 98   VAL B O   1 
ATOM   2890 C  CB  . VAL B 2 98  ? 14.315  8.230   56.839 1.00 9.33   ? 98   VAL B CB  1 
ATOM   2891 C  CG1 . VAL B 2 98  ? 15.143  8.609   55.616 1.00 14.25  ? 98   VAL B CG1 1 
ATOM   2892 C  CG2 . VAL B 2 98  ? 15.156  8.350   58.100 1.00 19.73  ? 98   VAL B CG2 1 
ATOM   2893 N  N   . ASP B 2 99  ? 12.043  10.148  54.984 1.00 11.88  ? 99   ASP B N   1 
ATOM   2894 C  CA  . ASP B 2 99  ? 11.422  10.153  53.650 1.00 14.38  ? 99   ASP B CA  1 
ATOM   2895 C  C   . ASP B 2 99  ? 12.264  9.337   52.668 1.00 11.18  ? 99   ASP B C   1 
ATOM   2896 O  O   . ASP B 2 99  ? 13.460  9.598   52.558 1.00 16.73  ? 99   ASP B O   1 
ATOM   2897 C  CB  . ASP B 2 99  ? 11.293  11.601  53.197 1.00 14.02  ? 99   ASP B CB  1 
ATOM   2898 C  CG  . ASP B 2 99  ? 10.721  11.858  51.825 1.00 12.50  ? 99   ASP B CG  1 
ATOM   2899 O  OD1 . ASP B 2 99  ? 10.403  10.894  51.110 1.00 14.95  ? 99   ASP B OD1 1 
ATOM   2900 O  OD2 . ASP B 2 99  ? 10.582  13.060  51.477 1.00 15.03  ? 99   ASP B OD2 1 
ATOM   2901 N  N   . PRO B 2 100 ? 11.700  8.321   52.037 1.00 10.08  ? 100  PRO B N   1 
ATOM   2902 C  CA  . PRO B 2 100 ? 12.422  7.414   51.137 1.00 13.36  ? 100  PRO B CA  1 
ATOM   2903 C  C   . PRO B 2 100 ? 13.088  8.104   49.959 1.00 15.70  ? 100  PRO B C   1 
ATOM   2904 O  O   . PRO B 2 100 ? 13.973  7.475   49.360 1.00 12.53  ? 100  PRO B O   1 
ATOM   2905 C  CB  . PRO B 2 100 ? 11.341  6.463   50.606 1.00 18.15  ? 100  PRO B CB  1 
ATOM   2906 C  CG  . PRO B 2 100 ? 10.293  6.503   51.674 1.00 18.97  ? 100  PRO B CG  1 
ATOM   2907 C  CD  . PRO B 2 100 ? 10.291  7.913   52.184 1.00 11.68  ? 100  PRO B CD  1 
ATOM   2908 N  N   . GLU B 2 101 ? 12.678  9.337   49.655 1.00 13.18  ? 101  GLU B N   1 
ATOM   2909 C  CA  . GLU B 2 101 ? 13.428  10.093  48.657 1.00 15.52  ? 101  GLU B CA  1 
ATOM   2910 C  C   . GLU B 2 101 ? 14.904  10.183  49.030 1.00 18.67  ? 101  GLU B C   1 
ATOM   2911 O  O   . GLU B 2 101 ? 15.770  10.193  48.146 1.00 16.81  ? 101  GLU B O   1 
ATOM   2912 C  CB  . GLU B 2 101 ? 12.844  11.491  48.455 1.00 15.81  ? 101  GLU B CB  1 
ATOM   2913 C  CG  . GLU B 2 101 ? 13.497  12.269  47.329 1.00 24.57  ? 101  GLU B CG  1 
ATOM   2914 C  CD  . GLU B 2 101 ? 13.426  11.602  45.973 1.00 34.04  ? 101  GLU B CD  1 
ATOM   2915 O  OE1 . GLU B 2 101 ? 12.456  10.866  45.706 1.00 25.48  ? 101  GLU B OE1 1 
ATOM   2916 O  OE2 . GLU B 2 101 ? 14.355  11.828  45.163 1.00 37.68  ? 101  GLU B OE2 1 
ATOM   2917 N  N   . ASN B 2 102 ? 15.207  10.212  50.329 1.00 15.68  ? 102  ASN B N   1 
ATOM   2918 C  CA  . ASN B 2 102 ? 16.596  10.279  50.771 1.00 15.91  ? 102  ASN B CA  1 
ATOM   2919 C  C   . ASN B 2 102 ? 17.432  9.080   50.344 1.00 14.67  ? 102  ASN B C   1 
ATOM   2920 O  O   . ASN B 2 102 ? 18.645  9.216   50.128 1.00 16.34  ? 102  ASN B O   1 
ATOM   2921 C  CB  . ASN B 2 102 ? 16.649  10.364  52.302 1.00 16.00  ? 102  ASN B CB  1 
ATOM   2922 C  CG  . ASN B 2 102 ? 16.229  11.703  52.850 1.00 20.51  ? 102  ASN B CG  1 
ATOM   2923 O  OD1 . ASN B 2 102 ? 16.938  12.687  52.674 1.00 24.01  ? 102  ASN B OD1 1 
ATOM   2924 N  ND2 . ASN B 2 102 ? 15.088  11.731  53.537 1.00 20.64  ? 102  ASN B ND2 1 
ATOM   2925 N  N   . PHE B 2 103 ? 16.830  7.902   50.234 1.00 13.07  ? 103  PHE B N   1 
ATOM   2926 C  CA  . PHE B 2 103 ? 17.562  6.716   49.801 1.00 13.21  ? 103  PHE B CA  1 
ATOM   2927 C  C   . PHE B 2 103 ? 17.953  6.872   48.328 1.00 12.80  ? 103  PHE B C   1 
ATOM   2928 O  O   . PHE B 2 103 ? 18.999  6.402   47.894 1.00 14.10  ? 103  PHE B O   1 
ATOM   2929 C  CB  . PHE B 2 103 ? 16.751  5.432   49.949 1.00 13.57  ? 103  PHE B CB  1 
ATOM   2930 C  CG  . PHE B 2 103 ? 16.139  5.213   51.325 1.00 13.16  ? 103  PHE B CG  1 
ATOM   2931 C  CD1 . PHE B 2 103 ? 16.893  5.449   52.467 1.00 16.25  ? 103  PHE B CD1 1 
ATOM   2932 C  CD2 . PHE B 2 103 ? 14.834  4.778   51.452 1.00 11.87  ? 103  PHE B CD2 1 
ATOM   2933 C  CE1 . PHE B 2 103 ? 16.349  5.272   53.722 1.00 22.52  ? 103  PHE B CE1 1 
ATOM   2934 C  CE2 . PHE B 2 103 ? 14.278  4.603   52.713 1.00 16.00  ? 103  PHE B CE2 1 
ATOM   2935 C  CZ  . PHE B 2 103 ? 15.035  4.848   53.841 1.00 20.23  ? 103  PHE B CZ  1 
ATOM   2936 N  N   . ARG B 2 104 ? 17.066  7.526   47.575 1.00 17.70  ? 104  ARG B N   1 
ATOM   2937 C  CA  . ARG B 2 104 ? 17.369  7.760   46.168 1.00 20.72  ? 104  ARG B CA  1 
ATOM   2938 C  C   . ARG B 2 104 ? 18.503  8.763   46.012 1.00 16.79  ? 104  ARG B C   1 
ATOM   2939 O  O   . ARG B 2 104 ? 19.362  8.601   45.141 1.00 15.97  ? 104  ARG B O   1 
ATOM   2940 C  CB  . ARG B 2 104 ? 16.109  8.208   45.420 1.00 21.54  ? 104  ARG B CB  1 
ATOM   2941 C  CG  . ARG B 2 104 ? 15.178  7.028   45.143 1.00 37.10  ? 104  ARG B CG  1 
ATOM   2942 C  CD  . ARG B 2 104 ? 13.760  7.305   45.609 1.00 59.04  ? 104  ARG B CD  1 
ATOM   2943 N  NE  . ARG B 2 104 ? 13.077  6.091   46.052 1.00 77.50  ? 104  ARG B NE  1 
ATOM   2944 C  CZ  . ARG B 2 104 ? 11.835  6.055   46.519 1.00 84.15  ? 104  ARG B CZ  1 
ATOM   2945 N  NH1 . ARG B 2 104 ? 11.127  7.174   46.607 1.00 86.33  ? 104  ARG B NH1 1 
ATOM   2946 N  NH2 . ARG B 2 104 ? 11.295  4.904   46.898 1.00 81.69  ? 104  ARG B NH2 1 
ATOM   2947 N  N   . LEU B 2 105 ? 18.517  9.797   46.850 1.00 16.82  ? 105  LEU B N   1 
ATOM   2948 C  CA  . LEU B 2 105 ? 19.572  10.792  46.761 1.00 15.10  ? 105  LEU B CA  1 
ATOM   2949 C  C   . LEU B 2 105 ? 20.908  10.163  47.144 1.00 13.85  ? 105  LEU B C   1 
ATOM   2950 O  O   . LEU B 2 105 ? 21.927  10.411  46.511 1.00 15.57  ? 105  LEU B O   1 
ATOM   2951 C  CB  . LEU B 2 105 ? 19.285  11.992  47.662 1.00 14.94  ? 105  LEU B CB  1 
ATOM   2952 C  CG  . LEU B 2 105 ? 18.106  12.890  47.301 1.00 18.71  ? 105  LEU B CG  1 
ATOM   2953 C  CD1 . LEU B 2 105 ? 17.818  13.865  48.441 1.00 20.18  ? 105  LEU B CD1 1 
ATOM   2954 C  CD2 . LEU B 2 105 ? 18.377  13.656  46.016 1.00 19.32  ? 105  LEU B CD2 1 
ATOM   2955 N  N   . LEU B 2 106 ? 20.899  9.332   48.186 1.00 16.25  ? 106  LEU B N   1 
ATOM   2956 C  CA  . LEU B 2 106 ? 22.130  8.608   48.527 1.00 16.51  ? 106  LEU B CA  1 
ATOM   2957 C  C   . LEU B 2 106 ? 22.599  7.718   47.377 1.00 16.22  ? 106  LEU B C   1 
ATOM   2958 O  O   . LEU B 2 106 ? 23.813  7.644   47.124 1.00 15.73  ? 106  LEU B O   1 
ATOM   2959 C  CB  . LEU B 2 106 ? 21.919  7.790   49.798 1.00 13.71  ? 106  LEU B CB  1 
ATOM   2960 C  CG  . LEU B 2 106 ? 23.116  6.963   50.279 1.00 13.87  ? 106  LEU B CG  1 
ATOM   2961 C  CD1 . LEU B 2 106 ? 24.331  7.870   50.449 1.00 23.67  ? 106  LEU B CD1 1 
ATOM   2962 C  CD2 . LEU B 2 106 ? 22.788  6.232   51.563 1.00 25.76  ? 106  LEU B CD2 1 
ATOM   2963 N  N   . GLY B 2 107 ? 21.677  7.044   46.702 1.00 14.48  ? 107  GLY B N   1 
ATOM   2964 C  CA  . GLY B 2 107 ? 21.985  6.245   45.517 1.00 14.73  ? 107  GLY B CA  1 
ATOM   2965 C  C   . GLY B 2 107 ? 22.733  7.041   44.462 1.00 17.85  ? 107  GLY B C   1 
ATOM   2966 O  O   . GLY B 2 107 ? 23.734  6.582   43.904 1.00 15.00  ? 107  GLY B O   1 
ATOM   2967 N  N   . LYS B 2 108 ? 22.275  8.252   44.150 1.00 17.14  ? 108  LYS B N   1 
ATOM   2968 C  CA  . LYS B 2 108 ? 22.922  9.073   43.129 1.00 15.20  ? 108  LYS B CA  1 
ATOM   2969 C  C   . LYS B 2 108 ? 24.331  9.470   43.563 1.00 16.03  ? 108  LYS B C   1 
ATOM   2970 O  O   . LYS B 2 108 ? 25.259  9.500   42.764 1.00 15.83  ? 108  LYS B O   1 
ATOM   2971 C  CB  . LYS B 2 108 ? 22.132  10.354  42.866 1.00 16.65  ? 108  LYS B CB  1 
ATOM   2972 C  CG  . LYS B 2 108 ? 20.781  10.107  42.195 1.00 25.05  ? 108  LYS B CG  1 
ATOM   2973 C  CD  . LYS B 2 108 ? 19.962  11.396  42.265 1.00 27.33  ? 108  LYS B CD  1 
ATOM   2974 C  CE  . LYS B 2 108 ? 20.844  12.587  41.928 1.00 32.52  ? 108  LYS B CE  1 
ATOM   2975 N  NZ  . LYS B 2 108 ? 20.071  13.659  41.237 1.00 63.88  ? 108  LYS B NZ  1 
ATOM   2976 N  N   . VAL B 2 109 ? 24.458  9.822   44.840 1.00 13.95  ? 109  VAL B N   1 
ATOM   2977 C  CA  . VAL B 2 109 ? 25.748  10.267  45.366 1.00 11.99  ? 109  VAL B CA  1 
ATOM   2978 C  C   . VAL B 2 109 ? 26.738  9.111   45.452 1.00 16.10  ? 109  VAL B C   1 
ATOM   2979 O  O   . VAL B 2 109 ? 27.929  9.295   45.195 1.00 19.51  ? 109  VAL B O   1 
ATOM   2980 C  CB  . VAL B 2 109 ? 25.594  10.897  46.769 1.00 16.89  ? 109  VAL B CB  1 
ATOM   2981 C  CG1 . VAL B 2 109 ? 26.966  10.976  47.425 1.00 20.76  ? 109  VAL B CG1 1 
ATOM   2982 C  CG2 . VAL B 2 109 ? 24.965  12.277  46.663 1.00 13.33  ? 109  VAL B CG2 1 
ATOM   2983 N  N   . LEU B 2 110 ? 26.250  7.922   45.794 1.00 11.87  ? 110  LEU B N   1 
ATOM   2984 C  CA  . LEU B 2 110 ? 27.122  6.749   45.777 1.00 13.87  ? 110  LEU B CA  1 
ATOM   2985 C  C   . LEU B 2 110 ? 27.649  6.477   44.376 1.00 18.70  ? 110  LEU B C   1 
ATOM   2986 O  O   . LEU B 2 110 ? 28.842  6.193   44.200 1.00 17.24  ? 110  LEU B O   1 
ATOM   2987 C  CB  . LEU B 2 110 ? 26.399  5.523   46.327 1.00 14.43  ? 110  LEU B CB  1 
ATOM   2988 C  CG  . LEU B 2 110 ? 27.187  4.218   46.419 1.00 17.96  ? 110  LEU B CG  1 
ATOM   2989 C  CD1 . LEU B 2 110 ? 28.521  4.440   47.131 1.00 16.35  ? 110  LEU B CD1 1 
ATOM   2990 C  CD2 . LEU B 2 110 ? 26.383  3.139   47.127 1.00 25.43  ? 110  LEU B CD2 1 
ATOM   2991 N  N   . VAL B 2 111 ? 26.800  6.559   43.344 1.00 16.05  ? 111  VAL B N   1 
ATOM   2992 C  CA  . VAL B 2 111 ? 27.302  6.293   41.987 1.00 16.55  ? 111  VAL B CA  1 
ATOM   2993 C  C   . VAL B 2 111 ? 28.388  7.300   41.627 1.00 15.48  ? 111  VAL B C   1 
ATOM   2994 O  O   . VAL B 2 111 ? 29.415  6.960   41.017 1.00 14.94  ? 111  VAL B O   1 
ATOM   2995 C  CB  . VAL B 2 111 ? 26.165  6.330   40.948 1.00 12.94  ? 111  VAL B CB  1 
ATOM   2996 C  CG1 . VAL B 2 111 ? 26.686  6.223   39.533 1.00 15.34  ? 111  VAL B CG1 1 
ATOM   2997 C  CG2 . VAL B 2 111 ? 25.165  5.207   41.209 1.00 17.07  ? 111  VAL B CG2 1 
ATOM   2998 N  N   . CYS B 2 112 ? 28.178  8.565   41.986 1.00 14.34  ? 112  CYS B N   1 
ATOM   2999 C  CA  . CYS B 2 112 ? 29.207  9.572   41.718 1.00 13.67  ? 112  CYS B CA  1 
ATOM   3000 C  C   . CYS B 2 112 ? 30.515  9.249   42.425 1.00 17.72  ? 112  CYS B C   1 
ATOM   3001 O  O   . CYS B 2 112 ? 31.590  9.403   41.847 1.00 16.24  ? 112  CYS B O   1 
ATOM   3002 C  CB  . CYS B 2 112 ? 28.735  10.967  42.134 1.00 18.28  ? 112  CYS B CB  1 
ATOM   3003 S  SG  . CYS B 2 112 ? 27.457  11.608  41.008 1.00 20.25  ? 112  CYS B SG  1 
ATOM   3004 N  N   . VAL B 2 113 ? 30.410  8.828   43.681 1.00 15.14  ? 113  VAL B N   1 
ATOM   3005 C  CA  . VAL B 2 113 ? 31.582  8.461   44.466 1.00 17.44  ? 113  VAL B CA  1 
ATOM   3006 C  C   . VAL B 2 113 ? 32.310  7.276   43.854 1.00 19.00  ? 113  VAL B C   1 
ATOM   3007 O  O   . VAL B 2 113 ? 33.543  7.321   43.764 1.00 17.40  ? 113  VAL B O   1 
ATOM   3008 C  CB  . VAL B 2 113 ? 31.193  8.147   45.927 1.00 16.99  ? 113  VAL B CB  1 
ATOM   3009 C  CG1 . VAL B 2 113 ? 32.295  7.381   46.632 1.00 19.26  ? 113  VAL B CG1 1 
ATOM   3010 C  CG2 . VAL B 2 113 ? 30.871  9.456   46.640 1.00 14.91  ? 113  VAL B CG2 1 
ATOM   3011 N  N   . LEU B 2 114 ? 31.574  6.251   43.418 1.00 12.70  ? 114  LEU B N   1 
ATOM   3012 C  CA  . LEU B 2 114 ? 32.240  5.140   42.749 1.00 13.14  ? 114  LEU B CA  1 
ATOM   3013 C  C   . LEU B 2 114 ? 32.961  5.587   41.484 1.00 16.82  ? 114  LEU B C   1 
ATOM   3014 O  O   . LEU B 2 114 ? 34.081  5.141   41.225 1.00 17.30  ? 114  LEU B O   1 
ATOM   3015 C  CB  . LEU B 2 114 ? 31.236  4.018   42.445 1.00 11.20  ? 114  LEU B CB  1 
ATOM   3016 C  CG  . LEU B 2 114 ? 30.689  3.346   43.713 1.00 14.21  ? 114  LEU B CG  1 
ATOM   3017 C  CD1 . LEU B 2 114 ? 29.588  2.356   43.371 1.00 21.55  ? 114  LEU B CD1 1 
ATOM   3018 C  CD2 . LEU B 2 114 ? 31.819  2.648   44.456 1.00 18.75  ? 114  LEU B CD2 1 
ATOM   3019 N  N   . ALA B 2 115 ? 32.359  6.488   40.706 1.00 14.11  ? 115  ALA B N   1 
ATOM   3020 C  CA  . ALA B 2 115 ? 32.997  6.960   39.481 1.00 15.18  ? 115  ALA B CA  1 
ATOM   3021 C  C   . ALA B 2 115 ? 34.266  7.739   39.833 1.00 21.31  ? 115  ALA B C   1 
ATOM   3022 O  O   . ALA B 2 115 ? 35.311  7.633   39.186 1.00 17.62  ? 115  ALA B O   1 
ATOM   3023 C  CB  . ALA B 2 115 ? 32.042  7.812   38.662 1.00 14.47  ? 115  ALA B CB  1 
ATOM   3024 N  N   . HIS B 2 116 ? 34.181  8.533   40.892 1.00 14.66  ? 116  HIS B N   1 
ATOM   3025 C  CA  . HIS B 2 116 ? 35.344  9.321   41.309 1.00 19.21  ? 116  HIS B CA  1 
ATOM   3026 C  C   . HIS B 2 116 ? 36.467  8.419   41.799 1.00 19.40  ? 116  HIS B C   1 
ATOM   3027 O  O   . HIS B 2 116 ? 37.646  8.619   41.461 1.00 19.15  ? 116  HIS B O   1 
ATOM   3028 C  CB  . HIS B 2 116 ? 34.928  10.337  42.383 1.00 17.39  ? 116  HIS B CB  1 
ATOM   3029 C  CG  . HIS B 2 116 ? 36.011  11.317  42.728 1.00 23.06  ? 116  HIS B CG  1 
ATOM   3030 N  ND1 . HIS B 2 116 ? 36.333  11.639  44.028 1.00 28.72  ? 116  HIS B ND1 1 
ATOM   3031 C  CD2 . HIS B 2 116 ? 36.854  12.039  41.955 1.00 23.24  ? 116  HIS B CD2 1 
ATOM   3032 C  CE1 . HIS B 2 116 ? 37.317  12.518  44.042 1.00 24.14  ? 116  HIS B CE1 1 
ATOM   3033 N  NE2 . HIS B 2 116 ? 37.656  12.778  42.793 1.00 20.01  ? 116  HIS B NE2 1 
ATOM   3034 N  N   . HIS B 2 117 ? 36.116  7.406   42.588 1.00 14.03  ? 117  HIS B N   1 
ATOM   3035 C  CA  . HIS B 2 117 ? 37.086  6.450   43.096 1.00 20.42  ? 117  HIS B CA  1 
ATOM   3036 C  C   . HIS B 2 117 ? 37.724  5.602   42.006 1.00 24.80  ? 117  HIS B C   1 
ATOM   3037 O  O   . HIS B 2 117 ? 38.934  5.363   42.062 1.00 22.46  ? 117  HIS B O   1 
ATOM   3038 C  CB  . HIS B 2 117 ? 36.445  5.498   44.128 1.00 22.98  ? 117  HIS B CB  1 
ATOM   3039 C  CG  . HIS B 2 117 ? 36.997  5.730   45.503 1.00 49.26  ? 117  HIS B CG  1 
ATOM   3040 N  ND1 . HIS B 2 117 ? 36.775  6.902   46.196 1.00 58.62  ? 117  HIS B ND1 1 
ATOM   3041 C  CD2 . HIS B 2 117 ? 37.765  4.960   46.304 1.00 59.54  ? 117  HIS B CD2 1 
ATOM   3042 C  CE1 . HIS B 2 117 ? 37.376  6.840   47.370 1.00 67.20  ? 117  HIS B CE1 1 
ATOM   3043 N  NE2 . HIS B 2 117 ? 37.985  5.670   47.461 1.00 69.78  ? 117  HIS B NE2 1 
ATOM   3044 N  N   . PHE B 2 118 ? 36.941  5.115   41.036 1.00 18.07  ? 118  PHE B N   1 
ATOM   3045 C  CA  . PHE B 2 118 ? 37.479  4.117   40.119 1.00 14.11  ? 118  PHE B CA  1 
ATOM   3046 C  C   . PHE B 2 118 ? 37.780  4.644   38.721 1.00 14.72  ? 118  PHE B C   1 
ATOM   3047 O  O   . PHE B 2 118 ? 38.330  3.882   37.916 1.00 17.94  ? 118  PHE B O   1 
ATOM   3048 C  CB  . PHE B 2 118 ? 36.510  2.936   40.023 1.00 17.42  ? 118  PHE B CB  1 
ATOM   3049 C  CG  . PHE B 2 118 ? 36.478  2.137   41.317 1.00 24.58  ? 118  PHE B CG  1 
ATOM   3050 C  CD1 . PHE B 2 118 ? 37.569  1.365   41.684 1.00 28.36  ? 118  PHE B CD1 1 
ATOM   3051 C  CD2 . PHE B 2 118 ? 35.368  2.175   42.141 1.00 26.29  ? 118  PHE B CD2 1 
ATOM   3052 C  CE1 . PHE B 2 118 ? 37.552  0.640   42.856 1.00 31.73  ? 118  PHE B CE1 1 
ATOM   3053 C  CE2 . PHE B 2 118 ? 35.345  1.446   43.314 1.00 23.98  ? 118  PHE B CE2 1 
ATOM   3054 C  CZ  . PHE B 2 118 ? 36.438  0.678   43.672 1.00 27.64  ? 118  PHE B CZ  1 
ATOM   3055 N  N   . GLY B 2 119 ? 37.458  5.896   38.446 1.00 17.02  ? 119  GLY B N   1 
ATOM   3056 C  CA  . GLY B 2 119 ? 37.716  6.522   37.159 1.00 19.04  ? 119  GLY B CA  1 
ATOM   3057 C  C   . GLY B 2 119 ? 37.315  5.639   35.993 1.00 18.88  ? 119  GLY B C   1 
ATOM   3058 O  O   . GLY B 2 119 ? 36.211  5.090   35.967 1.00 20.36  ? 119  GLY B O   1 
ATOM   3059 N  N   . LYS B 2 120 ? 38.210  5.465   35.019 1.00 21.12  ? 120  LYS B N   1 
ATOM   3060 C  CA  . LYS B 2 120 ? 37.828  4.780   33.784 1.00 20.29  ? 120  LYS B CA  1 
ATOM   3061 C  C   . LYS B 2 120 ? 37.307  3.375   34.049 1.00 19.60  ? 120  LYS B C   1 
ATOM   3062 O  O   . LYS B 2 120 ? 36.600  2.837   33.198 1.00 19.25  ? 120  LYS B O   1 
ATOM   3063 C  CB  . LYS B 2 120 ? 39.005  4.709   32.801 1.00 23.08  ? 120  LYS B CB  1 
ATOM   3064 C  CG  . LYS B 2 120 ? 39.900  3.507   33.063 1.00 28.76  ? 120  LYS B CG  1 
ATOM   3065 C  CD  . LYS B 2 120 ? 41.227  3.629   32.334 1.00 34.66  ? 120  LYS B CD  1 
ATOM   3066 C  CE  . LYS B 2 120 ? 41.990  2.308   32.397 1.00 38.97  ? 120  LYS B CE  1 
ATOM   3067 N  NZ  . LYS B 2 120 ? 43.349  2.444   31.794 1.00 70.84  ? 120  LYS B NZ  1 
ATOM   3068 N  N   . GLU B 2 121 ? 37.659  2.772   35.184 1.00 18.63  ? 121  GLU B N   1 
ATOM   3069 C  CA  . GLU B 2 121 ? 37.169  1.429   35.497 1.00 19.36  ? 121  GLU B CA  1 
ATOM   3070 C  C   . GLU B 2 121 ? 35.654  1.394   35.678 1.00 18.04  ? 121  GLU B C   1 
ATOM   3071 O  O   . GLU B 2 121 ? 35.024  0.331   35.588 1.00 17.56  ? 121  GLU B O   1 
ATOM   3072 C  CB  . GLU B 2 121 ? 37.851  0.914   36.767 1.00 26.73  ? 121  GLU B CB  1 
ATOM   3073 C  CG  . GLU B 2 121 ? 37.507  -0.526  37.093 1.00 34.25  ? 121  GLU B CG  1 
ATOM   3074 C  CD  . GLU B 2 121 ? 38.422  -1.128  38.141 1.00 39.04  ? 121  GLU B CD  1 
ATOM   3075 O  OE1 . GLU B 2 121 ? 39.549  -0.620  38.324 1.00 35.94  ? 121  GLU B OE1 1 
ATOM   3076 O  OE2 . GLU B 2 121 ? 37.998  -2.119  38.771 1.00 60.93  ? 121  GLU B OE2 1 
ATOM   3077 N  N   . PHE B 2 122 ? 35.084  2.564   35.931 1.00 16.52  ? 122  PHE B N   1 
ATOM   3078 C  CA  . PHE B 2 122 ? 33.641  2.689   36.152 1.00 21.27  ? 122  PHE B CA  1 
ATOM   3079 C  C   . PHE B 2 122 ? 32.980  2.956   34.805 1.00 16.55  ? 122  PHE B C   1 
ATOM   3080 O  O   . PHE B 2 122 ? 32.594  4.081   34.483 1.00 17.10  ? 122  PHE B O   1 
ATOM   3081 C  CB  . PHE B 2 122 ? 33.325  3.773   37.182 1.00 16.65  ? 122  PHE B CB  1 
ATOM   3082 C  CG  . PHE B 2 122 ? 31.918  3.678   37.764 1.00 13.25  ? 122  PHE B CG  1 
ATOM   3083 C  CD1 . PHE B 2 122 ? 31.587  2.644   38.623 1.00 20.91  ? 122  PHE B CD1 1 
ATOM   3084 C  CD2 . PHE B 2 122 ? 30.953  4.603   37.422 1.00 13.36  ? 122  PHE B CD2 1 
ATOM   3085 C  CE1 . PHE B 2 122 ? 30.310  2.541   39.147 1.00 19.80  ? 122  PHE B CE1 1 
ATOM   3086 C  CE2 . PHE B 2 122 ? 29.676  4.519   37.954 1.00 16.37  ? 122  PHE B CE2 1 
ATOM   3087 C  CZ  . PHE B 2 122 ? 29.362  3.478   38.802 1.00 17.06  ? 122  PHE B CZ  1 
ATOM   3088 N  N   . THR B 2 123 ? 32.898  1.895   34.005 1.00 14.20  ? 123  THR B N   1 
ATOM   3089 C  CA  . THR B 2 123 ? 32.480  2.080   32.606 1.00 19.25  ? 123  THR B CA  1 
ATOM   3090 C  C   . THR B 2 123 ? 30.971  2.231   32.473 1.00 22.77  ? 123  THR B C   1 
ATOM   3091 O  O   . THR B 2 123 ? 30.267  1.959   33.448 1.00 15.33  ? 123  THR B O   1 
ATOM   3092 C  CB  . THR B 2 123 ? 32.928  0.873   31.754 1.00 19.30  ? 123  THR B CB  1 
ATOM   3093 O  OG1 . THR B 2 123 ? 32.287  -0.300  32.250 1.00 21.93  ? 123  THR B OG1 1 
ATOM   3094 C  CG2 . THR B 2 123 ? 34.428  0.654   31.901 1.00 24.72  ? 123  THR B CG2 1 
ATOM   3095 N  N   . PRO B 2 124 ? 30.447  2.658   31.329 1.00 20.53  ? 124  PRO B N   1 
ATOM   3096 C  CA  . PRO B 2 124 ? 28.990  2.806   31.179 1.00 15.33  ? 124  PRO B CA  1 
ATOM   3097 C  C   . PRO B 2 124 ? 28.232  1.522   31.457 1.00 18.10  ? 124  PRO B C   1 
ATOM   3098 O  O   . PRO B 2 124 ? 27.187  1.610   32.122 1.00 18.14  ? 124  PRO B O   1 
ATOM   3099 C  CB  . PRO B 2 124 ? 28.817  3.276   29.730 1.00 13.54  ? 124  PRO B CB  1 
ATOM   3100 C  CG  . PRO B 2 124 ? 30.112  4.012   29.491 1.00 19.90  ? 124  PRO B CG  1 
ATOM   3101 C  CD  . PRO B 2 124 ? 31.150  3.100   30.102 1.00 17.92  ? 124  PRO B CD  1 
ATOM   3102 N  N   . PRO B 2 125 ? 28.627  0.322   31.067 1.00 22.71  ? 125  PRO B N   1 
ATOM   3103 C  CA  . PRO B 2 125 ? 27.838  -0.849  31.492 1.00 19.91  ? 125  PRO B CA  1 
ATOM   3104 C  C   . PRO B 2 125 ? 27.950  -1.127  32.986 1.00 19.29  ? 125  PRO B C   1 
ATOM   3105 O  O   . PRO B 2 125 ? 27.013  -1.592  33.636 1.00 18.48  ? 125  PRO B O   1 
ATOM   3106 C  CB  . PRO B 2 125 ? 28.447  -2.011  30.699 1.00 23.10  ? 125  PRO B CB  1 
ATOM   3107 C  CG  . PRO B 2 125 ? 29.278  -1.376  29.635 1.00 25.69  ? 125  PRO B CG  1 
ATOM   3108 C  CD  . PRO B 2 125 ? 29.756  -0.065  30.210 1.00 27.93  ? 125  PRO B CD  1 
ATOM   3109 N  N   . VAL B 2 126 ? 29.113  -0.864  33.580 1.00 16.66  ? 126  VAL B N   1 
ATOM   3110 C  CA  . VAL B 2 126 ? 29.233  -1.061  35.026 1.00 22.61  ? 126  VAL B CA  1 
ATOM   3111 C  C   . VAL B 2 126 ? 28.348  -0.088  35.797 1.00 23.63  ? 126  VAL B C   1 
ATOM   3112 O  O   . VAL B 2 126 ? 27.712  -0.419  36.798 1.00 16.79  ? 126  VAL B O   1 
ATOM   3113 C  CB  . VAL B 2 126 ? 30.706  -0.909  35.446 1.00 17.60  ? 126  VAL B CB  1 
ATOM   3114 C  CG1 . VAL B 2 126 ? 30.831  -0.765  36.955 1.00 28.42  ? 126  VAL B CG1 1 
ATOM   3115 C  CG2 . VAL B 2 126 ? 31.485  -2.125  34.945 1.00 19.30  ? 126  VAL B CG2 1 
ATOM   3116 N  N   . GLN B 2 127 ? 28.279  1.161   35.342 1.00 14.62  ? 127  GLN B N   1 
ATOM   3117 C  CA  . GLN B 2 127 ? 27.373  2.121   35.966 1.00 17.54  ? 127  GLN B CA  1 
ATOM   3118 C  C   . GLN B 2 127 ? 25.923  1.658   35.838 1.00 17.50  ? 127  GLN B C   1 
ATOM   3119 O  O   . GLN B 2 127 ? 25.145  1.720   36.791 1.00 16.64  ? 127  GLN B O   1 
ATOM   3120 C  CB  . GLN B 2 127 ? 27.526  3.511   35.337 1.00 18.29  ? 127  GLN B CB  1 
ATOM   3121 C  CG  . GLN B 2 127 ? 26.406  4.455   35.764 1.00 17.12  ? 127  GLN B CG  1 
ATOM   3122 C  CD  . GLN B 2 127 ? 26.424  5.781   35.030 1.00 18.51  ? 127  GLN B CD  1 
ATOM   3123 O  OE1 . GLN B 2 127 ? 27.325  6.088   34.241 1.00 18.63  ? 127  GLN B OE1 1 
ATOM   3124 N  NE2 . GLN B 2 127 ? 25.406  6.589   35.319 1.00 19.22  ? 127  GLN B NE2 1 
ATOM   3125 N  N   . ALA B 2 128 ? 25.544  1.197   34.651 1.00 15.56  ? 128  ALA B N   1 
ATOM   3126 C  CA  . ALA B 2 128 ? 24.170  0.745   34.447 1.00 18.96  ? 128  ALA B CA  1 
ATOM   3127 C  C   . ALA B 2 128 ? 23.797  -0.371  35.412 1.00 19.92  ? 128  ALA B C   1 
ATOM   3128 O  O   . ALA B 2 128 ? 22.687  -0.439  35.946 1.00 21.91  ? 128  ALA B O   1 
ATOM   3129 C  CB  . ALA B 2 128 ? 24.007  0.281   33.001 1.00 24.88  ? 128  ALA B CB  1 
ATOM   3130 N  N   . ALA B 2 129 ? 24.730  -1.294  35.643 1.00 16.92  ? 129  ALA B N   1 
ATOM   3131 C  CA  . ALA B 2 129 ? 24.452  -2.331  36.640 1.00 19.00  ? 129  ALA B CA  1 
ATOM   3132 C  C   . ALA B 2 129 ? 24.300  -1.767  38.041 1.00 16.57  ? 129  ALA B C   1 
ATOM   3133 O  O   . ALA B 2 129 ? 23.399  -2.178  38.791 1.00 16.90  ? 129  ALA B O   1 
ATOM   3134 C  CB  . ALA B 2 129 ? 25.554  -3.382  36.601 1.00 18.74  ? 129  ALA B CB  1 
ATOM   3135 N  N   . TYR B 2 130 ? 25.177  -0.849  38.449 1.00 14.35  ? 130  TYR B N   1 
ATOM   3136 C  CA  . TYR B 2 130 ? 25.039  -0.221  39.767 1.00 15.25  ? 130  TYR B CA  1 
ATOM   3137 C  C   . TYR B 2 130 ? 23.789  0.639   39.882 1.00 15.25  ? 130  TYR B C   1 
ATOM   3138 O  O   . TYR B 2 130 ? 23.193  0.752   40.963 1.00 17.97  ? 130  TYR B O   1 
ATOM   3139 C  CB  . TYR B 2 130 ? 26.298  0.607   40.072 1.00 13.96  ? 130  TYR B CB  1 
ATOM   3140 C  CG  . TYR B 2 130 ? 27.309  -0.215  40.856 1.00 13.79  ? 130  TYR B CG  1 
ATOM   3141 C  CD1 . TYR B 2 130 ? 27.235  -0.268  42.241 1.00 21.45  ? 130  TYR B CD1 1 
ATOM   3142 C  CD2 . TYR B 2 130 ? 28.303  -0.934  40.208 1.00 17.55  ? 130  TYR B CD2 1 
ATOM   3143 C  CE1 . TYR B 2 130 ? 28.141  -1.021  42.964 1.00 22.82  ? 130  TYR B CE1 1 
ATOM   3144 C  CE2 . TYR B 2 130 ? 29.223  -1.683  40.919 1.00 17.64  ? 130  TYR B CE2 1 
ATOM   3145 C  CZ  . TYR B 2 130 ? 29.128  -1.716  42.297 1.00 22.93  ? 130  TYR B CZ  1 
ATOM   3146 O  OH  . TYR B 2 130 ? 30.034  -2.454  43.035 1.00 22.09  ? 130  TYR B OH  1 
ATOM   3147 N  N   . GLN B 2 131 ? 23.341  1.251   38.782 1.00 15.27  ? 131  GLN B N   1 
ATOM   3148 C  CA  . GLN B 2 131 ? 22.087  2.001   38.836 1.00 19.17  ? 131  GLN B CA  1 
ATOM   3149 C  C   . GLN B 2 131 ? 20.938  1.065   39.196 1.00 16.24  ? 131  GLN B C   1 
ATOM   3150 O  O   . GLN B 2 131 ? 20.056  1.424   39.963 1.00 16.31  ? 131  GLN B O   1 
ATOM   3151 C  CB  . GLN B 2 131 ? 21.796  2.708   37.513 1.00 22.73  ? 131  GLN B CB  1 
ATOM   3152 C  CG  . GLN B 2 131 ? 22.798  3.786   37.142 1.00 18.28  ? 131  GLN B CG  1 
ATOM   3153 C  CD  . GLN B 2 131 ? 22.667  5.074   37.918 1.00 18.40  ? 131  GLN B CD  1 
ATOM   3154 O  OE1 . GLN B 2 131 ? 23.491  5.983   37.738 1.00 19.47  ? 131  GLN B OE1 1 
ATOM   3155 N  NE2 . GLN B 2 131 ? 21.639  5.212   38.751 1.00 18.95  ? 131  GLN B NE2 1 
ATOM   3156 N  N   . LYS B 2 132 ? 20.932  -0.145  38.632 1.00 15.40  ? 132  LYS B N   1 
ATOM   3157 C  CA  . LYS B 2 132 ? 19.843  -1.061  38.965 1.00 12.92  ? 132  LYS B CA  1 
ATOM   3158 C  C   . LYS B 2 132 ? 19.880  -1.414  40.450 1.00 17.27  ? 132  LYS B C   1 
ATOM   3159 O  O   . LYS B 2 132 ? 18.845  -1.448  41.104 1.00 18.73  ? 132  LYS B O   1 
ATOM   3160 C  CB  . LYS B 2 132 ? 19.914  -2.338  38.136 1.00 17.41  ? 132  LYS B CB  1 
ATOM   3161 C  CG  . LYS B 2 132 ? 19.563  -2.129  36.667 1.00 18.35  ? 132  LYS B CG  1 
ATOM   3162 C  CD  . LYS B 2 132 ? 19.541  -3.483  35.963 1.00 24.04  ? 132  LYS B CD  1 
ATOM   3163 C  CE  . LYS B 2 132 ? 19.545  -3.270  34.452 1.00 37.56  ? 132  LYS B CE  1 
ATOM   3164 N  NZ  . LYS B 2 132 ? 19.213  -4.533  33.736 1.00 34.22  ? 132  LYS B NZ  1 
ATOM   3165 N  N   . VAL B 2 133 ? 21.077  -1.693  40.962 1.00 18.08  ? 133  VAL B N   1 
ATOM   3166 C  CA  . VAL B 2 133 ? 21.230  -2.057  42.364 1.00 17.80  ? 133  VAL B CA  1 
ATOM   3167 C  C   . VAL B 2 133 ? 20.832  -0.933  43.310 1.00 17.29  ? 133  VAL B C   1 
ATOM   3168 O  O   . VAL B 2 133 ? 20.105  -1.212  44.277 1.00 18.81  ? 133  VAL B O   1 
ATOM   3169 C  CB  . VAL B 2 133 ? 22.684  -2.486  42.667 1.00 19.62  ? 133  VAL B CB  1 
ATOM   3170 C  CG1 . VAL B 2 133 ? 22.875  -2.715  44.157 1.00 21.04  ? 133  VAL B CG1 1 
ATOM   3171 C  CG2 . VAL B 2 133 ? 23.006  -3.746  41.885 1.00 16.64  ? 133  VAL B CG2 1 
ATOM   3172 N  N   . VAL B 2 134 ? 21.281  0.309   43.068 1.00 15.37  ? 134  VAL B N   1 
ATOM   3173 C  CA  . VAL B 2 134 ? 20.903  1.356   44.029 1.00 17.55  ? 134  VAL B CA  1 
ATOM   3174 C  C   . VAL B 2 134 ? 19.403  1.597   43.950 1.00 20.51  ? 134  VAL B C   1 
ATOM   3175 O  O   . VAL B 2 134 ? 18.745  1.882   44.960 1.00 16.00  ? 134  VAL B O   1 
ATOM   3176 C  CB  . VAL B 2 134 ? 21.667  2.673   43.848 1.00 17.19  ? 134  VAL B CB  1 
ATOM   3177 C  CG1 . VAL B 2 134 ? 23.158  2.466   44.131 1.00 18.59  ? 134  VAL B CG1 1 
ATOM   3178 C  CG2 . VAL B 2 134 ? 21.485  3.239   42.448 1.00 24.32  ? 134  VAL B CG2 1 
ATOM   3179 N  N   . ALA B 2 135 ? 18.820  1.473   42.756 1.00 16.46  ? 135  ALA B N   1 
ATOM   3180 C  CA  . ALA B 2 135 ? 17.356  1.585   42.688 1.00 18.91  ? 135  ALA B CA  1 
ATOM   3181 C  C   . ALA B 2 135 ? 16.644  0.475   43.463 1.00 16.50  ? 135  ALA B C   1 
ATOM   3182 O  O   . ALA B 2 135 ? 15.665  0.747   44.177 1.00 20.96  ? 135  ALA B O   1 
ATOM   3183 C  CB  . ALA B 2 135 ? 16.868  1.595   41.247 1.00 23.11  ? 135  ALA B CB  1 
ATOM   3184 N  N   . GLY B 2 136 ? 17.118  -0.747  43.301 1.00 14.22  ? 136  GLY B N   1 
ATOM   3185 C  CA  . GLY B 2 136 ? 16.668  -1.946  43.971 1.00 17.44  ? 136  GLY B CA  1 
ATOM   3186 C  C   . GLY B 2 136 ? 16.725  -1.811  45.483 1.00 19.40  ? 136  GLY B C   1 
ATOM   3187 O  O   . GLY B 2 136 ? 15.754  -2.143  46.159 1.00 16.61  ? 136  GLY B O   1 
ATOM   3188 N  N   . VAL B 2 137 ? 17.846  -1.341  46.021 1.00 17.48  ? 137  VAL B N   1 
ATOM   3189 C  CA  . VAL B 2 137 ? 17.969  -1.122  47.461 1.00 19.76  ? 137  VAL B CA  1 
ATOM   3190 C  C   . VAL B 2 137 ? 17.030  -0.030  47.941 1.00 15.65  ? 137  VAL B C   1 
ATOM   3191 O  O   . VAL B 2 137 ? 16.340  -0.167  48.952 1.00 19.41  ? 137  VAL B O   1 
ATOM   3192 C  CB  . VAL B 2 137 ? 19.427  -0.772  47.804 1.00 15.97  ? 137  VAL B CB  1 
ATOM   3193 C  CG1 . VAL B 2 137 ? 19.593  -0.384  49.270 1.00 18.79  ? 137  VAL B CG1 1 
ATOM   3194 C  CG2 . VAL B 2 137 ? 20.314  -1.967  47.471 1.00 22.75  ? 137  VAL B CG2 1 
ATOM   3195 N  N   . ALA B 2 138 ? 16.962  1.094   47.219 1.00 16.03  ? 138  ALA B N   1 
ATOM   3196 C  CA  . ALA B 2 138 ? 16.037  2.149   47.620 1.00 19.43  ? 138  ALA B CA  1 
ATOM   3197 C  C   . ALA B 2 138 ? 14.602  1.640   47.642 1.00 16.59  ? 138  ALA B C   1 
ATOM   3198 O  O   . ALA B 2 138 ? 13.845  1.922   48.576 1.00 20.00  ? 138  ALA B O   1 
ATOM   3199 C  CB  . ALA B 2 138 ? 16.176  3.348   46.689 1.00 21.28  ? 138  ALA B CB  1 
ATOM   3200 N  N   . ASN B 2 139 ? 14.217  0.879   46.617 1.00 12.25  ? 139  ASN B N   1 
ATOM   3201 C  CA  . ASN B 2 139 ? 12.856  0.344   46.577 1.00 13.92  ? 139  ASN B CA  1 
ATOM   3202 C  C   . ASN B 2 139 ? 12.632  -0.615  47.743 1.00 24.98  ? 139  ASN B C   1 
ATOM   3203 O  O   . ASN B 2 139 ? 11.567  -0.564  48.367 1.00 22.95  ? 139  ASN B O   1 
ATOM   3204 C  CB  . ASN B 2 139 ? 12.554  -0.348  45.246 1.00 19.20  ? 139  ASN B CB  1 
ATOM   3205 C  CG  . ASN B 2 139 ? 12.354  0.628   44.102 1.00 30.47  ? 139  ASN B CG  1 
ATOM   3206 O  OD1 . ASN B 2 139 ? 11.925  1.766   44.314 1.00 47.41  ? 139  ASN B OD1 1 
ATOM   3207 N  ND2 . ASN B 2 139 ? 12.655  0.182   42.889 1.00 36.69  ? 139  ASN B ND2 1 
ATOM   3208 N  N   . ALA B 2 140 ? 13.617  -1.457  48.056 1.00 15.98  ? 140  ALA B N   1 
ATOM   3209 C  CA  . ALA B 2 140 ? 13.476  -2.371  49.190 1.00 21.72  ? 140  ALA B CA  1 
ATOM   3210 C  C   . ALA B 2 140 ? 13.330  -1.640  50.520 1.00 20.03  ? 140  ALA B C   1 
ATOM   3211 O  O   . ALA B 2 140 ? 12.537  -2.024  51.385 1.00 20.85  ? 140  ALA B O   1 
ATOM   3212 C  CB  . ALA B 2 140 ? 14.662  -3.324  49.265 1.00 18.42  ? 140  ALA B CB  1 
ATOM   3213 N  N   . LEU B 2 141 ? 14.111  -0.581  50.722 1.00 12.49  ? 141  LEU B N   1 
ATOM   3214 C  CA  . LEU B 2 141 ? 14.029  0.172   51.964 1.00 15.44  ? 141  LEU B CA  1 
ATOM   3215 C  C   . LEU B 2 141 ? 12.717  0.943   52.064 1.00 21.98  ? 141  LEU B C   1 
ATOM   3216 O  O   . LEU B 2 141 ? 12.302  1.279   53.178 1.00 18.61  ? 141  LEU B O   1 
ATOM   3217 C  CB  . LEU B 2 141 ? 15.204  1.142   52.102 1.00 14.61  ? 141  LEU B CB  1 
ATOM   3218 C  CG  . LEU B 2 141 ? 16.509  0.544   52.638 1.00 26.87  ? 141  LEU B CG  1 
ATOM   3219 C  CD1 . LEU B 2 141 ? 17.685  1.469   52.340 1.00 27.18  ? 141  LEU B CD1 1 
ATOM   3220 C  CD2 . LEU B 2 141 ? 16.393  0.258   54.127 1.00 26.53  ? 141  LEU B CD2 1 
ATOM   3221 N  N   . ALA B 2 142 ? 12.072  1.249   50.938 1.00 17.29  ? 142  ALA B N   1 
ATOM   3222 C  CA  . ALA B 2 142 ? 10.818  2.004   51.023 1.00 17.78  ? 142  ALA B CA  1 
ATOM   3223 C  C   . ALA B 2 142 ? 9.599   1.087   51.087 1.00 19.81  ? 142  ALA B C   1 
ATOM   3224 O  O   . ALA B 2 142 ? 8.461   1.560   51.240 1.00 18.27  ? 142  ALA B O   1 
ATOM   3225 C  CB  . ALA B 2 142 ? 10.670  2.942   49.832 1.00 22.64  ? 142  ALA B CB  1 
ATOM   3226 N  N   . HIS B 2 143 ? 9.818   -0.214  50.967 1.00 16.79  ? 143  HIS B N   1 
ATOM   3227 C  CA  . HIS B 2 143 ? 8.735   -1.156  50.726 1.00 18.99  ? 143  HIS B CA  1 
ATOM   3228 C  C   . HIS B 2 143 ? 7.735   -1.282  51.870 1.00 24.62  ? 143  HIS B C   1 
ATOM   3229 O  O   . HIS B 2 143 ? 6.555   -1.536  51.605 1.00 25.64  ? 143  HIS B O   1 
ATOM   3230 C  CB  . HIS B 2 143 ? 9.317   -2.544  50.416 1.00 28.62  ? 143  HIS B CB  1 
ATOM   3231 C  CG  . HIS B 2 143 ? 8.276   -3.576  50.111 1.00 41.47  ? 143  HIS B CG  1 
ATOM   3232 N  ND1 . HIS B 2 143 ? 8.172   -4.764  50.801 1.00 41.04  ? 143  HIS B ND1 1 
ATOM   3233 C  CD2 . HIS B 2 143 ? 7.292   -3.601  49.181 1.00 42.89  ? 143  HIS B CD2 1 
ATOM   3234 C  CE1 . HIS B 2 143 ? 7.169   -5.476  50.315 1.00 43.98  ? 143  HIS B CE1 1 
ATOM   3235 N  NE2 . HIS B 2 143 ? 6.616   -4.792  49.327 1.00 44.24  ? 143  HIS B NE2 1 
ATOM   3236 N  N   . LYS B 2 144 ? 8.147   -1.136  53.120 1.00 24.69  ? 144  LYS B N   1 
ATOM   3237 C  CA  . LYS B 2 144 ? 7.252   -1.338  54.256 1.00 24.18  ? 144  LYS B CA  1 
ATOM   3238 C  C   . LYS B 2 144 ? 6.656   -0.033  54.768 1.00 19.33  ? 144  LYS B C   1 
ATOM   3239 O  O   . LYS B 2 144 ? 6.004   -0.015  55.818 1.00 21.37  ? 144  LYS B O   1 
ATOM   3240 C  CB  . LYS B 2 144 ? 7.990   -2.056  55.393 1.00 24.50  ? 144  LYS B CB  1 
ATOM   3241 C  CG  . LYS B 2 144 ? 8.356   -3.498  55.069 1.00 24.34  ? 144  LYS B CG  1 
ATOM   3242 C  CD  . LYS B 2 144 ? 7.302   -4.141  54.186 1.00 37.85  ? 144  LYS B CD  1 
ATOM   3243 C  CE  . LYS B 2 144 ? 6.002   -4.334  54.956 1.00 53.84  ? 144  LYS B CE  1 
ATOM   3244 N  NZ  . LYS B 2 144 ? 6.240   -4.331  56.430 1.00 60.67  ? 144  LYS B NZ  1 
ATOM   3245 N  N   . TYR B 2 145 ? 6.867   1.060   54.051 1.00 14.75  ? 145  TYR B N   1 
ATOM   3246 C  CA  . TYR B 2 145 ? 6.312   2.349   54.446 1.00 12.90  ? 145  TYR B CA  1 
ATOM   3247 C  C   . TYR B 2 145 ? 4.791   2.299   54.337 1.00 23.99  ? 145  TYR B C   1 
ATOM   3248 O  O   . TYR B 2 145 ? 4.198   1.717   53.434 1.00 26.25  ? 145  TYR B O   1 
ATOM   3249 C  CB  . TYR B 2 145 ? 6.864   3.516   53.622 1.00 13.79  ? 145  TYR B CB  1 
ATOM   3250 C  CG  . TYR B 2 145 ? 8.189   4.044   54.138 1.00 12.58  ? 145  TYR B CG  1 
ATOM   3251 C  CD1 . TYR B 2 145 ? 9.309   3.214   54.140 1.00 20.84  ? 145  TYR B CD1 1 
ATOM   3252 C  CD2 . TYR B 2 145 ? 8.322   5.330   54.634 1.00 14.42  ? 145  TYR B CD2 1 
ATOM   3253 C  CE1 . TYR B 2 145 ? 10.531  3.665   54.615 1.00 13.94  ? 145  TYR B CE1 1 
ATOM   3254 C  CE2 . TYR B 2 145 ? 9.543   5.794   55.107 1.00 14.92  ? 145  TYR B CE2 1 
ATOM   3255 C  CZ  . TYR B 2 145 ? 10.635  4.952   55.086 1.00 14.27  ? 145  TYR B CZ  1 
ATOM   3256 O  OH  . TYR B 2 145 ? 11.851  5.415   55.568 1.00 16.49  ? 145  TYR B OH  1 
ATOM   3257 N  N   . HIS B 2 146 ? 4.137   2.931   55.296 1.00 20.12  ? 146  HIS B N   1 
ATOM   3258 C  CA  . HIS B 2 146 ? 2.678   2.913   55.341 1.00 21.94  ? 146  HIS B CA  1 
ATOM   3259 C  C   . HIS B 2 146 ? 2.199   4.172   56.048 1.00 21.00  ? 146  HIS B C   1 
ATOM   3260 O  O   . HIS B 2 146 ? 3.039   4.918   56.567 1.00 23.68  ? 146  HIS B O   1 
ATOM   3261 C  CB  . HIS B 2 146 ? 2.246   1.638   56.086 1.00 21.17  ? 146  HIS B CB  1 
ATOM   3262 C  CG  . HIS B 2 146 ? 2.755   1.711   57.498 1.00 27.72  ? 146  HIS B CG  1 
ATOM   3263 N  ND1 . HIS B 2 146 ? 2.026   2.268   58.521 1.00 34.33  ? 146  HIS B ND1 1 
ATOM   3264 C  CD2 . HIS B 2 146 ? 3.938   1.338   58.033 1.00 28.94  ? 146  HIS B CD2 1 
ATOM   3265 C  CE1 . HIS B 2 146 ? 2.729   2.211   59.640 1.00 39.81  ? 146  HIS B CE1 1 
ATOM   3266 N  NE2 . HIS B 2 146 ? 3.893   1.648   59.368 1.00 28.79  ? 146  HIS B NE2 1 
ATOM   3267 O  OXT . HIS B 2 146 ? 0.972   4.397   56.071 1.00 27.91  ? 146  HIS B OXT 1 
ATOM   3268 N  N   . MET C 2 1   ? -1.631  -6.795  41.031 1.00 42.18  ? 1    MET D N   1 
ATOM   3269 C  CA  . MET C 2 1   ? -1.226  -5.988  42.177 1.00 40.49  ? 1    MET D CA  1 
ATOM   3270 C  C   . MET C 2 1   ? -2.179  -6.194  43.347 1.00 38.40  ? 1    MET D C   1 
ATOM   3271 O  O   . MET C 2 1   ? -3.346  -6.538  43.153 1.00 40.96  ? 1    MET D O   1 
ATOM   3272 C  CB  . MET C 2 1   ? -1.157  -4.507  41.796 1.00 39.42  ? 1    MET D CB  1 
ATOM   3273 C  CG  . MET C 2 1   ? -2.408  -3.707  42.119 1.00 47.58  ? 1    MET D CG  1 
ATOM   3274 S  SD  . MET C 2 1   ? -2.251  -1.953  41.699 1.00 46.70  ? 1    MET D SD  1 
ATOM   3275 C  CE  . MET C 2 1   ? -1.651  -1.306  43.255 1.00 34.53  ? 1    MET D CE  1 
ATOM   3276 N  N   . HIS C 2 2   ? -1.688  -5.974  44.564 1.00 44.73  ? 2    HIS D N   1 
ATOM   3277 C  CA  . HIS C 2 2   ? -2.531  -6.142  45.742 1.00 50.82  ? 2    HIS D CA  1 
ATOM   3278 C  C   . HIS C 2 2   ? -3.262  -4.853  46.105 1.00 51.26  ? 2    HIS D C   1 
ATOM   3279 O  O   . HIS C 2 2   ? -2.674  -3.776  46.179 1.00 49.40  ? 2    HIS D O   1 
ATOM   3280 C  CB  . HIS C 2 2   ? -1.705  -6.626  46.935 1.00 63.60  ? 2    HIS D CB  1 
ATOM   3281 C  CG  . HIS C 2 2   ? -2.482  -7.434  47.927 1.00 75.37  ? 2    HIS D CG  1 
ATOM   3282 N  ND1 . HIS C 2 2   ? -2.539  -7.117  49.268 1.00 82.62  ? 2    HIS D ND1 1 
ATOM   3283 C  CD2 . HIS C 2 2   ? -3.231  -8.552  47.780 1.00 77.86  ? 2    HIS D CD2 1 
ATOM   3284 C  CE1 . HIS C 2 2   ? -3.289  -7.999  49.903 1.00 83.73  ? 2    HIS D CE1 1 
ATOM   3285 N  NE2 . HIS C 2 2   ? -3.722  -8.884  49.020 1.00 82.15  ? 2    HIS D NE2 1 
ATOM   3286 N  N   . LEU C 2 3   ? -4.563  -4.989  46.327 1.00 43.85  ? 3    LEU D N   1 
ATOM   3287 C  CA  . LEU C 2 3   ? -5.406  -3.930  46.860 1.00 37.78  ? 3    LEU D CA  1 
ATOM   3288 C  C   . LEU C 2 3   ? -6.144  -4.474  48.082 1.00 41.10  ? 3    LEU D C   1 
ATOM   3289 O  O   . LEU C 2 3   ? -6.574  -5.635  48.077 1.00 33.23  ? 3    LEU D O   1 
ATOM   3290 C  CB  . LEU C 2 3   ? -6.424  -3.443  45.836 1.00 33.21  ? 3    LEU D CB  1 
ATOM   3291 C  CG  . LEU C 2 3   ? -6.031  -2.365  44.830 1.00 37.00  ? 3    LEU D CG  1 
ATOM   3292 C  CD1 . LEU C 2 3   ? -7.242  -1.942  44.003 1.00 29.45  ? 3    LEU D CD1 1 
ATOM   3293 C  CD2 . LEU C 2 3   ? -5.417  -1.149  45.505 1.00 44.04  ? 3    LEU D CD2 1 
ATOM   3294 N  N   . THR C 2 4   ? -6.314  -3.668  49.125 1.00 37.10  ? 4    THR D N   1 
ATOM   3295 C  CA  . THR C 2 4   ? -7.143  -4.164  50.229 1.00 34.30  ? 4    THR D CA  1 
ATOM   3296 C  C   . THR C 2 4   ? -8.563  -4.407  49.737 1.00 32.82  ? 4    THR D C   1 
ATOM   3297 O  O   . THR C 2 4   ? -8.956  -3.902  48.680 1.00 27.35  ? 4    THR D O   1 
ATOM   3298 C  CB  . THR C 2 4   ? -7.172  -3.185  51.413 1.00 33.87  ? 4    THR D CB  1 
ATOM   3299 O  OG1 . THR C 2 4   ? -7.916  -2.016  51.041 1.00 29.96  ? 4    THR D OG1 1 
ATOM   3300 C  CG2 . THR C 2 4   ? -5.772  -2.727  51.782 1.00 33.32  ? 4    THR D CG2 1 
ATOM   3301 N  N   . PRO C 2 5   ? -9.356  -5.170  50.476 1.00 33.96  ? 5    PRO D N   1 
ATOM   3302 C  CA  . PRO C 2 5   ? -10.756 -5.376  50.084 1.00 36.62  ? 5    PRO D CA  1 
ATOM   3303 C  C   . PRO C 2 5   ? -11.501 -4.058  49.916 1.00 30.50  ? 5    PRO D C   1 
ATOM   3304 O  O   . PRO C 2 5   ? -12.323 -3.894  49.023 1.00 30.24  ? 5    PRO D O   1 
ATOM   3305 C  CB  . PRO C 2 5   ? -11.335 -6.156  51.269 1.00 37.83  ? 5    PRO D CB  1 
ATOM   3306 C  CG  . PRO C 2 5   ? -10.152 -6.877  51.832 1.00 39.08  ? 5    PRO D CG  1 
ATOM   3307 C  CD  . PRO C 2 5   ? -9.000  -5.918  51.693 1.00 35.26  ? 5    PRO D CD  1 
ATOM   3308 N  N   . GLU C 2 6   ? -11.196 -3.127  50.808 1.00 37.00  ? 6    GLU D N   1 
ATOM   3309 C  CA  . GLU C 2 6   ? -11.789 -1.803  50.862 1.00 32.49  ? 6    GLU D CA  1 
ATOM   3310 C  C   . GLU C 2 6   ? -11.449 -1.000  49.607 1.00 20.03  ? 6    GLU D C   1 
ATOM   3311 O  O   . GLU C 2 6   ? -12.309 -0.363  49.000 1.00 22.84  ? 6    GLU D O   1 
ATOM   3312 C  CB  . GLU C 2 6   ? -11.299 -1.093  52.127 1.00 43.00  ? 6    GLU D CB  1 
ATOM   3313 C  CG  . GLU C 2 6   ? -11.891 -1.609  53.423 1.00 51.80  ? 6    GLU D CG  1 
ATOM   3314 C  CD  . GLU C 2 6   ? -11.194 -2.804  54.034 1.00 53.17  ? 6    GLU D CD  1 
ATOM   3315 O  OE1 . GLU C 2 6   ? -11.675 -3.298  55.083 1.00 46.87  ? 6    GLU D OE1 1 
ATOM   3316 O  OE2 . GLU C 2 6   ? -10.171 -3.275  53.492 1.00 46.87  ? 6    GLU D OE2 1 
ATOM   3317 N  N   . GLU C 2 7   ? -10.182 -1.041  49.216 1.00 26.61  ? 7    GLU D N   1 
ATOM   3318 C  CA  . GLU C 2 7   ? -9.718  -0.329  48.029 1.00 29.00  ? 7    GLU D CA  1 
ATOM   3319 C  C   . GLU C 2 7   ? -10.314 -0.921  46.759 1.00 33.84  ? 7    GLU D C   1 
ATOM   3320 O  O   . GLU C 2 7   ? -10.752 -0.232  45.835 1.00 26.50  ? 7    GLU D O   1 
ATOM   3321 C  CB  . GLU C 2 7   ? -8.193  -0.389  47.945 1.00 23.80  ? 7    GLU D CB  1 
ATOM   3322 C  CG  . GLU C 2 7   ? -7.420  0.295   49.055 1.00 23.59  ? 7    GLU D CG  1 
ATOM   3323 C  CD  . GLU C 2 7   ? -5.957  -0.093  49.074 1.00 22.06  ? 7    GLU D CD  1 
ATOM   3324 O  OE1 . GLU C 2 7   ? -5.588  -1.199  48.624 1.00 29.65  ? 7    GLU D OE1 1 
ATOM   3325 O  OE2 . GLU C 2 7   ? -5.133  0.708   49.568 1.00 28.86  ? 7    GLU D OE2 1 
ATOM   3326 N  N   . LYS C 2 8   ? -10.325 -2.255  46.666 1.00 21.85  ? 8    LYS D N   1 
ATOM   3327 C  CA  . LYS C 2 8   ? -10.847 -2.826  45.417 1.00 30.65  ? 8    LYS D CA  1 
ATOM   3328 C  C   . LYS C 2 8   ? -12.318 -2.477  45.249 1.00 24.07  ? 8    LYS D C   1 
ATOM   3329 O  O   . LYS C 2 8   ? -12.793 -2.110  44.174 1.00 27.38  ? 8    LYS D O   1 
ATOM   3330 C  CB  . LYS C 2 8   ? -10.674 -4.345  45.395 1.00 39.48  ? 8    LYS D CB  1 
ATOM   3331 C  CG  . LYS C 2 8   ? -11.121 -4.983  44.087 1.00 43.37  ? 8    LYS D CG  1 
ATOM   3332 C  CD  . LYS C 2 8   ? -10.282 -6.212  43.766 1.00 51.82  ? 8    LYS D CD  1 
ATOM   3333 C  CE  . LYS C 2 8   ? -8.853  -6.060  44.273 1.00 58.31  ? 8    LYS D CE  1 
ATOM   3334 N  NZ  . LYS C 2 8   ? -8.200  -7.390  44.471 1.00 56.29  ? 8    LYS D NZ  1 
ATOM   3335 N  N   . SER C 2 9   ? -13.060 -2.584  46.350 1.00 19.69  ? 9    SER D N   1 
ATOM   3336 C  CA  . SER C 2 9   ? -14.485 -2.269  46.284 1.00 24.69  ? 9    SER D CA  1 
ATOM   3337 C  C   . SER C 2 9   ? -14.755 -0.843  45.824 1.00 30.97  ? 9    SER D C   1 
ATOM   3338 O  O   . SER C 2 9   ? -15.678 -0.576  45.052 1.00 33.58  ? 9    SER D O   1 
ATOM   3339 C  CB  . SER C 2 9   ? -15.121 -2.514  47.660 1.00 35.47  ? 9    SER D CB  1 
ATOM   3340 O  OG  . SER C 2 9   ? -16.458 -2.047  47.674 1.00 55.22  ? 9    SER D OG  1 
ATOM   3341 N  N   . ALA C 2 10  ? -13.954 0.097   46.316 1.00 28.36  ? 10   ALA D N   1 
ATOM   3342 C  CA  . ALA C 2 10  ? -14.123 1.503   45.975 1.00 32.27  ? 10   ALA D CA  1 
ATOM   3343 C  C   . ALA C 2 10  ? -13.829 1.757   44.499 1.00 25.38  ? 10   ALA D C   1 
ATOM   3344 O  O   . ALA C 2 10  ? -14.538 2.498   43.816 1.00 22.75  ? 10   ALA D O   1 
ATOM   3345 C  CB  . ALA C 2 10  ? -13.223 2.357   46.852 1.00 27.65  ? 10   ALA D CB  1 
ATOM   3346 N  N   . VAL C 2 11  ? -12.775 1.118   44.004 1.00 23.13  ? 11   VAL D N   1 
ATOM   3347 C  CA  . VAL C 2 11  ? -12.419 1.297   42.599 1.00 24.11  ? 11   VAL D CA  1 
ATOM   3348 C  C   . VAL C 2 11  ? -13.527 0.780   41.690 1.00 19.20  ? 11   VAL D C   1 
ATOM   3349 O  O   . VAL C 2 11  ? -13.939 1.470   40.760 1.00 23.63  ? 11   VAL D O   1 
ATOM   3350 C  CB  . VAL C 2 11  ? -11.104 0.575   42.245 1.00 21.69  ? 11   VAL D CB  1 
ATOM   3351 C  CG1 . VAL C 2 11  ? -10.919 0.524   40.737 1.00 26.39  ? 11   VAL D CG1 1 
ATOM   3352 C  CG2 . VAL C 2 11  ? -9.940  1.295   42.913 1.00 19.19  ? 11   VAL D CG2 1 
ATOM   3353 N  N   . THR C 2 12  ? -13.972 -0.447  41.947 1.00 19.59  ? 12   THR D N   1 
ATOM   3354 C  CA  . THR C 2 12  ? -14.921 -1.078  41.030 1.00 26.03  ? 12   THR D CA  1 
ATOM   3355 C  C   . THR C 2 12  ? -16.278 -0.396  41.125 1.00 27.28  ? 12   THR D C   1 
ATOM   3356 O  O   . THR C 2 12  ? -16.976 -0.207  40.121 1.00 23.11  ? 12   THR D O   1 
ATOM   3357 C  CB  . THR C 2 12  ? -15.051 -2.589  41.302 1.00 39.38  ? 12   THR D CB  1 
ATOM   3358 O  OG1 . THR C 2 12  ? -15.284 -2.822  42.697 1.00 42.87  ? 12   THR D OG1 1 
ATOM   3359 C  CG2 . THR C 2 12  ? -13.754 -3.311  40.964 1.00 33.69  ? 12   THR D CG2 1 
ATOM   3360 N  N   . ALA C 2 13  ? -16.642 0.017   42.337 1.00 25.70  ? 13   ALA D N   1 
ATOM   3361 C  CA  . ALA C 2 13  ? -17.891 0.742   42.548 1.00 23.23  ? 13   ALA D CA  1 
ATOM   3362 C  C   . ALA C 2 13  ? -17.977 1.998   41.693 1.00 29.26  ? 13   ALA D C   1 
ATOM   3363 O  O   . ALA C 2 13  ? -18.976 2.279   41.028 1.00 23.94  ? 13   ALA D O   1 
ATOM   3364 C  CB  . ALA C 2 13  ? -18.028 1.114   44.020 1.00 39.89  ? 13   ALA D CB  1 
ATOM   3365 N  N   . LEU C 2 14  ? -16.924 2.816   41.695 1.00 24.28  ? 14   LEU D N   1 
ATOM   3366 C  CA  . LEU C 2 14  ? -16.987 4.081   40.959 1.00 22.40  ? 14   LEU D CA  1 
ATOM   3367 C  C   . LEU C 2 14  ? -16.916 3.850   39.457 1.00 19.16  ? 14   LEU D C   1 
ATOM   3368 O  O   . LEU C 2 14  ? -17.520 4.571   38.662 1.00 18.14  ? 14   LEU D O   1 
ATOM   3369 C  CB  . LEU C 2 14  ? -15.851 5.009   41.407 1.00 17.82  ? 14   LEU D CB  1 
ATOM   3370 C  CG  . LEU C 2 14  ? -15.893 6.431   40.852 1.00 21.30  ? 14   LEU D CG  1 
ATOM   3371 C  CD1 . LEU C 2 14  ? -17.017 7.231   41.494 1.00 25.11  ? 14   LEU D CD1 1 
ATOM   3372 C  CD2 . LEU C 2 14  ? -14.554 7.122   41.053 1.00 32.96  ? 14   LEU D CD2 1 
ATOM   3373 N  N   . TRP C 2 15  ? -16.146 2.836   39.060 1.00 16.81  ? 15   TRP D N   1 
ATOM   3374 C  CA  . TRP C 2 15  ? -15.907 2.632   37.638 1.00 21.98  ? 15   TRP D CA  1 
ATOM   3375 C  C   . TRP C 2 15  ? -17.188 2.189   36.929 1.00 23.26  ? 15   TRP D C   1 
ATOM   3376 O  O   . TRP C 2 15  ? -17.339 2.447   35.738 1.00 19.53  ? 15   TRP D O   1 
ATOM   3377 C  CB  . TRP C 2 15  ? -14.800 1.602   37.381 1.00 20.82  ? 15   TRP D CB  1 
ATOM   3378 C  CG  . TRP C 2 15  ? -14.249 1.746   35.989 1.00 21.55  ? 15   TRP D CG  1 
ATOM   3379 C  CD1 . TRP C 2 15  ? -14.417 0.921   34.916 1.00 23.30  ? 15   TRP D CD1 1 
ATOM   3380 C  CD2 . TRP C 2 15  ? -13.422 2.825   35.542 1.00 18.90  ? 15   TRP D CD2 1 
ATOM   3381 N  NE1 . TRP C 2 15  ? -13.738 1.423   33.830 1.00 22.77  ? 15   TRP D NE1 1 
ATOM   3382 C  CE2 . TRP C 2 15  ? -13.121 2.589   34.186 1.00 24.39  ? 15   TRP D CE2 1 
ATOM   3383 C  CE3 . TRP C 2 15  ? -12.907 3.964   36.174 1.00 20.72  ? 15   TRP D CE3 1 
ATOM   3384 C  CZ2 . TRP C 2 15  ? -12.327 3.458   33.443 1.00 24.81  ? 15   TRP D CZ2 1 
ATOM   3385 C  CZ3 . TRP C 2 15  ? -12.119 4.820   35.428 1.00 26.74  ? 15   TRP D CZ3 1 
ATOM   3386 C  CH2 . TRP C 2 15  ? -11.839 4.562   34.080 1.00 25.10  ? 15   TRP D CH2 1 
ATOM   3387 N  N   . GLY C 2 16  ? -18.102 1.564   37.661 1.00 19.96  ? 16   GLY D N   1 
ATOM   3388 C  CA  . GLY C 2 16  ? -19.383 1.169   37.085 1.00 24.91  ? 16   GLY D CA  1 
ATOM   3389 C  C   . GLY C 2 16  ? -20.230 2.337   36.632 1.00 23.80  ? 16   GLY D C   1 
ATOM   3390 O  O   . GLY C 2 16  ? -21.172 2.160   35.856 1.00 28.13  ? 16   GLY D O   1 
ATOM   3391 N  N   . LYS C 2 17  ? -19.932 3.534   37.120 1.00 23.39  ? 17   LYS D N   1 
ATOM   3392 C  CA  . LYS C 2 17  ? -20.645 4.760   36.805 1.00 24.26  ? 17   LYS D CA  1 
ATOM   3393 C  C   . LYS C 2 17  ? -19.911 5.579   35.750 1.00 25.13  ? 17   LYS D C   1 
ATOM   3394 O  O   . LYS C 2 17  ? -20.393 6.615   35.281 1.00 26.92  ? 17   LYS D O   1 
ATOM   3395 C  CB  . LYS C 2 17  ? -20.830 5.616   38.068 1.00 31.27  ? 17   LYS D CB  1 
ATOM   3396 C  CG  . LYS C 2 17  ? -21.368 4.868   39.274 1.00 34.43  ? 17   LYS D CG  1 
ATOM   3397 C  CD  . LYS C 2 17  ? -21.139 5.648   40.561 1.00 42.83  ? 17   LYS D CD  1 
ATOM   3398 C  CE  . LYS C 2 17  ? -21.727 7.045   40.464 1.00 41.27  ? 17   LYS D CE  1 
ATOM   3399 N  NZ  . LYS C 2 17  ? -22.352 7.486   41.742 1.00 36.92  ? 17   LYS D NZ  1 
ATOM   3400 N  N   . VAL C 2 18  ? -18.711 5.148   35.367 1.00 30.57  ? 18   VAL D N   1 
ATOM   3401 C  CA  . VAL C 2 18  ? -17.909 5.908   34.407 1.00 31.01  ? 18   VAL D CA  1 
ATOM   3402 C  C   . VAL C 2 18  ? -18.305 5.572   32.968 1.00 32.20  ? 18   VAL D C   1 
ATOM   3403 O  O   . VAL C 2 18  ? -18.263 4.407   32.565 1.00 26.41  ? 18   VAL D O   1 
ATOM   3404 C  CB  . VAL C 2 18  ? -16.403 5.638   34.575 1.00 27.85  ? 18   VAL D CB  1 
ATOM   3405 C  CG1 . VAL C 2 18  ? -15.601 6.318   33.474 1.00 23.30  ? 18   VAL D CG1 1 
ATOM   3406 C  CG2 . VAL C 2 18  ? -15.919 6.097   35.942 1.00 21.86  ? 18   VAL D CG2 1 
ATOM   3407 N  N   . ASN C 2 19  ? -18.686 6.596   32.223 1.00 26.85  ? 19   ASN D N   1 
ATOM   3408 C  CA  . ASN C 2 19  ? -18.832 6.522   30.772 1.00 25.03  ? 19   ASN D CA  1 
ATOM   3409 C  C   . ASN C 2 19  ? -17.454 6.695   30.138 1.00 18.27  ? 19   ASN D C   1 
ATOM   3410 O  O   . ASN C 2 19  ? -16.897 7.793   30.096 1.00 25.68  ? 19   ASN D O   1 
ATOM   3411 C  CB  . ASN C 2 19  ? -19.796 7.589   30.258 1.00 28.31  ? 19   ASN D CB  1 
ATOM   3412 C  CG  . ASN C 2 19  ? -19.948 7.614   28.751 1.00 40.63  ? 19   ASN D CG  1 
ATOM   3413 O  OD1 . ASN C 2 19  ? -19.245 6.931   28.003 1.00 45.62  ? 19   ASN D OD1 1 
ATOM   3414 N  ND2 . ASN C 2 19  ? -20.890 8.422   28.264 1.00 43.52  ? 19   ASN D ND2 1 
ATOM   3415 N  N   . VAL C 2 20  ? -16.882 5.590   29.683 1.00 23.84  ? 20   VAL D N   1 
ATOM   3416 C  CA  . VAL C 2 20  ? -15.491 5.631   29.233 1.00 34.27  ? 20   VAL D CA  1 
ATOM   3417 C  C   . VAL C 2 20  ? -15.313 6.555   28.043 1.00 33.27  ? 20   VAL D C   1 
ATOM   3418 O  O   . VAL C 2 20  ? -14.284 7.218   27.901 1.00 36.22  ? 20   VAL D O   1 
ATOM   3419 C  CB  . VAL C 2 20  ? -14.989 4.217   28.889 1.00 38.15  ? 20   VAL D CB  1 
ATOM   3420 C  CG1 . VAL C 2 20  ? -13.593 4.266   28.298 1.00 52.34  ? 20   VAL D CG1 1 
ATOM   3421 C  CG2 . VAL C 2 20  ? -15.035 3.354   30.144 1.00 37.38  ? 20   VAL D CG2 1 
ATOM   3422 N  N   . ASP C 2 21  ? -16.320 6.616   27.172 1.00 30.27  ? 21   ASP D N   1 
ATOM   3423 C  CA  . ASP C 2 21  ? -16.246 7.571   26.066 1.00 40.89  ? 21   ASP D CA  1 
ATOM   3424 C  C   . ASP C 2 21  ? -16.007 8.989   26.587 1.00 34.55  ? 21   ASP D C   1 
ATOM   3425 O  O   . ASP C 2 21  ? -15.012 9.622   26.236 1.00 30.69  ? 21   ASP D O   1 
ATOM   3426 C  CB  . ASP C 2 21  ? -17.524 7.539   25.231 1.00 46.20  ? 21   ASP D CB  1 
ATOM   3427 C  CG  . ASP C 2 21  ? -17.689 6.279   24.409 1.00 52.43  ? 21   ASP D CG  1 
ATOM   3428 O  OD1 . ASP C 2 21  ? -16.763 5.442   24.394 1.00 61.45  ? 21   ASP D OD1 1 
ATOM   3429 O  OD2 . ASP C 2 21  ? -18.753 6.112   23.774 1.00 65.64  ? 21   ASP D OD2 1 
ATOM   3430 N  N   . GLU C 2 22  ? -16.923 9.473   27.418 1.00 29.66  ? 22   GLU D N   1 
ATOM   3431 C  CA  . GLU C 2 22  ? -16.911 10.854  27.893 1.00 34.28  ? 22   GLU D CA  1 
ATOM   3432 C  C   . GLU C 2 22  ? -15.696 11.129  28.767 1.00 28.23  ? 22   GLU D C   1 
ATOM   3433 O  O   . GLU C 2 22  ? -15.003 12.141  28.619 1.00 28.72  ? 22   GLU D O   1 
ATOM   3434 C  CB  . GLU C 2 22  ? -18.209 11.173  28.637 1.00 37.86  ? 22   GLU D CB  1 
ATOM   3435 C  CG  . GLU C 2 22  ? -18.202 12.454  29.451 1.00 48.56  ? 22   GLU D CG  1 
ATOM   3436 C  CD  . GLU C 2 22  ? -19.411 12.637  30.345 1.00 56.17  ? 22   GLU D CD  1 
ATOM   3437 O  OE1 . GLU C 2 22  ? -19.632 11.819  31.265 1.00 55.05  ? 22   GLU D OE1 1 
ATOM   3438 O  OE2 . GLU C 2 22  ? -20.162 13.620  30.151 1.00 54.23  ? 22   GLU D OE2 1 
ATOM   3439 N  N   . VAL C 2 23  ? -15.393 10.225  29.698 1.00 23.70  ? 23   VAL D N   1 
ATOM   3440 C  CA  . VAL C 2 23  ? -14.216 10.474  30.544 1.00 23.47  ? 23   VAL D CA  1 
ATOM   3441 C  C   . VAL C 2 23  ? -12.926 10.358  29.746 1.00 19.16  ? 23   VAL D C   1 
ATOM   3442 O  O   . VAL C 2 23  ? -11.981 11.136  29.918 1.00 18.72  ? 23   VAL D O   1 
ATOM   3443 C  CB  . VAL C 2 23  ? -14.193 9.505   31.740 1.00 21.68  ? 23   VAL D CB  1 
ATOM   3444 C  CG1 . VAL C 2 23  ? -12.892 9.635   32.510 1.00 24.49  ? 23   VAL D CG1 1 
ATOM   3445 C  CG2 . VAL C 2 23  ? -15.390 9.778   32.646 1.00 28.23  ? 23   VAL D CG2 1 
ATOM   3446 N  N   . GLY C 2 24  ? -12.862 9.382   28.844 1.00 18.60  ? 24   GLY D N   1 
ATOM   3447 C  CA  . GLY C 2 24  ? -11.651 9.180   28.051 1.00 25.10  ? 24   GLY D CA  1 
ATOM   3448 C  C   . GLY C 2 24  ? -11.271 10.403  27.244 1.00 25.25  ? 24   GLY D C   1 
ATOM   3449 O  O   . GLY C 2 24  ? -10.115 10.836  27.200 1.00 20.03  ? 24   GLY D O   1 
ATOM   3450 N  N   . GLY C 2 25  ? -12.248 11.019  26.575 1.00 27.24  ? 25   GLY D N   1 
ATOM   3451 C  CA  . GLY C 2 25  ? -11.962 12.218  25.793 1.00 25.63  ? 25   GLY D CA  1 
ATOM   3452 C  C   . GLY C 2 25  ? -11.620 13.414  26.651 1.00 18.88  ? 25   GLY D C   1 
ATOM   3453 O  O   . GLY C 2 25  ? -10.788 14.258  26.314 1.00 23.42  ? 25   GLY D O   1 
ATOM   3454 N  N   . GLU C 2 26  ? -12.247 13.509  27.824 1.00 14.69  ? 26   GLU D N   1 
ATOM   3455 C  CA  . GLU C 2 26  ? -11.886 14.579  28.743 1.00 11.33  ? 26   GLU D CA  1 
ATOM   3456 C  C   . GLU C 2 26  ? -10.443 14.450  29.227 1.00 15.76  ? 26   GLU D C   1 
ATOM   3457 O  O   . GLU C 2 26  ? -9.703  15.430  29.274 1.00 18.55  ? 26   GLU D O   1 
ATOM   3458 C  CB  . GLU C 2 26  ? -12.838 14.552  29.943 1.00 21.00  ? 26   GLU D CB  1 
ATOM   3459 C  CG  . GLU C 2 26  ? -12.600 15.673  30.936 1.00 27.50  ? 26   GLU D CG  1 
ATOM   3460 C  CD  . GLU C 2 26  ? -13.258 16.961  30.478 1.00 36.72  ? 26   GLU D CD  1 
ATOM   3461 O  OE1 . GLU C 2 26  ? -14.113 16.885  29.567 1.00 41.71  ? 26   GLU D OE1 1 
ATOM   3462 O  OE2 . GLU C 2 26  ? -12.912 18.032  31.012 1.00 33.17  ? 26   GLU D OE2 1 
ATOM   3463 N  N   . ALA C 2 27  ? -10.064 13.238  29.622 1.00 14.32  ? 27   ALA D N   1 
ATOM   3464 C  CA  . ALA C 2 27  ? -8.744  12.974  30.183 1.00 15.18  ? 27   ALA D CA  1 
ATOM   3465 C  C   . ALA C 2 27  ? -7.635  13.231  29.176 1.00 17.61  ? 27   ALA D C   1 
ATOM   3466 O  O   . ALA C 2 27  ? -6.658  13.914  29.486 1.00 16.47  ? 27   ALA D O   1 
ATOM   3467 C  CB  . ALA C 2 27  ? -8.685  11.531  30.675 1.00 19.05  ? 27   ALA D CB  1 
ATOM   3468 N  N   . LEU C 2 28  ? -7.769  12.688  27.964 1.00 15.07  ? 28   LEU D N   1 
ATOM   3469 C  CA  . LEU C 2 28  ? -6.723  12.929  26.969 1.00 11.74  ? 28   LEU D CA  1 
ATOM   3470 C  C   . LEU C 2 28  ? -6.668  14.405  26.591 1.00 14.82  ? 28   LEU D C   1 
ATOM   3471 O  O   . LEU C 2 28  ? -5.592  14.964  26.424 1.00 14.53  ? 28   LEU D O   1 
ATOM   3472 C  CB  . LEU C 2 28  ? -6.945  12.120  25.687 1.00 17.97  ? 28   LEU D CB  1 
ATOM   3473 C  CG  . LEU C 2 28  ? -5.820  12.213  24.649 1.00 23.83  ? 28   LEU D CG  1 
ATOM   3474 C  CD1 . LEU C 2 28  ? -4.514  11.701  25.238 1.00 22.08  ? 28   LEU D CD1 1 
ATOM   3475 C  CD2 . LEU C 2 28  ? -6.172  11.438  23.390 1.00 30.19  ? 28   LEU D CD2 1 
ATOM   3476 N  N   . GLY C 2 29  ? -7.823  15.045  26.426 1.00 19.49  ? 29   GLY D N   1 
ATOM   3477 C  CA  . GLY C 2 29  ? -7.816  16.466  26.090 1.00 17.85  ? 29   GLY D CA  1 
ATOM   3478 C  C   . GLY C 2 29  ? -7.122  17.312  27.142 1.00 19.04  ? 29   GLY D C   1 
ATOM   3479 O  O   . GLY C 2 29  ? -6.320  18.194  26.831 1.00 14.23  ? 29   GLY D O   1 
ATOM   3480 N  N   . ARG C 2 30  ? -7.441  17.081  28.420 1.00 16.58  ? 30   ARG D N   1 
ATOM   3481 C  CA  . ARG C 2 30  ? -6.805  17.851  29.488 1.00 13.05  ? 30   ARG D CA  1 
ATOM   3482 C  C   . ARG C 2 30  ? -5.306  17.586  29.540 1.00 16.80  ? 30   ARG D C   1 
ATOM   3483 O  O   . ARG C 2 30  ? -4.561  18.524  29.804 1.00 16.73  ? 30   ARG D O   1 
ATOM   3484 C  CB  . ARG C 2 30  ? -7.431  17.557  30.849 1.00 14.54  ? 30   ARG D CB  1 
ATOM   3485 C  CG  . ARG C 2 30  ? -8.856  18.085  30.969 1.00 20.46  ? 30   ARG D CG  1 
ATOM   3486 C  CD  . ARG C 2 30  ? -9.356  17.988  32.411 1.00 18.16  ? 30   ARG D CD  1 
ATOM   3487 N  NE  . ARG C 2 30  ? -10.684 18.578  32.500 1.00 22.11  ? 30   ARG D NE  1 
ATOM   3488 C  CZ  . ARG C 2 30  ? -11.062 19.630  33.197 1.00 23.78  ? 30   ARG D CZ  1 
ATOM   3489 N  NH1 . ARG C 2 30  ? -10.198 20.296  33.942 1.00 17.23  ? 30   ARG D NH1 1 
ATOM   3490 N  NH2 . ARG C 2 30  ? -12.329 20.027  33.147 1.00 21.23  ? 30   ARG D NH2 1 
ATOM   3491 N  N   . LEU C 2 31  ? -4.887  16.353  29.279 1.00 12.13  ? 31   LEU D N   1 
ATOM   3492 C  CA  . LEU C 2 31  ? -3.463  16.043  29.184 1.00 13.80  ? 31   LEU D CA  1 
ATOM   3493 C  C   . LEU C 2 31  ? -2.757  16.942  28.173 1.00 18.57  ? 31   LEU D C   1 
ATOM   3494 O  O   . LEU C 2 31  ? -1.702  17.495  28.477 1.00 15.15  ? 31   LEU D O   1 
ATOM   3495 C  CB  . LEU C 2 31  ? -3.260  14.573  28.779 1.00 14.85  ? 31   LEU D CB  1 
ATOM   3496 C  CG  . LEU C 2 31  ? -1.786  14.168  28.667 1.00 18.64  ? 31   LEU D CG  1 
ATOM   3497 C  CD1 . LEU C 2 31  ? -1.148  14.115  30.046 1.00 25.67  ? 31   LEU D CD1 1 
ATOM   3498 C  CD2 . LEU C 2 31  ? -1.636  12.832  27.949 1.00 23.60  ? 31   LEU D CD2 1 
ATOM   3499 N  N   . LEU C 2 32  ? -3.324  17.067  26.979 1.00 14.38  ? 32   LEU D N   1 
ATOM   3500 C  CA  . LEU C 2 32  ? -2.739  17.873  25.909 1.00 13.08  ? 32   LEU D CA  1 
ATOM   3501 C  C   . LEU C 2 32  ? -2.780  19.360  26.229 1.00 13.18  ? 32   LEU D C   1 
ATOM   3502 O  O   . LEU C 2 32  ? -1.935  20.120  25.750 1.00 17.84  ? 32   LEU D O   1 
ATOM   3503 C  CB  . LEU C 2 32  ? -3.456  17.620  24.578 1.00 16.55  ? 32   LEU D CB  1 
ATOM   3504 C  CG  . LEU C 2 32  ? -3.546  16.191  24.052 1.00 26.74  ? 32   LEU D CG  1 
ATOM   3505 C  CD1 . LEU C 2 32  ? -4.248  16.160  22.694 1.00 19.18  ? 32   LEU D CD1 1 
ATOM   3506 C  CD2 . LEU C 2 32  ? -2.176  15.540  23.955 1.00 22.49  ? 32   LEU D CD2 1 
ATOM   3507 N  N   . VAL C 2 33  ? -3.765  19.808  26.996 1.00 15.64  ? 33   VAL D N   1 
ATOM   3508 C  CA  . VAL C 2 33  ? -3.899  21.218  27.357 1.00 11.95  ? 33   VAL D CA  1 
ATOM   3509 C  C   . VAL C 2 33  ? -2.954  21.572  28.509 1.00 20.08  ? 33   VAL D C   1 
ATOM   3510 O  O   . VAL C 2 33  ? -2.295  22.615  28.491 1.00 17.69  ? 33   VAL D O   1 
ATOM   3511 C  CB  . VAL C 2 33  ? -5.331  21.570  27.796 1.00 12.51  ? 33   VAL D CB  1 
ATOM   3512 C  CG1 . VAL C 2 33  ? -5.388  22.976  28.388 1.00 20.11  ? 33   VAL D CG1 1 
ATOM   3513 C  CG2 . VAL C 2 33  ? -6.313  21.432  26.631 1.00 19.06  ? 33   VAL D CG2 1 
ATOM   3514 N  N   . VAL C 2 34  ? -2.908  20.704  29.522 1.00 14.59  ? 34   VAL D N   1 
ATOM   3515 C  CA  . VAL C 2 34  ? -2.172  21.045  30.743 1.00 13.59  ? 34   VAL D CA  1 
ATOM   3516 C  C   . VAL C 2 34  ? -0.677  20.811  30.568 1.00 16.00  ? 34   VAL D C   1 
ATOM   3517 O  O   . VAL C 2 34  ? 0.138   21.572  31.096 1.00 17.79  ? 34   VAL D O   1 
ATOM   3518 C  CB  . VAL C 2 34  ? -2.715  20.267  31.951 1.00 14.94  ? 34   VAL D CB  1 
ATOM   3519 C  CG1 . VAL C 2 34  ? -1.909  20.523  33.212 1.00 20.38  ? 34   VAL D CG1 1 
ATOM   3520 C  CG2 . VAL C 2 34  ? -4.173  20.651  32.175 1.00 16.29  ? 34   VAL D CG2 1 
ATOM   3521 N  N   . TYR C 2 35  ? -0.331  19.753  29.840 1.00 13.08  ? 35   TYR D N   1 
ATOM   3522 C  CA  . TYR C 2 35  ? 1.064   19.393  29.612 1.00 13.89  ? 35   TYR D CA  1 
ATOM   3523 C  C   . TYR C 2 35  ? 1.313   19.353  28.110 1.00 13.70  ? 35   TYR D C   1 
ATOM   3524 O  O   . TYR C 2 35  ? 1.369   18.262  27.540 1.00 17.78  ? 35   TYR D O   1 
ATOM   3525 C  CB  . TYR C 2 35  ? 1.388   18.035  30.256 1.00 15.53  ? 35   TYR D CB  1 
ATOM   3526 C  CG  . TYR C 2 35  ? 0.996   18.030  31.718 1.00 21.38  ? 35   TYR D CG  1 
ATOM   3527 C  CD1 . TYR C 2 35  ? 1.708   18.803  32.622 1.00 19.76  ? 35   TYR D CD1 1 
ATOM   3528 C  CD2 . TYR C 2 35  ? -0.070  17.281  32.192 1.00 20.16  ? 35   TYR D CD2 1 
ATOM   3529 C  CE1 . TYR C 2 35  ? 1.375   18.832  33.965 1.00 17.56  ? 35   TYR D CE1 1 
ATOM   3530 C  CE2 . TYR C 2 35  ? -0.411  17.299  33.534 1.00 24.96  ? 35   TYR D CE2 1 
ATOM   3531 C  CZ  . TYR C 2 35  ? 0.318   18.074  34.413 1.00 18.64  ? 35   TYR D CZ  1 
ATOM   3532 O  OH  . TYR C 2 35  ? -0.018  18.100  35.750 1.00 24.22  ? 35   TYR D OH  1 
ATOM   3533 N  N   . PRO C 2 36  ? 1.429   20.515  27.478 1.00 15.44  ? 36   PRO D N   1 
ATOM   3534 C  CA  . PRO C 2 36  ? 1.361   20.595  26.014 1.00 23.33  ? 36   PRO D CA  1 
ATOM   3535 C  C   . PRO C 2 36  ? 2.466   19.860  25.271 1.00 20.85  ? 36   PRO D C   1 
ATOM   3536 O  O   . PRO C 2 36  ? 2.324   19.606  24.068 1.00 20.07  ? 36   PRO D O   1 
ATOM   3537 C  CB  . PRO C 2 36  ? 1.484   22.096  25.704 1.00 25.35  ? 36   PRO D CB  1 
ATOM   3538 C  CG  . PRO C 2 36  ? 1.381   22.814  26.995 1.00 25.50  ? 36   PRO D CG  1 
ATOM   3539 C  CD  . PRO C 2 36  ? 1.599   21.831  28.105 1.00 21.66  ? 36   PRO D CD  1 
ATOM   3540 N  N   . TRP C 2 37  ? 3.566   19.523  25.933 1.00 18.82  ? 37   TRP D N   1 
ATOM   3541 C  CA  . TRP C 2 37  ? 4.639   18.803  25.257 1.00 18.83  ? 37   TRP D CA  1 
ATOM   3542 C  C   . TRP C 2 37  ? 4.168   17.406  24.874 1.00 22.06  ? 37   TRP D C   1 
ATOM   3543 O  O   . TRP C 2 37  ? 4.753   16.776  23.990 1.00 16.51  ? 37   TRP D O   1 
ATOM   3544 C  CB  . TRP C 2 37  ? 5.919   18.753  26.088 1.00 17.00  ? 37   TRP D CB  1 
ATOM   3545 C  CG  . TRP C 2 37  ? 5.804   18.254  27.488 1.00 15.65  ? 37   TRP D CG  1 
ATOM   3546 C  CD1 . TRP C 2 37  ? 5.989   16.983  27.945 1.00 20.14  ? 37   TRP D CD1 1 
ATOM   3547 C  CD2 . TRP C 2 37  ? 5.473   19.039  28.651 1.00 17.83  ? 37   TRP D CD2 1 
ATOM   3548 N  NE1 . TRP C 2 37  ? 5.792   16.928  29.307 1.00 18.66  ? 37   TRP D NE1 1 
ATOM   3549 C  CE2 . TRP C 2 37  ? 5.475   18.177  29.760 1.00 17.64  ? 37   TRP D CE2 1 
ATOM   3550 C  CE3 . TRP C 2 37  ? 5.174   20.388  28.856 1.00 18.64  ? 37   TRP D CE3 1 
ATOM   3551 C  CZ2 . TRP C 2 37  ? 5.192   18.608  31.060 1.00 22.92  ? 37   TRP D CZ2 1 
ATOM   3552 C  CZ3 . TRP C 2 37  ? 4.893   20.814  30.143 1.00 20.23  ? 37   TRP D CZ3 1 
ATOM   3553 C  CH2 . TRP C 2 37  ? 4.901   19.934  31.228 1.00 18.02  ? 37   TRP D CH2 1 
ATOM   3554 N  N   . THR C 2 38  ? 3.095   16.934  25.514 1.00 19.40  ? 38   THR D N   1 
ATOM   3555 C  CA  . THR C 2 38  ? 2.541   15.632  25.150 1.00 14.85  ? 38   THR D CA  1 
ATOM   3556 C  C   . THR C 2 38  ? 1.937   15.638  23.752 1.00 17.96  ? 38   THR D C   1 
ATOM   3557 O  O   . THR C 2 38  ? 1.650   14.578  23.198 1.00 18.14  ? 38   THR D O   1 
ATOM   3558 C  CB  . THR C 2 38  ? 1.462   15.167  26.150 1.00 17.74  ? 38   THR D CB  1 
ATOM   3559 O  OG1 . THR C 2 38  ? 0.423   16.153  26.242 1.00 18.02  ? 38   THR D OG1 1 
ATOM   3560 C  CG2 . THR C 2 38  ? 2.078   15.029  27.539 1.00 18.80  ? 38   THR D CG2 1 
ATOM   3561 N  N   . GLN C 2 39  ? 1.716   16.821  23.183 1.00 17.59  ? 39   GLN D N   1 
ATOM   3562 C  CA  . GLN C 2 39  ? 1.184   16.924  21.824 1.00 13.70  ? 39   GLN D CA  1 
ATOM   3563 C  C   . GLN C 2 39  ? 2.140   16.387  20.769 1.00 20.64  ? 39   GLN D C   1 
ATOM   3564 O  O   . GLN C 2 39  ? 1.750   16.216  19.612 1.00 20.30  ? 39   GLN D O   1 
ATOM   3565 C  CB  . GLN C 2 39  ? 0.846   18.394  21.534 1.00 15.06  ? 39   GLN D CB  1 
ATOM   3566 C  CG  . GLN C 2 39  ? -0.266  18.921  22.448 1.00 21.28  ? 39   GLN D CG  1 
ATOM   3567 C  CD  . GLN C 2 39  ? -0.508  20.401  22.205 1.00 28.23  ? 39   GLN D CD  1 
ATOM   3568 O  OE1 . GLN C 2 39  ? 0.011   20.952  21.233 1.00 26.94  ? 39   GLN D OE1 1 
ATOM   3569 N  NE2 . GLN C 2 39  ? -1.268  21.054  23.071 1.00 24.86  ? 39   GLN D NE2 1 
ATOM   3570 N  N   . ARG C 2 40  ? 3.388   16.113  21.146 1.00 22.40  ? 40   ARG D N   1 
ATOM   3571 C  CA  . ARG C 2 40  ? 4.408   15.670  20.203 1.00 18.57  ? 40   ARG D CA  1 
ATOM   3572 C  C   . ARG C 2 40  ? 4.080   14.338  19.553 1.00 18.30  ? 40   ARG D C   1 
ATOM   3573 O  O   . ARG C 2 40  ? 4.631   14.029  18.486 1.00 28.29  ? 40   ARG D O   1 
ATOM   3574 C  CB  . ARG C 2 40  ? 5.783   15.582  20.886 1.00 25.13  ? 40   ARG D CB  1 
ATOM   3575 C  CG  . ARG C 2 40  ? 5.950   14.399  21.825 1.00 27.25  ? 40   ARG D CG  1 
ATOM   3576 C  CD  . ARG C 2 40  ? 7.135   14.555  22.767 1.00 22.37  ? 40   ARG D CD  1 
ATOM   3577 N  NE  . ARG C 2 40  ? 8.415   14.662  22.086 1.00 22.38  ? 40   ARG D NE  1 
ATOM   3578 C  CZ  . ARG C 2 40  ? 9.077   13.731  21.422 1.00 30.42  ? 40   ARG D CZ  1 
ATOM   3579 N  NH1 . ARG C 2 40  ? 8.617   12.495  21.287 1.00 25.13  ? 40   ARG D NH1 1 
ATOM   3580 N  NH2 . ARG C 2 40  ? 10.249  14.024  20.860 1.00 26.61  ? 40   ARG D NH2 1 
ATOM   3581 N  N   . PHE C 2 41  ? 3.210   13.537  20.147 1.00 17.97  ? 41   PHE D N   1 
ATOM   3582 C  CA  . PHE C 2 41  ? 2.781   12.267  19.583 1.00 21.10  ? 41   PHE D CA  1 
ATOM   3583 C  C   . PHE C 2 41  ? 1.544   12.348  18.698 1.00 19.25  ? 41   PHE D C   1 
ATOM   3584 O  O   . PHE C 2 41  ? 1.085   11.317  18.188 1.00 21.26  ? 41   PHE D O   1 
ATOM   3585 C  CB  . PHE C 2 41  ? 2.472   11.270  20.723 1.00 17.60  ? 41   PHE D CB  1 
ATOM   3586 C  CG  . PHE C 2 41  ? 3.659   11.149  21.668 1.00 17.49  ? 41   PHE D CG  1 
ATOM   3587 C  CD1 . PHE C 2 41  ? 4.751   10.385  21.278 1.00 18.33  ? 41   PHE D CD1 1 
ATOM   3588 C  CD2 . PHE C 2 41  ? 3.664   11.805  22.889 1.00 20.21  ? 41   PHE D CD2 1 
ATOM   3589 C  CE1 . PHE C 2 41  ? 5.841   10.278  22.122 1.00 21.68  ? 41   PHE D CE1 1 
ATOM   3590 C  CE2 . PHE C 2 41  ? 4.753   11.689  23.732 1.00 23.87  ? 41   PHE D CE2 1 
ATOM   3591 C  CZ  . PHE C 2 41  ? 5.840   10.931  23.340 1.00 20.50  ? 41   PHE D CZ  1 
ATOM   3592 N  N   . PHE C 2 42  ? 0.956   13.527  18.538 1.00 16.45  ? 42   PHE D N   1 
ATOM   3593 C  CA  . PHE C 2 42  ? -0.364  13.594  17.915 1.00 18.69  ? 42   PHE D CA  1 
ATOM   3594 C  C   . PHE C 2 42  ? -0.418  14.664  16.833 1.00 18.38  ? 42   PHE D C   1 
ATOM   3595 O  O   . PHE C 2 42  ? -1.464  15.267  16.597 1.00 22.10  ? 42   PHE D O   1 
ATOM   3596 C  CB  . PHE C 2 42  ? -1.425  13.870  18.985 1.00 22.21  ? 42   PHE D CB  1 
ATOM   3597 C  CG  . PHE C 2 42  ? -1.473  12.822  20.087 1.00 17.41  ? 42   PHE D CG  1 
ATOM   3598 C  CD1 . PHE C 2 42  ? -1.965  11.557  19.840 1.00 25.14  ? 42   PHE D CD1 1 
ATOM   3599 C  CD2 . PHE C 2 42  ? -1.016  13.140  21.361 1.00 18.45  ? 42   PHE D CD2 1 
ATOM   3600 C  CE1 . PHE C 2 42  ? -2.013  10.605  20.843 1.00 27.72  ? 42   PHE D CE1 1 
ATOM   3601 C  CE2 . PHE C 2 42  ? -1.075  12.192  22.367 1.00 25.14  ? 42   PHE D CE2 1 
ATOM   3602 C  CZ  . PHE C 2 42  ? -1.589  10.937  22.119 1.00 21.79  ? 42   PHE D CZ  1 
ATOM   3603 N  N   . GLU C 2 43  ? 0.702   14.908  16.158 1.00 20.68  ? 43   GLU D N   1 
ATOM   3604 C  CA  . GLU C 2 43  ? 0.802   15.895  15.094 1.00 21.37  ? 43   GLU D CA  1 
ATOM   3605 C  C   . GLU C 2 43  ? -0.239  15.668  14.002 1.00 19.07  ? 43   GLU D C   1 
ATOM   3606 O  O   . GLU C 2 43  ? -0.731  16.614  13.388 1.00 24.03  ? 43   GLU D O   1 
ATOM   3607 C  CB  . GLU C 2 43  ? 2.208   15.863  14.480 1.00 26.77  ? 43   GLU D CB  1 
ATOM   3608 C  CG  . GLU C 2 43  ? 3.313   16.243  15.459 1.00 27.72  ? 43   GLU D CG  1 
ATOM   3609 C  CD  . GLU C 2 43  ? 3.443   17.733  15.658 1.00 25.93  ? 43   GLU D CD  1 
ATOM   3610 O  OE1 . GLU C 2 43  ? 2.666   18.505  15.053 1.00 37.66  ? 43   GLU D OE1 1 
ATOM   3611 O  OE2 . GLU C 2 43  ? 4.338   18.159  16.417 1.00 49.10  ? 43   GLU D OE2 1 
ATOM   3612 N  N   . SER C 2 44  ? -0.586  14.411  13.747 1.00 25.77  ? 44   SER D N   1 
ATOM   3613 C  CA  . SER C 2 44  ? -1.590  14.101  12.739 1.00 24.98  ? 44   SER D CA  1 
ATOM   3614 C  C   . SER C 2 44  ? -3.017  14.304  13.209 1.00 29.78  ? 44   SER D C   1 
ATOM   3615 O  O   . SER C 2 44  ? -3.945  14.035  12.443 1.00 26.41  ? 44   SER D O   1 
ATOM   3616 C  CB  . SER C 2 44  ? -1.416  12.642  12.283 1.00 29.81  ? 44   SER D CB  1 
ATOM   3617 O  OG  . SER C 2 44  ? -1.748  11.748  13.330 1.00 35.61  ? 44   SER D OG  1 
ATOM   3618 N  N   . PHE C 2 45  ? -3.280  14.752  14.434 1.00 27.11  ? 45   PHE D N   1 
ATOM   3619 C  CA  . PHE C 2 45  ? -4.671  14.897  14.859 1.00 26.78  ? 45   PHE D CA  1 
ATOM   3620 C  C   . PHE C 2 45  ? -5.265  16.247  14.477 1.00 26.11  ? 45   PHE D C   1 
ATOM   3621 O  O   . PHE C 2 45  ? -6.441  16.516  14.744 1.00 32.79  ? 45   PHE D O   1 
ATOM   3622 C  CB  . PHE C 2 45  ? -4.801  14.705  16.371 1.00 25.07  ? 45   PHE D CB  1 
ATOM   3623 C  CG  . PHE C 2 45  ? -4.763  13.264  16.841 1.00 22.42  ? 45   PHE D CG  1 
ATOM   3624 C  CD1 . PHE C 2 45  ? -4.236  12.258  16.058 1.00 23.97  ? 45   PHE D CD1 1 
ATOM   3625 C  CD2 . PHE C 2 45  ? -5.267  12.936  18.095 1.00 25.01  ? 45   PHE D CD2 1 
ATOM   3626 C  CE1 . PHE C 2 45  ? -4.207  10.949  16.501 1.00 29.87  ? 45   PHE D CE1 1 
ATOM   3627 C  CE2 . PHE C 2 45  ? -5.242  11.631  18.542 1.00 26.07  ? 45   PHE D CE2 1 
ATOM   3628 C  CZ  . PHE C 2 45  ? -4.716  10.633  17.747 1.00 28.92  ? 45   PHE D CZ  1 
ATOM   3629 N  N   . GLY C 2 46  ? -4.476  17.127  13.869 1.00 38.66  ? 46   GLY D N   1 
ATOM   3630 C  CA  . GLY C 2 46  ? -5.035  18.391  13.419 1.00 38.77  ? 46   GLY D CA  1 
ATOM   3631 C  C   . GLY C 2 46  ? -4.654  19.572  14.290 1.00 38.09  ? 46   GLY D C   1 
ATOM   3632 O  O   . GLY C 2 46  ? -3.488  19.748  14.637 1.00 68.08  ? 46   GLY D O   1 
ATOM   3633 N  N   . ASP C 2 47  ? -5.661  20.365  14.616 1.00 48.08  ? 47   ASP D N   1 
ATOM   3634 C  CA  . ASP C 2 47  ? -5.577  21.614  15.351 1.00 45.08  ? 47   ASP D CA  1 
ATOM   3635 C  C   . ASP C 2 47  ? -5.603  21.389  16.859 1.00 31.38  ? 47   ASP D C   1 
ATOM   3636 O  O   . ASP C 2 47  ? -6.636  21.000  17.409 1.00 37.02  ? 47   ASP D O   1 
ATOM   3637 C  CB  . ASP C 2 47  ? -6.751  22.504  14.931 1.00 52.75  ? 47   ASP D CB  1 
ATOM   3638 C  CG  . ASP C 2 47  ? -6.622  23.949  15.358 1.00 56.25  ? 47   ASP D CG  1 
ATOM   3639 O  OD1 . ASP C 2 47  ? -5.504  24.402  15.682 1.00 45.55  ? 47   ASP D OD1 1 
ATOM   3640 O  OD2 . ASP C 2 47  ? -7.660  24.647  15.363 1.00 66.61  ? 47   ASP D OD2 1 
ATOM   3641 N  N   . LEU C 2 48  ? -4.485  21.627  17.536 1.00 32.65  ? 48   LEU D N   1 
ATOM   3642 C  CA  . LEU C 2 48  ? -4.458  21.493  18.995 1.00 31.66  ? 48   LEU D CA  1 
ATOM   3643 C  C   . LEU C 2 48  ? -4.023  22.800  19.661 1.00 35.72  ? 48   LEU D C   1 
ATOM   3644 O  O   . LEU C 2 48  ? -3.485  22.786  20.769 1.00 37.97  ? 48   LEU D O   1 
ATOM   3645 C  CB  . LEU C 2 48  ? -3.524  20.352  19.396 1.00 23.14  ? 48   LEU D CB  1 
ATOM   3646 C  CG  . LEU C 2 48  ? -3.820  18.971  18.809 1.00 29.79  ? 48   LEU D CG  1 
ATOM   3647 C  CD1 . LEU C 2 48  ? -2.657  18.016  19.060 1.00 27.20  ? 48   LEU D CD1 1 
ATOM   3648 C  CD2 . LEU C 2 48  ? -5.118  18.394  19.357 1.00 25.68  ? 48   LEU D CD2 1 
ATOM   3649 N  N   . SER C 2 49  ? -4.251  23.914  18.980 1.00 33.31  ? 49   SER D N   1 
ATOM   3650 C  CA  . SER C 2 49  ? -3.679  25.213  19.287 1.00 43.89  ? 49   SER D CA  1 
ATOM   3651 C  C   . SER C 2 49  ? -4.229  25.829  20.568 1.00 48.86  ? 49   SER D C   1 
ATOM   3652 O  O   . SER C 2 49  ? -3.495  26.483  21.311 1.00 59.24  ? 49   SER D O   1 
ATOM   3653 C  CB  . SER C 2 49  ? -3.897  26.198  18.128 1.00 51.36  ? 49   SER D CB  1 
ATOM   3654 O  OG  . SER C 2 49  ? -5.255  26.595  18.022 1.00 43.32  ? 49   SER D OG  1 
ATOM   3655 N  N   . THR C 2 50  ? -5.517  25.633  20.811 1.00 47.68  ? 50   THR D N   1 
ATOM   3656 C  CA  . THR C 2 50  ? -6.193  26.233  21.958 1.00 43.23  ? 50   THR D CA  1 
ATOM   3657 C  C   . THR C 2 50  ? -6.959  25.165  22.726 1.00 35.30  ? 50   THR D C   1 
ATOM   3658 O  O   . THR C 2 50  ? -7.224  24.110  22.145 1.00 31.10  ? 50   THR D O   1 
ATOM   3659 C  CB  . THR C 2 50  ? -7.177  27.321  21.494 1.00 36.84  ? 50   THR D CB  1 
ATOM   3660 O  OG1 . THR C 2 50  ? -8.353  26.696  20.961 1.00 44.77  ? 50   THR D OG1 1 
ATOM   3661 C  CG2 . THR C 2 50  ? -6.573  28.143  20.365 1.00 40.33  ? 50   THR D CG2 1 
ATOM   3662 N  N   . PRO C 2 51  ? -7.316  25.405  23.977 1.00 38.07  ? 51   PRO D N   1 
ATOM   3663 C  CA  . PRO C 2 51  ? -8.009  24.374  24.762 1.00 33.94  ? 51   PRO D CA  1 
ATOM   3664 C  C   . PRO C 2 51  ? -9.345  24.012  24.139 1.00 30.77  ? 51   PRO D C   1 
ATOM   3665 O  O   . PRO C 2 51  ? -9.785  22.864  24.105 1.00 31.61  ? 51   PRO D O   1 
ATOM   3666 C  CB  . PRO C 2 51  ? -8.231  25.036  26.125 1.00 37.21  ? 51   PRO D CB  1 
ATOM   3667 C  CG  . PRO C 2 51  ? -7.237  26.147  26.179 1.00 40.19  ? 51   PRO D CG  1 
ATOM   3668 C  CD  . PRO C 2 51  ? -7.107  26.636  24.759 1.00 46.32  ? 51   PRO D CD  1 
ATOM   3669 N  N   . ASP C 2 52  ? -10.050 25.019  23.613 1.00 28.04  ? 52   ASP D N   1 
ATOM   3670 C  CA  . ASP C 2 52  ? -11.319 24.643  22.977 1.00 38.39  ? 52   ASP D CA  1 
ATOM   3671 C  C   . ASP C 2 52  ? -11.060 23.870  21.697 1.00 30.88  ? 52   ASP D C   1 
ATOM   3672 O  O   . ASP C 2 52  ? -11.795 22.945  21.339 1.00 37.18  ? 52   ASP D O   1 
ATOM   3673 C  CB  . ASP C 2 52  ? -12.179 25.887  22.747 1.00 48.98  ? 52   ASP D CB  1 
ATOM   3674 C  CG  . ASP C 2 52  ? -12.788 26.371  24.056 1.00 59.20  ? 52   ASP D CG  1 
ATOM   3675 O  OD1 . ASP C 2 52  ? -13.970 26.060  24.311 1.00 70.82  ? 52   ASP D OD1 1 
ATOM   3676 O  OD2 . ASP C 2 52  ? -12.070 27.047  24.824 1.00 59.39  ? 52   ASP D OD2 1 
ATOM   3677 N  N   . ALA C 2 53  ? -9.986  24.195  20.976 1.00 25.71  ? 53   ALA D N   1 
ATOM   3678 C  CA  . ALA C 2 53  ? -9.705  23.349  19.809 1.00 35.28  ? 53   ALA D CA  1 
ATOM   3679 C  C   . ALA C 2 53  ? -9.349  21.930  20.241 1.00 35.31  ? 53   ALA D C   1 
ATOM   3680 O  O   . ALA C 2 53  ? -9.796  20.962  19.625 1.00 33.43  ? 53   ALA D O   1 
ATOM   3681 C  CB  . ALA C 2 53  ? -8.608  23.940  18.949 1.00 32.34  ? 53   ALA D CB  1 
ATOM   3682 N  N   . VAL C 2 54  ? -8.557  21.785  21.303 1.00 26.14  ? 54   VAL D N   1 
ATOM   3683 C  CA  . VAL C 2 54  ? -8.195  20.434  21.741 1.00 23.55  ? 54   VAL D CA  1 
ATOM   3684 C  C   . VAL C 2 54  ? -9.389  19.627  22.213 1.00 19.51  ? 54   VAL D C   1 
ATOM   3685 O  O   . VAL C 2 54  ? -9.597  18.482  21.793 1.00 30.80  ? 54   VAL D O   1 
ATOM   3686 C  CB  . VAL C 2 54  ? -7.140  20.458  22.864 1.00 20.99  ? 54   VAL D CB  1 
ATOM   3687 C  CG1 . VAL C 2 54  ? -6.915  19.045  23.391 1.00 21.62  ? 54   VAL D CG1 1 
ATOM   3688 C  CG2 . VAL C 2 54  ? -5.840  21.061  22.356 1.00 22.53  ? 54   VAL D CG2 1 
ATOM   3689 N  N   . MET C 2 55  ? -10.199 20.201  23.097 1.00 23.22  ? 55   MET D N   1 
ATOM   3690 C  CA  . MET C 2 55  ? -11.326 19.477  23.662 1.00 20.47  ? 55   MET D CA  1 
ATOM   3691 C  C   . MET C 2 55  ? -12.364 19.119  22.607 1.00 34.09  ? 55   MET D C   1 
ATOM   3692 O  O   . MET C 2 55  ? -13.084 18.127  22.750 1.00 39.54  ? 55   MET D O   1 
ATOM   3693 C  CB  . MET C 2 55  ? -11.956 20.299  24.793 1.00 28.06  ? 55   MET D CB  1 
ATOM   3694 C  CG  . MET C 2 55  ? -10.981 20.710  25.884 1.00 34.49  ? 55   MET D CG  1 
ATOM   3695 S  SD  . MET C 2 55  ? -10.109 19.320  26.639 1.00 28.13  ? 55   MET D SD  1 
ATOM   3696 C  CE  . MET C 2 55  ? -11.443 18.495  27.490 1.00 24.05  ? 55   MET D CE  1 
ATOM   3697 N  N   . GLY C 2 56  ? -12.459 19.900  21.533 1.00 37.72  ? 56   GLY D N   1 
ATOM   3698 C  CA  . GLY C 2 56  ? -13.489 19.657  20.531 1.00 43.33  ? 56   GLY D CA  1 
ATOM   3699 C  C   . GLY C 2 56  ? -13.019 18.776  19.390 1.00 40.45  ? 56   GLY D C   1 
ATOM   3700 O  O   . GLY C 2 56  ? -13.794 18.343  18.534 1.00 30.74  ? 56   GLY D O   1 
ATOM   3701 N  N   . ASN C 2 57  ? -11.722 18.500  19.364 1.00 34.56  ? 57   ASN D N   1 
ATOM   3702 C  CA  . ASN C 2 57  ? -11.114 17.717  18.295 1.00 26.26  ? 57   ASN D CA  1 
ATOM   3703 C  C   . ASN C 2 57  ? -11.618 16.282  18.324 1.00 27.26  ? 57   ASN D C   1 
ATOM   3704 O  O   . ASN C 2 57  ? -11.420 15.555  19.296 1.00 24.33  ? 57   ASN D O   1 
ATOM   3705 C  CB  . ASN C 2 57  ? -9.596  17.754  18.453 1.00 33.63  ? 57   ASN D CB  1 
ATOM   3706 C  CG  . ASN C 2 57  ? -8.856  17.171  17.266 1.00 25.85  ? 57   ASN D CG  1 
ATOM   3707 O  OD1 . ASN C 2 57  ? -9.034  16.013  16.905 1.00 27.14  ? 57   ASN D OD1 1 
ATOM   3708 N  ND2 . ASN C 2 57  ? -8.019  17.999  16.657 1.00 31.84  ? 57   ASN D ND2 1 
ATOM   3709 N  N   . PRO C 2 58  ? -12.274 15.851  17.256 1.00 26.75  ? 58   PRO D N   1 
ATOM   3710 C  CA  . PRO C 2 58  ? -12.875 14.518  17.224 1.00 22.28  ? 58   PRO D CA  1 
ATOM   3711 C  C   . PRO C 2 58  ? -11.841 13.407  17.252 1.00 19.73  ? 58   PRO D C   1 
ATOM   3712 O  O   . PRO C 2 58  ? -12.131 12.309  17.734 1.00 23.29  ? 58   PRO D O   1 
ATOM   3713 C  CB  . PRO C 2 58  ? -13.633 14.499  15.894 1.00 34.14  ? 58   PRO D CB  1 
ATOM   3714 C  CG  . PRO C 2 58  ? -12.963 15.536  15.059 1.00 36.73  ? 58   PRO D CG  1 
ATOM   3715 C  CD  . PRO C 2 58  ? -12.488 16.598  16.007 1.00 36.17  ? 58   PRO D CD  1 
ATOM   3716 N  N   . LYS C 2 59  ? -10.620 13.656  16.761 1.00 20.21  ? 59   LYS D N   1 
ATOM   3717 C  CA  . LYS C 2 59  ? -9.653  12.554  16.894 1.00 25.02  ? 59   LYS D CA  1 
ATOM   3718 C  C   . LYS C 2 59  ? -9.154  12.406  18.327 1.00 19.71  ? 59   LYS D C   1 
ATOM   3719 O  O   . LYS C 2 59  ? -8.814  11.300  18.767 1.00 19.43  ? 59   LYS D O   1 
ATOM   3720 C  CB  . LYS C 2 59  ? -8.492  12.751  15.922 1.00 30.46  ? 59   LYS D CB  1 
ATOM   3721 C  CG  . LYS C 2 59  ? -8.898  12.567  14.466 1.00 35.16  ? 59   LYS D CG  1 
ATOM   3722 C  CD  . LYS C 2 59  ? -8.073  13.462  13.553 1.00 39.58  ? 59   LYS D CD  1 
ATOM   3723 C  CE  . LYS C 2 59  ? -7.719  12.723  12.269 1.00 44.51  ? 59   LYS D CE  1 
ATOM   3724 N  NZ  . LYS C 2 59  ? -6.650  13.428  11.506 1.00 65.46  ? 59   LYS D NZ  1 
ATOM   3725 N  N   . VAL C 2 60  ? -9.092  13.508  19.066 1.00 23.01  ? 60   VAL D N   1 
ATOM   3726 C  CA  . VAL C 2 60  ? -8.735  13.430  20.486 1.00 19.20  ? 60   VAL D CA  1 
ATOM   3727 C  C   . VAL C 2 60  ? -9.761  12.602  21.245 1.00 20.61  ? 60   VAL D C   1 
ATOM   3728 O  O   . VAL C 2 60  ? -9.451  11.729  22.051 1.00 22.30  ? 60   VAL D O   1 
ATOM   3729 C  CB  . VAL C 2 60  ? -8.625  14.835  21.099 1.00 18.43  ? 60   VAL D CB  1 
ATOM   3730 C  CG1 . VAL C 2 60  ? -8.592  14.768  22.624 1.00 21.84  ? 60   VAL D CG1 1 
ATOM   3731 C  CG2 . VAL C 2 60  ? -7.396  15.551  20.566 1.00 23.78  ? 60   VAL D CG2 1 
ATOM   3732 N  N   . LYS C 2 61  ? -11.046 12.882  20.997 1.00 22.12  ? 61   LYS D N   1 
ATOM   3733 C  CA  . LYS C 2 61  ? -12.114 12.157  21.672 1.00 24.97  ? 61   LYS D CA  1 
ATOM   3734 C  C   . LYS C 2 61  ? -12.084 10.674  21.333 1.00 27.21  ? 61   LYS D C   1 
ATOM   3735 O  O   . LYS C 2 61  ? -12.294 9.810   22.190 1.00 28.12  ? 61   LYS D O   1 
ATOM   3736 C  CB  . LYS C 2 61  ? -13.482 12.746  21.301 1.00 23.95  ? 61   LYS D CB  1 
ATOM   3737 C  CG  . LYS C 2 61  ? -13.513 14.268  21.344 1.00 41.51  ? 61   LYS D CG  1 
ATOM   3738 C  CD  . LYS C 2 61  ? -14.887 14.790  20.955 1.00 43.08  ? 61   LYS D CD  1 
ATOM   3739 C  CE  . LYS C 2 61  ? -15.388 15.835  21.941 1.00 46.11  ? 61   LYS D CE  1 
ATOM   3740 N  NZ  . LYS C 2 61  ? -16.529 16.606  21.359 1.00 44.77  ? 61   LYS D NZ  1 
ATOM   3741 N  N   . ALA C 2 62  ? -11.831 10.388  20.052 1.00 22.11  ? 62   ALA D N   1 
ATOM   3742 C  CA  . ALA C 2 62  ? -11.799 8.989   19.628 1.00 20.33  ? 62   ALA D CA  1 
ATOM   3743 C  C   . ALA C 2 62  ? -10.625 8.280   20.287 1.00 21.46  ? 62   ALA D C   1 
ATOM   3744 O  O   . ALA C 2 62  ? -10.729 7.171   20.809 1.00 23.91  ? 62   ALA D O   1 
ATOM   3745 C  CB  . ALA C 2 62  ? -11.708 8.908   18.110 1.00 19.70  ? 62   ALA D CB  1 
ATOM   3746 N  N   . HIS C 2 63  ? -9.454  8.922   20.258 1.00 20.27  ? 63   HIS D N   1 
ATOM   3747 C  CA  . HIS C 2 63  ? -8.282  8.264   20.819 1.00 18.99  ? 63   HIS D CA  1 
ATOM   3748 C  C   . HIS C 2 63  ? -8.427  8.080   22.327 1.00 19.37  ? 63   HIS D C   1 
ATOM   3749 O  O   . HIS C 2 63  ? -8.051  7.045   22.884 1.00 18.88  ? 63   HIS D O   1 
ATOM   3750 C  CB  . HIS C 2 63  ? -6.998  9.050   20.521 1.00 24.81  ? 63   HIS D CB  1 
ATOM   3751 C  CG  . HIS C 2 63  ? -5.812  8.184   20.846 1.00 25.69  ? 63   HIS D CG  1 
ATOM   3752 N  ND1 . HIS C 2 63  ? -5.653  6.954   20.247 1.00 27.57  ? 63   HIS D ND1 1 
ATOM   3753 C  CD2 . HIS C 2 63  ? -4.777  8.340   21.697 1.00 24.51  ? 63   HIS D CD2 1 
ATOM   3754 C  CE1 . HIS C 2 63  ? -4.546  6.387   20.706 1.00 30.73  ? 63   HIS D CE1 1 
ATOM   3755 N  NE2 . HIS C 2 63  ? -3.999  7.208   21.586 1.00 27.04  ? 63   HIS D NE2 1 
ATOM   3756 N  N   . GLY C 2 64  ? -8.993  9.110   22.952 1.00 17.90  ? 64   GLY D N   1 
ATOM   3757 C  CA  . GLY C 2 64  ? -9.252  9.043   24.382 1.00 25.37  ? 64   GLY D CA  1 
ATOM   3758 C  C   . GLY C 2 64  ? -10.111 7.840   24.726 1.00 24.22  ? 64   GLY D C   1 
ATOM   3759 O  O   . GLY C 2 64  ? -9.845  7.148   25.705 1.00 25.42  ? 64   GLY D O   1 
ATOM   3760 N  N   . LYS C 2 65  ? -11.141 7.599   23.925 1.00 20.72  ? 65   LYS D N   1 
ATOM   3761 C  CA  . LYS C 2 65  ? -12.049 6.480   24.137 1.00 22.00  ? 65   LYS D CA  1 
ATOM   3762 C  C   . LYS C 2 65  ? -11.315 5.149   24.033 1.00 19.62  ? 65   LYS D C   1 
ATOM   3763 O  O   . LYS C 2 65  ? -11.542 4.236   24.836 1.00 23.38  ? 65   LYS D O   1 
ATOM   3764 C  CB  . LYS C 2 65  ? -13.202 6.527   23.125 1.00 27.96  ? 65   LYS D CB  1 
ATOM   3765 C  CG  . LYS C 2 65  ? -14.187 5.380   23.303 1.00 40.20  ? 65   LYS D CG  1 
ATOM   3766 C  CD  . LYS C 2 65  ? -15.139 5.256   22.122 1.00 54.51  ? 65   LYS D CD  1 
ATOM   3767 C  CE  . LYS C 2 65  ? -15.597 3.814   21.934 1.00 58.74  ? 65   LYS D CE  1 
ATOM   3768 N  NZ  . LYS C 2 65  ? -16.952 3.725   21.320 1.00 45.79  ? 65   LYS D NZ  1 
ATOM   3769 N  N   . LYS C 2 66  ? -10.418 5.052   23.057 1.00 19.29  ? 66   LYS D N   1 
ATOM   3770 C  CA  . LYS C 2 66  ? -9.616  3.843   22.885 1.00 22.69  ? 66   LYS D CA  1 
ATOM   3771 C  C   . LYS C 2 66  ? -8.735  3.560   24.099 1.00 19.84  ? 66   LYS D C   1 
ATOM   3772 O  O   . LYS C 2 66  ? -8.645  2.442   24.603 1.00 19.44  ? 66   LYS D O   1 
ATOM   3773 C  CB  . LYS C 2 66  ? -8.742  3.999   21.639 1.00 26.91  ? 66   LYS D CB  1 
ATOM   3774 C  CG  . LYS C 2 66  ? -8.041  2.719   21.214 1.00 41.73  ? 66   LYS D CG  1 
ATOM   3775 C  CD  . LYS C 2 66  ? -7.415  2.893   19.834 1.00 40.93  ? 66   LYS D CD  1 
ATOM   3776 C  CE  . LYS C 2 66  ? -7.686  4.290   19.299 1.00 35.74  ? 66   LYS D CE  1 
ATOM   3777 N  NZ  . LYS C 2 66  ? -7.304  4.424   17.865 1.00 58.68  ? 66   LYS D NZ  1 
ATOM   3778 N  N   . VAL C 2 67  ? -8.056  4.595   24.572 1.00 18.48  ? 67   VAL D N   1 
ATOM   3779 C  CA  . VAL C 2 67  ? -7.126  4.487   25.689 1.00 17.11  ? 67   VAL D CA  1 
ATOM   3780 C  C   . VAL C 2 67  ? -7.838  4.103   26.970 1.00 13.63  ? 67   VAL D C   1 
ATOM   3781 O  O   . VAL C 2 67  ? -7.432  3.187   27.673 1.00 18.24  ? 67   VAL D O   1 
ATOM   3782 C  CB  . VAL C 2 67  ? -6.384  5.833   25.895 1.00 17.62  ? 67   VAL D CB  1 
ATOM   3783 C  CG1 . VAL C 2 67  ? -5.654  5.837   27.225 1.00 26.80  ? 67   VAL D CG1 1 
ATOM   3784 C  CG2 . VAL C 2 67  ? -5.424  6.065   24.732 1.00 26.56  ? 67   VAL D CG2 1 
ATOM   3785 N  N   . LEU C 2 68  ? -8.917  4.793   27.346 1.00 15.12  ? 68   LEU D N   1 
ATOM   3786 C  CA  . LEU C 2 68  ? -9.606  4.422   28.572 1.00 18.90  ? 68   LEU D CA  1 
ATOM   3787 C  C   . LEU C 2 68  ? -10.374 3.114   28.428 1.00 20.64  ? 68   LEU D C   1 
ATOM   3788 O  O   . LEU C 2 68  ? -10.651 2.441   29.423 1.00 20.39  ? 68   LEU D O   1 
ATOM   3789 C  CB  . LEU C 2 68  ? -10.579 5.509   29.038 1.00 19.26  ? 68   LEU D CB  1 
ATOM   3790 C  CG  . LEU C 2 68  ? -10.503 5.796   30.543 1.00 36.46  ? 68   LEU D CG  1 
ATOM   3791 C  CD1 . LEU C 2 68  ? -9.134  6.362   30.892 1.00 34.55  ? 68   LEU D CD1 1 
ATOM   3792 C  CD2 . LEU C 2 68  ? -11.616 6.730   30.977 1.00 49.90  ? 68   LEU D CD2 1 
ATOM   3793 N  N   . GLY C 2 69  ? -10.704 2.756   27.194 1.00 18.35  ? 69   GLY D N   1 
ATOM   3794 C  CA  . GLY C 2 69  ? -11.229 1.425   26.916 1.00 15.63  ? 69   GLY D CA  1 
ATOM   3795 C  C   . GLY C 2 69  ? -10.249 0.352   27.333 1.00 17.87  ? 69   GLY D C   1 
ATOM   3796 O  O   . GLY C 2 69  ? -10.597 -0.614  28.008 1.00 23.08  ? 69   GLY D O   1 
ATOM   3797 N  N   . ALA C 2 70  ? -8.984  0.530   26.955 1.00 18.31  ? 70   ALA D N   1 
ATOM   3798 C  CA  . ALA C 2 70  ? -7.952  -0.431  27.312 1.00 20.27  ? 70   ALA D CA  1 
ATOM   3799 C  C   . ALA C 2 70  ? -7.674  -0.398  28.811 1.00 22.77  ? 70   ALA D C   1 
ATOM   3800 O  O   . ALA C 2 70  ? -7.363  -1.435  29.406 1.00 24.29  ? 70   ALA D O   1 
ATOM   3801 C  CB  . ALA C 2 70  ? -6.681  -0.161  26.518 1.00 16.87  ? 70   ALA D CB  1 
ATOM   3802 N  N   . PHE C 2 71  ? -7.782  0.783   29.402 1.00 19.55  ? 71   PHE D N   1 
ATOM   3803 C  CA  . PHE C 2 71  ? -7.585  0.944   30.842 1.00 19.58  ? 71   PHE D CA  1 
ATOM   3804 C  C   . PHE C 2 71  ? -8.683  0.177   31.575 1.00 20.01  ? 71   PHE D C   1 
ATOM   3805 O  O   . PHE C 2 71  ? -8.451  -0.496  32.572 1.00 25.35  ? 71   PHE D O   1 
ATOM   3806 C  CB  . PHE C 2 71  ? -7.590  2.426   31.202 1.00 18.13  ? 71   PHE D CB  1 
ATOM   3807 C  CG  . PHE C 2 71  ? -7.522  2.778   32.680 1.00 27.27  ? 71   PHE D CG  1 
ATOM   3808 C  CD1 . PHE C 2 71  ? -6.305  3.011   33.302 1.00 27.18  ? 71   PHE D CD1 1 
ATOM   3809 C  CD2 . PHE C 2 71  ? -8.671  2.891   33.443 1.00 30.03  ? 71   PHE D CD2 1 
ATOM   3810 C  CE1 . PHE C 2 71  ? -6.248  3.328   34.647 1.00 22.43  ? 71   PHE D CE1 1 
ATOM   3811 C  CE2 . PHE C 2 71  ? -8.626  3.196   34.791 1.00 33.22  ? 71   PHE D CE2 1 
ATOM   3812 C  CZ  . PHE C 2 71  ? -7.404  3.423   35.394 1.00 27.80  ? 71   PHE D CZ  1 
ATOM   3813 N  N   . SER C 2 72  ? -9.892  0.308   31.045 1.00 23.95  ? 72   SER D N   1 
ATOM   3814 C  CA  . SER C 2 72  ? -11.066 -0.334  31.629 1.00 27.85  ? 72   SER D CA  1 
ATOM   3815 C  C   . SER C 2 72  ? -10.870 -1.840  31.711 1.00 30.86  ? 72   SER D C   1 
ATOM   3816 O  O   . SER C 2 72  ? -11.152 -2.459  32.739 1.00 27.12  ? 72   SER D O   1 
ATOM   3817 C  CB  . SER C 2 72  ? -12.300 0.018   30.799 1.00 26.22  ? 72   SER D CB  1 
ATOM   3818 O  OG  . SER C 2 72  ? -13.490 -0.248  31.524 1.00 41.12  ? 72   SER D OG  1 
ATOM   3819 N  N   . ASP C 2 73  ? -10.383 -2.421  30.621 1.00 26.71  ? 73   ASP D N   1 
ATOM   3820 C  CA  . ASP C 2 73  ? -10.178 -3.870  30.572 1.00 29.46  ? 73   ASP D CA  1 
ATOM   3821 C  C   . ASP C 2 73  ? -9.088  -4.275  31.553 1.00 21.27  ? 73   ASP D C   1 
ATOM   3822 O  O   . ASP C 2 73  ? -9.018  -5.405  32.028 1.00 34.35  ? 73   ASP D O   1 
ATOM   3823 C  CB  . ASP C 2 73  ? -9.820  -4.320  29.157 1.00 35.14  ? 73   ASP D CB  1 
ATOM   3824 C  CG  . ASP C 2 73  ? -10.904 -4.015  28.144 1.00 40.21  ? 73   ASP D CG  1 
ATOM   3825 O  OD1 . ASP C 2 73  ? -12.064 -3.798  28.554 1.00 56.47  ? 73   ASP D OD1 1 
ATOM   3826 O  OD2 . ASP C 2 73  ? -10.599 -3.987  26.932 1.00 54.70  ? 73   ASP D OD2 1 
ATOM   3827 N  N   . GLY C 2 74  ? -8.222  -3.318  31.877 1.00 22.05  ? 74   GLY D N   1 
ATOM   3828 C  CA  . GLY C 2 74  ? -7.149  -3.586  32.823 1.00 18.42  ? 74   GLY D CA  1 
ATOM   3829 C  C   . GLY C 2 74  ? -7.667  -3.714  34.239 1.00 27.79  ? 74   GLY D C   1 
ATOM   3830 O  O   . GLY C 2 74  ? -7.115  -4.459  35.050 1.00 32.75  ? 74   GLY D O   1 
ATOM   3831 N  N   . LEU C 2 75  ? -8.742  -2.978  34.525 1.00 27.01  ? 75   LEU D N   1 
ATOM   3832 C  CA  . LEU C 2 75  ? -9.349  -3.039  35.848 1.00 30.92  ? 75   LEU D CA  1 
ATOM   3833 C  C   . LEU C 2 75  ? -10.086 -4.365  36.022 1.00 34.45  ? 75   LEU D C   1 
ATOM   3834 O  O   . LEU C 2 75  ? -10.527 -4.683  37.126 1.00 33.48  ? 75   LEU D O   1 
ATOM   3835 C  CB  . LEU C 2 75  ? -10.296 -1.860  36.068 1.00 28.22  ? 75   LEU D CB  1 
ATOM   3836 C  CG  . LEU C 2 75  ? -9.681  -0.466  36.144 1.00 33.21  ? 75   LEU D CG  1 
ATOM   3837 C  CD1 . LEU C 2 75  ? -10.761 0.607   36.081 1.00 45.81  ? 75   LEU D CD1 1 
ATOM   3838 C  CD2 . LEU C 2 75  ? -8.850  -0.303  37.410 1.00 34.72  ? 75   LEU D CD2 1 
ATOM   3839 N  N   . ALA C 2 76  ? -10.212 -5.136  34.945 1.00 29.95  ? 76   ALA D N   1 
ATOM   3840 C  CA  . ALA C 2 76  ? -10.779 -6.481  35.057 1.00 33.19  ? 76   ALA D CA  1 
ATOM   3841 C  C   . ALA C 2 76  ? -9.729  -7.496  35.486 1.00 30.33  ? 76   ALA D C   1 
ATOM   3842 O  O   . ALA C 2 76  ? -10.051 -8.616  35.877 1.00 44.56  ? 76   ALA D O   1 
ATOM   3843 C  CB  . ALA C 2 76  ? -11.412 -6.904  33.741 1.00 58.02  ? 76   ALA D CB  1 
ATOM   3844 N  N   . HIS C 2 77  ? -8.460  -7.112  35.420 1.00 31.98  ? 77   HIS D N   1 
ATOM   3845 C  CA  . HIS C 2 77  ? -7.346  -8.007  35.698 1.00 28.75  ? 77   HIS D CA  1 
ATOM   3846 C  C   . HIS C 2 77  ? -6.333  -7.404  36.660 1.00 21.24  ? 77   HIS D C   1 
ATOM   3847 O  O   . HIS C 2 77  ? -5.117  -7.516  36.499 1.00 29.94  ? 77   HIS D O   1 
ATOM   3848 C  CB  . HIS C 2 77  ? -6.661  -8.377  34.374 1.00 39.25  ? 77   HIS D CB  1 
ATOM   3849 C  CG  . HIS C 2 77  ? -7.596  -9.073  33.433 1.00 41.51  ? 77   HIS D CG  1 
ATOM   3850 N  ND1 . HIS C 2 77  ? -8.290  -8.415  32.443 1.00 49.88  ? 77   HIS D ND1 1 
ATOM   3851 C  CD2 . HIS C 2 77  ? -7.956  -10.372 33.342 1.00 35.69  ? 77   HIS D CD2 1 
ATOM   3852 C  CE1 . HIS C 2 77  ? -9.036  -9.277  31.776 1.00 43.94  ? 77   HIS D CE1 1 
ATOM   3853 N  NE2 . HIS C 2 77  ? -8.851  -10.473 32.304 1.00 40.86  ? 77   HIS D NE2 1 
ATOM   3854 N  N   . LEU C 2 78  ? -6.854  -6.762  37.703 1.00 25.76  ? 78   LEU D N   1 
ATOM   3855 C  CA  . LEU C 2 78  ? -6.063  -6.020  38.670 1.00 31.24  ? 78   LEU D CA  1 
ATOM   3856 C  C   . LEU C 2 78  ? -4.968  -6.857  39.310 1.00 26.51  ? 78   LEU D C   1 
ATOM   3857 O  O   . LEU C 2 78  ? -3.999  -6.326  39.845 1.00 32.02  ? 78   LEU D O   1 
ATOM   3858 C  CB  . LEU C 2 78  ? -6.992  -5.454  39.752 1.00 33.23  ? 78   LEU D CB  1 
ATOM   3859 C  CG  . LEU C 2 78  ? -6.876  -3.962  40.055 1.00 46.68  ? 78   LEU D CG  1 
ATOM   3860 C  CD1 . LEU C 2 78  ? -6.144  -3.232  38.939 1.00 30.13  ? 78   LEU D CD1 1 
ATOM   3861 C  CD2 . LEU C 2 78  ? -8.252  -3.357  40.295 1.00 42.37  ? 78   LEU D CD2 1 
ATOM   3862 N  N   . ASP C 2 79  ? -5.112  -8.181  39.287 1.00 27.10  ? 79   ASP D N   1 
ATOM   3863 C  CA  . ASP C 2 79  ? -4.150  -9.048  39.953 1.00 35.05  ? 79   ASP D CA  1 
ATOM   3864 C  C   . ASP C 2 79  ? -2.978  -9.384  39.040 1.00 35.01  ? 79   ASP D C   1 
ATOM   3865 O  O   . ASP C 2 79  ? -1.978  -9.965  39.464 1.00 34.50  ? 79   ASP D O   1 
ATOM   3866 C  CB  . ASP C 2 79  ? -4.841  -10.333 40.419 1.00 57.17  ? 79   ASP D CB  1 
ATOM   3867 C  CG  . ASP C 2 79  ? -5.982  -10.058 41.380 1.00 74.85  ? 79   ASP D CG  1 
ATOM   3868 O  OD1 . ASP C 2 79  ? -6.201  -8.875  41.720 1.00 96.61  ? 79   ASP D OD1 1 
ATOM   3869 O  OD2 . ASP C 2 79  ? -6.656  -11.026 41.797 1.00 105.20 ? 79   ASP D OD2 1 
ATOM   3870 N  N   . ASN C 2 80  ? -3.103  -9.022  37.765 1.00 30.65  ? 80   ASN D N   1 
ATOM   3871 C  CA  . ASN C 2 80  ? -2.039  -9.330  36.807 1.00 36.95  ? 80   ASN D CA  1 
ATOM   3872 C  C   . ASN C 2 80  ? -1.904  -8.223  35.768 1.00 30.61  ? 80   ASN D C   1 
ATOM   3873 O  O   . ASN C 2 80  ? -2.138  -8.418  34.574 1.00 25.32  ? 80   ASN D O   1 
ATOM   3874 C  CB  . ASN C 2 80  ? -2.294  -10.676 36.130 1.00 45.94  ? 80   ASN D CB  1 
ATOM   3875 C  CG  . ASN C 2 80  ? -1.001  -11.408 35.815 1.00 54.00  ? 80   ASN D CG  1 
ATOM   3876 O  OD1 . ASN C 2 80  ? 0.004   -10.786 35.465 1.00 61.29  ? 80   ASN D OD1 1 
ATOM   3877 N  ND2 . ASN C 2 80  ? -1.024  -12.729 35.940 1.00 63.44  ? 80   ASN D ND2 1 
ATOM   3878 N  N   . LEU C 2 81  ? -1.519  -7.042  36.261 1.00 22.64  ? 81   LEU D N   1 
ATOM   3879 C  CA  . LEU C 2 81  ? -1.449  -5.883  35.372 1.00 25.88  ? 81   LEU D CA  1 
ATOM   3880 C  C   . LEU C 2 81  ? -0.360  -6.079  34.328 1.00 18.26  ? 81   LEU D C   1 
ATOM   3881 O  O   . LEU C 2 81  ? -0.550  -5.797  33.141 1.00 24.01  ? 81   LEU D O   1 
ATOM   3882 C  CB  . LEU C 2 81  ? -1.228  -4.604  36.194 1.00 23.95  ? 81   LEU D CB  1 
ATOM   3883 C  CG  . LEU C 2 81  ? -2.463  -4.129  36.964 1.00 24.60  ? 81   LEU D CG  1 
ATOM   3884 C  CD1 . LEU C 2 81  ? -2.207  -2.783  37.620 1.00 28.31  ? 81   LEU D CD1 1 
ATOM   3885 C  CD2 . LEU C 2 81  ? -3.675  -4.043  36.045 1.00 20.99  ? 81   LEU D CD2 1 
ATOM   3886 N  N   . LYS C 2 82  ? 0.782   -6.599  34.763 1.00 21.85  ? 82   LYS D N   1 
ATOM   3887 C  CA  . LYS C 2 82  ? 1.910   -6.818  33.863 1.00 28.35  ? 82   LYS D CA  1 
ATOM   3888 C  C   . LYS C 2 82  ? 1.582   -7.740  32.699 1.00 32.09  ? 82   LYS D C   1 
ATOM   3889 O  O   . LYS C 2 82  ? 1.897   -7.444  31.541 1.00 26.00  ? 82   LYS D O   1 
ATOM   3890 C  CB  . LYS C 2 82  ? 3.094   -7.397  34.651 1.00 32.31  ? 82   LYS D CB  1 
ATOM   3891 C  CG  . LYS C 2 82  ? 4.103   -6.345  35.075 1.00 38.52  ? 82   LYS D CG  1 
ATOM   3892 C  CD  . LYS C 2 82  ? 5.238   -6.963  35.878 1.00 47.10  ? 82   LYS D CD  1 
ATOM   3893 C  CE  . LYS C 2 82  ? 5.984   -5.894  36.676 1.00 58.83  ? 82   LYS D CE  1 
ATOM   3894 N  NZ  . LYS C 2 82  ? 5.464   -4.522  36.363 1.00 62.79  ? 82   LYS D NZ  1 
ATOM   3895 N  N   . GLY C 2 83  ? 0.958   -8.884  32.984 1.00 29.74  ? 83   GLY D N   1 
ATOM   3896 C  CA  . GLY C 2 83  ? 0.620   -9.809  31.904 1.00 29.43  ? 83   GLY D CA  1 
ATOM   3897 C  C   . GLY C 2 83  ? -0.447  -9.217  31.011 1.00 28.69  ? 83   GLY D C   1 
ATOM   3898 O  O   . GLY C 2 83  ? -0.435  -9.358  29.789 1.00 32.58  ? 83   GLY D O   1 
ATOM   3899 N  N   . THR C 2 84  ? -1.396  -8.510  31.630 1.00 26.68  ? 84   THR D N   1 
ATOM   3900 C  CA  . THR C 2 84  ? -2.462  -7.882  30.861 1.00 23.69  ? 84   THR D CA  1 
ATOM   3901 C  C   . THR C 2 84  ? -1.929  -6.843  29.880 1.00 24.48  ? 84   THR D C   1 
ATOM   3902 O  O   . THR C 2 84  ? -2.418  -6.803  28.752 1.00 26.11  ? 84   THR D O   1 
ATOM   3903 C  CB  . THR C 2 84  ? -3.491  -7.192  31.780 1.00 29.40  ? 84   THR D CB  1 
ATOM   3904 O  OG1 . THR C 2 84  ? -4.067  -8.179  32.643 1.00 37.01  ? 84   THR D OG1 1 
ATOM   3905 C  CG2 . THR C 2 84  ? -4.618  -6.581  30.968 1.00 32.25  ? 84   THR D CG2 1 
ATOM   3906 N  N   . PHE C 2 85  ? -0.958  -6.020  30.272 1.00 21.38  ? 85   PHE D N   1 
ATOM   3907 C  CA  . PHE C 2 85  ? -0.511  -4.944  29.388 1.00 18.04  ? 85   PHE D CA  1 
ATOM   3908 C  C   . PHE C 2 85  ? 0.763   -5.234  28.616 1.00 20.58  ? 85   PHE D C   1 
ATOM   3909 O  O   . PHE C 2 85  ? 1.261   -4.336  27.923 1.00 20.32  ? 85   PHE D O   1 
ATOM   3910 C  CB  . PHE C 2 85  ? -0.330  -3.641  30.195 1.00 22.05  ? 85   PHE D CB  1 
ATOM   3911 C  CG  . PHE C 2 85  ? -1.695  -3.032  30.519 1.00 22.18  ? 85   PHE D CG  1 
ATOM   3912 C  CD1 . PHE C 2 85  ? -2.446  -2.440  29.522 1.00 19.08  ? 85   PHE D CD1 1 
ATOM   3913 C  CD2 . PHE C 2 85  ? -2.204  -3.089  31.802 1.00 19.07  ? 85   PHE D CD2 1 
ATOM   3914 C  CE1 . PHE C 2 85  ? -3.697  -1.907  29.788 1.00 21.34  ? 85   PHE D CE1 1 
ATOM   3915 C  CE2 . PHE C 2 85  ? -3.443  -2.542  32.085 1.00 25.48  ? 85   PHE D CE2 1 
ATOM   3916 C  CZ  . PHE C 2 85  ? -4.184  -1.952  31.080 1.00 26.12  ? 85   PHE D CZ  1 
ATOM   3917 N  N   . ALA C 2 86  ? 1.298   -6.450  28.671 1.00 17.86  ? 86   ALA D N   1 
ATOM   3918 C  CA  . ALA C 2 86  ? 2.558   -6.760  28.012 1.00 22.70  ? 86   ALA D CA  1 
ATOM   3919 C  C   . ALA C 2 86  ? 2.590   -6.374  26.541 1.00 21.98  ? 86   ALA D C   1 
ATOM   3920 O  O   . ALA C 2 86  ? 3.509   -5.703  26.065 1.00 18.79  ? 86   ALA D O   1 
ATOM   3921 C  CB  . ALA C 2 86  ? 2.849   -8.252  28.153 1.00 23.35  ? 86   ALA D CB  1 
ATOM   3922 N  N   . THR C 2 87  ? 1.586   -6.797  25.767 1.00 17.04  ? 87   THR D N   1 
ATOM   3923 C  CA  . THR C 2 87  ? 1.607   -6.488  24.335 1.00 17.25  ? 87   THR D CA  1 
ATOM   3924 C  C   . THR C 2 87  ? 1.532   -4.998  24.051 1.00 20.97  ? 87   THR D C   1 
ATOM   3925 O  O   . THR C 2 87  ? 2.250   -4.459  23.194 1.00 24.74  ? 87   THR D O   1 
ATOM   3926 C  CB  . THR C 2 87  ? 0.445   -7.230  23.642 1.00 21.11  ? 87   THR D CB  1 
ATOM   3927 O  OG1 . THR C 2 87  ? 0.663   -8.637  23.809 1.00 23.51  ? 87   THR D OG1 1 
ATOM   3928 C  CG2 . THR C 2 87  ? 0.415   -6.929  22.158 1.00 20.62  ? 87   THR D CG2 1 
ATOM   3929 N  N   . LEU C 2 88  ? 0.674   -4.268  24.761 1.00 18.90  ? 88   LEU D N   1 
ATOM   3930 C  CA  . LEU C 2 88  ? 0.653   -2.815  24.598 1.00 13.19  ? 88   LEU D CA  1 
ATOM   3931 C  C   . LEU C 2 88  ? 1.928   -2.148  25.097 1.00 15.98  ? 88   LEU D C   1 
ATOM   3932 O  O   . LEU C 2 88  ? 2.320   -1.096  24.565 1.00 21.49  ? 88   LEU D O   1 
ATOM   3933 C  CB  . LEU C 2 88  ? -0.566  -2.216  25.315 1.00 19.04  ? 88   LEU D CB  1 
ATOM   3934 C  CG  . LEU C 2 88  ? -1.919  -2.573  24.679 1.00 25.06  ? 88   LEU D CG  1 
ATOM   3935 C  CD1 . LEU C 2 88  ? -3.060  -2.021  25.522 1.00 21.50  ? 88   LEU D CD1 1 
ATOM   3936 C  CD2 . LEU C 2 88  ? -1.990  -2.063  23.251 1.00 21.36  ? 88   LEU D CD2 1 
ATOM   3937 N  N   . SER C 2 89  ? 2.601   -2.695  26.105 1.00 17.08  ? 89   SER D N   1 
ATOM   3938 C  CA  . SER C 2 89  ? 3.884   -2.122  26.538 1.00 15.45  ? 89   SER D CA  1 
ATOM   3939 C  C   . SER C 2 89  ? 4.916   -2.143  25.426 1.00 18.23  ? 89   SER D C   1 
ATOM   3940 O  O   . SER C 2 89  ? 5.583   -1.152  25.115 1.00 17.79  ? 89   SER D O   1 
ATOM   3941 C  CB  . SER C 2 89  ? 4.421   -2.865  27.762 1.00 16.08  ? 89   SER D CB  1 
ATOM   3942 O  OG  . SER C 2 89  ? 5.644   -2.306  28.208 1.00 17.46  ? 89   SER D OG  1 
ATOM   3943 N  N   . GLU C 2 90  ? 5.065   -3.319  24.817 1.00 20.04  ? 90   GLU D N   1 
ATOM   3944 C  CA  . GLU C 2 90  ? 5.972   -3.466  23.681 1.00 19.46  ? 90   GLU D CA  1 
ATOM   3945 C  C   . GLU C 2 90  ? 5.593   -2.532  22.543 1.00 16.22  ? 90   GLU D C   1 
ATOM   3946 O  O   . GLU C 2 90  ? 6.470   -1.925  21.922 1.00 22.48  ? 90   GLU D O   1 
ATOM   3947 C  CB  . GLU C 2 90  ? 5.962   -4.925  23.198 1.00 20.42  ? 90   GLU D CB  1 
ATOM   3948 C  CG  . GLU C 2 90  ? 6.374   -5.930  24.255 1.00 29.16  ? 90   GLU D CG  1 
ATOM   3949 C  CD  . GLU C 2 90  ? 7.063   -7.151  23.671 1.00 47.00  ? 90   GLU D CD  1 
ATOM   3950 O  OE1 . GLU C 2 90  ? 6.817   -7.460  22.482 1.00 47.71  ? 90   GLU D OE1 1 
ATOM   3951 O  OE2 . GLU C 2 90  ? 7.854   -7.798  24.395 1.00 69.04  ? 90   GLU D OE2 1 
ATOM   3952 N  N   . LEU C 2 91  ? 4.295   -2.387  22.250 1.00 14.65  ? 91   LEU D N   1 
ATOM   3953 C  CA  . LEU C 2 91  ? 3.910   -1.478  21.171 1.00 16.70  ? 91   LEU D CA  1 
ATOM   3954 C  C   . LEU C 2 91  ? 4.360   -0.062  21.489 1.00 20.38  ? 91   LEU D C   1 
ATOM   3955 O  O   . LEU C 2 91  ? 4.869   0.676   20.643 1.00 16.93  ? 91   LEU D O   1 
ATOM   3956 C  CB  . LEU C 2 91  ? 2.396   -1.534  20.956 1.00 16.08  ? 91   LEU D CB  1 
ATOM   3957 C  CG  . LEU C 2 91  ? 1.778   -0.547  19.970 1.00 18.98  ? 91   LEU D CG  1 
ATOM   3958 C  CD1 . LEU C 2 91  ? 2.039   -0.994  18.534 1.00 30.91  ? 91   LEU D CD1 1 
ATOM   3959 C  CD2 . LEU C 2 91  ? 0.284   -0.397  20.216 1.00 25.90  ? 91   LEU D CD2 1 
ATOM   3960 N  N   . HIS C 2 92  ? 4.151   0.337   22.756 1.00 17.33  ? 92   HIS D N   1 
ATOM   3961 C  CA  . HIS C 2 92  ? 4.396   1.744   23.063 1.00 13.39  ? 92   HIS D CA  1 
ATOM   3962 C  C   . HIS C 2 92  ? 5.890   2.030   23.039 1.00 19.62  ? 92   HIS D C   1 
ATOM   3963 O  O   . HIS C 2 92  ? 6.346   3.119   22.701 1.00 19.32  ? 92   HIS D O   1 
ATOM   3964 C  CB  . HIS C 2 92  ? 3.763   2.122   24.405 1.00 12.53  ? 92   HIS D CB  1 
ATOM   3965 C  CG  . HIS C 2 92  ? 2.315   2.484   24.285 1.00 15.31  ? 92   HIS D CG  1 
ATOM   3966 N  ND1 . HIS C 2 92  ? 1.293   1.546   24.267 1.00 18.05  ? 92   HIS D ND1 1 
ATOM   3967 C  CD2 . HIS C 2 92  ? 1.713   3.689   24.190 1.00 16.31  ? 92   HIS D CD2 1 
ATOM   3968 C  CE1 . HIS C 2 92  ? 0.131   2.177   24.157 1.00 18.66  ? 92   HIS D CE1 1 
ATOM   3969 N  NE2 . HIS C 2 92  ? 0.361   3.484   24.101 1.00 18.18  ? 92   HIS D NE2 1 
ATOM   3970 N  N   . CYS C 2 93  ? 6.693   1.023   23.383 1.00 18.00  ? 93   CYS D N   1 
ATOM   3971 C  CA  . CYS C 2 93  ? 8.140   1.241   23.309 1.00 17.50  ? 93   CYS D CA  1 
ATOM   3972 C  C   . CYS C 2 93  ? 8.653   1.147   21.873 1.00 20.04  ? 93   CYS D C   1 
ATOM   3973 O  O   . CYS C 2 93  ? 9.205   2.104   21.344 1.00 18.47  ? 93   CYS D O   1 
ATOM   3974 C  CB  . CYS C 2 93  ? 8.853   0.224   24.191 1.00 19.23  ? 93   CYS D CB  1 
ATOM   3975 S  SG  . CYS C 2 93  ? 10.657  0.287   24.150 1.00 21.16  ? 93   CYS D SG  1 
ATOM   3976 N  N   . ASP C 2 94  ? 8.496   -0.008  21.247 1.00 19.23  ? 94   ASP D N   1 
ATOM   3977 C  CA  . ASP C 2 94  ? 9.141   -0.359  19.991 1.00 22.33  ? 94   ASP D CA  1 
ATOM   3978 C  C   . ASP C 2 94  ? 8.586   0.361   18.772 1.00 22.49  ? 94   ASP D C   1 
ATOM   3979 O  O   . ASP C 2 94  ? 9.336   0.721   17.861 1.00 21.29  ? 94   ASP D O   1 
ATOM   3980 C  CB  . ASP C 2 94  ? 9.009   -1.871  19.747 1.00 16.52  ? 94   ASP D CB  1 
ATOM   3981 C  CG  . ASP C 2 94  ? 9.816   -2.692  20.727 1.00 31.72  ? 94   ASP D CG  1 
ATOM   3982 O  OD1 . ASP C 2 94  ? 10.751  -2.136  21.339 1.00 34.46  ? 94   ASP D OD1 1 
ATOM   3983 O  OD2 . ASP C 2 94  ? 9.503   -3.893  20.882 1.00 42.09  ? 94   ASP D OD2 1 
ATOM   3984 N  N   . LYS C 2 95  ? 7.275   0.563   18.707 1.00 16.11  ? 95   LYS D N   1 
ATOM   3985 C  CA  . LYS C 2 95  ? 6.683   1.204   17.543 1.00 21.91  ? 95   LYS D CA  1 
ATOM   3986 C  C   . LYS C 2 95  ? 6.343   2.665   17.767 1.00 21.80  ? 95   LYS D C   1 
ATOM   3987 O  O   . LYS C 2 95  ? 6.530   3.512   16.892 1.00 23.39  ? 95   LYS D O   1 
ATOM   3988 C  CB  . LYS C 2 95  ? 5.428   0.418   17.128 1.00 30.89  ? 95   LYS D CB  1 
ATOM   3989 C  CG  . LYS C 2 95  ? 5.736   -1.051  16.844 1.00 42.79  ? 95   LYS D CG  1 
ATOM   3990 C  CD  . LYS C 2 95  ? 6.576   -1.180  15.583 1.00 54.50  ? 95   LYS D CD  1 
ATOM   3991 C  CE  . LYS C 2 95  ? 6.687   -2.629  15.130 1.00 61.28  ? 95   LYS D CE  1 
ATOM   3992 N  NZ  . LYS C 2 95  ? 8.096   -2.978  14.779 1.00 62.15  ? 95   LYS D NZ  1 
ATOM   3993 N  N   . LEU C 2 96  ? 5.817   3.038   18.929 1.00 16.45  ? 96   LEU D N   1 
ATOM   3994 C  CA  . LEU C 2 96  ? 5.311   4.390   19.113 1.00 15.81  ? 96   LEU D CA  1 
ATOM   3995 C  C   . LEU C 2 96  ? 6.343   5.321   19.735 1.00 12.40  ? 96   LEU D C   1 
ATOM   3996 O  O   . LEU C 2 96  ? 6.197   6.528   19.576 1.00 16.75  ? 96   LEU D O   1 
ATOM   3997 C  CB  . LEU C 2 96  ? 4.054   4.351   20.003 1.00 14.64  ? 96   LEU D CB  1 
ATOM   3998 C  CG  . LEU C 2 96  ? 2.922   3.456   19.491 1.00 13.92  ? 96   LEU D CG  1 
ATOM   3999 C  CD1 . LEU C 2 96  ? 1.751   3.479   20.463 1.00 18.89  ? 96   LEU D CD1 1 
ATOM   4000 C  CD2 . LEU C 2 96  ? 2.519   3.907   18.095 1.00 25.20  ? 96   LEU D CD2 1 
ATOM   4001 N  N   . HIS C 2 97  ? 7.338   4.759   20.396 1.00 16.50  ? 97   HIS D N   1 
ATOM   4002 C  CA  . HIS C 2 97  ? 8.410   5.509   21.043 1.00 19.23  ? 97   HIS D CA  1 
ATOM   4003 C  C   . HIS C 2 97  ? 7.874   6.470   22.099 1.00 19.26  ? 97   HIS D C   1 
ATOM   4004 O  O   . HIS C 2 97  ? 8.282   7.629   22.152 1.00 18.08  ? 97   HIS D O   1 
ATOM   4005 C  CB  . HIS C 2 97  ? 9.240   6.296   20.017 1.00 19.74  ? 97   HIS D CB  1 
ATOM   4006 C  CG  . HIS C 2 97  ? 9.669   5.446   18.860 1.00 23.24  ? 97   HIS D CG  1 
ATOM   4007 N  ND1 . HIS C 2 97  ? 10.455  4.328   19.026 1.00 22.38  ? 97   HIS D ND1 1 
ATOM   4008 C  CD2 . HIS C 2 97  ? 9.405   5.527   17.537 1.00 27.12  ? 97   HIS D CD2 1 
ATOM   4009 C  CE1 . HIS C 2 97  ? 10.670  3.758   17.852 1.00 22.85  ? 97   HIS D CE1 1 
ATOM   4010 N  NE2 . HIS C 2 97  ? 10.043  4.471   16.938 1.00 23.29  ? 97   HIS D NE2 1 
ATOM   4011 N  N   . VAL C 2 98  ? 6.947   6.007   22.938 1.00 14.80  ? 98   VAL D N   1 
ATOM   4012 C  CA  . VAL C 2 98  ? 6.370   6.893   23.953 1.00 16.38  ? 98   VAL D CA  1 
ATOM   4013 C  C   . VAL C 2 98  ? 7.129   6.819   25.278 1.00 12.45  ? 98   VAL D C   1 
ATOM   4014 O  O   . VAL C 2 98  ? 7.216   5.745   25.863 1.00 17.33  ? 98   VAL D O   1 
ATOM   4015 C  CB  . VAL C 2 98  ? 4.893   6.521   24.185 1.00 15.50  ? 98   VAL D CB  1 
ATOM   4016 C  CG1 . VAL C 2 98  ? 4.290   7.309   25.334 1.00 22.68  ? 98   VAL D CG1 1 
ATOM   4017 C  CG2 . VAL C 2 98  ? 4.110   6.759   22.892 1.00 17.73  ? 98   VAL D CG2 1 
ATOM   4018 N  N   . ASP C 2 99  ? 7.654   7.947   25.739 1.00 13.87  ? 99   ASP D N   1 
ATOM   4019 C  CA  . ASP C 2 99  ? 8.307   8.024   27.051 1.00 15.69  ? 99   ASP D CA  1 
ATOM   4020 C  C   . ASP C 2 99  ? 7.296   7.635   28.120 1.00 11.24  ? 99   ASP D C   1 
ATOM   4021 O  O   . ASP C 2 99  ? 6.218   8.233   28.168 1.00 16.89  ? 99   ASP D O   1 
ATOM   4022 C  CB  . ASP C 2 99  ? 8.791   9.455   27.259 1.00 14.60  ? 99   ASP D CB  1 
ATOM   4023 C  CG  . ASP C 2 99  ? 9.541   9.757   28.529 1.00 15.18  ? 99   ASP D CG  1 
ATOM   4024 O  OD1 . ASP C 2 99  ? 9.752   8.876   29.391 1.00 18.82  ? 99   ASP D OD1 1 
ATOM   4025 O  OD2 . ASP C 2 99  ? 9.928   10.948  28.639 1.00 16.04  ? 99   ASP D OD2 1 
ATOM   4026 N  N   . PRO C 2 100 ? 7.600   6.632   28.924 1.00 13.27  ? 100  PRO D N   1 
ATOM   4027 C  CA  . PRO C 2 100 ? 6.663   6.182   29.958 1.00 18.01  ? 100  PRO D CA  1 
ATOM   4028 C  C   . PRO C 2 100 ? 6.279   7.248   30.967 1.00 14.99  ? 100  PRO D C   1 
ATOM   4029 O  O   . PRO C 2 100 ? 5.260   7.099   31.646 1.00 13.74  ? 100  PRO D O   1 
ATOM   4030 C  CB  . PRO C 2 100 ? 7.426   5.044   30.655 1.00 23.87  ? 100  PRO D CB  1 
ATOM   4031 C  CG  . PRO C 2 100 ? 8.413   4.588   29.634 1.00 19.30  ? 100  PRO D CG  1 
ATOM   4032 C  CD  . PRO C 2 100 ? 8.820   5.810   28.865 1.00 13.34  ? 100  PRO D CD  1 
ATOM   4033 N  N   . GLU C 2 101 ? 7.052   8.324   31.101 1.00 13.97  ? 101  GLU D N   1 
ATOM   4034 C  CA  . GLU C 2 101 ? 6.592   9.409   31.964 1.00 17.29  ? 101  GLU D CA  1 
ATOM   4035 C  C   . GLU C 2 101 ? 5.203   9.890   31.566 1.00 16.54  ? 101  GLU D C   1 
ATOM   4036 O  O   . GLU C 2 101 ? 4.408   10.327  32.404 1.00 16.61  ? 101  GLU D O   1 
ATOM   4037 C  CB  . GLU C 2 101 ? 7.602   10.560  31.945 1.00 22.22  ? 101  GLU D CB  1 
ATOM   4038 C  CG  . GLU C 2 101 ? 7.161   11.756  32.777 1.00 31.95  ? 101  GLU D CG  1 
ATOM   4039 C  CD  . GLU C 2 101 ? 7.093   11.440  34.260 1.00 39.08  ? 101  GLU D CD  1 
ATOM   4040 O  OE1 . GLU C 2 101 ? 7.811   10.530  34.725 1.00 26.45  ? 101  GLU D OE1 1 
ATOM   4041 O  OE2 . GLU C 2 101 ? 6.304   12.115  34.958 1.00 47.13  ? 101  GLU D OE2 1 
ATOM   4042 N  N   . ASN C 2 102 ? 4.860   9.802   30.282 1.00 15.64  ? 102  ASN D N   1 
ATOM   4043 C  CA  . ASN C 2 102 ? 3.531   10.198  29.816 1.00 17.36  ? 102  ASN D CA  1 
ATOM   4044 C  C   . ASN C 2 102 ? 2.402   9.389   30.442 1.00 15.61  ? 102  ASN D C   1 
ATOM   4045 O  O   . ASN C 2 102 ? 1.288   9.908   30.630 1.00 14.10  ? 102  ASN D O   1 
ATOM   4046 C  CB  . ASN C 2 102 ? 3.475   10.060  28.287 1.00 17.15  ? 102  ASN D CB  1 
ATOM   4047 C  CG  . ASN C 2 102 ? 4.316   11.123  27.606 1.00 18.32  ? 102  ASN D CG  1 
ATOM   4048 O  OD1 . ASN C 2 102 ? 3.932   12.286  27.657 1.00 19.09  ? 102  ASN D OD1 1 
ATOM   4049 N  ND2 . ASN C 2 102 ? 5.438   10.736  27.013 1.00 16.57  ? 102  ASN D ND2 1 
ATOM   4050 N  N   . PHE C 2 103 ? 2.630   8.132   30.787 1.00 14.97  ? 103  PHE D N   1 
ATOM   4051 C  CA  . PHE C 2 103 ? 1.608   7.317   31.436 1.00 14.03  ? 103  PHE D CA  1 
ATOM   4052 C  C   . PHE C 2 103 ? 1.322   7.841   32.845 1.00 18.95  ? 103  PHE D C   1 
ATOM   4053 O  O   . PHE C 2 103 ? 0.175   7.771   33.295 1.00 15.70  ? 103  PHE D O   1 
ATOM   4054 C  CB  . PHE C 2 103 ? 2.006   5.847   31.531 1.00 11.59  ? 103  PHE D CB  1 
ATOM   4055 C  CG  . PHE C 2 103 ? 2.425   5.210   30.209 1.00 16.82  ? 103  PHE D CG  1 
ATOM   4056 C  CD1 . PHE C 2 103 ? 1.737   5.470   29.034 1.00 20.26  ? 103  PHE D CD1 1 
ATOM   4057 C  CD2 . PHE C 2 103 ? 3.511   4.356   30.166 1.00 17.61  ? 103  PHE D CD2 1 
ATOM   4058 C  CE1 . PHE C 2 103 ? 2.138   4.874   27.851 1.00 26.03  ? 103  PHE D CE1 1 
ATOM   4059 C  CE2 . PHE C 2 103 ? 3.924   3.756   28.990 1.00 18.79  ? 103  PHE D CE2 1 
ATOM   4060 C  CZ  . PHE C 2 103 ? 3.236   4.031   27.821 1.00 26.87  ? 103  PHE D CZ  1 
ATOM   4061 N  N   . ARG C 2 104 ? 2.347   8.355   33.523 1.00 11.18  ? 104  ARG D N   1 
ATOM   4062 C  CA  . ARG C 2 104 ? 2.144   8.914   34.852 1.00 12.08  ? 104  ARG D CA  1 
ATOM   4063 C  C   . ARG C 2 104 ? 1.434   10.260  34.789 1.00 18.09  ? 104  ARG D C   1 
ATOM   4064 O  O   . ARG C 2 104 ? 0.590   10.567  35.635 1.00 18.16  ? 104  ARG D O   1 
ATOM   4065 C  CB  . ARG C 2 104 ? 3.488   9.077   35.562 1.00 20.33  ? 104  ARG D CB  1 
ATOM   4066 C  CG  . ARG C 2 104 ? 4.240   7.760   35.716 1.00 21.89  ? 104  ARG D CG  1 
ATOM   4067 C  CD  . ARG C 2 104 ? 5.722   7.977   35.471 1.00 41.01  ? 104  ARG D CD  1 
ATOM   4068 N  NE  . ARG C 2 104 ? 6.550   7.388   36.518 1.00 65.58  ? 104  ARG D NE  1 
ATOM   4069 C  CZ  . ARG C 2 104 ? 6.721   6.090   36.726 1.00 84.91  ? 104  ARG D CZ  1 
ATOM   4070 N  NH1 . ARG C 2 104 ? 6.116   5.198   35.950 1.00 103.81 ? 104  ARG D NH1 1 
ATOM   4071 N  NH2 . ARG C 2 104 ? 7.503   5.674   37.716 1.00 100.87 ? 104  ARG D NH2 1 
ATOM   4072 N  N   . LEU C 2 105 ? 1.755   11.074  33.782 1.00 19.29  ? 105  LEU D N   1 
ATOM   4073 C  CA  . LEU C 2 105 ? 1.032   12.319  33.579 1.00 13.49  ? 105  LEU D CA  1 
ATOM   4074 C  C   . LEU C 2 105 ? -0.442  12.043  33.282 1.00 13.27  ? 105  LEU D C   1 
ATOM   4075 O  O   . LEU C 2 105 ? -1.301  12.759  33.808 1.00 14.52  ? 105  LEU D O   1 
ATOM   4076 C  CB  . LEU C 2 105 ? 1.602   13.143  32.424 1.00 15.89  ? 105  LEU D CB  1 
ATOM   4077 C  CG  . LEU C 2 105 ? 3.015   13.712  32.594 1.00 14.83  ? 105  LEU D CG  1 
ATOM   4078 C  CD1 . LEU C 2 105 ? 3.398   14.530  31.366 1.00 16.47  ? 105  LEU D CD1 1 
ATOM   4079 C  CD2 . LEU C 2 105 ? 3.113   14.557  33.854 1.00 23.16  ? 105  LEU D CD2 1 
ATOM   4080 N  N   . LEU C 2 106 ? -0.724  11.049  32.447 1.00 10.62  ? 106  LEU D N   1 
ATOM   4081 C  CA  . LEU C 2 106 ? -2.129  10.732  32.160 1.00 12.57  ? 106  LEU D CA  1 
ATOM   4082 C  C   . LEU C 2 106 ? -2.865  10.307  33.428 1.00 16.05  ? 106  LEU D C   1 
ATOM   4083 O  O   . LEU C 2 106 ? -4.038  10.638  33.633 1.00 12.87  ? 106  LEU D O   1 
ATOM   4084 C  CB  . LEU C 2 106 ? -2.247  9.640   31.091 1.00 15.15  ? 106  LEU D CB  1 
ATOM   4085 C  CG  . LEU C 2 106 ? -3.653  9.269   30.616 1.00 18.45  ? 106  LEU D CG  1 
ATOM   4086 C  CD1 . LEU C 2 106 ? -4.412  10.475  30.091 1.00 24.78  ? 106  LEU D CD1 1 
ATOM   4087 C  CD2 . LEU C 2 106 ? -3.588  8.198   29.540 1.00 21.21  ? 106  LEU D CD2 1 
ATOM   4088 N  N   . GLY C 2 107 ? -2.176  9.544   34.275 1.00 16.72  ? 107  GLY D N   1 
ATOM   4089 C  CA  . GLY C 2 107 ? -2.723  9.101   35.546 1.00 15.45  ? 107  GLY D CA  1 
ATOM   4090 C  C   . GLY C 2 107 ? -3.158  10.270  36.412 1.00 14.43  ? 107  GLY D C   1 
ATOM   4091 O  O   . GLY C 2 107 ? -4.258  10.258  36.970 1.00 17.96  ? 107  GLY D O   1 
ATOM   4092 N  N   . LYS C 2 108 ? -2.302  11.278  36.544 1.00 14.62  ? 108  LYS D N   1 
ATOM   4093 C  CA  . LYS C 2 108 ? -2.608  12.448  37.350 1.00 18.23  ? 108  LYS D CA  1 
ATOM   4094 C  C   . LYS C 2 108 ? -3.855  13.165  36.834 1.00 14.03  ? 108  LYS D C   1 
ATOM   4095 O  O   . LYS C 2 108 ? -4.706  13.612  37.605 1.00 12.78  ? 108  LYS D O   1 
ATOM   4096 C  CB  . LYS C 2 108 ? -1.451  13.457  37.333 1.00 22.71  ? 108  LYS D CB  1 
ATOM   4097 C  CG  . LYS C 2 108 ? -0.285  13.099  38.239 1.00 27.71  ? 108  LYS D CG  1 
ATOM   4098 C  CD  . LYS C 2 108 ? 0.894   14.023  37.962 1.00 36.05  ? 108  LYS D CD  1 
ATOM   4099 C  CE  . LYS C 2 108 ? 0.524   15.477  38.205 1.00 34.90  ? 108  LYS D CE  1 
ATOM   4100 N  NZ  . LYS C 2 108 ? 1.713   16.372  38.112 1.00 40.33  ? 108  LYS D NZ  1 
ATOM   4101 N  N   . VAL C 2 109 ? -3.906  13.315  35.515 1.00 13.70  ? 109  VAL D N   1 
ATOM   4102 C  CA  . VAL C 2 109 ? -5.041  14.017  34.904 1.00 13.10  ? 109  VAL D CA  1 
ATOM   4103 C  C   . VAL C 2 109 ? -6.310  13.220  35.084 1.00 11.09  ? 109  VAL D C   1 
ATOM   4104 O  O   . VAL C 2 109 ? -7.374  13.761  35.391 1.00 13.11  ? 109  VAL D O   1 
ATOM   4105 C  CB  . VAL C 2 109 ? -4.779  14.292  33.411 1.00 21.67  ? 109  VAL D CB  1 
ATOM   4106 C  CG1 . VAL C 2 109 ? -6.036  14.753  32.693 1.00 20.91  ? 109  VAL D CG1 1 
ATOM   4107 C  CG2 . VAL C 2 109 ? -3.679  15.337  33.277 1.00 19.72  ? 109  VAL D CG2 1 
ATOM   4108 N  N   . LEU C 2 110 ? -6.216  11.897  34.916 1.00 13.19  ? 110  LEU D N   1 
ATOM   4109 C  CA  . LEU C 2 110 ? -7.403  11.071  35.118 1.00 15.73  ? 110  LEU D CA  1 
ATOM   4110 C  C   . LEU C 2 110 ? -7.960  11.209  36.530 1.00 13.90  ? 110  LEU D C   1 
ATOM   4111 O  O   . LEU C 2 110 ? -9.180  11.257  36.721 1.00 14.83  ? 110  LEU D O   1 
ATOM   4112 C  CB  . LEU C 2 110 ? -7.059  9.605   34.823 1.00 18.21  ? 110  LEU D CB  1 
ATOM   4113 C  CG  . LEU C 2 110 ? -8.201  8.602   35.004 1.00 16.61  ? 110  LEU D CG  1 
ATOM   4114 C  CD1 . LEU C 2 110 ? -9.397  8.981   34.143 1.00 15.25  ? 110  LEU D CD1 1 
ATOM   4115 C  CD2 . LEU C 2 110 ? -7.730  7.190   34.662 1.00 20.08  ? 110  LEU D CD2 1 
ATOM   4116 N  N   . VAL C 2 111 ? -7.092  11.274  37.535 1.00 9.47   ? 111  VAL D N   1 
ATOM   4117 C  CA  . VAL C 2 111 ? -7.569  11.430  38.916 1.00 15.54  ? 111  VAL D CA  1 
ATOM   4118 C  C   . VAL C 2 111 ? -8.290  12.766  39.063 1.00 16.95  ? 111  VAL D C   1 
ATOM   4119 O  O   . VAL C 2 111 ? -9.385  12.843  39.632 1.00 16.99  ? 111  VAL D O   1 
ATOM   4120 C  CB  . VAL C 2 111 ? -6.406  11.294  39.910 1.00 14.36  ? 111  VAL D CB  1 
ATOM   4121 C  CG1 . VAL C 2 111 ? -6.806  11.671  41.328 1.00 17.39  ? 111  VAL D CG1 1 
ATOM   4122 C  CG2 . VAL C 2 111 ? -5.858  9.866   39.880 1.00 16.36  ? 111  VAL D CG2 1 
ATOM   4123 N  N   . CYS C 2 112 ? -7.713  13.836  38.520 1.00 14.12  ? 112  CYS D N   1 
ATOM   4124 C  CA  . CYS C 2 112 ? -8.393  15.122  38.503 1.00 9.80   ? 112  CYS D CA  1 
ATOM   4125 C  C   . CYS C 2 112 ? -9.751  15.094  37.811 1.00 14.31  ? 112  CYS D C   1 
ATOM   4126 O  O   . CYS C 2 112 ? -10.698 15.740  38.276 1.00 15.99  ? 112  CYS D O   1 
ATOM   4127 C  CB  . CYS C 2 112 ? -7.536  16.193  37.819 1.00 15.84  ? 112  CYS D CB  1 
ATOM   4128 S  SG  . CYS C 2 112 ? -6.091  16.689  38.790 1.00 19.98  ? 112  CYS D SG  1 
ATOM   4129 N  N   . VAL C 2 113 ? -9.845  14.388  36.693 1.00 15.78  ? 113  VAL D N   1 
ATOM   4130 C  CA  . VAL C 2 113 ? -11.112 14.293  35.960 1.00 11.86  ? 113  VAL D CA  1 
ATOM   4131 C  C   . VAL C 2 113 ? -12.155 13.541  36.758 1.00 10.70  ? 113  VAL D C   1 
ATOM   4132 O  O   . VAL C 2 113 ? -13.345 13.899  36.809 1.00 14.68  ? 113  VAL D O   1 
ATOM   4133 C  CB  . VAL C 2 113 ? -10.859 13.596  34.605 1.00 17.75  ? 113  VAL D CB  1 
ATOM   4134 C  CG1 . VAL C 2 113 ? -12.172 13.146  33.975 1.00 22.54  ? 113  VAL D CG1 1 
ATOM   4135 C  CG2 . VAL C 2 113 ? -10.109 14.536  33.672 1.00 17.22  ? 113  VAL D CG2 1 
ATOM   4136 N  N   . LEU C 2 114 ? -11.754 12.444  37.408 1.00 15.00  ? 114  LEU D N   1 
ATOM   4137 C  CA  . LEU C 2 114 ? -12.745 11.725  38.224 1.00 14.88  ? 114  LEU D CA  1 
ATOM   4138 C  C   . LEU C 2 114 ? -13.218 12.627  39.354 1.00 17.07  ? 114  LEU D C   1 
ATOM   4139 O  O   . LEU C 2 114 ? -14.397 12.680  39.705 1.00 16.17  ? 114  LEU D O   1 
ATOM   4140 C  CB  . LEU C 2 114 ? -12.170 10.418  38.763 1.00 13.54  ? 114  LEU D CB  1 
ATOM   4141 C  CG  . LEU C 2 114 ? -11.705 9.444   37.665 1.00 20.89  ? 114  LEU D CG  1 
ATOM   4142 C  CD1 . LEU C 2 114 ? -10.931 8.279   38.255 1.00 21.26  ? 114  LEU D CD1 1 
ATOM   4143 C  CD2 . LEU C 2 114 ? -12.908 8.969   36.865 1.00 20.92  ? 114  LEU D CD2 1 
ATOM   4144 N  N   . ALA C 2 115 ? -12.282 13.378  39.936 1.00 13.23  ? 115  ALA D N   1 
ATOM   4145 C  CA  . ALA C 2 115 ? -12.701 14.254  41.045 1.00 14.95  ? 115  ALA D CA  1 
ATOM   4146 C  C   . ALA C 2 115 ? -13.666 15.325  40.540 1.00 20.05  ? 115  ALA D C   1 
ATOM   4147 O  O   . ALA C 2 115 ? -14.635 15.692  41.207 1.00 16.63  ? 115  ALA D O   1 
ATOM   4148 C  CB  . ALA C 2 115 ? -11.472 14.872  41.699 1.00 12.14  ? 115  ALA D CB  1 
ATOM   4149 N  N   . HIS C 2 116 ? -13.430 15.822  39.327 1.00 16.33  ? 116  HIS D N   1 
ATOM   4150 C  CA  . HIS C 2 116 ? -14.260 16.892  38.764 1.00 15.42  ? 116  HIS D CA  1 
ATOM   4151 C  C   . HIS C 2 116 ? -15.652 16.377  38.437 1.00 17.08  ? 116  HIS D C   1 
ATOM   4152 O  O   . HIS C 2 116 ? -16.671 17.038  38.675 1.00 17.20  ? 116  HIS D O   1 
ATOM   4153 C  CB  . HIS C 2 116 ? -13.574 17.471  37.511 1.00 16.82  ? 116  HIS D CB  1 
ATOM   4154 C  CG  . HIS C 2 116 ? -14.333 18.605  36.894 1.00 20.34  ? 116  HIS D CG  1 
ATOM   4155 N  ND1 . HIS C 2 116 ? -14.578 18.693  35.544 1.00 29.96  ? 116  HIS D ND1 1 
ATOM   4156 C  CD2 . HIS C 2 116 ? -14.925 19.691  37.444 1.00 27.97  ? 116  HIS D CD2 1 
ATOM   4157 C  CE1 . HIS C 2 116 ? -15.274 19.788  35.289 1.00 22.13  ? 116  HIS D CE1 1 
ATOM   4158 N  NE2 . HIS C 2 116 ? -15.502 20.417  36.424 1.00 24.41  ? 116  HIS D NE2 1 
ATOM   4159 N  N   . HIS C 2 117 ? -15.675 15.167  37.875 1.00 16.76  ? 117  HIS D N   1 
ATOM   4160 C  CA  . HIS C 2 117 ? -16.943 14.570  37.449 1.00 15.82  ? 117  HIS D CA  1 
ATOM   4161 C  C   . HIS C 2 117 ? -17.785 14.140  38.637 1.00 17.74  ? 117  HIS D C   1 
ATOM   4162 O  O   . HIS C 2 117 ? -19.007 14.334  38.671 1.00 16.44  ? 117  HIS D O   1 
ATOM   4163 C  CB  . HIS C 2 117 ? -16.650 13.376  36.528 1.00 17.49  ? 117  HIS D CB  1 
ATOM   4164 C  CG  . HIS C 2 117 ? -17.902 12.738  36.005 1.00 29.95  ? 117  HIS D CG  1 
ATOM   4165 N  ND1 . HIS C 2 117 ? -18.713 13.354  35.081 1.00 34.24  ? 117  HIS D ND1 1 
ATOM   4166 C  CD2 . HIS C 2 117 ? -18.492 11.556  36.287 1.00 36.67  ? 117  HIS D CD2 1 
ATOM   4167 C  CE1 . HIS C 2 117 ? -19.744 12.575  34.805 1.00 31.00  ? 117  HIS D CE1 1 
ATOM   4168 N  NE2 . HIS C 2 117 ? -19.634 11.474  35.525 1.00 34.57  ? 117  HIS D NE2 1 
ATOM   4169 N  N   . PHE C 2 118 ? -17.154 13.538  39.651 1.00 14.32  ? 118  PHE D N   1 
ATOM   4170 C  CA  . PHE C 2 118 ? -17.933 12.919  40.721 1.00 17.99  ? 118  PHE D CA  1 
ATOM   4171 C  C   . PHE C 2 118 ? -18.047 13.758  41.980 1.00 15.73  ? 118  PHE D C   1 
ATOM   4172 O  O   . PHE C 2 118 ? -18.828 13.425  42.881 1.00 22.36  ? 118  PHE D O   1 
ATOM   4173 C  CB  . PHE C 2 118 ? -17.331 11.551  41.079 1.00 16.26  ? 118  PHE D CB  1 
ATOM   4174 C  CG  . PHE C 2 118 ? -17.613 10.519  39.994 1.00 20.44  ? 118  PHE D CG  1 
ATOM   4175 C  CD1 . PHE C 2 118 ? -18.902 10.051  39.806 1.00 22.33  ? 118  PHE D CD1 1 
ATOM   4176 C  CD2 . PHE C 2 118 ? -16.599 10.039  39.177 1.00 19.08  ? 118  PHE D CD2 1 
ATOM   4177 C  CE1 . PHE C 2 118 ? -19.173 9.106   38.841 1.00 22.86  ? 118  PHE D CE1 1 
ATOM   4178 C  CE2 . PHE C 2 118 ? -16.868 9.102   38.196 1.00 26.26  ? 118  PHE D CE2 1 
ATOM   4179 C  CZ  . PHE C 2 118 ? -18.163 8.649   38.006 1.00 28.02  ? 118  PHE D CZ  1 
ATOM   4180 N  N   . GLY C 2 119 ? -17.279 14.835  42.081 1.00 18.88  ? 119  GLY D N   1 
ATOM   4181 C  CA  . GLY C 2 119 ? -17.382 15.695  43.254 1.00 21.02  ? 119  GLY D CA  1 
ATOM   4182 C  C   . GLY C 2 119 ? -17.156 14.988  44.573 1.00 20.89  ? 119  GLY D C   1 
ATOM   4183 O  O   . GLY C 2 119 ? -16.193 14.244  44.778 1.00 17.47  ? 119  GLY D O   1 
ATOM   4184 N  N   . LYS C 2 120 ? -18.061 15.200  45.517 1.00 21.09  ? 120  LYS D N   1 
ATOM   4185 C  CA  . LYS C 2 120 ? -17.879 14.763  46.897 1.00 19.25  ? 120  LYS D CA  1 
ATOM   4186 C  C   . LYS C 2 120 ? -17.786 13.254  47.038 1.00 17.08  ? 120  LYS D C   1 
ATOM   4187 O  O   . LYS C 2 120 ? -17.240 12.724  48.011 1.00 21.92  ? 120  LYS D O   1 
ATOM   4188 C  CB  . LYS C 2 120 ? -19.017 15.332  47.756 1.00 22.87  ? 120  LYS D CB  1 
ATOM   4189 C  CG  . LYS C 2 120 ? -20.273 14.480  47.778 1.00 38.22  ? 120  LYS D CG  1 
ATOM   4190 C  CD  . LYS C 2 120 ? -21.186 14.881  48.930 1.00 54.16  ? 120  LYS D CD  1 
ATOM   4191 C  CE  . LYS C 2 120 ? -22.410 13.979  48.994 1.00 55.89  ? 120  LYS D CE  1 
ATOM   4192 N  NZ  . LYS C 2 120 ? -23.435 14.499  49.943 1.00 69.32  ? 120  LYS D NZ  1 
ATOM   4193 N  N   . GLU C 2 121 ? -18.292 12.518  46.059 1.00 14.27  ? 121  GLU D N   1 
ATOM   4194 C  CA  . GLU C 2 121 ? -18.236 11.065  46.081 1.00 15.85  ? 121  GLU D CA  1 
ATOM   4195 C  C   . GLU C 2 121 ? -16.813 10.546  45.898 1.00 17.87  ? 121  GLU D C   1 
ATOM   4196 O  O   . GLU C 2 121 ? -16.500 9.432   46.316 1.00 19.55  ? 121  GLU D O   1 
ATOM   4197 C  CB  . GLU C 2 121 ? -19.146 10.498  44.987 1.00 18.18  ? 121  GLU D CB  1 
ATOM   4198 C  CG  . GLU C 2 121 ? -18.905 9.045   44.661 1.00 24.19  ? 121  GLU D CG  1 
ATOM   4199 C  CD  . GLU C 2 121 ? -19.996 8.454   43.784 1.00 46.78  ? 121  GLU D CD  1 
ATOM   4200 O  OE1 . GLU C 2 121 ? -20.620 9.219   43.016 1.00 33.38  ? 121  GLU D OE1 1 
ATOM   4201 O  OE2 . GLU C 2 121 ? -20.219 7.227   43.853 1.00 56.68  ? 121  GLU D OE2 1 
ATOM   4202 N  N   . PHE C 2 122 ? -15.960 11.344  45.277 1.00 15.30  ? 122  PHE D N   1 
ATOM   4203 C  CA  . PHE C 2 122 ? -14.543 11.001  45.142 1.00 17.07  ? 122  PHE D CA  1 
ATOM   4204 C  C   . PHE C 2 122 ? -13.800 11.400  46.417 1.00 16.74  ? 122  PHE D C   1 
ATOM   4205 O  O   . PHE C 2 122 ? -13.019 12.357  46.437 1.00 18.00  ? 122  PHE D O   1 
ATOM   4206 C  CB  . PHE C 2 122 ? -13.957 11.680  43.908 1.00 18.77  ? 122  PHE D CB  1 
ATOM   4207 C  CG  . PHE C 2 122 ? -12.657 11.087  43.387 1.00 19.18  ? 122  PHE D CG  1 
ATOM   4208 C  CD1 . PHE C 2 122 ? -12.643 9.844   42.780 1.00 20.24  ? 122  PHE D CD1 1 
ATOM   4209 C  CD2 . PHE C 2 122 ? -11.464 11.781  43.518 1.00 18.45  ? 122  PHE D CD2 1 
ATOM   4210 C  CE1 . PHE C 2 122 ? -11.464 9.305   42.285 1.00 17.86  ? 122  PHE D CE1 1 
ATOM   4211 C  CE2 . PHE C 2 122 ? -10.281 11.248  43.037 1.00 14.83  ? 122  PHE D CE2 1 
ATOM   4212 C  CZ  . PHE C 2 122 ? -10.285 10.004  42.453 1.00 17.55  ? 122  PHE D CZ  1 
ATOM   4213 N  N   . THR C 2 123 ? -14.076 10.659  47.485 1.00 12.88  ? 123  THR D N   1 
ATOM   4214 C  CA  . THR C 2 123 ? -13.486 10.951  48.794 1.00 15.71  ? 123  THR D CA  1 
ATOM   4215 C  C   . THR C 2 123 ? -11.988 10.673  48.859 1.00 17.40  ? 123  THR D C   1 
ATOM   4216 O  O   . THR C 2 123 ? -11.398 10.034  47.974 1.00 14.46  ? 123  THR D O   1 
ATOM   4217 C  CB  . THR C 2 123 ? -14.169 10.103  49.884 1.00 17.74  ? 123  THR D CB  1 
ATOM   4218 O  OG1 . THR C 2 123 ? -13.890 8.727   49.606 1.00 19.40  ? 123  THR D OG1 1 
ATOM   4219 C  CG2 . THR C 2 123 ? -15.681 10.270  49.842 1.00 22.65  ? 123  THR D CG2 1 
ATOM   4220 N  N   . PRO C 2 124 ? -11.313 11.171  49.895 1.00 18.34  ? 124  PRO D N   1 
ATOM   4221 C  CA  . PRO C 2 124 ? -9.882  10.874  50.046 1.00 11.89  ? 124  PRO D CA  1 
ATOM   4222 C  C   . PRO C 2 124 ? -9.526  9.398   50.009 1.00 15.57  ? 124  PRO D C   1 
ATOM   4223 O  O   . PRO C 2 124 ? -8.549  9.041   49.326 1.00 14.90  ? 124  PRO D O   1 
ATOM   4224 C  CB  . PRO C 2 124 ? -9.537  11.526  51.393 1.00 14.43  ? 124  PRO D CB  1 
ATOM   4225 C  CG  . PRO C 2 124 ? -10.484 12.686  51.459 1.00 18.35  ? 124  PRO D CG  1 
ATOM   4226 C  CD  . PRO C 2 124 ? -11.779 12.116  50.926 1.00 16.99  ? 124  PRO D CD  1 
ATOM   4227 N  N   . PRO C 2 125 ? -10.183 8.474   50.694 1.00 17.41  ? 125  PRO D N   1 
ATOM   4228 C  CA  . PRO C 2 125 ? -9.855  7.054   50.542 1.00 16.30  ? 125  PRO D CA  1 
ATOM   4229 C  C   . PRO C 2 125 ? -10.120 6.488   49.150 1.00 15.99  ? 125  PRO D C   1 
ATOM   4230 O  O   . PRO C 2 125 ? -9.388  5.619   48.672 1.00 16.64  ? 125  PRO D O   1 
ATOM   4231 C  CB  . PRO C 2 125 ? -10.761 6.356   51.565 1.00 21.66  ? 125  PRO D CB  1 
ATOM   4232 C  CG  . PRO C 2 125 ? -11.131 7.426   52.533 1.00 20.11  ? 125  PRO D CG  1 
ATOM   4233 C  CD  . PRO C 2 125 ? -11.206 8.700   51.735 1.00 19.64  ? 125  PRO D CD  1 
ATOM   4234 N  N   . VAL C 2 126 ? -11.170 6.956   48.481 1.00 14.64  ? 126  VAL D N   1 
ATOM   4235 C  CA  . VAL C 2 126 ? -11.394 6.560   47.098 1.00 18.53  ? 126  VAL D CA  1 
ATOM   4236 C  C   . VAL C 2 126 ? -10.251 7.054   46.217 1.00 17.85  ? 126  VAL D C   1 
ATOM   4237 O  O   . VAL C 2 126 ? -9.748  6.292   45.387 1.00 16.17  ? 126  VAL D O   1 
ATOM   4238 C  CB  . VAL C 2 126 ? -12.744 7.101   46.582 1.00 23.64  ? 126  VAL D CB  1 
ATOM   4239 C  CG1 . VAL C 2 126 ? -12.830 6.936   45.070 1.00 31.51  ? 126  VAL D CG1 1 
ATOM   4240 C  CG2 . VAL C 2 126 ? -13.893 6.374   47.255 1.00 16.35  ? 126  VAL D CG2 1 
ATOM   4241 N  N   . GLN C 2 127 ? -9.837  8.313   46.393 1.00 12.91  ? 127  GLN D N   1 
ATOM   4242 C  CA  . GLN C 2 127 ? -8.701  8.795   45.604 1.00 12.92  ? 127  GLN D CA  1 
ATOM   4243 C  C   . GLN C 2 127 ? -7.467  7.920   45.801 1.00 15.07  ? 127  GLN D C   1 
ATOM   4244 O  O   . GLN C 2 127 ? -6.762  7.556   44.854 1.00 13.28  ? 127  GLN D O   1 
ATOM   4245 C  CB  . GLN C 2 127 ? -8.345  10.245  45.977 1.00 14.42  ? 127  GLN D CB  1 
ATOM   4246 C  CG  . GLN C 2 127 ? -7.012  10.645  45.323 1.00 14.76  ? 127  GLN D CG  1 
ATOM   4247 C  CD  . GLN C 2 127 ? -6.617  12.065  45.692 1.00 12.86  ? 127  GLN D CD  1 
ATOM   4248 O  OE1 . GLN C 2 127 ? -7.356  12.768  46.376 1.00 15.36  ? 127  GLN D OE1 1 
ATOM   4249 N  NE2 . GLN C 2 127 ? -5.464  12.510  45.217 1.00 13.85  ? 127  GLN D NE2 1 
ATOM   4250 N  N   . ALA C 2 128 ? -7.162  7.596   47.057 1.00 14.26  ? 128  ALA D N   1 
ATOM   4251 C  CA  . ALA C 2 128 ? -5.945  6.851   47.374 1.00 13.09  ? 128  ALA D CA  1 
ATOM   4252 C  C   . ALA C 2 128 ? -5.966  5.497   46.681 1.00 13.87  ? 128  ALA D C   1 
ATOM   4253 O  O   . ALA C 2 128 ? -4.931  5.002   46.232 1.00 16.56  ? 128  ALA D O   1 
ATOM   4254 C  CB  . ALA C 2 128 ? -5.802  6.682   48.879 1.00 15.78  ? 128  ALA D CB  1 
ATOM   4255 N  N   . ALA C 2 129 ? -7.157  4.902   46.555 1.00 13.35  ? 129  ALA D N   1 
ATOM   4256 C  CA  . ALA C 2 129 ? -7.235  3.604   45.882 1.00 16.02  ? 129  ALA D CA  1 
ATOM   4257 C  C   . ALA C 2 129 ? -6.981  3.786   44.388 1.00 17.47  ? 129  ALA D C   1 
ATOM   4258 O  O   . ALA C 2 129 ? -6.257  3.013   43.769 1.00 14.63  ? 129  ALA D O   1 
ATOM   4259 C  CB  . ALA C 2 129 ? -8.564  2.928   46.145 1.00 13.98  ? 129  ALA D CB  1 
ATOM   4260 N  N   . TYR C 2 130 ? -7.573  4.819   43.784 1.00 13.38  ? 130  TYR D N   1 
ATOM   4261 C  CA  . TYR C 2 130 ? -7.289  5.119   42.381 1.00 11.59  ? 130  TYR D CA  1 
ATOM   4262 C  C   . TYR C 2 130 ? -5.830  5.490   42.150 1.00 13.41  ? 130  TYR D C   1 
ATOM   4263 O  O   . TYR C 2 130 ? -5.263  5.195   41.094 1.00 13.79  ? 130  TYR D O   1 
ATOM   4264 C  CB  . TYR C 2 130 ? -8.218  6.248   41.883 1.00 9.64   ? 130  TYR D CB  1 
ATOM   4265 C  CG  . TYR C 2 130 ? -9.451  5.588   41.276 1.00 12.42  ? 130  TYR D CG  1 
ATOM   4266 C  CD1 . TYR C 2 130 ? -9.463  5.200   39.943 1.00 17.50  ? 130  TYR D CD1 1 
ATOM   4267 C  CD2 . TYR C 2 130 ? -10.569 5.334   42.060 1.00 15.77  ? 130  TYR D CD2 1 
ATOM   4268 C  CE1 . TYR C 2 130 ? -10.592 4.595   39.402 1.00 19.06  ? 130  TYR D CE1 1 
ATOM   4269 C  CE2 . TYR C 2 130 ? -11.691 4.724   41.514 1.00 17.95  ? 130  TYR D CE2 1 
ATOM   4270 C  CZ  . TYR C 2 130 ? -11.697 4.358   40.188 1.00 24.80  ? 130  TYR D CZ  1 
ATOM   4271 O  OH  . TYR C 2 130 ? -12.809 3.735   39.645 1.00 20.60  ? 130  TYR D OH  1 
ATOM   4272 N  N   . GLN C 2 131 ? -5.187  6.126   43.126 1.00 13.65  ? 131  GLN D N   1 
ATOM   4273 C  CA  . GLN C 2 131 ? -3.768  6.454   42.947 1.00 13.74  ? 131  GLN D CA  1 
ATOM   4274 C  C   . GLN C 2 131 ? -2.920  5.200   42.813 1.00 14.23  ? 131  GLN D C   1 
ATOM   4275 O  O   . GLN C 2 131 ? -1.949  5.168   42.051 1.00 16.73  ? 131  GLN D O   1 
ATOM   4276 C  CB  . GLN C 2 131 ? -3.242  7.311   44.100 1.00 14.85  ? 131  GLN D CB  1 
ATOM   4277 C  CG  . GLN C 2 131 ? -3.843  8.704   44.112 1.00 17.29  ? 131  GLN D CG  1 
ATOM   4278 C  CD  . GLN C 2 131 ? -3.289  9.684   43.104 1.00 24.84  ? 131  GLN D CD  1 
ATOM   4279 O  OE1 . GLN C 2 131 ? -3.781  10.817  43.070 1.00 18.48  ? 131  GLN D OE1 1 
ATOM   4280 N  NE2 . GLN C 2 131 ? -2.290  9.332   42.302 1.00 16.16  ? 131  GLN D NE2 1 
ATOM   4281 N  N   . LYS C 2 132 ? -3.288  4.175   43.571 1.00 13.18  ? 132  LYS D N   1 
ATOM   4282 C  CA  . LYS C 2 132 ? -2.568  2.904   43.508 1.00 14.49  ? 132  LYS D CA  1 
ATOM   4283 C  C   . LYS C 2 132 ? -2.756  2.265   42.135 1.00 17.24  ? 132  LYS D C   1 
ATOM   4284 O  O   . LYS C 2 132 ? -1.806  1.762   41.531 1.00 15.88  ? 132  LYS D O   1 
ATOM   4285 C  CB  . LYS C 2 132 ? -3.074  1.944   44.590 1.00 14.21  ? 132  LYS D CB  1 
ATOM   4286 C  CG  . LYS C 2 132 ? -2.622  2.309   45.997 1.00 19.38  ? 132  LYS D CG  1 
ATOM   4287 C  CD  . LYS C 2 132 ? -2.975  1.174   46.953 1.00 27.45  ? 132  LYS D CD  1 
ATOM   4288 C  CE  . LYS C 2 132 ? -2.748  1.585   48.398 1.00 48.80  ? 132  LYS D CE  1 
ATOM   4289 N  NZ  . LYS C 2 132 ? -2.664  0.410   49.311 1.00 58.80  ? 132  LYS D NZ  1 
ATOM   4290 N  N   . VAL C 2 133 ? -4.002  2.309   41.669 1.00 14.25  ? 133  VAL D N   1 
ATOM   4291 C  CA  . VAL C 2 133 ? -4.359  1.707   40.387 1.00 16.54  ? 133  VAL D CA  1 
ATOM   4292 C  C   . VAL C 2 133 ? -3.697  2.451   39.232 1.00 21.52  ? 133  VAL D C   1 
ATOM   4293 O  O   . VAL C 2 133 ? -3.121  1.824   38.343 1.00 21.14  ? 133  VAL D O   1 
ATOM   4294 C  CB  . VAL C 2 133 ? -5.879  1.660   40.162 1.00 21.76  ? 133  VAL D CB  1 
ATOM   4295 C  CG1 . VAL C 2 133 ? -6.169  1.210   38.734 1.00 23.61  ? 133  VAL D CG1 1 
ATOM   4296 C  CG2 . VAL C 2 133 ? -6.552  0.739   41.172 1.00 19.88  ? 133  VAL D CG2 1 
ATOM   4297 N  N   . VAL C 2 134 ? -3.721  3.785   39.207 1.00 14.39  ? 134  VAL D N   1 
ATOM   4298 C  CA  . VAL C 2 134 ? -3.054  4.451   38.081 1.00 15.87  ? 134  VAL D CA  1 
ATOM   4299 C  C   . VAL C 2 134 ? -1.543  4.263   38.108 1.00 17.48  ? 134  VAL D C   1 
ATOM   4300 O  O   . VAL C 2 134 ? -0.909  4.182   37.042 1.00 18.80  ? 134  VAL D O   1 
ATOM   4301 C  CB  . VAL C 2 134 ? -3.404  5.947   37.976 1.00 20.97  ? 134  VAL D CB  1 
ATOM   4302 C  CG1 . VAL C 2 134 ? -4.914  6.117   37.847 1.00 16.56  ? 134  VAL D CG1 1 
ATOM   4303 C  CG2 . VAL C 2 134 ? -2.885  6.738   39.167 1.00 20.94  ? 134  VAL D CG2 1 
ATOM   4304 N  N   . ALA C 2 135 ? -0.913  4.198   39.270 1.00 16.82  ? 135  ALA D N   1 
ATOM   4305 C  CA  . ALA C 2 135 ? 0.515   3.877   39.324 1.00 14.97  ? 135  ALA D CA  1 
ATOM   4306 C  C   . ALA C 2 135 ? 0.780   2.457   38.836 1.00 19.30  ? 135  ALA D C   1 
ATOM   4307 O  O   . ALA C 2 135 ? 1.766   2.173   38.155 1.00 18.49  ? 135  ALA D O   1 
ATOM   4308 C  CB  . ALA C 2 135 ? 1.033   4.040   40.744 1.00 20.51  ? 135  ALA D CB  1 
ATOM   4309 N  N   . GLY C 2 136 ? -0.094  1.518   39.197 1.00 18.96  ? 136  GLY D N   1 
ATOM   4310 C  CA  . GLY C 2 136 ? 0.102   0.139   38.777 1.00 20.53  ? 136  GLY D CA  1 
ATOM   4311 C  C   . GLY C 2 136 ? -0.021  0.003   37.270 1.00 20.59  ? 136  GLY D C   1 
ATOM   4312 O  O   . GLY C 2 136 ? 0.693   -0.765  36.619 1.00 19.05  ? 136  GLY D O   1 
ATOM   4313 N  N   . VAL C 2 137 ? -0.965  0.740   36.683 1.00 16.48  ? 137  VAL D N   1 
ATOM   4314 C  CA  . VAL C 2 137 ? -1.155  0.642   35.232 1.00 16.72  ? 137  VAL D CA  1 
ATOM   4315 C  C   . VAL C 2 137 ? 0.013   1.290   34.507 1.00 18.65  ? 137  VAL D C   1 
ATOM   4316 O  O   . VAL C 2 137 ? 0.500   0.797   33.486 1.00 19.81  ? 137  VAL D O   1 
ATOM   4317 C  CB  . VAL C 2 137 ? -2.498  1.258   34.796 1.00 15.35  ? 137  VAL D CB  1 
ATOM   4318 C  CG1 . VAL C 2 137 ? -2.533  1.507   33.294 1.00 20.66  ? 137  VAL D CG1 1 
ATOM   4319 C  CG2 . VAL C 2 137 ? -3.656  0.359   35.211 1.00 18.50  ? 137  VAL D CG2 1 
ATOM   4320 N  N   . ALA C 2 138 ? 0.521   2.411   35.011 1.00 14.24  ? 138  ALA D N   1 
ATOM   4321 C  CA  . ALA C 2 138 ? 1.678   3.031   34.369 1.00 16.32  ? 138  ALA D CA  1 
ATOM   4322 C  C   . ALA C 2 138 ? 2.918   2.156   34.481 1.00 16.85  ? 138  ALA D C   1 
ATOM   4323 O  O   . ALA C 2 138 ? 3.727   2.041   33.558 1.00 16.87  ? 138  ALA D O   1 
ATOM   4324 C  CB  . ALA C 2 138 ? 1.915   4.408   34.990 1.00 15.79  ? 138  ALA D CB  1 
ATOM   4325 N  N   . ASN C 2 139 ? 3.094   1.502   35.629 1.00 16.05  ? 139  ASN D N   1 
ATOM   4326 C  CA  . ASN C 2 139 ? 4.260   0.623   35.773 1.00 18.58  ? 139  ASN D CA  1 
ATOM   4327 C  C   . ASN C 2 139 ? 4.164   -0.579  34.840 1.00 22.52  ? 139  ASN D C   1 
ATOM   4328 O  O   . ASN C 2 139 ? 5.154   -1.009  34.243 1.00 20.79  ? 139  ASN D O   1 
ATOM   4329 C  CB  . ASN C 2 139 ? 4.396   0.166   37.231 1.00 21.88  ? 139  ASN D CB  1 
ATOM   4330 C  CG  . ASN C 2 139 ? 5.023   1.250   38.087 1.00 26.97  ? 139  ASN D CG  1 
ATOM   4331 O  OD1 . ASN C 2 139 ? 5.792   2.069   37.572 1.00 37.90  ? 139  ASN D OD1 1 
ATOM   4332 N  ND2 . ASN C 2 139 ? 4.694   1.262   39.371 1.00 46.76  ? 139  ASN D ND2 1 
ATOM   4333 N  N   . ALA C 2 140 ? 2.958   -1.115  34.714 1.00 16.68  ? 140  ALA D N   1 
ATOM   4334 C  CA  . ALA C 2 140 ? 2.671   -2.216  33.800 1.00 20.22  ? 140  ALA D CA  1 
ATOM   4335 C  C   . ALA C 2 140 ? 2.931   -1.846  32.343 1.00 18.14  ? 140  ALA D C   1 
ATOM   4336 O  O   . ALA C 2 140 ? 3.478   -2.644  31.575 1.00 16.15  ? 140  ALA D O   1 
ATOM   4337 C  CB  . ALA C 2 140 ? 1.222   -2.689  33.954 1.00 16.67  ? 140  ALA D CB  1 
ATOM   4338 N  N   . LEU C 2 141 ? 2.542   -0.647  31.934 1.00 14.17  ? 141  LEU D N   1 
ATOM   4339 C  CA  . LEU C 2 141 ? 2.784   -0.202  30.563 1.00 17.25  ? 141  LEU D CA  1 
ATOM   4340 C  C   . LEU C 2 141 ? 4.248   0.081   30.282 1.00 22.23  ? 141  LEU D C   1 
ATOM   4341 O  O   . LEU C 2 141 ? 4.717   0.025   29.147 1.00 17.85  ? 141  LEU D O   1 
ATOM   4342 C  CB  . LEU C 2 141 ? 1.935   1.045   30.276 1.00 16.80  ? 141  LEU D CB  1 
ATOM   4343 C  CG  . LEU C 2 141 ? 0.515   0.719   29.789 1.00 26.14  ? 141  LEU D CG  1 
ATOM   4344 C  CD1 . LEU C 2 141 ? -0.324  1.981   29.701 1.00 28.73  ? 141  LEU D CD1 1 
ATOM   4345 C  CD2 . LEU C 2 141 ? 0.579   0.010   28.442 1.00 24.47  ? 141  LEU D CD2 1 
ATOM   4346 N  N   . ALA C 2 142 ? 5.021   0.371   31.323 1.00 17.66  ? 142  ALA D N   1 
ATOM   4347 C  CA  . ALA C 2 142 ? 6.437   0.657   31.113 1.00 13.16  ? 142  ALA D CA  1 
ATOM   4348 C  C   . ALA C 2 142 ? 7.312   -0.578  31.241 1.00 16.72  ? 142  ALA D C   1 
ATOM   4349 O  O   . ALA C 2 142 ? 8.536   -0.499  31.066 1.00 22.53  ? 142  ALA D O   1 
ATOM   4350 C  CB  . ALA C 2 142 ? 6.885   1.686   32.139 1.00 19.51  ? 142  ALA D CB  1 
ATOM   4351 N  N   . HIS C 2 143 ? 6.721   -1.714  31.578 1.00 17.33  ? 143  HIS D N   1 
ATOM   4352 C  CA  . HIS C 2 143 ? 7.511   -2.865  32.017 1.00 21.06  ? 143  HIS D CA  1 
ATOM   4353 C  C   . HIS C 2 143 ? 8.387   -3.431  30.910 1.00 25.77  ? 143  HIS D C   1 
ATOM   4354 O  O   . HIS C 2 143 ? 9.496   -3.898  31.182 1.00 22.99  ? 143  HIS D O   1 
ATOM   4355 C  CB  . HIS C 2 143 ? 6.577   -3.946  32.579 1.00 23.37  ? 143  HIS D CB  1 
ATOM   4356 C  CG  . HIS C 2 143 ? 7.321   -5.120  33.134 1.00 34.44  ? 143  HIS D CG  1 
ATOM   4357 N  ND1 . HIS C 2 143 ? 7.229   -6.383  32.597 1.00 34.17  ? 143  HIS D ND1 1 
ATOM   4358 C  CD2 . HIS C 2 143 ? 8.196   -5.218  34.163 1.00 36.93  ? 143  HIS D CD2 1 
ATOM   4359 C  CE1 . HIS C 2 143 ? 8.003   -7.212  33.273 1.00 37.24  ? 143  HIS D CE1 1 
ATOM   4360 N  NE2 . HIS C 2 143 ? 8.601   -6.531  34.237 1.00 31.96  ? 143  HIS D NE2 1 
ATOM   4361 N  N   . LYS C 2 144 ? 7.934   -3.403  29.655 1.00 26.02  ? 144  LYS D N   1 
ATOM   4362 C  CA  . LYS C 2 144 ? 8.710   -4.080  28.607 1.00 22.26  ? 144  LYS D CA  1 
ATOM   4363 C  C   . LYS C 2 144 ? 9.588   -3.121  27.813 1.00 23.42  ? 144  LYS D C   1 
ATOM   4364 O  O   . LYS C 2 144 ? 10.117  -3.489  26.758 1.00 24.31  ? 144  LYS D O   1 
ATOM   4365 C  CB  . LYS C 2 144 ? 7.782   -4.855  27.669 1.00 17.44  ? 144  LYS D CB  1 
ATOM   4366 C  CG  . LYS C 2 144 ? 6.879   -5.841  28.385 1.00 25.27  ? 144  LYS D CG  1 
ATOM   4367 C  CD  . LYS C 2 144 ? 7.640   -7.041  28.915 1.00 36.73  ? 144  LYS D CD  1 
ATOM   4368 C  CE  . LYS C 2 144 ? 6.917   -8.339  28.591 1.00 49.24  ? 144  LYS D CE  1 
ATOM   4369 N  NZ  . LYS C 2 144 ? 7.862   -9.389  28.112 1.00 59.37  ? 144  LYS D NZ  1 
ATOM   4370 N  N   . TYR C 2 145 ? 9.761   -1.907  28.322 1.00 15.37  ? 145  TYR D N   1 
ATOM   4371 C  CA  . TYR C 2 145 ? 10.676  -0.946  27.710 1.00 20.22  ? 145  TYR D CA  1 
ATOM   4372 C  C   . TYR C 2 145 ? 12.115  -1.430  27.867 1.00 24.37  ? 145  TYR D C   1 
ATOM   4373 O  O   . TYR C 2 145 ? 12.422  -2.013  28.907 1.00 29.44  ? 145  TYR D O   1 
ATOM   4374 C  CB  . TYR C 2 145 ? 10.533  0.442   28.337 1.00 14.38  ? 145  TYR D CB  1 
ATOM   4375 C  CG  . TYR C 2 145 ? 9.394   1.222   27.721 1.00 14.46  ? 145  TYR D CG  1 
ATOM   4376 C  CD1 . TYR C 2 145 ? 8.079   0.795   27.863 1.00 18.31  ? 145  TYR D CD1 1 
ATOM   4377 C  CD2 . TYR C 2 145 ? 9.659   2.388   27.003 1.00 15.79  ? 145  TYR D CD2 1 
ATOM   4378 C  CE1 . TYR C 2 145 ? 7.035   1.510   27.294 1.00 15.13  ? 145  TYR D CE1 1 
ATOM   4379 C  CE2 . TYR C 2 145 ? 8.626   3.106   26.437 1.00 17.20  ? 145  TYR D CE2 1 
ATOM   4380 C  CZ  . TYR C 2 145 ? 7.322   2.658   26.593 1.00 17.33  ? 145  TYR D CZ  1 
ATOM   4381 O  OH  . TYR C 2 145 ? 6.314   3.392   26.018 1.00 16.11  ? 145  TYR D OH  1 
ATOM   4382 N  N   . HIS C 2 146 ? 12.930  -1.195  26.854 1.00 19.43  ? 146  HIS D N   1 
ATOM   4383 C  CA  . HIS C 2 146 ? 14.322  -1.630  26.840 1.00 22.85  ? 146  HIS D CA  1 
ATOM   4384 C  C   . HIS C 2 146 ? 15.155  -0.735  25.923 1.00 22.07  ? 146  HIS D C   1 
ATOM   4385 O  O   . HIS C 2 146 ? 14.579  0.089   25.206 1.00 22.90  ? 146  HIS D O   1 
ATOM   4386 C  CB  . HIS C 2 146 ? 14.393  -3.076  26.328 1.00 23.26  ? 146  HIS D CB  1 
ATOM   4387 C  CG  . HIS C 2 146 ? 13.881  -3.107  24.911 1.00 32.03  ? 146  HIS D CG  1 
ATOM   4388 N  ND1 . HIS C 2 146 ? 14.722  -3.084  23.823 1.00 37.32  ? 146  HIS D ND1 1 
ATOM   4389 C  CD2 . HIS C 2 146 ? 12.625  -3.104  24.414 1.00 31.42  ? 146  HIS D CD2 1 
ATOM   4390 C  CE1 . HIS C 2 146 ? 14.007  -3.097  22.713 1.00 42.15  ? 146  HIS D CE1 1 
ATOM   4391 N  NE2 . HIS C 2 146 ? 12.727  -3.111  23.043 1.00 33.24  ? 146  HIS D NE2 1 
ATOM   4392 O  OXT . HIS C 2 146 ? 16.394  -0.889  25.945 1.00 24.87  ? 146  HIS D OXT 1 
HETATM 4393 C  CHA . HEM D 3 .   ? 19.092  18.557  20.364 1.00 19.97  ? 284  HEM A CHA 1 
HETATM 4394 C  CHB . HEM D 3 .   ? 21.168  20.733  24.117 1.00 22.83  ? 284  HEM A CHB 1 
HETATM 4395 C  CHC . HEM D 3 .   ? 19.008  17.648  27.115 1.00 18.12  ? 284  HEM A CHC 1 
HETATM 4396 C  CHD . HEM D 3 .   ? 16.925  15.464  23.357 1.00 19.48  ? 284  HEM A CHD 1 
HETATM 4397 C  C1A . HEM D 3 .   ? 19.924  19.378  21.087 1.00 18.32  ? 284  HEM A C1A 1 
HETATM 4398 C  C2A . HEM D 3 .   ? 20.844  20.368  20.557 1.00 21.69  ? 284  HEM A C2A 1 
HETATM 4399 C  C3A . HEM D 3 .   ? 21.474  20.940  21.617 1.00 23.96  ? 284  HEM A C3A 1 
HETATM 4400 C  C4A . HEM D 3 .   ? 20.899  20.368  22.819 1.00 19.16  ? 284  HEM A C4A 1 
HETATM 4401 C  CMA . HEM D 3 .   ? 22.606  21.962  21.613 1.00 21.76  ? 284  HEM A CMA 1 
HETATM 4402 C  CAA . HEM D 3 .   ? 21.059  20.639  19.067 1.00 21.93  ? 284  HEM A CAA 1 
HETATM 4403 C  CBA . HEM D 3 .   ? 20.418  21.854  18.424 1.00 35.80  ? 284  HEM A CBA 1 
HETATM 4404 C  CGA . HEM D 3 .   ? 20.553  21.959  16.915 1.00 44.77  ? 284  HEM A CGA 1 
HETATM 4405 O  O1A . HEM D 3 .   ? 21.332  21.151  16.361 1.00 47.06  ? 284  HEM A O1A 1 
HETATM 4406 O  O2A . HEM D 3 .   ? 19.865  22.843  16.353 1.00 43.65  ? 284  HEM A O2A 1 
HETATM 4407 C  C1B . HEM D 3 .   ? 20.838  20.064  25.275 1.00 22.59  ? 284  HEM A C1B 1 
HETATM 4408 C  C2B . HEM D 3 .   ? 21.341  20.337  26.604 1.00 20.25  ? 284  HEM A C2B 1 
HETATM 4409 C  C3B . HEM D 3 .   ? 20.711  19.482  27.464 1.00 16.70  ? 284  HEM A C3B 1 
HETATM 4410 C  C4B . HEM D 3 .   ? 19.834  18.646  26.656 1.00 22.13  ? 284  HEM A C4B 1 
HETATM 4411 C  CMB . HEM D 3 .   ? 22.389  21.399  26.922 1.00 18.99  ? 284  HEM A CMB 1 
HETATM 4412 C  CAB . HEM D 3 .   ? 20.737  19.285  28.872 1.00 18.55  ? 284  HEM A CAB 1 
HETATM 4413 C  CBB . HEM D 3 .   ? 21.889  19.637  29.667 1.00 34.58  ? 284  HEM A CBB 1 
HETATM 4414 C  C1C . HEM D 3 .   ? 18.213  16.789  26.390 1.00 16.86  ? 284  HEM A C1C 1 
HETATM 4415 C  C2C . HEM D 3 .   ? 17.545  15.608  26.893 1.00 13.28  ? 284  HEM A C2C 1 
HETATM 4416 C  C3C . HEM D 3 .   ? 17.045  14.930  25.817 1.00 14.89  ? 284  HEM A C3C 1 
HETATM 4417 C  C4C . HEM D 3 .   ? 17.313  15.750  24.646 1.00 17.37  ? 284  HEM A C4C 1 
HETATM 4418 C  CMC . HEM D 3 .   ? 17.457  15.200  28.362 1.00 16.60  ? 284  HEM A CMC 1 
HETATM 4419 C  CAC . HEM D 3 .   ? 16.341  13.705  25.660 1.00 15.80  ? 284  HEM A CAC 1 
HETATM 4420 C  CBC . HEM D 3 .   ? 16.542  12.593  26.555 1.00 26.05  ? 284  HEM A CBC 1 
HETATM 4421 C  C1D . HEM D 3 .   ? 17.301  16.099  22.195 1.00 21.33  ? 284  HEM A C1D 1 
HETATM 4422 C  C2D . HEM D 3 .   ? 16.959  15.703  20.842 1.00 22.92  ? 284  HEM A C2D 1 
HETATM 4423 C  C3D . HEM D 3 .   ? 17.588  16.566  20.000 1.00 19.33  ? 284  HEM A C3D 1 
HETATM 4424 C  C4D . HEM D 3 .   ? 18.290  17.535  20.816 1.00 21.77  ? 284  HEM A C4D 1 
HETATM 4425 C  CMD . HEM D 3 .   ? 16.068  14.525  20.471 1.00 17.06  ? 284  HEM A CMD 1 
HETATM 4426 C  CAD . HEM D 3 .   ? 17.676  16.507  18.478 1.00 20.56  ? 284  HEM A CAD 1 
HETATM 4427 C  CBD . HEM D 3 .   ? 18.708  15.556  17.872 1.00 21.73  ? 284  HEM A CBD 1 
HETATM 4428 C  CGD . HEM D 3 .   ? 18.777  15.568  16.354 1.00 23.70  ? 284  HEM A CGD 1 
HETATM 4429 O  O1D . HEM D 3 .   ? 19.803  16.078  15.855 1.00 32.55  ? 284  HEM A O1D 1 
HETATM 4430 O  O2D . HEM D 3 .   ? 17.810  15.055  15.756 1.00 26.23  ? 284  HEM A O2D 1 
HETATM 4431 N  NA  . HEM D 3 .   ? 20.034  19.357  22.459 1.00 20.83  ? 284  HEM A NA  1 
HETATM 4432 N  NB  . HEM D 3 .   ? 19.958  19.006  25.337 1.00 19.33  ? 284  HEM A NB  1 
HETATM 4433 N  NC  . HEM D 3 .   ? 17.980  16.890  25.035 1.00 16.77  ? 284  HEM A NC  1 
HETATM 4434 N  ND  . HEM D 3 .   ? 18.074  17.236  22.145 1.00 18.89  ? 284  HEM A ND  1 
HETATM 4435 FE FE  . HEM D 3 .   ? 18.693  18.397  23.770 1.00 18.64  ? 284  HEM A FE  1 
HETATM 4436 C  CHA . HEM E 3 .   ? 4.567   24.418  58.128 1.00 20.84  ? 285  HEM A CHA 1 
HETATM 4437 C  CHB . HEM E 3 .   ? 3.157   26.477  54.007 1.00 17.37  ? 285  HEM A CHB 1 
HETATM 4438 C  CHC . HEM E 3 .   ? 4.129   22.394  51.638 1.00 13.56  ? 285  HEM A CHC 1 
HETATM 4439 C  CHD . HEM E 3 .   ? 5.539   20.337  55.763 1.00 16.43  ? 285  HEM A CHD 1 
HETATM 4440 C  C1A . HEM E 3 .   ? 4.020   25.325  57.250 1.00 19.66  ? 285  HEM A C1A 1 
HETATM 4441 C  C2A . HEM E 3 .   ? 3.394   26.588  57.589 1.00 21.28  ? 285  HEM A C2A 1 
HETATM 4442 C  C3A . HEM E 3 .   ? 2.946   27.141  56.432 1.00 21.14  ? 285  HEM A C3A 1 
HETATM 4443 C  C4A . HEM E 3 .   ? 3.367   26.273  55.350 1.00 21.76  ? 285  HEM A C4A 1 
HETATM 4444 C  CMA . HEM E 3 .   ? 2.133   28.420  56.248 1.00 24.02  ? 285  HEM A CMA 1 
HETATM 4445 C  CAA . HEM E 3 .   ? 3.314   27.164  59.001 1.00 22.96  ? 285  HEM A CAA 1 
HETATM 4446 C  CBA . HEM E 3 .   ? 4.368   28.186  59.425 1.00 22.96  ? 285  HEM A CBA 1 
HETATM 4447 C  CGA . HEM E 3 .   ? 4.146   28.781  60.810 1.00 29.48  ? 285  HEM A CGA 1 
HETATM 4448 O  O1A . HEM E 3 .   ? 4.401   28.031  61.779 1.00 38.05  ? 285  HEM A O1A 1 
HETATM 4449 O  O2A . HEM E 3 .   ? 3.714   29.951  60.844 1.00 43.69  ? 285  HEM A O2A 1 
HETATM 4450 C  C1B . HEM E 3 .   ? 3.236   25.550  52.990 1.00 19.88  ? 285  HEM A C1B 1 
HETATM 4451 C  C2B . HEM E 3 .   ? 2.782   25.727  51.627 1.00 22.24  ? 285  HEM A C2B 1 
HETATM 4452 C  C3B . HEM E 3 .   ? 3.120   24.599  50.934 1.00 18.56  ? 285  HEM A C3B 1 
HETATM 4453 C  C4B . HEM E 3 .   ? 3.717   23.682  51.892 1.00 13.86  ? 285  HEM A C4B 1 
HETATM 4454 C  CMB . HEM E 3 .   ? 2.058   26.967  51.113 1.00 21.80  ? 285  HEM A CMB 1 
HETATM 4455 C  CAB . HEM E 3 .   ? 2.985   24.188  49.579 1.00 18.96  ? 285  HEM A CAB 1 
HETATM 4456 C  CBB . HEM E 3 .   ? 1.727   24.354  48.878 1.00 44.60  ? 285  HEM A CBB 1 
HETATM 4457 C  C1C . HEM E 3 .   ? 4.600   21.457  52.529 1.00 13.01  ? 285  HEM A C1C 1 
HETATM 4458 C  C2C . HEM E 3 .   ? 4.884   20.066  52.240 1.00 13.70  ? 285  HEM A C2C 1 
HETATM 4459 C  C3C . HEM E 3 .   ? 5.215   19.464  53.418 1.00 12.59  ? 285  HEM A C3C 1 
HETATM 4460 C  C4C . HEM E 3 .   ? 5.237   20.507  54.431 1.00 13.88  ? 285  HEM A C4C 1 
HETATM 4461 C  CMC . HEM E 3 .   ? 4.837   19.443  50.846 1.00 16.65  ? 285  HEM A CMC 1 
HETATM 4462 C  CAC . HEM E 3 .   ? 5.533   18.123  53.791 1.00 16.52  ? 285  HEM A CAC 1 
HETATM 4463 C  CBC . HEM E 3 .   ? 4.953   17.005  53.064 1.00 22.80  ? 285  HEM A CBC 1 
HETATM 4464 C  C1D . HEM E 3 .   ? 5.448   21.255  56.783 1.00 16.85  ? 285  HEM A C1D 1 
HETATM 4465 C  C2D . HEM E 3 .   ? 5.684   21.003  58.191 1.00 17.86  ? 285  HEM A C2D 1 
HETATM 4466 C  C3D . HEM E 3 .   ? 5.341   22.133  58.863 1.00 22.28  ? 285  HEM A C3D 1 
HETATM 4467 C  C4D . HEM E 3 .   ? 4.982   23.131  57.878 1.00 18.83  ? 285  HEM A C4D 1 
HETATM 4468 C  CMD . HEM E 3 .   ? 6.200   19.689  58.766 1.00 17.06  ? 285  HEM A CMD 1 
HETATM 4469 C  CAD . HEM E 3 .   ? 5.270   22.335  60.378 1.00 22.06  ? 285  HEM A CAD 1 
HETATM 4470 C  CBD . HEM E 3 .   ? 4.021   21.826  61.103 1.00 25.99  ? 285  HEM A CBD 1 
HETATM 4471 C  CGD . HEM E 3 .   ? 3.933   22.236  62.567 1.00 29.85  ? 285  HEM A CGD 1 
HETATM 4472 O  O1D . HEM E 3 .   ? 3.010   23.020  62.867 1.00 32.99  ? 285  HEM A O1D 1 
HETATM 4473 O  O2D . HEM E 3 .   ? 4.797   21.748  63.325 1.00 32.07  ? 285  HEM A O2D 1 
HETATM 4474 N  NA  . HEM E 3 .   ? 4.002   25.172  55.883 1.00 18.99  ? 285  HEM A NA  1 
HETATM 4475 N  NB  . HEM E 3 .   ? 3.776   24.291  53.123 1.00 17.71  ? 285  HEM A NB  1 
HETATM 4476 N  NC  . HEM E 3 .   ? 4.888   21.704  53.854 1.00 13.38  ? 285  HEM A NC  1 
HETATM 4477 N  ND  . HEM E 3 .   ? 5.116   22.584  56.619 1.00 16.74  ? 285  HEM A ND  1 
HETATM 4478 FE FE  . HEM E 3 .   ? 4.800   23.566  54.805 1.00 16.92  ? 285  HEM A FE  1 
HETATM 4479 C  CHA . HEM F 3 .   ? 20.129  4.019   61.068 1.00 18.92  ? 147  HEM B CHA 1 
HETATM 4480 C  CHB . HEM F 3 .   ? 20.949  1.483   57.048 1.00 15.09  ? 147  HEM B CHB 1 
HETATM 4481 C  CHC . HEM F 3 .   ? 19.982  5.381   54.394 1.00 15.53  ? 147  HEM B CHC 1 
HETATM 4482 C  CHD . HEM F 3 .   ? 19.161  7.921   58.406 1.00 13.45  ? 147  HEM B CHD 1 
HETATM 4483 C  C1A . HEM F 3 .   ? 20.483  2.980   60.239 1.00 20.12  ? 147  HEM B C1A 1 
HETATM 4484 C  C2A . HEM F 3 .   ? 20.957  1.668   60.635 1.00 17.89  ? 147  HEM B C2A 1 
HETATM 4485 C  C3A . HEM F 3 .   ? 21.307  1.003   59.500 1.00 12.36  ? 147  HEM B C3A 1 
HETATM 4486 C  C4A . HEM F 3 .   ? 20.894  1.826   58.381 1.00 16.88  ? 147  HEM B C4A 1 
HETATM 4487 C  CMA . HEM F 3 .   ? 21.979  -0.360  59.361 1.00 23.56  ? 147  HEM B CMA 1 
HETATM 4488 C  CAA . HEM F 3 .   ? 20.975  1.152   62.074 1.00 25.48  ? 147  HEM B CAA 1 
HETATM 4489 C  CBA . HEM F 3 .   ? 19.639  0.811   62.730 1.00 29.14  ? 147  HEM B CBA 1 
HETATM 4490 C  CGA . HEM F 3 .   ? 19.737  0.177   64.107 1.00 35.05  ? 147  HEM B CGA 1 
HETATM 4491 O  O1A . HEM F 3 .   ? 20.249  0.879   65.006 1.00 38.80  ? 147  HEM B O1A 1 
HETATM 4492 O  O2A . HEM F 3 .   ? 19.291  -0.987  64.217 1.00 34.24  ? 147  HEM B O2A 1 
HETATM 4493 C  C1B . HEM F 3 .   ? 20.719  2.281   55.951 1.00 18.99  ? 147  HEM B C1B 1 
HETATM 4494 C  C2B . HEM F 3 .   ? 20.850  1.895   54.559 1.00 15.64  ? 147  HEM B C2B 1 
HETATM 4495 C  C3B . HEM F 3 .   ? 20.584  2.999   53.802 1.00 18.42  ? 147  HEM B C3B 1 
HETATM 4496 C  C4B . HEM F 3 .   ? 20.271  4.078   54.725 1.00 19.57  ? 147  HEM B C4B 1 
HETATM 4497 C  CMB . HEM F 3 .   ? 21.229  0.495   54.098 1.00 19.23  ? 147  HEM B CMB 1 
HETATM 4498 C  CAB . HEM F 3 .   ? 20.557  3.271   52.402 1.00 23.16  ? 147  HEM B CAB 1 
HETATM 4499 C  CBB . HEM F 3 .   ? 21.320  2.476   51.466 1.00 31.41  ? 147  HEM B CBB 1 
HETATM 4500 C  C1C . HEM F 3 .   ? 19.708  6.439   55.229 1.00 15.43  ? 147  HEM B C1C 1 
HETATM 4501 C  C2C . HEM F 3 .   ? 19.580  7.827   54.839 1.00 16.10  ? 147  HEM B C2C 1 
HETATM 4502 C  C3C . HEM F 3 .   ? 19.238  8.535   55.956 1.00 13.61  ? 147  HEM B C3C 1 
HETATM 4503 C  C4C . HEM F 3 .   ? 19.295  7.606   57.073 1.00 14.14  ? 147  HEM B C4C 1 
HETATM 4504 C  CMC . HEM F 3 .   ? 19.811  8.343   53.420 1.00 18.83  ? 147  HEM B CMC 1 
HETATM 4505 C  CAC . HEM F 3 .   ? 18.874  9.890   56.201 1.00 19.51  ? 147  HEM B CAC 1 
HETATM 4506 C  CBC . HEM F 3 .   ? 19.418  10.961  55.391 1.00 22.16  ? 147  HEM B CBC 1 
HETATM 4507 C  C1D . HEM F 3 .   ? 19.322  7.107   59.502 1.00 15.89  ? 147  HEM B C1D 1 
HETATM 4508 C  C2D . HEM F 3 .   ? 19.223  7.499   60.896 1.00 17.31  ? 147  HEM B C2D 1 
HETATM 4509 C  C3D . HEM F 3 .   ? 19.550  6.414   61.642 1.00 18.40  ? 147  HEM B C3D 1 
HETATM 4510 C  C4D . HEM F 3 .   ? 19.774  5.307   60.733 1.00 17.70  ? 147  HEM B C4D 1 
HETATM 4511 C  CMD . HEM F 3 .   ? 18.842  8.905   61.355 1.00 19.18  ? 147  HEM B CMD 1 
HETATM 4512 C  CAD . HEM F 3 .   ? 19.749  6.317   63.159 1.00 21.23  ? 147  HEM B CAD 1 
HETATM 4513 C  CBD . HEM F 3 .   ? 21.196  6.242   63.652 1.00 23.42  ? 147  HEM B CBD 1 
HETATM 4514 C  CGD . HEM F 3 .   ? 21.402  6.436   65.136 1.00 28.58  ? 147  HEM B CGD 1 
HETATM 4515 O  O1D . HEM F 3 .   ? 22.543  6.825   65.487 1.00 31.02  ? 147  HEM B O1D 1 
HETATM 4516 O  O2D . HEM F 3 .   ? 20.438  6.171   65.884 1.00 29.67  ? 147  HEM B O2D 1 
HETATM 4517 N  NA  . HEM F 3 .   ? 20.427  3.029   58.862 1.00 19.22  ? 147  HEM B NA  1 
HETATM 4518 N  NB  . HEM F 3 .   ? 20.314  3.596   56.013 1.00 15.82  ? 147  HEM B NB  1 
HETATM 4519 N  NC  . HEM F 3 .   ? 19.510  6.336   56.589 1.00 16.57  ? 147  HEM B NC  1 
HETATM 4520 N  ND  . HEM F 3 .   ? 19.624  5.764   59.441 1.00 18.43  ? 147  HEM B ND  1 
HETATM 4521 FE FE  . HEM F 3 .   ? 19.622  4.584   57.721 1.00 17.82  ? 147  HEM B FE  1 
HETATM 4522 C  CHA . HEM G 3 .   ? -2.184  3.853   20.774 1.00 16.34  ? 147  HEM D CHA 1 
HETATM 4523 C  CHB . HEM G 3 .   ? -3.561  2.305   25.121 1.00 15.95  ? 147  HEM D CHB 1 
HETATM 4524 C  CHC . HEM G 3 .   ? -1.293  6.035   27.162 1.00 13.11  ? 147  HEM D CHC 1 
HETATM 4525 C  CHD . HEM G 3 .   ? 0.088   7.587   22.806 1.00 15.06  ? 147  HEM D CHD 1 
HETATM 4526 C  C1A . HEM G 3 .   ? -2.853  3.143   21.742 1.00 19.78  ? 147  HEM D C1A 1 
HETATM 4527 C  C2A . HEM G 3 .   ? -3.744  2.016   21.542 1.00 14.88  ? 147  HEM D C2A 1 
HETATM 4528 C  C3A . HEM G 3 .   ? -4.226  1.661   22.763 1.00 21.26  ? 147  HEM D C3A 1 
HETATM 4529 C  C4A . HEM G 3 .   ? -3.505  2.443   23.752 1.00 23.23  ? 147  HEM D C4A 1 
HETATM 4530 C  CMA . HEM G 3 .   ? -5.323  0.651   23.081 1.00 28.16  ? 147  HEM D CMA 1 
HETATM 4531 C  CAA . HEM G 3 .   ? -4.012  1.364   20.182 1.00 23.51  ? 147  HEM D CAA 1 
HETATM 4532 C  CBA . HEM G 3 .   ? -2.821  0.771   19.432 1.00 40.42  ? 147  HEM D CBA 1 
HETATM 4533 C  CGA . HEM G 3 .   ? -3.144  -0.156  18.283 1.00 60.30  ? 147  HEM D CGA 1 
HETATM 4534 O  O1A . HEM G 3 .   ? -3.983  0.246   17.444 1.00 69.53  ? 147  HEM D O1A 1 
HETATM 4535 O  O2A . HEM G 3 .   ? -2.523  -1.249  18.248 1.00 55.79  ? 147  HEM D O2A 1 
HETATM 4536 C  C1B . HEM G 3 .   ? -3.049  3.138   26.091 1.00 19.81  ? 147  HEM D C1B 1 
HETATM 4537 C  C2B . HEM G 3 .   ? -3.223  3.019   27.523 1.00 14.33  ? 147  HEM D C2B 1 
HETATM 4538 C  C3B . HEM G 3 .   ? -2.596  4.085   28.104 1.00 15.13  ? 147  HEM D C3B 1 
HETATM 4539 C  C4B . HEM G 3 .   ? -2.023  4.873   27.028 1.00 11.96  ? 147  HEM D C4B 1 
HETATM 4540 C  CMB . HEM G 3 .   ? -3.976  1.887   28.216 1.00 17.68  ? 147  HEM D CMB 1 
HETATM 4541 C  CAB . HEM G 3 .   ? -2.415  4.526   29.449 1.00 20.80  ? 147  HEM D CAB 1 
HETATM 4542 C  CBB . HEM G 3 .   ? -3.531  4.975   30.246 1.00 44.49  ? 147  HEM D CBB 1 
HETATM 4543 C  C1C . HEM G 3 .   ? -0.775  6.838   26.172 1.00 14.22  ? 147  HEM D C1C 1 
HETATM 4544 C  C2C . HEM G 3 .   ? -0.208  8.159   26.344 1.00 16.40  ? 147  HEM D C2C 1 
HETATM 4545 C  C3C . HEM G 3 .   ? 0.278   8.558   25.130 1.00 13.98  ? 147  HEM D C3C 1 
HETATM 4546 C  C4C . HEM G 3 .   ? -0.110  7.539   24.169 1.00 12.88  ? 147  HEM D C4C 1 
HETATM 4547 C  CMC . HEM G 3 .   ? -0.158  8.915   27.667 1.00 16.88  ? 147  HEM D CMC 1 
HETATM 4548 C  CAC . HEM G 3 .   ? 1.051   9.667   24.688 1.00 14.44  ? 147  HEM D CAC 1 
HETATM 4549 C  CBC . HEM G 3 .   ? 1.010   10.944  25.350 1.00 22.59  ? 147  HEM D CBC 1 
HETATM 4550 C  C1D . HEM G 3 .   ? -0.375  6.718   21.844 1.00 17.61  ? 147  HEM D C1D 1 
HETATM 4551 C  C2D . HEM G 3 .   ? -0.197  6.830   20.410 1.00 24.17  ? 147  HEM D C2D 1 
HETATM 4552 C  C3D . HEM G 3 .   ? -0.918  5.830   19.833 1.00 18.82  ? 147  HEM D C3D 1 
HETATM 4553 C  C4D . HEM G 3 .   ? -1.464  5.019   20.902 1.00 16.20  ? 147  HEM D C4D 1 
HETATM 4554 C  CMD . HEM G 3 .   ? 0.644   7.903   19.724 1.00 21.23  ? 147  HEM D CMD 1 
HETATM 4555 C  CAD . HEM G 3 .   ? -1.164  5.575   18.350 1.00 23.24  ? 147  HEM D CAD 1 
HETATM 4556 C  CBD . HEM G 3 .   ? -2.352  6.264   17.682 1.00 25.33  ? 147  HEM D CBD 1 
HETATM 4557 C  CGD . HEM G 3 .   ? -2.334  6.218   16.159 1.00 28.53  ? 147  HEM D CGD 1 
HETATM 4558 O  O1D . HEM G 3 .   ? -1.984  7.269   15.584 1.00 41.76  ? 147  HEM D O1D 1 
HETATM 4559 O  O2D . HEM G 3 .   ? -2.657  5.127   15.639 1.00 44.14  ? 147  HEM D O2D 1 
HETATM 4560 N  NA  . HEM G 3 .   ? -2.743  3.382   23.095 1.00 21.57  ? 147  HEM D NA  1 
HETATM 4561 N  NB  . HEM G 3 .   ? -2.297  4.265   25.826 1.00 16.39  ? 147  HEM D NB  1 
HETATM 4562 N  NC  . HEM G 3 .   ? -0.697  6.491   24.841 1.00 13.05  ? 147  HEM D NC  1 
HETATM 4563 N  ND  . HEM G 3 .   ? -1.136  5.598   22.110 1.00 16.33  ? 147  HEM D ND  1 
HETATM 4564 FE FE  . HEM G 3 .   ? -1.399  4.717   23.987 1.00 16.97  ? 147  HEM D FE  1 
HETATM 4565 O  O   . HOH H 4 .   ? -3.063  17.799  36.457 1.00 25.01  ? 1002 HOH A O   1 
HETATM 4566 O  O   . HOH H 4 .   ? -4.768  28.055  30.507 1.00 24.15  ? 1003 HOH A O   1 
HETATM 4567 O  O   . HOH H 4 .   ? 24.050  13.275  40.445 1.00 23.14  ? 1007 HOH A O   1 
HETATM 4568 O  O   . HOH H 4 .   ? 38.187  9.991   38.928 1.00 21.70  ? 1008 HOH A O   1 
HETATM 4569 O  O   . HOH H 4 .   ? 25.857  7.638   13.069 1.00 17.91  ? 1012 HOH A O   1 
HETATM 4570 O  O   . HOH H 4 .   ? 13.337  27.742  50.107 1.00 20.67  ? 1013 HOH A O   1 
HETATM 4571 O  O   . HOH H 4 .   ? 16.872  33.986  56.927 1.00 32.13  ? 1014 HOH A O   1 
HETATM 4572 O  O   . HOH H 4 .   ? -2.251  17.205  39.072 1.00 22.06  ? 1015 HOH A O   1 
HETATM 4573 O  O   . HOH H 4 .   ? 44.471  17.934  37.144 1.00 27.95  ? 1018 HOH A O   1 
HETATM 4574 O  O   . HOH H 4 .   ? 24.941  13.798  42.927 1.00 25.31  ? 1019 HOH A O   1 
HETATM 4575 O  O   . HOH H 4 .   ? 30.007  24.389  46.860 1.00 22.73  ? 1021 HOH A O   1 
HETATM 4576 O  O   . HOH H 4 .   ? -14.788 16.620  48.962 1.00 28.19  ? 1022 HOH A O   1 
HETATM 4577 O  O   . HOH H 4 .   ? 3.065   20.438  37.280 1.00 32.34  ? 1023 HOH A O   1 
HETATM 4578 O  O   . HOH H 4 .   ? 14.835  15.396  45.721 1.00 30.33  ? 1024 HOH A O   1 
HETATM 4579 O  O   . HOH H 4 .   ? 6.052   24.379  34.973 1.00 43.15  ? 1028 HOH A O   1 
HETATM 4580 O  O   . HOH H 4 .   ? 13.365  36.047  54.563 1.00 33.36  ? 1029 HOH A O   1 
HETATM 4581 O  O   . HOH H 4 .   ? 19.110  23.669  43.085 1.00 38.85  ? 1030 HOH A O   1 
HETATM 4582 O  O   . HOH H 4 .   ? 22.392  15.199  39.515 1.00 36.72  ? 1033 HOH A O   1 
HETATM 4583 O  O   . HOH H 4 .   ? 4.165   8.170   49.153 1.00 29.51  ? 1035 HOH A O   1 
HETATM 4584 O  O   . HOH H 4 .   ? 15.052  4.630   32.162 1.00 29.59  ? 1036 HOH A O   1 
HETATM 4585 O  O   . HOH H 4 .   ? -11.138 25.430  29.003 1.00 23.83  ? 1040 HOH A O   1 
HETATM 4586 O  O   . HOH H 4 .   ? 4.971   27.673  36.794 1.00 27.88  ? 1042 HOH A O   1 
HETATM 4587 O  O   . HOH H 4 .   ? 22.378  16.282  17.092 1.00 28.82  ? 1043 HOH A O   1 
HETATM 4588 O  O   . HOH H 4 .   ? 5.843   22.374  25.409 1.00 35.24  ? 1045 HOH A O   1 
HETATM 4589 O  O   . HOH H 4 .   ? -5.336  12.994  69.554 1.00 29.50  ? 1046 HOH A O   1 
HETATM 4590 O  O   . HOH H 4 .   ? -11.238 33.169  34.078 1.00 47.59  ? 1048 HOH A O   1 
HETATM 4591 O  O   . HOH H 4 .   ? 0.966   24.001  61.776 1.00 36.31  ? 1049 HOH A O   1 
HETATM 4592 O  O   . HOH H 4 .   ? 10.588  13.965  60.168 1.00 27.59  ? 1050 HOH A O   1 
HETATM 4593 O  O   . HOH H 4 .   ? 20.199  0.855   26.383 1.00 28.22  ? 1051 HOH A O   1 
HETATM 4594 O  O   . HOH H 4 .   ? 12.897  39.488  49.513 1.00 35.63  ? 1053 HOH A O   1 
HETATM 4595 O  O   . HOH H 4 .   ? -0.096  31.078  56.959 1.00 26.24  ? 1054 HOH A O   1 
HETATM 4596 O  O   . HOH H 4 .   ? 15.582  30.877  27.826 1.00 35.71  ? 1055 HOH A O   1 
HETATM 4597 O  O   . HOH H 4 .   ? -16.605 18.016  47.253 1.00 30.79  ? 1056 HOH A O   1 
HETATM 4598 O  O   . HOH H 4 .   ? 40.493  11.385  32.186 1.00 33.64  ? 1058 HOH A O   1 
HETATM 4599 O  O   . HOH H 4 .   ? 19.031  18.317  36.567 1.00 38.41  ? 1060 HOH A O   1 
HETATM 4600 O  O   . HOH H 4 .   ? 24.404  27.457  22.947 1.00 39.93  ? 1061 HOH A O   1 
HETATM 4601 O  O   . HOH H 4 .   ? -13.358 30.047  33.241 1.00 43.82  ? 1062 HOH A O   1 
HETATM 4602 O  O   . HOH H 4 .   ? 35.299  7.052   31.614 1.00 33.57  ? 1066 HOH A O   1 
HETATM 4603 O  O   . HOH H 4 .   ? 35.111  20.257  49.237 1.00 24.54  ? 1067 HOH A O   1 
HETATM 4604 O  O   . HOH H 4 .   ? 2.171   18.244  40.797 1.00 26.25  ? 1068 HOH A O   1 
HETATM 4605 O  O   . HOH H 4 .   ? 42.896  17.189  44.917 1.00 30.96  ? 1070 HOH A O   1 
HETATM 4606 O  O   . HOH H 4 .   ? 12.713  12.969  19.286 1.00 35.56  ? 1073 HOH A O   1 
HETATM 4607 O  O   . HOH H 4 .   ? 8.936   17.304  60.419 1.00 40.43  ? 1074 HOH A O   1 
HETATM 4608 O  O   . HOH H 4 .   ? 14.415  31.740  32.311 1.00 54.08  ? 1076 HOH A O   1 
HETATM 4609 O  O   . HOH H 4 .   ? 40.310  9.033   37.242 1.00 30.00  ? 1077 HOH A O   1 
HETATM 4610 O  O   . HOH H 4 .   ? 9.043   20.465  43.888 1.00 33.57  ? 1078 HOH A O   1 
HETATM 4611 O  O   . HOH H 4 .   ? 27.140  -0.854  20.351 1.00 42.70  ? 1081 HOH A O   1 
HETATM 4612 O  O   . HOH H 4 .   ? 16.911  21.019  61.029 1.00 54.17  ? 1082 HOH A O   1 
HETATM 4613 O  O   . HOH H 4 .   ? 10.031  10.139  20.163 1.00 26.33  ? 1084 HOH A O   1 
HETATM 4614 O  O   . HOH H 4 .   ? 12.382  22.168  43.442 1.00 56.13  ? 1085 HOH A O   1 
HETATM 4615 O  O   . HOH H 4 .   ? 6.786   15.241  33.687 1.00 36.69  ? 1086 HOH A O   1 
HETATM 4616 O  O   . HOH H 4 .   ? -7.413  32.056  53.083 1.00 31.61  ? 1090 HOH A O   1 
HETATM 4617 O  O   . HOH H 4 .   ? 30.469  1.814   26.574 0.50 39.03  ? 1091 HOH A O   1 
HETATM 4618 O  O   . HOH H 4 .   ? -9.741  33.136  53.293 1.00 43.11  ? 1093 HOH A O   1 
HETATM 4619 O  O   . HOH H 4 .   ? 35.234  25.351  22.965 0.50 41.68  ? 1095 HOH A O   1 
HETATM 4620 O  O   . HOH H 4 .   ? 38.359  21.808  42.787 1.00 47.60  ? 1100 HOH A O   1 
HETATM 4621 O  O   . HOH H 4 .   ? 1.347   6.594   46.355 1.00 39.66  ? 1102 HOH A O   1 
HETATM 4622 O  O   . HOH H 4 .   ? -6.142  36.403  47.399 1.00 34.48  ? 1103 HOH A O   1 
HETATM 4623 O  O   . HOH H 4 .   ? 12.774  34.137  57.869 1.00 30.00  ? 1106 HOH A O   1 
HETATM 4624 O  O   . HOH H 4 .   ? -18.710 19.242  43.306 1.00 27.15  ? 1107 HOH A O   1 
HETATM 4625 O  O   . HOH H 4 .   ? -2.852  32.137  58.510 0.50 36.96  ? 1109 HOH A O   1 
HETATM 4626 O  O   . HOH H 4 .   ? -0.167  18.806  39.561 1.00 37.14  ? 1111 HOH A O   1 
HETATM 4627 O  O   . HOH H 4 .   ? 4.402   21.658  41.908 1.00 41.84  ? 1112 HOH A O   1 
HETATM 4628 O  O   . HOH H 4 .   ? 42.219  15.472  37.124 1.00 30.17  ? 1119 HOH A O   1 
HETATM 4629 O  O   . HOH H 4 .   ? 29.432  23.779  49.301 1.00 49.78  ? 1121 HOH A O   1 
HETATM 4630 O  O   . HOH H 4 .   ? 20.545  22.483  56.381 1.00 40.69  ? 1123 HOH A O   1 
HETATM 4631 O  O   . HOH H 4 .   ? -8.631  35.866  46.150 0.50 39.13  ? 1124 HOH A O   1 
HETATM 4632 O  O   . HOH H 4 .   ? -18.917 23.220  53.851 1.00 58.17  ? 1125 HOH A O   1 
HETATM 4633 O  O   . HOH H 4 .   ? 11.690  25.603  34.238 1.00 26.64  ? 1126 HOH A O   1 
HETATM 4634 O  O   . HOH H 4 .   ? 14.129  18.854  34.891 1.00 38.66  ? 1129 HOH A O   1 
HETATM 4635 O  O   . HOH H 4 .   ? 17.310  27.172  42.454 0.50 46.92  ? 1130 HOH A O   1 
HETATM 4636 O  O   . HOH H 4 .   ? 19.955  14.860  38.596 1.00 30.70  ? 1131 HOH A O   1 
HETATM 4637 O  O   . HOH H 4 .   ? 11.960  25.916  27.239 1.00 25.01  ? 1132 HOH A O   1 
HETATM 4638 O  O   . HOH H 4 .   ? 3.297   21.501  21.422 1.00 36.64  ? 1133 HOH A O   1 
HETATM 4639 O  O   . HOH H 4 .   ? 13.473  26.307  43.415 1.00 35.52  ? 1135 HOH A O   1 
HETATM 4640 O  O   . HOH H 4 .   ? 34.685  33.514  43.922 1.00 37.21  ? 1136 HOH A O   1 
HETATM 4641 O  O   . HOH H 4 .   ? 23.044  24.518  18.671 0.50 35.42  ? 1137 HOH A O   1 
HETATM 4642 O  O   . HOH H 4 .   ? 11.090  31.718  58.788 1.00 35.47  ? 1139 HOH A O   1 
HETATM 4643 O  O   . HOH H 4 .   ? 14.404  28.040  39.904 1.00 59.41  ? 1141 HOH A O   1 
HETATM 4644 O  O   . HOH H 4 .   ? 11.751  37.088  56.858 1.00 35.64  ? 1142 HOH A O   1 
HETATM 4645 O  O   . HOH H 4 .   ? 20.127  0.570   34.641 1.00 39.02  ? 1150 HOH A O   1 
HETATM 4646 O  O   . HOH H 4 .   ? 16.502  33.805  59.682 1.00 45.51  ? 1151 HOH A O   1 
HETATM 4647 O  O   . HOH H 4 .   ? 7.182   13.989  43.458 1.00 39.95  ? 1153 HOH A O   1 
HETATM 4648 O  O   . HOH H 4 .   ? 30.103  32.936  47.191 1.00 49.39  ? 1155 HOH A O   1 
HETATM 4649 O  O   . HOH H 4 .   ? -10.818 30.771  31.288 1.00 41.09  ? 1156 HOH A O   1 
HETATM 4650 O  O   . HOH H 4 .   ? 21.768  18.670  38.755 1.00 30.59  ? 1157 HOH A O   1 
HETATM 4651 O  O   . HOH H 4 .   ? 17.099  2.906   34.939 1.00 30.94  ? 1161 HOH A O   1 
HETATM 4652 O  O   . HOH H 4 .   ? -2.084  7.025   55.262 1.00 32.44  ? 1162 HOH A O   1 
HETATM 4653 O  O   . HOH H 4 .   ? 39.886  16.252  30.767 0.50 45.07  ? 1163 HOH A O   1 
HETATM 4654 O  O   . HOH H 4 .   ? 25.368  37.568  46.324 1.00 57.16  ? 1164 HOH A O   1 
HETATM 4655 O  O   . HOH H 4 .   ? 13.005  22.919  37.322 1.00 47.91  ? 1165 HOH A O   1 
HETATM 4656 O  O   . HOH H 4 .   ? -15.390 23.665  29.474 1.00 44.69  ? 1166 HOH A O   1 
HETATM 4657 O  O   . HOH H 4 .   ? 20.795  15.512  24.606 1.00 25.21  ? 1167 HOH A O   1 
HETATM 4658 O  O   . HOH H 4 .   ? 9.162   39.433  44.999 1.00 37.04  ? 1168 HOH A O   1 
HETATM 4659 O  O   . HOH H 4 .   ? 37.581  8.254   32.913 1.00 27.82  ? 1169 HOH A O   1 
HETATM 4660 O  O   . HOH H 4 .   ? 18.598  23.217  52.874 1.00 35.37  ? 1171 HOH A O   1 
HETATM 4661 O  O   . HOH H 4 .   ? -1.868  22.412  63.707 1.00 31.35  ? 1173 HOH A O   1 
HETATM 4662 O  O   . HOH H 4 .   ? -2.020  5.110   47.379 1.00 33.78  ? 1174 HOH A O   1 
HETATM 4663 O  O   . HOH H 4 .   ? 17.472  25.549  45.865 1.00 36.00  ? 1175 HOH A O   1 
HETATM 4664 O  O   . HOH H 4 .   ? -10.576 36.958  37.944 1.00 31.20  ? 1176 HOH A O   1 
HETATM 4665 O  O   . HOH H 4 .   ? -11.186 10.716  54.828 1.00 38.11  ? 1177 HOH A O   1 
HETATM 4666 O  O   . HOH H 4 .   ? 6.305   34.131  54.143 1.00 34.24  ? 1178 HOH A O   1 
HETATM 4667 O  O   . HOH H 4 .   ? 1.740   21.845  39.968 1.00 38.78  ? 1179 HOH A O   1 
HETATM 4668 O  O   . HOH H 4 .   ? 1.948   21.167  54.549 1.00 32.92  ? 1180 HOH A O   1 
HETATM 4669 O  O   . HOH H 4 .   ? 22.148  33.268  34.580 1.00 41.83  ? 1181 HOH A O   1 
HETATM 4670 O  O   . HOH H 4 .   ? -8.636  15.287  58.167 1.00 39.06  ? 1185 HOH A O   1 
HETATM 4671 O  O   . HOH H 4 .   ? 16.364  34.900  53.176 1.00 36.70  ? 1186 HOH A O   1 
HETATM 4672 O  O   . HOH H 4 .   ? 7.566   25.829  31.663 1.00 27.05  ? 1187 HOH A O   1 
HETATM 4673 O  O   . HOH H 4 .   ? -12.206 28.616  30.946 1.00 34.78  ? 1191 HOH A O   1 
HETATM 4674 O  O   . HOH H 4 .   ? -8.814  17.180  59.802 1.00 36.71  ? 1193 HOH A O   1 
HETATM 4675 O  O   . HOH H 4 .   ? 20.088  17.845  41.355 1.00 34.93  ? 1196 HOH A O   1 
HETATM 4676 O  O   . HOH H 4 .   ? 17.911  22.922  44.904 0.50 47.69  ? 1197 HOH A O   1 
HETATM 4677 O  O   . HOH H 4 .   ? 25.447  23.539  20.363 1.00 34.04  ? 1199 HOH A O   1 
HETATM 4678 O  O   . HOH H 4 .   ? 40.269  12.034  29.566 1.00 38.46  ? 1200 HOH A O   1 
HETATM 4679 O  O   . HOH H 4 .   ? 2.777   15.255  41.496 1.00 38.18  ? 1202 HOH A O   1 
HETATM 4680 O  O   . HOH H 4 .   ? -12.247 24.097  27.024 1.00 46.74  ? 1204 HOH A O   1 
HETATM 4681 O  O   . HOH H 4 .   ? 1.847   6.279   43.619 1.00 39.20  ? 1205 HOH A O   1 
HETATM 4682 O  O   . HOH H 4 .   ? 6.900   11.200  44.366 1.00 48.07  ? 1206 HOH A O   1 
HETATM 4683 O  O   . HOH H 4 .   ? 18.194  14.539  13.357 1.00 43.48  ? 1208 HOH A O   1 
HETATM 4684 O  O   . HOH H 4 .   ? -2.336  28.385  30.779 1.00 46.82  ? 1210 HOH A O   1 
HETATM 4685 O  O   . HOH H 4 .   ? 1.919   11.010  62.904 1.00 30.04  ? 1214 HOH A O   1 
HETATM 4686 O  O   . HOH H 4 .   ? 15.493  4.574   20.039 1.00 34.88  ? 1215 HOH A O   1 
HETATM 4687 O  O   . HOH H 4 .   ? 16.260  19.366  37.391 1.00 42.23  ? 1216 HOH A O   1 
HETATM 4688 O  O   . HOH H 4 .   ? 6.437   32.918  29.048 1.00 40.24  ? 1217 HOH A O   1 
HETATM 4689 O  O   . HOH H 4 .   ? 7.888   23.603  40.150 1.00 39.27  ? 1219 HOH A O   1 
HETATM 4690 O  O   . HOH H 4 .   ? 14.298  33.564  60.288 1.00 40.51  ? 1224 HOH A O   1 
HETATM 4691 O  O   . HOH H 4 .   ? -6.545  13.761  58.386 1.00 34.77  ? 1225 HOH A O   1 
HETATM 4692 O  O   . HOH H 4 .   ? 32.065  13.796  20.152 1.00 48.30  ? 1226 HOH A O   1 
HETATM 4693 O  O   . HOH H 4 .   ? -4.119  27.390  62.145 1.00 42.16  ? 1228 HOH A O   1 
HETATM 4694 O  O   . HOH H 4 .   ? 25.761  33.312  24.106 1.00 45.24  ? 1229 HOH A O   1 
HETATM 4695 O  O   . HOH H 4 .   ? 24.460  14.030  15.449 1.00 41.88  ? 1230 HOH A O   1 
HETATM 4696 O  O   . HOH H 4 .   ? 11.262  33.575  48.430 1.00 51.77  ? 1231 HOH A O   1 
HETATM 4697 O  O   . HOH H 4 .   ? 33.247  23.573  24.369 1.00 46.50  ? 1233 HOH A O   1 
HETATM 4698 O  O   . HOH H 4 .   ? 20.662  29.092  22.951 1.00 52.66  ? 1234 HOH A O   1 
HETATM 4699 O  O   . HOH H 4 .   ? -6.681  38.358  44.792 1.00 51.50  ? 1236 HOH A O   1 
HETATM 4700 O  O   . HOH H 4 .   ? 18.830  1.534   19.918 1.00 48.98  ? 1239 HOH A O   1 
HETATM 4701 O  O   . HOH H 4 .   ? 36.879  22.312  46.103 1.00 43.59  ? 1241 HOH A O   1 
HETATM 4702 O  O   . HOH H 4 .   ? -9.313  24.020  58.330 1.00 49.13  ? 1242 HOH A O   1 
HETATM 4703 O  O   . HOH H 4 .   ? 33.489  28.726  28.769 1.00 38.24  ? 1243 HOH A O   1 
HETATM 4704 O  O   . HOH H 4 .   ? 3.859   25.822  61.946 1.00 56.53  ? 1244 HOH A O   1 
HETATM 4705 O  O   . HOH H 4 .   ? 13.310  26.251  17.372 1.00 53.45  ? 1256 HOH A O   1 
HETATM 4706 O  O   . HOH H 4 .   ? 12.380  29.018  35.293 1.00 38.03  ? 1260 HOH A O   1 
HETATM 4707 O  O   . HOH H 4 .   ? 28.197  33.112  49.058 1.00 44.47  ? 1261 HOH A O   1 
HETATM 4708 O  O   . HOH H 4 .   ? 20.166  2.272   17.369 1.00 36.89  ? 1265 HOH A O   1 
HETATM 4709 O  O   . HOH H 4 .   ? 21.066  12.360  12.103 1.00 34.48  ? 1268 HOH A O   1 
HETATM 4710 O  O   . HOH H 4 .   ? -7.889  10.228  56.975 1.00 48.11  ? 1272 HOH A O   1 
HETATM 4711 O  O   . HOH H 4 .   ? 40.665  25.438  35.246 1.00 49.59  ? 1273 HOH A O   1 
HETATM 4712 O  O   . HOH H 4 .   ? 31.821  33.449  49.389 1.00 36.84  ? 1277 HOH A O   1 
HETATM 4713 O  O   . HOH H 4 .   ? -18.747 24.978  41.023 1.00 52.08  ? 1279 HOH A O   1 
HETATM 4714 O  O   . HOH H 4 .   ? 33.709  26.544  47.091 1.00 43.42  ? 1280 HOH A O   1 
HETATM 4715 O  O   . HOH H 4 .   ? 27.206  25.370  46.592 1.00 47.94  ? 1282 HOH A O   1 
HETATM 4716 O  O   . HOH H 4 .   ? 13.313  14.814  16.947 1.00 44.91  ? 1283 HOH A O   1 
HETATM 4717 O  O   . HOH H 4 .   ? -13.338 16.155  59.084 1.00 53.59  ? 1287 HOH A O   1 
HETATM 4718 O  O   . HOH H 4 .   ? -10.440 29.648  55.354 1.00 46.08  ? 1288 HOH A O   1 
HETATM 4719 O  O   . HOH H 4 .   ? -8.898  7.602   61.152 1.00 54.46  ? 1291 HOH A O   1 
HETATM 4720 O  O   . HOH H 4 .   ? -5.506  11.396  55.864 1.00 41.87  ? 1292 HOH A O   1 
HETATM 4721 O  O   . HOH H 4 .   ? -9.982  33.179  48.864 1.00 53.55  ? 1293 HOH A O   1 
HETATM 4722 O  O   . HOH H 4 .   ? 7.140   21.657  41.121 1.00 46.42  ? 1296 HOH A O   1 
HETATM 4723 O  O   . HOH H 4 .   ? 16.784  25.234  39.596 0.50 43.68  ? 1297 HOH A O   1 
HETATM 4724 O  O   . HOH H 4 .   ? 21.794  14.880  13.497 1.00 46.21  ? 1298 HOH A O   1 
HETATM 4725 O  O   . HOH H 4 .   ? -14.204 34.399  41.559 1.00 44.04  ? 1299 HOH A O   1 
HETATM 4726 O  O   . HOH H 4 .   ? 40.851  19.740  43.790 1.00 67.27  ? 1301 HOH A O   1 
HETATM 4727 O  O   . HOH H 4 .   ? 9.144   16.334  18.426 1.00 41.92  ? 1302 HOH A O   1 
HETATM 4728 O  O   . HOH H 4 .   ? -11.357 34.783  53.555 1.00 54.83  ? 1304 HOH A O   1 
HETATM 4729 O  O   . HOH H 4 .   ? 40.033  22.509  47.613 1.00 53.56  ? 1306 HOH A O   1 
HETATM 4730 O  O   . HOH H 4 .   ? 35.303  9.877   27.298 1.00 43.79  ? 1307 HOH A O   1 
HETATM 4731 O  O   . HOH H 4 .   ? 19.973  25.273  40.428 1.00 36.05  ? 1308 HOH A O   1 
HETATM 4732 O  O   . HOH H 4 .   ? 45.642  16.152  33.930 1.00 60.30  ? 1313 HOH A O   1 
HETATM 4733 O  O   . HOH H 4 .   ? 1.867   12.659  41.608 1.00 52.77  ? 1315 HOH A O   1 
HETATM 4734 O  O   . HOH H 4 .   ? 40.914  14.225  32.522 0.50 51.94  ? 1316 HOH A O   1 
HETATM 4735 O  O   . HOH H 4 .   ? -3.139  5.168   52.346 1.00 46.19  ? 1317 HOH A O   1 
HETATM 4736 O  O   . HOH H 4 .   ? 34.466  31.808  31.934 0.50 41.38  ? 1318 HOH A O   1 
HETATM 4737 O  O   . HOH H 4 .   ? 17.594  19.573  16.667 1.00 49.72  ? 1320 HOH A O   1 
HETATM 4738 O  O   . HOH H 4 .   ? 26.382  14.718  13.933 1.00 55.09  ? 1321 HOH A O   1 
HETATM 4739 O  O   . HOH I 4 .   ? 8.096   11.402  49.653 1.00 21.54  ? 1001 HOH B O   1 
HETATM 4740 O  O   . HOH I 4 .   ? 40.157  1.748   38.994 1.00 23.05  ? 1005 HOH B O   1 
HETATM 4741 O  O   . HOH I 4 .   ? 4.997   6.810   56.026 1.00 24.60  ? 1006 HOH B O   1 
HETATM 4742 O  O   . HOH I 4 .   ? 11.361  12.756  56.482 1.00 22.18  ? 1010 HOH B O   1 
HETATM 4743 O  O   . HOH I 4 .   ? 33.612  -4.364  37.608 1.00 34.33  ? 1027 HOH B O   1 
HETATM 4744 O  O   . HOH I 4 .   ? 13.846  -3.998  45.364 1.00 33.09  ? 1031 HOH B O   1 
HETATM 4745 O  O   . HOH I 4 .   ? 19.139  4.089   39.232 1.00 24.38  ? 1041 HOH B O   1 
HETATM 4746 O  O   . HOH I 4 .   ? 31.392  18.359  66.499 1.00 47.38  ? 1044 HOH B O   1 
HETATM 4747 O  O   . HOH I 4 .   ? 16.327  -0.307  37.745 1.00 42.46  ? 1047 HOH B O   1 
HETATM 4748 O  O   . HOH I 4 .   ? 25.313  -3.352  32.481 1.00 28.88  ? 1052 HOH B O   1 
HETATM 4749 O  O   . HOH I 4 .   ? 19.716  7.035   43.031 1.00 35.90  ? 1057 HOH B O   1 
HETATM 4750 O  O   . HOH I 4 .   ? 25.571  -1.680  59.392 1.00 39.11  ? 1063 HOH B O   1 
HETATM 4751 O  O   . HOH I 4 .   ? 24.637  6.782   63.407 1.00 36.54  ? 1069 HOH B O   1 
HETATM 4752 O  O   . HOH I 4 .   ? 7.836   5.690   47.917 1.00 39.71  ? 1071 HOH B O   1 
HETATM 4753 O  O   . HOH I 4 .   ? 35.282  19.128  51.740 1.00 32.07  ? 1083 HOH B O   1 
HETATM 4754 O  O   . HOH I 4 .   ? 17.333  3.331   38.033 1.00 48.33  ? 1087 HOH B O   1 
HETATM 4755 O  O   . HOH I 4 .   ? 16.184  -1.920  39.986 1.00 34.81  ? 1089 HOH B O   1 
HETATM 4756 O  O   . HOH I 4 .   ? 13.796  14.198  54.420 1.00 31.10  ? 1092 HOH B O   1 
HETATM 4757 O  O   . HOH I 4 .   ? 7.135   8.070   59.749 1.00 30.53  ? 1094 HOH B O   1 
HETATM 4758 O  O   . HOH I 4 .   ? 24.448  22.189  48.050 1.00 36.42  ? 1096 HOH B O   1 
HETATM 4759 O  O   . HOH I 4 .   ? 24.399  -14.725 30.526 1.00 37.22  ? 1097 HOH B O   1 
HETATM 4760 O  O   . HOH I 4 .   ? 29.497  -5.383  32.217 1.00 48.61  ? 1099 HOH B O   1 
HETATM 4761 O  O   . HOH I 4 .   ? 27.859  -14.214 39.844 0.50 42.17  ? 1101 HOH B O   1 
HETATM 4762 O  O   . HOH I 4 .   ? 34.799  4.368   31.690 1.00 26.36  ? 1104 HOH B O   1 
HETATM 4763 O  O   . HOH I 4 .   ? 36.448  -2.317  53.299 1.00 30.70  ? 1105 HOH B O   1 
HETATM 4764 O  O   . HOH I 4 .   ? 18.362  -12.102 53.875 1.00 43.65  ? 1113 HOH B O   1 
HETATM 4765 O  O   . HOH I 4 .   ? 36.338  23.884  58.654 0.50 56.00  ? 1115 HOH B O   1 
HETATM 4766 O  O   . HOH I 4 .   ? 34.652  3.031   28.861 1.00 39.33  ? 1120 HOH B O   1 
HETATM 4767 O  O   . HOH I 4 .   ? 15.461  14.723  51.644 1.00 32.77  ? 1127 HOH B O   1 
HETATM 4768 O  O   . HOH I 4 .   ? 20.034  3.409   47.412 1.00 31.72  ? 1134 HOH B O   1 
HETATM 4769 O  O   . HOH I 4 .   ? 33.987  18.358  61.807 1.00 40.69  ? 1138 HOH B O   1 
HETATM 4770 O  O   . HOH I 4 .   ? 2.916   5.744   59.192 1.00 34.01  ? 1140 HOH B O   1 
HETATM 4771 O  O   . HOH I 4 .   ? 44.795  3.070   29.606 1.00 34.78  ? 1146 HOH B O   1 
HETATM 4772 O  O   . HOH I 4 .   ? 17.345  9.352   64.379 1.00 39.54  ? 1152 HOH B O   1 
HETATM 4773 O  O   . HOH I 4 .   ? 16.505  15.210  41.645 1.00 54.92  ? 1158 HOH B O   1 
HETATM 4774 O  O   . HOH I 4 .   ? 34.237  11.655  54.922 1.00 40.41  ? 1170 HOH B O   1 
HETATM 4775 O  O   . HOH I 4 .   ? 5.118   7.755   58.575 1.00 28.71  ? 1182 HOH B O   1 
HETATM 4776 O  O   . HOH I 4 .   ? 8.127   10.791  47.117 1.00 45.24  ? 1183 HOH B O   1 
HETATM 4777 O  O   . HOH I 4 .   ? 14.490  3.367   43.127 1.00 38.36  ? 1189 HOH B O   1 
HETATM 4778 O  O   . HOH I 4 .   ? 21.028  7.461   40.586 1.00 39.99  ? 1192 HOH B O   1 
HETATM 4779 O  O   . HOH I 4 .   ? 27.296  7.944   64.026 1.00 43.96  ? 1195 HOH B O   1 
HETATM 4780 O  O   . HOH I 4 .   ? 20.349  13.803  65.043 1.00 35.14  ? 1203 HOH B O   1 
HETATM 4781 O  O   . HOH I 4 .   ? 45.427  1.427   33.311 1.00 40.77  ? 1209 HOH B O   1 
HETATM 4782 O  O   . HOH I 4 .   ? 11.141  -4.318  52.275 1.00 33.93  ? 1211 HOH B O   1 
HETATM 4783 O  O   . HOH I 4 .   ? 24.407  -11.594 45.487 1.00 40.26  ? 1213 HOH B O   1 
HETATM 4784 O  O   . HOH I 4 .   ? 16.656  -5.434  57.425 1.00 38.32  ? 1221 HOH B O   1 
HETATM 4785 O  O   . HOH I 4 .   ? 35.468  -2.522  35.442 1.00 44.50  ? 1223 HOH B O   1 
HETATM 4786 O  O   . HOH I 4 .   ? 34.912  23.970  53.310 1.00 42.49  ? 1227 HOH B O   1 
HETATM 4787 O  O   . HOH I 4 .   ? 41.244  4.135   43.841 1.00 46.60  ? 1238 HOH B O   1 
HETATM 4788 O  O   . HOH I 4 .   ? 15.110  10.623  62.786 1.00 32.76  ? 1240 HOH B O   1 
HETATM 4789 O  O   . HOH I 4 .   ? 34.957  10.252  45.661 1.00 56.07  ? 1246 HOH B O   1 
HETATM 4790 O  O   . HOH I 4 .   ? 19.476  -13.443 46.661 1.00 42.83  ? 1247 HOH B O   1 
HETATM 4791 O  O   . HOH I 4 .   ? 17.886  15.750  63.717 1.00 38.84  ? 1252 HOH B O   1 
HETATM 4792 O  O   . HOH I 4 .   ? 9.845   2.775   45.998 1.00 48.44  ? 1253 HOH B O   1 
HETATM 4793 O  O   . HOH I 4 .   ? 13.552  -8.452  45.462 1.00 54.03  ? 1255 HOH B O   1 
HETATM 4794 O  O   . HOH I 4 .   ? 32.638  -2.451  31.249 1.00 37.18  ? 1257 HOH B O   1 
HETATM 4795 O  O   . HOH I 4 .   ? 26.484  22.614  51.312 1.00 36.74  ? 1259 HOH B O   1 
HETATM 4796 O  O   . HOH I 4 .   ? 38.087  2.018   48.559 1.00 35.04  ? 1262 HOH B O   1 
HETATM 4797 O  O   . HOH I 4 .   ? -0.560  3.596   54.558 1.00 37.94  ? 1263 HOH B O   1 
HETATM 4798 O  O   . HOH I 4 .   ? 38.939  -4.155  49.505 1.00 54.02  ? 1266 HOH B O   1 
HETATM 4799 O  O   . HOH I 4 .   ? 23.478  7.760   67.678 1.00 36.66  ? 1274 HOH B O   1 
HETATM 4800 O  O   . HOH I 4 .   ? 24.356  11.194  67.679 1.00 35.83  ? 1281 HOH B O   1 
HETATM 4801 O  O   . HOH I 4 .   ? 9.024   0.035   47.413 1.00 37.06  ? 1284 HOH B O   1 
HETATM 4802 O  O   . HOH I 4 .   ? 24.709  19.054  67.750 1.00 37.86  ? 1286 HOH B O   1 
HETATM 4803 O  O   . HOH I 4 .   ? 35.679  8.733   54.294 1.00 49.07  ? 1300 HOH B O   1 
HETATM 4804 O  O   . HOH I 4 .   ? 17.220  11.810  64.052 1.00 51.75  ? 1310 HOH B O   1 
HETATM 4805 O  O   . HOH I 4 .   ? 26.853  22.844  66.086 1.00 58.24  ? 1319 HOH B O   1 
HETATM 4806 O  O   . HOH I 4 .   ? 13.709  14.600  41.712 1.00 54.00  ? 1322 HOH B O   1 
HETATM 4807 O  O   . HOH J 4 .   ? 9.175   9.869   23.815 1.00 18.05  ? 1004 HOH D O   1 
HETATM 4808 O  O   . HOH J 4 .   ? 13.456  2.491   25.500 1.00 26.84  ? 1009 HOH D O   1 
HETATM 4809 O  O   . HOH J 4 .   ? -1.647  -5.696  26.017 1.00 23.94  ? 1011 HOH D O   1 
HETATM 4810 O  O   . HOH J 4 .   ? 0.986   -6.542  38.883 1.00 35.01  ? 1016 HOH D O   1 
HETATM 4811 O  O   . HOH J 4 .   ? -16.386 4.289   45.421 1.00 26.18  ? 1017 HOH D O   1 
HETATM 4812 O  O   . HOH J 4 .   ? 7.280   12.566  25.851 1.00 27.35  ? 1020 HOH D O   1 
HETATM 4813 O  O   . HOH J 4 .   ? 0.472   9.521   38.144 1.00 34.66  ? 1025 HOH D O   1 
HETATM 4814 O  O   . HOH J 4 .   ? 12.050  8.904   30.630 1.00 25.14  ? 1026 HOH D O   1 
HETATM 4815 O  O   . HOH J 4 .   ? -19.078 9.090   33.453 1.00 34.28  ? 1032 HOH D O   1 
HETATM 4816 O  O   . HOH J 4 .   ? 0.490   1.069   42.968 1.00 31.50  ? 1034 HOH D O   1 
HETATM 4817 O  O   . HOH J 4 .   ? 3.836   -5.453  30.784 1.00 28.55  ? 1037 HOH D O   1 
HETATM 4818 O  O   . HOH J 4 .   ? 0.441   11.979  14.656 1.00 28.48  ? 1038 HOH D O   1 
HETATM 4819 O  O   . HOH J 4 .   ? -1.109  11.031  40.057 1.00 36.12  ? 1039 HOH D O   1 
HETATM 4820 O  O   . HOH J 4 .   ? 2.497   9.137   16.919 1.00 38.54  ? 1059 HOH D O   1 
HETATM 4821 O  O   . HOH J 4 .   ? -16.994 18.573  41.103 1.00 25.21  ? 1064 HOH D O   1 
HETATM 4822 O  O   . HOH J 4 .   ? -8.075  9.210   16.775 1.00 32.87  ? 1065 HOH D O   1 
HETATM 4823 O  O   . HOH J 4 .   ? -0.276  7.254   41.943 1.00 28.58  ? 1072 HOH D O   1 
HETATM 4824 O  O   . HOH J 4 .   ? 2.139   -2.981  37.369 1.00 28.04  ? 1075 HOH D O   1 
HETATM 4825 O  O   . HOH J 4 .   ? -8.139  3.821   50.248 1.00 34.93  ? 1079 HOH D O   1 
HETATM 4826 O  O   . HOH J 4 .   ? -21.315 12.424  43.397 1.00 52.76  ? 1080 HOH D O   1 
HETATM 4827 O  O   . HOH J 4 .   ? -13.816 -2.608  34.001 1.00 41.04  ? 1088 HOH D O   1 
HETATM 4828 O  O   . HOH J 4 .   ? 11.081  -5.728  26.030 1.00 44.00  ? 1098 HOH D O   1 
HETATM 4829 O  O   . HOH J 4 .   ? -1.252  -10.721 23.607 1.00 32.61  ? 1108 HOH D O   1 
HETATM 4830 O  O   . HOH J 4 .   ? -25.186 15.158  46.689 1.00 41.22  ? 1110 HOH D O   1 
HETATM 4831 O  O   . HOH J 4 .   ? -2.226  24.538  26.801 1.00 32.63  ? 1114 HOH D O   1 
HETATM 4832 O  O   . HOH J 4 .   ? -22.780 7.081   34.841 1.00 28.38  ? 1116 HOH D O   1 
HETATM 4833 O  O   . HOH J 4 .   ? 0.828   20.419  18.341 1.00 42.18  ? 1117 HOH D O   1 
HETATM 4834 O  O   . HOH J 4 .   ? 7.385   -5.735  15.824 0.50 40.31  ? 1118 HOH D O   1 
HETATM 4835 O  O   . HOH J 4 .   ? 11.399  3.751   21.457 1.00 33.41  ? 1122 HOH D O   1 
HETATM 4836 O  O   . HOH J 4 .   ? -23.508 15.438  45.011 1.00 40.44  ? 1128 HOH D O   1 
HETATM 4837 O  O   . HOH J 4 .   ? -1.623  5.554   34.253 1.00 42.56  ? 1143 HOH D O   1 
HETATM 4838 O  O   . HOH J 4 .   ? 2.906   -0.067  41.414 1.00 54.48  ? 1144 HOH D O   1 
HETATM 4839 O  O   . HOH J 4 .   ? -6.368  -3.566  27.269 1.00 51.20  ? 1145 HOH D O   1 
HETATM 4840 O  O   . HOH J 4 .   ? -11.063 -9.532  28.440 0.50 33.43  ? 1147 HOH D O   1 
HETATM 4841 O  O   . HOH J 4 .   ? 1.564   7.126   39.196 1.00 47.06  ? 1148 HOH D O   1 
HETATM 4842 O  O   . HOH J 4 .   ? 4.910   -9.667  31.514 1.00 47.17  ? 1149 HOH D O   1 
HETATM 4843 O  O   . HOH J 4 .   ? 1.007   2.891   45.081 1.00 54.96  ? 1154 HOH D O   1 
HETATM 4844 O  O   . HOH J 4 .   ? 14.558  0.247   22.583 1.00 34.12  ? 1159 HOH D O   1 
HETATM 4845 O  O   . HOH J 4 .   ? 5.321   -2.382  37.922 1.00 50.64  ? 1160 HOH D O   1 
HETATM 4846 O  O   . HOH J 4 .   ? -0.475  -8.747  27.089 1.00 36.44  ? 1172 HOH D O   1 
HETATM 4847 O  O   . HOH J 4 .   ? 5.149   7.868   17.833 1.00 39.92  ? 1184 HOH D O   1 
HETATM 4848 O  O   . HOH J 4 .   ? -15.139 6.892   51.010 1.00 37.36  ? 1188 HOH D O   1 
HETATM 4849 O  O   . HOH J 4 .   ? -0.425  24.672  29.327 1.00 40.30  ? 1190 HOH D O   1 
HETATM 4850 O  O   . HOH J 4 .   ? 3.599   -5.540  20.620 1.00 32.41  ? 1194 HOH D O   1 
HETATM 4851 O  O   . HOH J 4 .   ? -9.400  -0.128  23.568 1.00 30.69  ? 1198 HOH D O   1 
HETATM 4852 O  O   . HOH J 4 .   ? 5.868   13.853  28.252 1.00 34.30  ? 1201 HOH D O   1 
HETATM 4853 O  O   . HOH J 4 .   ? -2.566  17.700  12.304 0.50 30.74  ? 1207 HOH D O   1 
HETATM 4854 O  O   . HOH J 4 .   ? 5.629   -7.189  30.855 0.50 43.47  ? 1212 HOH D O   1 
HETATM 4855 O  O   . HOH J 4 .   ? 7.506   -0.787  35.138 1.00 42.60  ? 1218 HOH D O   1 
HETATM 4856 O  O   . HOH J 4 .   ? -14.848 14.068  49.156 1.00 33.89  ? 1220 HOH D O   1 
HETATM 4857 O  O   . HOH J 4 .   ? -21.508 2.097   41.247 1.00 31.19  ? 1222 HOH D O   1 
HETATM 4858 O  O   . HOH J 4 .   ? -24.724 17.372  49.049 1.00 45.10  ? 1232 HOH D O   1 
HETATM 4859 O  O   . HOH J 4 .   ? -4.819  17.135  10.139 1.00 52.27  ? 1235 HOH D O   1 
HETATM 4860 O  O   . HOH J 4 .   ? -6.622  6.799   17.517 1.00 43.11  ? 1237 HOH D O   1 
HETATM 4861 O  O   . HOH J 4 .   ? 8.120   6.950   34.459 1.00 57.08  ? 1245 HOH D O   1 
HETATM 4862 O  O   . HOH J 4 .   ? 7.641   -4.911  19.003 1.00 65.59  ? 1248 HOH D O   1 
HETATM 4863 O  O   . HOH J 4 .   ? -14.624 10.782  17.666 1.00 47.53  ? 1249 HOH D O   1 
HETATM 4864 O  O   . HOH J 4 .   ? -14.580 16.185  27.033 0.50 26.06  ? 1250 HOH D O   1 
HETATM 4865 O  O   . HOH J 4 .   ? 11.703  8.134   33.493 1.00 45.35  ? 1251 HOH D O   1 
HETATM 4866 O  O   . HOH J 4 .   ? -17.869 7.690   47.769 1.00 33.90  ? 1254 HOH D O   1 
HETATM 4867 O  O   . HOH J 4 .   ? -2.284  24.237  22.817 1.00 45.79  ? 1258 HOH D O   1 
HETATM 4868 O  O   . HOH J 4 .   ? -10.141 -3.367  57.116 1.00 48.56  ? 1264 HOH D O   1 
HETATM 4869 O  O   . HOH J 4 .   ? -6.184  0.371   18.094 1.00 52.62  ? 1267 HOH D O   1 
HETATM 4870 O  O   . HOH J 4 .   ? -0.424  21.004  16.333 1.00 50.43  ? 1269 HOH D O   1 
HETATM 4871 O  O   . HOH J 4 .   ? -15.647 13.887  52.109 1.00 47.24  ? 1270 HOH D O   1 
HETATM 4872 O  O   . HOH J 4 .   ? 4.038   4.638   38.177 1.00 37.17  ? 1271 HOH D O   1 
HETATM 4873 O  O   . HOH J 4 .   ? -26.048 16.765  50.924 1.00 50.79  ? 1275 HOH D O   1 
HETATM 4874 O  O   . HOH J 4 .   ? 18.250  -2.057  27.860 1.00 41.64  ? 1276 HOH D O   1 
HETATM 4875 O  O   . HOH J 4 .   ? 5.274   16.758  38.608 1.00 50.73  ? 1278 HOH D O   1 
HETATM 4876 O  O   . HOH J 4 .   ? -15.219 22.008  32.130 1.00 45.72  ? 1285 HOH D O   1 
HETATM 4877 O  O   . HOH J 4 .   ? -12.852 15.826  24.491 1.00 55.16  ? 1289 HOH D O   1 
HETATM 4878 O  O   . HOH J 4 .   ? -0.928  2.154   16.950 1.00 42.29  ? 1290 HOH D O   1 
HETATM 4879 O  O   . HOH J 4 .   ? -8.307  -4.837  54.779 1.00 54.68  ? 1294 HOH D O   1 
HETATM 4880 O  O   . HOH J 4 .   ? -16.643 13.983  32.349 1.00 65.64  ? 1295 HOH D O   1 
HETATM 4881 O  O   . HOH J 4 .   ? -26.322 13.339  47.519 1.00 53.78  ? 1303 HOH D O   1 
HETATM 4882 O  O   . HOH J 4 .   ? -10.163 28.672  20.189 1.00 45.79  ? 1305 HOH D O   1 
HETATM 4883 O  O   . HOH J 4 .   ? 6.006   20.622  15.901 0.50 41.92  ? 1309 HOH D O   1 
HETATM 4884 O  O   . HOH J 4 .   ? -21.705 16.412  52.471 0.50 74.95  ? 1311 HOH D O   1 
HETATM 4885 O  O   . HOH J 4 .   ? -12.780 10.746  14.728 1.00 41.57  ? 1312 HOH D O   1 
HETATM 4886 O  O   . HOH J 4 .   ? -15.174 14.153  26.005 0.50 38.00  ? 1314 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   LEU 2   2   2   LEU LEU A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  TRP 14  14  14  TRP TRP A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  HIS 20  20  20  HIS HIS A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  HIS 45  45  45  HIS HIS A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  HIS 50  50  50  HIS HIS A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  HIS 72  72  72  HIS HIS A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  MET 76  76  76  MET MET A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  HIS 89  89  89  HIS HIS A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 HIS 103 103 103 HIS HIS A . n 
A 1 104 CYS 104 104 104 CYS CYS A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 HIS 112 112 112 HIS HIS A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 HIS 122 122 122 HIS HIS A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 LYS 139 139 139 LYS LYS A . n 
A 1 140 TYR 140 140 140 TYR TYR A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 PRO 146 146 146 PRO PRO A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 TRP 156 156 156 TRP TRP A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 TYR 166 166 166 TYR TYR A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 ARG 173 173 173 ARG ARG A . n 
A 1 174 MET 174 174 174 MET MET A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 PRO 179 179 179 PRO PRO A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 THR 183 183 183 THR THR A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 PRO 186 186 186 PRO PRO A . n 
A 1 187 HIS 187 187 187 HIS HIS A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 HIS 192 192 192 HIS HIS A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 SER 194 194 194 SER SER A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 GLN 196 196 196 GLN GLN A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 HIS 200 200 200 HIS HIS A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 LYS 203 203 203 LYS LYS A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 ASN 210 210 210 ASN ASN A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 HIS 214 214 214 HIS HIS A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 MET 218 218 218 MET MET A . n 
A 1 219 PRO 219 219 219 PRO PRO A . n 
A 1 220 ASN 220 220 220 ASN ASN A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 HIS 229 229 229 HIS HIS A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 HIS 231 231 231 HIS HIS A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 VAL 235 235 235 VAL VAL A . n 
A 1 236 ASP 236 236 236 ASP ASP A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ASN 239 239 239 ASN ASN A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 LYS 241 241 241 LYS LYS A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 LEU 243 243 243 LEU LEU A . n 
A 1 244 SER 244 244 244 SER SER A . n 
A 1 245 HIS 245 245 245 HIS HIS A . n 
A 1 246 CYS 246 246 246 CYS CYS A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 HIS 254 254 254 HIS HIS A . n 
A 1 255 LEU 255 255 255 LEU LEU A . n 
A 1 256 PRO 256 256 256 PRO PRO A . n 
A 1 257 ALA 257 257 257 ALA ALA A . n 
A 1 258 GLU 258 258 258 GLU GLU A . n 
A 1 259 PHE 259 259 259 PHE PHE A . n 
A 1 260 THR 260 260 260 THR THR A . n 
A 1 261 PRO 261 261 261 PRO PRO A . n 
A 1 262 ALA 262 262 262 ALA ALA A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 ALA 265 265 265 ALA ALA A . n 
A 1 266 SER 266 266 266 SER SER A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 ASP 268 268 268 ASP ASP A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 PHE 270 270 270 PHE PHE A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 ALA 272 272 272 ALA ALA A . n 
A 1 273 SER 273 273 273 SER SER A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 THR 279 279 279 THR THR A . n 
A 1 280 SER 280 280 280 SER SER A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
B 2 1   MET 1   1   1   MET MET B . n 
B 2 2   HIS 2   2   2   HIS HIS B . n 
B 2 3   LEU 3   3   3   LEU LEU B . n 
B 2 4   THR 4   4   4   THR THR B . n 
B 2 5   PRO 5   5   5   PRO PRO B . n 
B 2 6   GLU 6   6   6   GLU GLU B . n 
B 2 7   GLU 7   7   7   GLU GLU B . n 
B 2 8   LYS 8   8   8   LYS LYS B . n 
B 2 9   SER 9   9   9   SER SER B . n 
B 2 10  ALA 10  10  10  ALA ALA B . n 
B 2 11  VAL 11  11  11  VAL VAL B . n 
B 2 12  THR 12  12  12  THR THR B . n 
B 2 13  ALA 13  13  13  ALA ALA B . n 
B 2 14  LEU 14  14  14  LEU LEU B . n 
B 2 15  TRP 15  15  15  TRP TRP B . n 
B 2 16  GLY 16  16  16  GLY GLY B . n 
B 2 17  LYS 17  17  17  LYS LYS B . n 
B 2 18  VAL 18  18  18  VAL VAL B . n 
B 2 19  ASN 19  19  19  ASN ASN B . n 
B 2 20  VAL 20  20  20  VAL VAL B . n 
B 2 21  ASP 21  21  21  ASP ASP B . n 
B 2 22  GLU 22  22  22  GLU GLU B . n 
B 2 23  VAL 23  23  23  VAL VAL B . n 
B 2 24  GLY 24  24  24  GLY GLY B . n 
B 2 25  GLY 25  25  25  GLY GLY B . n 
B 2 26  GLU 26  26  26  GLU GLU B . n 
B 2 27  ALA 27  27  27  ALA ALA B . n 
B 2 28  LEU 28  28  28  LEU LEU B . n 
B 2 29  GLY 29  29  29  GLY GLY B . n 
B 2 30  ARG 30  30  30  ARG ARG B . n 
B 2 31  LEU 31  31  31  LEU LEU B . n 
B 2 32  LEU 32  32  32  LEU LEU B . n 
B 2 33  VAL 33  33  33  VAL VAL B . n 
B 2 34  VAL 34  34  34  VAL VAL B . n 
B 2 35  TYR 35  35  35  TYR TYR B . n 
B 2 36  PRO 36  36  36  PRO PRO B . n 
B 2 37  TRP 37  37  37  TRP TRP B . n 
B 2 38  THR 38  38  38  THR THR B . n 
B 2 39  GLN 39  39  39  GLN GLN B . n 
B 2 40  ARG 40  40  40  ARG ARG B . n 
B 2 41  PHE 41  41  41  PHE PHE B . n 
B 2 42  PHE 42  42  42  PHE PHE B . n 
B 2 43  GLU 43  43  43  GLU GLU B . n 
B 2 44  SER 44  44  44  SER SER B . n 
B 2 45  PHE 45  45  45  PHE PHE B . n 
B 2 46  GLY 46  46  46  GLY GLY B . n 
B 2 47  ASP 47  47  47  ASP ASP B . n 
B 2 48  LEU 48  48  48  LEU LEU B . n 
B 2 49  SER 49  49  49  SER SER B . n 
B 2 50  THR 50  50  50  THR THR B . n 
B 2 51  PRO 51  51  51  PRO PRO B . n 
B 2 52  ASP 52  52  52  ASP ASP B . n 
B 2 53  ALA 53  53  53  ALA ALA B . n 
B 2 54  VAL 54  54  54  VAL VAL B . n 
B 2 55  MET 55  55  55  MET MET B . n 
B 2 56  GLY 56  56  56  GLY GLY B . n 
B 2 57  ASN 57  57  57  ASN ASN B . n 
B 2 58  PRO 58  58  58  PRO PRO B . n 
B 2 59  LYS 59  59  59  LYS LYS B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  LYS 61  61  61  LYS LYS B . n 
B 2 62  ALA 62  62  62  ALA ALA B . n 
B 2 63  HIS 63  63  63  HIS HIS B . n 
B 2 64  GLY 64  64  64  GLY GLY B . n 
B 2 65  LYS 65  65  65  LYS LYS B . n 
B 2 66  LYS 66  66  66  LYS LYS B . n 
B 2 67  VAL 67  67  67  VAL VAL B . n 
B 2 68  LEU 68  68  68  LEU LEU B . n 
B 2 69  GLY 69  69  69  GLY GLY B . n 
B 2 70  ALA 70  70  70  ALA ALA B . n 
B 2 71  PHE 71  71  71  PHE PHE B . n 
B 2 72  SER 72  72  72  SER SER B . n 
B 2 73  ASP 73  73  73  ASP ASP B . n 
B 2 74  GLY 74  74  74  GLY GLY B . n 
B 2 75  LEU 75  75  75  LEU LEU B . n 
B 2 76  ALA 76  76  76  ALA ALA B . n 
B 2 77  HIS 77  77  77  HIS HIS B . n 
B 2 78  LEU 78  78  78  LEU LEU B . n 
B 2 79  ASP 79  79  79  ASP ASP B . n 
B 2 80  ASN 80  80  80  ASN ASN B . n 
B 2 81  LEU 81  81  81  LEU LEU B . n 
B 2 82  LYS 82  82  82  LYS LYS B . n 
B 2 83  GLY 83  83  83  GLY GLY B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  PHE 85  85  85  PHE PHE B . n 
B 2 86  ALA 86  86  86  ALA ALA B . n 
B 2 87  THR 87  87  87  THR THR B . n 
B 2 88  LEU 88  88  88  LEU LEU B . n 
B 2 89  SER 89  89  89  SER SER B . n 
B 2 90  GLU 90  90  90  GLU GLU B . n 
B 2 91  LEU 91  91  91  LEU LEU B . n 
B 2 92  HIS 92  92  92  HIS HIS B . n 
B 2 93  CYS 93  93  93  CYS CYS B . n 
B 2 94  ASP 94  94  94  ASP ASP B . n 
B 2 95  LYS 95  95  95  LYS LYS B . n 
B 2 96  LEU 96  96  96  LEU LEU B . n 
B 2 97  HIS 97  97  97  HIS HIS B . n 
B 2 98  VAL 98  98  98  VAL VAL B . n 
B 2 99  ASP 99  99  99  ASP ASP B . n 
B 2 100 PRO 100 100 100 PRO PRO B . n 
B 2 101 GLU 101 101 101 GLU GLU B . n 
B 2 102 ASN 102 102 102 ASN ASN B . n 
B 2 103 PHE 103 103 103 PHE PHE B . n 
B 2 104 ARG 104 104 104 ARG ARG B . n 
B 2 105 LEU 105 105 105 LEU LEU B . n 
B 2 106 LEU 106 106 106 LEU LEU B . n 
B 2 107 GLY 107 107 107 GLY GLY B . n 
B 2 108 LYS 108 108 108 LYS LYS B . n 
B 2 109 VAL 109 109 109 VAL VAL B . n 
B 2 110 LEU 110 110 110 LEU LEU B . n 
B 2 111 VAL 111 111 111 VAL VAL B . n 
B 2 112 CYS 112 112 112 CYS CYS B . n 
B 2 113 VAL 113 113 113 VAL VAL B . n 
B 2 114 LEU 114 114 114 LEU LEU B . n 
B 2 115 ALA 115 115 115 ALA ALA B . n 
B 2 116 HIS 116 116 116 HIS HIS B . n 
B 2 117 HIS 117 117 117 HIS HIS B . n 
B 2 118 PHE 118 118 118 PHE PHE B . n 
B 2 119 GLY 119 119 119 GLY GLY B . n 
B 2 120 LYS 120 120 120 LYS LYS B . n 
B 2 121 GLU 121 121 121 GLU GLU B . n 
B 2 122 PHE 122 122 122 PHE PHE B . n 
B 2 123 THR 123 123 123 THR THR B . n 
B 2 124 PRO 124 124 124 PRO PRO B . n 
B 2 125 PRO 125 125 125 PRO PRO B . n 
B 2 126 VAL 126 126 126 VAL VAL B . n 
B 2 127 GLN 127 127 127 GLN GLN B . n 
B 2 128 ALA 128 128 128 ALA ALA B . n 
B 2 129 ALA 129 129 129 ALA ALA B . n 
B 2 130 TYR 130 130 130 TYR TYR B . n 
B 2 131 GLN 131 131 131 GLN GLN B . n 
B 2 132 LYS 132 132 132 LYS LYS B . n 
B 2 133 VAL 133 133 133 VAL VAL B . n 
B 2 134 VAL 134 134 134 VAL VAL B . n 
B 2 135 ALA 135 135 135 ALA ALA B . n 
B 2 136 GLY 136 136 136 GLY GLY B . n 
B 2 137 VAL 137 137 137 VAL VAL B . n 
B 2 138 ALA 138 138 138 ALA ALA B . n 
B 2 139 ASN 139 139 139 ASN ASN B . n 
B 2 140 ALA 140 140 140 ALA ALA B . n 
B 2 141 LEU 141 141 141 LEU LEU B . n 
B 2 142 ALA 142 142 142 ALA ALA B . n 
B 2 143 HIS 143 143 143 HIS HIS B . n 
B 2 144 LYS 144 144 144 LYS LYS B . n 
B 2 145 TYR 145 145 145 TYR TYR B . n 
B 2 146 HIS 146 146 146 HIS HIS B . n 
C 2 1   MET 1   1   1   MET MET D . n 
C 2 2   HIS 2   2   2   HIS HIS D . n 
C 2 3   LEU 3   3   3   LEU LEU D . n 
C 2 4   THR 4   4   4   THR THR D . n 
C 2 5   PRO 5   5   5   PRO PRO D . n 
C 2 6   GLU 6   6   6   GLU GLU D . n 
C 2 7   GLU 7   7   7   GLU GLU D . n 
C 2 8   LYS 8   8   8   LYS LYS D . n 
C 2 9   SER 9   9   9   SER SER D . n 
C 2 10  ALA 10  10  10  ALA ALA D . n 
C 2 11  VAL 11  11  11  VAL VAL D . n 
C 2 12  THR 12  12  12  THR THR D . n 
C 2 13  ALA 13  13  13  ALA ALA D . n 
C 2 14  LEU 14  14  14  LEU LEU D . n 
C 2 15  TRP 15  15  15  TRP TRP D . n 
C 2 16  GLY 16  16  16  GLY GLY D . n 
C 2 17  LYS 17  17  17  LYS LYS D . n 
C 2 18  VAL 18  18  18  VAL VAL D . n 
C 2 19  ASN 19  19  19  ASN ASN D . n 
C 2 20  VAL 20  20  20  VAL VAL D . n 
C 2 21  ASP 21  21  21  ASP ASP D . n 
C 2 22  GLU 22  22  22  GLU GLU D . n 
C 2 23  VAL 23  23  23  VAL VAL D . n 
C 2 24  GLY 24  24  24  GLY GLY D . n 
C 2 25  GLY 25  25  25  GLY GLY D . n 
C 2 26  GLU 26  26  26  GLU GLU D . n 
C 2 27  ALA 27  27  27  ALA ALA D . n 
C 2 28  LEU 28  28  28  LEU LEU D . n 
C 2 29  GLY 29  29  29  GLY GLY D . n 
C 2 30  ARG 30  30  30  ARG ARG D . n 
C 2 31  LEU 31  31  31  LEU LEU D . n 
C 2 32  LEU 32  32  32  LEU LEU D . n 
C 2 33  VAL 33  33  33  VAL VAL D . n 
C 2 34  VAL 34  34  34  VAL VAL D . n 
C 2 35  TYR 35  35  35  TYR TYR D . n 
C 2 36  PRO 36  36  36  PRO PRO D . n 
C 2 37  TRP 37  37  37  TRP TRP D . n 
C 2 38  THR 38  38  38  THR THR D . n 
C 2 39  GLN 39  39  39  GLN GLN D . n 
C 2 40  ARG 40  40  40  ARG ARG D . n 
C 2 41  PHE 41  41  41  PHE PHE D . n 
C 2 42  PHE 42  42  42  PHE PHE D . n 
C 2 43  GLU 43  43  43  GLU GLU D . n 
C 2 44  SER 44  44  44  SER SER D . n 
C 2 45  PHE 45  45  45  PHE PHE D . n 
C 2 46  GLY 46  46  46  GLY GLY D . n 
C 2 47  ASP 47  47  47  ASP ASP D . n 
C 2 48  LEU 48  48  48  LEU LEU D . n 
C 2 49  SER 49  49  49  SER SER D . n 
C 2 50  THR 50  50  50  THR THR D . n 
C 2 51  PRO 51  51  51  PRO PRO D . n 
C 2 52  ASP 52  52  52  ASP ASP D . n 
C 2 53  ALA 53  53  53  ALA ALA D . n 
C 2 54  VAL 54  54  54  VAL VAL D . n 
C 2 55  MET 55  55  55  MET MET D . n 
C 2 56  GLY 56  56  56  GLY GLY D . n 
C 2 57  ASN 57  57  57  ASN ASN D . n 
C 2 58  PRO 58  58  58  PRO PRO D . n 
C 2 59  LYS 59  59  59  LYS LYS D . n 
C 2 60  VAL 60  60  60  VAL VAL D . n 
C 2 61  LYS 61  61  61  LYS LYS D . n 
C 2 62  ALA 62  62  62  ALA ALA D . n 
C 2 63  HIS 63  63  63  HIS HIS D . n 
C 2 64  GLY 64  64  64  GLY GLY D . n 
C 2 65  LYS 65  65  65  LYS LYS D . n 
C 2 66  LYS 66  66  66  LYS LYS D . n 
C 2 67  VAL 67  67  67  VAL VAL D . n 
C 2 68  LEU 68  68  68  LEU LEU D . n 
C 2 69  GLY 69  69  69  GLY GLY D . n 
C 2 70  ALA 70  70  70  ALA ALA D . n 
C 2 71  PHE 71  71  71  PHE PHE D . n 
C 2 72  SER 72  72  72  SER SER D . n 
C 2 73  ASP 73  73  73  ASP ASP D . n 
C 2 74  GLY 74  74  74  GLY GLY D . n 
C 2 75  LEU 75  75  75  LEU LEU D . n 
C 2 76  ALA 76  76  76  ALA ALA D . n 
C 2 77  HIS 77  77  77  HIS HIS D . n 
C 2 78  LEU 78  78  78  LEU LEU D . n 
C 2 79  ASP 79  79  79  ASP ASP D . n 
C 2 80  ASN 80  80  80  ASN ASN D . n 
C 2 81  LEU 81  81  81  LEU LEU D . n 
C 2 82  LYS 82  82  82  LYS LYS D . n 
C 2 83  GLY 83  83  83  GLY GLY D . n 
C 2 84  THR 84  84  84  THR THR D . n 
C 2 85  PHE 85  85  85  PHE PHE D . n 
C 2 86  ALA 86  86  86  ALA ALA D . n 
C 2 87  THR 87  87  87  THR THR D . n 
C 2 88  LEU 88  88  88  LEU LEU D . n 
C 2 89  SER 89  89  89  SER SER D . n 
C 2 90  GLU 90  90  90  GLU GLU D . n 
C 2 91  LEU 91  91  91  LEU LEU D . n 
C 2 92  HIS 92  92  92  HIS HIS D . n 
C 2 93  CYS 93  93  93  CYS CYS D . n 
C 2 94  ASP 94  94  94  ASP ASP D . n 
C 2 95  LYS 95  95  95  LYS LYS D . n 
C 2 96  LEU 96  96  96  LEU LEU D . n 
C 2 97  HIS 97  97  97  HIS HIS D . n 
C 2 98  VAL 98  98  98  VAL VAL D . n 
C 2 99  ASP 99  99  99  ASP ASP D . n 
C 2 100 PRO 100 100 100 PRO PRO D . n 
C 2 101 GLU 101 101 101 GLU GLU D . n 
C 2 102 ASN 102 102 102 ASN ASN D . n 
C 2 103 PHE 103 103 103 PHE PHE D . n 
C 2 104 ARG 104 104 104 ARG ARG D . n 
C 2 105 LEU 105 105 105 LEU LEU D . n 
C 2 106 LEU 106 106 106 LEU LEU D . n 
C 2 107 GLY 107 107 107 GLY GLY D . n 
C 2 108 LYS 108 108 108 LYS LYS D . n 
C 2 109 VAL 109 109 109 VAL VAL D . n 
C 2 110 LEU 110 110 110 LEU LEU D . n 
C 2 111 VAL 111 111 111 VAL VAL D . n 
C 2 112 CYS 112 112 112 CYS CYS D . n 
C 2 113 VAL 113 113 113 VAL VAL D . n 
C 2 114 LEU 114 114 114 LEU LEU D . n 
C 2 115 ALA 115 115 115 ALA ALA D . n 
C 2 116 HIS 116 116 116 HIS HIS D . n 
C 2 117 HIS 117 117 117 HIS HIS D . n 
C 2 118 PHE 118 118 118 PHE PHE D . n 
C 2 119 GLY 119 119 119 GLY GLY D . n 
C 2 120 LYS 120 120 120 LYS LYS D . n 
C 2 121 GLU 121 121 121 GLU GLU D . n 
C 2 122 PHE 122 122 122 PHE PHE D . n 
C 2 123 THR 123 123 123 THR THR D . n 
C 2 124 PRO 124 124 124 PRO PRO D . n 
C 2 125 PRO 125 125 125 PRO PRO D . n 
C 2 126 VAL 126 126 126 VAL VAL D . n 
C 2 127 GLN 127 127 127 GLN GLN D . n 
C 2 128 ALA 128 128 128 ALA ALA D . n 
C 2 129 ALA 129 129 129 ALA ALA D . n 
C 2 130 TYR 130 130 130 TYR TYR D . n 
C 2 131 GLN 131 131 131 GLN GLN D . n 
C 2 132 LYS 132 132 132 LYS LYS D . n 
C 2 133 VAL 133 133 133 VAL VAL D . n 
C 2 134 VAL 134 134 134 VAL VAL D . n 
C 2 135 ALA 135 135 135 ALA ALA D . n 
C 2 136 GLY 136 136 136 GLY GLY D . n 
C 2 137 VAL 137 137 137 VAL VAL D . n 
C 2 138 ALA 138 138 138 ALA ALA D . n 
C 2 139 ASN 139 139 139 ASN ASN D . n 
C 2 140 ALA 140 140 140 ALA ALA D . n 
C 2 141 LEU 141 141 141 LEU LEU D . n 
C 2 142 ALA 142 142 142 ALA ALA D . n 
C 2 143 HIS 143 143 143 HIS HIS D . n 
C 2 144 LYS 144 144 144 LYS LYS D . n 
C 2 145 TYR 145 145 145 TYR TYR D . n 
C 2 146 HIS 146 146 146 HIS HIS D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 HEM 1   284  284  HEM HEM A . 
E 3 HEM 1   285  285  HEM HEM A . 
F 3 HEM 1   147  147  HEM HEM B . 
G 3 HEM 1   147  147  HEM HEM D . 
H 4 HOH 1   1002 1002 HOH HOH A . 
H 4 HOH 2   1003 1003 HOH HOH A . 
H 4 HOH 3   1007 1007 HOH HOH A . 
H 4 HOH 4   1008 1008 HOH HOH A . 
H 4 HOH 5   1012 1012 HOH HOH A . 
H 4 HOH 6   1013 1013 HOH HOH A . 
H 4 HOH 7   1014 1014 HOH HOH A . 
H 4 HOH 8   1015 1015 HOH HOH A . 
H 4 HOH 9   1018 1018 HOH HOH A . 
H 4 HOH 10  1019 1019 HOH HOH A . 
H 4 HOH 11  1021 1021 HOH HOH A . 
H 4 HOH 12  1022 1022 HOH HOH A . 
H 4 HOH 13  1023 1023 HOH HOH A . 
H 4 HOH 14  1024 1024 HOH HOH A . 
H 4 HOH 15  1028 1028 HOH HOH A . 
H 4 HOH 16  1029 1029 HOH HOH A . 
H 4 HOH 17  1030 1030 HOH HOH A . 
H 4 HOH 18  1033 1033 HOH HOH A . 
H 4 HOH 19  1035 1035 HOH HOH A . 
H 4 HOH 20  1036 1036 HOH HOH A . 
H 4 HOH 21  1040 1040 HOH HOH A . 
H 4 HOH 22  1042 1042 HOH HOH A . 
H 4 HOH 23  1043 1043 HOH HOH A . 
H 4 HOH 24  1045 1045 HOH HOH A . 
H 4 HOH 25  1046 1046 HOH HOH A . 
H 4 HOH 26  1048 1048 HOH HOH A . 
H 4 HOH 27  1049 1049 HOH HOH A . 
H 4 HOH 28  1050 1050 HOH HOH A . 
H 4 HOH 29  1051 1051 HOH HOH A . 
H 4 HOH 30  1053 1053 HOH HOH A . 
H 4 HOH 31  1054 1054 HOH HOH A . 
H 4 HOH 32  1055 1055 HOH HOH A . 
H 4 HOH 33  1056 1056 HOH HOH A . 
H 4 HOH 34  1058 1058 HOH HOH A . 
H 4 HOH 35  1060 1060 HOH HOH A . 
H 4 HOH 36  1061 1061 HOH HOH A . 
H 4 HOH 37  1062 1062 HOH HOH A . 
H 4 HOH 38  1066 1066 HOH HOH A . 
H 4 HOH 39  1067 1067 HOH HOH A . 
H 4 HOH 40  1068 1068 HOH HOH A . 
H 4 HOH 41  1070 1070 HOH HOH A . 
H 4 HOH 42  1073 1073 HOH HOH A . 
H 4 HOH 43  1074 1074 HOH HOH A . 
H 4 HOH 44  1076 1076 HOH HOH A . 
H 4 HOH 45  1077 1077 HOH HOH A . 
H 4 HOH 46  1078 1078 HOH HOH A . 
H 4 HOH 47  1081 1081 HOH HOH A . 
H 4 HOH 48  1082 1082 HOH HOH A . 
H 4 HOH 49  1084 1084 HOH HOH A . 
H 4 HOH 50  1085 1085 HOH HOH A . 
H 4 HOH 51  1086 1086 HOH HOH A . 
H 4 HOH 52  1090 1090 HOH HOH A . 
H 4 HOH 53  1091 1091 HOH HOH A . 
H 4 HOH 54  1093 1093 HOH HOH A . 
H 4 HOH 55  1095 1095 HOH HOH A . 
H 4 HOH 56  1100 1100 HOH HOH A . 
H 4 HOH 57  1102 1102 HOH HOH A . 
H 4 HOH 58  1103 1103 HOH HOH A . 
H 4 HOH 59  1106 1106 HOH HOH A . 
H 4 HOH 60  1107 1107 HOH HOH A . 
H 4 HOH 61  1109 1109 HOH HOH A . 
H 4 HOH 62  1111 1111 HOH HOH A . 
H 4 HOH 63  1112 1112 HOH HOH A . 
H 4 HOH 64  1119 1119 HOH HOH A . 
H 4 HOH 65  1121 1121 HOH HOH A . 
H 4 HOH 66  1123 1123 HOH HOH A . 
H 4 HOH 67  1124 1124 HOH HOH A . 
H 4 HOH 68  1125 1125 HOH HOH A . 
H 4 HOH 69  1126 1126 HOH HOH A . 
H 4 HOH 70  1129 1129 HOH HOH A . 
H 4 HOH 71  1130 1130 HOH HOH A . 
H 4 HOH 72  1131 1131 HOH HOH A . 
H 4 HOH 73  1132 1132 HOH HOH A . 
H 4 HOH 74  1133 1133 HOH HOH A . 
H 4 HOH 75  1135 1135 HOH HOH A . 
H 4 HOH 76  1136 1136 HOH HOH A . 
H 4 HOH 77  1137 1137 HOH HOH A . 
H 4 HOH 78  1139 1139 HOH HOH A . 
H 4 HOH 79  1141 1141 HOH HOH A . 
H 4 HOH 80  1142 1142 HOH HOH A . 
H 4 HOH 81  1150 1150 HOH HOH A . 
H 4 HOH 82  1151 1151 HOH HOH A . 
H 4 HOH 83  1153 1153 HOH HOH A . 
H 4 HOH 84  1155 1155 HOH HOH A . 
H 4 HOH 85  1156 1156 HOH HOH A . 
H 4 HOH 86  1157 1157 HOH HOH A . 
H 4 HOH 87  1161 1161 HOH HOH A . 
H 4 HOH 88  1162 1162 HOH HOH A . 
H 4 HOH 89  1163 1163 HOH HOH A . 
H 4 HOH 90  1164 1164 HOH HOH A . 
H 4 HOH 91  1165 1165 HOH HOH A . 
H 4 HOH 92  1166 1166 HOH HOH A . 
H 4 HOH 93  1167 1167 HOH HOH A . 
H 4 HOH 94  1168 1168 HOH HOH A . 
H 4 HOH 95  1169 1169 HOH HOH A . 
H 4 HOH 96  1171 1171 HOH HOH A . 
H 4 HOH 97  1173 1173 HOH HOH A . 
H 4 HOH 98  1174 1174 HOH HOH A . 
H 4 HOH 99  1175 1175 HOH HOH A . 
H 4 HOH 100 1176 1176 HOH HOH A . 
H 4 HOH 101 1177 1177 HOH HOH A . 
H 4 HOH 102 1178 1178 HOH HOH A . 
H 4 HOH 103 1179 1179 HOH HOH A . 
H 4 HOH 104 1180 1180 HOH HOH A . 
H 4 HOH 105 1181 1181 HOH HOH A . 
H 4 HOH 106 1185 1185 HOH HOH A . 
H 4 HOH 107 1186 1186 HOH HOH A . 
H 4 HOH 108 1187 1187 HOH HOH A . 
H 4 HOH 109 1191 1191 HOH HOH A . 
H 4 HOH 110 1193 1193 HOH HOH A . 
H 4 HOH 111 1196 1196 HOH HOH A . 
H 4 HOH 112 1197 1197 HOH HOH A . 
H 4 HOH 113 1199 1199 HOH HOH A . 
H 4 HOH 114 1200 1200 HOH HOH A . 
H 4 HOH 115 1202 1202 HOH HOH A . 
H 4 HOH 116 1204 1204 HOH HOH A . 
H 4 HOH 117 1205 1205 HOH HOH A . 
H 4 HOH 118 1206 1206 HOH HOH A . 
H 4 HOH 119 1208 1208 HOH HOH A . 
H 4 HOH 120 1210 1210 HOH HOH A . 
H 4 HOH 121 1214 1214 HOH HOH A . 
H 4 HOH 122 1215 1215 HOH HOH A . 
H 4 HOH 123 1216 1216 HOH HOH A . 
H 4 HOH 124 1217 1217 HOH HOH A . 
H 4 HOH 125 1219 1219 HOH HOH A . 
H 4 HOH 126 1224 1224 HOH HOH A . 
H 4 HOH 127 1225 1225 HOH HOH A . 
H 4 HOH 128 1226 1226 HOH HOH A . 
H 4 HOH 129 1228 1228 HOH HOH A . 
H 4 HOH 130 1229 1229 HOH HOH A . 
H 4 HOH 131 1230 1230 HOH HOH A . 
H 4 HOH 132 1231 1231 HOH HOH A . 
H 4 HOH 133 1233 1233 HOH HOH A . 
H 4 HOH 134 1234 1234 HOH HOH A . 
H 4 HOH 135 1236 1236 HOH HOH A . 
H 4 HOH 136 1239 1239 HOH HOH A . 
H 4 HOH 137 1241 1241 HOH HOH A . 
H 4 HOH 138 1242 1242 HOH HOH A . 
H 4 HOH 139 1243 1243 HOH HOH A . 
H 4 HOH 140 1244 1244 HOH HOH A . 
H 4 HOH 141 1256 1256 HOH HOH A . 
H 4 HOH 142 1260 1260 HOH HOH A . 
H 4 HOH 143 1261 1261 HOH HOH A . 
H 4 HOH 144 1265 1265 HOH HOH A . 
H 4 HOH 145 1268 1268 HOH HOH A . 
H 4 HOH 146 1272 1272 HOH HOH A . 
H 4 HOH 147 1273 1273 HOH HOH A . 
H 4 HOH 148 1277 1277 HOH HOH A . 
H 4 HOH 149 1279 1279 HOH HOH A . 
H 4 HOH 150 1280 1280 HOH HOH A . 
H 4 HOH 151 1282 1282 HOH HOH A . 
H 4 HOH 152 1283 1283 HOH HOH A . 
H 4 HOH 153 1287 1287 HOH HOH A . 
H 4 HOH 154 1288 1288 HOH HOH A . 
H 4 HOH 155 1291 1291 HOH HOH A . 
H 4 HOH 156 1292 1292 HOH HOH A . 
H 4 HOH 157 1293 1293 HOH HOH A . 
H 4 HOH 158 1296 1296 HOH HOH A . 
H 4 HOH 159 1297 1297 HOH HOH A . 
H 4 HOH 160 1298 1298 HOH HOH A . 
H 4 HOH 161 1299 1299 HOH HOH A . 
H 4 HOH 162 1301 1301 HOH HOH A . 
H 4 HOH 163 1302 1302 HOH HOH A . 
H 4 HOH 164 1304 1304 HOH HOH A . 
H 4 HOH 165 1306 1306 HOH HOH A . 
H 4 HOH 166 1307 1307 HOH HOH A . 
H 4 HOH 167 1308 1308 HOH HOH A . 
H 4 HOH 168 1313 1313 HOH HOH A . 
H 4 HOH 169 1315 1315 HOH HOH A . 
H 4 HOH 170 1316 1316 HOH HOH A . 
H 4 HOH 171 1317 1317 HOH HOH A . 
H 4 HOH 172 1318 1318 HOH HOH A . 
H 4 HOH 173 1320 1320 HOH HOH A . 
H 4 HOH 174 1321 1321 HOH HOH A . 
I 4 HOH 1   1001 1001 HOH HOH B . 
I 4 HOH 2   1005 1005 HOH HOH B . 
I 4 HOH 3   1006 1006 HOH HOH B . 
I 4 HOH 4   1010 1010 HOH HOH B . 
I 4 HOH 5   1027 1027 HOH HOH B . 
I 4 HOH 6   1031 1031 HOH HOH B . 
I 4 HOH 7   1041 1041 HOH HOH B . 
I 4 HOH 8   1044 1044 HOH HOH B . 
I 4 HOH 9   1047 1047 HOH HOH B . 
I 4 HOH 10  1052 1052 HOH HOH B . 
I 4 HOH 11  1057 1057 HOH HOH B . 
I 4 HOH 12  1063 1063 HOH HOH B . 
I 4 HOH 13  1069 1069 HOH HOH B . 
I 4 HOH 14  1071 1071 HOH HOH B . 
I 4 HOH 15  1083 1083 HOH HOH B . 
I 4 HOH 16  1087 1087 HOH HOH B . 
I 4 HOH 17  1089 1089 HOH HOH B . 
I 4 HOH 18  1092 1092 HOH HOH B . 
I 4 HOH 19  1094 1094 HOH HOH B . 
I 4 HOH 20  1096 1096 HOH HOH B . 
I 4 HOH 21  1097 1097 HOH HOH B . 
I 4 HOH 22  1099 1099 HOH HOH B . 
I 4 HOH 23  1101 1101 HOH HOH B . 
I 4 HOH 24  1104 1104 HOH HOH B . 
I 4 HOH 25  1105 1105 HOH HOH B . 
I 4 HOH 26  1113 1113 HOH HOH B . 
I 4 HOH 27  1115 1115 HOH HOH B . 
I 4 HOH 28  1120 1120 HOH HOH B . 
I 4 HOH 29  1127 1127 HOH HOH B . 
I 4 HOH 30  1134 1134 HOH HOH B . 
I 4 HOH 31  1138 1138 HOH HOH B . 
I 4 HOH 32  1140 1140 HOH HOH B . 
I 4 HOH 33  1146 1146 HOH HOH B . 
I 4 HOH 34  1152 1152 HOH HOH B . 
I 4 HOH 35  1158 1158 HOH HOH B . 
I 4 HOH 36  1170 1170 HOH HOH B . 
I 4 HOH 37  1182 1182 HOH HOH B . 
I 4 HOH 38  1183 1183 HOH HOH B . 
I 4 HOH 39  1189 1189 HOH HOH B . 
I 4 HOH 40  1192 1192 HOH HOH B . 
I 4 HOH 41  1195 1195 HOH HOH B . 
I 4 HOH 42  1203 1203 HOH HOH B . 
I 4 HOH 43  1209 1209 HOH HOH B . 
I 4 HOH 44  1211 1211 HOH HOH B . 
I 4 HOH 45  1213 1213 HOH HOH B . 
I 4 HOH 46  1221 1221 HOH HOH B . 
I 4 HOH 47  1223 1223 HOH HOH B . 
I 4 HOH 48  1227 1227 HOH HOH B . 
I 4 HOH 49  1238 1238 HOH HOH B . 
I 4 HOH 50  1240 1240 HOH HOH B . 
I 4 HOH 51  1246 1246 HOH HOH B . 
I 4 HOH 52  1247 1247 HOH HOH B . 
I 4 HOH 53  1252 1252 HOH HOH B . 
I 4 HOH 54  1253 1253 HOH HOH B . 
I 4 HOH 55  1255 1255 HOH HOH B . 
I 4 HOH 56  1257 1257 HOH HOH B . 
I 4 HOH 57  1259 1259 HOH HOH B . 
I 4 HOH 58  1262 1262 HOH HOH B . 
I 4 HOH 59  1263 1263 HOH HOH B . 
I 4 HOH 60  1266 1266 HOH HOH B . 
I 4 HOH 61  1274 1274 HOH HOH B . 
I 4 HOH 62  1281 1281 HOH HOH B . 
I 4 HOH 63  1284 1284 HOH HOH B . 
I 4 HOH 64  1286 1286 HOH HOH B . 
I 4 HOH 65  1300 1300 HOH HOH B . 
I 4 HOH 66  1310 1310 HOH HOH B . 
I 4 HOH 67  1319 1319 HOH HOH B . 
I 4 HOH 68  1322 1322 HOH HOH B . 
J 4 HOH 1   1004 1004 HOH HOH D . 
J 4 HOH 2   1009 1009 HOH HOH D . 
J 4 HOH 3   1011 1011 HOH HOH D . 
J 4 HOH 4   1016 1016 HOH HOH D . 
J 4 HOH 5   1017 1017 HOH HOH D . 
J 4 HOH 6   1020 1020 HOH HOH D . 
J 4 HOH 7   1025 1025 HOH HOH D . 
J 4 HOH 8   1026 1026 HOH HOH D . 
J 4 HOH 9   1032 1032 HOH HOH D . 
J 4 HOH 10  1034 1034 HOH HOH D . 
J 4 HOH 11  1037 1037 HOH HOH D . 
J 4 HOH 12  1038 1038 HOH HOH D . 
J 4 HOH 13  1039 1039 HOH HOH D . 
J 4 HOH 14  1059 1059 HOH HOH D . 
J 4 HOH 15  1064 1064 HOH HOH D . 
J 4 HOH 16  1065 1065 HOH HOH D . 
J 4 HOH 17  1072 1072 HOH HOH D . 
J 4 HOH 18  1075 1075 HOH HOH D . 
J 4 HOH 19  1079 1079 HOH HOH D . 
J 4 HOH 20  1080 1080 HOH HOH D . 
J 4 HOH 21  1088 1088 HOH HOH D . 
J 4 HOH 22  1098 1098 HOH HOH D . 
J 4 HOH 23  1108 1108 HOH HOH D . 
J 4 HOH 24  1110 1110 HOH HOH D . 
J 4 HOH 25  1114 1114 HOH HOH D . 
J 4 HOH 26  1116 1116 HOH HOH D . 
J 4 HOH 27  1117 1117 HOH HOH D . 
J 4 HOH 28  1118 1118 HOH HOH D . 
J 4 HOH 29  1122 1122 HOH HOH D . 
J 4 HOH 30  1128 1128 HOH HOH D . 
J 4 HOH 31  1143 1143 HOH HOH D . 
J 4 HOH 32  1144 1144 HOH HOH D . 
J 4 HOH 33  1145 1145 HOH HOH D . 
J 4 HOH 34  1147 1147 HOH HOH D . 
J 4 HOH 35  1148 1148 HOH HOH D . 
J 4 HOH 36  1149 1149 HOH HOH D . 
J 4 HOH 37  1154 1154 HOH HOH D . 
J 4 HOH 38  1159 1159 HOH HOH D . 
J 4 HOH 39  1160 1160 HOH HOH D . 
J 4 HOH 40  1172 1172 HOH HOH D . 
J 4 HOH 41  1184 1184 HOH HOH D . 
J 4 HOH 42  1188 1188 HOH HOH D . 
J 4 HOH 43  1190 1190 HOH HOH D . 
J 4 HOH 44  1194 1194 HOH HOH D . 
J 4 HOH 45  1198 1198 HOH HOH D . 
J 4 HOH 46  1201 1201 HOH HOH D . 
J 4 HOH 47  1207 1207 HOH HOH D . 
J 4 HOH 48  1212 1212 HOH HOH D . 
J 4 HOH 49  1218 1218 HOH HOH D . 
J 4 HOH 50  1220 1220 HOH HOH D . 
J 4 HOH 51  1222 1222 HOH HOH D . 
J 4 HOH 52  1232 1232 HOH HOH D . 
J 4 HOH 53  1235 1235 HOH HOH D . 
J 4 HOH 54  1237 1237 HOH HOH D . 
J 4 HOH 55  1245 1245 HOH HOH D . 
J 4 HOH 56  1248 1248 HOH HOH D . 
J 4 HOH 57  1249 1249 HOH HOH D . 
J 4 HOH 58  1250 1250 HOH HOH D . 
J 4 HOH 59  1251 1251 HOH HOH D . 
J 4 HOH 60  1254 1254 HOH HOH D . 
J 4 HOH 61  1258 1258 HOH HOH D . 
J 4 HOH 62  1264 1264 HOH HOH D . 
J 4 HOH 63  1267 1267 HOH HOH D . 
J 4 HOH 64  1269 1269 HOH HOH D . 
J 4 HOH 65  1270 1270 HOH HOH D . 
J 4 HOH 66  1271 1271 HOH HOH D . 
J 4 HOH 67  1275 1275 HOH HOH D . 
J 4 HOH 68  1276 1276 HOH HOH D . 
J 4 HOH 69  1278 1278 HOH HOH D . 
J 4 HOH 70  1285 1285 HOH HOH D . 
J 4 HOH 71  1289 1289 HOH HOH D . 
J 4 HOH 72  1290 1290 HOH HOH D . 
J 4 HOH 73  1294 1294 HOH HOH D . 
J 4 HOH 74  1295 1295 HOH HOH D . 
J 4 HOH 75  1303 1303 HOH HOH D . 
J 4 HOH 76  1305 1305 HOH HOH D . 
J 4 HOH 77  1309 1309 HOH HOH D . 
J 4 HOH 78  1311 1311 HOH HOH D . 
J 4 HOH 79  1312 1312 HOH HOH D . 
J 4 HOH 80  1314 1314 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10710 ? 
1 MORE         -110  ? 
1 'SSA (A^2)'  23690 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 87  ? A HIS 87  ? 1_555 FE ? D HEM . ? A HEM 284 ? 1_555 NA ? D HEM . ? A HEM 284 ? 1_555 101.1 ? 
2  NE2 ? A HIS 87  ? A HIS 87  ? 1_555 FE ? D HEM . ? A HEM 284 ? 1_555 NB ? D HEM . ? A HEM 284 ? 1_555 101.4 ? 
3  NA  ? D HEM .   ? A HEM 284 ? 1_555 FE ? D HEM . ? A HEM 284 ? 1_555 NB ? D HEM . ? A HEM 284 ? 1_555 87.1  ? 
4  NE2 ? A HIS 87  ? A HIS 87  ? 1_555 FE ? D HEM . ? A HEM 284 ? 1_555 NC ? D HEM . ? A HEM 284 ? 1_555 101.8 ? 
5  NA  ? D HEM .   ? A HEM 284 ? 1_555 FE ? D HEM . ? A HEM 284 ? 1_555 NC ? D HEM . ? A HEM 284 ? 1_555 157.1 ? 
6  NB  ? D HEM .   ? A HEM 284 ? 1_555 FE ? D HEM . ? A HEM 284 ? 1_555 NC ? D HEM . ? A HEM 284 ? 1_555 87.9  ? 
7  NE2 ? A HIS 87  ? A HIS 87  ? 1_555 FE ? D HEM . ? A HEM 284 ? 1_555 ND ? D HEM . ? A HEM 284 ? 1_555 102.0 ? 
8  NA  ? D HEM .   ? A HEM 284 ? 1_555 FE ? D HEM . ? A HEM 284 ? 1_555 ND ? D HEM . ? A HEM 284 ? 1_555 87.6  ? 
9  NB  ? D HEM .   ? A HEM 284 ? 1_555 FE ? D HEM . ? A HEM 284 ? 1_555 ND ? D HEM . ? A HEM 284 ? 1_555 156.6 ? 
10 NC  ? D HEM .   ? A HEM 284 ? 1_555 FE ? D HEM . ? A HEM 284 ? 1_555 ND ? D HEM . ? A HEM 284 ? 1_555 88.2  ? 
11 NE2 ? A HIS 229 ? A HIS 229 ? 1_555 FE ? E HEM . ? A HEM 285 ? 1_555 NA ? E HEM . ? A HEM 285 ? 1_555 100.4 ? 
12 NE2 ? A HIS 229 ? A HIS 229 ? 1_555 FE ? E HEM . ? A HEM 285 ? 1_555 NB ? E HEM . ? A HEM 285 ? 1_555 100.1 ? 
13 NA  ? E HEM .   ? A HEM 285 ? 1_555 FE ? E HEM . ? A HEM 285 ? 1_555 NB ? E HEM . ? A HEM 285 ? 1_555 87.8  ? 
14 NE2 ? A HIS 229 ? A HIS 229 ? 1_555 FE ? E HEM . ? A HEM 285 ? 1_555 NC ? E HEM . ? A HEM 285 ? 1_555 100.6 ? 
15 NA  ? E HEM .   ? A HEM 285 ? 1_555 FE ? E HEM . ? A HEM 285 ? 1_555 NC ? E HEM . ? A HEM 285 ? 1_555 158.9 ? 
16 NB  ? E HEM .   ? A HEM 285 ? 1_555 FE ? E HEM . ? A HEM 285 ? 1_555 NC ? E HEM . ? A HEM 285 ? 1_555 87.9  ? 
17 NE2 ? A HIS 229 ? A HIS 229 ? 1_555 FE ? E HEM . ? A HEM 285 ? 1_555 ND ? E HEM . ? A HEM 285 ? 1_555 101.0 ? 
18 NA  ? E HEM .   ? A HEM 285 ? 1_555 FE ? E HEM . ? A HEM 285 ? 1_555 ND ? E HEM . ? A HEM 285 ? 1_555 88.3  ? 
19 NB  ? E HEM .   ? A HEM 285 ? 1_555 FE ? E HEM . ? A HEM 285 ? 1_555 ND ? E HEM . ? A HEM 285 ? 1_555 158.9 ? 
20 NC  ? E HEM .   ? A HEM 285 ? 1_555 FE ? E HEM . ? A HEM 285 ? 1_555 ND ? E HEM . ? A HEM 285 ? 1_555 88.3  ? 
21 NE2 ? B HIS 92  ? B HIS 92  ? 1_555 FE ? F HEM . ? B HEM 147 ? 1_555 NA ? F HEM . ? B HEM 147 ? 1_555 99.9  ? 
22 NE2 ? B HIS 92  ? B HIS 92  ? 1_555 FE ? F HEM . ? B HEM 147 ? 1_555 NB ? F HEM . ? B HEM 147 ? 1_555 99.9  ? 
23 NA  ? F HEM .   ? B HEM 147 ? 1_555 FE ? F HEM . ? B HEM 147 ? 1_555 NB ? F HEM . ? B HEM 147 ? 1_555 88.1  ? 
24 NE2 ? B HIS 92  ? B HIS 92  ? 1_555 FE ? F HEM . ? B HEM 147 ? 1_555 NC ? F HEM . ? B HEM 147 ? 1_555 100.0 ? 
25 NA  ? F HEM .   ? B HEM 147 ? 1_555 FE ? F HEM . ? B HEM 147 ? 1_555 NC ? F HEM . ? B HEM 147 ? 1_555 160.1 ? 
26 NB  ? F HEM .   ? B HEM 147 ? 1_555 FE ? F HEM . ? B HEM 147 ? 1_555 NC ? F HEM . ? B HEM 147 ? 1_555 88.4  ? 
27 NE2 ? B HIS 92  ? B HIS 92  ? 1_555 FE ? F HEM . ? B HEM 147 ? 1_555 ND ? F HEM . ? B HEM 147 ? 1_555 100.0 ? 
28 NA  ? F HEM .   ? B HEM 147 ? 1_555 FE ? F HEM . ? B HEM 147 ? 1_555 ND ? F HEM . ? B HEM 147 ? 1_555 88.3  ? 
29 NB  ? F HEM .   ? B HEM 147 ? 1_555 FE ? F HEM . ? B HEM 147 ? 1_555 ND ? F HEM . ? B HEM 147 ? 1_555 160.1 ? 
30 NC  ? F HEM .   ? B HEM 147 ? 1_555 FE ? F HEM . ? B HEM 147 ? 1_555 ND ? F HEM . ? B HEM 147 ? 1_555 88.4  ? 
31 NE2 ? C HIS 92  ? D HIS 92  ? 1_555 FE ? G HEM . ? D HEM 147 ? 1_555 NA ? G HEM . ? D HEM 147 ? 1_555 100.5 ? 
32 NE2 ? C HIS 92  ? D HIS 92  ? 1_555 FE ? G HEM . ? D HEM 147 ? 1_555 NB ? G HEM . ? D HEM 147 ? 1_555 100.4 ? 
33 NA  ? G HEM .   ? D HEM 147 ? 1_555 FE ? G HEM . ? D HEM 147 ? 1_555 NB ? G HEM . ? D HEM 147 ? 1_555 87.8  ? 
34 NE2 ? C HIS 92  ? D HIS 92  ? 1_555 FE ? G HEM . ? D HEM 147 ? 1_555 NC ? G HEM . ? D HEM 147 ? 1_555 101.0 ? 
35 NA  ? G HEM .   ? D HEM 147 ? 1_555 FE ? G HEM . ? D HEM 147 ? 1_555 NC ? G HEM . ? D HEM 147 ? 1_555 158.5 ? 
36 NB  ? G HEM .   ? D HEM 147 ? 1_555 FE ? G HEM . ? D HEM 147 ? 1_555 NC ? G HEM . ? D HEM 147 ? 1_555 88.2  ? 
37 NE2 ? C HIS 92  ? D HIS 92  ? 1_555 FE ? G HEM . ? D HEM 147 ? 1_555 ND ? G HEM . ? D HEM 147 ? 1_555 100.7 ? 
38 NA  ? G HEM .   ? D HEM 147 ? 1_555 FE ? G HEM . ? D HEM 147 ? 1_555 ND ? G HEM . ? D HEM 147 ? 1_555 88.1  ? 
39 NB  ? G HEM .   ? D HEM 147 ? 1_555 FE ? G HEM . ? D HEM 147 ? 1_555 ND ? G HEM . ? D HEM 147 ? 1_555 158.9 ? 
40 NC  ? G HEM .   ? D HEM 147 ? 1_555 FE ? G HEM . ? D HEM 147 ? 1_555 ND ? G HEM . ? D HEM 147 ? 1_555 88.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-06-30 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-08-02 
5 'Structure model' 1 4 2019-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 4 'Structure model' 'Source and taxonomy'       
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen 
2 4 'Structure model' software       
3 5 'Structure model' software       
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_software.classification' 
2 5 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL-97 refinement       . ? 1 
XSCALE    'data scaling'   . ? 2 
CNS       refinement       . ? 3 
XDS       'data scaling'   . ? 4 
XDS       'data reduction' . ? 5 
CNS       phasing          . ? 6 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              92 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              92 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              92 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                116.59 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.71 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 2   ? ? -55.90  109.97 
2 1 LYS A 232 ? ? -108.58 -68.75 
3 1 ASN B 80  ? ? -150.24 56.27  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PROTOPORPHYRIN IX CONTAINING FE' HEM 
4 water                             HOH 
#