data_1C7G
# 
_entry.id   1C7G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1C7G         
RCSB  RCSB001429   
WWPDB D_1000001429 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1C7G 
_pdbx_database_status.recvd_initial_deposition_date   2000-02-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mikami, B.'   1 
'Yamamoto, Y.' 2 
'Katayama, T.' 3 
'Suzuki, H.'   4 
# 
_citation.id                        primary 
_citation.title                     'The Structure of Tyrosine Phenol-Lyase from Erwinia Herbicola' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mikami, B.'   1 
primary 'Yamamoto, Y.' 2 
primary 'Katayama, T.' 3 
primary 'Suzuki, H.'   4 
primary 'Kumagai, H.'  5 
# 
_cell.entry_id           1C7G 
_cell.length_a           163.490 
_cell.length_b           113.040 
_cell.length_c           101.090 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1C7G 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'TYROSINE PHENOL-LYASE'  51429.629 4   4.1.99.2 ? ? 
;PYRIDOXAL 5'-PHOSPHATE LINK TO A 257, B 257, C 257 AND D 257
;
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE" 247.142   4   ?        ? ? ? 
3 water       nat water                    18.015    425 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNYPAEPFRIKSVETVSMISRDERVKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMIGDEAYAGSENFYHL
EKTVKELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRFHQEKNGATFVDIVRDEAHDASLNLPFKGDIDL
NKLATLIKEKGAENIAYICLAVTVNLAGGQPVSMANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQEAGYENVSIKDI
VHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRVK
QVRYLGDKLREAGVPIVEPTGGHAVFLDARRFCPHLTQDQFPAQSLAASIYMETGVRSMERGIVSAGRSKETGENHRPKL
ETVRLTIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLTFVYEPKQLRFFTARFDFI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNYPAEPFRIKSVETVSMISRDERVKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMIGDEAYAGSENFYHL
EKTVKELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRFHQEKNGATFVDIVRDEAHDASLNLPFKGDIDL
NKLATLIKEKGAENIAYICLAVTVNLAGGQPVSMANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQEAGYENVSIKDI
VHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRVK
QVRYLGDKLREAGVPIVEPTGGHAVFLDARRFCPHLTQDQFPAQSLAASIYMETGVRSMERGIVSAGRSKETGENHRPKL
ETVRLTIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLTFVYEPKQLRFFTARFDFI
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   TYR n 
1 4   PRO n 
1 5   ALA n 
1 6   GLU n 
1 7   PRO n 
1 8   PHE n 
1 9   ARG n 
1 10  ILE n 
1 11  LYS n 
1 12  SER n 
1 13  VAL n 
1 14  GLU n 
1 15  THR n 
1 16  VAL n 
1 17  SER n 
1 18  MET n 
1 19  ILE n 
1 20  SER n 
1 21  ARG n 
1 22  ASP n 
1 23  GLU n 
1 24  ARG n 
1 25  VAL n 
1 26  LYS n 
1 27  LYS n 
1 28  MET n 
1 29  GLN n 
1 30  GLU n 
1 31  ALA n 
1 32  GLY n 
1 33  TYR n 
1 34  ASN n 
1 35  THR n 
1 36  PHE n 
1 37  LEU n 
1 38  LEU n 
1 39  ASN n 
1 40  SER n 
1 41  LYS n 
1 42  ASP n 
1 43  ILE n 
1 44  TYR n 
1 45  ILE n 
1 46  ASP n 
1 47  LEU n 
1 48  LEU n 
1 49  THR n 
1 50  ASP n 
1 51  SER n 
1 52  GLY n 
1 53  THR n 
1 54  ASN n 
1 55  ALA n 
1 56  MET n 
1 57  SER n 
1 58  ASP n 
1 59  LYS n 
1 60  GLN n 
1 61  TRP n 
1 62  ALA n 
1 63  GLY n 
1 64  MET n 
1 65  MET n 
1 66  ILE n 
1 67  GLY n 
1 68  ASP n 
1 69  GLU n 
1 70  ALA n 
1 71  TYR n 
1 72  ALA n 
1 73  GLY n 
1 74  SER n 
1 75  GLU n 
1 76  ASN n 
1 77  PHE n 
1 78  TYR n 
1 79  HIS n 
1 80  LEU n 
1 81  GLU n 
1 82  LYS n 
1 83  THR n 
1 84  VAL n 
1 85  LYS n 
1 86  GLU n 
1 87  LEU n 
1 88  PHE n 
1 89  GLY n 
1 90  PHE n 
1 91  LYS n 
1 92  HIS n 
1 93  ILE n 
1 94  VAL n 
1 95  PRO n 
1 96  THR n 
1 97  HIS n 
1 98  GLN n 
1 99  GLY n 
1 100 ARG n 
1 101 GLY n 
1 102 ALA n 
1 103 GLU n 
1 104 ASN n 
1 105 LEU n 
1 106 LEU n 
1 107 SER n 
1 108 GLN n 
1 109 LEU n 
1 110 ALA n 
1 111 ILE n 
1 112 LYS n 
1 113 PRO n 
1 114 GLY n 
1 115 GLN n 
1 116 TYR n 
1 117 VAL n 
1 118 ALA n 
1 119 GLY n 
1 120 ASN n 
1 121 MET n 
1 122 TYR n 
1 123 PHE n 
1 124 THR n 
1 125 THR n 
1 126 THR n 
1 127 ARG n 
1 128 PHE n 
1 129 HIS n 
1 130 GLN n 
1 131 GLU n 
1 132 LYS n 
1 133 ASN n 
1 134 GLY n 
1 135 ALA n 
1 136 THR n 
1 137 PHE n 
1 138 VAL n 
1 139 ASP n 
1 140 ILE n 
1 141 VAL n 
1 142 ARG n 
1 143 ASP n 
1 144 GLU n 
1 145 ALA n 
1 146 HIS n 
1 147 ASP n 
1 148 ALA n 
1 149 SER n 
1 150 LEU n 
1 151 ASN n 
1 152 LEU n 
1 153 PRO n 
1 154 PHE n 
1 155 LYS n 
1 156 GLY n 
1 157 ASP n 
1 158 ILE n 
1 159 ASP n 
1 160 LEU n 
1 161 ASN n 
1 162 LYS n 
1 163 LEU n 
1 164 ALA n 
1 165 THR n 
1 166 LEU n 
1 167 ILE n 
1 168 LYS n 
1 169 GLU n 
1 170 LYS n 
1 171 GLY n 
1 172 ALA n 
1 173 GLU n 
1 174 ASN n 
1 175 ILE n 
1 176 ALA n 
1 177 TYR n 
1 178 ILE n 
1 179 CYS n 
1 180 LEU n 
1 181 ALA n 
1 182 VAL n 
1 183 THR n 
1 184 VAL n 
1 185 ASN n 
1 186 LEU n 
1 187 ALA n 
1 188 GLY n 
1 189 GLY n 
1 190 GLN n 
1 191 PRO n 
1 192 VAL n 
1 193 SER n 
1 194 MET n 
1 195 ALA n 
1 196 ASN n 
1 197 MET n 
1 198 ARG n 
1 199 ALA n 
1 200 VAL n 
1 201 HIS n 
1 202 GLU n 
1 203 MET n 
1 204 ALA n 
1 205 SER n 
1 206 THR n 
1 207 TYR n 
1 208 GLY n 
1 209 ILE n 
1 210 LYS n 
1 211 ILE n 
1 212 PHE n 
1 213 TYR n 
1 214 ASP n 
1 215 ALA n 
1 216 THR n 
1 217 ARG n 
1 218 CYS n 
1 219 VAL n 
1 220 GLU n 
1 221 ASN n 
1 222 ALA n 
1 223 TYR n 
1 224 PHE n 
1 225 ILE n 
1 226 LYS n 
1 227 GLU n 
1 228 GLN n 
1 229 GLU n 
1 230 ALA n 
1 231 GLY n 
1 232 TYR n 
1 233 GLU n 
1 234 ASN n 
1 235 VAL n 
1 236 SER n 
1 237 ILE n 
1 238 LYS n 
1 239 ASP n 
1 240 ILE n 
1 241 VAL n 
1 242 HIS n 
1 243 GLU n 
1 244 MET n 
1 245 PHE n 
1 246 SER n 
1 247 TYR n 
1 248 ALA n 
1 249 ASP n 
1 250 GLY n 
1 251 CYS n 
1 252 THR n 
1 253 MET n 
1 254 SER n 
1 255 GLY n 
1 256 LYS n 
1 257 LYS n 
1 258 ASP n 
1 259 CYS n 
1 260 LEU n 
1 261 VAL n 
1 262 ASN n 
1 263 ILE n 
1 264 GLY n 
1 265 GLY n 
1 266 PHE n 
1 267 LEU n 
1 268 CYS n 
1 269 MET n 
1 270 ASN n 
1 271 ASP n 
1 272 GLU n 
1 273 GLU n 
1 274 MET n 
1 275 PHE n 
1 276 SER n 
1 277 ALA n 
1 278 ALA n 
1 279 LYS n 
1 280 GLU n 
1 281 LEU n 
1 282 VAL n 
1 283 VAL n 
1 284 VAL n 
1 285 TYR n 
1 286 GLU n 
1 287 GLY n 
1 288 MET n 
1 289 PRO n 
1 290 SER n 
1 291 TYR n 
1 292 GLY n 
1 293 GLY n 
1 294 LEU n 
1 295 ALA n 
1 296 GLY n 
1 297 ARG n 
1 298 ASP n 
1 299 MET n 
1 300 GLU n 
1 301 ALA n 
1 302 MET n 
1 303 ALA n 
1 304 ILE n 
1 305 GLY n 
1 306 LEU n 
1 307 ARG n 
1 308 GLU n 
1 309 ALA n 
1 310 MET n 
1 311 GLN n 
1 312 TYR n 
1 313 GLU n 
1 314 TYR n 
1 315 ILE n 
1 316 GLU n 
1 317 HIS n 
1 318 ARG n 
1 319 VAL n 
1 320 LYS n 
1 321 GLN n 
1 322 VAL n 
1 323 ARG n 
1 324 TYR n 
1 325 LEU n 
1 326 GLY n 
1 327 ASP n 
1 328 LYS n 
1 329 LEU n 
1 330 ARG n 
1 331 GLU n 
1 332 ALA n 
1 333 GLY n 
1 334 VAL n 
1 335 PRO n 
1 336 ILE n 
1 337 VAL n 
1 338 GLU n 
1 339 PRO n 
1 340 THR n 
1 341 GLY n 
1 342 GLY n 
1 343 HIS n 
1 344 ALA n 
1 345 VAL n 
1 346 PHE n 
1 347 LEU n 
1 348 ASP n 
1 349 ALA n 
1 350 ARG n 
1 351 ARG n 
1 352 PHE n 
1 353 CYS n 
1 354 PRO n 
1 355 HIS n 
1 356 LEU n 
1 357 THR n 
1 358 GLN n 
1 359 ASP n 
1 360 GLN n 
1 361 PHE n 
1 362 PRO n 
1 363 ALA n 
1 364 GLN n 
1 365 SER n 
1 366 LEU n 
1 367 ALA n 
1 368 ALA n 
1 369 SER n 
1 370 ILE n 
1 371 TYR n 
1 372 MET n 
1 373 GLU n 
1 374 THR n 
1 375 GLY n 
1 376 VAL n 
1 377 ARG n 
1 378 SER n 
1 379 MET n 
1 380 GLU n 
1 381 ARG n 
1 382 GLY n 
1 383 ILE n 
1 384 VAL n 
1 385 SER n 
1 386 ALA n 
1 387 GLY n 
1 388 ARG n 
1 389 SER n 
1 390 LYS n 
1 391 GLU n 
1 392 THR n 
1 393 GLY n 
1 394 GLU n 
1 395 ASN n 
1 396 HIS n 
1 397 ARG n 
1 398 PRO n 
1 399 LYS n 
1 400 LEU n 
1 401 GLU n 
1 402 THR n 
1 403 VAL n 
1 404 ARG n 
1 405 LEU n 
1 406 THR n 
1 407 ILE n 
1 408 PRO n 
1 409 ARG n 
1 410 ARG n 
1 411 VAL n 
1 412 TYR n 
1 413 THR n 
1 414 TYR n 
1 415 ALA n 
1 416 HIS n 
1 417 MET n 
1 418 ASP n 
1 419 VAL n 
1 420 VAL n 
1 421 ALA n 
1 422 ASP n 
1 423 GLY n 
1 424 ILE n 
1 425 ILE n 
1 426 LYS n 
1 427 LEU n 
1 428 TYR n 
1 429 GLN n 
1 430 HIS n 
1 431 LYS n 
1 432 GLU n 
1 433 ASP n 
1 434 ILE n 
1 435 ARG n 
1 436 GLY n 
1 437 LEU n 
1 438 THR n 
1 439 PHE n 
1 440 VAL n 
1 441 TYR n 
1 442 GLU n 
1 443 PRO n 
1 444 LYS n 
1 445 GLN n 
1 446 LEU n 
1 447 ARG n 
1 448 PHE n 
1 449 PHE n 
1 450 THR n 
1 451 ALA n 
1 452 ARG n 
1 453 PHE n 
1 454 ASP n 
1 455 PHE n 
1 456 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pantoea 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Pantoea agglomerans' 
_entity_src_gen.gene_src_strain                    'pv. gypsophilae' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pantoea agglomerans pv. gypsophilae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     48984 
_entity_src_gen.pdbx_gene_src_variant              AJ2985 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               JM101 
_entity_src_gen.pdbx_host_org_variant              'TNA DEFICIENT' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PUC18 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'RECOMBINANT GENE' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TPL_ENTAG 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNYPAEPFRIKSVETVSMISRDERVKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMIGDEAYAGSENFYHL
EKTVKELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRFHQEKNGATFVDIVRDEAHDASLNLPFKGDIDL
NKLATLIKEKGAENIAYICLAVTVNLAGGQPVSMANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQEAGYENVSIKDI
VHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRVK
QVRYLGDKLREAGVPIVEPTGGHAVFLDARRFCPHLTQDQFPAQSLAASIYMETGVRSMERGIVSAGRSKETGENHRPKL
ETVRLTIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLTFVYEPKQLRFFTARFDFI
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P31011 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1C7G A 1 ? 456 ? P31011 1 ? 456 ? 1 456 
2 1 1C7G B 1 ? 456 ? P31011 1 ? 456 ? 1 456 
3 1 1C7G C 1 ? 456 ? P31011 1 ? 456 ? 1 456 
4 1 1C7G D 1 ? 456 ? P31011 1 ? 456 ? 1 456 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?                      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ?                      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?                      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?                      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ?                      'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                      'C9 H11 N O2'    165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE" 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'  247.142 
PRO 'L-peptide linking' y PROLINE                  ?                      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?                      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ?                      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ?                      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1C7G 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   43 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.pdbx_details    '30% PEG6000, 0.2M AMMONIUM ACETATE, 0.1M SODIUM CITRATE, PH 6.2' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1998-05-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    CARBON 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'MACSCIENCE M18X' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1C7G 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             42 
_reflns.d_resolution_high            2.007 
_reflns.number_obs                   113432 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.31 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.102 
_reflns.pdbx_netI_over_sigmaI        1.34 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.59 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.007 
_reflns_shell.d_res_low              2.079 
_reflns_shell.percent_possible_all   53.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1C7G 
_refine.ls_number_reflns_obs                     84494 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    78.57 
_refine.ls_R_factor_obs                          0.1862 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1862 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.006 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               19.16 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1TPL' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1C7G 
_refine_analyze.Luzzati_coordinate_error_obs    022 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           4 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14420 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             425 
_refine_hist.number_atoms_total               14905 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.442 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.3  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.875 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.1 
_refine_ls_shell.d_res_low                        2.19 
_refine_ls_shell.number_reflns_R_work             6865 
_refine_ls_shell.R_factor_R_work                  0.236 
_refine_ls_shell.percent_reflns_obs               57.49 
_refine_ls_shell.R_factor_R_free                  0.288 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10.12 
_refine_ls_shell.number_reflns_R_free             773 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO TOPH19X.PRO  'X-RAY DIFFRACTION' 
2 ?            ?            'X-RAY DIFFRACTION' 
3 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1C7G 
_struct.title                     'TYROSINE PHENOL-LYASE FROM ERWINIA HERBICOLA' 
_struct.pdbx_descriptor           'TYROSINE PHENOL-LYASE (E.C.4.1.99.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1C7G 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            
;LYASE, TYROSINE DEGRADATION, PYRIDOXAL 5'-PHOSPHATE DEPENDENT
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 21  ? GLU A 30  ? ARG A 21  GLU A 30  1 ? 10 
HELX_P HELX_P2  2  THR A 35  ? LEU A 37  ? THR A 35  LEU A 37  5 ? 3  
HELX_P HELX_P3  3  SER A 40  ? ASP A 42  ? SER A 40  ASP A 42  5 ? 3  
HELX_P HELX_P4  4  ASP A 58  ? MET A 65  ? ASP A 58  MET A 65  1 ? 8  
HELX_P HELX_P5  5  GLU A 75  ? LEU A 87  ? GLU A 75  LEU A 87  1 ? 13 
HELX_P HELX_P6  6  GLY A 99  ? ALA A 110 ? GLY A 99  ALA A 110 1 ? 12 
HELX_P HELX_P7  7  THR A 124 ? LYS A 132 ? THR A 124 LYS A 132 1 ? 9  
HELX_P HELX_P8  8  ASP A 143 ? HIS A 146 ? ASP A 143 HIS A 146 5 ? 4  
HELX_P HELX_P9  9  LEU A 160 ? LYS A 170 ? LEU A 160 LYS A 170 1 ? 11 
HELX_P HELX_P10 10 ALA A 172 ? ASN A 174 ? ALA A 172 ASN A 174 5 ? 3  
HELX_P HELX_P11 11 MET A 194 ? TYR A 207 ? MET A 194 TYR A 207 1 ? 14 
HELX_P HELX_P12 12 CYS A 218 ? GLN A 228 ? CYS A 218 GLN A 228 1 ? 11 
HELX_P HELX_P13 13 ILE A 237 ? TYR A 247 ? ILE A 237 TYR A 247 1 ? 11 
HELX_P HELX_P14 14 GLU A 272 ? TYR A 285 ? GLU A 272 TYR A 285 1 ? 14 
HELX_P HELX_P15 15 GLY A 296 ? MET A 310 ? GLY A 296 MET A 310 1 ? 15 
HELX_P HELX_P16 16 TYR A 312 ? ALA A 332 ? TYR A 312 ALA A 332 1 ? 21 
HELX_P HELX_P17 17 ALA A 349 ? PHE A 352 ? ALA A 349 PHE A 352 1 ? 4  
HELX_P HELX_P18 18 GLN A 358 ? GLN A 360 ? GLN A 358 GLN A 360 5 ? 3  
HELX_P HELX_P19 19 PRO A 362 ? THR A 374 ? PRO A 362 THR A 374 1 ? 13 
HELX_P HELX_P20 20 ILE A 383 ? ALA A 386 ? ILE A 383 ALA A 386 1 ? 4  
HELX_P HELX_P21 21 TYR A 414 ? ASP A 433 ? TYR A 414 ASP A 433 1 ? 20 
HELX_P HELX_P22 22 ARG A 447 ? THR A 450 ? ARG A 447 THR A 450 1 ? 4  
HELX_P HELX_P23 23 ARG B 21  ? GLU B 30  ? ARG B 21  GLU B 30  1 ? 10 
HELX_P HELX_P24 24 THR B 35  ? LEU B 37  ? THR B 35  LEU B 37  5 ? 3  
HELX_P HELX_P25 25 SER B 40  ? ASP B 42  ? SER B 40  ASP B 42  5 ? 3  
HELX_P HELX_P26 26 ASP B 58  ? MET B 65  ? ASP B 58  MET B 65  1 ? 8  
HELX_P HELX_P27 27 GLU B 75  ? PHE B 88  ? GLU B 75  PHE B 88  1 ? 14 
HELX_P HELX_P28 28 GLY B 99  ? ALA B 110 ? GLY B 99  ALA B 110 1 ? 12 
HELX_P HELX_P29 29 THR B 124 ? ASN B 133 ? THR B 124 ASN B 133 1 ? 10 
HELX_P HELX_P30 30 ASP B 143 ? HIS B 146 ? ASP B 143 HIS B 146 5 ? 4  
HELX_P HELX_P31 31 LEU B 160 ? LYS B 170 ? LEU B 160 LYS B 170 1 ? 11 
HELX_P HELX_P32 32 ALA B 172 ? ASN B 174 ? ALA B 172 ASN B 174 5 ? 3  
HELX_P HELX_P33 33 MET B 194 ? TYR B 207 ? MET B 194 TYR B 207 1 ? 14 
HELX_P HELX_P34 34 ALA B 215 ? GLN B 228 ? ALA B 215 GLN B 228 5 ? 14 
HELX_P HELX_P35 35 ILE B 237 ? TYR B 247 ? ILE B 237 TYR B 247 1 ? 11 
HELX_P HELX_P36 36 GLU B 272 ? TYR B 285 ? GLU B 272 TYR B 285 1 ? 14 
HELX_P HELX_P37 37 GLY B 296 ? MET B 310 ? GLY B 296 MET B 310 1 ? 15 
HELX_P HELX_P38 38 TYR B 312 ? ALA B 332 ? TYR B 312 ALA B 332 1 ? 21 
HELX_P HELX_P39 39 ALA B 349 ? PHE B 352 ? ALA B 349 PHE B 352 1 ? 4  
HELX_P HELX_P40 40 GLN B 358 ? GLN B 360 ? GLN B 358 GLN B 360 5 ? 3  
HELX_P HELX_P41 41 PRO B 362 ? THR B 374 ? PRO B 362 THR B 374 1 ? 13 
HELX_P HELX_P42 42 ILE B 383 ? ALA B 386 ? ILE B 383 ALA B 386 1 ? 4  
HELX_P HELX_P43 43 TYR B 414 ? ASP B 433 ? TYR B 414 ASP B 433 1 ? 20 
HELX_P HELX_P44 44 ARG B 447 ? THR B 450 ? ARG B 447 THR B 450 1 ? 4  
HELX_P HELX_P45 45 ARG C 21  ? GLU C 30  ? ARG C 21  GLU C 30  1 ? 10 
HELX_P HELX_P46 46 THR C 35  ? LEU C 37  ? THR C 35  LEU C 37  5 ? 3  
HELX_P HELX_P47 47 SER C 40  ? ASP C 42  ? SER C 40  ASP C 42  5 ? 3  
HELX_P HELX_P48 48 ASP C 58  ? MET C 65  ? ASP C 58  MET C 65  1 ? 8  
HELX_P HELX_P49 49 GLU C 75  ? PHE C 88  ? GLU C 75  PHE C 88  1 ? 14 
HELX_P HELX_P50 50 GLY C 99  ? ALA C 110 ? GLY C 99  ALA C 110 1 ? 12 
HELX_P HELX_P51 51 THR C 124 ? LYS C 132 ? THR C 124 LYS C 132 1 ? 9  
HELX_P HELX_P52 52 ASP C 143 ? HIS C 146 ? ASP C 143 HIS C 146 5 ? 4  
HELX_P HELX_P53 53 LEU C 160 ? LYS C 170 ? LEU C 160 LYS C 170 1 ? 11 
HELX_P HELX_P54 54 ALA C 172 ? ASN C 174 ? ALA C 172 ASN C 174 5 ? 3  
HELX_P HELX_P55 55 ASN C 185 ? ALA C 187 ? ASN C 185 ALA C 187 5 ? 3  
HELX_P HELX_P56 56 MET C 194 ? TYR C 207 ? MET C 194 TYR C 207 1 ? 14 
HELX_P HELX_P57 57 CYS C 218 ? GLN C 228 ? CYS C 218 GLN C 228 1 ? 11 
HELX_P HELX_P58 58 ILE C 237 ? TYR C 247 ? ILE C 237 TYR C 247 1 ? 11 
HELX_P HELX_P59 59 GLU C 272 ? TYR C 285 ? GLU C 272 TYR C 285 1 ? 14 
HELX_P HELX_P60 60 GLY C 296 ? MET C 310 ? GLY C 296 MET C 310 1 ? 15 
HELX_P HELX_P61 61 TYR C 312 ? ALA C 332 ? TYR C 312 ALA C 332 1 ? 21 
HELX_P HELX_P62 62 ALA C 349 ? PHE C 352 ? ALA C 349 PHE C 352 1 ? 4  
HELX_P HELX_P63 63 GLN C 358 ? GLN C 360 ? GLN C 358 GLN C 360 5 ? 3  
HELX_P HELX_P64 64 PRO C 362 ? THR C 374 ? PRO C 362 THR C 374 1 ? 13 
HELX_P HELX_P65 65 ILE C 383 ? ALA C 386 ? ILE C 383 ALA C 386 1 ? 4  
HELX_P HELX_P66 66 TYR C 414 ? ASP C 433 ? TYR C 414 ASP C 433 1 ? 20 
HELX_P HELX_P67 67 ARG C 447 ? THR C 450 ? ARG C 447 THR C 450 1 ? 4  
HELX_P HELX_P68 68 ARG D 21  ? GLU D 30  ? ARG D 21  GLU D 30  1 ? 10 
HELX_P HELX_P69 69 THR D 35  ? LEU D 37  ? THR D 35  LEU D 37  5 ? 3  
HELX_P HELX_P70 70 SER D 40  ? ASP D 42  ? SER D 40  ASP D 42  5 ? 3  
HELX_P HELX_P71 71 ASP D 58  ? ILE D 66  ? ASP D 58  ILE D 66  1 ? 9  
HELX_P HELX_P72 72 GLU D 75  ? PHE D 88  ? GLU D 75  PHE D 88  1 ? 14 
HELX_P HELX_P73 73 GLY D 99  ? ALA D 110 ? GLY D 99  ALA D 110 1 ? 12 
HELX_P HELX_P74 74 THR D 124 ? LYS D 132 ? THR D 124 LYS D 132 1 ? 9  
HELX_P HELX_P75 75 ASP D 143 ? HIS D 146 ? ASP D 143 HIS D 146 5 ? 4  
HELX_P HELX_P76 76 LEU D 160 ? LYS D 170 ? LEU D 160 LYS D 170 1 ? 11 
HELX_P HELX_P77 77 ALA D 172 ? ASN D 174 ? ALA D 172 ASN D 174 5 ? 3  
HELX_P HELX_P78 78 MET D 194 ? THR D 206 ? MET D 194 THR D 206 1 ? 13 
HELX_P HELX_P79 79 CYS D 218 ? GLN D 228 ? CYS D 218 GLN D 228 1 ? 11 
HELX_P HELX_P80 80 ILE D 237 ? TYR D 247 ? ILE D 237 TYR D 247 1 ? 11 
HELX_P HELX_P81 81 GLU D 272 ? TYR D 285 ? GLU D 272 TYR D 285 1 ? 14 
HELX_P HELX_P82 82 GLY D 296 ? MET D 310 ? GLY D 296 MET D 310 1 ? 15 
HELX_P HELX_P83 83 TYR D 312 ? ALA D 332 ? TYR D 312 ALA D 332 1 ? 21 
HELX_P HELX_P84 84 ALA D 349 ? PHE D 352 ? ALA D 349 PHE D 352 1 ? 4  
HELX_P HELX_P85 85 GLN D 358 ? GLN D 360 ? GLN D 358 GLN D 360 5 ? 3  
HELX_P HELX_P86 86 PRO D 362 ? THR D 374 ? PRO D 362 THR D 374 1 ? 13 
HELX_P HELX_P87 87 ILE D 383 ? ALA D 386 ? ILE D 383 ALA D 386 1 ? 4  
HELX_P HELX_P88 88 TYR D 414 ? ASP D 433 ? TYR D 414 ASP D 433 1 ? 20 
HELX_P HELX_P89 89 ARG D 447 ? THR D 450 ? ARG D 447 THR D 450 1 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LYS 257 NZ  ? ? ? 1_555 E PLP .   C4A ? ? A LYS 257  A PLP 1000 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale2 covale ? ? B LYS 257 NZ  ? ? ? 1_555 F PLP .   C4A ? ? B LYS 257  B PLP 1000 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale3 covale ? ? D LYS 257 NZ  ? ? ? 1_555 H PLP .   C4A ? ? D LYS 257  D PLP 1000 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale4 covale ? ? G PLP .   C4A ? ? ? 1_555 C LYS 257 NZ  ? ? C PLP 1000 C LYS 257  1_555 ? ? ? ? ? ? ? 1.349 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 182 A . ? VAL 182 A THR 183 A ? THR 183 A 1 -0.30  
2 GLU 338 A . ? GLU 338 A PRO 339 A ? PRO 339 A 1 -19.98 
3 VAL 182 B . ? VAL 182 B THR 183 B ? THR 183 B 1 -0.15  
4 GLU 338 B . ? GLU 338 B PRO 339 B ? PRO 339 B 1 -22.24 
5 VAL 182 C . ? VAL 182 C THR 183 C ? THR 183 C 1 -0.26  
6 GLU 338 C . ? GLU 338 C PRO 339 C ? PRO 339 C 1 -25.55 
7 VAL 182 D . ? VAL 182 D THR 183 D ? THR 183 D 1 -0.03  
8 GLU 338 D . ? GLU 338 D PRO 339 D ? PRO 339 D 1 -18.49 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 3 ? 
C ? 2 ? 
D ? 7 ? 
E ? 3 ? 
F ? 2 ? 
G ? 7 ? 
H ? 3 ? 
I ? 2 ? 
J ? 7 ? 
K ? 3 ? 
L ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
J 6 7 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 92  ? THR A 96  ? HIS A 92  THR A 96  
A 2 GLY A 265 ? MET A 269 ? GLY A 265 MET A 269 
A 3 GLY A 250 ? SER A 254 ? GLY A 250 SER A 254 
A 4 ILE A 211 ? ASP A 214 ? ILE A 211 ASP A 214 
A 5 ILE A 175 ? ALA A 181 ? ILE A 175 ALA A 181 
A 6 GLN A 115 ? GLY A 119 ? GLN A 115 GLY A 119 
A 7 ALA A 135 ? ASP A 139 ? ALA A 135 ASP A 139 
B 1 ALA A 344 ? ASP A 348 ? ALA A 344 ASP A 348 
B 2 THR A 402 ? THR A 406 ? THR A 402 THR A 406 
B 3 MET A 379 ? ARG A 381 ? MET A 379 ARG A 381 
C 1 LEU A 437 ? TYR A 441 ? LEU A 437 TYR A 441 
C 2 ARG A 452 ? PHE A 455 ? ARG A 452 PHE A 455 
D 1 HIS B 92  ? THR B 96  ? HIS B 92  THR B 96  
D 2 GLY B 265 ? MET B 269 ? GLY B 265 MET B 269 
D 3 GLY B 250 ? SER B 254 ? GLY B 250 SER B 254 
D 4 LYS B 210 ? ASP B 214 ? LYS B 210 ASP B 214 
D 5 ILE B 175 ? ALA B 181 ? ILE B 175 ALA B 181 
D 6 GLN B 115 ? GLY B 119 ? GLN B 115 GLY B 119 
D 7 ALA B 135 ? ASP B 139 ? ALA B 135 ASP B 139 
E 1 ALA B 344 ? ASP B 348 ? ALA B 344 ASP B 348 
E 2 THR B 402 ? THR B 406 ? THR B 402 THR B 406 
E 3 MET B 379 ? ARG B 381 ? MET B 379 ARG B 381 
F 1 LEU B 437 ? TYR B 441 ? LEU B 437 TYR B 441 
F 2 ARG B 452 ? PHE B 455 ? ARG B 452 PHE B 455 
G 1 HIS C 92  ? THR C 96  ? HIS C 92  THR C 96  
G 2 GLY C 265 ? MET C 269 ? GLY C 265 MET C 269 
G 3 GLY C 250 ? SER C 254 ? GLY C 250 SER C 254 
G 4 ILE C 211 ? ASP C 214 ? ILE C 211 ASP C 214 
G 5 ILE C 175 ? ALA C 181 ? ILE C 175 ALA C 181 
G 6 GLN C 115 ? GLY C 119 ? GLN C 115 GLY C 119 
G 7 ALA C 135 ? ASP C 139 ? ALA C 135 ASP C 139 
H 1 ALA C 344 ? ASP C 348 ? ALA C 344 ASP C 348 
H 2 THR C 402 ? THR C 406 ? THR C 402 THR C 406 
H 3 MET C 379 ? ARG C 381 ? MET C 379 ARG C 381 
I 1 LEU C 437 ? TYR C 441 ? LEU C 437 TYR C 441 
I 2 ARG C 452 ? PHE C 455 ? ARG C 452 PHE C 455 
J 1 HIS D 92  ? THR D 96  ? HIS D 92  THR D 96  
J 2 GLY D 265 ? MET D 269 ? GLY D 265 MET D 269 
J 3 GLY D 250 ? SER D 254 ? GLY D 250 SER D 254 
J 4 ILE D 211 ? ASP D 214 ? ILE D 211 ASP D 214 
J 5 ILE D 175 ? ALA D 181 ? ILE D 175 ALA D 181 
J 6 GLN D 115 ? GLY D 119 ? GLN D 115 GLY D 119 
J 7 ALA D 135 ? ASP D 139 ? ALA D 135 ASP D 139 
K 1 ALA D 344 ? ASP D 348 ? ALA D 344 ASP D 348 
K 2 THR D 402 ? THR D 406 ? THR D 402 THR D 406 
K 3 MET D 379 ? ARG D 381 ? MET D 379 ARG D 381 
L 1 LEU D 437 ? TYR D 441 ? LEU D 437 TYR D 441 
L 2 ARG D 452 ? PHE D 455 ? ARG D 452 PHE D 455 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 92  ? O HIS A 92  N MET A 269 ? N MET A 269 
A 2 3 O PHE A 266 ? O PHE A 266 N MET A 253 ? N MET A 253 
A 3 4 O GLY A 250 ? O GLY A 250 N TYR A 213 ? N TYR A 213 
A 4 5 O PHE A 212 ? O PHE A 212 N ILE A 178 ? N ILE A 178 
A 5 6 O ALA A 176 ? O ALA A 176 N TYR A 116 ? N TYR A 116 
A 6 7 O GLN A 115 ? O GLN A 115 N THR A 136 ? N THR A 136 
B 1 2 O VAL A 345 ? O VAL A 345 N LEU A 405 ? N LEU A 405 
B 2 3 O THR A 402 ? O THR A 402 N ARG A 381 ? N ARG A 381 
C 1 2 O THR A 438 ? O THR A 438 N ASP A 454 ? N ASP A 454 
D 1 2 O HIS B 92  ? O HIS B 92  N MET B 269 ? N MET B 269 
D 2 3 O PHE B 266 ? O PHE B 266 N MET B 253 ? N MET B 253 
D 3 4 O GLY B 250 ? O GLY B 250 N TYR B 213 ? N TYR B 213 
D 4 5 O LYS B 210 ? O LYS B 210 N ILE B 178 ? N ILE B 178 
D 5 6 O ALA B 176 ? O ALA B 176 N TYR B 116 ? N TYR B 116 
D 6 7 O GLN B 115 ? O GLN B 115 N THR B 136 ? N THR B 136 
E 1 2 O VAL B 345 ? O VAL B 345 N LEU B 405 ? N LEU B 405 
E 2 3 O THR B 402 ? O THR B 402 N ARG B 381 ? N ARG B 381 
F 1 2 O THR B 438 ? O THR B 438 N ASP B 454 ? N ASP B 454 
G 1 2 O HIS C 92  ? O HIS C 92  N MET C 269 ? N MET C 269 
G 2 3 O PHE C 266 ? O PHE C 266 N MET C 253 ? N MET C 253 
G 3 4 O GLY C 250 ? O GLY C 250 N TYR C 213 ? N TYR C 213 
G 4 5 O PHE C 212 ? O PHE C 212 N ILE C 178 ? N ILE C 178 
G 5 6 O ALA C 176 ? O ALA C 176 N TYR C 116 ? N TYR C 116 
G 6 7 O GLN C 115 ? O GLN C 115 N THR C 136 ? N THR C 136 
H 1 2 O VAL C 345 ? O VAL C 345 N LEU C 405 ? N LEU C 405 
H 2 3 O THR C 402 ? O THR C 402 N ARG C 381 ? N ARG C 381 
I 1 2 O THR C 438 ? O THR C 438 N ASP C 454 ? N ASP C 454 
J 1 2 O HIS D 92  ? O HIS D 92  N MET D 269 ? N MET D 269 
J 2 3 O PHE D 266 ? O PHE D 266 N MET D 253 ? N MET D 253 
J 3 4 O GLY D 250 ? O GLY D 250 N TYR D 213 ? N TYR D 213 
J 4 5 O PHE D 212 ? O PHE D 212 N ILE D 178 ? N ILE D 178 
J 5 6 O ALA D 176 ? O ALA D 176 N TYR D 116 ? N TYR D 116 
J 6 7 O GLN D 115 ? O GLN D 115 N THR D 136 ? N THR D 136 
K 1 2 O VAL D 345 ? O VAL D 345 N LEU D 405 ? N LEU D 405 
K 2 3 O THR D 402 ? O THR D 402 N ARG D 381 ? N ARG D 381 
L 1 2 O THR D 438 ? O THR D 438 N ASP D 454 ? N ASP D 454 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PLP A 1000' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PLP B 1000' 
AC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PLP C 1000' 
AC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PLP D 1000' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 GLN A 98  ? GLN A 98  . ? 1_555 ? 
2  AC1 12 GLY A 99  ? GLY A 99  . ? 1_555 ? 
3  AC1 12 ARG A 100 ? ARG A 100 . ? 1_555 ? 
4  AC1 12 GLU A 103 ? GLU A 103 . ? 1_555 ? 
5  AC1 12 PHE A 123 ? PHE A 123 . ? 1_555 ? 
6  AC1 12 ASP A 214 ? ASP A 214 . ? 1_555 ? 
7  AC1 12 THR A 216 ? THR A 216 . ? 1_555 ? 
8  AC1 12 ARG A 217 ? ARG A 217 . ? 1_555 ? 
9  AC1 12 SER A 254 ? SER A 254 . ? 1_555 ? 
10 AC1 12 LYS A 257 ? LYS A 257 . ? 1_555 ? 
11 AC1 12 HOH I .   ? HOH A 543 . ? 1_555 ? 
12 AC1 12 HOH I .   ? HOH A 682 . ? 1_555 ? 
13 AC2 11 GLN B 98  ? GLN B 98  . ? 1_555 ? 
14 AC2 11 GLY B 99  ? GLY B 99  . ? 1_555 ? 
15 AC2 11 ARG B 100 ? ARG B 100 . ? 1_555 ? 
16 AC2 11 GLU B 103 ? GLU B 103 . ? 1_555 ? 
17 AC2 11 PHE B 123 ? PHE B 123 . ? 1_555 ? 
18 AC2 11 ASP B 214 ? ASP B 214 . ? 1_555 ? 
19 AC2 11 THR B 216 ? THR B 216 . ? 1_555 ? 
20 AC2 11 ARG B 217 ? ARG B 217 . ? 1_555 ? 
21 AC2 11 SER B 254 ? SER B 254 . ? 1_555 ? 
22 AC2 11 LYS B 257 ? LYS B 257 . ? 1_555 ? 
23 AC2 11 HOH J .   ? HOH B 554 . ? 1_555 ? 
24 AC3 12 GLN C 98  ? GLN C 98  . ? 1_555 ? 
25 AC3 12 GLY C 99  ? GLY C 99  . ? 1_555 ? 
26 AC3 12 ARG C 100 ? ARG C 100 . ? 1_555 ? 
27 AC3 12 GLU C 103 ? GLU C 103 . ? 1_555 ? 
28 AC3 12 PHE C 123 ? PHE C 123 . ? 1_555 ? 
29 AC3 12 ASP C 214 ? ASP C 214 . ? 1_555 ? 
30 AC3 12 THR C 216 ? THR C 216 . ? 1_555 ? 
31 AC3 12 ARG C 217 ? ARG C 217 . ? 1_555 ? 
32 AC3 12 SER C 254 ? SER C 254 . ? 1_555 ? 
33 AC3 12 LYS C 257 ? LYS C 257 . ? 1_555 ? 
34 AC3 12 HOH K .   ? HOH C 767 . ? 1_555 ? 
35 AC3 12 HOH K .   ? HOH C 811 . ? 1_555 ? 
36 AC4 11 GLN D 98  ? GLN D 98  . ? 1_555 ? 
37 AC4 11 GLY D 99  ? GLY D 99  . ? 1_555 ? 
38 AC4 11 ARG D 100 ? ARG D 100 . ? 1_555 ? 
39 AC4 11 GLU D 103 ? GLU D 103 . ? 1_555 ? 
40 AC4 11 PHE D 123 ? PHE D 123 . ? 1_555 ? 
41 AC4 11 ASP D 214 ? ASP D 214 . ? 1_555 ? 
42 AC4 11 THR D 216 ? THR D 216 . ? 1_555 ? 
43 AC4 11 ARG D 217 ? ARG D 217 . ? 1_555 ? 
44 AC4 11 SER D 254 ? SER D 254 . ? 1_555 ? 
45 AC4 11 LYS D 257 ? LYS D 257 . ? 1_555 ? 
46 AC4 11 HOH L .   ? HOH D 920 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1C7G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1C7G 
_atom_sites.fract_transf_matrix[1][1]   0.006116 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008846 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009892 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A 1 1   ? -20.112 98.689  53.597  1.00 20.00 ? 1    MET A N   1 
ATOM   2     C CA  . MET A 1 1   ? -19.767 97.999  52.317  1.00 20.00 ? 1    MET A CA  1 
ATOM   3     C C   . MET A 1 1   ? -18.300 97.599  52.319  1.00 20.00 ? 1    MET A C   1 
ATOM   4     O O   . MET A 1 1   ? -17.910 96.593  51.719  1.00 20.00 ? 1    MET A O   1 
ATOM   5     C CB  . MET A 1 1   ? -20.035 98.924  51.122  1.00 20.00 ? 1    MET A CB  1 
ATOM   6     C CG  . MET A 1 1   ? -20.081 98.214  49.764  1.00 20.00 ? 1    MET A CG  1 
ATOM   7     S SD  . MET A 1 1   ? -18.450 97.702  49.133  1.00 20.00 ? 1    MET A SD  1 
ATOM   8     C CE  . MET A 1 1   ? -18.855 96.083  48.379  1.00 20.00 ? 1    MET A CE  1 
ATOM   9     N N   . ASN A 1 2   ? -17.486 98.395  52.999  1.00 20.00 ? 2    ASN A N   1 
ATOM   10    C CA  . ASN A 1 2   ? -16.066 98.111  53.068  1.00 20.00 ? 2    ASN A CA  1 
ATOM   11    C C   . ASN A 1 2   ? -15.622 97.721  54.467  1.00 20.00 ? 2    ASN A C   1 
ATOM   12    O O   . ASN A 1 2   ? -16.101 98.263  55.465  1.00 20.00 ? 2    ASN A O   1 
ATOM   13    C CB  . ASN A 1 2   ? -15.268 99.319  52.580  1.00 20.00 ? 2    ASN A CB  1 
ATOM   14    C CG  . ASN A 1 2   ? -15.150 99.358  51.068  1.00 20.00 ? 2    ASN A CG  1 
ATOM   15    O OD1 . ASN A 1 2   ? -14.122 98.974  50.507  1.00 20.00 ? 2    ASN A OD1 1 
ATOM   16    N ND2 . ASN A 1 2   ? -16.209 99.816  50.398  1.00 20.00 ? 2    ASN A ND2 1 
ATOM   17    N N   . TYR A 1 3   ? -14.709 96.759  54.524  1.00 20.00 ? 3    TYR A N   1 
ATOM   18    C CA  . TYR A 1 3   ? -14.184 96.277  55.789  1.00 20.00 ? 3    TYR A CA  1 
ATOM   19    C C   . TYR A 1 3   ? -12.662 96.367  55.772  1.00 20.00 ? 3    TYR A C   1 
ATOM   20    O O   . TYR A 1 3   ? -12.014 95.967  54.802  1.00 20.00 ? 3    TYR A O   1 
ATOM   21    C CB  . TYR A 1 3   ? -14.622 94.832  56.018  1.00 20.00 ? 3    TYR A CB  1 
ATOM   22    C CG  . TYR A 1 3   ? -16.108 94.616  55.864  1.00 20.00 ? 3    TYR A CG  1 
ATOM   23    C CD1 . TYR A 1 3   ? -16.655 94.272  54.628  1.00 20.00 ? 3    TYR A CD1 1 
ATOM   24    C CD2 . TYR A 1 3   ? -16.967 94.730  56.958  1.00 20.00 ? 3    TYR A CD2 1 
ATOM   25    C CE1 . TYR A 1 3   ? -18.016 94.045  54.482  1.00 20.00 ? 3    TYR A CE1 1 
ATOM   26    C CE2 . TYR A 1 3   ? -18.329 94.506  56.827  1.00 20.00 ? 3    TYR A CE2 1 
ATOM   27    C CZ  . TYR A 1 3   ? -18.851 94.162  55.586  1.00 20.00 ? 3    TYR A CZ  1 
ATOM   28    O OH  . TYR A 1 3   ? -20.205 93.939  55.444  1.00 20.00 ? 3    TYR A OH  1 
ATOM   29    N N   . PRO A 1 4   ? -12.071 96.904  56.846  1.00 20.00 ? 4    PRO A N   1 
ATOM   30    C CA  . PRO A 1 4   ? -10.632 97.143  56.808  1.00 20.00 ? 4    PRO A CA  1 
ATOM   31    C C   . PRO A 1 4   ? -9.818  95.880  57.076  1.00 20.00 ? 4    PRO A C   1 
ATOM   32    O O   . PRO A 1 4   ? -10.298 94.939  57.711  1.00 20.00 ? 4    PRO A O   1 
ATOM   33    C CB  . PRO A 1 4   ? -10.423 98.208  57.880  1.00 20.00 ? 4    PRO A CB  1 
ATOM   34    C CG  . PRO A 1 4   ? -11.539 97.998  58.843  1.00 20.00 ? 4    PRO A CG  1 
ATOM   35    C CD  . PRO A 1 4   ? -12.669 97.319  58.126  1.00 20.00 ? 4    PRO A CD  1 
ATOM   36    N N   . ALA A 1 5   ? -8.592  95.865  56.565  1.00 20.00 ? 5    ALA A N   1 
ATOM   37    C CA  . ALA A 1 5   ? -7.684  94.740  56.740  1.00 20.00 ? 5    ALA A CA  1 
ATOM   38    C C   . ALA A 1 5   ? -7.106  94.886  58.144  1.00 20.00 ? 5    ALA A C   1 
ATOM   39    O O   . ALA A 1 5   ? -7.088  95.989  58.696  1.00 20.00 ? 5    ALA A O   1 
ATOM   40    C CB  . ALA A 1 5   ? -6.571  94.803  55.708  1.00 20.00 ? 5    ALA A CB  1 
ATOM   41    N N   . GLU A 1 6   ? -6.626  93.790  58.723  1.00 20.00 ? 6    GLU A N   1 
ATOM   42    C CA  . GLU A 1 6   ? -6.064  93.850  60.067  1.00 20.00 ? 6    GLU A CA  1 
ATOM   43    C C   . GLU A 1 6   ? -4.972  94.917  60.195  1.00 20.00 ? 6    GLU A C   1 
ATOM   44    O O   . GLU A 1 6   ? -4.041  94.961  59.390  1.00 20.00 ? 6    GLU A O   1 
ATOM   45    C CB  . GLU A 1 6   ? -5.514  92.482  60.472  1.00 20.00 ? 6    GLU A CB  1 
ATOM   46    C CG  . GLU A 1 6   ? -6.554  91.387  60.503  1.00 20.00 ? 6    GLU A CG  1 
ATOM   47    C CD  . GLU A 1 6   ? -6.840  90.836  59.131  1.00 20.00 ? 6    GLU A CD  1 
ATOM   48    O OE1 . GLU A 1 6   ? -6.223  91.320  58.158  1.00 20.00 ? 6    GLU A OE1 1 
ATOM   49    O OE2 . GLU A 1 6   ? -7.676  89.916  59.018  1.00 20.00 ? 6    GLU A OE2 1 
ATOM   50    N N   . PRO A 1 7   ? -5.077  95.799  61.211  1.00 20.00 ? 7    PRO A N   1 
ATOM   51    C CA  . PRO A 1 7   ? -4.050  96.825  61.406  1.00 20.00 ? 7    PRO A CA  1 
ATOM   52    C C   . PRO A 1 7   ? -2.867  96.286  62.201  1.00 20.00 ? 7    PRO A C   1 
ATOM   53    O O   . PRO A 1 7   ? -2.353  96.950  63.100  1.00 20.00 ? 7    PRO A O   1 
ATOM   54    C CB  . PRO A 1 7   ? -4.787  97.932  62.149  1.00 20.00 ? 7    PRO A CB  1 
ATOM   55    C CG  . PRO A 1 7   ? -5.878  97.229  62.899  1.00 20.00 ? 7    PRO A CG  1 
ATOM   56    C CD  . PRO A 1 7   ? -6.137  95.890  62.229  1.00 20.00 ? 7    PRO A CD  1 
ATOM   57    N N   . PHE A 1 8   ? -2.447  95.073  61.862  1.00 20.00 ? 8    PHE A N   1 
ATOM   58    C CA  . PHE A 1 8   ? -1.326  94.419  62.527  1.00 20.00 ? 8    PHE A CA  1 
ATOM   59    C C   . PHE A 1 8   ? -0.948  93.184  61.726  1.00 20.00 ? 8    PHE A C   1 
ATOM   60    O O   . PHE A 1 8   ? -1.654  92.807  60.799  1.00 20.00 ? 8    PHE A O   1 
ATOM   61    C CB  . PHE A 1 8   ? -1.721  94.002  63.955  1.00 20.00 ? 8    PHE A CB  1 
ATOM   62    C CG  . PHE A 1 8   ? -3.013  93.208  64.037  1.00 20.00 ? 8    PHE A CG  1 
ATOM   63    C CD1 . PHE A 1 8   ? -3.072  91.890  63.584  1.00 20.00 ? 8    PHE A CD1 1 
ATOM   64    C CD2 . PHE A 1 8   ? -4.172  93.785  64.553  1.00 20.00 ? 8    PHE A CD2 1 
ATOM   65    C CE1 . PHE A 1 8   ? -4.267  91.151  63.634  1.00 20.00 ? 8    PHE A CE1 1 
ATOM   66    C CE2 . PHE A 1 8   ? -5.379  93.060  64.612  1.00 20.00 ? 8    PHE A CE2 1 
ATOM   67    C CZ  . PHE A 1 8   ? -5.423  91.739  64.149  1.00 20.00 ? 8    PHE A CZ  1 
ATOM   68    N N   . ARG A 1 9   ? 0.178   92.567  62.068  1.00 20.00 ? 9    ARG A N   1 
ATOM   69    C CA  . ARG A 1 9   ? 0.634   91.361  61.380  1.00 20.00 ? 9    ARG A CA  1 
ATOM   70    C C   . ARG A 1 9   ? 0.556   90.269  62.427  1.00 20.00 ? 9    ARG A C   1 
ATOM   71    O O   . ARG A 1 9   ? 0.391   90.551  63.606  1.00 20.00 ? 9    ARG A O   1 
ATOM   72    C CB  . ARG A 1 9   ? 2.097   91.462  60.951  1.00 20.00 ? 9    ARG A CB  1 
ATOM   73    C CG  . ARG A 1 9   ? 2.472   92.665  60.140  1.00 20.00 ? 9    ARG A CG  1 
ATOM   74    C CD  . ARG A 1 9   ? 3.919   92.548  59.694  1.00 20.00 ? 9    ARG A CD  1 
ATOM   75    N NE  . ARG A 1 9   ? 4.406   93.802  59.128  1.00 20.00 ? 9    ARG A NE  1 
ATOM   76    C CZ  . ARG A 1 9   ? 5.686   94.080  58.921  1.00 20.00 ? 9    ARG A CZ  1 
ATOM   77    N NH1 . ARG A 1 9   ? 6.612   93.188  59.233  1.00 20.00 ? 9    ARG A NH1 1 
ATOM   78    N NH2 . ARG A 1 9   ? 6.037   95.255  58.412  1.00 20.00 ? 9    ARG A NH2 1 
ATOM   79    N N   . ILE A 1 10  ? 0.679   89.017  62.009  1.00 20.00 ? 10   ILE A N   1 
ATOM   80    C CA  . ILE A 1 10  ? 0.625   87.932  62.966  1.00 20.00 ? 10   ILE A CA  1 
ATOM   81    C C   . ILE A 1 10  ? 2.066   87.671  63.441  1.00 20.00 ? 10   ILE A C   1 
ATOM   82    O O   . ILE A 1 10  ? 2.953   87.437  62.626  1.00 20.00 ? 10   ILE A O   1 
ATOM   83    C CB  . ILE A 1 10  ? 0.053   86.658  62.325  1.00 20.00 ? 10   ILE A CB  1 
ATOM   84    C CG1 . ILE A 1 10  ? -1.391  86.891  61.908  1.00 20.00 ? 10   ILE A CG1 1 
ATOM   85    C CG2 . ILE A 1 10  ? 0.108   85.503  63.305  1.00 20.00 ? 10   ILE A CG2 1 
ATOM   86    C CD1 . ILE A 1 10  ? -1.948  85.774  61.087  1.00 20.00 ? 10   ILE A CD1 1 
ATOM   87    N N   . LYS A 1 11  ? 2.303   87.731  64.752  1.00 20.00 ? 11   LYS A N   1 
ATOM   88    C CA  . LYS A 1 11  ? 3.637   87.495  65.303  1.00 20.00 ? 11   LYS A CA  1 
ATOM   89    C C   . LYS A 1 11  ? 3.819   86.009  65.607  1.00 20.00 ? 11   LYS A C   1 
ATOM   90    O O   . LYS A 1 11  ? 4.875   85.441  65.372  1.00 20.00 ? 11   LYS A O   1 
ATOM   91    C CB  . LYS A 1 11  ? 3.836   88.314  66.573  1.00 20.00 ? 11   LYS A CB  1 
ATOM   92    C CG  . LYS A 1 11  ? 5.133   88.014  67.300  1.00 20.00 ? 11   LYS A CG  1 
ATOM   93    C CD  . LYS A 1 11  ? 6.342   88.437  66.480  1.00 20.00 ? 11   LYS A CD  1 
ATOM   94    C CE  . LYS A 1 11  ? 7.643   88.059  67.169  1.00 20.00 ? 11   LYS A CE  1 
ATOM   95    N NZ  . LYS A 1 11  ? 8.109   89.167  68.032  1.00 20.00 ? 11   LYS A NZ  1 
ATOM   96    N N   . SER A 1 12  ? 2.783   85.381  66.151  1.00 20.00 ? 12   SER A N   1 
ATOM   97    C CA  . SER A 1 12  ? 2.837   83.957  66.473  1.00 20.00 ? 12   SER A CA  1 
ATOM   98    C C   . SER A 1 12  ? 1.430   83.409  66.350  1.00 20.00 ? 12   SER A C   1 
ATOM   99    O O   . SER A 1 12  ? 0.450   84.141  66.489  1.00 20.00 ? 12   SER A O   1 
ATOM   100   C CB  . SER A 1 12  ? 3.396   83.713  67.879  1.00 20.00 ? 12   SER A CB  1 
ATOM   101   O OG  . SER A 1 12  ? 2.453   84.013  68.888  1.00 20.00 ? 12   SER A OG  1 
ATOM   102   N N   . VAL A 1 13  ? 1.327   82.117  66.079  1.00 20.00 ? 13   VAL A N   1 
ATOM   103   C CA  . VAL A 1 13  ? 0.032   81.488  65.927  1.00 20.00 ? 13   VAL A CA  1 
ATOM   104   C C   . VAL A 1 13  ? -0.209  80.371  66.920  1.00 20.00 ? 13   VAL A C   1 
ATOM   105   O O   . VAL A 1 13  ? 0.711   79.835  67.529  1.00 20.00 ? 13   VAL A O   1 
ATOM   106   C CB  . VAL A 1 13  ? -0.130  80.888  64.503  1.00 20.00 ? 13   VAL A CB  1 
ATOM   107   C CG1 . VAL A 1 13  ? 0.196   81.937  63.450  1.00 20.00 ? 13   VAL A CG1 1 
ATOM   108   C CG2 . VAL A 1 13  ? 0.782   79.674  64.348  1.00 20.00 ? 13   VAL A CG2 1 
ATOM   109   N N   . GLU A 1 14  ? -1.476  80.037  67.089  1.00 20.00 ? 14   GLU A N   1 
ATOM   110   C CA  . GLU A 1 14  ? -1.857  78.980  67.993  1.00 20.00 ? 14   GLU A CA  1 
ATOM   111   C C   . GLU A 1 14  ? -2.295  77.894  67.023  1.00 20.00 ? 14   GLU A C   1 
ATOM   112   O O   . GLU A 1 14  ? -3.243  78.079  66.262  1.00 20.00 ? 14   GLU A O   1 
ATOM   113   C CB  . GLU A 1 14  ? -3.022  79.426  68.873  1.00 20.00 ? 14   GLU A CB  1 
ATOM   114   C CG  . GLU A 1 14  ? -3.289  78.510  70.041  1.00 20.00 ? 14   GLU A CG  1 
ATOM   115   C CD  . GLU A 1 14  ? -4.322  79.063  71.009  1.00 20.00 ? 14   GLU A CD  1 
ATOM   116   O OE1 . GLU A 1 14  ? -4.757  80.225  70.835  1.00 20.00 ? 14   GLU A OE1 1 
ATOM   117   O OE2 . GLU A 1 14  ? -4.698  78.324  71.946  1.00 20.00 ? 14   GLU A OE2 1 
ATOM   118   N N   . THR A 1 15  ? -1.576  76.781  67.014  1.00 20.00 ? 15   THR A N   1 
ATOM   119   C CA  . THR A 1 15  ? -1.906  75.680  66.121  1.00 20.00 ? 15   THR A CA  1 
ATOM   120   C C   . THR A 1 15  ? -3.217  75.028  66.530  1.00 20.00 ? 15   THR A C   1 
ATOM   121   O O   . THR A 1 15  ? -3.551  74.962  67.714  1.00 20.00 ? 15   THR A O   1 
ATOM   122   C CB  . THR A 1 15  ? -0.803  74.604  66.128  1.00 20.00 ? 15   THR A CB  1 
ATOM   123   O OG1 . THR A 1 15  ? -0.302  74.439  67.463  1.00 20.00 ? 15   THR A OG1 1 
ATOM   124   C CG2 . THR A 1 15  ? 0.335   75.008  65.194  1.00 20.00 ? 15   THR A CG2 1 
ATOM   125   N N   . VAL A 1 16  ? -3.967  74.556  65.543  1.00 20.00 ? 16   VAL A N   1 
ATOM   126   C CA  . VAL A 1 16  ? -5.241  73.911  65.814  1.00 20.00 ? 16   VAL A CA  1 
ATOM   127   C C   . VAL A 1 16  ? -5.357  72.607  65.031  1.00 20.00 ? 16   VAL A C   1 
ATOM   128   O O   . VAL A 1 16  ? -4.843  72.486  63.917  1.00 20.00 ? 16   VAL A O   1 
ATOM   129   C CB  . VAL A 1 16  ? -6.430  74.829  65.448  1.00 20.00 ? 16   VAL A CB  1 
ATOM   130   C CG1 . VAL A 1 16  ? -6.330  76.130  66.206  1.00 20.00 ? 16   VAL A CG1 1 
ATOM   131   C CG2 . VAL A 1 16  ? -6.451  75.087  63.965  1.00 20.00 ? 16   VAL A CG2 1 
ATOM   132   N N   . SER A 1 17  ? -6.020  71.627  65.634  1.00 20.00 ? 17   SER A N   1 
ATOM   133   C CA  . SER A 1 17  ? -6.205  70.335  64.995  1.00 20.00 ? 17   SER A CA  1 
ATOM   134   C C   . SER A 1 17  ? -7.512  70.353  64.225  1.00 20.00 ? 17   SER A C   1 
ATOM   135   O O   . SER A 1 17  ? -8.590  70.513  64.809  1.00 20.00 ? 17   SER A O   1 
ATOM   136   C CB  . SER A 1 17  ? -6.241  69.227  66.041  1.00 20.00 ? 17   SER A CB  1 
ATOM   137   O OG  . SER A 1 17  ? -4.962  68.638  66.179  1.00 20.00 ? 17   SER A OG  1 
ATOM   138   N N   . MET A 1 18  ? -7.408  70.199  62.911  1.00 20.00 ? 18   MET A N   1 
ATOM   139   C CA  . MET A 1 18  ? -8.572  70.196  62.041  1.00 20.00 ? 18   MET A CA  1 
ATOM   140   C C   . MET A 1 18  ? -9.138  68.787  61.950  1.00 20.00 ? 18   MET A C   1 
ATOM   141   O O   . MET A 1 18  ? -8.798  68.027  61.040  1.00 20.00 ? 18   MET A O   1 
ATOM   142   C CB  . MET A 1 18  ? -8.180  70.692  60.648  1.00 20.00 ? 18   MET A CB  1 
ATOM   143   C CG  . MET A 1 18  ? -7.168  71.835  60.655  1.00 20.00 ? 18   MET A CG  1 
ATOM   144   S SD  . MET A 1 18  ? -7.950  73.457  60.846  1.00 20.00 ? 18   MET A SD  1 
ATOM   145   C CE  . MET A 1 18  ? -8.795  73.599  59.259  1.00 20.00 ? 18   MET A CE  1 
ATOM   146   N N   . ILE A 1 19  ? -9.997  68.437  62.902  1.00 20.00 ? 19   ILE A N   1 
ATOM   147   C CA  . ILE A 1 19  ? -10.600 67.115  62.912  1.00 20.00 ? 19   ILE A CA  1 
ATOM   148   C C   . ILE A 1 19  ? -11.772 67.073  61.944  1.00 20.00 ? 19   ILE A C   1 
ATOM   149   O O   . ILE A 1 19  ? -12.425 68.086  61.694  1.00 20.00 ? 19   ILE A O   1 
ATOM   150   C CB  . ILE A 1 19  ? -11.091 66.723  64.318  1.00 20.00 ? 19   ILE A CB  1 
ATOM   151   C CG1 . ILE A 1 19  ? -12.164 67.699  64.791  1.00 20.00 ? 19   ILE A CG1 1 
ATOM   152   C CG2 . ILE A 1 19  ? -9.917  66.701  65.293  1.00 20.00 ? 19   ILE A CG2 1 
ATOM   153   C CD1 . ILE A 1 19  ? -12.812 67.277  66.088  1.00 20.00 ? 19   ILE A CD1 1 
ATOM   154   N N   . SER A 1 20  ? -12.022 65.893  61.390  1.00 20.00 ? 20   SER A N   1 
ATOM   155   C CA  . SER A 1 20  ? -13.111 65.713  60.445  1.00 20.00 ? 20   SER A CA  1 
ATOM   156   C C   . SER A 1 20  ? -14.469 65.932  61.101  1.00 20.00 ? 20   SER A C   1 
ATOM   157   O O   . SER A 1 20  ? -14.575 66.122  62.318  1.00 20.00 ? 20   SER A O   1 
ATOM   158   C CB  . SER A 1 20  ? -13.052 64.306  59.831  1.00 20.00 ? 20   SER A CB  1 
ATOM   159   O OG  . SER A 1 20  ? -13.407 63.305  60.776  1.00 20.00 ? 20   SER A OG  1 
ATOM   160   N N   . ARG A 1 21  ? -15.505 65.912  60.274  1.00 20.00 ? 21   ARG A N   1 
ATOM   161   C CA  . ARG A 1 21  ? -16.869 66.102  60.739  1.00 20.00 ? 21   ARG A CA  1 
ATOM   162   C C   . ARG A 1 21  ? -17.285 64.864  61.531  1.00 20.00 ? 21   ARG A C   1 
ATOM   163   O O   . ARG A 1 21  ? -18.005 64.949  62.530  1.00 20.00 ? 21   ARG A O   1 
ATOM   164   C CB  . ARG A 1 21  ? -17.796 66.303  59.543  1.00 20.00 ? 21   ARG A CB  1 
ATOM   165   C CG  . ARG A 1 21  ? -19.154 65.674  59.714  1.00 20.00 ? 21   ARG A CG  1 
ATOM   166   C CD  . ARG A 1 21  ? -20.096 66.060  58.600  1.00 20.00 ? 21   ARG A CD  1 
ATOM   167   N NE  . ARG A 1 21  ? -21.328 66.614  59.142  1.00 20.00 ? 21   ARG A NE  1 
ATOM   168   C CZ  . ARG A 1 21  ? -22.257 65.908  59.781  1.00 20.00 ? 21   ARG A CZ  1 
ATOM   169   N NH1 . ARG A 1 21  ? -22.112 64.598  59.962  1.00 20.00 ? 21   ARG A NH1 1 
ATOM   170   N NH2 . ARG A 1 21  ? -23.343 66.522  60.234  1.00 20.00 ? 21   ARG A NH2 1 
ATOM   171   N N   . ASP A 1 22  ? -16.824 63.711  61.076  1.00 20.00 ? 22   ASP A N   1 
ATOM   172   C CA  . ASP A 1 22  ? -17.149 62.470  61.746  1.00 20.00 ? 22   ASP A CA  1 
ATOM   173   C C   . ASP A 1 22  ? -16.639 62.540  63.173  1.00 20.00 ? 22   ASP A C   1 
ATOM   174   O O   . ASP A 1 22  ? -17.320 62.131  64.114  1.00 20.00 ? 22   ASP A O   1 
ATOM   175   C CB  . ASP A 1 22  ? -16.495 61.297  61.019  1.00 20.00 ? 22   ASP A CB  1 
ATOM   176   C CG  . ASP A 1 22  ? -17.382 60.722  59.931  1.00 20.00 ? 22   ASP A CG  1 
ATOM   177   O OD1 . ASP A 1 22  ? -18.106 61.509  59.278  1.00 20.00 ? 22   ASP A OD1 1 
ATOM   178   O OD2 . ASP A 1 22  ? -17.359 59.487  59.729  1.00 20.00 ? 22   ASP A OD2 1 
ATOM   179   N N   . GLU A 1 23  ? -15.435 63.074  63.326  1.00 20.00 ? 23   GLU A N   1 
ATOM   180   C CA  . GLU A 1 23  ? -14.833 63.196  64.642  1.00 20.00 ? 23   GLU A CA  1 
ATOM   181   C C   . GLU A 1 23  ? -15.557 64.230  65.485  1.00 20.00 ? 23   GLU A C   1 
ATOM   182   O O   . GLU A 1 23  ? -15.735 64.043  66.689  1.00 20.00 ? 23   GLU A O   1 
ATOM   183   C CB  . GLU A 1 23  ? -13.361 63.585  64.522  1.00 20.00 ? 23   GLU A CB  1 
ATOM   184   C CG  . GLU A 1 23  ? -12.472 62.485  63.985  1.00 20.00 ? 23   GLU A CG  1 
ATOM   185   C CD  . GLU A 1 23  ? -11.027 62.928  63.871  1.00 20.00 ? 23   GLU A CD  1 
ATOM   186   O OE1 . GLU A 1 23  ? -10.332 62.946  64.912  1.00 20.00 ? 23   GLU A OE1 1 
ATOM   187   O OE2 . GLU A 1 23  ? -10.588 63.262  62.746  1.00 20.00 ? 23   GLU A OE2 1 
ATOM   188   N N   . ARG A 1 24  ? -15.969 65.320  64.847  1.00 20.00 ? 24   ARG A N   1 
ATOM   189   C CA  . ARG A 1 24  ? -16.673 66.379  65.557  1.00 20.00 ? 24   ARG A CA  1 
ATOM   190   C C   . ARG A 1 24  ? -18.029 65.888  66.050  1.00 20.00 ? 24   ARG A C   1 
ATOM   191   O O   . ARG A 1 24  ? -18.505 66.295  67.114  1.00 20.00 ? 24   ARG A O   1 
ATOM   192   C CB  . ARG A 1 24  ? -16.842 67.596  64.653  1.00 20.00 ? 24   ARG A CB  1 
ATOM   193   C CG  . ARG A 1 24  ? -15.545 68.351  64.402  1.00 20.00 ? 24   ARG A CG  1 
ATOM   194   C CD  . ARG A 1 24  ? -15.829 69.736  63.872  1.00 20.00 ? 24   ARG A CD  1 
ATOM   195   N NE  . ARG A 1 24  ? -16.779 69.696  62.763  1.00 20.00 ? 24   ARG A NE  1 
ATOM   196   C CZ  . ARG A 1 24  ? -16.440 69.762  61.479  1.00 20.00 ? 24   ARG A CZ  1 
ATOM   197   N NH1 . ARG A 1 24  ? -15.166 69.873  61.131  1.00 20.00 ? 24   ARG A NH1 1 
ATOM   198   N NH2 . ARG A 1 24  ? -17.379 69.712  60.541  1.00 20.00 ? 24   ARG A NH2 1 
ATOM   199   N N   . VAL A 1 25  ? -18.646 65.002  65.279  1.00 20.00 ? 25   VAL A N   1 
ATOM   200   C CA  . VAL A 1 25  ? -19.942 64.466  65.662  1.00 20.00 ? 25   VAL A CA  1 
ATOM   201   C C   . VAL A 1 25  ? -19.762 63.564  66.883  1.00 20.00 ? 25   VAL A C   1 
ATOM   202   O O   . VAL A 1 25  ? -20.583 63.584  67.809  1.00 20.00 ? 25   VAL A O   1 
ATOM   203   C CB  . VAL A 1 25  ? -20.576 63.677  64.504  1.00 20.00 ? 25   VAL A CB  1 
ATOM   204   C CG1 . VAL A 1 25  ? -21.793 62.921  65.001  1.00 20.00 ? 25   VAL A CG1 1 
ATOM   205   C CG2 . VAL A 1 25  ? -20.968 64.641  63.385  1.00 20.00 ? 25   VAL A CG2 1 
ATOM   206   N N   . LYS A 1 26  ? -18.680 62.789  66.892  1.00 20.00 ? 26   LYS A N   1 
ATOM   207   C CA  . LYS A 1 26  ? -18.407 61.892  68.012  1.00 20.00 ? 26   LYS A CA  1 
ATOM   208   C C   . LYS A 1 26  ? -18.123 62.707  69.272  1.00 20.00 ? 26   LYS A C   1 
ATOM   209   O O   . LYS A 1 26  ? -18.634 62.397  70.351  1.00 20.00 ? 26   LYS A O   1 
ATOM   210   C CB  . LYS A 1 26  ? -17.215 60.982  67.694  1.00 20.00 ? 26   LYS A CB  1 
ATOM   211   C CG  . LYS A 1 26  ? -17.402 60.154  66.425  1.00 20.00 ? 26   LYS A CG  1 
ATOM   212   C CD  . LYS A 1 26  ? -16.475 58.942  66.368  1.00 20.00 ? 26   LYS A CD  1 
ATOM   213   C CE  . LYS A 1 26  ? -15.024 59.338  66.097  1.00 20.00 ? 26   LYS A CE  1 
ATOM   214   N NZ  . LYS A 1 26  ? -14.410 58.575  64.963  1.00 20.00 ? 26   LYS A NZ  1 
ATOM   215   N N   . LYS A 1 27  ? -17.317 63.757  69.123  1.00 20.00 ? 27   LYS A N   1 
ATOM   216   C CA  . LYS A 1 27  ? -16.960 64.627  70.245  1.00 20.00 ? 27   LYS A CA  1 
ATOM   217   C C   . LYS A 1 27  ? -18.184 65.346  70.802  1.00 20.00 ? 27   LYS A C   1 
ATOM   218   O O   . LYS A 1 27  ? -18.317 65.507  72.017  1.00 20.00 ? 27   LYS A O   1 
ATOM   219   C CB  . LYS A 1 27  ? -15.925 65.669  69.808  1.00 20.00 ? 27   LYS A CB  1 
ATOM   220   C CG  . LYS A 1 27  ? -14.514 65.378  70.270  1.00 20.00 ? 27   LYS A CG  1 
ATOM   221   C CD  . LYS A 1 27  ? -13.635 64.975  69.107  1.00 20.00 ? 27   LYS A CD  1 
ATOM   222   C CE  . LYS A 1 27  ? -12.316 64.420  69.596  1.00 20.00 ? 27   LYS A CE  1 
ATOM   223   N NZ  . LYS A 1 27  ? -12.394 64.045  71.035  1.00 20.00 ? 27   LYS A NZ  1 
ATOM   224   N N   . MET A 1 28  ? -19.065 65.791  69.910  1.00 20.00 ? 28   MET A N   1 
ATOM   225   C CA  . MET A 1 28  ? -20.272 66.489  70.332  1.00 20.00 ? 28   MET A CA  1 
ATOM   226   C C   . MET A 1 28  ? -21.109 65.503  71.135  1.00 20.00 ? 28   MET A C   1 
ATOM   227   O O   . MET A 1 28  ? -21.709 65.857  72.153  1.00 20.00 ? 28   MET A O   1 
ATOM   228   C CB  . MET A 1 28  ? -21.060 66.984  69.120  1.00 20.00 ? 28   MET A CB  1 
ATOM   229   C CG  . MET A 1 28  ? -22.073 68.089  69.439  1.00 20.00 ? 28   MET A CG  1 
ATOM   230   S SD  . MET A 1 28  ? -21.540 69.271  70.704  1.00 20.00 ? 28   MET A SD  1 
ATOM   231   C CE  . MET A 1 28  ? -21.662 70.784  69.832  1.00 20.00 ? 28   MET A CE  1 
ATOM   232   N N   . GLN A 1 29  ? -21.126 64.264  70.669  1.00 20.00 ? 29   GLN A N   1 
ATOM   233   C CA  . GLN A 1 29  ? -21.872 63.200  71.322  1.00 20.00 ? 29   GLN A CA  1 
ATOM   234   C C   . GLN A 1 29  ? -21.390 63.019  72.761  1.00 20.00 ? 29   GLN A C   1 
ATOM   235   O O   . GLN A 1 29  ? -22.167 63.102  73.715  1.00 20.00 ? 29   GLN A O   1 
ATOM   236   C CB  . GLN A 1 29  ? -21.654 61.889  70.577  1.00 20.00 ? 29   GLN A CB  1 
ATOM   237   C CG  . GLN A 1 29  ? -22.651 61.578  69.484  1.00 20.00 ? 29   GLN A CG  1 
ATOM   238   C CD  . GLN A 1 29  ? -22.568 60.125  69.064  1.00 20.00 ? 29   GLN A CD  1 
ATOM   239   O OE1 . GLN A 1 29  ? -21.725 59.749  68.245  1.00 20.00 ? 29   GLN A OE1 1 
ATOM   240   N NE2 . GLN A 1 29  ? -23.435 59.293  69.636  1.00 20.00 ? 29   GLN A NE2 1 
ATOM   241   N N   . GLU A 1 30  ? -20.095 62.761  72.899  1.00 20.00 ? 30   GLU A N   1 
ATOM   242   C CA  . GLU A 1 30  ? -19.492 62.559  74.209  1.00 20.00 ? 30   GLU A CA  1 
ATOM   243   C C   . GLU A 1 30  ? -19.692 63.744  75.132  1.00 20.00 ? 30   GLU A C   1 
ATOM   244   O O   . GLU A 1 30  ? -19.659 63.590  76.353  1.00 20.00 ? 30   GLU A O   1 
ATOM   245   C CB  . GLU A 1 30  ? -17.996 62.294  74.069  1.00 20.00 ? 30   GLU A CB  1 
ATOM   246   C CG  . GLU A 1 30  ? -17.632 61.253  73.040  1.00 20.00 ? 30   GLU A CG  1 
ATOM   247   C CD  . GLU A 1 30  ? -16.131 61.033  72.969  1.00 20.00 ? 30   GLU A CD  1 
ATOM   248   O OE1 . GLU A 1 30  ? -15.395 62.025  72.773  1.00 20.00 ? 30   GLU A OE1 1 
ATOM   249   O OE2 . GLU A 1 30  ? -15.685 59.873  73.115  1.00 20.00 ? 30   GLU A OE2 1 
ATOM   250   N N   . ALA A 1 31  ? -19.884 64.920  74.540  1.00 20.00 ? 31   ALA A N   1 
ATOM   251   C CA  . ALA A 1 31  ? -20.091 66.158  75.293  1.00 20.00 ? 31   ALA A CA  1 
ATOM   252   C C   . ALA A 1 31  ? -21.550 66.332  75.703  1.00 20.00 ? 31   ALA A C   1 
ATOM   253   O O   . ALA A 1 31  ? -21.913 67.339  76.321  1.00 20.00 ? 31   ALA A O   1 
ATOM   254   C CB  . ALA A 1 31  ? -19.643 67.357  74.458  1.00 20.00 ? 31   ALA A CB  1 
ATOM   255   N N   . GLY A 1 32  ? -22.378 65.347  75.358  1.00 20.00 ? 32   GLY A N   1 
ATOM   256   C CA  . GLY A 1 32  ? -23.791 65.406  75.693  1.00 20.00 ? 32   GLY A CA  1 
ATOM   257   C C   . GLY A 1 32  ? -24.506 66.497  74.916  1.00 20.00 ? 32   GLY A C   1 
ATOM   258   O O   . GLY A 1 32  ? -25.528 67.025  75.360  1.00 20.00 ? 32   GLY A O   1 
ATOM   259   N N   . TYR A 1 33  ? -23.958 66.829  73.750  1.00 20.00 ? 33   TYR A N   1 
ATOM   260   C CA  . TYR A 1 33  ? -24.510 67.857  72.869  1.00 20.00 ? 33   TYR A CA  1 
ATOM   261   C C   . TYR A 1 33  ? -24.476 69.244  73.507  1.00 20.00 ? 33   TYR A C   1 
ATOM   262   O O   . TYR A 1 33  ? -25.184 70.147  73.082  1.00 20.00 ? 33   TYR A O   1 
ATOM   263   C CB  . TYR A 1 33  ? -25.946 67.484  72.449  1.00 20.00 ? 33   TYR A CB  1 
ATOM   264   C CG  . TYR A 1 33  ? -26.000 66.238  71.592  1.00 20.00 ? 33   TYR A CG  1 
ATOM   265   C CD1 . TYR A 1 33  ? -25.508 66.248  70.284  1.00 20.00 ? 33   TYR A CD1 1 
ATOM   266   C CD2 . TYR A 1 33  ? -26.459 65.024  72.113  1.00 20.00 ? 33   TYR A CD2 1 
ATOM   267   C CE1 . TYR A 1 33  ? -25.461 65.081  69.519  1.00 20.00 ? 33   TYR A CE1 1 
ATOM   268   C CE2 . TYR A 1 33  ? -26.416 63.851  71.356  1.00 20.00 ? 33   TYR A CE2 1 
ATOM   269   C CZ  . TYR A 1 33  ? -25.912 63.886  70.063  1.00 20.00 ? 33   TYR A CZ  1 
ATOM   270   O OH  . TYR A 1 33  ? -25.835 62.721  69.331  1.00 20.00 ? 33   TYR A OH  1 
ATOM   271   N N   . ASN A 1 34  ? -23.632 69.401  74.519  1.00 20.00 ? 34   ASN A N   1 
ATOM   272   C CA  . ASN A 1 34  ? -23.480 70.666  75.235  1.00 20.00 ? 34   ASN A CA  1 
ATOM   273   C C   . ASN A 1 34  ? -22.102 71.251  74.905  1.00 20.00 ? 34   ASN A C   1 
ATOM   274   O O   . ASN A 1 34  ? -21.078 70.712  75.333  1.00 20.00 ? 34   ASN A O   1 
ATOM   275   C CB  . ASN A 1 34  ? -23.606 70.408  76.744  1.00 20.00 ? 34   ASN A CB  1 
ATOM   276   C CG  . ASN A 1 34  ? -23.525 71.678  77.567  1.00 20.00 ? 34   ASN A CG  1 
ATOM   277   O OD1 . ASN A 1 34  ? -23.228 72.755  77.047  1.00 20.00 ? 34   ASN A OD1 1 
ATOM   278   N ND2 . ASN A 1 34  ? -23.786 71.557  78.864  1.00 20.00 ? 34   ASN A ND2 1 
ATOM   279   N N   . THR A 1 35  ? -22.072 72.354  74.156  1.00 20.00 ? 35   THR A N   1 
ATOM   280   C CA  . THR A 1 35  ? -20.806 72.979  73.785  1.00 20.00 ? 35   THR A CA  1 
ATOM   281   C C   . THR A 1 35  ? -19.904 73.342  74.965  1.00 20.00 ? 35   THR A C   1 
ATOM   282   O O   . THR A 1 35  ? -18.679 73.394  74.814  1.00 20.00 ? 35   THR A O   1 
ATOM   283   C CB  . THR A 1 35  ? -21.030 74.242  72.906  1.00 20.00 ? 35   THR A CB  1 
ATOM   284   O OG1 . THR A 1 35  ? -21.826 75.202  73.609  1.00 20.00 ? 35   THR A OG1 1 
ATOM   285   C CG2 . THR A 1 35  ? -21.720 73.862  71.612  1.00 20.00 ? 35   THR A CG2 1 
ATOM   286   N N   . PHE A 1 36  ? -20.495 73.577  76.136  1.00 20.00 ? 36   PHE A N   1 
ATOM   287   C CA  . PHE A 1 36  ? -19.724 73.932  77.333  1.00 20.00 ? 36   PHE A CA  1 
ATOM   288   C C   . PHE A 1 36  ? -18.866 72.770  77.837  1.00 20.00 ? 36   PHE A C   1 
ATOM   289   O O   . PHE A 1 36  ? -17.927 72.972  78.602  1.00 20.00 ? 36   PHE A O   1 
ATOM   290   C CB  . PHE A 1 36  ? -20.658 74.378  78.463  1.00 20.00 ? 36   PHE A CB  1 
ATOM   291   C CG  . PHE A 1 36  ? -20.544 75.835  78.812  1.00 20.00 ? 36   PHE A CG  1 
ATOM   292   C CD1 . PHE A 1 36  ? -19.406 76.327  79.442  1.00 20.00 ? 36   PHE A CD1 1 
ATOM   293   C CD2 . PHE A 1 36  ? -21.584 76.713  78.532  1.00 20.00 ? 36   PHE A CD2 1 
ATOM   294   C CE1 . PHE A 1 36  ? -19.308 77.671  79.789  1.00 20.00 ? 36   PHE A CE1 1 
ATOM   295   C CE2 . PHE A 1 36  ? -21.496 78.063  78.876  1.00 20.00 ? 36   PHE A CE2 1 
ATOM   296   C CZ  . PHE A 1 36  ? -20.358 78.541  79.506  1.00 20.00 ? 36   PHE A CZ  1 
ATOM   297   N N   . LEU A 1 37  ? -19.198 71.558  77.411  1.00 20.00 ? 37   LEU A N   1 
ATOM   298   C CA  . LEU A 1 37  ? -18.464 70.373  77.819  1.00 20.00 ? 37   LEU A CA  1 
ATOM   299   C C   . LEU A 1 37  ? -17.385 69.994  76.805  1.00 20.00 ? 37   LEU A C   1 
ATOM   300   O O   . LEU A 1 37  ? -16.690 68.988  76.975  1.00 20.00 ? 37   LEU A O   1 
ATOM   301   C CB  . LEU A 1 37  ? -19.433 69.200  77.985  1.00 20.00 ? 37   LEU A CB  1 
ATOM   302   C CG  . LEU A 1 37  ? -20.006 68.925  79.375  1.00 20.00 ? 37   LEU A CG  1 
ATOM   303   C CD1 . LEU A 1 37  ? -20.137 70.224  80.141  1.00 20.00 ? 37   LEU A CD1 1 
ATOM   304   C CD2 . LEU A 1 37  ? -21.364 68.255  79.239  1.00 20.00 ? 37   LEU A CD2 1 
ATOM   305   N N   . LEU A 1 38  ? -17.246 70.796  75.754  1.00 20.00 ? 38   LEU A N   1 
ATOM   306   C CA  . LEU A 1 38  ? -16.249 70.517  74.731  1.00 20.00 ? 38   LEU A CA  1 
ATOM   307   C C   . LEU A 1 38  ? -14.840 70.893  75.188  1.00 20.00 ? 38   LEU A C   1 
ATOM   308   O O   . LEU A 1 38  ? -14.657 71.821  75.968  1.00 20.00 ? 38   LEU A O   1 
ATOM   309   C CB  . LEU A 1 38  ? -16.599 71.262  73.430  1.00 20.00 ? 38   LEU A CB  1 
ATOM   310   C CG  . LEU A 1 38  ? -17.755 70.720  72.571  1.00 20.00 ? 38   LEU A CG  1 
ATOM   311   C CD1 . LEU A 1 38  ? -17.986 71.667  71.402  1.00 20.00 ? 38   LEU A CD1 1 
ATOM   312   C CD2 . LEU A 1 38  ? -17.446 69.306  72.066  1.00 20.00 ? 38   LEU A CD2 1 
ATOM   313   N N   . ASN A 1 39  ? -13.850 70.148  74.707  1.00 20.00 ? 39   ASN A N   1 
ATOM   314   C CA  . ASN A 1 39  ? -12.460 70.395  75.053  1.00 20.00 ? 39   ASN A CA  1 
ATOM   315   C C   . ASN A 1 39  ? -11.946 71.465  74.118  1.00 20.00 ? 39   ASN A C   1 
ATOM   316   O O   . ASN A 1 39  ? -12.143 71.380  72.914  1.00 20.00 ? 39   ASN A O   1 
ATOM   317   C CB  . ASN A 1 39  ? -11.621 69.142  74.840  1.00 20.00 ? 39   ASN A CB  1 
ATOM   318   C CG  . ASN A 1 39  ? -11.809 68.120  75.929  1.00 20.00 ? 39   ASN A CG  1 
ATOM   319   O OD1 . ASN A 1 39  ? -12.258 68.440  77.034  1.00 20.00 ? 39   ASN A OD1 1 
ATOM   320   N ND2 . ASN A 1 39  ? -11.465 66.877  75.626  1.00 20.00 ? 39   ASN A ND2 1 
ATOM   321   N N   . SER A 1 40  ? -11.276 72.465  74.671  1.00 20.00 ? 40   SER A N   1 
ATOM   322   C CA  . SER A 1 40  ? -10.731 73.550  73.868  1.00 20.00 ? 40   SER A CA  1 
ATOM   323   C C   . SER A 1 40  ? -9.960  72.992  72.677  1.00 20.00 ? 40   SER A C   1 
ATOM   324   O O   . SER A 1 40  ? -10.090 73.485  71.558  1.00 20.00 ? 40   SER A O   1 
ATOM   325   C CB  . SER A 1 40  ? -9.799  74.412  74.727  1.00 20.00 ? 40   SER A CB  1 
ATOM   326   O OG  . SER A 1 40  ? -9.218  75.468  73.977  1.00 20.00 ? 40   SER A OG  1 
ATOM   327   N N   . LYS A 1 41  ? -9.182  71.943  72.919  1.00 20.00 ? 41   LYS A N   1 
ATOM   328   C CA  . LYS A 1 41  ? -8.378  71.313  71.875  1.00 20.00 ? 41   LYS A CA  1 
ATOM   329   C C   . LYS A 1 41  ? -9.159  70.711  70.720  1.00 20.00 ? 41   LYS A C   1 
ATOM   330   O O   . LYS A 1 41  ? -8.595  70.446  69.653  1.00 20.00 ? 41   LYS A O   1 
ATOM   331   C CB  . LYS A 1 41  ? -7.480  70.237  72.484  1.00 20.00 ? 41   LYS A CB  1 
ATOM   332   C CG  . LYS A 1 41  ? -8.240  69.115  73.164  1.00 20.00 ? 41   LYS A CG  1 
ATOM   333   C CD  . LYS A 1 41  ? -7.288  68.057  73.724  1.00 20.00 ? 41   LYS A CD  1 
ATOM   334   C CE  . LYS A 1 41  ? -7.638  66.659  73.224  1.00 20.00 ? 41   LYS A CE  1 
ATOM   335   N NZ  . LYS A 1 41  ? -7.236  66.449  71.800  1.00 20.00 ? 41   LYS A NZ  1 
ATOM   336   N N   . ASP A 1 42  ? -10.451 70.499  70.929  1.00 20.00 ? 42   ASP A N   1 
ATOM   337   C CA  . ASP A 1 42  ? -11.297 69.922  69.893  1.00 20.00 ? 42   ASP A CA  1 
ATOM   338   C C   . ASP A 1 42  ? -12.083 70.983  69.128  1.00 20.00 ? 42   ASP A C   1 
ATOM   339   O O   . ASP A 1 42  ? -12.952 70.652  68.316  1.00 20.00 ? 42   ASP A O   1 
ATOM   340   C CB  . ASP A 1 42  ? -12.263 68.913  70.517  1.00 20.00 ? 42   ASP A CB  1 
ATOM   341   C CG  . ASP A 1 42  ? -11.546 67.698  71.080  1.00 20.00 ? 42   ASP A CG  1 
ATOM   342   O OD1 . ASP A 1 42  ? -10.533 67.274  70.472  1.00 20.00 ? 42   ASP A OD1 1 
ATOM   343   O OD2 . ASP A 1 42  ? -11.990 67.172  72.128  1.00 20.00 ? 42   ASP A OD2 1 
ATOM   344   N N   . ILE A 1 43  ? -11.759 72.251  69.378  1.00 20.00 ? 43   ILE A N   1 
ATOM   345   C CA  . ILE A 1 43  ? -12.427 73.373  68.724  1.00 20.00 ? 43   ILE A CA  1 
ATOM   346   C C   . ILE A 1 43  ? -11.510 74.188  67.803  1.00 20.00 ? 43   ILE A C   1 
ATOM   347   O O   . ILE A 1 43  ? -10.384 74.550  68.176  1.00 20.00 ? 43   ILE A O   1 
ATOM   348   C CB  . ILE A 1 43  ? -13.057 74.303  69.778  1.00 20.00 ? 43   ILE A CB  1 
ATOM   349   C CG1 . ILE A 1 43  ? -13.980 73.489  70.681  1.00 20.00 ? 43   ILE A CG1 1 
ATOM   350   C CG2 . ILE A 1 43  ? -13.854 75.412  69.109  1.00 20.00 ? 43   ILE A CG2 1 
ATOM   351   C CD1 . ILE A 1 43  ? -14.296 74.190  71.962  1.00 20.00 ? 43   ILE A CD1 1 
ATOM   352   N N   . TYR A 1 44  ? -12.008 74.467  66.596  1.00 20.00 ? 44   TYR A N   1 
ATOM   353   C CA  . TYR A 1 44  ? -11.279 75.231  65.583  1.00 20.00 ? 44   TYR A CA  1 
ATOM   354   C C   . TYR A 1 44  ? -11.421 76.718  65.886  1.00 20.00 ? 44   TYR A C   1 
ATOM   355   O O   . TYR A 1 44  ? -10.425 77.407  66.096  1.00 20.00 ? 44   TYR A O   1 
ATOM   356   C CB  . TYR A 1 44  ? -11.848 74.891  64.189  1.00 20.00 ? 44   TYR A CB  1 
ATOM   357   C CG  . TYR A 1 44  ? -11.284 75.665  63.000  1.00 20.00 ? 44   TYR A CG  1 
ATOM   358   C CD1 . TYR A 1 44  ? -10.003 76.209  63.022  1.00 20.00 ? 44   TYR A CD1 1 
ATOM   359   C CD2 . TYR A 1 44  ? -12.047 75.840  61.845  1.00 20.00 ? 44   TYR A CD2 1 
ATOM   360   C CE1 . TYR A 1 44  ? -9.495  76.912  61.918  1.00 20.00 ? 44   TYR A CE1 1 
ATOM   361   C CE2 . TYR A 1 44  ? -11.552 76.536  60.746  1.00 20.00 ? 44   TYR A CE2 1 
ATOM   362   C CZ  . TYR A 1 44  ? -10.279 77.069  60.788  1.00 20.00 ? 44   TYR A CZ  1 
ATOM   363   O OH  . TYR A 1 44  ? -9.811  77.773  59.708  1.00 20.00 ? 44   TYR A OH  1 
ATOM   364   N N   . ILE A 1 45  ? -12.665 77.196  65.926  1.00 20.00 ? 45   ILE A N   1 
ATOM   365   C CA  . ILE A 1 45  ? -12.965 78.599  66.204  1.00 20.00 ? 45   ILE A CA  1 
ATOM   366   C C   . ILE A 1 45  ? -13.848 78.650  67.453  1.00 20.00 ? 45   ILE A C   1 
ATOM   367   O O   . ILE A 1 45  ? -14.992 78.212  67.422  1.00 20.00 ? 45   ILE A O   1 
ATOM   368   C CB  . ILE A 1 45  ? -13.704 79.245  65.011  1.00 20.00 ? 45   ILE A CB  1 
ATOM   369   C CG1 . ILE A 1 45  ? -12.848 79.120  63.752  1.00 20.00 ? 45   ILE A CG1 1 
ATOM   370   C CG2 . ILE A 1 45  ? -13.978 80.706  65.282  1.00 20.00 ? 45   ILE A CG2 1 
ATOM   371   C CD1 . ILE A 1 45  ? -13.628 79.283  62.468  1.00 20.00 ? 45   ILE A CD1 1 
ATOM   372   N N   . ASP A 1 46  ? -13.306 79.176  68.550  1.00 20.00 ? 46   ASP A N   1 
ATOM   373   C CA  . ASP A 1 46  ? -14.036 79.277  69.817  1.00 20.00 ? 46   ASP A CA  1 
ATOM   374   C C   . ASP A 1 46  ? -14.656 80.652  70.038  1.00 20.00 ? 46   ASP A C   1 
ATOM   375   O O   . ASP A 1 46  ? -13.961 81.608  70.374  1.00 20.00 ? 46   ASP A O   1 
ATOM   376   C CB  . ASP A 1 46  ? -13.089 78.946  70.976  1.00 20.00 ? 46   ASP A CB  1 
ATOM   377   C CG  . ASP A 1 46  ? -13.824 78.505  72.236  1.00 20.00 ? 46   ASP A CG  1 
ATOM   378   O OD1 . ASP A 1 46  ? -15.044 78.738  72.341  1.00 20.00 ? 46   ASP A OD1 1 
ATOM   379   O OD2 . ASP A 1 46  ? -13.177 77.929  73.134  1.00 20.00 ? 46   ASP A OD2 1 
ATOM   380   N N   . LEU A 1 47  ? -15.971 80.736  69.859  1.00 20.00 ? 47   LEU A N   1 
ATOM   381   C CA  . LEU A 1 47  ? -16.707 81.979  70.030  1.00 20.00 ? 47   LEU A CA  1 
ATOM   382   C C   . LEU A 1 47  ? -17.568 81.976  71.296  1.00 20.00 ? 47   LEU A C   1 
ATOM   383   O O   . LEU A 1 47  ? -18.553 82.704  71.396  1.00 20.00 ? 47   LEU A O   1 
ATOM   384   C CB  . LEU A 1 47  ? -17.572 82.248  68.797  1.00 20.00 ? 47   LEU A CB  1 
ATOM   385   C CG  . LEU A 1 47  ? -16.868 82.143  67.437  1.00 20.00 ? 47   LEU A CG  1 
ATOM   386   C CD1 . LEU A 1 47  ? -17.776 82.700  66.356  1.00 20.00 ? 47   LEU A CD1 1 
ATOM   387   C CD2 . LEU A 1 47  ? -15.551 82.905  67.463  1.00 20.00 ? 47   LEU A CD2 1 
ATOM   388   N N   . LEU A 1 48  ? -17.176 81.151  72.263  1.00 20.00 ? 48   LEU A N   1 
ATOM   389   C CA  . LEU A 1 48  ? -17.885 81.040  73.538  1.00 20.00 ? 48   LEU A CA  1 
ATOM   390   C C   . LEU A 1 48  ? -17.933 82.412  74.222  1.00 20.00 ? 48   LEU A C   1 
ATOM   391   O O   . LEU A 1 48  ? -18.976 82.845  74.704  1.00 20.00 ? 48   LEU A O   1 
ATOM   392   C CB  . LEU A 1 48  ? -17.156 80.060  74.465  1.00 20.00 ? 48   LEU A CB  1 
ATOM   393   C CG  . LEU A 1 48  ? -17.859 78.893  75.173  1.00 20.00 ? 48   LEU A CG  1 
ATOM   394   C CD1 . LEU A 1 48  ? -17.327 78.779  76.595  1.00 20.00 ? 48   LEU A CD1 1 
ATOM   395   C CD2 . LEU A 1 48  ? -19.356 79.093  75.194  1.00 20.00 ? 48   LEU A CD2 1 
ATOM   396   N N   . THR A 1 49  ? -16.798 83.100  74.249  1.00 20.00 ? 49   THR A N   1 
ATOM   397   C CA  . THR A 1 49  ? -16.738 84.407  74.882  1.00 20.00 ? 49   THR A CA  1 
ATOM   398   C C   . THR A 1 49  ? -15.583 85.268  74.386  1.00 20.00 ? 49   THR A C   1 
ATOM   399   O O   . THR A 1 49  ? -14.629 84.769  73.797  1.00 20.00 ? 49   THR A O   1 
ATOM   400   C CB  . THR A 1 49  ? -16.604 84.246  76.419  1.00 20.00 ? 49   THR A CB  1 
ATOM   401   O OG1 . THR A 1 49  ? -16.538 85.532  77.039  1.00 20.00 ? 49   THR A OG1 1 
ATOM   402   C CG2 . THR A 1 49  ? -15.342 83.451  76.771  1.00 20.00 ? 49   THR A CG2 1 
ATOM   403   N N   . ASP A 1 50  ? -15.697 86.568  74.628  1.00 20.00 ? 50   ASP A N   1 
ATOM   404   C CA  . ASP A 1 50  ? -14.687 87.530  74.238  1.00 20.00 ? 50   ASP A CA  1 
ATOM   405   C C   . ASP A 1 50  ? -13.913 87.921  75.505  1.00 20.00 ? 50   ASP A C   1 
ATOM   406   O O   . ASP A 1 50  ? -13.078 88.823  75.487  1.00 20.00 ? 50   ASP A O   1 
ATOM   407   C CB  . ASP A 1 50  ? -15.337 88.771  73.614  1.00 20.00 ? 50   ASP A CB  1 
ATOM   408   C CG  . ASP A 1 50  ? -16.096 89.608  74.625  1.00 20.00 ? 50   ASP A CG  1 
ATOM   409   O OD1 . ASP A 1 50  ? -16.785 89.028  75.492  1.00 20.00 ? 50   ASP A OD1 1 
ATOM   410   O OD2 . ASP A 1 50  ? -16.011 90.853  74.556  1.00 20.00 ? 50   ASP A OD2 1 
ATOM   411   N N   . SER A 1 51  ? -14.201 87.231  76.603  1.00 20.00 ? 51   SER A N   1 
ATOM   412   C CA  . SER A 1 51  ? -13.547 87.493  77.875  1.00 20.00 ? 51   SER A CA  1 
ATOM   413   C C   . SER A 1 51  ? -12.251 86.710  78.068  1.00 20.00 ? 51   SER A C   1 
ATOM   414   O O   . SER A 1 51  ? -12.254 85.479  78.104  1.00 20.00 ? 51   SER A O   1 
ATOM   415   C CB  . SER A 1 51  ? -14.499 87.164  79.027  1.00 20.00 ? 51   SER A CB  1 
ATOM   416   O OG  . SER A 1 51  ? -13.905 87.476  80.273  1.00 20.00 ? 51   SER A OG  1 
ATOM   417   N N   . GLY A 1 52  ? -11.144 87.435  78.185  1.00 20.00 ? 52   GLY A N   1 
ATOM   418   C CA  . GLY A 1 52  ? -9.848  86.805  78.382  1.00 20.00 ? 52   GLY A CA  1 
ATOM   419   C C   . GLY A 1 52  ? -9.297  85.939  77.268  1.00 20.00 ? 52   GLY A C   1 
ATOM   420   O O   . GLY A 1 52  ? -8.264  85.301  77.442  1.00 20.00 ? 52   GLY A O   1 
ATOM   421   N N   . THR A 1 53  ? -9.972  85.924  76.127  1.00 20.00 ? 53   THR A N   1 
ATOM   422   C CA  . THR A 1 53  ? -9.543  85.127  74.984  1.00 20.00 ? 53   THR A CA  1 
ATOM   423   C C   . THR A 1 53  ? -8.748  85.934  73.953  1.00 20.00 ? 53   THR A C   1 
ATOM   424   O O   . THR A 1 53  ? -8.399  85.420  72.887  1.00 20.00 ? 53   THR A O   1 
ATOM   425   C CB  . THR A 1 53  ? -10.762 84.543  74.293  1.00 20.00 ? 53   THR A CB  1 
ATOM   426   O OG1 . THR A 1 53  ? -11.772 85.551  74.227  1.00 20.00 ? 53   THR A OG1 1 
ATOM   427   C CG2 . THR A 1 53  ? -11.301 83.373  75.076  1.00 20.00 ? 53   THR A CG2 1 
ATOM   428   N N   . ASN A 1 54  ? -8.466  87.192  74.280  1.00 20.00 ? 54   ASN A N   1 
ATOM   429   C CA  . ASN A 1 54  ? -7.723  88.085  73.401  1.00 20.00 ? 54   ASN A CA  1 
ATOM   430   C C   . ASN A 1 54  ? -6.278  87.684  73.124  1.00 20.00 ? 54   ASN A C   1 
ATOM   431   O O   . ASN A 1 54  ? -5.666  86.940  73.884  1.00 20.00 ? 54   ASN A O   1 
ATOM   432   C CB  . ASN A 1 54  ? -7.717  89.496  73.988  1.00 20.00 ? 54   ASN A CB  1 
ATOM   433   C CG  . ASN A 1 54  ? -9.070  89.925  74.477  1.00 20.00 ? 54   ASN A CG  1 
ATOM   434   O OD1 . ASN A 1 54  ? -10.036 89.968  73.713  1.00 20.00 ? 54   ASN A OD1 1 
ATOM   435   N ND2 . ASN A 1 54  ? -9.156  90.251  75.759  1.00 20.00 ? 54   ASN A ND2 1 
ATOM   436   N N   . ALA A 1 55  ? -5.748  88.178  72.010  1.00 20.00 ? 55   ALA A N   1 
ATOM   437   C CA  . ALA A 1 55  ? -4.374  87.900  71.615  1.00 20.00 ? 55   ALA A CA  1 
ATOM   438   C C   . ALA A 1 55  ? -3.609  89.164  71.976  1.00 20.00 ? 55   ALA A C   1 
ATOM   439   O O   . ALA A 1 55  ? -4.045  90.276  71.657  1.00 20.00 ? 55   ALA A O   1 
ATOM   440   C CB  . ALA A 1 55  ? -4.276  87.646  70.118  1.00 20.00 ? 55   ALA A CB  1 
ATOM   441   N N   . MET A 1 56  ? -2.481  88.999  72.659  1.00 20.00 ? 56   MET A N   1 
ATOM   442   C CA  . MET A 1 56  ? -1.664  90.138  73.060  1.00 20.00 ? 56   MET A CA  1 
ATOM   443   C C   . MET A 1 56  ? -0.641  90.494  71.976  1.00 20.00 ? 56   MET A C   1 
ATOM   444   O O   . MET A 1 56  ? -0.407  89.722  71.048  1.00 20.00 ? 56   MET A O   1 
ATOM   445   C CB  . MET A 1 56  ? -0.932  89.816  74.360  1.00 20.00 ? 56   MET A CB  1 
ATOM   446   C CG  . MET A 1 56  ? -1.844  89.498  75.523  1.00 20.00 ? 56   MET A CG  1 
ATOM   447   S SD  . MET A 1 56  ? -1.023  89.730  77.101  1.00 20.00 ? 56   MET A SD  1 
ATOM   448   C CE  . MET A 1 56  ? -0.238  88.174  77.265  1.00 20.00 ? 56   MET A CE  1 
ATOM   449   N N   . SER A 1 57  ? -0.029  91.665  72.092  1.00 20.00 ? 57   SER A N   1 
ATOM   450   C CA  . SER A 1 57  ? 0.960   92.075  71.108  1.00 20.00 ? 57   SER A CA  1 
ATOM   451   C C   . SER A 1 57  ? 2.345   91.658  71.565  1.00 20.00 ? 57   SER A C   1 
ATOM   452   O O   . SER A 1 57  ? 2.517   91.091  72.644  1.00 20.00 ? 57   SER A O   1 
ATOM   453   C CB  . SER A 1 57  ? 0.941   93.586  70.918  1.00 20.00 ? 57   SER A CB  1 
ATOM   454   O OG  . SER A 1 57  ? 1.370   94.242  72.093  1.00 20.00 ? 57   SER A OG  1 
ATOM   455   N N   . ASP A 1 58  ? 3.332   91.936  70.728  1.00 20.00 ? 58   ASP A N   1 
ATOM   456   C CA  . ASP A 1 58  ? 4.696   91.593  71.054  1.00 20.00 ? 58   ASP A CA  1 
ATOM   457   C C   . ASP A 1 58  ? 5.148   92.510  72.190  1.00 20.00 ? 58   ASP A C   1 
ATOM   458   O O   . ASP A 1 58  ? 5.934   92.119  73.046  1.00 20.00 ? 58   ASP A O   1 
ATOM   459   C CB  . ASP A 1 58  ? 5.598   91.746  69.814  1.00 20.00 ? 58   ASP A CB  1 
ATOM   460   C CG  . ASP A 1 58  ? 5.337   93.025  69.033  1.00 20.00 ? 58   ASP A CG  1 
ATOM   461   O OD1 . ASP A 1 58  ? 4.280   93.661  69.218  1.00 20.00 ? 58   ASP A OD1 1 
ATOM   462   O OD2 . ASP A 1 58  ? 6.209   93.400  68.219  1.00 20.00 ? 58   ASP A OD2 1 
ATOM   463   N N   . LYS A 1 59  ? 4.630   93.733  72.196  1.00 20.00 ? 59   LYS A N   1 
ATOM   464   C CA  . LYS A 1 59  ? 4.971   94.705  73.220  1.00 20.00 ? 59   LYS A CA  1 
ATOM   465   C C   . LYS A 1 59  ? 4.450   94.263  74.583  1.00 20.00 ? 59   LYS A C   1 
ATOM   466   O O   . LYS A 1 59  ? 5.092   94.483  75.608  1.00 20.00 ? 59   LYS A O   1 
ATOM   467   C CB  . LYS A 1 59  ? 4.382   96.055  72.852  1.00 20.00 ? 59   LYS A CB  1 
ATOM   468   C CG  . LYS A 1 59  ? 4.777   96.512  71.469  1.00 20.00 ? 59   LYS A CG  1 
ATOM   469   C CD  . LYS A 1 59  ? 6.162   97.119  71.482  1.00 20.00 ? 59   LYS A CD  1 
ATOM   470   C CE  . LYS A 1 59  ? 6.481   97.774  70.147  1.00 20.00 ? 59   LYS A CE  1 
ATOM   471   N NZ  . LYS A 1 59  ? 7.006   96.795  69.142  1.00 20.00 ? 59   LYS A NZ  1 
ATOM   472   N N   . GLN A 1 60  ? 3.274   93.646  74.598  1.00 20.00 ? 60   GLN A N   1 
ATOM   473   C CA  . GLN A 1 60  ? 2.689   93.177  75.849  1.00 20.00 ? 60   GLN A CA  1 
ATOM   474   C C   . GLN A 1 60  ? 3.507   91.994  76.348  1.00 20.00 ? 60   GLN A C   1 
ATOM   475   O O   . GLN A 1 60  ? 3.763   91.866  77.546  1.00 20.00 ? 60   GLN A O   1 
ATOM   476   C CB  . GLN A 1 60  ? 1.236   92.746  75.632  1.00 20.00 ? 60   GLN A CB  1 
ATOM   477   C CG  . GLN A 1 60  ? 0.261   93.902  75.501  1.00 20.00 ? 60   GLN A CG  1 
ATOM   478   C CD  . GLN A 1 60  ? -1.141  93.433  75.217  1.00 20.00 ? 60   GLN A CD  1 
ATOM   479   O OE1 . GLN A 1 60  ? -1.430  92.961  74.123  1.00 20.00 ? 60   GLN A OE1 1 
ATOM   480   N NE2 . GLN A 1 60  ? -2.027  93.556  76.203  1.00 20.00 ? 60   GLN A NE2 1 
ATOM   481   N N   . TRP A 1 61  ? 3.918   91.127  75.424  1.00 20.00 ? 61   TRP A N   1 
ATOM   482   C CA  . TRP A 1 61  ? 4.709   89.957  75.793  1.00 20.00 ? 61   TRP A CA  1 
ATOM   483   C C   . TRP A 1 61  ? 6.077   90.377  76.277  1.00 20.00 ? 61   TRP A C   1 
ATOM   484   O O   . TRP A 1 61  ? 6.706   89.659  77.041  1.00 20.00 ? 61   TRP A O   1 
ATOM   485   C CB  . TRP A 1 61  ? 4.829   88.973  74.624  1.00 20.00 ? 61   TRP A CB  1 
ATOM   486   C CG  . TRP A 1 61  ? 3.720   87.950  74.643  1.00 20.00 ? 61   TRP A CG  1 
ATOM   487   C CD1 . TRP A 1 61  ? 2.624   87.904  73.821  1.00 20.00 ? 61   TRP A CD1 1 
ATOM   488   C CD2 . TRP A 1 61  ? 3.557   86.881  75.582  1.00 20.00 ? 61   TRP A CD2 1 
ATOM   489   N NE1 . TRP A 1 61  ? 1.791   86.878  74.195  1.00 20.00 ? 61   TRP A NE1 1 
ATOM   490   C CE2 . TRP A 1 61  ? 2.338   86.234  75.273  1.00 20.00 ? 61   TRP A CE2 1 
ATOM   491   C CE3 . TRP A 1 61  ? 4.321   86.407  76.658  1.00 20.00 ? 61   TRP A CE3 1 
ATOM   492   C CZ2 . TRP A 1 61  ? 1.870   85.142  76.001  1.00 20.00 ? 61   TRP A CZ2 1 
ATOM   493   C CZ3 . TRP A 1 61  ? 3.853   85.323  77.379  1.00 20.00 ? 61   TRP A CZ3 1 
ATOM   494   C CH2 . TRP A 1 61  ? 2.641   84.701  77.049  1.00 20.00 ? 61   TRP A CH2 1 
ATOM   495   N N   . ALA A 1 62  ? 6.549   91.533  75.828  1.00 20.00 ? 62   ALA A N   1 
ATOM   496   C CA  . ALA A 1 62  ? 7.855   92.016  76.261  1.00 20.00 ? 62   ALA A CA  1 
ATOM   497   C C   . ALA A 1 62  ? 7.641   92.462  77.700  1.00 20.00 ? 62   ALA A C   1 
ATOM   498   O O   . ALA A 1 62  ? 8.503   92.287  78.550  1.00 20.00 ? 62   ALA A O   1 
ATOM   499   C CB  . ALA A 1 62  ? 8.315   93.198  75.405  1.00 20.00 ? 62   ALA A CB  1 
ATOM   500   N N   . GLY A 1 63  ? 6.470   93.033  77.963  1.00 20.00 ? 63   GLY A N   1 
ATOM   501   C CA  . GLY A 1 63  ? 6.147   93.495  79.300  1.00 20.00 ? 63   GLY A CA  1 
ATOM   502   C C   . GLY A 1 63  ? 5.995   92.332  80.263  1.00 20.00 ? 63   GLY A C   1 
ATOM   503   O O   . GLY A 1 63  ? 6.253   92.468  81.453  1.00 20.00 ? 63   GLY A O   1 
ATOM   504   N N   . MET A 1 64  ? 5.586   91.182  79.740  1.00 20.00 ? 64   MET A N   1 
ATOM   505   C CA  . MET A 1 64  ? 5.394   89.983  80.544  1.00 20.00 ? 64   MET A CA  1 
ATOM   506   C C   . MET A 1 64  ? 6.710   89.400  81.044  1.00 20.00 ? 64   MET A C   1 
ATOM   507   O O   . MET A 1 64  ? 6.723   88.581  81.964  1.00 20.00 ? 64   MET A O   1 
ATOM   508   C CB  . MET A 1 64  ? 4.672   88.914  79.730  1.00 20.00 ? 64   MET A CB  1 
ATOM   509   C CG  . MET A 1 64  ? 3.233   89.251  79.402  1.00 20.00 ? 64   MET A CG  1 
ATOM   510   S SD  . MET A 1 64  ? 2.130   88.692  80.685  1.00 20.00 ? 64   MET A SD  1 
ATOM   511   C CE  . MET A 1 64  ? 2.205   86.915  80.448  1.00 20.00 ? 64   MET A CE  1 
ATOM   512   N N   . MET A 1 65  ? 7.813   89.819  80.427  1.00 20.00 ? 65   MET A N   1 
ATOM   513   C CA  . MET A 1 65  ? 9.131   89.334  80.809  1.00 20.00 ? 65   MET A CA  1 
ATOM   514   C C   . MET A 1 65  ? 9.782   90.197  81.874  1.00 20.00 ? 65   MET A C   1 
ATOM   515   O O   . MET A 1 65  ? 10.721  89.766  82.534  1.00 20.00 ? 65   MET A O   1 
ATOM   516   C CB  . MET A 1 65  ? 10.039  89.255  79.577  1.00 20.00 ? 65   MET A CB  1 
ATOM   517   C CG  . MET A 1 65  ? 9.531   88.316  78.489  1.00 20.00 ? 65   MET A CG  1 
ATOM   518   S SD  . MET A 1 65  ? 9.549   86.610  79.057  1.00 20.00 ? 65   MET A SD  1 
ATOM   519   C CE  . MET A 1 65  ? 7.940   86.067  78.549  1.00 20.00 ? 65   MET A CE  1 
ATOM   520   N N   . ILE A 1 66  ? 9.296   91.422  82.041  1.00 20.00 ? 66   ILE A N   1 
ATOM   521   C CA  . ILE A 1 66  ? 9.873   92.295  83.043  1.00 20.00 ? 66   ILE A CA  1 
ATOM   522   C C   . ILE A 1 66  ? 8.927   92.519  84.215  1.00 20.00 ? 66   ILE A C   1 
ATOM   523   O O   . ILE A 1 66  ? 8.773   93.633  84.701  1.00 20.00 ? 66   ILE A O   1 
ATOM   524   C CB  . ILE A 1 66  ? 10.288  93.659  82.436  1.00 20.00 ? 66   ILE A CB  1 
ATOM   525   C CG1 . ILE A 1 66  ? 9.143   94.246  81.614  1.00 20.00 ? 66   ILE A CG1 1 
ATOM   526   C CG2 . ILE A 1 66  ? 11.537  93.477  81.572  1.00 20.00 ? 66   ILE A CG2 1 
ATOM   527   C CD1 . ILE A 1 66  ? 9.084   95.751  81.667  1.00 20.00 ? 66   ILE A CD1 1 
ATOM   528   N N   . GLY A 1 67  ? 8.298   91.448  84.675  1.00 20.00 ? 67   GLY A N   1 
ATOM   529   C CA  . GLY A 1 67  ? 7.383   91.575  85.789  1.00 20.00 ? 67   GLY A CA  1 
ATOM   530   C C   . GLY A 1 67  ? 8.108   91.766  87.107  1.00 20.00 ? 67   GLY A C   1 
ATOM   531   O O   . GLY A 1 67  ? 8.983   90.981  87.467  1.00 20.00 ? 67   GLY A O   1 
ATOM   532   N N   . ASP A 1 68  ? 7.768   92.839  87.809  1.00 20.00 ? 68   ASP A N   1 
ATOM   533   C CA  . ASP A 1 68  ? 8.367   93.152  89.102  1.00 20.00 ? 68   ASP A CA  1 
ATOM   534   C C   . ASP A 1 68  ? 7.347   92.569  90.080  1.00 20.00 ? 68   ASP A C   1 
ATOM   535   O O   . ASP A 1 68  ? 6.337   93.209  90.402  1.00 20.00 ? 68   ASP A O   1 
ATOM   536   C CB  . ASP A 1 68  ? 8.474   94.665  89.275  1.00 20.00 ? 68   ASP A CB  1 
ATOM   537   C CG  . ASP A 1 68  ? 8.991   95.061  90.644  1.00 20.00 ? 68   ASP A CG  1 
ATOM   538   O OD1 . ASP A 1 68  ? 9.223   94.170  91.492  1.00 20.00 ? 68   ASP A OD1 1 
ATOM   539   O OD2 . ASP A 1 68  ? 9.163   96.275  90.867  1.00 20.00 ? 68   ASP A OD2 1 
ATOM   540   N N   . GLU A 1 69  ? 7.614   91.346  90.524  1.00 20.00 ? 69   GLU A N   1 
ATOM   541   C CA  . GLU A 1 69  ? 6.744   90.638  91.441  1.00 20.00 ? 69   GLU A CA  1 
ATOM   542   C C   . GLU A 1 69  ? 6.757   91.034  92.916  1.00 20.00 ? 69   GLU A C   1 
ATOM   543   O O   . GLU A 1 69  ? 6.271   90.275  93.764  1.00 20.00 ? 69   GLU A O   1 
ATOM   544   C CB  . GLU A 1 69  ? 7.014   89.142  91.301  1.00 20.00 ? 69   GLU A CB  1 
ATOM   545   C CG  . GLU A 1 69  ? 6.914   88.661  89.869  1.00 20.00 ? 69   GLU A CG  1 
ATOM   546   C CD  . GLU A 1 69  ? 5.535   88.912  89.273  1.00 20.00 ? 69   GLU A CD  1 
ATOM   547   O OE1 . GLU A 1 69  ? 4.556   88.976  90.043  1.00 20.00 ? 69   GLU A OE1 1 
ATOM   548   O OE2 . GLU A 1 69  ? 5.426   89.044  88.037  1.00 20.00 ? 69   GLU A OE2 1 
ATOM   549   N N   . ALA A 1 70  ? 7.290   92.213  93.225  1.00 20.00 ? 70   ALA A N   1 
ATOM   550   C CA  . ALA A 1 70  ? 7.350   92.689  94.605  1.00 20.00 ? 70   ALA A CA  1 
ATOM   551   C C   . ALA A 1 70  ? 5.937   92.809  95.148  1.00 20.00 ? 70   ALA A C   1 
ATOM   552   O O   . ALA A 1 70  ? 5.018   93.148  94.411  1.00 20.00 ? 70   ALA A O   1 
ATOM   553   C CB  . ALA A 1 70  ? 8.035   94.027  94.660  1.00 20.00 ? 70   ALA A CB  1 
ATOM   554   N N   . TYR A 1 71  ? 5.776   92.529  96.439  1.00 20.00 ? 71   TYR A N   1 
ATOM   555   C CA  . TYR A 1 71  ? 4.484   92.592  97.114  1.00 20.00 ? 71   TYR A CA  1 
ATOM   556   C C   . TYR A 1 71  ? 3.942   94.007  97.164  1.00 20.00 ? 71   TYR A C   1 
ATOM   557   O O   . TYR A 1 71  ? 2.736   94.225  97.151  1.00 20.00 ? 71   TYR A O   1 
ATOM   558   C CB  . TYR A 1 71  ? 4.617   92.055  98.539  1.00 20.00 ? 71   TYR A CB  1 
ATOM   559   C CG  . TYR A 1 71  ? 3.377   91.377  99.045  1.00 20.00 ? 71   TYR A CG  1 
ATOM   560   C CD1 . TYR A 1 71  ? 2.842   90.277  98.374  1.00 20.00 ? 71   TYR A CD1 1 
ATOM   561   C CD2 . TYR A 1 71  ? 2.732   91.831  100.188 1.00 20.00 ? 71   TYR A CD2 1 
ATOM   562   C CE1 . TYR A 1 71  ? 1.686   89.640  98.828  1.00 20.00 ? 71   TYR A CE1 1 
ATOM   563   C CE2 . TYR A 1 71  ? 1.575   91.206  100.656 1.00 20.00 ? 71   TYR A CE2 1 
ATOM   564   C CZ  . TYR A 1 71  ? 1.054   90.106  99.968  1.00 20.00 ? 71   TYR A CZ  1 
ATOM   565   O OH  . TYR A 1 71  ? -0.096  89.476  100.407 1.00 20.00 ? 71   TYR A OH  1 
ATOM   566   N N   . ALA A 1 72  ? 4.848   94.972  97.232  1.00 20.00 ? 72   ALA A N   1 
ATOM   567   C CA  . ALA A 1 72  ? 4.463   96.368  97.286  1.00 20.00 ? 72   ALA A CA  1 
ATOM   568   C C   . ALA A 1 72  ? 5.509   97.214  96.566  1.00 20.00 ? 72   ALA A C   1 
ATOM   569   O O   . ALA A 1 72  ? 6.682   96.865  96.533  1.00 20.00 ? 72   ALA A O   1 
ATOM   570   C CB  . ALA A 1 72  ? 4.337   96.811  98.733  1.00 20.00 ? 72   ALA A CB  1 
ATOM   571   N N   . GLY A 1 73  ? 5.071   98.323  95.984  1.00 20.00 ? 73   GLY A N   1 
ATOM   572   C CA  . GLY A 1 73  ? 5.983   99.199  95.278  1.00 20.00 ? 73   GLY A CA  1 
ATOM   573   C C   . GLY A 1 73  ? 6.449   98.688  93.929  1.00 20.00 ? 73   GLY A C   1 
ATOM   574   O O   . GLY A 1 73  ? 7.456   99.157  93.398  1.00 20.00 ? 73   GLY A O   1 
ATOM   575   N N   . SER A 1 74  ? 5.728   97.725  93.368  1.00 20.00 ? 74   SER A N   1 
ATOM   576   C CA  . SER A 1 74  ? 6.096   97.171  92.068  1.00 20.00 ? 74   SER A CA  1 
ATOM   577   C C   . SER A 1 74  ? 6.062   98.250  90.978  1.00 20.00 ? 74   SER A C   1 
ATOM   578   O O   . SER A 1 74  ? 5.210   99.139  90.998  1.00 20.00 ? 74   SER A O   1 
ATOM   579   C CB  . SER A 1 74  ? 5.143   96.046  91.687  1.00 20.00 ? 74   SER A CB  1 
ATOM   580   O OG  . SER A 1 74  ? 5.371   95.668  90.344  1.00 20.00 ? 74   SER A OG  1 
ATOM   581   N N   . GLU A 1 75  ? 6.995   98.177  90.032  1.00 20.00 ? 75   GLU A N   1 
ATOM   582   C CA  . GLU A 1 75  ? 7.041   99.157  88.951  1.00 20.00 ? 75   GLU A CA  1 
ATOM   583   C C   . GLU A 1 75  ? 5.852   98.962  88.029  1.00 20.00 ? 75   GLU A C   1 
ATOM   584   O O   . GLU A 1 75  ? 5.364   99.912  87.434  1.00 20.00 ? 75   GLU A O   1 
ATOM   585   C CB  . GLU A 1 75  ? 8.327   99.011  88.134  1.00 20.00 ? 75   GLU A CB  1 
ATOM   586   C CG  . GLU A 1 75  ? 9.544   99.663  88.764  1.00 20.00 ? 75   GLU A CG  1 
ATOM   587   C CD  . GLU A 1 75  ? 9.503   101.176 88.693  1.00 20.00 ? 75   GLU A CD  1 
ATOM   588   O OE1 . GLU A 1 75  ? 9.772   101.722 87.604  1.00 20.00 ? 75   GLU A OE1 1 
ATOM   589   O OE2 . GLU A 1 75  ? 9.202   101.824 89.723  1.00 20.00 ? 75   GLU A OE2 1 
ATOM   590   N N   . ASN A 1 76  ? 5.390   97.721  87.915  1.00 20.00 ? 76   ASN A N   1 
ATOM   591   C CA  . ASN A 1 76  ? 4.255   97.412  87.059  1.00 20.00 ? 76   ASN A CA  1 
ATOM   592   C C   . ASN A 1 76  ? 2.983   98.081  87.558  1.00 20.00 ? 76   ASN A C   1 
ATOM   593   O O   . ASN A 1 76  ? 2.145   98.476  86.758  1.00 20.00 ? 76   ASN A O   1 
ATOM   594   C CB  . ASN A 1 76  ? 4.028   95.904  86.990  1.00 20.00 ? 76   ASN A CB  1 
ATOM   595   C CG  . ASN A 1 76  ? 5.262   95.146  86.548  1.00 20.00 ? 76   ASN A CG  1 
ATOM   596   O OD1 . ASN A 1 76  ? 5.631   94.151  87.164  1.00 20.00 ? 76   ASN A OD1 1 
ATOM   597   N ND2 . ASN A 1 76  ? 5.901   95.606  85.472  1.00 20.00 ? 76   ASN A ND2 1 
ATOM   598   N N   . PHE A 1 77  ? 2.831   98.195  88.874  1.00 20.00 ? 77   PHE A N   1 
ATOM   599   C CA  . PHE A 1 77  ? 1.638   98.829  89.432  1.00 20.00 ? 77   PHE A CA  1 
ATOM   600   C C   . PHE A 1 77  ? 1.640   100.329 89.135  1.00 20.00 ? 77   PHE A C   1 
ATOM   601   O O   . PHE A 1 77  ? 0.608   100.920 88.802  1.00 20.00 ? 77   PHE A O   1 
ATOM   602   C CB  . PHE A 1 77  ? 1.555   98.623  90.954  1.00 20.00 ? 77   PHE A CB  1 
ATOM   603   C CG  . PHE A 1 77  ? 0.501   99.478  91.619  1.00 20.00 ? 77   PHE A CG  1 
ATOM   604   C CD1 . PHE A 1 77  ? -0.849  99.176  91.473  1.00 20.00 ? 77   PHE A CD1 1 
ATOM   605   C CD2 . PHE A 1 77  ? 0.860   100.603 92.351  1.00 20.00 ? 77   PHE A CD2 1 
ATOM   606   C CE1 . PHE A 1 77  ? -1.825  99.987  92.046  1.00 20.00 ? 77   PHE A CE1 1 
ATOM   607   C CE2 . PHE A 1 77  ? -0.108  101.420 92.926  1.00 20.00 ? 77   PHE A CE2 1 
ATOM   608   C CZ  . PHE A 1 77  ? -1.453  101.115 92.774  1.00 20.00 ? 77   PHE A CZ  1 
ATOM   609   N N   . TYR A 1 78  ? 2.806   100.943 89.270  1.00 20.00 ? 78   TYR A N   1 
ATOM   610   C CA  . TYR A 1 78  ? 2.928   102.363 89.015  1.00 20.00 ? 78   TYR A CA  1 
ATOM   611   C C   . TYR A 1 78  ? 2.553   102.600 87.567  1.00 20.00 ? 78   TYR A C   1 
ATOM   612   O O   . TYR A 1 78  ? 1.863   103.564 87.252  1.00 20.00 ? 78   TYR A O   1 
ATOM   613   C CB  . TYR A 1 78  ? 4.362   102.831 89.274  1.00 20.00 ? 78   TYR A CB  1 
ATOM   614   C CG  . TYR A 1 78  ? 4.790   102.739 90.726  1.00 20.00 ? 78   TYR A CG  1 
ATOM   615   C CD1 . TYR A 1 78  ? 3.890   103.000 91.764  1.00 20.00 ? 78   TYR A CD1 1 
ATOM   616   C CD2 . TYR A 1 78  ? 6.096   102.389 91.062  1.00 20.00 ? 78   TYR A CD2 1 
ATOM   617   C CE1 . TYR A 1 78  ? 4.282   102.912 93.099  1.00 20.00 ? 78   TYR A CE1 1 
ATOM   618   C CE2 . TYR A 1 78  ? 6.500   102.298 92.393  1.00 20.00 ? 78   TYR A CE2 1 
ATOM   619   C CZ  . TYR A 1 78  ? 5.591   102.559 93.403  1.00 20.00 ? 78   TYR A CZ  1 
ATOM   620   O OH  . TYR A 1 78  ? 5.999   102.458 94.711  1.00 20.00 ? 78   TYR A OH  1 
ATOM   621   N N   . HIS A 1 79  ? 3.015   101.716 86.691  1.00 20.00 ? 79   HIS A N   1 
ATOM   622   C CA  . HIS A 1 79  ? 2.726   101.820 85.262  1.00 20.00 ? 79   HIS A CA  1 
ATOM   623   C C   . HIS A 1 79  ? 1.225   101.749 85.018  1.00 20.00 ? 79   HIS A C   1 
ATOM   624   O O   . HIS A 1 79  ? 0.684   102.532 84.247  1.00 20.00 ? 79   HIS A O   1 
ATOM   625   C CB  . HIS A 1 79  ? 3.394   100.687 84.482  1.00 20.00 ? 79   HIS A CB  1 
ATOM   626   C CG  . HIS A 1 79  ? 4.886   100.808 84.374  1.00 20.00 ? 79   HIS A CG  1 
ATOM   627   N ND1 . HIS A 1 79  ? 5.686   99.767  83.952  1.00 20.00 ? 79   HIS A ND1 1 
ATOM   628   C CD2 . HIS A 1 79  ? 5.725   101.835 84.652  1.00 20.00 ? 79   HIS A CD2 1 
ATOM   629   C CE1 . HIS A 1 79  ? 6.951   100.146 83.977  1.00 20.00 ? 79   HIS A CE1 1 
ATOM   630   N NE2 . HIS A 1 79  ? 7.003   101.395 84.398  1.00 20.00 ? 79   HIS A NE2 1 
ATOM   631   N N   . LEU A 1 80  ? 0.552   100.808 85.676  1.00 20.00 ? 80   LEU A N   1 
ATOM   632   C CA  . LEU A 1 80  ? -0.893  100.665 85.502  1.00 20.00 ? 80   LEU A CA  1 
ATOM   633   C C   . LEU A 1 80  ? -1.638  101.849 86.102  1.00 20.00 ? 80   LEU A C   1 
ATOM   634   O O   . LEU A 1 80  ? -2.579  102.376 85.511  1.00 20.00 ? 80   LEU A O   1 
ATOM   635   C CB  . LEU A 1 80  ? -1.394  99.361  86.146  1.00 20.00 ? 80   LEU A CB  1 
ATOM   636   C CG  . LEU A 1 80  ? -2.916  99.120  86.170  1.00 20.00 ? 80   LEU A CG  1 
ATOM   637   C CD1 . LEU A 1 80  ? -3.445  98.938  84.748  1.00 20.00 ? 80   LEU A CD1 1 
ATOM   638   C CD2 . LEU A 1 80  ? -3.232  97.899  87.023  1.00 20.00 ? 80   LEU A CD2 1 
ATOM   639   N N   . GLU A 1 81  ? -1.215  102.269 87.282  1.00 20.00 ? 81   GLU A N   1 
ATOM   640   C CA  . GLU A 1 81  ? -1.855  103.387 87.948  1.00 20.00 ? 81   GLU A CA  1 
ATOM   641   C C   . GLU A 1 81  ? -1.769  104.669 87.123  1.00 20.00 ? 81   GLU A C   1 
ATOM   642   O O   . GLU A 1 81  ? -2.752  105.405 86.978  1.00 20.00 ? 81   GLU A O   1 
ATOM   643   C CB  . GLU A 1 81  ? -1.205  103.596 89.313  1.00 20.00 ? 81   GLU A CB  1 
ATOM   644   C CG  . GLU A 1 81  ? -1.671  104.829 90.036  1.00 20.00 ? 81   GLU A CG  1 
ATOM   645   C CD  . GLU A 1 81  ? -1.034  104.960 91.402  1.00 20.00 ? 81   GLU A CD  1 
ATOM   646   O OE1 . GLU A 1 81  ? 0.212   105.021 91.470  1.00 20.00 ? 81   GLU A OE1 1 
ATOM   647   O OE2 . GLU A 1 81  ? -1.778  105.000 92.405  1.00 20.00 ? 81   GLU A OE2 1 
ATOM   648   N N   . LYS A 1 82  ? -0.584  104.927 86.582  1.00 20.00 ? 82   LYS A N   1 
ATOM   649   C CA  . LYS A 1 82  ? -0.343  106.113 85.771  1.00 20.00 ? 82   LYS A CA  1 
ATOM   650   C C   . LYS A 1 82  ? -1.153  106.102 84.485  1.00 20.00 ? 82   LYS A C   1 
ATOM   651   O O   . LYS A 1 82  ? -1.727  107.109 84.103  1.00 20.00 ? 82   LYS A O   1 
ATOM   652   C CB  . LYS A 1 82  ? 1.140   106.214 85.434  1.00 20.00 ? 82   LYS A CB  1 
ATOM   653   C CG  . LYS A 1 82  ? 1.535   107.552 84.876  1.00 20.00 ? 82   LYS A CG  1 
ATOM   654   C CD  . LYS A 1 82  ? 2.923   107.515 84.275  1.00 20.00 ? 82   LYS A CD  1 
ATOM   655   C CE  . LYS A 1 82  ? 3.112   108.676 83.308  1.00 20.00 ? 82   LYS A CE  1 
ATOM   656   N NZ  . LYS A 1 82  ? 1.868   108.963 82.517  1.00 20.00 ? 82   LYS A NZ  1 
ATOM   657   N N   . THR A 1 83  ? -1.194  104.955 83.819  1.00 20.00 ? 83   THR A N   1 
ATOM   658   C CA  . THR A 1 83  ? -1.939  104.815 82.567  1.00 20.00 ? 83   THR A CA  1 
ATOM   659   C C   . THR A 1 83  ? -3.445  105.030 82.768  1.00 20.00 ? 83   THR A C   1 
ATOM   660   O O   . THR A 1 83  ? -4.059  105.807 82.049  1.00 20.00 ? 83   THR A O   1 
ATOM   661   C CB  . THR A 1 83  ? -1.704  103.412 81.935  1.00 20.00 ? 83   THR A CB  1 
ATOM   662   O OG1 . THR A 1 83  ? -0.315  103.255 81.619  1.00 20.00 ? 83   THR A OG1 1 
ATOM   663   C CG2 . THR A 1 83  ? -2.536  103.233 80.666  1.00 20.00 ? 83   THR A CG2 1 
ATOM   664   N N   . VAL A 1 84  ? -4.032  104.344 83.744  1.00 20.00 ? 84   VAL A N   1 
ATOM   665   C CA  . VAL A 1 84  ? -5.462  104.477 84.012  1.00 20.00 ? 84   VAL A CA  1 
ATOM   666   C C   . VAL A 1 84  ? -5.803  105.908 84.440  1.00 20.00 ? 84   VAL A C   1 
ATOM   667   O O   . VAL A 1 84  ? -6.805  106.469 84.006  1.00 20.00 ? 84   VAL A O   1 
ATOM   668   C CB  . VAL A 1 84  ? -5.936  103.452 85.091  1.00 20.00 ? 84   VAL A CB  1 
ATOM   669   C CG1 . VAL A 1 84  ? -7.346  103.786 85.564  1.00 20.00 ? 84   VAL A CG1 1 
ATOM   670   C CG2 . VAL A 1 84  ? -5.931  102.047 84.510  1.00 20.00 ? 84   VAL A CG2 1 
ATOM   671   N N   . LYS A 1 85  ? -4.962  106.501 85.280  1.00 20.00 ? 85   LYS A N   1 
ATOM   672   C CA  . LYS A 1 85  ? -5.200  107.860 85.736  1.00 20.00 ? 85   LYS A CA  1 
ATOM   673   C C   . LYS A 1 85  ? -5.148  108.798 84.533  1.00 20.00 ? 85   LYS A C   1 
ATOM   674   O O   . LYS A 1 85  ? -5.915  109.746 84.439  1.00 20.00 ? 85   LYS A O   1 
ATOM   675   C CB  . LYS A 1 85  ? -4.138  108.276 86.747  1.00 20.00 ? 85   LYS A CB  1 
ATOM   676   C CG  . LYS A 1 85  ? -4.469  107.934 88.181  1.00 20.00 ? 85   LYS A CG  1 
ATOM   677   C CD  . LYS A 1 85  ? -3.919  109.001 89.113  1.00 20.00 ? 85   LYS A CD  1 
ATOM   678   C CE  . LYS A 1 85  ? -3.087  108.393 90.224  1.00 20.00 ? 85   LYS A CE  1 
ATOM   679   N NZ  . LYS A 1 85  ? -3.855  107.386 91.006  1.00 20.00 ? 85   LYS A NZ  1 
ATOM   680   N N   . GLU A 1 86  ? -4.241  108.518 83.606  1.00 20.00 ? 86   GLU A N   1 
ATOM   681   C CA  . GLU A 1 86  ? -4.102  109.343 82.417  1.00 20.00 ? 86   GLU A CA  1 
ATOM   682   C C   . GLU A 1 86  ? -5.268  109.174 81.444  1.00 20.00 ? 86   GLU A C   1 
ATOM   683   O O   . GLU A 1 86  ? -5.872  110.153 81.021  1.00 20.00 ? 86   GLU A O   1 
ATOM   684   C CB  . GLU A 1 86  ? -2.783  109.014 81.703  1.00 20.00 ? 86   GLU A CB  1 
ATOM   685   C CG  . GLU A 1 86  ? -2.572  109.757 80.384  1.00 20.00 ? 86   GLU A CG  1 
ATOM   686   C CD  . GLU A 1 86  ? -1.294  109.341 79.651  1.00 20.00 ? 86   GLU A CD  1 
ATOM   687   O OE1 . GLU A 1 86  ? -0.428  108.683 80.268  1.00 20.00 ? 86   GLU A OE1 1 
ATOM   688   O OE2 . GLU A 1 86  ? -1.156  109.675 78.453  1.00 20.00 ? 86   GLU A OE2 1 
ATOM   689   N N   . LEU A 1 87  ? -5.598  107.934 81.102  1.00 20.00 ? 87   LEU A N   1 
ATOM   690   C CA  . LEU A 1 87  ? -6.692  107.678 80.168  1.00 20.00 ? 87   LEU A CA  1 
ATOM   691   C C   . LEU A 1 87  ? -8.137  107.750 80.689  1.00 20.00 ? 87   LEU A C   1 
ATOM   692   O O   . LEU A 1 87  ? -9.023  108.250 79.984  1.00 20.00 ? 87   LEU A O   1 
ATOM   693   C CB  . LEU A 1 87  ? -6.468  106.327 79.487  1.00 20.00 ? 87   LEU A CB  1 
ATOM   694   C CG  . LEU A 1 87  ? -5.142  106.147 78.744  1.00 20.00 ? 87   LEU A CG  1 
ATOM   695   C CD1 . LEU A 1 87  ? -5.078  104.752 78.159  1.00 20.00 ? 87   LEU A CD1 1 
ATOM   696   C CD2 . LEU A 1 87  ? -5.013  107.172 77.655  1.00 20.00 ? 87   LEU A CD2 1 
ATOM   697   N N   . PHE A 1 88  ? -8.395  107.242 81.894  1.00 20.00 ? 88   PHE A N   1 
ATOM   698   C CA  . PHE A 1 88  ? -9.753  107.279 82.440  1.00 20.00 ? 88   PHE A CA  1 
ATOM   699   C C   . PHE A 1 88  ? -10.013 108.551 83.236  1.00 20.00 ? 88   PHE A C   1 
ATOM   700   O O   . PHE A 1 88  ? -11.158 108.973 83.400  1.00 20.00 ? 88   PHE A O   1 
ATOM   701   C CB  . PHE A 1 88  ? -10.018 106.041 83.304  1.00 20.00 ? 88   PHE A CB  1 
ATOM   702   C CG  . PHE A 1 88  ? -10.294 104.779 82.505  1.00 20.00 ? 88   PHE A CG  1 
ATOM   703   C CD1 . PHE A 1 88  ? -9.959  104.694 81.155  1.00 20.00 ? 88   PHE A CD1 1 
ATOM   704   C CD2 . PHE A 1 88  ? -10.885 103.673 83.111  1.00 20.00 ? 88   PHE A CD2 1 
ATOM   705   C CE1 . PHE A 1 88  ? -10.204 103.527 80.424  1.00 20.00 ? 88   PHE A CE1 1 
ATOM   706   C CE2 . PHE A 1 88  ? -11.134 102.502 82.389  1.00 20.00 ? 88   PHE A CE2 1 
ATOM   707   C CZ  . PHE A 1 88  ? -10.790 102.432 81.043  1.00 20.00 ? 88   PHE A CZ  1 
ATOM   708   N N   . GLY A 1 89  ? -8.945  109.164 83.725  1.00 20.00 ? 89   GLY A N   1 
ATOM   709   C CA  . GLY A 1 89  ? -9.081  110.388 84.488  1.00 20.00 ? 89   GLY A CA  1 
ATOM   710   C C   . GLY A 1 89  ? -9.544  110.266 85.926  1.00 20.00 ? 89   GLY A C   1 
ATOM   711   O O   . GLY A 1 89  ? -9.884  111.275 86.543  1.00 20.00 ? 89   GLY A O   1 
ATOM   712   N N   . PHE A 1 90  ? -9.563  109.054 86.472  1.00 20.00 ? 90   PHE A N   1 
ATOM   713   C CA  . PHE A 1 90  ? -9.998  108.869 87.853  1.00 20.00 ? 90   PHE A CA  1 
ATOM   714   C C   . PHE A 1 90  ? -8.840  109.123 88.817  1.00 20.00 ? 90   PHE A C   1 
ATOM   715   O O   . PHE A 1 90  ? -7.675  108.958 88.450  1.00 20.00 ? 90   PHE A O   1 
ATOM   716   C CB  . PHE A 1 90  ? -10.557 107.463 88.036  1.00 20.00 ? 90   PHE A CB  1 
ATOM   717   C CG  . PHE A 1 90  ? -11.920 107.280 87.430  1.00 20.00 ? 90   PHE A CG  1 
ATOM   718   C CD1 . PHE A 1 90  ? -13.006 108.024 87.891  1.00 20.00 ? 90   PHE A CD1 1 
ATOM   719   C CD2 . PHE A 1 90  ? -12.120 106.373 86.397  1.00 20.00 ? 90   PHE A CD2 1 
ATOM   720   C CE1 . PHE A 1 90  ? -14.276 107.864 87.328  1.00 20.00 ? 90   PHE A CE1 1 
ATOM   721   C CE2 . PHE A 1 90  ? -13.383 106.206 85.830  1.00 20.00 ? 90   PHE A CE2 1 
ATOM   722   C CZ  . PHE A 1 90  ? -14.462 106.952 86.296  1.00 20.00 ? 90   PHE A CZ  1 
ATOM   723   N N   . LYS A 1 91  ? -9.168  109.526 90.043  1.00 20.00 ? 91   LYS A N   1 
ATOM   724   C CA  . LYS A 1 91  ? -8.166  109.816 91.072  1.00 20.00 ? 91   LYS A CA  1 
ATOM   725   C C   . LYS A 1 91  ? -7.463  108.603 91.665  1.00 20.00 ? 91   LYS A C   1 
ATOM   726   O O   . LYS A 1 91  ? -6.245  108.607 91.829  1.00 20.00 ? 91   LYS A O   1 
ATOM   727   C CB  . LYS A 1 91  ? -8.800  110.621 92.208  1.00 20.00 ? 91   LYS A CB  1 
ATOM   728   C CG  . LYS A 1 91  ? -9.571  111.852 91.745  1.00 20.00 ? 91   LYS A CG  1 
ATOM   729   C CD  . LYS A 1 91  ? -8.918  113.135 92.232  1.00 20.00 ? 91   LYS A CD  1 
ATOM   730   C CE  . LYS A 1 91  ? -9.171  113.346 93.720  1.00 20.00 ? 91   LYS A CE  1 
ATOM   731   N NZ  . LYS A 1 91  ? -8.097  112.727 94.557  1.00 20.00 ? 91   LYS A NZ  1 
ATOM   732   N N   . HIS A 1 92  ? -8.226  107.569 92.001  1.00 20.00 ? 92   HIS A N   1 
ATOM   733   C CA  . HIS A 1 92  ? -7.637  106.373 92.580  1.00 20.00 ? 92   HIS A CA  1 
ATOM   734   C C   . HIS A 1 92  ? -8.005  105.122 91.823  1.00 20.00 ? 92   HIS A C   1 
ATOM   735   O O   . HIS A 1 92  ? -9.047  105.059 91.170  1.00 20.00 ? 92   HIS A O   1 
ATOM   736   C CB  . HIS A 1 92  ? -8.071  106.219 94.034  1.00 20.00 ? 92   HIS A CB  1 
ATOM   737   C CG  . HIS A 1 92  ? -7.995  107.487 94.818  1.00 20.00 ? 92   HIS A CG  1 
ATOM   738   N ND1 . HIS A 1 92  ? -6.808  107.985 95.308  1.00 20.00 ? 92   HIS A ND1 1 
ATOM   739   C CD2 . HIS A 1 92  ? -8.955  108.367 95.182  1.00 20.00 ? 92   HIS A CD2 1 
ATOM   740   C CE1 . HIS A 1 92  ? -7.041  109.121 95.941  1.00 20.00 ? 92   HIS A CE1 1 
ATOM   741   N NE2 . HIS A 1 92  ? -8.336  109.375 95.879  1.00 20.00 ? 92   HIS A NE2 1 
ATOM   742   N N   . ILE A 1 93  ? -7.146  104.118 91.944  1.00 20.00 ? 93   ILE A N   1 
ATOM   743   C CA  . ILE A 1 93  ? -7.335  102.841 91.281  1.00 20.00 ? 93   ILE A CA  1 
ATOM   744   C C   . ILE A 1 93  ? -6.923  101.692 92.192  1.00 20.00 ? 93   ILE A C   1 
ATOM   745   O O   . ILE A 1 93  ? -5.892  101.751 92.864  1.00 20.00 ? 93   ILE A O   1 
ATOM   746   C CB  . ILE A 1 93  ? -6.487  102.764 89.988  1.00 20.00 ? 93   ILE A CB  1 
ATOM   747   C CG1 . ILE A 1 93  ? -6.645  101.399 89.331  1.00 20.00 ? 93   ILE A CG1 1 
ATOM   748   C CG2 . ILE A 1 93  ? -5.018  102.983 90.315  1.00 20.00 ? 93   ILE A CG2 1 
ATOM   749   C CD1 . ILE A 1 93  ? -5.689  101.172 88.198  1.00 20.00 ? 93   ILE A CD1 1 
ATOM   750   N N   . VAL A 1 94  ? -7.752  100.658 92.222  1.00 20.00 ? 94   VAL A N   1 
ATOM   751   C CA  . VAL A 1 94  ? -7.495  99.481  93.027  1.00 20.00 ? 94   VAL A CA  1 
ATOM   752   C C   . VAL A 1 94  ? -7.550  98.349  92.010  1.00 20.00 ? 94   VAL A C   1 
ATOM   753   O O   . VAL A 1 94  ? -8.595  98.111  91.397  1.00 20.00 ? 94   VAL A O   1 
ATOM   754   C CB  . VAL A 1 94  ? -8.587  99.262  94.100  1.00 20.00 ? 94   VAL A CB  1 
ATOM   755   C CG1 . VAL A 1 94  ? -8.359  97.943  94.813  1.00 20.00 ? 94   VAL A CG1 1 
ATOM   756   C CG2 . VAL A 1 94  ? -8.568  100.399 95.095  1.00 20.00 ? 94   VAL A CG2 1 
ATOM   757   N N   . PRO A 1 95  ? -6.419  97.661  91.781  1.00 20.00 ? 95   PRO A N   1 
ATOM   758   C CA  . PRO A 1 95  ? -6.467  96.475  90.920  1.00 20.00 ? 95   PRO A CA  1 
ATOM   759   C C   . PRO A 1 95  ? -7.198  95.289  91.555  1.00 20.00 ? 95   PRO A C   1 
ATOM   760   O O   . PRO A 1 95  ? -7.258  95.152  92.777  1.00 20.00 ? 95   PRO A O   1 
ATOM   761   C CB  . PRO A 1 95  ? -4.993  96.170  90.646  1.00 20.00 ? 95   PRO A CB  1 
ATOM   762   C CG  . PRO A 1 95  ? -4.277  96.720  91.827  1.00 20.00 ? 95   PRO A CG  1 
ATOM   763   C CD  . PRO A 1 95  ? -5.056  97.936  92.270  1.00 20.00 ? 95   PRO A CD  1 
ATOM   764   N N   . THR A 1 96  ? -7.773  94.450  90.703  1.00 20.00 ? 96   THR A N   1 
ATOM   765   C CA  . THR A 1 96  ? -8.506  93.262  91.130  1.00 20.00 ? 96   THR A CA  1 
ATOM   766   C C   . THR A 1 96  ? -8.182  92.214  90.070  1.00 20.00 ? 96   THR A C   1 
ATOM   767   O O   . THR A 1 96  ? -7.867  92.574  88.926  1.00 20.00 ? 96   THR A O   1 
ATOM   768   C CB  . THR A 1 96  ? -10.048 93.513  91.178  1.00 20.00 ? 96   THR A CB  1 
ATOM   769   O OG1 . THR A 1 96  ? -10.497 94.063  89.931  1.00 20.00 ? 96   THR A OG1 1 
ATOM   770   C CG2 . THR A 1 96  ? -10.392 94.479  92.289  1.00 20.00 ? 96   THR A CG2 1 
ATOM   771   N N   . HIS A 1 97  ? -8.247  90.931  90.427  1.00 20.00 ? 97   HIS A N   1 
ATOM   772   C CA  . HIS A 1 97  ? -7.940  89.888  89.453  1.00 20.00 ? 97   HIS A CA  1 
ATOM   773   C C   . HIS A 1 97  ? -8.891  89.851  88.254  1.00 20.00 ? 97   HIS A C   1 
ATOM   774   O O   . HIS A 1 97  ? -8.505  89.422  87.172  1.00 20.00 ? 97   HIS A O   1 
ATOM   775   C CB  . HIS A 1 97  ? -7.887  88.514  90.134  1.00 20.00 ? 97   HIS A CB  1 
ATOM   776   C CG  . HIS A 1 97  ? -9.219  87.852  90.282  1.00 20.00 ? 97   HIS A CG  1 
ATOM   777   N ND1 . HIS A 1 97  ? -10.162 88.272  91.197  1.00 20.00 ? 97   HIS A ND1 1 
ATOM   778   C CD2 . HIS A 1 97  ? -9.757  86.781  89.652  1.00 20.00 ? 97   HIS A CD2 1 
ATOM   779   C CE1 . HIS A 1 97  ? -11.221 87.486  91.123  1.00 20.00 ? 97   HIS A CE1 1 
ATOM   780   N NE2 . HIS A 1 97  ? -11.000 86.573  90.194  1.00 20.00 ? 97   HIS A NE2 1 
ATOM   781   N N   . GLN A 1 98  ? -10.122 90.318  88.447  1.00 20.00 ? 98   GLN A N   1 
ATOM   782   C CA  . GLN A 1 98  ? -11.124 90.334  87.388  1.00 20.00 ? 98   GLN A CA  1 
ATOM   783   C C   . GLN A 1 98  ? -12.143 91.440  87.627  1.00 20.00 ? 98   GLN A C   1 
ATOM   784   O O   . GLN A 1 98  ? -12.075 92.158  88.623  1.00 20.00 ? 98   GLN A O   1 
ATOM   785   C CB  . GLN A 1 98  ? -11.854 88.992  87.353  1.00 20.00 ? 98   GLN A CB  1 
ATOM   786   C CG  . GLN A 1 98  ? -11.742 88.276  86.048  1.00 20.00 ? 98   GLN A CG  1 
ATOM   787   C CD  . GLN A 1 98  ? -12.183 86.830  86.132  1.00 20.00 ? 98   GLN A CD  1 
ATOM   788   O OE1 . GLN A 1 98  ? -11.360 85.915  86.160  1.00 20.00 ? 98   GLN A OE1 1 
ATOM   789   N NE2 . GLN A 1 98  ? -13.485 86.615  86.163  1.00 20.00 ? 98   GLN A NE2 1 
ATOM   790   N N   . GLY A 1 99  ? -13.107 91.553  86.719  1.00 20.00 ? 99   GLY A N   1 
ATOM   791   C CA  . GLY A 1 99  ? -14.136 92.570  86.847  1.00 20.00 ? 99   GLY A CA  1 
ATOM   792   C C   . GLY A 1 99  ? -15.051 92.324  88.028  1.00 20.00 ? 99   GLY A C   1 
ATOM   793   O O   . GLY A 1 99  ? -15.390 93.263  88.743  1.00 20.00 ? 99   GLY A O   1 
ATOM   794   N N   . ARG A 1 100 ? -15.455 91.068  88.228  1.00 20.00 ? 100  ARG A N   1 
ATOM   795   C CA  . ARG A 1 100 ? -16.340 90.682  89.338  1.00 20.00 ? 100  ARG A CA  1 
ATOM   796   C C   . ARG A 1 100 ? -15.728 91.033  90.681  1.00 20.00 ? 100  ARG A C   1 
ATOM   797   O O   . ARG A 1 100 ? -16.437 91.396  91.615  1.00 20.00 ? 100  ARG A O   1 
ATOM   798   C CB  . ARG A 1 100 ? -16.609 89.174  89.353  1.00 20.00 ? 100  ARG A CB  1 
ATOM   799   C CG  . ARG A 1 100 ? -16.960 88.553  88.031  1.00 20.00 ? 100  ARG A CG  1 
ATOM   800   C CD  . ARG A 1 100 ? -16.091 87.346  87.793  1.00 20.00 ? 100  ARG A CD  1 
ATOM   801   N NE  . ARG A 1 100 ? -16.874 86.154  87.507  1.00 20.00 ? 100  ARG A NE  1 
ATOM   802   C CZ  . ARG A 1 100 ? -17.344 85.837  86.306  1.00 20.00 ? 100  ARG A CZ  1 
ATOM   803   N NH1 . ARG A 1 100 ? -17.115 86.629  85.267  1.00 20.00 ? 100  ARG A NH1 1 
ATOM   804   N NH2 . ARG A 1 100 ? -18.028 84.713  86.143  1.00 20.00 ? 100  ARG A NH2 1 
ATOM   805   N N   . GLY A 1 101 ? -14.412 90.885  90.784  1.00 20.00 ? 101  GLY A N   1 
ATOM   806   C CA  . GLY A 1 101 ? -13.734 91.197  92.027  1.00 20.00 ? 101  GLY A CA  1 
ATOM   807   C C   . GLY A 1 101 ? -13.943 92.654  92.382  1.00 20.00 ? 101  GLY A C   1 
ATOM   808   O O   . GLY A 1 101 ? -14.126 93.003  93.551  1.00 20.00 ? 101  GLY A O   1 
ATOM   809   N N   . ALA A 1 102 ? -13.913 93.512  91.368  1.00 20.00 ? 102  ALA A N   1 
ATOM   810   C CA  . ALA A 1 102 ? -14.107 94.942  91.580  1.00 20.00 ? 102  ALA A CA  1 
ATOM   811   C C   . ALA A 1 102 ? -15.569 95.201  91.979  1.00 20.00 ? 102  ALA A C   1 
ATOM   812   O O   . ALA A 1 102 ? -15.845 96.006  92.868  1.00 20.00 ? 102  ALA A O   1 
ATOM   813   C CB  . ALA A 1 102 ? -13.751 95.715  90.309  1.00 20.00 ? 102  ALA A CB  1 
ATOM   814   N N   . GLU A 1 103 ? -16.496 94.499  91.328  1.00 20.00 ? 103  GLU A N   1 
ATOM   815   C CA  . GLU A 1 103 ? -17.923 94.639  91.602  1.00 20.00 ? 103  GLU A CA  1 
ATOM   816   C C   . GLU A 1 103 ? -18.233 94.226  93.032  1.00 20.00 ? 103  GLU A C   1 
ATOM   817   O O   . GLU A 1 103 ? -19.060 94.839  93.699  1.00 20.00 ? 103  GLU A O   1 
ATOM   818   C CB  . GLU A 1 103 ? -18.737 93.777  90.635  1.00 20.00 ? 103  GLU A CB  1 
ATOM   819   C CG  . GLU A 1 103 ? -18.730 94.293  89.213  1.00 20.00 ? 103  GLU A CG  1 
ATOM   820   C CD  . GLU A 1 103 ? -19.219 93.273  88.195  1.00 20.00 ? 103  GLU A CD  1 
ATOM   821   O OE1 . GLU A 1 103 ? -19.443 92.100  88.541  1.00 20.00 ? 103  GLU A OE1 1 
ATOM   822   O OE2 . GLU A 1 103 ? -19.381 93.646  87.025  1.00 20.00 ? 103  GLU A OE2 1 
ATOM   823   N N   . ASN A 1 104 ? -17.575 93.171  93.497  1.00 20.00 ? 104  ASN A N   1 
ATOM   824   C CA  . ASN A 1 104 ? -17.797 92.696  94.855  1.00 20.00 ? 104  ASN A CA  1 
ATOM   825   C C   . ASN A 1 104 ? -17.421 93.826  95.808  1.00 20.00 ? 104  ASN A C   1 
ATOM   826   O O   . ASN A 1 104 ? -18.138 94.126  96.763  1.00 20.00 ? 104  ASN A O   1 
ATOM   827   C CB  . ASN A 1 104 ? -16.926 91.461  95.132  1.00 20.00 ? 104  ASN A CB  1 
ATOM   828   C CG  . ASN A 1 104 ? -16.865 91.101  96.610  1.00 20.00 ? 104  ASN A CG  1 
ATOM   829   O OD1 . ASN A 1 104 ? -17.880 91.087  97.302  1.00 20.00 ? 104  ASN A OD1 1 
ATOM   830   N ND2 . ASN A 1 104 ? -15.668 90.807  97.095  1.00 20.00 ? 104  ASN A ND2 1 
ATOM   831   N N   . LEU A 1 105 ? -16.292 94.462  95.522  1.00 20.00 ? 105  LEU A N   1 
ATOM   832   C CA  . LEU A 1 105 ? -15.802 95.556  96.339  1.00 20.00 ? 105  LEU A CA  1 
ATOM   833   C C   . LEU A 1 105 ? -16.735 96.750  96.329  1.00 20.00 ? 105  LEU A C   1 
ATOM   834   O O   . LEU A 1 105 ? -17.179 97.206  97.380  1.00 20.00 ? 105  LEU A O   1 
ATOM   835   C CB  . LEU A 1 105 ? -14.419 95.992  95.853  1.00 20.00 ? 105  LEU A CB  1 
ATOM   836   C CG  . LEU A 1 105 ? -13.171 95.534  96.616  1.00 20.00 ? 105  LEU A CG  1 
ATOM   837   C CD1 . LEU A 1 105 ? -13.452 94.285  97.418  1.00 20.00 ? 105  LEU A CD1 1 
ATOM   838   C CD2 . LEU A 1 105 ? -12.047 95.299  95.623  1.00 20.00 ? 105  LEU A CD2 1 
ATOM   839   N N   . LEU A 1 106 ? -17.033 97.258  95.139  1.00 20.00 ? 106  LEU A N   1 
ATOM   840   C CA  . LEU A 1 106 ? -17.911 98.407  95.024  1.00 20.00 ? 106  LEU A CA  1 
ATOM   841   C C   . LEU A 1 106 ? -19.260 98.202  95.698  1.00 20.00 ? 106  LEU A C   1 
ATOM   842   O O   . LEU A 1 106 ? -19.719 99.062  96.439  1.00 20.00 ? 106  LEU A O   1 
ATOM   843   C CB  . LEU A 1 106 ? -18.121 98.778  93.553  1.00 20.00 ? 106  LEU A CB  1 
ATOM   844   C CG  . LEU A 1 106 ? -19.033 99.989  93.318  1.00 20.00 ? 106  LEU A CG  1 
ATOM   845   C CD1 . LEU A 1 106 ? -18.259 101.273 93.574  1.00 20.00 ? 106  LEU A CD1 1 
ATOM   846   C CD2 . LEU A 1 106 ? -19.571 99.958  91.903  1.00 20.00 ? 106  LEU A CD2 1 
ATOM   847   N N   . SER A 1 107 ? -19.890 97.061  95.446  1.00 20.00 ? 107  SER A N   1 
ATOM   848   C CA  . SER A 1 107 ? -21.190 96.772  96.038  1.00 20.00 ? 107  SER A CA  1 
ATOM   849   C C   . SER A 1 107 ? -21.152 96.736  97.554  1.00 20.00 ? 107  SER A C   1 
ATOM   850   O O   . SER A 1 107 ? -22.073 97.206  98.215  1.00 20.00 ? 107  SER A O   1 
ATOM   851   C CB  . SER A 1 107 ? -21.723 95.443  95.513  1.00 20.00 ? 107  SER A CB  1 
ATOM   852   O OG  . SER A 1 107 ? -21.980 95.531  94.126  1.00 20.00 ? 107  SER A OG  1 
ATOM   853   N N   . GLN A 1 108 ? -20.096 96.161  98.109  1.00 20.00 ? 108  GLN A N   1 
ATOM   854   C CA  . GLN A 1 108 ? -19.981 96.087  99.553  1.00 20.00 ? 108  GLN A CA  1 
ATOM   855   C C   . GLN A 1 108 ? -19.766 97.477  100.154 1.00 20.00 ? 108  GLN A C   1 
ATOM   856   O O   . GLN A 1 108 ? -20.146 97.723  101.294 1.00 20.00 ? 108  GLN A O   1 
ATOM   857   C CB  . GLN A 1 108 ? -18.825 95.169  99.940  1.00 20.00 ? 108  GLN A CB  1 
ATOM   858   C CG  . GLN A 1 108 ? -19.083 93.705  99.647  1.00 20.00 ? 108  GLN A CG  1 
ATOM   859   C CD  . GLN A 1 108 ? -18.285 92.783  100.547 1.00 20.00 ? 108  GLN A CD  1 
ATOM   860   O OE1 . GLN A 1 108 ? -18.207 92.992  101.756 1.00 20.00 ? 108  GLN A OE1 1 
ATOM   861   N NE2 . GLN A 1 108 ? -17.688 91.756  99.961  1.00 20.00 ? 108  GLN A NE2 1 
ATOM   862   N N   . LEU A 1 109 ? -19.189 98.390  99.374  1.00 20.00 ? 109  LEU A N   1 
ATOM   863   C CA  . LEU A 1 109 ? -18.923 99.751  99.839  1.00 20.00 ? 109  LEU A CA  1 
ATOM   864   C C   . LEU A 1 109 ? -19.944 100.844 99.527  1.00 20.00 ? 109  LEU A C   1 
ATOM   865   O O   . LEU A 1 109 ? -20.065 101.805 100.285 1.00 20.00 ? 109  LEU A O   1 
ATOM   866   C CB  . LEU A 1 109 ? -17.577 100.234 99.297  1.00 20.00 ? 109  LEU A CB  1 
ATOM   867   C CG  . LEU A 1 109 ? -16.320 99.440  99.634  1.00 20.00 ? 109  LEU A CG  1 
ATOM   868   C CD1 . LEU A 1 109 ? -15.244 99.774  98.617  1.00 20.00 ? 109  LEU A CD1 1 
ATOM   869   C CD2 . LEU A 1 109 ? -15.857 99.771  101.044 1.00 20.00 ? 109  LEU A CD2 1 
ATOM   870   N N   . ALA A 1 110 ? -20.675 100.712 98.427  1.00 20.00 ? 110  ALA A N   1 
ATOM   871   C CA  . ALA A 1 110 ? -21.653 101.729 98.054  1.00 20.00 ? 110  ALA A CA  1 
ATOM   872   C C   . ALA A 1 110 ? -23.131 101.434 98.254  1.00 20.00 ? 110  ALA A C   1 
ATOM   873   O O   . ALA A 1 110 ? -23.965 102.294 97.985  1.00 20.00 ? 110  ALA A O   1 
ATOM   874   C CB  . ALA A 1 110 ? -21.418 102.134 96.609  1.00 20.00 ? 110  ALA A CB  1 
ATOM   875   N N   . ILE A 1 111 ? -23.463 100.238 98.719  1.00 20.00 ? 111  ILE A N   1 
ATOM   876   C CA  . ILE A 1 111 ? -24.856 99.874  98.935  1.00 20.00 ? 111  ILE A CA  1 
ATOM   877   C C   . ILE A 1 111 ? -25.210 99.615  100.399 1.00 20.00 ? 111  ILE A C   1 
ATOM   878   O O   . ILE A 1 111 ? -24.441 99.009  101.141 1.00 20.00 ? 111  ILE A O   1 
ATOM   879   C CB  . ILE A 1 111 ? -25.225 98.609  98.130  1.00 20.00 ? 111  ILE A CB  1 
ATOM   880   C CG1 . ILE A 1 111 ? -24.961 98.842  96.642  1.00 20.00 ? 111  ILE A CG1 1 
ATOM   881   C CG2 . ILE A 1 111 ? -26.682 98.249  98.364  1.00 20.00 ? 111  ILE A CG2 1 
ATOM   882   C CD1 . ILE A 1 111 ? -25.121 97.603  95.789  1.00 20.00 ? 111  ILE A CD1 1 
ATOM   883   N N   . LYS A 1 112 ? -26.382 100.092 100.800 1.00 20.00 ? 112  LYS A N   1 
ATOM   884   C CA  . LYS A 1 112 ? -26.879 99.920  102.160 1.00 20.00 ? 112  LYS A CA  1 
ATOM   885   C C   . LYS A 1 112 ? -28.197 99.184  101.991 1.00 20.00 ? 112  LYS A C   1 
ATOM   886   O O   . LYS A 1 112 ? -28.935 99.446  101.047 1.00 20.00 ? 112  LYS A O   1 
ATOM   887   C CB  . LYS A 1 112 ? -27.115 101.274 102.821 1.00 20.00 ? 112  LYS A CB  1 
ATOM   888   C CG  . LYS A 1 112 ? -25.851 102.094 102.980 1.00 20.00 ? 112  LYS A CG  1 
ATOM   889   C CD  . LYS A 1 112 ? -25.938 103.007 104.178 1.00 20.00 ? 112  LYS A CD  1 
ATOM   890   C CE  . LYS A 1 112 ? -25.521 104.426 103.818 1.00 20.00 ? 112  LYS A CE  1 
ATOM   891   N NZ  . LYS A 1 112 ? -26.245 104.938 102.622 1.00 20.00 ? 112  LYS A NZ  1 
ATOM   892   N N   . PRO A 1 113 ? -28.501 98.230  102.879 1.00 20.00 ? 113  PRO A N   1 
ATOM   893   C CA  . PRO A 1 113 ? -29.677 97.371  102.676 1.00 20.00 ? 113  PRO A CA  1 
ATOM   894   C C   . PRO A 1 113 ? -30.966 98.170  102.476 1.00 20.00 ? 113  PRO A C   1 
ATOM   895   O O   . PRO A 1 113 ? -31.208 99.166  103.164 1.00 20.00 ? 113  PRO A O   1 
ATOM   896   C CB  . PRO A 1 113 ? -29.722 96.511  103.936 1.00 20.00 ? 113  PRO A CB  1 
ATOM   897   C CG  . PRO A 1 113 ? -28.329 96.538  104.462 1.00 20.00 ? 113  PRO A CG  1 
ATOM   898   C CD  . PRO A 1 113 ? -27.778 97.891  104.115 1.00 20.00 ? 113  PRO A CD  1 
ATOM   899   N N   . GLY A 1 114 ? -31.782 97.724  101.525 1.00 20.00 ? 114  GLY A N   1 
ATOM   900   C CA  . GLY A 1 114 ? -33.030 98.400  101.239 1.00 20.00 ? 114  GLY A CA  1 
ATOM   901   C C   . GLY A 1 114 ? -32.891 99.513  100.211 1.00 20.00 ? 114  GLY A C   1 
ATOM   902   O O   . GLY A 1 114 ? -33.883 100.122 99.812  1.00 20.00 ? 114  GLY A O   1 
ATOM   903   N N   . GLN A 1 115 ? -31.666 99.782  99.772  1.00 20.00 ? 115  GLN A N   1 
ATOM   904   C CA  . GLN A 1 115 ? -31.442 100.832 98.791  1.00 20.00 ? 115  GLN A CA  1 
ATOM   905   C C   . GLN A 1 115 ? -31.677 100.308 97.382  1.00 20.00 ? 115  GLN A C   1 
ATOM   906   O O   . GLN A 1 115 ? -31.798 99.106  97.170  1.00 20.00 ? 115  GLN A O   1 
ATOM   907   C CB  . GLN A 1 115 ? -30.023 101.402 98.926  1.00 20.00 ? 115  GLN A CB  1 
ATOM   908   C CG  . GLN A 1 115 ? -29.929 102.567 99.901  1.00 20.00 ? 115  GLN A CG  1 
ATOM   909   C CD  . GLN A 1 115 ? -28.548 103.168 99.969  1.00 20.00 ? 115  GLN A CD  1 
ATOM   910   O OE1 . GLN A 1 115 ? -27.552 102.483 99.758  1.00 20.00 ? 115  GLN A OE1 1 
ATOM   911   N NE2 . GLN A 1 115 ? -28.479 104.459 100.267 1.00 20.00 ? 115  GLN A NE2 1 
ATOM   912   N N   . TYR A 1 116 ? -31.762 101.223 96.424  1.00 20.00 ? 116  TYR A N   1 
ATOM   913   C CA  . TYR A 1 116 ? -31.985 100.859 95.034  1.00 20.00 ? 116  TYR A CA  1 
ATOM   914   C C   . TYR A 1 116 ? -30.762 101.166 94.195  1.00 20.00 ? 116  TYR A C   1 
ATOM   915   O O   . TYR A 1 116 ? -29.960 102.022 94.548  1.00 20.00 ? 116  TYR A O   1 
ATOM   916   C CB  . TYR A 1 116 ? -33.167 101.644 94.458  1.00 20.00 ? 116  TYR A CB  1 
ATOM   917   C CG  . TYR A 1 116 ? -34.501 101.178 94.976  1.00 20.00 ? 116  TYR A CG  1 
ATOM   918   C CD1 . TYR A 1 116 ? -35.041 101.714 96.145  1.00 20.00 ? 116  TYR A CD1 1 
ATOM   919   C CD2 . TYR A 1 116 ? -35.199 100.162 94.332  1.00 20.00 ? 116  TYR A CD2 1 
ATOM   920   C CE1 . TYR A 1 116 ? -36.239 101.241 96.661  1.00 20.00 ? 116  TYR A CE1 1 
ATOM   921   C CE2 . TYR A 1 116 ? -36.398 99.682  94.837  1.00 20.00 ? 116  TYR A CE2 1 
ATOM   922   C CZ  . TYR A 1 116 ? -36.910 100.222 96.001  1.00 20.00 ? 116  TYR A CZ  1 
ATOM   923   O OH  . TYR A 1 116 ? -38.083 99.730  96.517  1.00 20.00 ? 116  TYR A OH  1 
ATOM   924   N N   . VAL A 1 117 ? -30.622 100.442 93.093  1.00 20.00 ? 117  VAL A N   1 
ATOM   925   C CA  . VAL A 1 117 ? -29.506 100.629 92.169  1.00 20.00 ? 117  VAL A CA  1 
ATOM   926   C C   . VAL A 1 117 ? -30.167 100.585 90.802  1.00 20.00 ? 117  VAL A C   1 
ATOM   927   O O   . VAL A 1 117 ? -30.775 99.579  90.436  1.00 20.00 ? 117  VAL A O   1 
ATOM   928   C CB  . VAL A 1 117 ? -28.454 99.506  92.244  1.00 20.00 ? 117  VAL A CB  1 
ATOM   929   C CG1 . VAL A 1 117 ? -27.480 99.656  91.088  1.00 20.00 ? 117  VAL A CG1 1 
ATOM   930   C CG2 . VAL A 1 117 ? -27.697 99.572  93.567  1.00 20.00 ? 117  VAL A CG2 1 
ATOM   931   N N   . ALA A 1 118 ? -30.082 101.687 90.066  1.00 20.00 ? 118  ALA A N   1 
ATOM   932   C CA  . ALA A 1 118 ? -30.679 101.761 88.745  1.00 20.00 ? 118  ALA A CA  1 
ATOM   933   C C   . ALA A 1 118 ? -29.603 101.663 87.688  1.00 20.00 ? 118  ALA A C   1 
ATOM   934   O O   . ALA A 1 118 ? -28.517 102.191 87.858  1.00 20.00 ? 118  ALA A O   1 
ATOM   935   C CB  . ALA A 1 118 ? -31.462 103.074 88.590  1.00 20.00 ? 118  ALA A CB  1 
ATOM   936   N N   . GLY A 1 119 ? -29.907 100.973 86.598  1.00 20.00 ? 119  GLY A N   1 
ATOM   937   C CA  . GLY A 1 119 ? -28.938 100.827 85.531  1.00 20.00 ? 119  GLY A CA  1 
ATOM   938   C C   . GLY A 1 119 ? -29.592 100.441 84.221  1.00 20.00 ? 119  GLY A C   1 
ATOM   939   O O   . GLY A 1 119 ? -30.760 100.039 84.205  1.00 20.00 ? 119  GLY A O   1 
ATOM   940   N N   . ASN A 1 120 ? -28.854 100.584 83.123  1.00 20.00 ? 120  ASN A N   1 
ATOM   941   C CA  . ASN A 1 120 ? -29.372 100.241 81.809  1.00 20.00 ? 120  ASN A CA  1 
ATOM   942   C C   . ASN A 1 120 ? -29.114 98.766  81.620  1.00 20.00 ? 120  ASN A C   1 
ATOM   943   O O   . ASN A 1 120 ? -28.068 98.369  81.128  1.00 20.00 ? 120  ASN A O   1 
ATOM   944   C CB  . ASN A 1 120 ? -28.671 101.042 80.710  1.00 20.00 ? 120  ASN A CB  1 
ATOM   945   C CG  . ASN A 1 120 ? -27.162 101.066 80.863  1.00 20.00 ? 120  ASN A CG  1 
ATOM   946   O OD1 . ASN A 1 120 ? -26.627 100.824 81.945  1.00 20.00 ? 120  ASN A OD1 1 
ATOM   947   N ND2 . ASN A 1 120 ? -26.467 101.367 79.771  1.00 20.00 ? 120  ASN A ND2 1 
ATOM   948   N N   . MET A 1 121 ? -30.083 97.956  82.020  1.00 20.00 ? 121  MET A N   1 
ATOM   949   C CA  . MET A 1 121 ? -29.978 96.509  81.911  1.00 20.00 ? 121  MET A CA  1 
ATOM   950   C C   . MET A 1 121 ? -28.957 96.028  82.934  1.00 20.00 ? 121  MET A C   1 
ATOM   951   O O   . MET A 1 121 ? -28.499 96.808  83.765  1.00 20.00 ? 121  MET A O   1 
ATOM   952   C CB  . MET A 1 121 ? -29.573 96.086  80.496  1.00 20.00 ? 121  MET A CB  1 
ATOM   953   C CG  . MET A 1 121 ? -30.611 95.199  79.815  1.00 20.00 ? 121  MET A CG  1 
ATOM   954   S SD  . MET A 1 121 ? -30.967 95.631  78.092  1.00 20.00 ? 121  MET A SD  1 
ATOM   955   C CE  . MET A 1 121 ? -31.795 94.174  77.564  1.00 20.00 ? 121  MET A CE  1 
ATOM   956   N N   . TYR A 1 122 ? -28.585 94.755  82.871  1.00 20.00 ? 122  TYR A N   1 
ATOM   957   C CA  . TYR A 1 122 ? -27.622 94.226  83.827  1.00 20.00 ? 122  TYR A CA  1 
ATOM   958   C C   . TYR A 1 122 ? -26.783 93.071  83.291  1.00 20.00 ? 122  TYR A C   1 
ATOM   959   O O   . TYR A 1 122 ? -26.918 92.651  82.142  1.00 20.00 ? 122  TYR A O   1 
ATOM   960   C CB  . TYR A 1 122 ? -28.374 93.740  85.069  1.00 20.00 ? 122  TYR A CB  1 
ATOM   961   C CG  . TYR A 1 122 ? -29.259 92.548  84.764  1.00 20.00 ? 122  TYR A CG  1 
ATOM   962   C CD1 . TYR A 1 122 ? -30.531 92.719  84.212  1.00 20.00 ? 122  TYR A CD1 1 
ATOM   963   C CD2 . TYR A 1 122 ? -28.798 91.245  84.960  1.00 20.00 ? 122  TYR A CD2 1 
ATOM   964   C CE1 . TYR A 1 122 ? -31.320 91.617  83.855  1.00 20.00 ? 122  TYR A CE1 1 
ATOM   965   C CE2 . TYR A 1 122 ? -29.574 90.141  84.610  1.00 20.00 ? 122  TYR A CE2 1 
ATOM   966   C CZ  . TYR A 1 122 ? -30.832 90.333  84.056  1.00 20.00 ? 122  TYR A CZ  1 
ATOM   967   O OH  . TYR A 1 122 ? -31.591 89.243  83.692  1.00 20.00 ? 122  TYR A OH  1 
ATOM   968   N N   . PHE A 1 123 ? -25.910 92.574  84.157  1.00 20.00 ? 123  PHE A N   1 
ATOM   969   C CA  . PHE A 1 123 ? -25.024 91.458  83.849  1.00 20.00 ? 123  PHE A CA  1 
ATOM   970   C C   . PHE A 1 123 ? -25.070 90.580  85.100  1.00 20.00 ? 123  PHE A C   1 
ATOM   971   O O   . PHE A 1 123 ? -25.120 91.085  86.217  1.00 20.00 ? 123  PHE A O   1 
ATOM   972   C CB  . PHE A 1 123 ? -23.594 91.931  83.567  1.00 20.00 ? 123  PHE A CB  1 
ATOM   973   C CG  . PHE A 1 123 ? -22.640 90.807  83.274  1.00 20.00 ? 123  PHE A CG  1 
ATOM   974   C CD1 . PHE A 1 123 ? -22.711 90.113  82.069  1.00 20.00 ? 123  PHE A CD1 1 
ATOM   975   C CD2 . PHE A 1 123 ? -21.708 90.401  84.225  1.00 20.00 ? 123  PHE A CD2 1 
ATOM   976   C CE1 . PHE A 1 123 ? -21.866 89.018  81.814  1.00 20.00 ? 123  PHE A CE1 1 
ATOM   977   C CE2 . PHE A 1 123 ? -20.858 89.308  83.981  1.00 20.00 ? 123  PHE A CE2 1 
ATOM   978   C CZ  . PHE A 1 123 ? -20.941 88.617  82.773  1.00 20.00 ? 123  PHE A CZ  1 
ATOM   979   N N   . THR A 1 124 ? -25.061 89.270  84.908  1.00 20.00 ? 124  THR A N   1 
ATOM   980   C CA  . THR A 1 124 ? -25.116 88.322  86.013  1.00 20.00 ? 124  THR A CA  1 
ATOM   981   C C   . THR A 1 124 ? -24.264 88.575  87.259  1.00 20.00 ? 124  THR A C   1 
ATOM   982   O O   . THR A 1 124 ? -24.808 88.686  88.362  1.00 20.00 ? 124  THR A O   1 
ATOM   983   C CB  . THR A 1 124 ? -24.847 86.890  85.506  1.00 20.00 ? 124  THR A CB  1 
ATOM   984   O OG1 . THR A 1 124 ? -23.596 86.843  84.811  1.00 20.00 ? 124  THR A OG1 1 
ATOM   985   C CG2 . THR A 1 124 ? -25.952 86.466  84.552  1.00 20.00 ? 124  THR A CG2 1 
ATOM   986   N N   . THR A 1 125 ? -22.945 88.664  87.108  1.00 20.00 ? 125  THR A N   1 
ATOM   987   C CA  . THR A 1 125 ? -22.090 88.898  88.270  1.00 20.00 ? 125  THR A CA  1 
ATOM   988   C C   . THR A 1 125 ? -22.356 90.239  88.959  1.00 20.00 ? 125  THR A C   1 
ATOM   989   O O   . THR A 1 125 ? -22.531 90.299  90.179  1.00 20.00 ? 125  THR A O   1 
ATOM   990   C CB  . THR A 1 125 ? -20.567 88.816  87.909  1.00 20.00 ? 125  THR A CB  1 
ATOM   991   O OG1 . THR A 1 125 ? -20.224 89.850  86.978  1.00 20.00 ? 125  THR A OG1 1 
ATOM   992   C CG2 . THR A 1 125 ? -20.225 87.461  87.305  1.00 20.00 ? 125  THR A CG2 1 
ATOM   993   N N   . THR A 1 126 ? -22.402 91.310  88.177  1.00 20.00 ? 126  THR A N   1 
ATOM   994   C CA  . THR A 1 126 ? -22.637 92.628  88.739  1.00 20.00 ? 126  THR A CA  1 
ATOM   995   C C   . THR A 1 126 ? -23.967 92.771  89.473  1.00 20.00 ? 126  THR A C   1 
ATOM   996   O O   . THR A 1 126 ? -24.039 93.444  90.506  1.00 20.00 ? 126  THR A O   1 
ATOM   997   C CB  . THR A 1 126 ? -22.500 93.717  87.659  1.00 20.00 ? 126  THR A CB  1 
ATOM   998   O OG1 . THR A 1 126 ? -23.689 94.511  87.616  1.00 20.00 ? 126  THR A OG1 1 
ATOM   999   C CG2 . THR A 1 126 ? -22.251 93.092  86.312  1.00 20.00 ? 126  THR A CG2 1 
ATOM   1000  N N   . ARG A 1 127 ? -25.012 92.138  88.953  1.00 20.00 ? 127  ARG A N   1 
ATOM   1001  C CA  . ARG A 1 127 ? -26.325 92.210  89.583  1.00 20.00 ? 127  ARG A CA  1 
ATOM   1002  C C   . ARG A 1 127 ? -26.340 91.356  90.852  1.00 20.00 ? 127  ARG A C   1 
ATOM   1003  O O   . ARG A 1 127 ? -27.011 91.688  91.828  1.00 20.00 ? 127  ARG A O   1 
ATOM   1004  C CB  . ARG A 1 127 ? -27.404 91.725  88.616  1.00 20.00 ? 127  ARG A CB  1 
ATOM   1005  C CG  . ARG A 1 127 ? -28.807 92.092  89.052  1.00 20.00 ? 127  ARG A CG  1 
ATOM   1006  C CD  . ARG A 1 127 ? -29.846 91.155  88.468  1.00 20.00 ? 127  ARG A CD  1 
ATOM   1007  N NE  . ARG A 1 127 ? -31.134 91.361  89.117  1.00 20.00 ? 127  ARG A NE  1 
ATOM   1008  C CZ  . ARG A 1 127 ? -32.278 91.578  88.477  1.00 20.00 ? 127  ARG A CZ  1 
ATOM   1009  N NH1 . ARG A 1 127 ? -32.311 91.618  87.150  1.00 20.00 ? 127  ARG A NH1 1 
ATOM   1010  N NH2 . ARG A 1 127 ? -33.389 91.777  89.174  1.00 20.00 ? 127  ARG A NH2 1 
ATOM   1011  N N   . PHE A 1 128 ? -25.594 90.254  90.833  1.00 20.00 ? 128  PHE A N   1 
ATOM   1012  C CA  . PHE A 1 128 ? -25.528 89.366  91.986  1.00 20.00 ? 128  PHE A CA  1 
ATOM   1013  C C   . PHE A 1 128 ? -24.982 90.104  93.209  1.00 20.00 ? 128  PHE A C   1 
ATOM   1014  O O   . PHE A 1 128 ? -25.558 90.059  94.293  1.00 20.00 ? 128  PHE A O   1 
ATOM   1015  C CB  . PHE A 1 128 ? -24.630 88.154  91.692  1.00 20.00 ? 128  PHE A CB  1 
ATOM   1016  C CG  . PHE A 1 128 ? -24.148 87.450  92.930  1.00 20.00 ? 128  PHE A CG  1 
ATOM   1017  C CD1 . PHE A 1 128 ? -22.991 87.874  93.583  1.00 20.00 ? 128  PHE A CD1 1 
ATOM   1018  C CD2 . PHE A 1 128 ? -24.889 86.410  93.488  1.00 20.00 ? 128  PHE A CD2 1 
ATOM   1019  C CE1 . PHE A 1 128 ? -22.585 87.281  94.775  1.00 20.00 ? 128  PHE A CE1 1 
ATOM   1020  C CE2 . PHE A 1 128 ? -24.491 85.806  94.685  1.00 20.00 ? 128  PHE A CE2 1 
ATOM   1021  C CZ  . PHE A 1 128 ? -23.339 86.243  95.330  1.00 20.00 ? 128  PHE A CZ  1 
ATOM   1022  N N   . HIS A 1 129 ? -23.853 90.771  93.036  1.00 20.00 ? 129  HIS A N   1 
ATOM   1023  C CA  . HIS A 1 129 ? -23.253 91.499  94.135  1.00 20.00 ? 129  HIS A CA  1 
ATOM   1024  C C   . HIS A 1 129 ? -24.144 92.636  94.624  1.00 20.00 ? 129  HIS A C   1 
ATOM   1025  O O   . HIS A 1 129 ? -24.131 92.971  95.810  1.00 20.00 ? 129  HIS A O   1 
ATOM   1026  C CB  . HIS A 1 129 ? -21.887 92.016  93.707  1.00 20.00 ? 129  HIS A CB  1 
ATOM   1027  C CG  . HIS A 1 129 ? -20.871 90.931  93.539  1.00 20.00 ? 129  HIS A CG  1 
ATOM   1028  N ND1 . HIS A 1 129 ? -20.455 90.135  94.585  1.00 20.00 ? 129  HIS A ND1 1 
ATOM   1029  C CD2 . HIS A 1 129 ? -20.202 90.495  92.445  1.00 20.00 ? 129  HIS A CD2 1 
ATOM   1030  C CE1 . HIS A 1 129 ? -19.574 89.257  94.143  1.00 20.00 ? 129  HIS A CE1 1 
ATOM   1031  N NE2 . HIS A 1 129 ? -19.403 89.454  92.848  1.00 20.00 ? 129  HIS A NE2 1 
ATOM   1032  N N   . GLN A 1 130 ? -24.921 93.219  93.716  1.00 20.00 ? 130  GLN A N   1 
ATOM   1033  C CA  . GLN A 1 130 ? -25.818 94.316  94.073  1.00 20.00 ? 130  GLN A CA  1 
ATOM   1034  C C   . GLN A 1 130 ? -26.874 93.791  95.040  1.00 20.00 ? 130  GLN A C   1 
ATOM   1035  O O   . GLN A 1 130 ? -27.039 94.303  96.149  1.00 20.00 ? 130  GLN A O   1 
ATOM   1036  C CB  . GLN A 1 130 ? -26.509 94.881  92.824  1.00 20.00 ? 130  GLN A CB  1 
ATOM   1037  C CG  . GLN A 1 130 ? -25.784 96.065  92.179  1.00 20.00 ? 130  GLN A CG  1 
ATOM   1038  C CD  . GLN A 1 130 ? -26.110 96.228  90.697  1.00 20.00 ? 130  GLN A CD  1 
ATOM   1039  O OE1 . GLN A 1 130 ? -25.296 96.741  89.922  1.00 20.00 ? 130  GLN A OE1 1 
ATOM   1040  N NE2 . GLN A 1 130 ? -27.303 95.793  90.299  1.00 20.00 ? 130  GLN A NE2 1 
ATOM   1041  N N   . GLU A 1 131 ? -27.582 92.756  94.612  1.00 20.00 ? 131  GLU A N   1 
ATOM   1042  C CA  . GLU A 1 131 ? -28.620 92.157  95.436  1.00 20.00 ? 131  GLU A CA  1 
ATOM   1043  C C   . GLU A 1 131 ? -28.019 91.483  96.666  1.00 20.00 ? 131  GLU A C   1 
ATOM   1044  O O   . GLU A 1 131 ? -28.590 91.529  97.756  1.00 20.00 ? 131  GLU A O   1 
ATOM   1045  C CB  . GLU A 1 131 ? -29.409 91.142  94.611  1.00 20.00 ? 131  GLU A CB  1 
ATOM   1046  C CG  . GLU A 1 131 ? -30.343 91.789  93.605  1.00 20.00 ? 131  GLU A CG  1 
ATOM   1047  C CD  . GLU A 1 131 ? -30.922 90.796  92.620  1.00 20.00 ? 131  GLU A CD  1 
ATOM   1048  O OE1 . GLU A 1 131 ? -30.622 89.591  92.744  1.00 20.00 ? 131  GLU A OE1 1 
ATOM   1049  O OE2 . GLU A 1 131 ? -31.678 91.225  91.722  1.00 20.00 ? 131  GLU A OE2 1 
ATOM   1050  N N   . LYS A 1 132 ? -26.861 90.857  96.482  1.00 20.00 ? 132  LYS A N   1 
ATOM   1051  C CA  . LYS A 1 132 ? -26.174 90.173  97.569  1.00 20.00 ? 132  LYS A CA  1 
ATOM   1052  C C   . LYS A 1 132 ? -25.968 91.134  98.722  1.00 20.00 ? 132  LYS A C   1 
ATOM   1053  O O   . LYS A 1 132 ? -26.042 90.744  99.883  1.00 20.00 ? 132  LYS A O   1 
ATOM   1054  C CB  . LYS A 1 132 ? -24.811 89.655  97.093  1.00 20.00 ? 132  LYS A CB  1 
ATOM   1055  C CG  . LYS A 1 132 ? -23.915 89.110  98.198  1.00 20.00 ? 132  LYS A CG  1 
ATOM   1056  C CD  . LYS A 1 132 ? -22.770 90.074  98.526  1.00 20.00 ? 132  LYS A CD  1 
ATOM   1057  C CE  . LYS A 1 132 ? -21.491 89.776  97.723  1.00 20.00 ? 132  LYS A CE  1 
ATOM   1058  N NZ  . LYS A 1 132 ? -20.700 91.009  97.395  1.00 20.00 ? 132  LYS A NZ  1 
ATOM   1059  N N   . ASN A 1 133 ? -25.725 92.398  98.401  1.00 20.00 ? 133  ASN A N   1 
ATOM   1060  C CA  . ASN A 1 133 ? -25.506 93.386  99.438  1.00 20.00 ? 133  ASN A CA  1 
ATOM   1061  C C   . ASN A 1 133 ? -26.736 94.172  99.894  1.00 20.00 ? 133  ASN A C   1 
ATOM   1062  O O   . ASN A 1 133 ? -26.622 95.263  100.453 1.00 20.00 ? 133  ASN A O   1 
ATOM   1063  C CB  . ASN A 1 133 ? -24.372 94.316  99.008  1.00 20.00 ? 133  ASN A CB  1 
ATOM   1064  C CG  . ASN A 1 133 ? -23.020 93.603  99.000  1.00 20.00 ? 133  ASN A CG  1 
ATOM   1065  O OD1 . ASN A 1 133 ? -22.538 93.154  97.953  1.00 20.00 ? 133  ASN A OD1 1 
ATOM   1066  N ND2 . ASN A 1 133 ? -22.410 93.485  100.174 1.00 20.00 ? 133  ASN A ND2 1 
ATOM   1067  N N   . GLY A 1 134 ? -27.911 93.602  99.655  1.00 20.00 ? 134  GLY A N   1 
ATOM   1068  C CA  . GLY A 1 134 ? -29.152 94.243  100.056 1.00 20.00 ? 134  GLY A CA  1 
ATOM   1069  C C   . GLY A 1 134 ? -29.742 95.358  99.222  1.00 20.00 ? 134  GLY A C   1 
ATOM   1070  O O   . GLY A 1 134 ? -30.302 96.298  99.780  1.00 20.00 ? 134  GLY A O   1 
ATOM   1071  N N   . ALA A 1 135 ? -29.637 95.267  97.901  1.00 20.00 ? 135  ALA A N   1 
ATOM   1072  C CA  . ALA A 1 135 ? -30.185 96.301  97.034  1.00 20.00 ? 135  ALA A CA  1 
ATOM   1073  C C   . ALA A 1 135 ? -31.164 95.716  96.020  1.00 20.00 ? 135  ALA A C   1 
ATOM   1074  O O   . ALA A 1 135 ? -31.107 94.532  95.685  1.00 20.00 ? 135  ALA A O   1 
ATOM   1075  C CB  . ALA A 1 135 ? -29.071 97.026  96.312  1.00 20.00 ? 135  ALA A CB  1 
ATOM   1076  N N   . THR A 1 136 ? -32.057 96.563  95.531  1.00 20.00 ? 136  THR A N   1 
ATOM   1077  C CA  . THR A 1 136 ? -33.053 96.150  94.558  1.00 20.00 ? 136  THR A CA  1 
ATOM   1078  C C   . THR A 1 136 ? -32.694 96.754  93.218  1.00 20.00 ? 136  THR A C   1 
ATOM   1079  O O   . THR A 1 136 ? -32.597 97.974  93.096  1.00 20.00 ? 136  THR A O   1 
ATOM   1080  C CB  . THR A 1 136 ? -34.450 96.642  94.968  1.00 20.00 ? 136  THR A CB  1 
ATOM   1081  O OG1 . THR A 1 136 ? -34.807 96.053  96.226  1.00 20.00 ? 136  THR A OG1 1 
ATOM   1082  C CG2 . THR A 1 136 ? -35.480 96.262  93.921  1.00 20.00 ? 136  THR A CG2 1 
ATOM   1083  N N   . PHE A 1 137 ? -32.504 95.909  92.214  1.00 20.00 ? 137  PHE A N   1 
ATOM   1084  C CA  . PHE A 1 137 ? -32.150 96.393  90.889  1.00 20.00 ? 137  PHE A CA  1 
ATOM   1085  C C   . PHE A 1 137 ? -33.335 96.933  90.109  1.00 20.00 ? 137  PHE A C   1 
ATOM   1086  O O   . PHE A 1 137 ? -34.380 96.298  90.033  1.00 20.00 ? 137  PHE A O   1 
ATOM   1087  C CB  . PHE A 1 137 ? -31.482 95.292  90.062  1.00 20.00 ? 137  PHE A CB  1 
ATOM   1088  C CG  . PHE A 1 137 ? -31.191 95.703  88.644  1.00 20.00 ? 137  PHE A CG  1 
ATOM   1089  C CD1 . PHE A 1 137 ? -30.258 96.701  88.372  1.00 20.00 ? 137  PHE A CD1 1 
ATOM   1090  C CD2 . PHE A 1 137 ? -31.880 95.126  87.579  1.00 20.00 ? 137  PHE A CD2 1 
ATOM   1091  C CE1 . PHE A 1 137 ? -30.020 97.120  87.063  1.00 20.00 ? 137  PHE A CE1 1 
ATOM   1092  C CE2 . PHE A 1 137 ? -31.646 95.540  86.266  1.00 20.00 ? 137  PHE A CE2 1 
ATOM   1093  C CZ  . PHE A 1 137 ? -30.716 96.539  86.010  1.00 20.00 ? 137  PHE A CZ  1 
ATOM   1094  N N   . VAL A 1 138 ? -33.157 98.107  89.518  1.00 20.00 ? 138  VAL A N   1 
ATOM   1095  C CA  . VAL A 1 138 ? -34.210 98.730  88.738  1.00 20.00 ? 138  VAL A CA  1 
ATOM   1096  C C   . VAL A 1 138 ? -33.677 99.048  87.339  1.00 20.00 ? 138  VAL A C   1 
ATOM   1097  O O   . VAL A 1 138 ? -32.747 99.839  87.172  1.00 20.00 ? 138  VAL A O   1 
ATOM   1098  C CB  . VAL A 1 138 ? -34.696 100.029 89.412  1.00 20.00 ? 138  VAL A CB  1 
ATOM   1099  C CG1 . VAL A 1 138 ? -35.745 100.701 88.547  1.00 20.00 ? 138  VAL A CG1 1 
ATOM   1100  C CG2 . VAL A 1 138 ? -35.263 99.719  90.784  1.00 20.00 ? 138  VAL A CG2 1 
ATOM   1101  N N   . ASP A 1 139 ? -34.266 98.413  86.335  1.00 20.00 ? 139  ASP A N   1 
ATOM   1102  C CA  . ASP A 1 139 ? -33.855 98.626  84.955  1.00 20.00 ? 139  ASP A CA  1 
ATOM   1103  C C   . ASP A 1 139 ? -34.452 99.937  84.431  1.00 20.00 ? 139  ASP A C   1 
ATOM   1104  O O   . ASP A 1 139 ? -35.668 100.103 84.413  1.00 20.00 ? 139  ASP A O   1 
ATOM   1105  C CB  . ASP A 1 139 ? -34.335 97.453  84.104  1.00 20.00 ? 139  ASP A CB  1 
ATOM   1106  C CG  . ASP A 1 139 ? -33.713 97.431  82.721  1.00 20.00 ? 139  ASP A CG  1 
ATOM   1107  O OD1 . ASP A 1 139 ? -33.075 98.429  82.319  1.00 20.00 ? 139  ASP A OD1 1 
ATOM   1108  O OD2 . ASP A 1 139 ? -33.868 96.404  82.033  1.00 20.00 ? 139  ASP A OD2 1 
ATOM   1109  N N   . ILE A 1 140 ? -33.605 100.872 84.013  1.00 20.00 ? 140  ILE A N   1 
ATOM   1110  C CA  . ILE A 1 140 ? -34.099 102.139 83.503  1.00 20.00 ? 140  ILE A CA  1 
ATOM   1111  C C   . ILE A 1 140 ? -33.646 102.405 82.073  1.00 20.00 ? 140  ILE A C   1 
ATOM   1112  O O   . ILE A 1 140 ? -33.549 103.547 81.645  1.00 20.00 ? 140  ILE A O   1 
ATOM   1113  C CB  . ILE A 1 140 ? -33.654 103.311 84.398  1.00 20.00 ? 140  ILE A CB  1 
ATOM   1114  C CG1 . ILE A 1 140 ? -32.136 103.310 84.550  1.00 20.00 ? 140  ILE A CG1 1 
ATOM   1115  C CG2 . ILE A 1 140 ? -34.313 103.198 85.764  1.00 20.00 ? 140  ILE A CG2 1 
ATOM   1116  C CD1 . ILE A 1 140 ? -31.592 104.543 85.239  1.00 20.00 ? 140  ILE A CD1 1 
ATOM   1117  N N   . VAL A 1 141 ? -33.365 101.344 81.332  1.00 20.00 ? 141  VAL A N   1 
ATOM   1118  C CA  . VAL A 1 141 ? -32.927 101.486 79.951  1.00 20.00 ? 141  VAL A CA  1 
ATOM   1119  C C   . VAL A 1 141 ? -34.158 101.782 79.106  1.00 20.00 ? 141  VAL A C   1 
ATOM   1120  O O   . VAL A 1 141 ? -35.274 101.514 79.540  1.00 20.00 ? 141  VAL A O   1 
ATOM   1121  C CB  . VAL A 1 141 ? -32.279 100.186 79.442  1.00 20.00 ? 141  VAL A CB  1 
ATOM   1122  C CG1 . VAL A 1 141 ? -33.347 99.159  79.145  1.00 20.00 ? 141  VAL A CG1 1 
ATOM   1123  C CG2 . VAL A 1 141 ? -31.468 100.463 78.198  1.00 20.00 ? 141  VAL A CG2 1 
ATOM   1124  N N   . ARG A 1 142 ? -33.964 102.328 77.907  1.00 20.00 ? 142  ARG A N   1 
ATOM   1125  C CA  . ARG A 1 142 ? -35.097 102.635 77.039  1.00 20.00 ? 142  ARG A CA  1 
ATOM   1126  C C   . ARG A 1 142 ? -35.760 101.332 76.643  1.00 20.00 ? 142  ARG A C   1 
ATOM   1127  O O   . ARG A 1 142 ? -35.103 100.300 76.547  1.00 20.00 ? 142  ARG A O   1 
ATOM   1128  C CB  . ARG A 1 142 ? -34.647 103.400 75.797  1.00 20.00 ? 142  ARG A CB  1 
ATOM   1129  C CG  . ARG A 1 142 ? -33.505 102.780 75.050  1.00 20.00 ? 142  ARG A CG  1 
ATOM   1130  C CD  . ARG A 1 142 ? -33.579 103.177 73.595  1.00 20.00 ? 142  ARG A CD  1 
ATOM   1131  N NE  . ARG A 1 142 ? -32.633 104.233 73.239  1.00 20.00 ? 142  ARG A NE  1 
ATOM   1132  C CZ  . ARG A 1 142 ? -32.929 105.294 72.490  1.00 20.00 ? 142  ARG A CZ  1 
ATOM   1133  N NH1 . ARG A 1 142 ? -34.152 105.463 72.003  1.00 20.00 ? 142  ARG A NH1 1 
ATOM   1134  N NH2 . ARG A 1 142 ? -31.984 106.181 72.205  1.00 20.00 ? 142  ARG A NH2 1 
ATOM   1135  N N   . ASP A 1 143 ? -37.066 101.383 76.415  1.00 20.00 ? 143  ASP A N   1 
ATOM   1136  C CA  . ASP A 1 143 ? -37.824 100.198 76.041  1.00 20.00 ? 143  ASP A CA  1 
ATOM   1137  C C   . ASP A 1 143 ? -37.413 99.558  74.726  1.00 20.00 ? 143  ASP A C   1 
ATOM   1138  O O   . ASP A 1 143 ? -37.499 98.342  74.581  1.00 20.00 ? 143  ASP A O   1 
ATOM   1139  C CB  . ASP A 1 143 ? -39.320 100.526 76.023  1.00 20.00 ? 143  ASP A CB  1 
ATOM   1140  C CG  . ASP A 1 143 ? -39.896 100.711 77.424  1.00 20.00 ? 143  ASP A CG  1 
ATOM   1141  O OD1 . ASP A 1 143 ? -39.589 99.880  78.316  1.00 20.00 ? 143  ASP A OD1 1 
ATOM   1142  O OD2 . ASP A 1 143 ? -40.655 101.688 77.629  1.00 20.00 ? 143  ASP A OD2 1 
ATOM   1143  N N   . GLU A 1 144 ? -36.966 100.366 73.770  1.00 20.00 ? 144  GLU A N   1 
ATOM   1144  C CA  . GLU A 1 144 ? -36.548 99.848  72.468  1.00 20.00 ? 144  GLU A CA  1 
ATOM   1145  C C   . GLU A 1 144 ? -35.385 98.873  72.631  1.00 20.00 ? 144  GLU A C   1 
ATOM   1146  O O   . GLU A 1 144 ? -35.149 98.025  71.774  1.00 20.00 ? 144  GLU A O   1 
ATOM   1147  C CB  . GLU A 1 144 ? -36.114 100.990 71.539  1.00 20.00 ? 144  GLU A CB  1 
ATOM   1148  C CG  . GLU A 1 144 ? -37.216 101.965 71.161  1.00 20.00 ? 144  GLU A CG  1 
ATOM   1149  C CD  . GLU A 1 144 ? -37.415 103.031 72.208  1.00 20.00 ? 144  GLU A CD  1 
ATOM   1150  O OE1 . GLU A 1 144 ? -36.595 103.090 73.143  1.00 20.00 ? 144  GLU A OE1 1 
ATOM   1151  O OE2 . GLU A 1 144 ? -38.386 103.805 72.106  1.00 20.00 ? 144  GLU A OE2 1 
ATOM   1152  N N   . ALA A 1 145 ? -34.656 99.006  73.733  1.00 20.00 ? 145  ALA A N   1 
ATOM   1153  C CA  . ALA A 1 145 ? -33.523 98.139  74.005  1.00 20.00 ? 145  ALA A CA  1 
ATOM   1154  C C   . ALA A 1 145 ? -33.994 96.698  74.083  1.00 20.00 ? 145  ALA A C   1 
ATOM   1155  O O   . ALA A 1 145 ? -33.242 95.768  73.787  1.00 20.00 ? 145  ALA A O   1 
ATOM   1156  C CB  . ALA A 1 145 ? -32.866 98.541  75.313  1.00 20.00 ? 145  ALA A CB  1 
ATOM   1157  N N   . HIS A 1 146 ? -35.250 96.518  74.479  1.00 20.00 ? 146  HIS A N   1 
ATOM   1158  C CA  . HIS A 1 146 ? -35.837 95.185  74.602  1.00 20.00 ? 146  HIS A CA  1 
ATOM   1159  C C   . HIS A 1 146 ? -36.404 94.622  73.305  1.00 20.00 ? 146  HIS A C   1 
ATOM   1160  O O   . HIS A 1 146 ? -36.904 93.504  73.281  1.00 20.00 ? 146  HIS A O   1 
ATOM   1161  C CB  . HIS A 1 146 ? -36.926 95.200  75.670  1.00 20.00 ? 146  HIS A CB  1 
ATOM   1162  C CG  . HIS A 1 146 ? -36.416 95.531  77.037  1.00 20.00 ? 146  HIS A CG  1 
ATOM   1163  N ND1 . HIS A 1 146 ? -36.425 96.814  77.544  1.00 20.00 ? 146  HIS A ND1 1 
ATOM   1164  C CD2 . HIS A 1 146 ? -35.874 94.748  78.000  1.00 20.00 ? 146  HIS A CD2 1 
ATOM   1165  C CE1 . HIS A 1 146 ? -35.910 96.805  78.761  1.00 20.00 ? 146  HIS A CE1 1 
ATOM   1166  N NE2 . HIS A 1 146 ? -35.568 95.565  79.061  1.00 20.00 ? 146  HIS A NE2 1 
ATOM   1167  N N   . ASP A 1 147 ? -36.326 95.399  72.229  1.00 20.00 ? 147  ASP A N   1 
ATOM   1168  C CA  . ASP A 1 147 ? -36.828 94.974  70.929  1.00 20.00 ? 147  ASP A CA  1 
ATOM   1169  C C   . ASP A 1 147 ? -35.636 94.500  70.113  1.00 20.00 ? 147  ASP A C   1 
ATOM   1170  O O   . ASP A 1 147 ? -34.933 95.305  69.513  1.00 20.00 ? 147  ASP A O   1 
ATOM   1171  C CB  . ASP A 1 147 ? -37.507 96.145  70.213  1.00 20.00 ? 147  ASP A CB  1 
ATOM   1172  C CG  . ASP A 1 147 ? -38.386 95.699  69.049  1.00 20.00 ? 147  ASP A CG  1 
ATOM   1173  O OD1 . ASP A 1 147 ? -38.259 94.539  68.595  1.00 20.00 ? 147  ASP A OD1 1 
ATOM   1174  O OD2 . ASP A 1 147 ? -39.209 96.522  68.589  1.00 20.00 ? 147  ASP A OD2 1 
ATOM   1175  N N   . ALA A 1 148 ? -35.418 93.191  70.090  1.00 20.00 ? 148  ALA A N   1 
ATOM   1176  C CA  . ALA A 1 148 ? -34.307 92.600  69.355  1.00 20.00 ? 148  ALA A CA  1 
ATOM   1177  C C   . ALA A 1 148 ? -34.364 92.801  67.848  1.00 20.00 ? 148  ALA A C   1 
ATOM   1178  O O   . ALA A 1 148 ? -33.376 92.590  67.154  1.00 20.00 ? 148  ALA A O   1 
ATOM   1179  C CB  . ALA A 1 148 ? -34.229 91.127  69.664  1.00 20.00 ? 148  ALA A CB  1 
ATOM   1180  N N   . SER A 1 149 ? -35.519 93.210  67.342  1.00 20.00 ? 149  SER A N   1 
ATOM   1181  C CA  . SER A 1 149 ? -35.677 93.427  65.910  1.00 20.00 ? 149  SER A CA  1 
ATOM   1182  C C   . SER A 1 149 ? -35.509 94.880  65.500  1.00 20.00 ? 149  SER A C   1 
ATOM   1183  O O   . SER A 1 149 ? -35.199 95.167  64.346  1.00 20.00 ? 149  SER A O   1 
ATOM   1184  C CB  . SER A 1 149 ? -37.050 92.928  65.454  1.00 20.00 ? 149  SER A CB  1 
ATOM   1185  O OG  . SER A 1 149 ? -37.039 91.518  65.295  1.00 20.00 ? 149  SER A OG  1 
ATOM   1186  N N   . LEU A 1 150 ? -35.714 95.792  66.445  1.00 20.00 ? 150  LEU A N   1 
ATOM   1187  C CA  . LEU A 1 150 ? -35.589 97.219  66.177  1.00 20.00 ? 150  LEU A CA  1 
ATOM   1188  C C   . LEU A 1 150 ? -34.151 97.626  65.894  1.00 20.00 ? 150  LEU A C   1 
ATOM   1189  O O   . LEU A 1 150 ? -33.301 97.614  66.783  1.00 20.00 ? 150  LEU A O   1 
ATOM   1190  C CB  . LEU A 1 150 ? -36.130 98.021  67.362  1.00 20.00 ? 150  LEU A CB  1 
ATOM   1191  C CG  . LEU A 1 150 ? -36.399 99.507  67.117  1.00 20.00 ? 150  LEU A CG  1 
ATOM   1192  C CD1 . LEU A 1 150 ? -37.254 99.679  65.870  1.00 20.00 ? 150  LEU A CD1 1 
ATOM   1193  C CD2 . LEU A 1 150 ? -37.097 100.100 68.330  1.00 20.00 ? 150  LEU A CD2 1 
ATOM   1194  N N   . ASN A 1 151 ? -33.889 97.982  64.642  1.00 20.00 ? 151  ASN A N   1 
ATOM   1195  C CA  . ASN A 1 151 ? -32.563 98.395  64.230  1.00 20.00 ? 151  ASN A CA  1 
ATOM   1196  C C   . ASN A 1 151 ? -32.400 99.877  64.512  1.00 20.00 ? 151  ASN A C   1 
ATOM   1197  O O   . ASN A 1 151 ? -32.529 100.703 63.614  1.00 20.00 ? 151  ASN A O   1 
ATOM   1198  C CB  . ASN A 1 151 ? -32.376 98.139  62.743  1.00 20.00 ? 151  ASN A CB  1 
ATOM   1199  C CG  . ASN A 1 151 ? -30.966 98.406  62.285  1.00 20.00 ? 151  ASN A CG  1 
ATOM   1200  O OD1 . ASN A 1 151 ? -30.404 99.464  62.554  1.00 20.00 ? 151  ASN A OD1 1 
ATOM   1201  N ND2 . ASN A 1 151 ? -30.379 97.440  61.589  1.00 20.00 ? 151  ASN A ND2 1 
ATOM   1202  N N   . LEU A 1 152 ? -32.112 100.215 65.761  1.00 20.00 ? 152  LEU A N   1 
ATOM   1203  C CA  . LEU A 1 152 ? -31.941 101.609 66.131  1.00 20.00 ? 152  LEU A CA  1 
ATOM   1204  C C   . LEU A 1 152 ? -30.597 101.808 66.833  1.00 20.00 ? 152  LEU A C   1 
ATOM   1205  O O   . LEU A 1 152 ? -30.105 100.911 67.514  1.00 20.00 ? 152  LEU A O   1 
ATOM   1206  C CB  . LEU A 1 152 ? -33.119 102.038 67.018  1.00 20.00 ? 152  LEU A CB  1 
ATOM   1207  C CG  . LEU A 1 152 ? -32.898 102.822 68.309  1.00 20.00 ? 152  LEU A CG  1 
ATOM   1208  C CD1 . LEU A 1 152 ? -33.458 104.224 68.147  1.00 20.00 ? 152  LEU A CD1 1 
ATOM   1209  C CD2 . LEU A 1 152 ? -33.584 102.110 69.467  1.00 20.00 ? 152  LEU A CD2 1 
ATOM   1210  N N   . PRO A 1 153 ? -29.972 102.980 66.644  1.00 20.00 ? 153  PRO A N   1 
ATOM   1211  C CA  . PRO A 1 153 ? -28.680 103.279 67.264  1.00 20.00 ? 153  PRO A CA  1 
ATOM   1212  C C   . PRO A 1 153 ? -28.796 103.600 68.754  1.00 20.00 ? 153  PRO A C   1 
ATOM   1213  O O   . PRO A 1 153 ? -29.859 104.023 69.230  1.00 20.00 ? 153  PRO A O   1 
ATOM   1214  C CB  . PRO A 1 153 ? -28.175 104.474 66.466  1.00 20.00 ? 153  PRO A CB  1 
ATOM   1215  C CG  . PRO A 1 153 ? -29.419 105.178 66.064  1.00 20.00 ? 153  PRO A CG  1 
ATOM   1216  C CD  . PRO A 1 153 ? -30.444 104.100 65.814  1.00 20.00 ? 153  PRO A CD  1 
ATOM   1217  N N   . PHE A 1 154 ? -27.693 103.396 69.474  1.00 20.00 ? 154  PHE A N   1 
ATOM   1218  C CA  . PHE A 1 154 ? -27.626 103.653 70.907  1.00 20.00 ? 154  PHE A CA  1 
ATOM   1219  C C   . PHE A 1 154 ? -28.824 103.119 71.684  1.00 20.00 ? 154  PHE A C   1 
ATOM   1220  O O   . PHE A 1 154 ? -29.497 103.866 72.403  1.00 20.00 ? 154  PHE A O   1 
ATOM   1221  C CB  . PHE A 1 154 ? -27.459 105.155 71.151  1.00 20.00 ? 154  PHE A CB  1 
ATOM   1222  C CG  . PHE A 1 154 ? -26.246 105.731 70.487  1.00 20.00 ? 154  PHE A CG  1 
ATOM   1223  C CD1 . PHE A 1 154 ? -24.970 105.425 70.957  1.00 20.00 ? 154  PHE A CD1 1 
ATOM   1224  C CD2 . PHE A 1 154 ? -26.370 106.554 69.377  1.00 20.00 ? 154  PHE A CD2 1 
ATOM   1225  C CE1 . PHE A 1 154 ? -23.826 105.929 70.330  1.00 20.00 ? 154  PHE A CE1 1 
ATOM   1226  C CE2 . PHE A 1 154 ? -25.239 107.069 68.735  1.00 20.00 ? 154  PHE A CE2 1 
ATOM   1227  C CZ  . PHE A 1 154 ? -23.961 106.755 69.212  1.00 20.00 ? 154  PHE A CZ  1 
ATOM   1228  N N   . LYS A 1 155 ? -29.076 101.820 71.538  1.00 20.00 ? 155  LYS A N   1 
ATOM   1229  C CA  . LYS A 1 155 ? -30.184 101.153 72.217  1.00 20.00 ? 155  LYS A CA  1 
ATOM   1230  C C   . LYS A 1 155 ? -29.894 100.966 73.707  1.00 20.00 ? 155  LYS A C   1 
ATOM   1231  O O   . LYS A 1 155 ? -30.757 100.524 74.470  1.00 20.00 ? 155  LYS A O   1 
ATOM   1232  C CB  . LYS A 1 155 ? -30.429 99.780  71.592  1.00 20.00 ? 155  LYS A CB  1 
ATOM   1233  C CG  . LYS A 1 155 ? -31.410 99.771  70.440  1.00 20.00 ? 155  LYS A CG  1 
ATOM   1234  C CD  . LYS A 1 155 ? -31.361 98.433  69.716  1.00 20.00 ? 155  LYS A CD  1 
ATOM   1235  C CE  . LYS A 1 155 ? -32.674 97.686  69.831  1.00 20.00 ? 155  LYS A CE  1 
ATOM   1236  N NZ  . LYS A 1 155 ? -32.571 96.319  69.264  1.00 20.00 ? 155  LYS A NZ  1 
ATOM   1237  N N   . GLY A 1 156 ? -28.671 101.289 74.112  1.00 20.00 ? 156  GLY A N   1 
ATOM   1238  C CA  . GLY A 1 156 ? -28.299 101.142 75.503  1.00 20.00 ? 156  GLY A CA  1 
ATOM   1239  C C   . GLY A 1 156 ? -28.557 102.386 76.323  1.00 20.00 ? 156  GLY A C   1 
ATOM   1240  O O   . GLY A 1 156 ? -28.342 102.383 77.539  1.00 20.00 ? 156  GLY A O   1 
ATOM   1241  N N   . ASP A 1 157 ? -29.022 103.444 75.660  1.00 20.00 ? 157  ASP A N   1 
ATOM   1242  C CA  . ASP A 1 157 ? -29.309 104.704 76.333  1.00 20.00 ? 157  ASP A CA  1 
ATOM   1243  C C   . ASP A 1 157 ? -30.290 104.507 77.476  1.00 20.00 ? 157  ASP A C   1 
ATOM   1244  O O   . ASP A 1 157 ? -31.184 103.665 77.410  1.00 20.00 ? 157  ASP A O   1 
ATOM   1245  C CB  . ASP A 1 157 ? -29.880 105.725 75.345  1.00 20.00 ? 157  ASP A CB  1 
ATOM   1246  C CG  . ASP A 1 157 ? -28.800 106.530 74.642  1.00 20.00 ? 157  ASP A CG  1 
ATOM   1247  O OD1 . ASP A 1 157 ? -27.606 106.198 74.799  1.00 20.00 ? 157  ASP A OD1 1 
ATOM   1248  O OD2 . ASP A 1 157 ? -29.142 107.499 73.932  1.00 20.00 ? 157  ASP A OD2 1 
ATOM   1249  N N   . ILE A 1 158 ? -30.101 105.288 78.530  1.00 20.00 ? 158  ILE A N   1 
ATOM   1250  C CA  . ILE A 1 158 ? -30.951 105.231 79.705  1.00 20.00 ? 158  ILE A CA  1 
ATOM   1251  C C   . ILE A 1 158 ? -32.167 106.124 79.443  1.00 20.00 ? 158  ILE A C   1 
ATOM   1252  O O   . ILE A 1 158 ? -32.054 107.153 78.776  1.00 20.00 ? 158  ILE A O   1 
ATOM   1253  C CB  . ILE A 1 158 ? -30.181 105.755 80.938  1.00 20.00 ? 158  ILE A CB  1 
ATOM   1254  C CG1 . ILE A 1 158 ? -29.445 104.602 81.611  1.00 20.00 ? 158  ILE A CG1 1 
ATOM   1255  C CG2 . ILE A 1 158 ? -31.125 106.456 81.905  1.00 20.00 ? 158  ILE A CG2 1 
ATOM   1256  C CD1 . ILE A 1 158 ? -28.575 105.040 82.774  1.00 20.00 ? 158  ILE A CD1 1 
ATOM   1257  N N   . ASP A 1 159 ? -33.330 105.718 79.940  1.00 20.00 ? 159  ASP A N   1 
ATOM   1258  C CA  . ASP A 1 159 ? -34.544 106.510 79.750  1.00 20.00 ? 159  ASP A CA  1 
ATOM   1259  C C   . ASP A 1 159 ? -34.599 107.478 80.932  1.00 20.00 ? 159  ASP A C   1 
ATOM   1260  O O   . ASP A 1 159 ? -34.892 107.087 82.066  1.00 20.00 ? 159  ASP A O   1 
ATOM   1261  C CB  . ASP A 1 159 ? -35.781 105.611 79.740  1.00 20.00 ? 159  ASP A CB  1 
ATOM   1262  C CG  . ASP A 1 159 ? -37.061 106.373 79.416  1.00 20.00 ? 159  ASP A CG  1 
ATOM   1263  O OD1 . ASP A 1 159 ? -37.164 107.576 79.754  1.00 20.00 ? 159  ASP A OD1 1 
ATOM   1264  O OD2 . ASP A 1 159 ? -37.966 105.754 78.822  1.00 20.00 ? 159  ASP A OD2 1 
ATOM   1265  N N   . LEU A 1 160 ? -34.296 108.739 80.657  1.00 20.00 ? 160  LEU A N   1 
ATOM   1266  C CA  . LEU A 1 160 ? -34.295 109.766 81.680  1.00 20.00 ? 160  LEU A CA  1 
ATOM   1267  C C   . LEU A 1 160 ? -35.627 109.961 82.388  1.00 20.00 ? 160  LEU A C   1 
ATOM   1268  O O   . LEU A 1 160 ? -35.662 110.465 83.509  1.00 20.00 ? 160  LEU A O   1 
ATOM   1269  C CB  . LEU A 1 160 ? -33.811 111.082 81.078  1.00 20.00 ? 160  LEU A CB  1 
ATOM   1270  C CG  . LEU A 1 160 ? -32.321 111.026 80.743  1.00 20.00 ? 160  LEU A CG  1 
ATOM   1271  C CD1 . LEU A 1 160 ? -32.011 111.949 79.590  1.00 20.00 ? 160  LEU A CD1 1 
ATOM   1272  C CD2 . LEU A 1 160 ? -31.519 111.409 81.973  1.00 20.00 ? 160  LEU A CD2 1 
ATOM   1273  N N   . ASN A 1 161 ? -36.722 109.562 81.746  1.00 20.00 ? 161  ASN A N   1 
ATOM   1274  C CA  . ASN A 1 161 ? -38.035 109.711 82.357  1.00 20.00 ? 161  ASN A CA  1 
ATOM   1275  C C   . ASN A 1 161 ? -38.193 108.648 83.425  1.00 20.00 ? 161  ASN A C   1 
ATOM   1276  O O   . ASN A 1 161 ? -38.776 108.897 84.478  1.00 20.00 ? 161  ASN A O   1 
ATOM   1277  C CB  . ASN A 1 161 ? -39.134 109.552 81.315  1.00 20.00 ? 161  ASN A CB  1 
ATOM   1278  C CG  . ASN A 1 161 ? -39.164 110.693 80.331  1.00 20.00 ? 161  ASN A CG  1 
ATOM   1279  O OD1 . ASN A 1 161 ? -39.341 110.485 79.131  1.00 20.00 ? 161  ASN A OD1 1 
ATOM   1280  N ND2 . ASN A 1 161 ? -38.990 111.912 80.830  1.00 20.00 ? 161  ASN A ND2 1 
ATOM   1281  N N   . LYS A 1 162 ? -37.681 107.455 83.142  1.00 20.00 ? 162  LYS A N   1 
ATOM   1282  C CA  . LYS A 1 162 ? -37.765 106.355 84.092  1.00 20.00 ? 162  LYS A CA  1 
ATOM   1283  C C   . LYS A 1 162 ? -36.867 106.681 85.280  1.00 20.00 ? 162  LYS A C   1 
ATOM   1284  O O   . LYS A 1 162 ? -37.190 106.359 86.418  1.00 20.00 ? 162  LYS A O   1 
ATOM   1285  C CB  . LYS A 1 162 ? -37.300 105.057 83.446  1.00 20.00 ? 162  LYS A CB  1 
ATOM   1286  C CG  . LYS A 1 162 ? -38.192 104.551 82.337  1.00 20.00 ? 162  LYS A CG  1 
ATOM   1287  C CD  . LYS A 1 162 ? -37.740 103.184 81.881  1.00 20.00 ? 162  LYS A CD  1 
ATOM   1288  C CE  . LYS A 1 162 ? -38.537 102.699 80.696  1.00 20.00 ? 162  LYS A CE  1 
ATOM   1289  N NZ  . LYS A 1 162 ? -38.360 101.226 80.541  1.00 20.00 ? 162  LYS A NZ  1 
ATOM   1290  N N   . LEU A 1 163 ? -35.732 107.318 85.010  1.00 20.00 ? 163  LEU A N   1 
ATOM   1291  C CA  . LEU A 1 163 ? -34.802 107.682 86.072  1.00 20.00 ? 163  LEU A CA  1 
ATOM   1292  C C   . LEU A 1 163 ? -35.445 108.735 86.978  1.00 20.00 ? 163  LEU A C   1 
ATOM   1293  O O   . LEU A 1 163 ? -35.519 108.561 88.193  1.00 20.00 ? 163  LEU A O   1 
ATOM   1294  C CB  . LEU A 1 163 ? -33.495 108.232 85.475  1.00 20.00 ? 163  LEU A CB  1 
ATOM   1295  C CG  . LEU A 1 163 ? -32.497 108.872 86.456  1.00 20.00 ? 163  LEU A CG  1 
ATOM   1296  C CD1 . LEU A 1 163 ? -32.062 107.841 87.482  1.00 20.00 ? 163  LEU A CD1 1 
ATOM   1297  C CD2 . LEU A 1 163 ? -31.294 109.423 85.704  1.00 20.00 ? 163  LEU A CD2 1 
ATOM   1298  N N   . ALA A 1 164 ? -35.912 109.824 86.376  1.00 20.00 ? 164  ALA A N   1 
ATOM   1299  C CA  . ALA A 1 164 ? -36.550 110.909 87.122  1.00 20.00 ? 164  ALA A CA  1 
ATOM   1300  C C   . ALA A 1 164 ? -37.719 110.399 87.963  1.00 20.00 ? 164  ALA A C   1 
ATOM   1301  O O   . ALA A 1 164 ? -37.937 110.850 89.088  1.00 20.00 ? 164  ALA A O   1 
ATOM   1302  C CB  . ALA A 1 164 ? -37.031 111.987 86.159  1.00 20.00 ? 164  ALA A CB  1 
ATOM   1303  N N   . THR A 1 165 ? -38.469 109.457 87.408  1.00 20.00 ? 165  THR A N   1 
ATOM   1304  C CA  . THR A 1 165 ? -39.611 108.885 88.105  1.00 20.00 ? 165  THR A CA  1 
ATOM   1305  C C   . THR A 1 165 ? -39.145 108.109 89.330  1.00 20.00 ? 165  THR A C   1 
ATOM   1306  O O   . THR A 1 165 ? -39.736 108.201 90.403  1.00 20.00 ? 165  THR A O   1 
ATOM   1307  C CB  . THR A 1 165 ? -40.389 107.938 87.186  1.00 20.00 ? 165  THR A CB  1 
ATOM   1308  O OG1 . THR A 1 165 ? -41.031 108.701 86.160  1.00 20.00 ? 165  THR A OG1 1 
ATOM   1309  C CG2 . THR A 1 165 ? -41.435 107.167 87.973  1.00 20.00 ? 165  THR A CG2 1 
ATOM   1310  N N   . LEU A 1 166 ? -38.081 107.337 89.153  1.00 20.00 ? 166  LEU A N   1 
ATOM   1311  C CA  . LEU A 1 166 ? -37.514 106.535 90.227  1.00 20.00 ? 166  LEU A CA  1 
ATOM   1312  C C   . LEU A 1 166 ? -37.155 107.484 91.356  1.00 20.00 ? 166  LEU A C   1 
ATOM   1313  O O   . LEU A 1 166 ? -37.552 107.291 92.503  1.00 20.00 ? 166  LEU A O   1 
ATOM   1314  C CB  . LEU A 1 166 ? -36.247 105.828 89.730  1.00 20.00 ? 166  LEU A CB  1 
ATOM   1315  C CG  . LEU A 1 166 ? -35.845 104.449 90.261  1.00 20.00 ? 166  LEU A CG  1 
ATOM   1316  C CD1 . LEU A 1 166 ? -34.325 104.331 90.250  1.00 20.00 ? 166  LEU A CD1 1 
ATOM   1317  C CD2 . LEU A 1 166 ? -36.386 104.246 91.661  1.00 20.00 ? 166  LEU A CD2 1 
ATOM   1318  N N   . ILE A 1 167 ? -36.401 108.519 91.007  1.00 20.00 ? 167  ILE A N   1 
ATOM   1319  C CA  . ILE A 1 167 ? -35.968 109.516 91.968  1.00 20.00 ? 167  ILE A CA  1 
ATOM   1320  C C   . ILE A 1 167 ? -37.170 110.103 92.684  1.00 20.00 ? 167  ILE A C   1 
ATOM   1321  O O   . ILE A 1 167 ? -37.138 110.322 93.894  1.00 20.00 ? 167  ILE A O   1 
ATOM   1322  C CB  . ILE A 1 167 ? -35.182 110.646 91.269  1.00 20.00 ? 167  ILE A CB  1 
ATOM   1323  C CG1 . ILE A 1 167 ? -33.871 110.088 90.714  1.00 20.00 ? 167  ILE A CG1 1 
ATOM   1324  C CG2 . ILE A 1 167 ? -34.901 111.773 92.241  1.00 20.00 ? 167  ILE A CG2 1 
ATOM   1325  C CD1 . ILE A 1 167 ? -33.096 111.071 89.881  1.00 20.00 ? 167  ILE A CD1 1 
ATOM   1326  N N   . LYS A 1 168 ? -38.240 110.337 91.935  1.00 20.00 ? 168  LYS A N   1 
ATOM   1327  C CA  . LYS A 1 168 ? -39.454 110.904 92.502  1.00 20.00 ? 168  LYS A CA  1 
ATOM   1328  C C   . LYS A 1 168 ? -40.222 109.949 93.409  1.00 20.00 ? 168  LYS A C   1 
ATOM   1329  O O   . LYS A 1 168 ? -40.642 110.327 94.499  1.00 20.00 ? 168  LYS A O   1 
ATOM   1330  C CB  . LYS A 1 168 ? -40.361 111.401 91.371  1.00 20.00 ? 168  LYS A CB  1 
ATOM   1331  C CG  . LYS A 1 168 ? -41.794 111.691 91.778  1.00 20.00 ? 168  LYS A CG  1 
ATOM   1332  C CD  . LYS A 1 168 ? -42.769 111.250 90.689  1.00 20.00 ? 168  LYS A CD  1 
ATOM   1333  C CE  . LYS A 1 168 ? -43.012 112.358 89.667  1.00 20.00 ? 168  LYS A CE  1 
ATOM   1334  N NZ  . LYS A 1 168 ? -41.861 112.538 88.726  1.00 20.00 ? 168  LYS A NZ  1 
ATOM   1335  N N   . GLU A 1 169 ? -40.398 108.710 92.974  1.00 20.00 ? 169  GLU A N   1 
ATOM   1336  C CA  . GLU A 1 169 ? -41.127 107.738 93.777  1.00 20.00 ? 169  GLU A CA  1 
ATOM   1337  C C   . GLU A 1 169 ? -40.356 107.104 94.935  1.00 20.00 ? 169  GLU A C   1 
ATOM   1338  O O   . GLU A 1 169 ? -40.971 106.583 95.864  1.00 20.00 ? 169  GLU A O   1 
ATOM   1339  C CB  . GLU A 1 169 ? -41.682 106.631 92.875  1.00 20.00 ? 169  GLU A CB  1 
ATOM   1340  C CG  . GLU A 1 169 ? -42.138 107.111 91.501  1.00 20.00 ? 169  GLU A CG  1 
ATOM   1341  C CD  . GLU A 1 169 ? -43.652 107.129 91.356  1.00 20.00 ? 169  GLU A CD  1 
ATOM   1342  O OE1 . GLU A 1 169 ? -44.315 106.265 91.968  1.00 20.00 ? 169  GLU A OE1 1 
ATOM   1343  O OE2 . GLU A 1 169 ? -44.177 108.004 90.631  1.00 20.00 ? 169  GLU A OE2 1 
ATOM   1344  N N   . LYS A 1 170 ? -39.025 107.143 94.899  1.00 20.00 ? 170  LYS A N   1 
ATOM   1345  C CA  . LYS A 1 170 ? -38.236 106.544 95.979  1.00 20.00 ? 170  LYS A CA  1 
ATOM   1346  C C   . LYS A 1 170 ? -37.369 107.517 96.764  1.00 20.00 ? 170  LYS A C   1 
ATOM   1347  O O   . LYS A 1 170 ? -37.028 107.257 97.914  1.00 20.00 ? 170  LYS A O   1 
ATOM   1348  C CB  . LYS A 1 170 ? -37.348 105.430 95.429  1.00 20.00 ? 170  LYS A CB  1 
ATOM   1349  C CG  . LYS A 1 170 ? -38.082 104.410 94.584  1.00 20.00 ? 170  LYS A CG  1 
ATOM   1350  C CD  . LYS A 1 170 ? -38.867 103.445 95.443  1.00 20.00 ? 170  LYS A CD  1 
ATOM   1351  C CE  . LYS A 1 170 ? -39.654 102.484 94.576  1.00 20.00 ? 170  LYS A CE  1 
ATOM   1352  N NZ  . LYS A 1 170 ? -40.527 101.594 95.389  1.00 20.00 ? 170  LYS A NZ  1 
ATOM   1353  N N   . GLY A 1 171 ? -36.997 108.628 96.147  1.00 20.00 ? 171  GLY A N   1 
ATOM   1354  C CA  . GLY A 1 171 ? -36.170 109.586 96.850  1.00 20.00 ? 171  GLY A CA  1 
ATOM   1355  C C   . GLY A 1 171 ? -34.702 109.318 96.614  1.00 20.00 ? 171  GLY A C   1 
ATOM   1356  O O   . GLY A 1 171 ? -34.246 108.179 96.707  1.00 20.00 ? 171  GLY A O   1 
ATOM   1357  N N   . ALA A 1 172 ? -33.965 110.381 96.310  1.00 20.00 ? 172  ALA A N   1 
ATOM   1358  C CA  . ALA A 1 172 ? -32.533 110.301 96.050  1.00 20.00 ? 172  ALA A CA  1 
ATOM   1359  C C   . ALA A 1 172 ? -31.774 109.538 97.131  1.00 20.00 ? 172  ALA A C   1 
ATOM   1360  O O   . ALA A 1 172 ? -30.883 108.753 96.820  1.00 20.00 ? 172  ALA A O   1 
ATOM   1361  C CB  . ALA A 1 172 ? -31.960 111.707 95.900  1.00 20.00 ? 172  ALA A CB  1 
ATOM   1362  N N   . GLU A 1 173 ? -32.131 109.763 98.394  1.00 20.00 ? 173  GLU A N   1 
ATOM   1363  C CA  . GLU A 1 173 ? -31.471 109.094 99.519  1.00 20.00 ? 173  GLU A CA  1 
ATOM   1364  C C   . GLU A 1 173 ? -31.567 107.587 99.469  1.00 20.00 ? 173  GLU A C   1 
ATOM   1365  O O   . GLU A 1 173 ? -30.789 106.891 100.122 1.00 20.00 ? 173  GLU A O   1 
ATOM   1366  C CB  . GLU A 1 173 ? -32.067 109.519 100.872 1.00 20.00 ? 173  GLU A CB  1 
ATOM   1367  C CG  . GLU A 1 173 ? -32.840 110.822 100.905 1.00 20.00 ? 173  GLU A CG  1 
ATOM   1368  C CD  . GLU A 1 173 ? -34.317 110.680 100.574 1.00 20.00 ? 173  GLU A CD  1 
ATOM   1369  O OE1 . GLU A 1 173 ? -35.057 109.983 101.307 1.00 20.00 ? 173  GLU A OE1 1 
ATOM   1370  O OE2 . GLU A 1 173 ? -34.734 111.292 99.570  1.00 20.00 ? 173  GLU A OE2 1 
ATOM   1371  N N   . ASN A 1 174 ? -32.529 107.075 98.714  1.00 20.00 ? 174  ASN A N   1 
ATOM   1372  C CA  . ASN A 1 174 ? -32.705 105.627 98.616  1.00 20.00 ? 174  ASN A CA  1 
ATOM   1373  C C   . ASN A 1 174 ? -32.099 104.942 97.398  1.00 20.00 ? 174  ASN A C   1 
ATOM   1374  O O   . ASN A 1 174 ? -32.275 103.743 97.203  1.00 20.00 ? 174  ASN A O   1 
ATOM   1375  C CB  . ASN A 1 174 ? -34.187 105.302 98.728  1.00 20.00 ? 174  ASN A CB  1 
ATOM   1376  C CG  . ASN A 1 174 ? -34.759 105.759 100.044 1.00 20.00 ? 174  ASN A CG  1 
ATOM   1377  O OD1 . ASN A 1 174 ? -34.141 105.571 101.092 1.00 20.00 ? 174  ASN A OD1 1 
ATOM   1378  N ND2 . ASN A 1 174 ? -35.930 106.374 100.005 1.00 20.00 ? 174  ASN A ND2 1 
ATOM   1379  N N   . ILE A 1 175 ? -31.378 105.703 96.588  1.00 20.00 ? 175  ILE A N   1 
ATOM   1380  C CA  . ILE A 1 175 ? -30.744 105.160 95.398  1.00 20.00 ? 175  ILE A CA  1 
ATOM   1381  C C   . ILE A 1 175 ? -29.245 105.124 95.680  1.00 20.00 ? 175  ILE A C   1 
ATOM   1382  O O   . ILE A 1 175 ? -28.602 106.171 95.704  1.00 20.00 ? 175  ILE A O   1 
ATOM   1383  C CB  . ILE A 1 175 ? -31.016 106.055 94.174  1.00 20.00 ? 175  ILE A CB  1 
ATOM   1384  C CG1 . ILE A 1 175 ? -32.512 106.050 93.854  1.00 20.00 ? 175  ILE A CG1 1 
ATOM   1385  C CG2 . ILE A 1 175 ? -30.207 105.572 92.982  1.00 20.00 ? 175  ILE A CG2 1 
ATOM   1386  C CD1 . ILE A 1 175 ? -32.943 107.156 92.927  1.00 20.00 ? 175  ILE A CD1 1 
ATOM   1387  N N   . ALA A 1 176 ? -28.698 103.928 95.904  1.00 20.00 ? 176  ALA A N   1 
ATOM   1388  C CA  . ALA A 1 176 ? -27.268 103.768 96.188  1.00 20.00 ? 176  ALA A CA  1 
ATOM   1389  C C   . ALA A 1 176 ? -26.432 104.451 95.114  1.00 20.00 ? 176  ALA A C   1 
ATOM   1390  O O   . ALA A 1 176 ? -25.542 105.244 95.419  1.00 20.00 ? 176  ALA A O   1 
ATOM   1391  C CB  . ALA A 1 176 ? -26.910 102.293 96.268  1.00 20.00 ? 176  ALA A CB  1 
ATOM   1392  N N   . TYR A 1 177 ? -26.726 104.129 93.858  1.00 20.00 ? 177  TYR A N   1 
ATOM   1393  C CA  . TYR A 1 177 ? -26.026 104.700 92.721  1.00 20.00 ? 177  TYR A CA  1 
ATOM   1394  C C   . TYR A 1 177 ? -26.628 104.206 91.413  1.00 20.00 ? 177  TYR A C   1 
ATOM   1395  O O   . TYR A 1 177 ? -27.412 103.258 91.391  1.00 20.00 ? 177  TYR A O   1 
ATOM   1396  C CB  . TYR A 1 177 ? -24.522 104.357 92.765  1.00 20.00 ? 177  TYR A CB  1 
ATOM   1397  C CG  . TYR A 1 177 ? -24.181 102.874 92.713  1.00 20.00 ? 177  TYR A CG  1 
ATOM   1398  C CD1 . TYR A 1 177 ? -24.036 102.205 91.492  1.00 20.00 ? 177  TYR A CD1 1 
ATOM   1399  C CD2 . TYR A 1 177 ? -23.991 102.140 93.889  1.00 20.00 ? 177  TYR A CD2 1 
ATOM   1400  C CE1 . TYR A 1 177 ? -23.711 100.836 91.447  1.00 20.00 ? 177  TYR A CE1 1 
ATOM   1401  C CE2 . TYR A 1 177 ? -23.668 100.778 93.853  1.00 20.00 ? 177  TYR A CE2 1 
ATOM   1402  C CZ  . TYR A 1 177 ? -23.531 100.135 92.631  1.00 20.00 ? 177  TYR A CZ  1 
ATOM   1403  O OH  . TYR A 1 177 ? -23.220 98.793  92.602  1.00 20.00 ? 177  TYR A OH  1 
ATOM   1404  N N   . ILE A 1 178 ? -26.265 104.871 90.321  1.00 20.00 ? 178  ILE A N   1 
ATOM   1405  C CA  . ILE A 1 178 ? -26.750 104.509 89.001  1.00 20.00 ? 178  ILE A CA  1 
ATOM   1406  C C   . ILE A 1 178 ? -25.598 103.748 88.344  1.00 20.00 ? 178  ILE A C   1 
ATOM   1407  O O   . ILE A 1 178 ? -24.490 104.270 88.245  1.00 20.00 ? 178  ILE A O   1 
ATOM   1408  C CB  . ILE A 1 178 ? -27.070 105.758 88.168  1.00 20.00 ? 178  ILE A CB  1 
ATOM   1409  C CG1 . ILE A 1 178 ? -28.369 106.390 88.657  1.00 20.00 ? 178  ILE A CG1 1 
ATOM   1410  C CG2 . ILE A 1 178 ? -27.205 105.402 86.701  1.00 20.00 ? 178  ILE A CG2 1 
ATOM   1411  C CD1 . ILE A 1 178 ? -28.551 107.809 88.166  1.00 20.00 ? 178  ILE A CD1 1 
ATOM   1412  N N   . CYS A 1 179 ? -25.857 102.514 87.921  1.00 20.00 ? 179  CYS A N   1 
ATOM   1413  C CA  . CYS A 1 179 ? -24.839 101.687 87.275  1.00 20.00 ? 179  CYS A CA  1 
ATOM   1414  C C   . CYS A 1 179 ? -25.023 101.763 85.768  1.00 20.00 ? 179  CYS A C   1 
ATOM   1415  O O   . CYS A 1 179 ? -25.854 101.060 85.200  1.00 20.00 ? 179  CYS A O   1 
ATOM   1416  C CB  . CYS A 1 179 ? -24.963 100.232 87.739  1.00 20.00 ? 179  CYS A CB  1 
ATOM   1417  S SG  . CYS A 1 179 ? -23.767 99.084  87.017  1.00 20.00 ? 179  CYS A SG  1 
ATOM   1418  N N   . LEU A 1 180 ? -24.257 102.631 85.120  1.00 20.00 ? 180  LEU A N   1 
ATOM   1419  C CA  . LEU A 1 180 ? -24.349 102.784 83.676  1.00 20.00 ? 180  LEU A CA  1 
ATOM   1420  C C   . LEU A 1 180 ? -23.327 101.865 83.024  1.00 20.00 ? 180  LEU A C   1 
ATOM   1421  O O   . LEU A 1 180 ? -22.133 101.958 83.303  1.00 20.00 ? 180  LEU A O   1 
ATOM   1422  C CB  . LEU A 1 180 ? -24.071 104.237 83.296  1.00 20.00 ? 180  LEU A CB  1 
ATOM   1423  C CG  . LEU A 1 180 ? -24.566 104.757 81.950  1.00 20.00 ? 180  LEU A CG  1 
ATOM   1424  C CD1 . LEU A 1 180 ? -24.819 106.239 82.085  1.00 20.00 ? 180  LEU A CD1 1 
ATOM   1425  C CD2 . LEU A 1 180 ? -23.539 104.501 80.861  1.00 20.00 ? 180  LEU A CD2 1 
ATOM   1426  N N   . ALA A 1 181 ? -23.790 100.968 82.162  1.00 20.00 ? 181  ALA A N   1 
ATOM   1427  C CA  . ALA A 1 181 ? -22.884 100.047 81.490  1.00 20.00 ? 181  ALA A CA  1 
ATOM   1428  C C   . ALA A 1 181 ? -22.600 100.474 80.059  1.00 20.00 ? 181  ALA A C   1 
ATOM   1429  O O   . ALA A 1 181 ? -23.465 101.018 79.375  1.00 20.00 ? 181  ALA A O   1 
ATOM   1430  C CB  . ALA A 1 181 ? -23.467 98.644  81.505  1.00 20.00 ? 181  ALA A CB  1 
ATOM   1431  N N   . VAL A 1 182 ? -21.372 100.229 79.618  1.00 20.00 ? 182  VAL A N   1 
ATOM   1432  C CA  . VAL A 1 182 ? -20.935 100.569 78.270  1.00 20.00 ? 182  VAL A CA  1 
ATOM   1433  C C   . VAL A 1 182 ? -19.978 99.471  77.813  1.00 20.00 ? 182  VAL A C   1 
ATOM   1434  O O   . VAL A 1 182 ? -18.906 99.310  78.402  1.00 20.00 ? 182  VAL A O   1 
ATOM   1435  C CB  . VAL A 1 182 ? -20.182 101.916 78.239  1.00 20.00 ? 182  VAL A CB  1 
ATOM   1436  C CG1 . VAL A 1 182 ? -21.136 103.060 78.561  1.00 20.00 ? 182  VAL A CG1 1 
ATOM   1437  C CG2 . VAL A 1 182 ? -19.019 101.894 79.239  1.00 20.00 ? 182  VAL A CG2 1 
ATOM   1438  N N   . THR A 1 183 ? -20.358 98.677  76.813  1.00 20.00 ? 183  THR A N   1 
ATOM   1439  C CA  . THR A 1 183 ? -21.637 98.775  76.118  1.00 20.00 ? 183  THR A CA  1 
ATOM   1440  C C   . THR A 1 183 ? -22.654 97.962  76.919  1.00 20.00 ? 183  THR A C   1 
ATOM   1441  O O   . THR A 1 183 ? -22.326 97.418  77.971  1.00 20.00 ? 183  THR A O   1 
ATOM   1442  C CB  . THR A 1 183 ? -21.553 98.159  74.711  1.00 20.00 ? 183  THR A CB  1 
ATOM   1443  O OG1 . THR A 1 183 ? -20.968 96.854  74.798  1.00 20.00 ? 183  THR A OG1 1 
ATOM   1444  C CG2 . THR A 1 183 ? -20.718 99.018  73.795  1.00 20.00 ? 183  THR A CG2 1 
ATOM   1445  N N   . VAL A 1 184 ? -23.883 97.877  76.419  1.00 20.00 ? 184  VAL A N   1 
ATOM   1446  C CA  . VAL A 1 184 ? -24.923 97.123  77.108  1.00 20.00 ? 184  VAL A CA  1 
ATOM   1447  C C   . VAL A 1 184 ? -24.957 95.704  76.560  1.00 20.00 ? 184  VAL A C   1 
ATOM   1448  O O   . VAL A 1 184 ? -25.496 95.454  75.486  1.00 20.00 ? 184  VAL A O   1 
ATOM   1449  C CB  . VAL A 1 184 ? -26.295 97.788  76.931  1.00 20.00 ? 184  VAL A CB  1 
ATOM   1450  C CG1 . VAL A 1 184 ? -27.344 97.047  77.748  1.00 20.00 ? 184  VAL A CG1 1 
ATOM   1451  C CG2 . VAL A 1 184 ? -26.212 99.229  77.376  1.00 20.00 ? 184  VAL A CG2 1 
ATOM   1452  N N   . ASN A 1 185 ? -24.374 94.785  77.321  1.00 20.00 ? 185  ASN A N   1 
ATOM   1453  C CA  . ASN A 1 185 ? -24.303 93.383  76.949  1.00 20.00 ? 185  ASN A CA  1 
ATOM   1454  C C   . ASN A 1 185 ? -25.617 92.699  76.630  1.00 20.00 ? 185  ASN A C   1 
ATOM   1455  O O   . ASN A 1 185 ? -25.797 92.193  75.524  1.00 20.00 ? 185  ASN A O   1 
ATOM   1456  C CB  . ASN A 1 185 ? -23.591 92.587  78.039  1.00 20.00 ? 185  ASN A CB  1 
ATOM   1457  C CG  . ASN A 1 185 ? -23.417 91.128  77.667  1.00 20.00 ? 185  ASN A CG  1 
ATOM   1458  O OD1 . ASN A 1 185 ? -22.776 90.805  76.664  1.00 20.00 ? 185  ASN A OD1 1 
ATOM   1459  N ND2 . ASN A 1 185 ? -23.994 90.236  78.467  1.00 20.00 ? 185  ASN A ND2 1 
ATOM   1460  N N   . LEU A 1 186 ? -26.519 92.666  77.604  1.00 20.00 ? 186  LEU A N   1 
ATOM   1461  C CA  . LEU A 1 186 ? -27.821 92.034  77.438  1.00 20.00 ? 186  LEU A CA  1 
ATOM   1462  C C   . LEU A 1 186 ? -28.537 92.371  76.131  1.00 20.00 ? 186  LEU A C   1 
ATOM   1463  O O   . LEU A 1 186 ? -29.194 91.511  75.541  1.00 20.00 ? 186  LEU A O   1 
ATOM   1464  C CB  . LEU A 1 186 ? -28.726 92.393  78.622  1.00 20.00 ? 186  LEU A CB  1 
ATOM   1465  C CG  . LEU A 1 186 ? -29.133 91.282  79.599  1.00 20.00 ? 186  LEU A CG  1 
ATOM   1466  C CD1 . LEU A 1 186 ? -30.311 90.525  79.023  1.00 20.00 ? 186  LEU A CD1 1 
ATOM   1467  C CD2 . LEU A 1 186 ? -27.960 90.331  79.862  1.00 20.00 ? 186  LEU A CD2 1 
ATOM   1468  N N   . ALA A 1 187 ? -28.406 93.616  75.681  1.00 20.00 ? 187  ALA A N   1 
ATOM   1469  C CA  . ALA A 1 187 ? -29.047 94.061  74.446  1.00 20.00 ? 187  ALA A CA  1 
ATOM   1470  C C   . ALA A 1 187 ? -28.324 93.634  73.167  1.00 20.00 ? 187  ALA A C   1 
ATOM   1471  O O   . ALA A 1 187 ? -28.800 93.911  72.060  1.00 20.00 ? 187  ALA A O   1 
ATOM   1472  C CB  . ALA A 1 187 ? -29.208 95.579  74.468  1.00 20.00 ? 187  ALA A CB  1 
ATOM   1473  N N   . GLY A 1 188 ? -27.180 92.967  73.324  1.00 20.00 ? 188  GLY A N   1 
ATOM   1474  C CA  . GLY A 1 188 ? -26.409 92.513  72.178  1.00 20.00 ? 188  GLY A CA  1 
ATOM   1475  C C   . GLY A 1 188 ? -25.127 93.300  71.964  1.00 20.00 ? 188  GLY A C   1 
ATOM   1476  O O   . GLY A 1 188 ? -24.523 93.226  70.897  1.00 20.00 ? 188  GLY A O   1 
ATOM   1477  N N   . GLY A 1 189 ? -24.710 94.047  72.986  1.00 20.00 ? 189  GLY A N   1 
ATOM   1478  C CA  . GLY A 1 189 ? -23.500 94.853  72.908  1.00 20.00 ? 189  GLY A CA  1 
ATOM   1479  C C   . GLY A 1 189 ? -23.788 96.221  72.314  1.00 20.00 ? 189  GLY A C   1 
ATOM   1480  O O   . GLY A 1 189 ? -23.010 96.739  71.515  1.00 20.00 ? 189  GLY A O   1 
ATOM   1481  N N   . GLN A 1 190 ? -24.911 96.808  72.720  1.00 20.00 ? 190  GLN A N   1 
ATOM   1482  C CA  . GLN A 1 190 ? -25.335 98.115  72.238  1.00 20.00 ? 190  GLN A CA  1 
ATOM   1483  C C   . GLN A 1 190 ? -24.736 99.276  73.008  1.00 20.00 ? 190  GLN A C   1 
ATOM   1484  O O   . GLN A 1 190 ? -24.632 99.238  74.235  1.00 20.00 ? 190  GLN A O   1 
ATOM   1485  C CB  . GLN A 1 190 ? -26.863 98.219  72.293  1.00 20.00 ? 190  GLN A CB  1 
ATOM   1486  C CG  . GLN A 1 190 ? -27.579 97.011  71.717  1.00 20.00 ? 190  GLN A CG  1 
ATOM   1487  C CD  . GLN A 1 190 ? -27.326 96.862  70.234  1.00 20.00 ? 190  GLN A CD  1 
ATOM   1488  O OE1 . GLN A 1 190 ? -27.000 97.832  69.563  1.00 20.00 ? 190  GLN A OE1 1 
ATOM   1489  N NE2 . GLN A 1 190 ? -27.472 95.647  69.717  1.00 20.00 ? 190  GLN A NE2 1 
ATOM   1490  N N   . PRO A 1 191 ? -24.348 100.338 72.289  1.00 20.00 ? 191  PRO A N   1 
ATOM   1491  C CA  . PRO A 1 191 ? -23.661 101.490 72.873  1.00 20.00 ? 191  PRO A CA  1 
ATOM   1492  C C   . PRO A 1 191 ? -24.587 102.508 73.527  1.00 20.00 ? 191  PRO A C   1 
ATOM   1493  O O   . PRO A 1 191 ? -25.810 102.477 73.345  1.00 20.00 ? 191  PRO A O   1 
ATOM   1494  C CB  . PRO A 1 191 ? -22.933 102.101 71.687  1.00 20.00 ? 191  PRO A CB  1 
ATOM   1495  C CG  . PRO A 1 191 ? -23.843 101.817 70.539  1.00 20.00 ? 191  PRO A CG  1 
ATOM   1496  C CD  . PRO A 1 191 ? -24.522 100.495 70.833  1.00 20.00 ? 191  PRO A CD  1 
ATOM   1497  N N   . VAL A 1 192 ? -23.968 103.412 74.282  1.00 20.00 ? 192  VAL A N   1 
ATOM   1498  C CA  . VAL A 1 192 ? -24.647 104.482 74.992  1.00 20.00 ? 192  VAL A CA  1 
ATOM   1499  C C   . VAL A 1 192 ? -24.050 105.769 74.397  1.00 20.00 ? 192  VAL A C   1 
ATOM   1500  O O   . VAL A 1 192 ? -22.833 105.870 74.235  1.00 20.00 ? 192  VAL A O   1 
ATOM   1501  C CB  . VAL A 1 192 ? -24.342 104.405 76.512  1.00 20.00 ? 192  VAL A CB  1 
ATOM   1502  C CG1 . VAL A 1 192 ? -24.998 105.568 77.243  1.00 20.00 ? 192  VAL A CG1 1 
ATOM   1503  C CG2 . VAL A 1 192 ? -24.835 103.078 77.073  1.00 20.00 ? 192  VAL A CG2 1 
ATOM   1504  N N   . SER A 1 193 ? -24.894 106.737 74.050  1.00 20.00 ? 193  SER A N   1 
ATOM   1505  C CA  . SER A 1 193 ? -24.408 107.994 73.474  1.00 20.00 ? 193  SER A CA  1 
ATOM   1506  C C   . SER A 1 193 ? -23.797 108.910 74.527  1.00 20.00 ? 193  SER A C   1 
ATOM   1507  O O   . SER A 1 193 ? -24.123 108.810 75.703  1.00 20.00 ? 193  SER A O   1 
ATOM   1508  C CB  . SER A 1 193 ? -25.551 108.734 72.773  1.00 20.00 ? 193  SER A CB  1 
ATOM   1509  O OG  . SER A 1 193 ? -26.562 109.096 73.700  1.00 20.00 ? 193  SER A OG  1 
ATOM   1510  N N   . MET A 1 194 ? -22.917 109.811 74.101  1.00 20.00 ? 194  MET A N   1 
ATOM   1511  C CA  . MET A 1 194 ? -22.277 110.736 75.027  1.00 20.00 ? 194  MET A CA  1 
ATOM   1512  C C   . MET A 1 194 ? -23.314 111.714 75.570  1.00 20.00 ? 194  MET A C   1 
ATOM   1513  O O   . MET A 1 194 ? -23.201 112.215 76.692  1.00 20.00 ? 194  MET A O   1 
ATOM   1514  C CB  . MET A 1 194 ? -21.164 111.509 74.321  1.00 20.00 ? 194  MET A CB  1 
ATOM   1515  C CG  . MET A 1 194 ? -20.321 112.367 75.253  1.00 20.00 ? 194  MET A CG  1 
ATOM   1516  S SD  . MET A 1 194 ? -19.079 111.394 76.085  1.00 20.00 ? 194  MET A SD  1 
ATOM   1517  C CE  . MET A 1 194 ? -17.907 111.152 74.742  1.00 20.00 ? 194  MET A CE  1 
ATOM   1518  N N   . ALA A 1 195 ? -24.326 111.988 74.759  1.00 20.00 ? 195  ALA A N   1 
ATOM   1519  C CA  . ALA A 1 195 ? -25.386 112.902 75.159  1.00 20.00 ? 195  ALA A CA  1 
ATOM   1520  C C   . ALA A 1 195 ? -26.162 112.315 76.333  1.00 20.00 ? 195  ALA A C   1 
ATOM   1521  O O   . ALA A 1 195 ? -26.550 113.029 77.253  1.00 20.00 ? 195  ALA A O   1 
ATOM   1522  C CB  . ALA A 1 195 ? -26.321 113.154 73.991  1.00 20.00 ? 195  ALA A CB  1 
ATOM   1523  N N   . ASN A 1 196 ? -26.382 111.007 76.302  1.00 20.00 ? 196  ASN A N   1 
ATOM   1524  C CA  . ASN A 1 196 ? -27.110 110.351 77.372  1.00 20.00 ? 196  ASN A CA  1 
ATOM   1525  C C   . ASN A 1 196 ? -26.309 110.383 78.668  1.00 20.00 ? 196  ASN A C   1 
ATOM   1526  O O   . ASN A 1 196 ? -26.832 110.769 79.708  1.00 20.00 ? 196  ASN A O   1 
ATOM   1527  C CB  . ASN A 1 196 ? -27.428 108.911 76.982  1.00 20.00 ? 196  ASN A CB  1 
ATOM   1528  C CG  . ASN A 1 196 ? -28.454 108.280 77.891  1.00 20.00 ? 196  ASN A CG  1 
ATOM   1529  O OD1 . ASN A 1 196 ? -28.192 107.259 78.536  1.00 20.00 ? 196  ASN A OD1 1 
ATOM   1530  N ND2 . ASN A 1 196 ? -29.634 108.880 77.948  1.00 20.00 ? 196  ASN A ND2 1 
ATOM   1531  N N   . MET A 1 197 ? -25.044 109.973 78.607  1.00 20.00 ? 197  MET A N   1 
ATOM   1532  C CA  . MET A 1 197 ? -24.178 109.966 79.793  1.00 20.00 ? 197  MET A CA  1 
ATOM   1533  C C   . MET A 1 197 ? -24.145 111.374 80.397  1.00 20.00 ? 197  MET A C   1 
ATOM   1534  O O   . MET A 1 197 ? -24.234 111.553 81.613  1.00 20.00 ? 197  MET A O   1 
ATOM   1535  C CB  . MET A 1 197 ? -22.752 109.545 79.417  1.00 20.00 ? 197  MET A CB  1 
ATOM   1536  C CG  . MET A 1 197 ? -22.624 108.089 79.029  1.00 20.00 ? 197  MET A CG  1 
ATOM   1537  S SD  . MET A 1 197 ? -20.967 107.693 78.487  1.00 20.00 ? 197  MET A SD  1 
ATOM   1538  C CE  . MET A 1 197 ? -21.236 107.180 76.820  1.00 20.00 ? 197  MET A CE  1 
ATOM   1539  N N   . ARG A 1 198 ? -24.015 112.370 79.531  1.00 20.00 ? 198  ARG A N   1 
ATOM   1540  C CA  . ARG A 1 198 ? -23.974 113.752 79.969  1.00 20.00 ? 198  ARG A CA  1 
ATOM   1541  C C   . ARG A 1 198 ? -25.290 114.112 80.649  1.00 20.00 ? 198  ARG A C   1 
ATOM   1542  O O   . ARG A 1 198 ? -25.292 114.732 81.708  1.00 20.00 ? 198  ARG A O   1 
ATOM   1543  C CB  . ARG A 1 198 ? -23.739 114.672 78.773  1.00 20.00 ? 198  ARG A CB  1 
ATOM   1544  C CG  . ARG A 1 198 ? -23.626 116.145 79.135  1.00 20.00 ? 198  ARG A CG  1 
ATOM   1545  C CD  . ARG A 1 198 ? -23.500 116.999 77.888  1.00 20.00 ? 198  ARG A CD  1 
ATOM   1546  N NE  . ARG A 1 198 ? -22.364 116.605 77.056  1.00 20.00 ? 198  ARG A NE  1 
ATOM   1547  C CZ  . ARG A 1 198 ? -22.455 116.294 75.766  1.00 20.00 ? 198  ARG A CZ  1 
ATOM   1548  N NH1 . ARG A 1 198 ? -23.632 116.326 75.159  1.00 20.00 ? 198  ARG A NH1 1 
ATOM   1549  N NH2 . ARG A 1 198 ? -21.375 115.948 75.082  1.00 20.00 ? 198  ARG A NH2 1 
ATOM   1550  N N   . ALA A 1 199 ? -26.405 113.708 80.040  1.00 20.00 ? 199  ALA A N   1 
ATOM   1551  C CA  . ALA A 1 199 ? -27.741 113.989 80.579  1.00 20.00 ? 199  ALA A CA  1 
ATOM   1552  C C   . ALA A 1 199 ? -28.019 113.287 81.906  1.00 20.00 ? 199  ALA A C   1 
ATOM   1553  O O   . ALA A 1 199 ? -28.618 113.866 82.809  1.00 20.00 ? 199  ALA A O   1 
ATOM   1554  C CB  . ALA A 1 199 ? -28.802 113.611 79.558  1.00 20.00 ? 199  ALA A CB  1 
ATOM   1555  N N   . VAL A 1 200 ? -27.594 112.037 82.022  1.00 20.00 ? 200  VAL A N   1 
ATOM   1556  C CA  . VAL A 1 200 ? -27.809 111.291 83.251  1.00 20.00 ? 200  VAL A CA  1 
ATOM   1557  C C   . VAL A 1 200 ? -26.975 111.930 84.361  1.00 20.00 ? 200  VAL A C   1 
ATOM   1558  O O   . VAL A 1 200 ? -27.420 112.056 85.501  1.00 20.00 ? 200  VAL A O   1 
ATOM   1559  C CB  . VAL A 1 200 ? -27.403 109.822 83.074  1.00 20.00 ? 200  VAL A CB  1 
ATOM   1560  C CG1 . VAL A 1 200 ? -27.259 109.143 84.422  1.00 20.00 ? 200  VAL A CG1 1 
ATOM   1561  C CG2 . VAL A 1 200 ? -28.436 109.118 82.229  1.00 20.00 ? 200  VAL A CG2 1 
ATOM   1562  N N   . HIS A 1 201 ? -25.765 112.345 84.019  1.00 20.00 ? 201  HIS A N   1 
ATOM   1563  C CA  . HIS A 1 201 ? -24.884 112.971 84.996  1.00 20.00 ? 201  HIS A CA  1 
ATOM   1564  C C   . HIS A 1 201 ? -25.495 114.264 85.533  1.00 20.00 ? 201  HIS A C   1 
ATOM   1565  O O   . HIS A 1 201 ? -25.385 114.574 86.721  1.00 20.00 ? 201  HIS A O   1 
ATOM   1566  C CB  . HIS A 1 201 ? -23.522 113.278 84.368  1.00 20.00 ? 201  HIS A CB  1 
ATOM   1567  C CG  . HIS A 1 201 ? -22.678 114.191 85.198  1.00 20.00 ? 201  HIS A CG  1 
ATOM   1568  N ND1 . HIS A 1 201 ? -21.944 113.747 86.277  1.00 20.00 ? 201  HIS A ND1 1 
ATOM   1569  C CD2 . HIS A 1 201 ? -22.507 115.534 85.152  1.00 20.00 ? 201  HIS A CD2 1 
ATOM   1570  C CE1 . HIS A 1 201 ? -21.361 114.778 86.862  1.00 20.00 ? 201  HIS A CE1 1 
ATOM   1571  N NE2 . HIS A 1 201 ? -21.688 115.873 86.198  1.00 20.00 ? 201  HIS A NE2 1 
ATOM   1572  N N   . GLU A 1 202 ? -26.128 115.021 84.645  1.00 20.00 ? 202  GLU A N   1 
ATOM   1573  C CA  . GLU A 1 202 ? -26.758 116.279 85.014  1.00 20.00 ? 202  GLU A CA  1 
ATOM   1574  C C   . GLU A 1 202 ? -27.869 116.062 86.023  1.00 20.00 ? 202  GLU A C   1 
ATOM   1575  O O   . GLU A 1 202 ? -27.967 116.781 87.015  1.00 20.00 ? 202  GLU A O   1 
ATOM   1576  C CB  . GLU A 1 202 ? -27.346 116.942 83.781  1.00 20.00 ? 202  GLU A CB  1 
ATOM   1577  C CG  . GLU A 1 202 ? -26.476 118.000 83.162  1.00 20.00 ? 202  GLU A CG  1 
ATOM   1578  C CD  . GLU A 1 202 ? -27.086 118.536 81.890  1.00 20.00 ? 202  GLU A CD  1 
ATOM   1579  O OE1 . GLU A 1 202 ? -28.182 119.140 81.965  1.00 20.00 ? 202  GLU A OE1 1 
ATOM   1580  O OE2 . GLU A 1 202 ? -26.474 118.343 80.817  1.00 20.00 ? 202  GLU A OE2 1 
ATOM   1581  N N   . MET A 1 203 ? -28.717 115.073 85.755  1.00 20.00 ? 203  MET A N   1 
ATOM   1582  C CA  . MET A 1 203 ? -29.824 114.767 86.645  1.00 20.00 ? 203  MET A CA  1 
ATOM   1583  C C   . MET A 1 203 ? -29.339 114.205 87.974  1.00 20.00 ? 203  MET A C   1 
ATOM   1584  O O   . MET A 1 203 ? -29.735 114.677 89.035  1.00 20.00 ? 203  MET A O   1 
ATOM   1585  C CB  . MET A 1 203 ? -30.776 113.774 85.988  1.00 20.00 ? 203  MET A CB  1 
ATOM   1586  C CG  . MET A 1 203 ? -32.061 113.560 86.784  1.00 20.00 ? 203  MET A CG  1 
ATOM   1587  S SD  . MET A 1 203 ? -33.407 112.816 85.846  1.00 20.00 ? 203  MET A SD  1 
ATOM   1588  C CE  . MET A 1 203 ? -33.304 113.724 84.308  1.00 20.00 ? 203  MET A CE  1 
ATOM   1589  N N   . ALA A 1 204 ? -28.483 113.192 87.912  1.00 20.00 ? 204  ALA A N   1 
ATOM   1590  C CA  . ALA A 1 204 ? -27.949 112.576 89.115  1.00 20.00 ? 204  ALA A CA  1 
ATOM   1591  C C   . ALA A 1 204 ? -27.217 113.611 89.968  1.00 20.00 ? 204  ALA A C   1 
ATOM   1592  O O   . ALA A 1 204 ? -27.375 113.647 91.186  1.00 20.00 ? 204  ALA A O   1 
ATOM   1593  C CB  . ALA A 1 204 ? -27.002 111.446 88.737  1.00 20.00 ? 204  ALA A CB  1 
ATOM   1594  N N   . SER A 1 205 ? -26.420 114.449 89.312  1.00 20.00 ? 205  SER A N   1 
ATOM   1595  C CA  . SER A 1 205 ? -25.648 115.494 89.977  1.00 20.00 ? 205  SER A CA  1 
ATOM   1596  C C   . SER A 1 205 ? -26.546 116.460 90.736  1.00 20.00 ? 205  SER A C   1 
ATOM   1597  O O   . SER A 1 205 ? -26.143 117.038 91.745  1.00 20.00 ? 205  SER A O   1 
ATOM   1598  C CB  . SER A 1 205 ? -24.814 116.259 88.943  1.00 20.00 ? 205  SER A CB  1 
ATOM   1599  O OG  . SER A 1 205 ? -24.517 117.570 89.384  1.00 20.00 ? 205  SER A OG  1 
ATOM   1600  N N   . THR A 1 206 ? -27.766 116.632 90.246  1.00 20.00 ? 206  THR A N   1 
ATOM   1601  C CA  . THR A 1 206 ? -28.725 117.528 90.879  1.00 20.00 ? 206  THR A CA  1 
ATOM   1602  C C   . THR A 1 206 ? -29.196 116.985 92.224  1.00 20.00 ? 206  THR A C   1 
ATOM   1603  O O   . THR A 1 206 ? -29.366 117.740 93.177  1.00 20.00 ? 206  THR A O   1 
ATOM   1604  C CB  . THR A 1 206 ? -29.972 117.740 89.988  1.00 20.00 ? 206  THR A CB  1 
ATOM   1605  O OG1 . THR A 1 206 ? -29.635 118.577 88.875  1.00 20.00 ? 206  THR A OG1 1 
ATOM   1606  C CG2 . THR A 1 206 ? -31.095 118.399 90.783  1.00 20.00 ? 206  THR A CG2 1 
ATOM   1607  N N   . TYR A 1 207 ? -29.407 115.675 92.294  1.00 20.00 ? 207  TYR A N   1 
ATOM   1608  C CA  . TYR A 1 207 ? -29.865 115.035 93.521  1.00 20.00 ? 207  TYR A CA  1 
ATOM   1609  C C   . TYR A 1 207 ? -28.769 114.399 94.342  1.00 20.00 ? 207  TYR A C   1 
ATOM   1610  O O   . TYR A 1 207 ? -29.045 113.709 95.321  1.00 20.00 ? 207  TYR A O   1 
ATOM   1611  C CB  . TYR A 1 207 ? -30.906 113.980 93.193  1.00 20.00 ? 207  TYR A CB  1 
ATOM   1612  C CG  . TYR A 1 207 ? -32.101 114.556 92.499  1.00 20.00 ? 207  TYR A CG  1 
ATOM   1613  C CD1 . TYR A 1 207 ? -33.140 115.125 93.227  1.00 20.00 ? 207  TYR A CD1 1 
ATOM   1614  C CD2 . TYR A 1 207 ? -32.192 114.552 91.114  1.00 20.00 ? 207  TYR A CD2 1 
ATOM   1615  C CE1 . TYR A 1 207 ? -34.237 115.671 92.596  1.00 20.00 ? 207  TYR A CE1 1 
ATOM   1616  C CE2 . TYR A 1 207 ? -33.289 115.099 90.471  1.00 20.00 ? 207  TYR A CE2 1 
ATOM   1617  C CZ  . TYR A 1 207 ? -34.308 115.657 91.222  1.00 20.00 ? 207  TYR A CZ  1 
ATOM   1618  O OH  . TYR A 1 207 ? -35.403 116.199 90.601  1.00 20.00 ? 207  TYR A OH  1 
ATOM   1619  N N   . GLY A 1 208 ? -27.525 114.623 93.945  1.00 20.00 ? 208  GLY A N   1 
ATOM   1620  C CA  . GLY A 1 208 ? -26.419 114.049 94.682  1.00 20.00 ? 208  GLY A CA  1 
ATOM   1621  C C   . GLY A 1 208 ? -26.341 112.538 94.600  1.00 20.00 ? 208  GLY A C   1 
ATOM   1622  O O   . GLY A 1 208 ? -25.879 111.896 95.544  1.00 20.00 ? 208  GLY A O   1 
ATOM   1623  N N   . ILE A 1 209 ? -26.787 111.967 93.483  1.00 20.00 ? 209  ILE A N   1 
ATOM   1624  C CA  . ILE A 1 209 ? -26.753 110.516 93.295  1.00 20.00 ? 209  ILE A CA  1 
ATOM   1625  C C   . ILE A 1 209 ? -25.463 110.072 92.589  1.00 20.00 ? 209  ILE A C   1 
ATOM   1626  O O   . ILE A 1 209 ? -25.048 110.677 91.603  1.00 20.00 ? 209  ILE A O   1 
ATOM   1627  C CB  . ILE A 1 209 ? -27.962 110.028 92.468  1.00 20.00 ? 209  ILE A CB  1 
ATOM   1628  C CG1 . ILE A 1 209 ? -29.260 110.495 93.124  1.00 20.00 ? 209  ILE A CG1 1 
ATOM   1629  C CG2 . ILE A 1 209 ? -27.943 108.516 92.370  1.00 20.00 ? 209  ILE A CG2 1 
ATOM   1630  C CD1 . ILE A 1 209 ? -30.506 110.206 92.308  1.00 20.00 ? 209  ILE A CD1 1 
ATOM   1631  N N   . LYS A 1 210 ? -24.852 109.001 93.095  1.00 20.00 ? 210  LYS A N   1 
ATOM   1632  C CA  . LYS A 1 210 ? -23.612 108.455 92.544  1.00 20.00 ? 210  LYS A CA  1 
ATOM   1633  C C   . LYS A 1 210 ? -23.782 107.686 91.242  1.00 20.00 ? 210  LYS A C   1 
ATOM   1634  O O   . LYS A 1 210 ? -24.787 107.003 91.040  1.00 20.00 ? 210  LYS A O   1 
ATOM   1635  C CB  . LYS A 1 210 ? -22.947 107.535 93.572  1.00 20.00 ? 210  LYS A CB  1 
ATOM   1636  C CG  . LYS A 1 210 ? -21.616 108.032 94.080  1.00 20.00 ? 210  LYS A CG  1 
ATOM   1637  C CD  . LYS A 1 210 ? -21.768 109.366 94.780  1.00 20.00 ? 210  LYS A CD  1 
ATOM   1638  C CE  . LYS A 1 210 ? -20.752 109.519 95.898  1.00 20.00 ? 210  LYS A CE  1 
ATOM   1639  N NZ  . LYS A 1 210 ? -20.675 108.294 96.743  1.00 20.00 ? 210  LYS A NZ  1 
ATOM   1640  N N   . ILE A 1 211 ? -22.779 107.793 90.372  1.00 20.00 ? 211  ILE A N   1 
ATOM   1641  C CA  . ILE A 1 211 ? -22.784 107.116 89.076  1.00 20.00 ? 211  ILE A CA  1 
ATOM   1642  C C   . ILE A 1 211 ? -21.525 106.279 88.908  1.00 20.00 ? 211  ILE A C   1 
ATOM   1643  O O   . ILE A 1 211 ? -20.417 106.812 88.910  1.00 20.00 ? 211  ILE A O   1 
ATOM   1644  C CB  . ILE A 1 211 ? -22.811 108.117 87.899  1.00 20.00 ? 211  ILE A CB  1 
ATOM   1645  C CG1 . ILE A 1 211 ? -24.140 108.865 87.865  1.00 20.00 ? 211  ILE A CG1 1 
ATOM   1646  C CG2 . ILE A 1 211 ? -22.593 107.383 86.583  1.00 20.00 ? 211  ILE A CG2 1 
ATOM   1647  C CD1 . ILE A 1 211 ? -24.111 110.064 86.940  1.00 20.00 ? 211  ILE A CD1 1 
ATOM   1648  N N   . PHE A 1 212 ? -21.694 104.970 88.764  1.00 20.00 ? 212  PHE A N   1 
ATOM   1649  C CA  . PHE A 1 212 ? -20.556 104.084 88.590  1.00 20.00 ? 212  PHE A CA  1 
ATOM   1650  C C   . PHE A 1 212 ? -20.758 103.316 87.303  1.00 20.00 ? 212  PHE A C   1 
ATOM   1651  O O   . PHE A 1 212 ? -21.786 102.671 87.117  1.00 20.00 ? 212  PHE A O   1 
ATOM   1652  C CB  . PHE A 1 212 ? -20.425 103.119 89.775  1.00 20.00 ? 212  PHE A CB  1 
ATOM   1653  C CG  . PHE A 1 212 ? -19.986 103.792 91.049  1.00 20.00 ? 212  PHE A CG  1 
ATOM   1654  C CD1 . PHE A 1 212 ? -18.664 104.189 91.220  1.00 20.00 ? 212  PHE A CD1 1 
ATOM   1655  C CD2 . PHE A 1 212 ? -20.901 104.068 92.059  1.00 20.00 ? 212  PHE A CD2 1 
ATOM   1656  C CE1 . PHE A 1 212 ? -18.261 104.856 92.378  1.00 20.00 ? 212  PHE A CE1 1 
ATOM   1657  C CE2 . PHE A 1 212 ? -20.507 104.735 93.222  1.00 20.00 ? 212  PHE A CE2 1 
ATOM   1658  C CZ  . PHE A 1 212 ? -19.185 105.129 93.380  1.00 20.00 ? 212  PHE A CZ  1 
ATOM   1659  N N   . TYR A 1 213 ? -19.778 103.405 86.410  1.00 20.00 ? 213  TYR A N   1 
ATOM   1660  C CA  . TYR A 1 213 ? -19.837 102.719 85.129  1.00 20.00 ? 213  TYR A CA  1 
ATOM   1661  C C   . TYR A 1 213 ? -19.324 101.291 85.228  1.00 20.00 ? 213  TYR A C   1 
ATOM   1662  O O   . TYR A 1 213 ? -18.497 100.972 86.080  1.00 20.00 ? 213  TYR A O   1 
ATOM   1663  C CB  . TYR A 1 213 ? -18.946 103.416 84.095  1.00 20.00 ? 213  TYR A CB  1 
ATOM   1664  C CG  . TYR A 1 213 ? -19.446 104.724 83.530  1.00 20.00 ? 213  TYR A CG  1 
ATOM   1665  C CD1 . TYR A 1 213 ? -20.557 105.378 84.068  1.00 20.00 ? 213  TYR A CD1 1 
ATOM   1666  C CD2 . TYR A 1 213 ? -18.795 105.313 82.448  1.00 20.00 ? 213  TYR A CD2 1 
ATOM   1667  C CE1 . TYR A 1 213 ? -21.003 106.588 83.539  1.00 20.00 ? 213  TYR A CE1 1 
ATOM   1668  C CE2 . TYR A 1 213 ? -19.231 106.518 81.914  1.00 20.00 ? 213  TYR A CE2 1 
ATOM   1669  C CZ  . TYR A 1 213 ? -20.334 107.148 82.465  1.00 20.00 ? 213  TYR A CZ  1 
ATOM   1670  O OH  . TYR A 1 213 ? -20.749 108.345 81.939  1.00 20.00 ? 213  TYR A OH  1 
ATOM   1671  N N   . ASP A 1 214 ? -19.839 100.435 84.355  1.00 20.00 ? 214  ASP A N   1 
ATOM   1672  C CA  . ASP A 1 214 ? -19.435 99.038  84.285  1.00 20.00 ? 214  ASP A CA  1 
ATOM   1673  C C   . ASP A 1 214 ? -18.805 99.234  82.914  1.00 20.00 ? 214  ASP A C   1 
ATOM   1674  O O   . ASP A 1 214 ? -19.420 98.978  81.885  1.00 20.00 ? 214  ASP A O   1 
ATOM   1675  C CB  . ASP A 1 214 ? -20.627 98.092  84.189  1.00 20.00 ? 214  ASP A CB  1 
ATOM   1676  C CG  . ASP A 1 214 ? -20.202 96.668  83.865  1.00 20.00 ? 214  ASP A CG  1 
ATOM   1677  O OD1 . ASP A 1 214 ? -19.035 96.475  83.468  1.00 20.00 ? 214  ASP A OD1 1 
ATOM   1678  O OD2 . ASP A 1 214 ? -21.026 95.741  84.006  1.00 20.00 ? 214  ASP A OD2 1 
ATOM   1679  N N   . ALA A 1 215 ? -17.583 99.748  82.918  1.00 20.00 ? 215  ALA A N   1 
ATOM   1680  C CA  . ALA A 1 215 ? -16.850 100.026 81.697  1.00 20.00 ? 215  ALA A CA  1 
ATOM   1681  C C   . ALA A 1 215 ? -16.138 98.897  80.992  1.00 20.00 ? 215  ALA A C   1 
ATOM   1682  O O   . ALA A 1 215 ? -15.274 99.168  80.170  1.00 20.00 ? 215  ALA A O   1 
ATOM   1683  C CB  . ALA A 1 215 ? -15.856 101.143 81.981  1.00 20.00 ? 215  ALA A CB  1 
ATOM   1684  N N   . THR A 1 216 ? -16.500 97.648  81.258  1.00 20.00 ? 216  THR A N   1 
ATOM   1685  C CA  . THR A 1 216 ? -15.811 96.539  80.598  1.00 20.00 ? 216  THR A CA  1 
ATOM   1686  C C   . THR A 1 216 ? -15.577 96.670  79.092  1.00 20.00 ? 216  THR A C   1 
ATOM   1687  O O   . THR A 1 216 ? -14.547 96.221  78.592  1.00 20.00 ? 216  THR A O   1 
ATOM   1688  C CB  . THR A 1 216 ? -16.482 95.182  80.899  1.00 20.00 ? 216  THR A CB  1 
ATOM   1689  O OG1 . THR A 1 216 ? -17.739 95.097  80.227  1.00 20.00 ? 216  THR A OG1 1 
ATOM   1690  C CG2 . THR A 1 216 ? -16.685 95.022  82.387  1.00 20.00 ? 216  THR A CG2 1 
ATOM   1691  N N   . ARG A 1 217 ? -16.505 97.286  78.364  1.00 20.00 ? 217  ARG A N   1 
ATOM   1692  C CA  . ARG A 1 217 ? -16.326 97.441  76.918  1.00 20.00 ? 217  ARG A CA  1 
ATOM   1693  C C   . ARG A 1 217 ? -16.482 98.887  76.495  1.00 20.00 ? 217  ARG A C   1 
ATOM   1694  O O   . ARG A 1 217 ? -17.110 99.184  75.484  1.00 20.00 ? 217  ARG A O   1 
ATOM   1695  C CB  . ARG A 1 217 ? -17.316 96.560  76.160  1.00 20.00 ? 217  ARG A CB  1 
ATOM   1696  C CG  . ARG A 1 217 ? -17.051 95.079  76.351  1.00 20.00 ? 217  ARG A CG  1 
ATOM   1697  C CD  . ARG A 1 217 ? -18.070 94.237  75.636  1.00 20.00 ? 217  ARG A CD  1 
ATOM   1698  N NE  . ARG A 1 217 ? -17.934 92.821  75.967  1.00 20.00 ? 217  ARG A NE  1 
ATOM   1699  C CZ  . ARG A 1 217 ? -18.631 92.202  76.914  1.00 20.00 ? 217  ARG A CZ  1 
ATOM   1700  N NH1 . ARG A 1 217 ? -19.515 92.863  77.642  1.00 20.00 ? 217  ARG A NH1 1 
ATOM   1701  N NH2 . ARG A 1 217 ? -18.440 90.917  77.141  1.00 20.00 ? 217  ARG A NH2 1 
ATOM   1702  N N   . CYS A 1 218 ? -15.872 99.784  77.262  1.00 20.00 ? 218  CYS A N   1 
ATOM   1703  C CA  . CYS A 1 218 ? -15.929 101.211 76.998  1.00 20.00 ? 218  CYS A CA  1 
ATOM   1704  C C   . CYS A 1 218 ? -15.257 101.681 75.718  1.00 20.00 ? 218  CYS A C   1 
ATOM   1705  O O   . CYS A 1 218 ? -15.626 102.721 75.182  1.00 20.00 ? 218  CYS A O   1 
ATOM   1706  C CB  . CYS A 1 218 ? -15.342 101.973 78.176  1.00 20.00 ? 218  CYS A CB  1 
ATOM   1707  S SG  . CYS A 1 218 ? -13.613 101.615 78.434  1.00 20.00 ? 218  CYS A SG  1 
ATOM   1708  N N   . VAL A 1 219 ? -14.270 100.944 75.223  1.00 20.00 ? 219  VAL A N   1 
ATOM   1709  C CA  . VAL A 1 219 ? -13.594 101.356 73.989  1.00 20.00 ? 219  VAL A CA  1 
ATOM   1710  C C   . VAL A 1 219 ? -14.473 101.042 72.780  1.00 20.00 ? 219  VAL A C   1 
ATOM   1711  O O   . VAL A 1 219 ? -14.491 101.787 71.812  1.00 20.00 ? 219  VAL A O   1 
ATOM   1712  C CB  . VAL A 1 219 ? -12.232 100.661 73.835  1.00 20.00 ? 219  VAL A CB  1 
ATOM   1713  C CG1 . VAL A 1 219 ? -11.488 101.228 72.633  1.00 20.00 ? 219  VAL A CG1 1 
ATOM   1714  C CG2 . VAL A 1 219 ? -11.423 100.848 75.104  1.00 20.00 ? 219  VAL A CG2 1 
ATOM   1715  N N   . GLU A 1 220 ? -15.192 99.927  72.837  1.00 20.00 ? 220  GLU A N   1 
ATOM   1716  C CA  . GLU A 1 220 ? -16.070 99.547  71.741  1.00 20.00 ? 220  GLU A CA  1 
ATOM   1717  C C   . GLU A 1 220 ? -17.162 100.622 71.710  1.00 20.00 ? 220  GLU A C   1 
ATOM   1718  O O   . GLU A 1 220 ? -17.575 101.066 70.642  1.00 20.00 ? 220  GLU A O   1 
ATOM   1719  C CB  . GLU A 1 220 ? -16.689 98.165  71.987  1.00 20.00 ? 220  GLU A CB  1 
ATOM   1720  C CG  . GLU A 1 220 ? -15.735 97.003  71.681  1.00 20.00 ? 220  GLU A CG  1 
ATOM   1721  C CD  . GLU A 1 220 ? -16.222 95.666  72.224  1.00 20.00 ? 220  GLU A CD  1 
ATOM   1722  O OE1 . GLU A 1 220 ? -17.397 95.566  72.631  1.00 20.00 ? 220  GLU A OE1 1 
ATOM   1723  O OE2 . GLU A 1 220 ? -15.428 94.704  72.249  1.00 20.00 ? 220  GLU A OE2 1 
ATOM   1724  N N   . ASN A 1 221 ? -17.612 101.042 72.891  1.00 20.00 ? 221  ASN A N   1 
ATOM   1725  C CA  . ASN A 1 221 ? -18.642 102.065 73.001  1.00 20.00 ? 221  ASN A CA  1 
ATOM   1726  C C   . ASN A 1 221 ? -18.084 103.364 72.434  1.00 20.00 ? 221  ASN A C   1 
ATOM   1727  O O   . ASN A 1 221 ? -18.789 104.111 71.749  1.00 20.00 ? 221  ASN A O   1 
ATOM   1728  C CB  . ASN A 1 221 ? -19.032 102.287 74.471  1.00 20.00 ? 221  ASN A CB  1 
ATOM   1729  C CG  . ASN A 1 221 ? -20.357 103.022 74.624  1.00 20.00 ? 221  ASN A CG  1 
ATOM   1730  O OD1 . ASN A 1 221 ? -21.413 102.396 74.710  1.00 20.00 ? 221  ASN A OD1 1 
ATOM   1731  N ND2 . ASN A 1 221 ? -20.309 104.353 74.655  1.00 20.00 ? 221  ASN A ND2 1 
ATOM   1732  N N   . ALA A 1 222 ? -16.811 103.622 72.728  1.00 20.00 ? 222  ALA A N   1 
ATOM   1733  C CA  . ALA A 1 222 ? -16.136 104.827 72.259  1.00 20.00 ? 222  ALA A CA  1 
ATOM   1734  C C   . ALA A 1 222 ? -16.141 104.890 70.734  1.00 20.00 ? 222  ALA A C   1 
ATOM   1735  O O   . ALA A 1 222 ? -16.302 105.961 70.147  1.00 20.00 ? 222  ALA A O   1 
ATOM   1736  C CB  . ALA A 1 222 ? -14.702 104.863 72.790  1.00 20.00 ? 222  ALA A CB  1 
ATOM   1737  N N   . TYR A 1 223 ? -15.973 103.738 70.091  1.00 20.00 ? 223  TYR A N   1 
ATOM   1738  C CA  . TYR A 1 223 ? -15.967 103.695 68.635  1.00 20.00 ? 223  TYR A CA  1 
ATOM   1739  C C   . TYR A 1 223 ? -17.337 104.020 68.024  1.00 20.00 ? 223  TYR A C   1 
ATOM   1740  O O   . TYR A 1 223 ? -17.428 104.748 67.034  1.00 20.00 ? 223  TYR A O   1 
ATOM   1741  C CB  . TYR A 1 223 ? -15.522 102.325 68.130  1.00 20.00 ? 223  TYR A CB  1 
ATOM   1742  C CG  . TYR A 1 223 ? -15.643 102.231 66.632  1.00 20.00 ? 223  TYR A CG  1 
ATOM   1743  C CD1 . TYR A 1 223 ? -14.711 102.856 65.802  1.00 20.00 ? 223  TYR A CD1 1 
ATOM   1744  C CD2 . TYR A 1 223 ? -16.738 101.603 66.041  1.00 20.00 ? 223  TYR A CD2 1 
ATOM   1745  C CE1 . TYR A 1 223 ? -14.869 102.868 64.431  1.00 20.00 ? 223  TYR A CE1 1 
ATOM   1746  C CE2 . TYR A 1 223 ? -16.903 101.609 64.661  1.00 20.00 ? 223  TYR A CE2 1 
ATOM   1747  C CZ  . TYR A 1 223 ? -15.966 102.248 63.865  1.00 20.00 ? 223  TYR A CZ  1 
ATOM   1748  O OH  . TYR A 1 223 ? -16.146 102.298 62.506  1.00 20.00 ? 223  TYR A OH  1 
ATOM   1749  N N   . PHE A 1 224 ? -18.400 103.467 68.594  1.00 20.00 ? 224  PHE A N   1 
ATOM   1750  C CA  . PHE A 1 224 ? -19.726 103.730 68.068  1.00 20.00 ? 224  PHE A CA  1 
ATOM   1751  C C   . PHE A 1 224 ? -20.056 105.213 68.178  1.00 20.00 ? 224  PHE A C   1 
ATOM   1752  O O   . PHE A 1 224 ? -20.754 105.760 67.323  1.00 20.00 ? 224  PHE A O   1 
ATOM   1753  C CB  . PHE A 1 224 ? -20.770 102.915 68.824  1.00 20.00 ? 224  PHE A CB  1 
ATOM   1754  C CG  . PHE A 1 224 ? -20.840 101.481 68.395  1.00 20.00 ? 224  PHE A CG  1 
ATOM   1755  C CD1 . PHE A 1 224 ? -21.530 101.118 67.243  1.00 20.00 ? 224  PHE A CD1 1 
ATOM   1756  C CD2 . PHE A 1 224 ? -20.222 100.487 69.147  1.00 20.00 ? 224  PHE A CD2 1 
ATOM   1757  C CE1 . PHE A 1 224 ? -21.605 99.783  66.846  1.00 20.00 ? 224  PHE A CE1 1 
ATOM   1758  C CE2 . PHE A 1 224 ? -20.290 99.151  68.762  1.00 20.00 ? 224  PHE A CE2 1 
ATOM   1759  C CZ  . PHE A 1 224 ? -20.984 98.797  67.607  1.00 20.00 ? 224  PHE A CZ  1 
ATOM   1760  N N   . ILE A 1 225 ? -19.554 105.854 69.231  1.00 20.00 ? 225  ILE A N   1 
ATOM   1761  C CA  . ILE A 1 225 ? -19.797 107.277 69.451  1.00 20.00 ? 225  ILE A CA  1 
ATOM   1762  C C   . ILE A 1 225 ? -19.062 108.059 68.384  1.00 20.00 ? 225  ILE A C   1 
ATOM   1763  O O   . ILE A 1 225 ? -19.579 109.029 67.835  1.00 20.00 ? 225  ILE A O   1 
ATOM   1764  C CB  . ILE A 1 225 ? -19.306 107.735 70.858  1.00 20.00 ? 225  ILE A CB  1 
ATOM   1765  C CG1 . ILE A 1 225 ? -20.292 107.267 71.932  1.00 20.00 ? 225  ILE A CG1 1 
ATOM   1766  C CG2 . ILE A 1 225 ? -19.211 109.262 70.922  1.00 20.00 ? 225  ILE A CG2 1 
ATOM   1767  C CD1 . ILE A 1 225 ? -19.856 107.564 73.347  1.00 20.00 ? 225  ILE A CD1 1 
ATOM   1768  N N   . LYS A 1 226 ? -17.846 107.628 68.083  1.00 20.00 ? 226  LYS A N   1 
ATOM   1769  C CA  . LYS A 1 226 ? -17.050 108.304 67.074  1.00 20.00 ? 226  LYS A CA  1 
ATOM   1770  C C   . LYS A 1 226 ? -17.667 108.080 65.709  1.00 20.00 ? 226  LYS A C   1 
ATOM   1771  O O   . LYS A 1 226 ? -17.628 108.947 64.847  1.00 20.00 ? 226  LYS A O   1 
ATOM   1772  C CB  . LYS A 1 226 ? -15.621 107.764 67.070  1.00 20.00 ? 226  LYS A CB  1 
ATOM   1773  C CG  . LYS A 1 226 ? -14.676 108.567 66.200  1.00 20.00 ? 226  LYS A CG  1 
ATOM   1774  C CD  . LYS A 1 226 ? -13.265 108.019 66.246  1.00 20.00 ? 226  LYS A CD  1 
ATOM   1775  C CE  . LYS A 1 226 ? -12.438 108.582 65.109  1.00 20.00 ? 226  LYS A CE  1 
ATOM   1776  N NZ  . LYS A 1 226 ? -12.243 110.048 65.286  1.00 20.00 ? 226  LYS A NZ  1 
ATOM   1777  N N   . GLU A 1 227 ? -18.255 106.911 65.523  1.00 20.00 ? 227  GLU A N   1 
ATOM   1778  C CA  . GLU A 1 227 ? -18.872 106.575 64.253  1.00 20.00 ? 227  GLU A CA  1 
ATOM   1779  C C   . GLU A 1 227 ? -20.271 107.108 64.010  1.00 20.00 ? 227  GLU A C   1 
ATOM   1780  O O   . GLU A 1 227 ? -20.581 107.534 62.898  1.00 20.00 ? 227  GLU A O   1 
ATOM   1781  C CB  . GLU A 1 227 ? -18.895 105.053 64.084  1.00 20.00 ? 227  GLU A CB  1 
ATOM   1782  C CG  . GLU A 1 227 ? -19.396 104.595 62.723  1.00 20.00 ? 227  GLU A CG  1 
ATOM   1783  C CD  . GLU A 1 227 ? -19.581 103.091 62.631  1.00 20.00 ? 227  GLU A CD  1 
ATOM   1784  O OE1 . GLU A 1 227 ? -20.540 102.571 63.236  1.00 20.00 ? 227  GLU A OE1 1 
ATOM   1785  O OE2 . GLU A 1 227 ? -18.768 102.431 61.944  1.00 20.00 ? 227  GLU A OE2 1 
ATOM   1786  N N   . GLN A 1 228 ? -21.115 107.110 65.036  1.00 20.00 ? 228  GLN A N   1 
ATOM   1787  C CA  . GLN A 1 228 ? -22.481 107.590 64.861  1.00 20.00 ? 228  GLN A CA  1 
ATOM   1788  C C   . GLN A 1 228 ? -22.997 108.811 65.625  1.00 20.00 ? 228  GLN A C   1 
ATOM   1789  O O   . GLN A 1 228 ? -24.134 109.234 65.392  1.00 20.00 ? 228  GLN A O   1 
ATOM   1790  C CB  . GLN A 1 228 ? -23.437 106.413 65.093  1.00 20.00 ? 228  GLN A CB  1 
ATOM   1791  C CG  . GLN A 1 228 ? -23.072 105.184 64.272  1.00 20.00 ? 228  GLN A CG  1 
ATOM   1792  C CD  . GLN A 1 228 ? -23.749 103.922 64.748  1.00 20.00 ? 228  GLN A CD  1 
ATOM   1793  O OE1 . GLN A 1 228 ? -24.759 103.969 65.448  1.00 20.00 ? 228  GLN A OE1 1 
ATOM   1794  N NE2 . GLN A 1 228 ? -23.194 102.777 64.366  1.00 20.00 ? 228  GLN A NE2 1 
ATOM   1795  N N   . GLU A 1 229 ? -22.206 109.382 66.528  1.00 20.00 ? 229  GLU A N   1 
ATOM   1796  C CA  . GLU A 1 229 ? -22.694 110.545 67.258  1.00 20.00 ? 229  GLU A CA  1 
ATOM   1797  C C   . GLU A 1 229 ? -22.198 111.825 66.614  1.00 20.00 ? 229  GLU A C   1 
ATOM   1798  O O   . GLU A 1 229 ? -20.998 112.035 66.441  1.00 20.00 ? 229  GLU A O   1 
ATOM   1799  C CB  . GLU A 1 229 ? -22.283 110.495 68.733  1.00 20.00 ? 229  GLU A CB  1 
ATOM   1800  C CG  . GLU A 1 229 ? -23.115 111.428 69.617  1.00 20.00 ? 229  GLU A CG  1 
ATOM   1801  C CD  . GLU A 1 229 ? -23.169 110.995 71.072  1.00 20.00 ? 229  GLU A CD  1 
ATOM   1802  O OE1 . GLU A 1 229 ? -22.614 109.929 71.404  1.00 20.00 ? 229  GLU A OE1 1 
ATOM   1803  O OE2 . GLU A 1 229 ? -23.772 111.725 71.891  1.00 20.00 ? 229  GLU A OE2 1 
ATOM   1804  N N   . ALA A 1 230 ? -23.147 112.680 66.256  1.00 20.00 ? 230  ALA A N   1 
ATOM   1805  C CA  . ALA A 1 230 ? -22.852 113.947 65.621  1.00 20.00 ? 230  ALA A CA  1 
ATOM   1806  C C   . ALA A 1 230 ? -21.894 114.819 66.417  1.00 20.00 ? 230  ALA A C   1 
ATOM   1807  O O   . ALA A 1 230 ? -22.101 115.078 67.603  1.00 20.00 ? 230  ALA A O   1 
ATOM   1808  C CB  . ALA A 1 230 ? -24.152 114.701 65.360  1.00 20.00 ? 230  ALA A CB  1 
ATOM   1809  N N   . GLY A 1 231 ? -20.840 115.268 65.747  1.00 20.00 ? 231  GLY A N   1 
ATOM   1810  C CA  . GLY A 1 231 ? -19.855 116.115 66.386  1.00 20.00 ? 231  GLY A CA  1 
ATOM   1811  C C   . GLY A 1 231 ? -18.649 115.370 66.903  1.00 20.00 ? 231  GLY A C   1 
ATOM   1812  O O   . GLY A 1 231 ? -17.683 115.985 67.343  1.00 20.00 ? 231  GLY A O   1 
ATOM   1813  N N   . TYR A 1 232 ? -18.697 114.046 66.856  1.00 20.00 ? 232  TYR A N   1 
ATOM   1814  C CA  . TYR A 1 232 ? -17.578 113.260 67.337  1.00 20.00 ? 232  TYR A CA  1 
ATOM   1815  C C   . TYR A 1 232 ? -16.816 112.625 66.188  1.00 20.00 ? 232  TYR A C   1 
ATOM   1816  O O   . TYR A 1 232 ? -15.917 111.817 66.401  1.00 20.00 ? 232  TYR A O   1 
ATOM   1817  C CB  . TYR A 1 232 ? -18.073 112.199 68.325  1.00 20.00 ? 232  TYR A CB  1 
ATOM   1818  C CG  . TYR A 1 232 ? -18.362 112.785 69.688  1.00 20.00 ? 232  TYR A CG  1 
ATOM   1819  C CD1 . TYR A 1 232 ? -17.325 113.061 70.580  1.00 20.00 ? 232  TYR A CD1 1 
ATOM   1820  C CD2 . TYR A 1 232 ? -19.651 113.166 70.043  1.00 20.00 ? 232  TYR A CD2 1 
ATOM   1821  C CE1 . TYR A 1 232 ? -17.562 113.712 71.781  1.00 20.00 ? 232  TYR A CE1 1 
ATOM   1822  C CE2 . TYR A 1 232 ? -19.901 113.821 71.247  1.00 20.00 ? 232  TYR A CE2 1 
ATOM   1823  C CZ  . TYR A 1 232 ? -18.851 114.097 72.107  1.00 20.00 ? 232  TYR A CZ  1 
ATOM   1824  O OH  . TYR A 1 232 ? -19.074 114.801 73.270  1.00 20.00 ? 232  TYR A OH  1 
ATOM   1825  N N   . GLU A 1 233 ? -17.161 113.016 64.967  1.00 20.00 ? 233  GLU A N   1 
ATOM   1826  C CA  . GLU A 1 233 ? -16.503 112.479 63.780  1.00 20.00 ? 233  GLU A CA  1 
ATOM   1827  C C   . GLU A 1 233 ? -14.987 112.642 63.824  1.00 20.00 ? 233  GLU A C   1 
ATOM   1828  O O   . GLU A 1 233 ? -14.244 111.719 63.494  1.00 20.00 ? 233  GLU A O   1 
ATOM   1829  C CB  . GLU A 1 233 ? -17.034 113.168 62.517  1.00 20.00 ? 233  GLU A CB  1 
ATOM   1830  C CG  . GLU A 1 233 ? -18.546 113.167 62.385  1.00 20.00 ? 233  GLU A CG  1 
ATOM   1831  C CD  . GLU A 1 233 ? -19.185 114.418 62.955  1.00 20.00 ? 233  GLU A CD  1 
ATOM   1832  O OE1 . GLU A 1 233 ? -18.441 115.360 63.309  1.00 20.00 ? 233  GLU A OE1 1 
ATOM   1833  O OE2 . GLU A 1 233 ? -20.433 114.457 63.048  1.00 20.00 ? 233  GLU A OE2 1 
ATOM   1834  N N   . ASN A 1 234 ? -14.532 113.818 64.239  1.00 20.00 ? 234  ASN A N   1 
ATOM   1835  C CA  . ASN A 1 234 ? -13.101 114.089 64.309  1.00 20.00 ? 234  ASN A CA  1 
ATOM   1836  C C   . ASN A 1 234 ? -12.453 114.035 65.695  1.00 20.00 ? 234  ASN A C   1 
ATOM   1837  O O   . ASN A 1 234 ? -11.346 114.537 65.872  1.00 20.00 ? 234  ASN A O   1 
ATOM   1838  C CB  . ASN A 1 234 ? -12.801 115.453 63.670  1.00 20.00 ? 234  ASN A CB  1 
ATOM   1839  C CG  . ASN A 1 234 ? -13.345 115.575 62.249  1.00 20.00 ? 234  ASN A CG  1 
ATOM   1840  O OD1 . ASN A 1 234 ? -12.994 114.789 61.368  1.00 20.00 ? 234  ASN A OD1 1 
ATOM   1841  N ND2 . ASN A 1 234 ? -14.204 116.569 62.023  1.00 20.00 ? 234  ASN A ND2 1 
ATOM   1842  N N   . VAL A 1 235 ? -13.121 113.445 66.679  1.00 20.00 ? 235  VAL A N   1 
ATOM   1843  C CA  . VAL A 1 235 ? -12.531 113.371 68.011  1.00 20.00 ? 235  VAL A CA  1 
ATOM   1844  C C   . VAL A 1 235 ? -11.832 112.026 68.138  1.00 20.00 ? 235  VAL A C   1 
ATOM   1845  O O   . VAL A 1 235 ? -12.316 111.014 67.634  1.00 20.00 ? 235  VAL A O   1 
ATOM   1846  C CB  . VAL A 1 235 ? -13.593 113.507 69.115  1.00 20.00 ? 235  VAL A CB  1 
ATOM   1847  C CG1 . VAL A 1 235 ? -12.948 113.394 70.477  1.00 20.00 ? 235  VAL A CG1 1 
ATOM   1848  C CG2 . VAL A 1 235 ? -14.302 114.845 68.984  1.00 20.00 ? 235  VAL A CG2 1 
ATOM   1849  N N   . SER A 1 236 ? -10.680 112.018 68.800  1.00 20.00 ? 236  SER A N   1 
ATOM   1850  C CA  . SER A 1 236 ? -9.921  110.788 68.978  1.00 20.00 ? 236  SER A CA  1 
ATOM   1851  C C   . SER A 1 236 ? -10.590 109.844 69.957  1.00 20.00 ? 236  SER A C   1 
ATOM   1852  O O   . SER A 1 236 ? -11.345 110.269 70.830  1.00 20.00 ? 236  SER A O   1 
ATOM   1853  C CB  . SER A 1 236 ? -8.504  111.107 69.461  1.00 20.00 ? 236  SER A CB  1 
ATOM   1854  O OG  . SER A 1 236 ? -8.520  111.627 70.778  1.00 20.00 ? 236  SER A OG  1 
ATOM   1855  N N   . ILE A 1 237 ? -10.311 108.555 69.808  1.00 20.00 ? 237  ILE A N   1 
ATOM   1856  C CA  . ILE A 1 237 ? -10.890 107.554 70.692  1.00 20.00 ? 237  ILE A CA  1 
ATOM   1857  C C   . ILE A 1 237 ? -10.487 107.909 72.117  1.00 20.00 ? 237  ILE A C   1 
ATOM   1858  O O   . ILE A 1 237 ? -11.305 107.901 73.035  1.00 20.00 ? 237  ILE A O   1 
ATOM   1859  C CB  . ILE A 1 237 ? -10.362 106.135 70.361  1.00 20.00 ? 237  ILE A CB  1 
ATOM   1860  C CG1 . ILE A 1 237 ? -11.002 105.622 69.067  1.00 20.00 ? 237  ILE A CG1 1 
ATOM   1861  C CG2 . ILE A 1 237 ? -10.646 105.189 71.512  1.00 20.00 ? 237  ILE A CG2 1 
ATOM   1862  C CD1 . ILE A 1 237 ? -12.517 105.619 69.082  1.00 20.00 ? 237  ILE A CD1 1 
ATOM   1863  N N   . LYS A 1 238 ? -9.214  108.232 72.285  1.00 20.00 ? 238  LYS A N   1 
ATOM   1864  C CA  . LYS A 1 238 ? -8.678  108.590 73.586  1.00 20.00 ? 238  LYS A CA  1 
ATOM   1865  C C   . LYS A 1 238 ? -9.444  109.743 74.219  1.00 20.00 ? 238  LYS A C   1 
ATOM   1866  O O   . LYS A 1 238 ? -9.711  109.729 75.416  1.00 20.00 ? 238  LYS A O   1 
ATOM   1867  C CB  . LYS A 1 238 ? -7.203  108.967 73.446  1.00 20.00 ? 238  LYS A CB  1 
ATOM   1868  C CG  . LYS A 1 238 ? -6.356  108.611 74.646  1.00 20.00 ? 238  LYS A CG  1 
ATOM   1869  C CD  . LYS A 1 238 ? -5.380  109.722 75.020  1.00 20.00 ? 238  LYS A CD  1 
ATOM   1870  C CE  . LYS A 1 238 ? -4.418  110.055 73.894  1.00 20.00 ? 238  LYS A CE  1 
ATOM   1871  N NZ  . LYS A 1 238 ? -3.006  110.165 74.380  1.00 20.00 ? 238  LYS A NZ  1 
ATOM   1872  N N   . ASP A 1 239 ? -9.790  110.751 73.425  1.00 20.00 ? 239  ASP A N   1 
ATOM   1873  C CA  . ASP A 1 239 ? -10.525 111.894 73.956  1.00 20.00 ? 239  ASP A CA  1 
ATOM   1874  C C   . ASP A 1 239 ? -11.972 111.523 74.252  1.00 20.00 ? 239  ASP A C   1 
ATOM   1875  O O   . ASP A 1 239 ? -12.575 112.034 75.191  1.00 20.00 ? 239  ASP A O   1 
ATOM   1876  C CB  . ASP A 1 239 ? -10.487 113.059 72.967  1.00 20.00 ? 239  ASP A CB  1 
ATOM   1877  C CG  . ASP A 1 239 ? -9.222  113.882 73.082  1.00 20.00 ? 239  ASP A CG  1 
ATOM   1878  O OD1 . ASP A 1 239 ? -8.566  113.828 74.148  1.00 20.00 ? 239  ASP A OD1 1 
ATOM   1879  O OD2 . ASP A 1 239 ? -8.885  114.583 72.100  1.00 20.00 ? 239  ASP A OD2 1 
ATOM   1880  N N   . ILE A 1 240 ? -12.538 110.637 73.443  1.00 20.00 ? 240  ILE A N   1 
ATOM   1881  C CA  . ILE A 1 240 ? -13.913 110.231 73.662  1.00 20.00 ? 240  ILE A CA  1 
ATOM   1882  C C   . ILE A 1 240 ? -13.992 109.464 74.984  1.00 20.00 ? 240  ILE A C   1 
ATOM   1883  O O   . ILE A 1 240 ? -14.904 109.672 75.787  1.00 20.00 ? 240  ILE A O   1 
ATOM   1884  C CB  . ILE A 1 240 ? -14.417 109.361 72.498  1.00 20.00 ? 240  ILE A CB  1 
ATOM   1885  C CG1 . ILE A 1 240 ? -14.663 110.248 71.276  1.00 20.00 ? 240  ILE A CG1 1 
ATOM   1886  C CG2 . ILE A 1 240 ? -15.706 108.647 72.887  1.00 20.00 ? 240  ILE A CG2 1 
ATOM   1887  C CD1 . ILE A 1 240 ? -14.792 109.493 69.989  1.00 20.00 ? 240  ILE A CD1 1 
ATOM   1888  N N   . VAL A 1 241 ? -13.021 108.591 75.219  1.00 20.00 ? 241  VAL A N   1 
ATOM   1889  C CA  . VAL A 1 241 ? -12.997 107.804 76.448  1.00 20.00 ? 241  VAL A CA  1 
ATOM   1890  C C   . VAL A 1 241 ? -12.830 108.704 77.670  1.00 20.00 ? 241  VAL A C   1 
ATOM   1891  O O   . VAL A 1 241 ? -13.484 108.513 78.689  1.00 20.00 ? 241  VAL A O   1 
ATOM   1892  C CB  . VAL A 1 241 ? -11.859 106.758 76.409  1.00 20.00 ? 241  VAL A CB  1 
ATOM   1893  C CG1 . VAL A 1 241 ? -11.543 106.267 77.815  1.00 20.00 ? 241  VAL A CG1 1 
ATOM   1894  C CG2 . VAL A 1 241 ? -12.270 105.584 75.524  1.00 20.00 ? 241  VAL A CG2 1 
ATOM   1895  N N   . HIS A 1 242 ? -11.966 109.700 77.563  1.00 20.00 ? 242  HIS A N   1 
ATOM   1896  C CA  . HIS A 1 242 ? -11.752 110.600 78.678  1.00 20.00 ? 242  HIS A CA  1 
ATOM   1897  C C   . HIS A 1 242 ? -13.021 111.351 79.051  1.00 20.00 ? 242  HIS A C   1 
ATOM   1898  O O   . HIS A 1 242 ? -13.337 111.483 80.235  1.00 20.00 ? 242  HIS A O   1 
ATOM   1899  C CB  . HIS A 1 242 ? -10.641 111.596 78.365  1.00 20.00 ? 242  HIS A CB  1 
ATOM   1900  C CG  . HIS A 1 242 ? -10.149 112.331 79.572  1.00 20.00 ? 242  HIS A CG  1 
ATOM   1901  N ND1 . HIS A 1 242 ? -9.135  111.851 80.374  1.00 20.00 ? 242  HIS A ND1 1 
ATOM   1902  C CD2 . HIS A 1 242 ? -10.560 113.490 80.140  1.00 20.00 ? 242  HIS A CD2 1 
ATOM   1903  C CE1 . HIS A 1 242 ? -8.944  112.681 81.384  1.00 20.00 ? 242  HIS A CE1 1 
ATOM   1904  N NE2 . HIS A 1 242 ? -9.797  113.684 81.266  1.00 20.00 ? 242  HIS A NE2 1 
ATOM   1905  N N   . GLU A 1 243 ? -13.748 111.850 78.053  1.00 20.00 ? 243  GLU A N   1 
ATOM   1906  C CA  . GLU A 1 243 ? -14.986 112.582 78.323  1.00 20.00 ? 243  GLU A CA  1 
ATOM   1907  C C   . GLU A 1 243 ? -16.069 111.661 78.874  1.00 20.00 ? 243  GLU A C   1 
ATOM   1908  O O   . GLU A 1 243 ? -16.867 112.060 79.724  1.00 20.00 ? 243  GLU A O   1 
ATOM   1909  C CB  . GLU A 1 243 ? -15.521 113.270 77.065  1.00 20.00 ? 243  GLU A CB  1 
ATOM   1910  C CG  . GLU A 1 243 ? -16.576 114.321 77.398  1.00 20.00 ? 243  GLU A CG  1 
ATOM   1911  C CD  . GLU A 1 243 ? -17.399 114.755 76.204  1.00 20.00 ? 243  GLU A CD  1 
ATOM   1912  O OE1 . GLU A 1 243 ? -16.931 114.591 75.061  1.00 20.00 ? 243  GLU A OE1 1 
ATOM   1913  O OE2 . GLU A 1 243 ? -18.520 115.268 76.412  1.00 20.00 ? 243  GLU A OE2 1 
ATOM   1914  N N   . MET A 1 244 ? -16.098 110.429 78.381  1.00 20.00 ? 244  MET A N   1 
ATOM   1915  C CA  . MET A 1 244 ? -17.084 109.462 78.833  1.00 20.00 ? 244  MET A CA  1 
ATOM   1916  C C   . MET A 1 244 ? -17.025 109.323 80.338  1.00 20.00 ? 244  MET A C   1 
ATOM   1917  O O   . MET A 1 244 ? -18.039 109.443 81.019  1.00 20.00 ? 244  MET A O   1 
ATOM   1918  C CB  . MET A 1 244 ? -16.820 108.102 78.202  1.00 20.00 ? 244  MET A CB  1 
ATOM   1919  C CG  . MET A 1 244 ? -17.489 107.902 76.872  1.00 20.00 ? 244  MET A CG  1 
ATOM   1920  S SD  . MET A 1 244 ? -17.025 106.347 76.129  1.00 20.00 ? 244  MET A SD  1 
ATOM   1921  C CE  . MET A 1 244 ? -17.517 105.215 77.380  1.00 20.00 ? 244  MET A CE  1 
ATOM   1922  N N   . PHE A 1 245 ? -15.826 109.083 80.859  1.00 20.00 ? 245  PHE A N   1 
ATOM   1923  C CA  . PHE A 1 245 ? -15.646 108.921 82.296  1.00 20.00 ? 245  PHE A CA  1 
ATOM   1924  C C   . PHE A 1 245 ? -15.733 110.200 83.123  1.00 20.00 ? 245  PHE A C   1 
ATOM   1925  O O   . PHE A 1 245 ? -15.796 110.138 84.347  1.00 20.00 ? 245  PHE A O   1 
ATOM   1926  C CB  . PHE A 1 245 ? -14.327 108.193 82.571  1.00 20.00 ? 245  PHE A CB  1 
ATOM   1927  C CG  . PHE A 1 245 ? -14.346 106.754 82.148  1.00 20.00 ? 245  PHE A CG  1 
ATOM   1928  C CD1 . PHE A 1 245 ? -15.130 105.834 82.823  1.00 20.00 ? 245  PHE A CD1 1 
ATOM   1929  C CD2 . PHE A 1 245 ? -13.636 106.330 81.035  1.00 20.00 ? 245  PHE A CD2 1 
ATOM   1930  C CE1 . PHE A 1 245 ? -15.214 104.513 82.390  1.00 20.00 ? 245  PHE A CE1 1 
ATOM   1931  C CE2 . PHE A 1 245 ? -13.716 105.010 80.596  1.00 20.00 ? 245  PHE A CE2 1 
ATOM   1932  C CZ  . PHE A 1 245 ? -14.505 104.103 81.270  1.00 20.00 ? 245  PHE A CZ  1 
ATOM   1933  N N   . SER A 1 246 ? -15.753 111.358 82.471  1.00 20.00 ? 246  SER A N   1 
ATOM   1934  C CA  . SER A 1 246 ? -15.840 112.613 83.211  1.00 20.00 ? 246  SER A CA  1 
ATOM   1935  C C   . SER A 1 246 ? -17.245 112.807 83.786  1.00 20.00 ? 246  SER A C   1 
ATOM   1936  O O   . SER A 1 246 ? -17.504 113.762 84.508  1.00 20.00 ? 246  SER A O   1 
ATOM   1937  C CB  . SER A 1 246 ? -15.480 113.792 82.309  1.00 20.00 ? 246  SER A CB  1 
ATOM   1938  O OG  . SER A 1 246 ? -16.510 114.064 81.381  1.00 20.00 ? 246  SER A OG  1 
ATOM   1939  N N   . TYR A 1 247 ? -18.150 111.896 83.458  1.00 20.00 ? 247  TYR A N   1 
ATOM   1940  C CA  . TYR A 1 247 ? -19.522 111.968 83.944  1.00 20.00 ? 247  TYR A CA  1 
ATOM   1941  C C   . TYR A 1 247 ? -19.786 110.885 84.983  1.00 20.00 ? 247  TYR A C   1 
ATOM   1942  O O   . TYR A 1 247 ? -20.918 110.705 85.431  1.00 20.00 ? 247  TYR A O   1 
ATOM   1943  C CB  . TYR A 1 247 ? -20.501 111.787 82.788  1.00 20.00 ? 247  TYR A CB  1 
ATOM   1944  C CG  . TYR A 1 247 ? -20.357 112.815 81.702  1.00 20.00 ? 247  TYR A CG  1 
ATOM   1945  C CD1 . TYR A 1 247 ? -20.473 114.173 81.989  1.00 20.00 ? 247  TYR A CD1 1 
ATOM   1946  C CD2 . TYR A 1 247 ? -20.095 112.435 80.385  1.00 20.00 ? 247  TYR A CD2 1 
ATOM   1947  C CE1 . TYR A 1 247 ? -20.330 115.129 80.998  1.00 20.00 ? 247  TYR A CE1 1 
ATOM   1948  C CE2 . TYR A 1 247 ? -19.949 113.385 79.382  1.00 20.00 ? 247  TYR A CE2 1 
ATOM   1949  C CZ  . TYR A 1 247 ? -20.066 114.732 79.698  1.00 20.00 ? 247  TYR A CZ  1 
ATOM   1950  O OH  . TYR A 1 247 ? -19.907 115.693 78.728  1.00 20.00 ? 247  TYR A OH  1 
ATOM   1951  N N   . ALA A 1 248 ? -18.740 110.160 85.358  1.00 20.00 ? 248  ALA A N   1 
ATOM   1952  C CA  . ALA A 1 248 ? -18.861 109.092 86.340  1.00 20.00 ? 248  ALA A CA  1 
ATOM   1953  C C   . ALA A 1 248 ? -18.056 109.399 87.592  1.00 20.00 ? 248  ALA A C   1 
ATOM   1954  O O   . ALA A 1 248 ? -17.129 110.203 87.559  1.00 20.00 ? 248  ALA A O   1 
ATOM   1955  C CB  . ALA A 1 248 ? -18.389 107.763 85.729  1.00 20.00 ? 248  ALA A CB  1 
ATOM   1956  N N   . ASP A 1 249 ? -18.421 108.747 88.693  1.00 20.00 ? 249  ASP A N   1 
ATOM   1957  C CA  . ASP A 1 249 ? -17.744 108.930 89.972  1.00 20.00 ? 249  ASP A CA  1 
ATOM   1958  C C   . ASP A 1 249 ? -16.720 107.823 90.173  1.00 20.00 ? 249  ASP A C   1 
ATOM   1959  O O   . ASP A 1 249 ? -15.901 107.889 91.081  1.00 20.00 ? 249  ASP A O   1 
ATOM   1960  C CB  . ASP A 1 249 ? -18.756 108.899 91.120  1.00 20.00 ? 249  ASP A CB  1 
ATOM   1961  C CG  . ASP A 1 249 ? -19.671 110.104 91.122  1.00 20.00 ? 249  ASP A CG  1 
ATOM   1962  O OD1 . ASP A 1 249 ? -19.164 111.245 91.163  1.00 20.00 ? 249  ASP A OD1 1 
ATOM   1963  O OD2 . ASP A 1 249 ? -20.902 109.905 91.082  1.00 20.00 ? 249  ASP A OD2 1 
ATOM   1964  N N   . GLY A 1 250 ? -16.788 106.805 89.319  1.00 20.00 ? 250  GLY A N   1 
ATOM   1965  C CA  . GLY A 1 250 ? -15.871 105.681 89.396  1.00 20.00 ? 250  GLY A CA  1 
ATOM   1966  C C   . GLY A 1 250 ? -16.283 104.625 88.394  1.00 20.00 ? 250  GLY A C   1 
ATOM   1967  O O   . GLY A 1 250 ? -17.108 104.889 87.530  1.00 20.00 ? 250  GLY A O   1 
ATOM   1968  N N   . CYS A 1 251 ? -15.721 103.430 88.499  1.00 20.00 ? 251  CYS A N   1 
ATOM   1969  C CA  . CYS A 1 251 ? -16.068 102.361 87.570  1.00 20.00 ? 251  CYS A CA  1 
ATOM   1970  C C   . CYS A 1 251 ? -15.487 101.026 87.968  1.00 20.00 ? 251  CYS A C   1 
ATOM   1971  O O   . CYS A 1 251 ? -14.607 100.946 88.824  1.00 20.00 ? 251  CYS A O   1 
ATOM   1972  C CB  . CYS A 1 251 ? -15.587 102.701 86.146  1.00 20.00 ? 251  CYS A CB  1 
ATOM   1973  S SG  . CYS A 1 251 ? -13.777 102.571 85.795  1.00 20.00 ? 251  CYS A SG  1 
ATOM   1974  N N   . THR A 1 252 ? -16.024 99.972  87.369  1.00 20.00 ? 252  THR A N   1 
ATOM   1975  C CA  . THR A 1 252 ? -15.561 98.616  87.625  1.00 20.00 ? 252  THR A CA  1 
ATOM   1976  C C   . THR A 1 252 ? -15.148 98.222  86.222  1.00 20.00 ? 252  THR A C   1 
ATOM   1977  O O   . THR A 1 252 ? -15.906 98.409  85.271  1.00 20.00 ? 252  THR A O   1 
ATOM   1978  C CB  . THR A 1 252 ? -16.667 97.701  88.151  1.00 20.00 ? 252  THR A CB  1 
ATOM   1979  O OG1 . THR A 1 252 ? -17.813 97.778  87.298  1.00 20.00 ? 252  THR A OG1 1 
ATOM   1980  C CG2 . THR A 1 252 ? -17.036 98.110  89.568  1.00 20.00 ? 252  THR A CG2 1 
ATOM   1981  N N   . MET A 1 253 ? -13.938 97.705  86.082  1.00 20.00 ? 253  MET A N   1 
ATOM   1982  C CA  . MET A 1 253 ? -13.453 97.323  84.771  1.00 20.00 ? 253  MET A CA  1 
ATOM   1983  C C   . MET A 1 253 ? -12.877 95.920  84.646  1.00 20.00 ? 253  MET A C   1 
ATOM   1984  O O   . MET A 1 253 ? -12.137 95.450  85.510  1.00 20.00 ? 253  MET A O   1 
ATOM   1985  C CB  . MET A 1 253 ? -12.403 98.358  84.333  1.00 20.00 ? 253  MET A CB  1 
ATOM   1986  C CG  . MET A 1 253 ? -11.653 98.035  83.062  1.00 20.00 ? 253  MET A CG  1 
ATOM   1987  S SD  . MET A 1 253 ? -12.705 98.324  81.690  1.00 20.00 ? 253  MET A SD  1 
ATOM   1988  C CE  . MET A 1 253 ? -11.531 98.528  80.377  1.00 20.00 ? 253  MET A CE  1 
ATOM   1989  N N   . SER A 1 254 ? -13.233 95.256  83.554  1.00 20.00 ? 254  SER A N   1 
ATOM   1990  C CA  . SER A 1 254 ? -12.750 93.914  83.291  1.00 20.00 ? 254  SER A CA  1 
ATOM   1991  C C   . SER A 1 254 ? -11.722 94.069  82.188  1.00 20.00 ? 254  SER A C   1 
ATOM   1992  O O   . SER A 1 254 ? -12.077 94.271  81.032  1.00 20.00 ? 254  SER A O   1 
ATOM   1993  C CB  . SER A 1 254 ? -13.867 93.008  82.797  1.00 20.00 ? 254  SER A CB  1 
ATOM   1994  O OG  . SER A 1 254 ? -13.339 91.740  82.447  1.00 20.00 ? 254  SER A OG  1 
ATOM   1995  N N   . GLY A 1 255 ? -10.447 94.013  82.549  1.00 20.00 ? 255  GLY A N   1 
ATOM   1996  C CA  . GLY A 1 255 ? -9.406  94.149  81.551  1.00 20.00 ? 255  GLY A CA  1 
ATOM   1997  C C   . GLY A 1 255 ? -9.487  93.023  80.544  1.00 20.00 ? 255  GLY A C   1 
ATOM   1998  O O   . GLY A 1 255 ? -9.046  93.167  79.404  1.00 20.00 ? 255  GLY A O   1 
ATOM   1999  N N   . LYS A 1 256 ? -10.050 91.897  80.969  1.00 20.00 ? 256  LYS A N   1 
ATOM   2000  C CA  . LYS A 1 256 ? -10.202 90.724  80.116  1.00 20.00 ? 256  LYS A CA  1 
ATOM   2001  C C   . LYS A 1 256 ? -10.992 91.050  78.855  1.00 20.00 ? 256  LYS A C   1 
ATOM   2002  O O   . LYS A 1 256 ? -11.062 90.240  77.936  1.00 20.00 ? 256  LYS A O   1 
ATOM   2003  C CB  . LYS A 1 256 ? -10.926 89.611  80.873  1.00 20.00 ? 256  LYS A CB  1 
ATOM   2004  C CG  . LYS A 1 256 ? -10.216 89.137  82.112  1.00 20.00 ? 256  LYS A CG  1 
ATOM   2005  C CD  . LYS A 1 256 ? -11.049 88.095  82.828  1.00 20.00 ? 256  LYS A CD  1 
ATOM   2006  C CE  . LYS A 1 256 ? -10.922 86.744  82.177  1.00 20.00 ? 256  LYS A CE  1 
ATOM   2007  N NZ  . LYS A 1 256 ? -11.659 85.718  82.963  1.00 20.00 ? 256  LYS A NZ  1 
ATOM   2008  N N   . LYS A 1 257 ? -11.614 92.221  78.815  1.00 20.00 ? 257  LYS A N   1 
ATOM   2009  C CA  . LYS A 1 257 ? -12.379 92.588  77.642  1.00 20.00 ? 257  LYS A CA  1 
ATOM   2010  C C   . LYS A 1 257 ? -11.606 93.603  76.819  1.00 20.00 ? 257  LYS A C   1 
ATOM   2011  O O   . LYS A 1 257 ? -10.691 93.245  76.092  1.00 20.00 ? 257  LYS A O   1 
ATOM   2012  C CB  . LYS A 1 257 ? -13.758 93.128  78.029  1.00 20.00 ? 257  LYS A CB  1 
ATOM   2013  C CG  . LYS A 1 257 ? -14.898 92.097  78.205  1.00 20.00 ? 257  LYS A CG  1 
ATOM   2014  C CD  . LYS A 1 257 ? -14.752 91.285  79.469  1.00 20.00 ? 257  LYS A CD  1 
ATOM   2015  C CE  . LYS A 1 257 ? -15.884 90.288  79.713  1.00 20.00 ? 257  LYS A CE  1 
ATOM   2016  N NZ  . LYS A 1 257 ? -16.395 90.621  81.044  1.00 20.00 ? 257  LYS A NZ  1 
ATOM   2017  N N   . ASP A 1 258 ? -11.953 94.877  76.961  1.00 20.00 ? 258  ASP A N   1 
ATOM   2018  C CA  . ASP A 1 258 ? -11.287 95.922  76.201  1.00 20.00 ? 258  ASP A CA  1 
ATOM   2019  C C   . ASP A 1 258 ? -9.853  96.300  76.535  1.00 20.00 ? 258  ASP A C   1 
ATOM   2020  O O   . ASP A 1 258 ? -9.282  97.177  75.875  1.00 20.00 ? 258  ASP A O   1 
ATOM   2021  C CB  . ASP A 1 258 ? -12.159 97.184  76.183  1.00 20.00 ? 258  ASP A CB  1 
ATOM   2022  C CG  . ASP A 1 258 ? -13.124 97.204  74.999  1.00 20.00 ? 258  ASP A CG  1 
ATOM   2023  O OD1 . ASP A 1 258 ? -12.948 96.382  74.076  1.00 20.00 ? 258  ASP A OD1 1 
ATOM   2024  O OD2 . ASP A 1 258 ? -14.055 98.035  74.987  1.00 20.00 ? 258  ASP A OD2 1 
ATOM   2025  N N   . CYS A 1 259 ? -9.261  95.664  77.541  1.00 20.00 ? 259  CYS A N   1 
ATOM   2026  C CA  . CYS A 1 259 ? -7.876  95.992  77.890  1.00 20.00 ? 259  CYS A CA  1 
ATOM   2027  C C   . CYS A 1 259 ? -6.915  95.030  77.208  1.00 20.00 ? 259  CYS A C   1 
ATOM   2028  O O   . CYS A 1 259 ? -5.729  95.008  77.511  1.00 20.00 ? 259  CYS A O   1 
ATOM   2029  C CB  . CYS A 1 259 ? -7.660  95.964  79.399  1.00 20.00 ? 259  CYS A CB  1 
ATOM   2030  S SG  . CYS A 1 259 ? -8.263  97.446  80.209  1.00 20.00 ? 259  CYS A SG  1 
ATOM   2031  N N   . LEU A 1 260 ? -7.450  94.222  76.297  1.00 20.00 ? 260  LEU A N   1 
ATOM   2032  C CA  . LEU A 1 260 ? -6.670  93.251  75.543  1.00 20.00 ? 260  LEU A CA  1 
ATOM   2033  C C   . LEU A 1 260 ? -5.777  92.281  76.317  1.00 20.00 ? 260  LEU A C   1 
ATOM   2034  O O   . LEU A 1 260 ? -4.656  91.996  75.893  1.00 20.00 ? 260  LEU A O   1 
ATOM   2035  C CB  . LEU A 1 260 ? -5.829  93.996  74.498  1.00 20.00 ? 260  LEU A CB  1 
ATOM   2036  C CG  . LEU A 1 260 ? -6.656  94.709  73.420  1.00 20.00 ? 260  LEU A CG  1 
ATOM   2037  C CD1 . LEU A 1 260 ? -5.892  95.911  72.866  1.00 20.00 ? 260  LEU A CD1 1 
ATOM   2038  C CD2 . LEU A 1 260 ? -6.998  93.713  72.307  1.00 20.00 ? 260  LEU A CD2 1 
ATOM   2039  N N   . VAL A 1 261 ? -6.274  91.759  77.436  1.00 20.00 ? 261  VAL A N   1 
ATOM   2040  C CA  . VAL A 1 261 ? -5.505  90.815  78.248  1.00 20.00 ? 261  VAL A CA  1 
ATOM   2041  C C   . VAL A 1 261 ? -6.297  89.524  78.499  1.00 20.00 ? 261  VAL A C   1 
ATOM   2042  O O   . VAL A 1 261 ? -7.468  89.418  78.125  1.00 20.00 ? 261  VAL A O   1 
ATOM   2043  C CB  . VAL A 1 261 ? -5.082  91.448  79.598  1.00 20.00 ? 261  VAL A CB  1 
ATOM   2044  C CG1 . VAL A 1 261 ? -3.912  92.380  79.374  1.00 20.00 ? 261  VAL A CG1 1 
ATOM   2045  C CG2 . VAL A 1 261 ? -6.225  92.227  80.207  1.00 20.00 ? 261  VAL A CG2 1 
ATOM   2046  N N   . ASN A 1 262 ? -5.654  88.538  79.118  1.00 20.00 ? 262  ASN A N   1 
ATOM   2047  C CA  . ASN A 1 262 ? -6.304  87.260  79.409  1.00 20.00 ? 262  ASN A CA  1 
ATOM   2048  C C   . ASN A 1 262 ? -6.735  87.121  80.869  1.00 20.00 ? 262  ASN A C   1 
ATOM   2049  O O   . ASN A 1 262 ? -7.274  86.089  81.266  1.00 20.00 ? 262  ASN A O   1 
ATOM   2050  C CB  . ASN A 1 262 ? -5.377  86.099  79.046  1.00 20.00 ? 262  ASN A CB  1 
ATOM   2051  C CG  . ASN A 1 262 ? -4.810  86.224  77.648  1.00 20.00 ? 262  ASN A CG  1 
ATOM   2052  O OD1 . ASN A 1 262 ? -3.609  86.388  77.471  1.00 20.00 ? 262  ASN A OD1 1 
ATOM   2053  N ND2 . ASN A 1 262 ? -5.677  86.148  76.644  1.00 20.00 ? 262  ASN A ND2 1 
ATOM   2054  N N   . ILE A 1 263 ? -6.485  88.161  81.658  1.00 20.00 ? 263  ILE A N   1 
ATOM   2055  C CA  . ILE A 1 263 ? -6.838  88.190  83.074  1.00 20.00 ? 263  ILE A CA  1 
ATOM   2056  C C   . ILE A 1 263 ? -6.572  89.612  83.546  1.00 20.00 ? 263  ILE A C   1 
ATOM   2057  O O   . ILE A 1 263 ? -5.744  90.302  82.964  1.00 20.00 ? 263  ILE A O   1 
ATOM   2058  C CB  . ILE A 1 263 ? -5.989  87.175  83.904  1.00 20.00 ? 263  ILE A CB  1 
ATOM   2059  C CG1 . ILE A 1 263 ? -6.610  86.976  85.283  1.00 20.00 ? 263  ILE A CG1 1 
ATOM   2060  C CG2 . ILE A 1 263 ? -4.557  87.656  84.047  1.00 20.00 ? 263  ILE A CG2 1 
ATOM   2061  C CD1 . ILE A 1 263 ? -7.798  86.065  85.258  1.00 20.00 ? 263  ILE A CD1 1 
ATOM   2062  N N   . GLY A 1 264 ? -7.291  90.060  84.573  1.00 20.00 ? 264  GLY A N   1 
ATOM   2063  C CA  . GLY A 1 264 ? -7.083  91.407  85.071  1.00 20.00 ? 264  GLY A CA  1 
ATOM   2064  C C   . GLY A 1 264 ? -8.299  92.315  85.060  1.00 20.00 ? 264  GLY A C   1 
ATOM   2065  O O   . GLY A 1 264 ? -9.185  92.181  84.213  1.00 20.00 ? 264  GLY A O   1 
ATOM   2066  N N   . GLY A 1 265 ? -8.328  93.242  86.012  1.00 20.00 ? 265  GLY A N   1 
ATOM   2067  C CA  . GLY A 1 265 ? -9.425  94.188  86.135  1.00 20.00 ? 265  GLY A CA  1 
ATOM   2068  C C   . GLY A 1 265 ? -9.090  95.203  87.213  1.00 20.00 ? 265  GLY A C   1 
ATOM   2069  O O   . GLY A 1 265 ? -8.017  95.135  87.811  1.00 20.00 ? 265  GLY A O   1 
ATOM   2070  N N   . PHE A 1 266 ? -9.978  96.154  87.469  1.00 20.00 ? 266  PHE A N   1 
ATOM   2071  C CA  . PHE A 1 266 ? -9.702  97.150  88.498  1.00 20.00 ? 266  PHE A CA  1 
ATOM   2072  C C   . PHE A 1 266 ? -10.903 97.998  88.874  1.00 20.00 ? 266  PHE A C   1 
ATOM   2073  O O   . PHE A 1 266 ? -11.901 98.036  88.159  1.00 20.00 ? 266  PHE A O   1 
ATOM   2074  C CB  . PHE A 1 266 ? -8.529  98.058  88.087  1.00 20.00 ? 266  PHE A CB  1 
ATOM   2075  C CG  . PHE A 1 266 ? -8.698  98.729  86.747  1.00 20.00 ? 266  PHE A CG  1 
ATOM   2076  C CD1 . PHE A 1 266 ? -9.475  99.875  86.618  1.00 20.00 ? 266  PHE A CD1 1 
ATOM   2077  C CD2 . PHE A 1 266 ? -8.040  98.236  85.623  1.00 20.00 ? 266  PHE A CD2 1 
ATOM   2078  C CE1 . PHE A 1 266 ? -9.594  100.523 85.389  1.00 20.00 ? 266  PHE A CE1 1 
ATOM   2079  C CE2 . PHE A 1 266 ? -8.151  98.875  84.390  1.00 20.00 ? 266  PHE A CE2 1 
ATOM   2080  C CZ  . PHE A 1 266 ? -8.930  100.023 84.272  1.00 20.00 ? 266  PHE A CZ  1 
ATOM   2081  N N   . LEU A 1 267 ? -10.801 98.657  90.022  1.00 20.00 ? 267  LEU A N   1 
ATOM   2082  C CA  . LEU A 1 267 ? -11.862 99.513  90.523  1.00 20.00 ? 267  LEU A CA  1 
ATOM   2083  C C   . LEU A 1 267 ? -11.347 100.941 90.573  1.00 20.00 ? 267  LEU A C   1 
ATOM   2084  O O   . LEU A 1 267 ? -10.265 101.191 91.082  1.00 20.00 ? 267  LEU A O   1 
ATOM   2085  C CB  . LEU A 1 267 ? -12.279 99.056  91.923  1.00 20.00 ? 267  LEU A CB  1 
ATOM   2086  C CG  . LEU A 1 267 ? -13.211 99.986  92.697  1.00 20.00 ? 267  LEU A CG  1 
ATOM   2087  C CD1 . LEU A 1 267 ? -14.613 99.883  92.156  1.00 20.00 ? 267  LEU A CD1 1 
ATOM   2088  C CD2 . LEU A 1 267 ? -13.186 99.612  94.160  1.00 20.00 ? 267  LEU A CD2 1 
ATOM   2089  N N   . CYS A 1 268 ? -12.116 101.877 90.034  1.00 20.00 ? 268  CYS A N   1 
ATOM   2090  C CA  . CYS A 1 268 ? -11.710 103.278 90.031  1.00 20.00 ? 268  CYS A CA  1 
ATOM   2091  C C   . CYS A 1 268 ? -12.704 104.149 90.777  1.00 20.00 ? 268  CYS A C   1 
ATOM   2092  O O   . CYS A 1 268 ? -13.904 103.882 90.754  1.00 20.00 ? 268  CYS A O   1 
ATOM   2093  C CB  . CYS A 1 268 ? -11.596 103.797 88.599  1.00 20.00 ? 268  CYS A CB  1 
ATOM   2094  S SG  . CYS A 1 268 ? -10.185 103.181 87.685  1.00 20.00 ? 268  CYS A SG  1 
ATOM   2095  N N   . MET A 1 269 ? -12.201 105.199 91.422  1.00 20.00 ? 269  MET A N   1 
ATOM   2096  C CA  . MET A 1 269 ? -13.042 106.124 92.174  1.00 20.00 ? 269  MET A CA  1 
ATOM   2097  C C   . MET A 1 269 ? -12.298 107.420 92.478  1.00 20.00 ? 269  MET A C   1 
ATOM   2098  O O   . MET A 1 269 ? -11.068 107.445 92.538  1.00 20.00 ? 269  MET A O   1 
ATOM   2099  C CB  . MET A 1 269 ? -13.510 105.479 93.480  1.00 20.00 ? 269  MET A CB  1 
ATOM   2100  C CG  . MET A 1 269 ? -12.449 105.418 94.563  1.00 20.00 ? 269  MET A CG  1 
ATOM   2101  S SD  . MET A 1 269 ? -11.792 103.749 94.763  1.00 20.00 ? 269  MET A SD  1 
ATOM   2102  C CE  . MET A 1 269 ? -13.177 102.930 95.536  1.00 20.00 ? 269  MET A CE  1 
ATOM   2103  N N   . ASN A 1 270 ? -13.051 108.498 92.661  1.00 20.00 ? 270  ASN A N   1 
ATOM   2104  C CA  . ASN A 1 270 ? -12.455 109.794 92.962  1.00 20.00 ? 270  ASN A CA  1 
ATOM   2105  C C   . ASN A 1 270 ? -12.541 110.082 94.451  1.00 20.00 ? 270  ASN A C   1 
ATOM   2106  O O   . ASN A 1 270 ? -11.722 110.825 94.995  1.00 20.00 ? 270  ASN A O   1 
ATOM   2107  C CB  . ASN A 1 270 ? -13.179 110.904 92.212  1.00 20.00 ? 270  ASN A CB  1 
ATOM   2108  C CG  . ASN A 1 270 ? -12.883 110.897 90.739  1.00 20.00 ? 270  ASN A CG  1 
ATOM   2109  O OD1 . ASN A 1 270 ? -11.743 110.717 90.317  1.00 20.00 ? 270  ASN A OD1 1 
ATOM   2110  N ND2 . ASN A 1 270 ? -13.916 111.100 89.940  1.00 20.00 ? 270  ASN A ND2 1 
ATOM   2111  N N   . ASP A 1 271 ? -13.537 109.488 95.102  1.00 20.00 ? 271  ASP A N   1 
ATOM   2112  C CA  . ASP A 1 271 ? -13.758 109.667 96.534  1.00 20.00 ? 271  ASP A CA  1 
ATOM   2113  C C   . ASP A 1 271 ? -12.636 109.064 97.364  1.00 20.00 ? 271  ASP A C   1 
ATOM   2114  O O   . ASP A 1 271 ? -12.305 107.889 97.207  1.00 20.00 ? 271  ASP A O   1 
ATOM   2115  C CB  . ASP A 1 271 ? -15.094 109.040 96.938  1.00 20.00 ? 271  ASP A CB  1 
ATOM   2116  C CG  . ASP A 1 271 ? -15.582 109.533 98.287  1.00 20.00 ? 271  ASP A CG  1 
ATOM   2117  O OD1 . ASP A 1 271 ? -15.958 110.724 98.395  1.00 20.00 ? 271  ASP A OD1 1 
ATOM   2118  O OD2 . ASP A 1 271 ? -15.586 108.728 99.242  1.00 20.00 ? 271  ASP A OD2 1 
ATOM   2119  N N   . GLU A 1 272 ? -12.059 109.870 98.254  1.00 20.00 ? 272  GLU A N   1 
ATOM   2120  C CA  . GLU A 1 272 ? -10.970 109.401 99.101  1.00 20.00 ? 272  GLU A CA  1 
ATOM   2121  C C   . GLU A 1 272 ? -11.462 108.488 100.207 1.00 20.00 ? 272  GLU A C   1 
ATOM   2122  O O   . GLU A 1 272 ? -10.785 107.525 100.560 1.00 20.00 ? 272  GLU A O   1 
ATOM   2123  C CB  . GLU A 1 272 ? -10.205 110.584 99.702  1.00 20.00 ? 272  GLU A CB  1 
ATOM   2124  C CG  . GLU A 1 272 ? -8.812  110.770 99.109  1.00 20.00 ? 272  GLU A CG  1 
ATOM   2125  C CD  . GLU A 1 272 ? -8.760  111.888 98.075  1.00 20.00 ? 272  GLU A CD  1 
ATOM   2126  O OE1 . GLU A 1 272 ? -8.592  113.064 98.476  1.00 20.00 ? 272  GLU A OE1 1 
ATOM   2127  O OE2 . GLU A 1 272 ? -8.890  111.594 96.865  1.00 20.00 ? 272  GLU A OE2 1 
ATOM   2128  N N   . GLU A 1 273 ? -12.636 108.790 100.754 1.00 20.00 ? 273  GLU A N   1 
ATOM   2129  C CA  . GLU A 1 273 ? -13.192 107.971 101.820 1.00 20.00 ? 273  GLU A CA  1 
ATOM   2130  C C   . GLU A 1 273 ? -13.449 106.581 101.276 1.00 20.00 ? 273  GLU A C   1 
ATOM   2131  O O   . GLU A 1 273 ? -13.136 105.591 101.928 1.00 20.00 ? 273  GLU A O   1 
ATOM   2132  C CB  . GLU A 1 273 ? -14.502 108.564 102.337 1.00 20.00 ? 273  GLU A CB  1 
ATOM   2133  C CG  . GLU A 1 273 ? -14.395 109.205 103.714 1.00 20.00 ? 273  GLU A CG  1 
ATOM   2134  C CD  . GLU A 1 273 ? -14.006 110.684 103.651 1.00 20.00 ? 273  GLU A CD  1 
ATOM   2135  O OE1 . GLU A 1 273 ? -14.327 111.355 102.638 1.00 20.00 ? 273  GLU A OE1 1 
ATOM   2136  O OE2 . GLU A 1 273 ? -13.377 111.174 104.619 1.00 20.00 ? 273  GLU A OE2 1 
ATOM   2137  N N   . MET A 1 274 ? -14.015 106.515 100.074 1.00 20.00 ? 274  MET A N   1 
ATOM   2138  C CA  . MET A 1 274 ? -14.312 105.237 99.436  1.00 20.00 ? 274  MET A CA  1 
ATOM   2139  C C   . MET A 1 274 ? -13.036 104.503 99.049  1.00 20.00 ? 274  MET A C   1 
ATOM   2140  O O   . MET A 1 274 ? -12.994 103.272 99.034  1.00 20.00 ? 274  MET A O   1 
ATOM   2141  C CB  . MET A 1 274 ? -15.175 105.447 98.195  1.00 20.00 ? 274  MET A CB  1 
ATOM   2142  C CG  . MET A 1 274 ? -16.517 104.738 98.280  1.00 20.00 ? 274  MET A CG  1 
ATOM   2143  S SD  . MET A 1 274 ? -17.413 104.655 96.723  1.00 20.00 ? 274  MET A SD  1 
ATOM   2144  C CE  . MET A 1 274 ? -16.395 103.495 95.814  1.00 20.00 ? 274  MET A CE  1 
ATOM   2145  N N   . PHE A 1 275 ? -11.996 105.260 98.721  1.00 20.00 ? 275  PHE A N   1 
ATOM   2146  C CA  . PHE A 1 275 ? -10.730 104.658 98.342  1.00 20.00 ? 275  PHE A CA  1 
ATOM   2147  C C   . PHE A 1 275 ? -10.100 103.982 99.564  1.00 20.00 ? 275  PHE A C   1 
ATOM   2148  O O   . PHE A 1 275 ? -9.669  102.826 99.502  1.00 20.00 ? 275  PHE A O   1 
ATOM   2149  C CB  . PHE A 1 275 ? -9.784  105.724 97.801  1.00 20.00 ? 275  PHE A CB  1 
ATOM   2150  C CG  . PHE A 1 275 ? -8.419  105.205 97.490  1.00 20.00 ? 275  PHE A CG  1 
ATOM   2151  C CD1 . PHE A 1 275 ? -8.260  103.987 96.832  1.00 20.00 ? 275  PHE A CD1 1 
ATOM   2152  C CD2 . PHE A 1 275 ? -7.290  105.934 97.833  1.00 20.00 ? 275  PHE A CD2 1 
ATOM   2153  C CE1 . PHE A 1 275 ? -6.995  103.504 96.517  1.00 20.00 ? 275  PHE A CE1 1 
ATOM   2154  C CE2 . PHE A 1 275 ? -6.020  105.463 97.522  1.00 20.00 ? 275  PHE A CE2 1 
ATOM   2155  C CZ  . PHE A 1 275 ? -5.872  104.244 96.861  1.00 20.00 ? 275  PHE A CZ  1 
ATOM   2156  N N   . SER A 1 276 ? -10.048 104.708 100.674 1.00 20.00 ? 276  SER A N   1 
ATOM   2157  C CA  . SER A 1 276 ? -9.472  104.172 101.904 1.00 20.00 ? 276  SER A CA  1 
ATOM   2158  C C   . SER A 1 276 ? -10.195 102.902 102.335 1.00 20.00 ? 276  SER A C   1 
ATOM   2159  O O   . SER A 1 276 ? -9.559  101.911 102.691 1.00 20.00 ? 276  SER A O   1 
ATOM   2160  C CB  . SER A 1 276 ? -9.548  105.216 103.019 1.00 20.00 ? 276  SER A CB  1 
ATOM   2161  O OG  . SER A 1 276 ? -9.011  106.458 102.584 1.00 20.00 ? 276  SER A OG  1 
ATOM   2162  N N   . ALA A 1 277 ? -11.525 102.934 102.296 1.00 20.00 ? 277  ALA A N   1 
ATOM   2163  C CA  . ALA A 1 277 ? -12.340 101.783 102.681 1.00 20.00 ? 277  ALA A CA  1 
ATOM   2164  C C   . ALA A 1 277 ? -12.101 100.616 101.725 1.00 20.00 ? 277  ALA A C   1 
ATOM   2165  O O   . ALA A 1 277 ? -12.040 99.458  102.149 1.00 20.00 ? 277  ALA A O   1 
ATOM   2166  C CB  . ALA A 1 277 ? -13.819 102.163 102.683 1.00 20.00 ? 277  ALA A CB  1 
ATOM   2167  N N   . ALA A 1 278 ? -11.966 100.925 100.438 1.00 20.00 ? 278  ALA A N   1 
ATOM   2168  C CA  . ALA A 1 278 ? -11.730 99.904  99.422  1.00 20.00 ? 278  ALA A CA  1 
ATOM   2169  C C   . ALA A 1 278 ? -10.389 99.221  99.651  1.00 20.00 ? 278  ALA A C   1 
ATOM   2170  O O   . ALA A 1 278 ? -10.243 98.028  99.407  1.00 20.00 ? 278  ALA A O   1 
ATOM   2171  C CB  . ALA A 1 278 ? -11.765 100.527 98.031  1.00 20.00 ? 278  ALA A CB  1 
ATOM   2172  N N   . LYS A 1 279 ? -9.414  99.990  100.122 1.00 20.00 ? 279  LYS A N   1 
ATOM   2173  C CA  . LYS A 1 279 ? -8.080  99.472  100.389 1.00 20.00 ? 279  LYS A CA  1 
ATOM   2174  C C   . LYS A 1 279 ? -8.119  98.433  101.496 1.00 20.00 ? 279  LYS A C   1 
ATOM   2175  O O   . LYS A 1 279 ? -7.400  97.440  101.458 1.00 20.00 ? 279  LYS A O   1 
ATOM   2176  C CB  . LYS A 1 279 ? -7.143  100.608 100.789 1.00 20.00 ? 279  LYS A CB  1 
ATOM   2177  C CG  . LYS A 1 279 ? -6.111  100.929 99.736  1.00 20.00 ? 279  LYS A CG  1 
ATOM   2178  C CD  . LYS A 1 279 ? -5.928  102.418 99.599  1.00 20.00 ? 279  LYS A CD  1 
ATOM   2179  C CE  . LYS A 1 279 ? -4.782  102.913 100.462 1.00 20.00 ? 279  LYS A CE  1 
ATOM   2180  N NZ  . LYS A 1 279 ? -5.033  104.305 100.941 1.00 20.00 ? 279  LYS A NZ  1 
ATOM   2181  N N   . GLU A 1 280 ? -8.965  98.668  102.486 1.00 20.00 ? 280  GLU A N   1 
ATOM   2182  C CA  . GLU A 1 280 ? -9.083  97.739  103.594 1.00 20.00 ? 280  GLU A CA  1 
ATOM   2183  C C   . GLU A 1 280 ? -9.827  96.459  103.194 1.00 20.00 ? 280  GLU A C   1 
ATOM   2184  O O   . GLU A 1 280 ? -9.519  95.374  103.682 1.00 20.00 ? 280  GLU A O   1 
ATOM   2185  C CB  . GLU A 1 280 ? -9.805  98.415  104.760 1.00 20.00 ? 280  GLU A CB  1 
ATOM   2186  C CG  . GLU A 1 280 ? -9.840  97.586  106.033 1.00 20.00 ? 280  GLU A CG  1 
ATOM   2187  C CD  . GLU A 1 280 ? -10.468 98.332  107.197 1.00 20.00 ? 280  GLU A CD  1 
ATOM   2188  O OE1 . GLU A 1 280 ? -11.161 99.343  106.953 1.00 20.00 ? 280  GLU A OE1 1 
ATOM   2189  O OE2 . GLU A 1 280 ? -10.268 97.908  108.357 1.00 20.00 ? 280  GLU A OE2 1 
ATOM   2190  N N   . LEU A 1 281 ? -10.792 96.585  102.292 1.00 20.00 ? 281  LEU A N   1 
ATOM   2191  C CA  . LEU A 1 281 ? -11.576 95.437  101.840 1.00 20.00 ? 281  LEU A CA  1 
ATOM   2192  C C   . LEU A 1 281 ? -10.895 94.548  100.799 1.00 20.00 ? 281  LEU A C   1 
ATOM   2193  O O   . LEU A 1 281 ? -11.090 93.333  100.781 1.00 20.00 ? 281  LEU A O   1 
ATOM   2194  C CB  . LEU A 1 281 ? -12.914 95.931  101.286 1.00 20.00 ? 281  LEU A CB  1 
ATOM   2195  C CG  . LEU A 1 281 ? -14.103 94.976  101.336 1.00 20.00 ? 281  LEU A CG  1 
ATOM   2196  C CD1 . LEU A 1 281 ? -14.381 94.554  102.767 1.00 20.00 ? 281  LEU A CD1 1 
ATOM   2197  C CD2 . LEU A 1 281 ? -15.313 95.672  100.744 1.00 20.00 ? 281  LEU A CD2 1 
ATOM   2198  N N   . VAL A 1 282 ? -10.107 95.157  99.925  1.00 20.00 ? 282  VAL A N   1 
ATOM   2199  C CA  . VAL A 1 282 ? -9.410  94.416  98.885  1.00 20.00 ? 282  VAL A CA  1 
ATOM   2200  C C   . VAL A 1 282 ? -8.406  93.415  99.453  1.00 20.00 ? 282  VAL A C   1 
ATOM   2201  O O   . VAL A 1 282 ? -8.163  92.359  98.868  1.00 20.00 ? 282  VAL A O   1 
ATOM   2202  C CB  . VAL A 1 282 ? -8.694  95.385  97.918  1.00 20.00 ? 282  VAL A CB  1 
ATOM   2203  C CG1 . VAL A 1 282 ? -7.502  96.027  98.608  1.00 20.00 ? 282  VAL A CG1 1 
ATOM   2204  C CG2 . VAL A 1 282 ? -8.273  94.646  96.655  1.00 20.00 ? 282  VAL A CG2 1 
ATOM   2205  N N   . VAL A 1 283 ? -7.842  93.743  100.608 1.00 20.00 ? 283  VAL A N   1 
ATOM   2206  C CA  . VAL A 1 283 ? -6.869  92.874  101.250 1.00 20.00 ? 283  VAL A CA  1 
ATOM   2207  C C   . VAL A 1 283 ? -7.382  91.453  101.512 1.00 20.00 ? 283  VAL A C   1 
ATOM   2208  O O   . VAL A 1 283 ? -6.708  90.474  101.171 1.00 20.00 ? 283  VAL A O   1 
ATOM   2209  C CB  . VAL A 1 283 ? -6.395  93.490  102.582 1.00 20.00 ? 283  VAL A CB  1 
ATOM   2210  C CG1 . VAL A 1 283 ? -5.459  92.536  103.293 1.00 20.00 ? 283  VAL A CG1 1 
ATOM   2211  C CG2 . VAL A 1 283 ? -5.693  94.816  102.319 1.00 20.00 ? 283  VAL A CG2 1 
ATOM   2212  N N   . VAL A 1 284 ? -8.572  91.342  102.101 1.00 20.00 ? 284  VAL A N   1 
ATOM   2213  C CA  . VAL A 1 284 ? -9.167  90.041  102.414 1.00 20.00 ? 284  VAL A CA  1 
ATOM   2214  C C   . VAL A 1 284 ? -9.748  89.267  101.231 1.00 20.00 ? 284  VAL A C   1 
ATOM   2215  O O   . VAL A 1 284 ? -9.924  88.048  101.303 1.00 20.00 ? 284  VAL A O   1 
ATOM   2216  C CB  . VAL A 1 284 ? -10.273 90.186  103.486 1.00 20.00 ? 284  VAL A CB  1 
ATOM   2217  C CG1 . VAL A 1 284 ? -9.678  90.715  104.773 1.00 20.00 ? 284  VAL A CG1 1 
ATOM   2218  C CG2 . VAL A 1 284 ? -11.356 91.120  103.002 1.00 20.00 ? 284  VAL A CG2 1 
ATOM   2219  N N   . TYR A 1 285 ? -10.028 89.967  100.138 1.00 20.00 ? 285  TYR A N   1 
ATOM   2220  C CA  . TYR A 1 285 ? -10.592 89.332  98.954  1.00 20.00 ? 285  TYR A CA  1 
ATOM   2221  C C   . TYR A 1 285 ? -9.646  89.101  97.768  1.00 20.00 ? 285  TYR A C   1 
ATOM   2222  O O   . TYR A 1 285 ? -9.564  87.990  97.249  1.00 20.00 ? 285  TYR A O   1 
ATOM   2223  C CB  . TYR A 1 285 ? -11.806 90.142  98.481  1.00 20.00 ? 285  TYR A CB  1 
ATOM   2224  C CG  . TYR A 1 285 ? -13.012 89.983  99.379  1.00 20.00 ? 285  TYR A CG  1 
ATOM   2225  C CD1 . TYR A 1 285 ? -13.728 88.784  99.407  1.00 20.00 ? 285  TYR A CD1 1 
ATOM   2226  C CD2 . TYR A 1 285 ? -13.411 91.008  100.233 1.00 20.00 ? 285  TYR A CD2 1 
ATOM   2227  C CE1 . TYR A 1 285 ? -14.805 88.607  100.262 1.00 20.00 ? 285  TYR A CE1 1 
ATOM   2228  C CE2 . TYR A 1 285 ? -14.490 90.841  101.096 1.00 20.00 ? 285  TYR A CE2 1 
ATOM   2229  C CZ  . TYR A 1 285 ? -15.181 89.635  101.103 1.00 20.00 ? 285  TYR A CZ  1 
ATOM   2230  O OH  . TYR A 1 285 ? -16.249 89.456  101.947 1.00 20.00 ? 285  TYR A OH  1 
ATOM   2231  N N   . GLU A 1 286 ? -8.939  90.141  97.336  1.00 20.00 ? 286  GLU A N   1 
ATOM   2232  C CA  . GLU A 1 286 ? -8.022  90.010  96.200  1.00 20.00 ? 286  GLU A CA  1 
ATOM   2233  C C   . GLU A 1 286 ? -6.545  89.981  96.553  1.00 20.00 ? 286  GLU A C   1 
ATOM   2234  O O   . GLU A 1 286 ? -5.794  89.164  96.025  1.00 20.00 ? 286  GLU A O   1 
ATOM   2235  C CB  . GLU A 1 286 ? -8.265  91.143  95.196  1.00 20.00 ? 286  GLU A CB  1 
ATOM   2236  C CG  . GLU A 1 286 ? -9.725  91.375  94.818  1.00 20.00 ? 286  GLU A CG  1 
ATOM   2237  C CD  . GLU A 1 286 ? -10.227 90.360  93.816  1.00 20.00 ? 286  GLU A CD  1 
ATOM   2238  O OE1 . GLU A 1 286 ? -9.524  90.105  92.822  1.00 20.00 ? 286  GLU A OE1 1 
ATOM   2239  O OE2 . GLU A 1 286 ? -11.323 89.810  94.022  1.00 20.00 ? 286  GLU A OE2 1 
ATOM   2240  N N   . GLY A 1 287 ? -6.144  90.878  97.445  1.00 20.00 ? 287  GLY A N   1 
ATOM   2241  C CA  . GLY A 1 287 ? -4.760  90.969  97.872  1.00 20.00 ? 287  GLY A CA  1 
ATOM   2242  C C   . GLY A 1 287 ? -4.471  92.418  98.219  1.00 20.00 ? 287  GLY A C   1 
ATOM   2243  O O   . GLY A 1 287 ? -5.390  93.244  98.245  1.00 20.00 ? 287  GLY A O   1 
ATOM   2244  N N   . MET A 1 288 ? -3.210  92.741  98.483  1.00 20.00 ? 288  MET A N   1 
ATOM   2245  C CA  . MET A 1 288 ? -2.841  94.110  98.829  1.00 20.00 ? 288  MET A CA  1 
ATOM   2246  C C   . MET A 1 288 ? -3.295  95.083  97.755  1.00 20.00 ? 288  MET A C   1 
ATOM   2247  O O   . MET A 1 288 ? -3.432  94.717  96.592  1.00 20.00 ? 288  MET A O   1 
ATOM   2248  C CB  . MET A 1 288 ? -1.325  94.234  99.010  1.00 20.00 ? 288  MET A CB  1 
ATOM   2249  C CG  . MET A 1 288 ? -0.813  93.688  100.328 1.00 20.00 ? 288  MET A CG  1 
ATOM   2250  S SD  . MET A 1 288 ? -1.888  94.084  101.724 1.00 20.00 ? 288  MET A SD  1 
ATOM   2251  C CE  . MET A 1 288 ? -1.064  95.495  102.399 1.00 20.00 ? 288  MET A CE  1 
ATOM   2252  N N   . PRO A 1 289 ? -3.515  96.349  98.131  1.00 20.00 ? 289  PRO A N   1 
ATOM   2253  C CA  . PRO A 1 289 ? -3.938  97.356  97.150  1.00 20.00 ? 289  PRO A CA  1 
ATOM   2254  C C   . PRO A 1 289 ? -2.890  97.566  96.070  1.00 20.00 ? 289  PRO A C   1 
ATOM   2255  O O   . PRO A 1 289 ? -3.185  98.122  95.018  1.00 20.00 ? 289  PRO A O   1 
ATOM   2256  C CB  . PRO A 1 289 ? -4.137  98.621  97.983  1.00 20.00 ? 289  PRO A CB  1 
ATOM   2257  C CG  . PRO A 1 289 ? -4.167  98.169  99.403  1.00 20.00 ? 289  PRO A CG  1 
ATOM   2258  C CD  . PRO A 1 289 ? -3.369  96.917  99.480  1.00 20.00 ? 289  PRO A CD  1 
ATOM   2259  N N   . SER A 1 290 ? -1.670  97.107  96.348  1.00 20.00 ? 290  SER A N   1 
ATOM   2260  C CA  . SER A 1 290 ? -0.535  97.227  95.431  1.00 20.00 ? 290  SER A CA  1 
ATOM   2261  C C   . SER A 1 290 ? -0.446  96.173  94.323  1.00 20.00 ? 290  SER A C   1 
ATOM   2262  O O   . SER A 1 290 ? 0.464   96.224  93.501  1.00 20.00 ? 290  SER A O   1 
ATOM   2263  C CB  . SER A 1 290 ? 0.765   97.213  96.237  1.00 20.00 ? 290  SER A CB  1 
ATOM   2264  O OG  . SER A 1 290 ? 0.686   96.261  97.284  1.00 20.00 ? 290  SER A OG  1 
ATOM   2265  N N   . TYR A 1 291 ? -1.363  95.209  94.307  1.00 20.00 ? 291  TYR A N   1 
ATOM   2266  C CA  . TYR A 1 291 ? -1.341  94.173  93.274  1.00 20.00 ? 291  TYR A CA  1 
ATOM   2267  C C   . TYR A 1 291 ? -2.717  93.543  93.061  1.00 20.00 ? 291  TYR A C   1 
ATOM   2268  O O   . TYR A 1 291 ? -2.999  93.001  91.995  1.00 20.00 ? 291  TYR A O   1 
ATOM   2269  C CB  . TYR A 1 291 ? -0.280  93.102  93.595  1.00 20.00 ? 291  TYR A CB  1 
ATOM   2270  C CG  . TYR A 1 291 ? -0.643  92.140  94.697  1.00 20.00 ? 291  TYR A CG  1 
ATOM   2271  C CD1 . TYR A 1 291 ? -1.345  90.971  94.422  1.00 20.00 ? 291  TYR A CD1 1 
ATOM   2272  C CD2 . TYR A 1 291 ? -0.282  92.397  96.019  1.00 20.00 ? 291  TYR A CD2 1 
ATOM   2273  C CE1 . TYR A 1 291 ? -1.686  90.080  95.443  1.00 20.00 ? 291  TYR A CE1 1 
ATOM   2274  C CE2 . TYR A 1 291 ? -0.614  91.515  97.043  1.00 20.00 ? 291  TYR A CE2 1 
ATOM   2275  C CZ  . TYR A 1 291 ? -1.318  90.364  96.749  1.00 20.00 ? 291  TYR A CZ  1 
ATOM   2276  O OH  . TYR A 1 291 ? -1.668  89.505  97.761  1.00 20.00 ? 291  TYR A OH  1 
ATOM   2277  N N   . GLY A 1 292 ? -3.559  93.626  94.086  1.00 20.00 ? 292  GLY A N   1 
ATOM   2278  C CA  . GLY A 1 292 ? -4.908  93.087  94.034  1.00 20.00 ? 292  GLY A CA  1 
ATOM   2279  C C   . GLY A 1 292 ? -5.222  91.765  93.354  1.00 20.00 ? 292  GLY A C   1 
ATOM   2280  O O   . GLY A 1 292 ? -6.197  91.677  92.616  1.00 20.00 ? 292  GLY A O   1 
ATOM   2281  N N   . GLY A 1 293 ? -4.419  90.738  93.602  1.00 20.00 ? 293  GLY A N   1 
ATOM   2282  C CA  . GLY A 1 293 ? -4.669  89.447  92.993  1.00 20.00 ? 293  GLY A CA  1 
ATOM   2283  C C   . GLY A 1 293 ? -4.136  89.289  91.591  1.00 20.00 ? 293  GLY A C   1 
ATOM   2284  O O   . GLY A 1 293 ? -4.541  88.396  90.858  1.00 20.00 ? 293  GLY A O   1 
ATOM   2285  N N   . LEU A 1 294 ? -3.211  90.157  91.220  1.00 20.00 ? 294  LEU A N   1 
ATOM   2286  C CA  . LEU A 1 294 ? -2.619  90.115  89.896  1.00 20.00 ? 294  LEU A CA  1 
ATOM   2287  C C   . LEU A 1 294 ? -1.087  90.051  89.984  1.00 20.00 ? 294  LEU A C   1 
ATOM   2288  O O   . LEU A 1 294 ? -0.483  90.710  90.828  1.00 20.00 ? 294  LEU A O   1 
ATOM   2289  C CB  . LEU A 1 294 ? -3.033  91.372  89.132  1.00 20.00 ? 294  LEU A CB  1 
ATOM   2290  C CG  . LEU A 1 294 ? -3.859  91.328  87.836  1.00 20.00 ? 294  LEU A CG  1 
ATOM   2291  C CD1 . LEU A 1 294 ? -4.826  90.159  87.807  1.00 20.00 ? 294  LEU A CD1 1 
ATOM   2292  C CD2 . LEU A 1 294 ? -4.605  92.649  87.718  1.00 20.00 ? 294  LEU A CD2 1 
ATOM   2293  N N   . ALA A 1 295 ? -0.462  89.240  89.134  1.00 20.00 ? 295  ALA A N   1 
ATOM   2294  C CA  . ALA A 1 295 ? 0.992   89.134  89.142  1.00 20.00 ? 295  ALA A CA  1 
ATOM   2295  C C   . ALA A 1 295 ? 1.476   90.476  88.596  1.00 20.00 ? 295  ALA A C   1 
ATOM   2296  O O   . ALA A 1 295 ? 0.756   91.129  87.853  1.00 20.00 ? 295  ALA A O   1 
ATOM   2297  C CB  . ALA A 1 295 ? 1.450   88.008  88.231  1.00 20.00 ? 295  ALA A CB  1 
ATOM   2298  N N   . GLY A 1 296 ? 2.680   90.900  88.967  1.00 20.00 ? 296  GLY A N   1 
ATOM   2299  C CA  . GLY A 1 296 ? 3.178   92.168  88.472  1.00 20.00 ? 296  GLY A CA  1 
ATOM   2300  C C   . GLY A 1 296 ? 3.221   92.215  86.954  1.00 20.00 ? 296  GLY A C   1 
ATOM   2301  O O   . GLY A 1 296 ? 2.923   93.239  86.351  1.00 20.00 ? 296  GLY A O   1 
ATOM   2302  N N   . ARG A 1 297 ? 3.580   91.100  86.328  1.00 20.00 ? 297  ARG A N   1 
ATOM   2303  C CA  . ARG A 1 297 ? 3.657   91.040  84.872  1.00 20.00 ? 297  ARG A CA  1 
ATOM   2304  C C   . ARG A 1 297 ? 2.311   91.282  84.205  1.00 20.00 ? 297  ARG A C   1 
ATOM   2305  O O   . ARG A 1 297 ? 2.239   91.825  83.105  1.00 20.00 ? 297  ARG A O   1 
ATOM   2306  C CB  . ARG A 1 297 ? 4.203   89.681  84.436  1.00 20.00 ? 297  ARG A CB  1 
ATOM   2307  C CG  . ARG A 1 297 ? 3.434   88.500  84.984  1.00 20.00 ? 297  ARG A CG  1 
ATOM   2308  C CD  . ARG A 1 297 ? 3.831   87.213  84.277  1.00 20.00 ? 297  ARG A CD  1 
ATOM   2309  N NE  . ARG A 1 297 ? 3.069   86.081  84.783  1.00 20.00 ? 297  ARG A NE  1 
ATOM   2310  C CZ  . ARG A 1 297 ? 3.457   85.329  85.804  1.00 20.00 ? 297  ARG A CZ  1 
ATOM   2311  N NH1 . ARG A 1 297 ? 4.602   85.597  86.420  1.00 20.00 ? 297  ARG A NH1 1 
ATOM   2312  N NH2 . ARG A 1 297 ? 2.698   84.325  86.222  1.00 20.00 ? 297  ARG A NH2 1 
ATOM   2313  N N   . ASP A 1 298 ? 1.239   90.875  84.874  1.00 20.00 ? 298  ASP A N   1 
ATOM   2314  C CA  . ASP A 1 298 ? -0.093  91.054  84.324  1.00 20.00 ? 298  ASP A CA  1 
ATOM   2315  C C   . ASP A 1 298 ? -0.582  92.487  84.430  1.00 20.00 ? 298  ASP A C   1 
ATOM   2316  O O   . ASP A 1 298 ? -1.425  92.915  83.649  1.00 20.00 ? 298  ASP A O   1 
ATOM   2317  C CB  . ASP A 1 298 ? -1.053  90.078  84.993  1.00 20.00 ? 298  ASP A CB  1 
ATOM   2318  C CG  . ASP A 1 298 ? -0.850  88.655  84.504  1.00 20.00 ? 298  ASP A CG  1 
ATOM   2319  O OD1 . ASP A 1 298 ? -0.804  88.458  83.279  1.00 20.00 ? 298  ASP A OD1 1 
ATOM   2320  O OD2 . ASP A 1 298 ? -0.735  87.726  85.328  1.00 20.00 ? 298  ASP A OD2 1 
ATOM   2321  N N   . MET A 1 299 ? -0.057  93.236  85.390  1.00 20.00 ? 299  MET A N   1 
ATOM   2322  C CA  . MET A 1 299 ? -0.461  94.623  85.548  1.00 20.00 ? 299  MET A CA  1 
ATOM   2323  C C   . MET A 1 299 ? 0.237   95.398  84.431  1.00 20.00 ? 299  MET A C   1 
ATOM   2324  O O   . MET A 1 299 ? -0.256  96.423  83.955  1.00 20.00 ? 299  MET A O   1 
ATOM   2325  C CB  . MET A 1 299 ? -0.029  95.168  86.911  1.00 20.00 ? 299  MET A CB  1 
ATOM   2326  C CG  . MET A 1 299 ? -0.836  94.621  88.073  1.00 20.00 ? 299  MET A CG  1 
ATOM   2327  S SD  . MET A 1 299 ? -0.458  95.419  89.639  1.00 20.00 ? 299  MET A SD  1 
ATOM   2328  C CE  . MET A 1 299 ? 0.893   94.481  90.183  1.00 20.00 ? 299  MET A CE  1 
ATOM   2329  N N   . GLU A 1 300 ? 1.398   94.904  84.012  1.00 20.00 ? 300  GLU A N   1 
ATOM   2330  C CA  . GLU A 1 300 ? 2.147   95.561  82.947  1.00 20.00 ? 300  GLU A CA  1 
ATOM   2331  C C   . GLU A 1 300 ? 1.461   95.291  81.622  1.00 20.00 ? 300  GLU A C   1 
ATOM   2332  O O   . GLU A 1 300 ? 1.315   96.180  80.803  1.00 20.00 ? 300  GLU A O   1 
ATOM   2333  C CB  . GLU A 1 300 ? 3.574   95.025  82.867  1.00 20.00 ? 300  GLU A CB  1 
ATOM   2334  C CG  . GLU A 1 300 ? 4.448   95.769  81.865  1.00 20.00 ? 300  GLU A CG  1 
ATOM   2335  C CD  . GLU A 1 300 ? 4.882   97.120  82.387  1.00 20.00 ? 300  GLU A CD  1 
ATOM   2336  O OE1 . GLU A 1 300 ? 4.884   97.304  83.618  1.00 20.00 ? 300  GLU A OE1 1 
ATOM   2337  O OE2 . GLU A 1 300 ? 5.223   97.997  81.575  1.00 20.00 ? 300  GLU A OE2 1 
ATOM   2338  N N   . ALA A 1 301 ? 1.049   94.048  81.409  1.00 20.00 ? 301  ALA A N   1 
ATOM   2339  C CA  . ALA A 1 301 ? 0.386   93.706  80.166  1.00 20.00 ? 301  ALA A CA  1 
ATOM   2340  C C   . ALA A 1 301 ? -0.921  94.471  80.018  1.00 20.00 ? 301  ALA A C   1 
ATOM   2341  O O   . ALA A 1 301 ? -1.281  94.866  78.910  1.00 20.00 ? 301  ALA A O   1 
ATOM   2342  C CB  . ALA A 1 301 ? 0.136   92.221  80.097  1.00 20.00 ? 301  ALA A CB  1 
ATOM   2343  N N   . MET A 1 302 ? -1.622  94.692  81.128  1.00 20.00 ? 302  MET A N   1 
ATOM   2344  C CA  . MET A 1 302 ? -2.895  95.417  81.103  1.00 20.00 ? 302  MET A CA  1 
ATOM   2345  C C   . MET A 1 302 ? -2.699  96.912  80.876  1.00 20.00 ? 302  MET A C   1 
ATOM   2346  O O   . MET A 1 302 ? -3.502  97.551  80.204  1.00 20.00 ? 302  MET A O   1 
ATOM   2347  C CB  . MET A 1 302 ? -3.669  95.183  82.406  1.00 20.00 ? 302  MET A CB  1 
ATOM   2348  C CG  . MET A 1 302 ? -5.040  95.879  82.462  1.00 20.00 ? 302  MET A CG  1 
ATOM   2349  S SD  . MET A 1 302 ? -6.198  95.165  83.675  1.00 20.00 ? 302  MET A SD  1 
ATOM   2350  C CE  . MET A 1 302 ? -5.230  95.170  85.202  1.00 20.00 ? 302  MET A CE  1 
ATOM   2351  N N   . ALA A 1 303 ? -1.640  97.483  81.436  1.00 20.00 ? 303  ALA A N   1 
ATOM   2352  C CA  . ALA A 1 303 ? -1.402  98.910  81.246  1.00 20.00 ? 303  ALA A CA  1 
ATOM   2353  C C   . ALA A 1 303 ? -1.068  99.152  79.778  1.00 20.00 ? 303  ALA A C   1 
ATOM   2354  O O   . ALA A 1 303 ? -1.436  100.175 79.204  1.00 20.00 ? 303  ALA A O   1 
ATOM   2355  C CB  . ALA A 1 303 ? -0.249  99.377  82.120  1.00 20.00 ? 303  ALA A CB  1 
ATOM   2356  N N   . ILE A 1 304 ? -0.362  98.203  79.171  1.00 20.00 ? 304  ILE A N   1 
ATOM   2357  C CA  . ILE A 1 304 ? 0.023   98.316  77.767  1.00 20.00 ? 304  ILE A CA  1 
ATOM   2358  C C   . ILE A 1 304 ? -1.179  98.131  76.843  1.00 20.00 ? 304  ILE A C   1 
ATOM   2359  O O   . ILE A 1 304 ? -1.382  98.917  75.920  1.00 20.00 ? 304  ILE A O   1 
ATOM   2360  C CB  . ILE A 1 304 ? 1.116   97.272  77.402  1.00 20.00 ? 304  ILE A CB  1 
ATOM   2361  C CG1 . ILE A 1 304 ? 2.417   97.586  78.152  1.00 20.00 ? 304  ILE A CG1 1 
ATOM   2362  C CG2 . ILE A 1 304 ? 1.396   97.308  75.907  1.00 20.00 ? 304  ILE A CG2 1 
ATOM   2363  C CD1 . ILE A 1 304 ? 3.393   96.430  78.185  1.00 20.00 ? 304  ILE A CD1 1 
ATOM   2364  N N   . GLY A 1 305 ? -1.973  97.094  77.101  1.00 20.00 ? 305  GLY A N   1 
ATOM   2365  C CA  . GLY A 1 305 ? -3.139  96.827  76.283  1.00 20.00 ? 305  GLY A CA  1 
ATOM   2366  C C   . GLY A 1 305 ? -4.158  97.953  76.289  1.00 20.00 ? 305  GLY A C   1 
ATOM   2367  O O   . GLY A 1 305 ? -4.790  98.241  75.273  1.00 20.00 ? 305  GLY A O   1 
ATOM   2368  N N   . LEU A 1 306 ? -4.334  98.588  77.437  1.00 20.00 ? 306  LEU A N   1 
ATOM   2369  C CA  . LEU A 1 306 ? -5.284  99.679  77.553  1.00 20.00 ? 306  LEU A CA  1 
ATOM   2370  C C   . LEU A 1 306 ? -4.868  100.760 76.573  1.00 20.00 ? 306  LEU A C   1 
ATOM   2371  O O   . LEU A 1 306 ? -5.703  101.362 75.903  1.00 20.00 ? 306  LEU A O   1 
ATOM   2372  C CB  . LEU A 1 306 ? -5.296  100.217 78.987  1.00 20.00 ? 306  LEU A CB  1 
ATOM   2373  C CG  . LEU A 1 306 ? -6.361  101.262 79.331  1.00 20.00 ? 306  LEU A CG  1 
ATOM   2374  C CD1 . LEU A 1 306 ? -7.733  100.784 78.860  1.00 20.00 ? 306  LEU A CD1 1 
ATOM   2375  C CD2 . LEU A 1 306 ? -6.359  101.505 80.826  1.00 20.00 ? 306  LEU A CD2 1 
ATOM   2376  N N   . ARG A 1 307 ? -3.561  100.984 76.481  1.00 20.00 ? 307  ARG A N   1 
ATOM   2377  C CA  . ARG A 1 307 ? -3.014  101.985 75.579  1.00 20.00 ? 307  ARG A CA  1 
ATOM   2378  C C   . ARG A 1 307 ? -3.167  101.544 74.119  1.00 20.00 ? 307  ARG A C   1 
ATOM   2379  O O   . ARG A 1 307 ? -3.447  102.361 73.251  1.00 20.00 ? 307  ARG A O   1 
ATOM   2380  C CB  . ARG A 1 307 ? -1.539  102.229 75.892  1.00 20.00 ? 307  ARG A CB  1 
ATOM   2381  C CG  . ARG A 1 307 ? -1.181  103.701 75.951  1.00 20.00 ? 307  ARG A CG  1 
ATOM   2382  C CD  . ARG A 1 307 ? 0.186   103.918 76.560  1.00 20.00 ? 307  ARG A CD  1 
ATOM   2383  N NE  . ARG A 1 307 ? 0.111   104.399 77.937  1.00 20.00 ? 307  ARG A NE  1 
ATOM   2384  C CZ  . ARG A 1 307 ? -0.180  105.647 78.290  1.00 20.00 ? 307  ARG A CZ  1 
ATOM   2385  N NH1 . ARG A 1 307 ? -0.429  106.564 77.367  1.00 20.00 ? 307  ARG A NH1 1 
ATOM   2386  N NH2 . ARG A 1 307 ? -0.213  105.977 79.572  1.00 20.00 ? 307  ARG A NH2 1 
ATOM   2387  N N   . GLU A 1 308 ? -2.983  100.255 73.849  1.00 20.00 ? 308  GLU A N   1 
ATOM   2388  C CA  . GLU A 1 308 ? -3.110  99.735  72.488  1.00 20.00 ? 308  GLU A CA  1 
ATOM   2389  C C   . GLU A 1 308 ? -4.543  99.800  72.001  1.00 20.00 ? 308  GLU A C   1 
ATOM   2390  O O   . GLU A 1 308 ? -4.799  99.934  70.806  1.00 20.00 ? 308  GLU A O   1 
ATOM   2391  C CB  . GLU A 1 308 ? -2.658  98.281  72.432  1.00 20.00 ? 308  GLU A CB  1 
ATOM   2392  C CG  . GLU A 1 308 ? -1.171  98.098  72.630  1.00 20.00 ? 308  GLU A CG  1 
ATOM   2393  C CD  . GLU A 1 308 ? -0.715  96.707  72.282  1.00 20.00 ? 308  GLU A CD  1 
ATOM   2394  O OE1 . GLU A 1 308 ? -1.586  95.846  72.037  1.00 20.00 ? 308  GLU A OE1 1 
ATOM   2395  O OE2 . GLU A 1 308 ? 0.515   96.479  72.259  1.00 20.00 ? 308  GLU A OE2 1 
ATOM   2396  N N   . ALA A 1 309 ? -5.475  99.683  72.940  1.00 20.00 ? 309  ALA A N   1 
ATOM   2397  C CA  . ALA A 1 309 ? -6.897  99.720  72.643  1.00 20.00 ? 309  ALA A CA  1 
ATOM   2398  C C   . ALA A 1 309 ? -7.361  101.080 72.131  1.00 20.00 ? 309  ALA A C   1 
ATOM   2399  O O   . ALA A 1 309 ? -8.379  101.174 71.450  1.00 20.00 ? 309  ALA A O   1 
ATOM   2400  C CB  . ALA A 1 309 ? -7.689  99.327  73.894  1.00 20.00 ? 309  ALA A CB  1 
ATOM   2401  N N   . MET A 1 310 ? -6.607  102.130 72.455  1.00 20.00 ? 310  MET A N   1 
ATOM   2402  C CA  . MET A 1 310 ? -6.949  103.489 72.030  1.00 20.00 ? 310  MET A CA  1 
ATOM   2403  C C   . MET A 1 310 ? -6.651  103.805 70.568  1.00 20.00 ? 310  MET A C   1 
ATOM   2404  O O   . MET A 1 310 ? -7.027  104.871 70.082  1.00 20.00 ? 310  MET A O   1 
ATOM   2405  C CB  . MET A 1 310 ? -6.234  104.521 72.911  1.00 20.00 ? 310  MET A CB  1 
ATOM   2406  C CG  . MET A 1 310 ? -6.465  104.336 74.404  1.00 20.00 ? 310  MET A CG  1 
ATOM   2407  S SD  . MET A 1 310 ? -8.113  104.839 74.935  1.00 20.00 ? 310  MET A SD  1 
ATOM   2408  C CE  . MET A 1 310 ? -8.581  103.472 75.946  1.00 20.00 ? 310  MET A CE  1 
ATOM   2409  N N   . GLN A 1 311 ? -5.970  102.902 69.870  1.00 20.00 ? 311  GLN A N   1 
ATOM   2410  C CA  . GLN A 1 311 ? -5.652  103.137 68.464  1.00 20.00 ? 311  GLN A CA  1 
ATOM   2411  C C   . GLN A 1 311 ? -6.906  102.944 67.612  1.00 20.00 ? 311  GLN A C   1 
ATOM   2412  O O   . GLN A 1 311 ? -7.482  101.858 67.567  1.00 20.00 ? 311  GLN A O   1 
ATOM   2413  C CB  . GLN A 1 311 ? -4.552  102.183 67.990  1.00 20.00 ? 311  GLN A CB  1 
ATOM   2414  C CG  . GLN A 1 311 ? -3.921  102.584 66.658  1.00 20.00 ? 311  GLN A CG  1 
ATOM   2415  C CD  . GLN A 1 311 ? -3.416  101.403 65.859  1.00 20.00 ? 311  GLN A CD  1 
ATOM   2416  O OE1 . GLN A 1 311 ? -3.370  100.278 66.353  1.00 20.00 ? 311  GLN A OE1 1 
ATOM   2417  N NE2 . GLN A 1 311 ? -3.032  101.654 64.611  1.00 20.00 ? 311  GLN A NE2 1 
ATOM   2418  N N   . TYR A 1 312 ? -7.315  104.011 66.937  1.00 20.00 ? 312  TYR A N   1 
ATOM   2419  C CA  . TYR A 1 312 ? -8.497  103.974 66.091  1.00 20.00 ? 312  TYR A CA  1 
ATOM   2420  C C   . TYR A 1 312 ? -8.556  102.768 65.176  1.00 20.00 ? 312  TYR A C   1 
ATOM   2421  O O   . TYR A 1 312 ? -9.492  101.983 65.247  1.00 20.00 ? 312  TYR A O   1 
ATOM   2422  C CB  . TYR A 1 312 ? -8.589  105.243 65.244  1.00 20.00 ? 312  TYR A CB  1 
ATOM   2423  C CG  . TYR A 1 312 ? -9.800  105.248 64.349  1.00 20.00 ? 312  TYR A CG  1 
ATOM   2424  C CD1 . TYR A 1 312 ? -11.084 105.240 64.892  1.00 20.00 ? 312  TYR A CD1 1 
ATOM   2425  C CD2 . TYR A 1 312 ? -9.670  105.205 62.961  1.00 20.00 ? 312  TYR A CD2 1 
ATOM   2426  C CE1 . TYR A 1 312 ? -12.214 105.185 64.080  1.00 20.00 ? 312  TYR A CE1 1 
ATOM   2427  C CE2 . TYR A 1 312 ? -10.801 105.150 62.134  1.00 20.00 ? 312  TYR A CE2 1 
ATOM   2428  C CZ  . TYR A 1 312 ? -12.066 105.140 62.703  1.00 20.00 ? 312  TYR A CZ  1 
ATOM   2429  O OH  . TYR A 1 312 ? -13.187 105.102 61.910  1.00 20.00 ? 312  TYR A OH  1 
ATOM   2430  N N   . GLU A 1 313 ? -7.556  102.624 64.315  1.00 20.00 ? 313  GLU A N   1 
ATOM   2431  C CA  . GLU A 1 313 ? -7.504  101.509 63.379  1.00 20.00 ? 313  GLU A CA  1 
ATOM   2432  C C   . GLU A 1 313 ? -7.746  100.174 64.032  1.00 20.00 ? 313  GLU A C   1 
ATOM   2433  O O   . GLU A 1 313 ? -8.341  99.297  63.427  1.00 20.00 ? 313  GLU A O   1 
ATOM   2434  C CB  . GLU A 1 313 ? -6.156  101.461 62.666  1.00 20.00 ? 313  GLU A CB  1 
ATOM   2435  C CG  . GLU A 1 313 ? -5.991  102.515 61.616  1.00 20.00 ? 313  GLU A CG  1 
ATOM   2436  C CD  . GLU A 1 313 ? -5.471  103.796 62.200  1.00 20.00 ? 313  GLU A CD  1 
ATOM   2437  O OE1 . GLU A 1 313 ? -4.997  103.757 63.355  1.00 20.00 ? 313  GLU A OE1 1 
ATOM   2438  O OE2 . GLU A 1 313 ? -5.536  104.840 61.515  1.00 20.00 ? 313  GLU A OE2 1 
ATOM   2439  N N   . TYR A 1 314 ? -7.281  100.002 65.265  1.00 20.00 ? 314  TYR A N   1 
ATOM   2440  C CA  . TYR A 1 314 ? -7.489  98.736  65.936  1.00 20.00 ? 314  TYR A CA  1 
ATOM   2441  C C   . TYR A 1 314 ? -8.952  98.514  66.302  1.00 20.00 ? 314  TYR A C   1 
ATOM   2442  O O   . TYR A 1 314 ? -9.521  97.463  65.998  1.00 20.00 ? 314  TYR A O   1 
ATOM   2443  C CB  . TYR A 1 314 ? -6.653  98.631  67.213  1.00 20.00 ? 314  TYR A CB  1 
ATOM   2444  C CG  . TYR A 1 314 ? -7.343  97.778  68.253  1.00 20.00 ? 314  TYR A CG  1 
ATOM   2445  C CD1 . TYR A 1 314 ? -7.458  96.397  68.083  1.00 20.00 ? 314  TYR A CD1 1 
ATOM   2446  C CD2 . TYR A 1 314 ? -7.985  98.361  69.349  1.00 20.00 ? 314  TYR A CD2 1 
ATOM   2447  C CE1 . TYR A 1 314 ? -8.205  95.620  68.968  1.00 20.00 ? 314  TYR A CE1 1 
ATOM   2448  C CE2 . TYR A 1 314 ? -8.733  97.597  70.240  1.00 20.00 ? 314  TYR A CE2 1 
ATOM   2449  C CZ  . TYR A 1 314 ? -8.845  96.232  70.040  1.00 20.00 ? 314  TYR A CZ  1 
ATOM   2450  O OH  . TYR A 1 314 ? -9.627  95.486  70.886  1.00 20.00 ? 314  TYR A OH  1 
ATOM   2451  N N   . ILE A 1 315 ? -9.556  99.493  66.968  1.00 20.00 ? 315  ILE A N   1 
ATOM   2452  C CA  . ILE A 1 315 ? -10.948 99.369  67.371  1.00 20.00 ? 315  ILE A CA  1 
ATOM   2453  C C   . ILE A 1 315 ? -11.906 99.405  66.191  1.00 20.00 ? 315  ILE A C   1 
ATOM   2454  O O   . ILE A 1 315 ? -12.940 98.746  66.214  1.00 20.00 ? 315  ILE A O   1 
ATOM   2455  C CB  . ILE A 1 315 ? -11.332 100.454 68.422  1.00 20.00 ? 315  ILE A CB  1 
ATOM   2456  C CG1 . ILE A 1 315 ? -12.601 100.033 69.173  1.00 20.00 ? 315  ILE A CG1 1 
ATOM   2457  C CG2 . ILE A 1 315 ? -11.544 101.800 67.748  1.00 20.00 ? 315  ILE A CG2 1 
ATOM   2458  C CD1 . ILE A 1 315 ? -12.484 98.728  69.923  1.00 20.00 ? 315  ILE A CD1 1 
ATOM   2459  N N   . GLU A 1 316 ? -11.570 100.159 65.152  1.00 20.00 ? 316  GLU A N   1 
ATOM   2460  C CA  . GLU A 1 316 ? -12.457 100.219 63.998  1.00 20.00 ? 316  GLU A CA  1 
ATOM   2461  C C   . GLU A 1 316 ? -12.572 98.831  63.378  1.00 20.00 ? 316  GLU A C   1 
ATOM   2462  O O   . GLU A 1 316 ? -13.664 98.382  63.038  1.00 20.00 ? 316  GLU A O   1 
ATOM   2463  C CB  . GLU A 1 316 ? -11.936 101.198 62.948  1.00 20.00 ? 316  GLU A CB  1 
ATOM   2464  C CG  . GLU A 1 316 ? -12.731 101.134 61.648  1.00 20.00 ? 316  GLU A CG  1 
ATOM   2465  C CD  . GLU A 1 316 ? -11.994 101.733 60.480  1.00 20.00 ? 316  GLU A CD  1 
ATOM   2466  O OE1 . GLU A 1 316 ? -10.748 101.776 60.529  1.00 20.00 ? 316  GLU A OE1 1 
ATOM   2467  O OE2 . GLU A 1 316 ? -12.656 102.164 59.512  1.00 20.00 ? 316  GLU A OE2 1 
ATOM   2468  N N   . HIS A 1 317 ? -11.434 98.158  63.232  1.00 20.00 ? 317  HIS A N   1 
ATOM   2469  C CA  . HIS A 1 317 ? -11.387 96.811  62.655  1.00 20.00 ? 317  HIS A CA  1 
ATOM   2470  C C   . HIS A 1 317 ? -12.058 95.800  63.586  1.00 20.00 ? 317  HIS A C   1 
ATOM   2471  O O   . HIS A 1 317 ? -12.750 94.885  63.142  1.00 20.00 ? 317  HIS A O   1 
ATOM   2472  C CB  . HIS A 1 317 ? -9.931  96.389  62.405  1.00 20.00 ? 317  HIS A CB  1 
ATOM   2473  C CG  . HIS A 1 317 ? -9.775  94.932  62.092  1.00 20.00 ? 317  HIS A CG  1 
ATOM   2474  N ND1 . HIS A 1 317 ? -9.441  94.001  63.050  1.00 20.00 ? 317  HIS A ND1 1 
ATOM   2475  C CD2 . HIS A 1 317 ? -9.949  94.243  60.940  1.00 20.00 ? 317  HIS A CD2 1 
ATOM   2476  C CE1 . HIS A 1 317 ? -9.419  92.800  62.502  1.00 20.00 ? 317  HIS A CE1 1 
ATOM   2477  N NE2 . HIS A 1 317 ? -9.724  92.920  61.223  1.00 20.00 ? 317  HIS A NE2 1 
ATOM   2478  N N   . ARG A 1 318 ? -11.834 95.963  64.882  1.00 20.00 ? 318  ARG A N   1 
ATOM   2479  C CA  . ARG A 1 318 ? -12.421 95.069  65.857  1.00 20.00 ? 318  ARG A CA  1 
ATOM   2480  C C   . ARG A 1 318 ? -13.930 95.023  65.649  1.00 20.00 ? 318  ARG A C   1 
ATOM   2481  O O   . ARG A 1 318 ? -14.498 93.963  65.396  1.00 20.00 ? 318  ARG A O   1 
ATOM   2482  C CB  . ARG A 1 318 ? -12.114 95.565  67.274  1.00 20.00 ? 318  ARG A CB  1 
ATOM   2483  C CG  . ARG A 1 318 ? -12.519 94.599  68.401  1.00 20.00 ? 318  ARG A CG  1 
ATOM   2484  C CD  . ARG A 1 318 ? -14.037 94.535  68.636  1.00 20.00 ? 318  ARG A CD  1 
ATOM   2485  N NE  . ARG A 1 318 ? -14.366 93.787  69.848  1.00 20.00 ? 318  ARG A NE  1 
ATOM   2486  C CZ  . ARG A 1 318 ? -14.408 92.460  69.922  1.00 20.00 ? 318  ARG A CZ  1 
ATOM   2487  N NH1 . ARG A 1 318 ? -14.147 91.723  68.859  1.00 20.00 ? 318  ARG A NH1 1 
ATOM   2488  N NH2 . ARG A 1 318 ? -14.681 91.864  71.065  1.00 20.00 ? 318  ARG A NH2 1 
ATOM   2489  N N   . VAL A 1 319 ? -14.566 96.189  65.744  1.00 20.00 ? 319  VAL A N   1 
ATOM   2490  C CA  . VAL A 1 319 ? -16.011 96.306  65.581  1.00 20.00 ? 319  VAL A CA  1 
ATOM   2491  C C   . VAL A 1 319 ? -16.536 95.950  64.197  1.00 20.00 ? 319  VAL A C   1 
ATOM   2492  O O   . VAL A 1 319 ? -17.569 95.290  64.079  1.00 20.00 ? 319  VAL A O   1 
ATOM   2493  C CB  . VAL A 1 319 ? -16.486 97.726  65.944  1.00 20.00 ? 319  VAL A CB  1 
ATOM   2494  C CG1 . VAL A 1 319 ? -17.966 97.894  65.612  1.00 20.00 ? 319  VAL A CG1 1 
ATOM   2495  C CG2 . VAL A 1 319 ? -16.250 97.974  67.425  1.00 20.00 ? 319  VAL A CG2 1 
ATOM   2496  N N   . LYS A 1 320 ? -15.835 96.379  63.152  1.00 20.00 ? 320  LYS A N   1 
ATOM   2497  C CA  . LYS A 1 320 ? -16.267 96.084  61.790  1.00 20.00 ? 320  LYS A CA  1 
ATOM   2498  C C   . LYS A 1 320 ? -16.129 94.615  61.455  1.00 20.00 ? 320  LYS A C   1 
ATOM   2499  O O   . LYS A 1 320 ? -16.795 94.121  60.549  1.00 20.00 ? 320  LYS A O   1 
ATOM   2500  C CB  . LYS A 1 320 ? -15.488 96.924  60.782  1.00 20.00 ? 320  LYS A CB  1 
ATOM   2501  C CG  . LYS A 1 320 ? -16.261 98.140  60.306  1.00 20.00 ? 320  LYS A CG  1 
ATOM   2502  C CD  . LYS A 1 320 ? -15.328 99.294  60.001  1.00 20.00 ? 320  LYS A CD  1 
ATOM   2503  C CE  . LYS A 1 320 ? -16.089 100.550 59.624  1.00 20.00 ? 320  LYS A CE  1 
ATOM   2504  N NZ  . LYS A 1 320 ? -15.212 101.480 58.852  1.00 20.00 ? 320  LYS A NZ  1 
ATOM   2505  N N   . GLN A 1 321 ? -15.264 93.912  62.175  1.00 20.00 ? 321  GLN A N   1 
ATOM   2506  C CA  . GLN A 1 321 ? -15.085 92.493  61.918  1.00 20.00 ? 321  GLN A CA  1 
ATOM   2507  C C   . GLN A 1 321 ? -16.336 91.764  62.412  1.00 20.00 ? 321  GLN A C   1 
ATOM   2508  O O   . GLN A 1 321 ? -16.749 90.760  61.837  1.00 20.00 ? 321  GLN A O   1 
ATOM   2509  C CB  . GLN A 1 321 ? -13.853 91.951  62.641  1.00 20.00 ? 321  GLN A CB  1 
ATOM   2510  C CG  . GLN A 1 321 ? -13.653 90.456  62.417  1.00 20.00 ? 321  GLN A CG  1 
ATOM   2511  C CD  . GLN A 1 321 ? -12.487 89.903  63.188  1.00 20.00 ? 321  GLN A CD  1 
ATOM   2512  O OE1 . GLN A 1 321 ? -12.529 89.810  64.414  1.00 20.00 ? 321  GLN A OE1 1 
ATOM   2513  N NE2 . GLN A 1 321 ? -11.431 89.528  62.474  1.00 20.00 ? 321  GLN A NE2 1 
ATOM   2514  N N   . VAL A 1 322 ? -16.932 92.274  63.490  1.00 20.00 ? 322  VAL A N   1 
ATOM   2515  C CA  . VAL A 1 322 ? -18.141 91.671  64.053  1.00 20.00 ? 322  VAL A CA  1 
ATOM   2516  C C   . VAL A 1 322 ? -19.297 92.040  63.120  1.00 20.00 ? 322  VAL A C   1 
ATOM   2517  O O   . VAL A 1 322 ? -20.197 91.239  62.884  1.00 20.00 ? 322  VAL A O   1 
ATOM   2518  C CB  . VAL A 1 322 ? -18.439 92.220  65.468  1.00 20.00 ? 322  VAL A CB  1 
ATOM   2519  C CG1 . VAL A 1 322 ? -19.779 91.704  65.951  1.00 20.00 ? 322  VAL A CG1 1 
ATOM   2520  C CG2 . VAL A 1 322 ? -17.331 91.810  66.429  1.00 20.00 ? 322  VAL A CG2 1 
ATOM   2521  N N   . ARG A 1 323 ? -19.253 93.268  62.602  1.00 20.00 ? 323  ARG A N   1 
ATOM   2522  C CA  . ARG A 1 323 ? -20.270 93.787  61.686  1.00 20.00 ? 323  ARG A CA  1 
ATOM   2523  C C   . ARG A 1 323 ? -20.259 92.943  60.406  1.00 20.00 ? 323  ARG A C   1 
ATOM   2524  O O   . ARG A 1 323 ? -21.301 92.669  59.804  1.00 20.00 ? 323  ARG A O   1 
ATOM   2525  C CB  . ARG A 1 323 ? -19.968 95.256  61.359  1.00 20.00 ? 323  ARG A CB  1 
ATOM   2526  C CG  . ARG A 1 323 ? -21.060 95.976  60.569  1.00 20.00 ? 323  ARG A CG  1 
ATOM   2527  C CD  . ARG A 1 323 ? -20.855 97.502  60.536  1.00 20.00 ? 323  ARG A CD  1 
ATOM   2528  N NE  . ARG A 1 323 ? -20.986 98.120  61.859  1.00 20.00 ? 323  ARG A NE  1 
ATOM   2529  C CZ  . ARG A 1 323 ? -20.573 99.349  62.155  1.00 20.00 ? 323  ARG A CZ  1 
ATOM   2530  N NH1 . ARG A 1 323 ? -20.003 100.094 61.218  1.00 20.00 ? 323  ARG A NH1 1 
ATOM   2531  N NH2 . ARG A 1 323 ? -20.712 99.826  63.390  1.00 20.00 ? 323  ARG A NH2 1 
ATOM   2532  N N   . TYR A 1 324 ? -19.065 92.525  60.005  1.00 20.00 ? 324  TYR A N   1 
ATOM   2533  C CA  . TYR A 1 324 ? -18.890 91.711  58.815  1.00 20.00 ? 324  TYR A CA  1 
ATOM   2534  C C   . TYR A 1 324 ? -19.683 90.414  58.956  1.00 20.00 ? 324  TYR A C   1 
ATOM   2535  O O   . TYR A 1 324 ? -20.353 89.986  58.021  1.00 20.00 ? 324  TYR A O   1 
ATOM   2536  C CB  . TYR A 1 324 ? -17.404 91.398  58.618  1.00 20.00 ? 324  TYR A CB  1 
ATOM   2537  C CG  . TYR A 1 324 ? -17.116 90.422  57.504  1.00 20.00 ? 324  TYR A CG  1 
ATOM   2538  C CD1 . TYR A 1 324 ? -17.071 89.054  57.747  1.00 20.00 ? 324  TYR A CD1 1 
ATOM   2539  C CD2 . TYR A 1 324 ? -16.882 90.864  56.207  1.00 20.00 ? 324  TYR A CD2 1 
ATOM   2540  C CE1 . TYR A 1 324 ? -16.802 88.149  56.728  1.00 20.00 ? 324  TYR A CE1 1 
ATOM   2541  C CE2 . TYR A 1 324 ? -16.610 89.965  55.177  1.00 20.00 ? 324  TYR A CE2 1 
ATOM   2542  C CZ  . TYR A 1 324 ? -16.573 88.612  55.448  1.00 20.00 ? 324  TYR A CZ  1 
ATOM   2543  O OH  . TYR A 1 324 ? -16.320 87.713  54.442  1.00 20.00 ? 324  TYR A OH  1 
ATOM   2544  N N   . LEU A 1 325 ? -19.611 89.795  60.131  1.00 20.00 ? 325  LEU A N   1 
ATOM   2545  C CA  . LEU A 1 325 ? -20.325 88.545  60.395  1.00 20.00 ? 325  LEU A CA  1 
ATOM   2546  C C   . LEU A 1 325 ? -21.826 88.783  60.357  1.00 20.00 ? 325  LEU A C   1 
ATOM   2547  O O   . LEU A 1 325 ? -22.563 88.013  59.756  1.00 20.00 ? 325  LEU A O   1 
ATOM   2548  C CB  . LEU A 1 325 ? -19.942 87.988  61.774  1.00 20.00 ? 325  LEU A CB  1 
ATOM   2549  C CG  . LEU A 1 325 ? -19.898 86.468  62.025  1.00 20.00 ? 325  LEU A CG  1 
ATOM   2550  C CD1 . LEU A 1 325 ? -20.155 86.201  63.487  1.00 20.00 ? 325  LEU A CD1 1 
ATOM   2551  C CD2 . LEU A 1 325 ? -20.908 85.737  61.183  1.00 20.00 ? 325  LEU A CD2 1 
ATOM   2552  N N   . GLY A 1 326 ? -22.275 89.845  61.020  1.00 20.00 ? 326  GLY A N   1 
ATOM   2553  C CA  . GLY A 1 326 ? -23.691 90.158  61.044  1.00 20.00 ? 326  GLY A CA  1 
ATOM   2554  C C   . GLY A 1 326 ? -24.211 90.435  59.645  1.00 20.00 ? 326  GLY A C   1 
ATOM   2555  O O   . GLY A 1 326 ? -25.276 89.954  59.253  1.00 20.00 ? 326  GLY A O   1 
ATOM   2556  N N   . ASP A 1 327 ? -23.452 91.214  58.884  1.00 20.00 ? 327  ASP A N   1 
ATOM   2557  C CA  . ASP A 1 327 ? -23.838 91.558  57.523  1.00 20.00 ? 327  ASP A CA  1 
ATOM   2558  C C   . ASP A 1 327 ? -24.039 90.322  56.651  1.00 20.00 ? 327  ASP A C   1 
ATOM   2559  O O   . ASP A 1 327 ? -25.059 90.187  55.985  1.00 20.00 ? 327  ASP A O   1 
ATOM   2560  C CB  . ASP A 1 327 ? -22.777 92.456  56.901  1.00 20.00 ? 327  ASP A CB  1 
ATOM   2561  C CG  . ASP A 1 327 ? -22.821 93.866  57.445  1.00 20.00 ? 327  ASP A CG  1 
ATOM   2562  O OD1 . ASP A 1 327 ? -23.782 94.203  58.174  1.00 20.00 ? 327  ASP A OD1 1 
ATOM   2563  O OD2 . ASP A 1 327 ? -21.892 94.642  57.138  1.00 20.00 ? 327  ASP A OD2 1 
ATOM   2564  N N   . LYS A 1 328 ? -23.063 89.420  56.654  1.00 20.00 ? 328  LYS A N   1 
ATOM   2565  C CA  . LYS A 1 328 ? -23.151 88.204  55.858  1.00 20.00 ? 328  LYS A CA  1 
ATOM   2566  C C   . LYS A 1 328 ? -24.390 87.378  56.209  1.00 20.00 ? 328  LYS A C   1 
ATOM   2567  O O   . LYS A 1 328 ? -25.066 86.854  55.326  1.00 20.00 ? 328  LYS A O   1 
ATOM   2568  C CB  . LYS A 1 328 ? -21.888 87.371  56.055  1.00 20.00 ? 328  LYS A CB  1 
ATOM   2569  C CG  . LYS A 1 328 ? -20.671 87.916  55.312  1.00 20.00 ? 328  LYS A CG  1 
ATOM   2570  C CD  . LYS A 1 328 ? -20.237 86.989  54.170  1.00 20.00 ? 328  LYS A CD  1 
ATOM   2571  C CE  . LYS A 1 328 ? -20.000 85.554  54.655  1.00 20.00 ? 328  LYS A CE  1 
ATOM   2572  N NZ  . LYS A 1 328 ? -19.492 84.636  53.586  1.00 20.00 ? 328  LYS A NZ  1 
ATOM   2573  N N   . LEU A 1 329 ? -24.685 87.269  57.499  1.00 20.00 ? 329  LEU A N   1 
ATOM   2574  C CA  . LEU A 1 329 ? -25.838 86.512  57.961  1.00 20.00 ? 329  LEU A CA  1 
ATOM   2575  C C   . LEU A 1 329 ? -27.141 87.206  57.573  1.00 20.00 ? 329  LEU A C   1 
ATOM   2576  O O   . LEU A 1 329 ? -28.088 86.560  57.136  1.00 20.00 ? 329  LEU A O   1 
ATOM   2577  C CB  . LEU A 1 329 ? -25.776 86.346  59.479  1.00 20.00 ? 329  LEU A CB  1 
ATOM   2578  C CG  . LEU A 1 329 ? -24.627 85.481  60.000  1.00 20.00 ? 329  LEU A CG  1 
ATOM   2579  C CD1 . LEU A 1 329 ? -24.535 85.590  61.512  1.00 20.00 ? 329  LEU A CD1 1 
ATOM   2580  C CD2 . LEU A 1 329 ? -24.853 84.048  59.598  1.00 20.00 ? 329  LEU A CD2 1 
ATOM   2581  N N   . ARG A 1 330 ? -27.189 88.524  57.731  1.00 20.00 ? 330  ARG A N   1 
ATOM   2582  C CA  . ARG A 1 330 ? -28.388 89.283  57.392  1.00 20.00 ? 330  ARG A CA  1 
ATOM   2583  C C   . ARG A 1 330 ? -28.712 89.219  55.901  1.00 20.00 ? 330  ARG A C   1 
ATOM   2584  O O   . ARG A 1 330 ? -29.873 89.211  55.500  1.00 20.00 ? 330  ARG A O   1 
ATOM   2585  C CB  . ARG A 1 330 ? -28.226 90.744  57.812  1.00 20.00 ? 330  ARG A CB  1 
ATOM   2586  C CG  . ARG A 1 330 ? -29.485 91.558  57.615  1.00 20.00 ? 330  ARG A CG  1 
ATOM   2587  C CD  . ARG A 1 330 ? -29.253 93.036  57.866  1.00 20.00 ? 330  ARG A CD  1 
ATOM   2588  N NE  . ARG A 1 330 ? -28.700 93.263  59.194  1.00 20.00 ? 330  ARG A NE  1 
ATOM   2589  C CZ  . ARG A 1 330 ? -27.419 93.519  59.428  1.00 20.00 ? 330  ARG A CZ  1 
ATOM   2590  N NH1 . ARG A 1 330 ? -26.560 93.580  58.416  1.00 20.00 ? 330  ARG A NH1 1 
ATOM   2591  N NH2 . ARG A 1 330 ? -26.998 93.697  60.673  1.00 20.00 ? 330  ARG A NH2 1 
ATOM   2592  N N   . GLU A 1 331 ? -27.674 89.174  55.082  1.00 20.00 ? 331  GLU A N   1 
ATOM   2593  C CA  . GLU A 1 331 ? -27.840 89.112  53.644  1.00 20.00 ? 331  GLU A CA  1 
ATOM   2594  C C   . GLU A 1 331 ? -28.522 87.819  53.211  1.00 20.00 ? 331  GLU A C   1 
ATOM   2595  O O   . GLU A 1 331 ? -29.129 87.761  52.146  1.00 20.00 ? 331  GLU A O   1 
ATOM   2596  C CB  . GLU A 1 331 ? -26.475 89.218  52.975  1.00 20.00 ? 331  GLU A CB  1 
ATOM   2597  C CG  . GLU A 1 331 ? -26.425 90.114  51.755  1.00 20.00 ? 331  GLU A CG  1 
ATOM   2598  C CD  . GLU A 1 331 ? -25.098 89.998  51.022  1.00 20.00 ? 331  GLU A CD  1 
ATOM   2599  O OE1 . GLU A 1 331 ? -24.051 89.899  51.705  1.00 20.00 ? 331  GLU A OE1 1 
ATOM   2600  O OE2 . GLU A 1 331 ? -25.101 90.001  49.768  1.00 20.00 ? 331  GLU A OE2 1 
ATOM   2601  N N   . ALA A 1 332 ? -28.417 86.783  54.036  1.00 20.00 ? 332  ALA A N   1 
ATOM   2602  C CA  . ALA A 1 332 ? -29.023 85.486  53.732  1.00 20.00 ? 332  ALA A CA  1 
ATOM   2603  C C   . ALA A 1 332 ? -30.336 85.284  54.484  1.00 20.00 ? 332  ALA A C   1 
ATOM   2604  O O   . ALA A 1 332 ? -30.914 84.196  54.471  1.00 20.00 ? 332  ALA A O   1 
ATOM   2605  C CB  . ALA A 1 332 ? -28.050 84.371  54.080  1.00 20.00 ? 332  ALA A CB  1 
ATOM   2606  N N   . GLY A 1 333 ? -30.793 86.340  55.148  1.00 20.00 ? 333  GLY A N   1 
ATOM   2607  C CA  . GLY A 1 333 ? -32.029 86.270  55.901  1.00 20.00 ? 333  GLY A CA  1 
ATOM   2608  C C   . GLY A 1 333 ? -31.988 85.438  57.171  1.00 20.00 ? 333  GLY A C   1 
ATOM   2609  O O   . GLY A 1 333 ? -33.001 84.880  57.591  1.00 20.00 ? 333  GLY A O   1 
ATOM   2610  N N   . VAL A 1 334 ? -30.822 85.343  57.796  1.00 20.00 ? 334  VAL A N   1 
ATOM   2611  C CA  . VAL A 1 334 ? -30.708 84.566  59.019  1.00 20.00 ? 334  VAL A CA  1 
ATOM   2612  C C   . VAL A 1 334 ? -31.118 85.476  60.175  1.00 20.00 ? 334  VAL A C   1 
ATOM   2613  O O   . VAL A 1 334 ? -30.698 86.628  60.247  1.00 20.00 ? 334  VAL A O   1 
ATOM   2614  C CB  . VAL A 1 334 ? -29.261 84.045  59.210  1.00 20.00 ? 334  VAL A CB  1 
ATOM   2615  C CG1 . VAL A 1 334 ? -29.062 83.530  60.625  1.00 20.00 ? 334  VAL A CG1 1 
ATOM   2616  C CG2 . VAL A 1 334 ? -28.985 82.930  58.211  1.00 20.00 ? 334  VAL A CG2 1 
ATOM   2617  N N   . PRO A 1 335 ? -31.978 84.980  61.079  1.00 20.00 ? 335  PRO A N   1 
ATOM   2618  C CA  . PRO A 1 335 ? -32.547 85.839  62.123  1.00 20.00 ? 335  PRO A CA  1 
ATOM   2619  C C   . PRO A 1 335 ? -31.547 86.178  63.229  1.00 20.00 ? 335  PRO A C   1 
ATOM   2620  O O   . PRO A 1 335 ? -31.139 85.317  64.003  1.00 20.00 ? 335  PRO A O   1 
ATOM   2621  C CB  . PRO A 1 335 ? -33.731 85.033  62.641  1.00 20.00 ? 335  PRO A CB  1 
ATOM   2622  C CG  . PRO A 1 335 ? -33.353 83.611  62.386  1.00 20.00 ? 335  PRO A CG  1 
ATOM   2623  C CD  . PRO A 1 335 ? -32.471 83.594  61.165  1.00 20.00 ? 335  PRO A CD  1 
ATOM   2624  N N   . ILE A 1 336 ? -31.162 87.444  63.295  1.00 20.00 ? 336  ILE A N   1 
ATOM   2625  C CA  . ILE A 1 336 ? -30.211 87.913  64.294  1.00 20.00 ? 336  ILE A CA  1 
ATOM   2626  C C   . ILE A 1 336 ? -30.736 89.147  65.015  1.00 20.00 ? 336  ILE A C   1 
ATOM   2627  O O   . ILE A 1 336 ? -31.649 89.826  64.531  1.00 20.00 ? 336  ILE A O   1 
ATOM   2628  C CB  . ILE A 1 336 ? -28.867 88.293  63.645  1.00 20.00 ? 336  ILE A CB  1 
ATOM   2629  C CG1 . ILE A 1 336 ? -29.062 89.526  62.766  1.00 20.00 ? 336  ILE A CG1 1 
ATOM   2630  C CG2 . ILE A 1 336 ? -28.333 87.128  62.814  1.00 20.00 ? 336  ILE A CG2 1 
ATOM   2631  C CD1 . ILE A 1 336 ? -27.773 90.192  62.331  1.00 20.00 ? 336  ILE A CD1 1 
ATOM   2632  N N   . VAL A 1 337 ? -30.141 89.434  66.168  1.00 20.00 ? 337  VAL A N   1 
ATOM   2633  C CA  . VAL A 1 337 ? -30.525 90.584  66.973  1.00 20.00 ? 337  VAL A CA  1 
ATOM   2634  C C   . VAL A 1 337 ? -29.963 91.818  66.275  1.00 20.00 ? 337  VAL A C   1 
ATOM   2635  O O   . VAL A 1 337 ? -28.848 91.782  65.759  1.00 20.00 ? 337  VAL A O   1 
ATOM   2636  C CB  . VAL A 1 337 ? -29.938 90.473  68.414  1.00 20.00 ? 337  VAL A CB  1 
ATOM   2637  C CG1 . VAL A 1 337 ? -30.113 91.786  69.163  1.00 20.00 ? 337  VAL A CG1 1 
ATOM   2638  C CG2 . VAL A 1 337 ? -30.617 89.333  69.167  1.00 20.00 ? 337  VAL A CG2 1 
ATOM   2639  N N   . GLU A 1 338 ? -30.733 92.903  66.248  1.00 20.00 ? 338  GLU A N   1 
ATOM   2640  C CA  . GLU A 1 338 ? -30.291 94.137  65.600  1.00 20.00 ? 338  GLU A CA  1 
ATOM   2641  C C   . GLU A 1 338 ? -30.212 95.314  66.559  1.00 20.00 ? 338  GLU A C   1 
ATOM   2642  O O   . GLU A 1 338 ? -30.913 95.352  67.568  1.00 20.00 ? 338  GLU A O   1 
ATOM   2643  C CB  . GLU A 1 338 ? -31.244 94.500  64.463  1.00 20.00 ? 338  GLU A CB  1 
ATOM   2644  C CG  . GLU A 1 338 ? -31.403 93.414  63.436  1.00 20.00 ? 338  GLU A CG  1 
ATOM   2645  C CD  . GLU A 1 338 ? -30.491 93.628  62.253  1.00 20.00 ? 338  GLU A CD  1 
ATOM   2646  O OE1 . GLU A 1 338 ? -29.558 94.456  62.367  1.00 20.00 ? 338  GLU A OE1 1 
ATOM   2647  O OE2 . GLU A 1 338 ? -30.705 92.973  61.212  1.00 20.00 ? 338  GLU A OE2 1 
ATOM   2648  N N   . PRO A 1 339 ? -29.356 96.302  66.248  1.00 20.00 ? 339  PRO A N   1 
ATOM   2649  C CA  . PRO A 1 339 ? -28.228 96.140  65.323  1.00 20.00 ? 339  PRO A CA  1 
ATOM   2650  C C   . PRO A 1 339 ? -27.094 95.320  65.939  1.00 20.00 ? 339  PRO A C   1 
ATOM   2651  O O   . PRO A 1 339 ? -27.139 94.977  67.122  1.00 20.00 ? 339  PRO A O   1 
ATOM   2652  C CB  . PRO A 1 339 ? -27.803 97.570  65.014  1.00 20.00 ? 339  PRO A CB  1 
ATOM   2653  C CG  . PRO A 1 339 ? -28.284 98.377  66.164  1.00 20.00 ? 339  PRO A CG  1 
ATOM   2654  C CD  . PRO A 1 339 ? -29.443 97.666  66.795  1.00 20.00 ? 339  PRO A CD  1 
ATOM   2655  N N   . THR A 1 340 ? -26.087 94.999  65.128  1.00 20.00 ? 340  THR A N   1 
ATOM   2656  C CA  . THR A 1 340 ? -24.944 94.218  65.601  1.00 20.00 ? 340  THR A CA  1 
ATOM   2657  C C   . THR A 1 340 ? -24.158 95.000  66.657  1.00 20.00 ? 340  THR A C   1 
ATOM   2658  O O   . THR A 1 340 ? -23.784 96.159  66.442  1.00 20.00 ? 340  THR A O   1 
ATOM   2659  C CB  . THR A 1 340 ? -24.004 93.846  64.425  1.00 20.00 ? 340  THR A CB  1 
ATOM   2660  O OG1 . THR A 1 340 ? -24.699 92.992  63.511  1.00 20.00 ? 340  THR A OG1 1 
ATOM   2661  C CG2 . THR A 1 340 ? -22.789 93.110  64.921  1.00 20.00 ? 340  THR A CG2 1 
ATOM   2662  N N   . GLY A 1 341 ? -23.925 94.369  67.806  1.00 20.00 ? 341  GLY A N   1 
ATOM   2663  C CA  . GLY A 1 341 ? -23.186 95.030  68.870  1.00 20.00 ? 341  GLY A CA  1 
ATOM   2664  C C   . GLY A 1 341 ? -21.708 95.170  68.541  1.00 20.00 ? 341  GLY A C   1 
ATOM   2665  O O   . GLY A 1 341 ? -21.285 94.936  67.408  1.00 20.00 ? 341  GLY A O   1 
ATOM   2666  N N   . GLY A 1 342 ? -20.904 95.536  69.532  1.00 20.00 ? 342  GLY A N   1 
ATOM   2667  C CA  . GLY A 1 342 ? -19.483 95.688  69.282  1.00 20.00 ? 342  GLY A CA  1 
ATOM   2668  C C   . GLY A 1 342 ? -18.648 94.436  69.474  1.00 20.00 ? 342  GLY A C   1 
ATOM   2669  O O   . GLY A 1 342 ? -17.577 94.308  68.877  1.00 20.00 ? 342  GLY A O   1 
ATOM   2670  N N   . HIS A 1 343 ? -19.140 93.490  70.268  1.00 20.00 ? 343  HIS A N   1 
ATOM   2671  C CA  . HIS A 1 343 ? -18.392 92.261  70.522  1.00 20.00 ? 343  HIS A CA  1 
ATOM   2672  C C   . HIS A 1 343 ? -19.021 90.939  70.115  1.00 20.00 ? 343  HIS A C   1 
ATOM   2673  O O   . HIS A 1 343 ? -18.407 89.894  70.287  1.00 20.00 ? 343  HIS A O   1 
ATOM   2674  C CB  . HIS A 1 343 ? -18.089 92.177  72.009  1.00 20.00 ? 343  HIS A CB  1 
ATOM   2675  C CG  . HIS A 1 343 ? -19.291 91.845  72.838  1.00 20.00 ? 343  HIS A CG  1 
ATOM   2676  N ND1 . HIS A 1 343 ? -20.311 92.744  73.062  1.00 20.00 ? 343  HIS A ND1 1 
ATOM   2677  C CD2 . HIS A 1 343 ? -19.654 90.701  73.467  1.00 20.00 ? 343  HIS A CD2 1 
ATOM   2678  C CE1 . HIS A 1 343 ? -21.250 92.169  73.792  1.00 20.00 ? 343  HIS A CE1 1 
ATOM   2679  N NE2 . HIS A 1 343 ? -20.877 90.930  74.052  1.00 20.00 ? 343  HIS A NE2 1 
ATOM   2680  N N   . ALA A 1 344 ? -20.234 90.948  69.589  1.00 20.00 ? 344  ALA A N   1 
ATOM   2681  C CA  . ALA A 1 344 ? -20.827 89.675  69.215  1.00 20.00 ? 344  ALA A CA  1 
ATOM   2682  C C   . ALA A 1 344 ? -22.010 89.803  68.281  1.00 20.00 ? 344  ALA A C   1 
ATOM   2683  O O   . ALA A 1 344 ? -22.450 90.903  67.960  1.00 20.00 ? 344  ALA A O   1 
ATOM   2684  C CB  . ALA A 1 344 ? -21.258 88.929  70.477  1.00 20.00 ? 344  ALA A CB  1 
ATOM   2685  N N   . VAL A 1 345 ? -22.504 88.649  67.847  1.00 20.00 ? 345  VAL A N   1 
ATOM   2686  C CA  . VAL A 1 345 ? -23.646 88.554  66.953  1.00 20.00 ? 345  VAL A CA  1 
ATOM   2687  C C   . VAL A 1 345 ? -24.536 87.525  67.624  1.00 20.00 ? 345  VAL A C   1 
ATOM   2688  O O   . VAL A 1 345 ? -24.085 86.431  67.950  1.00 20.00 ? 345  VAL A O   1 
ATOM   2689  C CB  . VAL A 1 345 ? -23.250 88.040  65.557  1.00 20.00 ? 345  VAL A CB  1 
ATOM   2690  C CG1 . VAL A 1 345 ? -24.487 87.569  64.808  1.00 20.00 ? 345  VAL A CG1 1 
ATOM   2691  C CG2 . VAL A 1 345 ? -22.559 89.140  64.776  1.00 20.00 ? 345  VAL A CG2 1 
ATOM   2692  N N   . PHE A 1 346 ? -25.791 87.885  67.859  1.00 20.00 ? 346  PHE A N   1 
ATOM   2693  C CA  . PHE A 1 346 ? -26.725 86.971  68.501  1.00 20.00 ? 346  PHE A CA  1 
ATOM   2694  C C   . PHE A 1 346 ? -27.693 86.405  67.482  1.00 20.00 ? 346  PHE A C   1 
ATOM   2695  O O   . PHE A 1 346 ? -28.257 87.155  66.693  1.00 20.00 ? 346  PHE A O   1 
ATOM   2696  C CB  . PHE A 1 346 ? -27.532 87.702  69.572  1.00 20.00 ? 346  PHE A CB  1 
ATOM   2697  C CG  . PHE A 1 346 ? -26.743 88.079  70.793  1.00 20.00 ? 346  PHE A CG  1 
ATOM   2698  C CD1 . PHE A 1 346 ? -25.780 89.079  70.738  1.00 20.00 ? 346  PHE A CD1 1 
ATOM   2699  C CD2 . PHE A 1 346 ? -26.996 87.463  72.013  1.00 20.00 ? 346  PHE A CD2 1 
ATOM   2700  C CE1 . PHE A 1 346 ? -25.078 89.467  71.886  1.00 20.00 ? 346  PHE A CE1 1 
ATOM   2701  C CE2 . PHE A 1 346 ? -26.303 87.843  73.164  1.00 20.00 ? 346  PHE A CE2 1 
ATOM   2702  C CZ  . PHE A 1 346 ? -25.340 88.852  73.095  1.00 20.00 ? 346  PHE A CZ  1 
ATOM   2703  N N   . LEU A 1 347 ? -27.877 85.088  67.500  1.00 20.00 ? 347  LEU A N   1 
ATOM   2704  C CA  . LEU A 1 347 ? -28.793 84.434  66.575  1.00 20.00 ? 347  LEU A CA  1 
ATOM   2705  C C   . LEU A 1 347 ? -30.110 84.182  67.308  1.00 20.00 ? 347  LEU A C   1 
ATOM   2706  O O   . LEU A 1 347 ? -30.122 83.856  68.502  1.00 20.00 ? 347  LEU A O   1 
ATOM   2707  C CB  . LEU A 1 347 ? -28.251 83.087  66.107  1.00 20.00 ? 347  LEU A CB  1 
ATOM   2708  C CG  . LEU A 1 347 ? -26.938 83.027  65.338  1.00 20.00 ? 347  LEU A CG  1 
ATOM   2709  C CD1 . LEU A 1 347 ? -26.624 81.558  65.045  1.00 20.00 ? 347  LEU A CD1 1 
ATOM   2710  C CD2 . LEU A 1 347 ? -27.040 83.830  64.060  1.00 20.00 ? 347  LEU A CD2 1 
ATOM   2711  N N   . ASP A 1 348 ? -31.216 84.343  66.590  1.00 20.00 ? 348  ASP A N   1 
ATOM   2712  C CA  . ASP A 1 348 ? -32.536 84.127  67.164  1.00 20.00 ? 348  ASP A CA  1 
ATOM   2713  C C   . ASP A 1 348 ? -32.897 82.662  66.920  1.00 20.00 ? 348  ASP A C   1 
ATOM   2714  O O   . ASP A 1 348 ? -33.401 82.301  65.849  1.00 20.00 ? 348  ASP A O   1 
ATOM   2715  C CB  . ASP A 1 348 ? -33.552 85.046  66.493  1.00 20.00 ? 348  ASP A CB  1 
ATOM   2716  C CG  . ASP A 1 348 ? -34.758 85.308  67.364  1.00 20.00 ? 348  ASP A CG  1 
ATOM   2717  O OD1 . ASP A 1 348 ? -35.102 84.415  68.171  1.00 20.00 ? 348  ASP A OD1 1 
ATOM   2718  O OD2 . ASP A 1 348 ? -35.357 86.402  67.242  1.00 20.00 ? 348  ASP A OD2 1 
ATOM   2719  N N   . ALA A 1 349 ? -32.615 81.822  67.911  1.00 20.00 ? 349  ALA A N   1 
ATOM   2720  C CA  . ALA A 1 349 ? -32.899 80.398  67.812  1.00 20.00 ? 349  ALA A CA  1 
ATOM   2721  C C   . ALA A 1 349 ? -34.384 80.127  67.621  1.00 20.00 ? 349  ALA A C   1 
ATOM   2722  O O   . ALA A 1 349 ? -34.765 79.106  67.044  1.00 20.00 ? 349  ALA A O   1 
ATOM   2723  C CB  . ALA A 1 349 ? -32.395 79.685  69.049  1.00 20.00 ? 349  ALA A CB  1 
ATOM   2724  N N   . ARG A 1 350 ? -35.219 81.036  68.115  1.00 20.00 ? 350  ARG A N   1 
ATOM   2725  C CA  . ARG A 1 350 ? -36.661 80.891  67.992  1.00 20.00 ? 350  ARG A CA  1 
ATOM   2726  C C   . ARG A 1 350 ? -37.053 80.927  66.524  1.00 20.00 ? 350  ARG A C   1 
ATOM   2727  O O   . ARG A 1 350 ? -37.664 79.983  66.014  1.00 20.00 ? 350  ARG A O   1 
ATOM   2728  C CB  . ARG A 1 350 ? -37.373 82.017  68.741  1.00 20.00 ? 350  ARG A CB  1 
ATOM   2729  C CG  . ARG A 1 350 ? -37.861 81.608  70.121  1.00 20.00 ? 350  ARG A CG  1 
ATOM   2730  C CD  . ARG A 1 350 ? -38.950 82.538  70.634  1.00 20.00 ? 350  ARG A CD  1 
ATOM   2731  N NE  . ARG A 1 350 ? -38.567 83.169  71.892  1.00 20.00 ? 350  ARG A NE  1 
ATOM   2732  C CZ  . ARG A 1 350 ? -39.011 82.806  73.093  1.00 20.00 ? 350  ARG A CZ  1 
ATOM   2733  N NH1 . ARG A 1 350 ? -39.872 81.806  73.229  1.00 20.00 ? 350  ARG A NH1 1 
ATOM   2734  N NH2 . ARG A 1 350 ? -38.590 83.455  74.166  1.00 20.00 ? 350  ARG A NH2 1 
ATOM   2735  N N   . ARG A 1 351 ? -36.692 82.022  65.855  1.00 20.00 ? 351  ARG A N   1 
ATOM   2736  C CA  . ARG A 1 351 ? -36.988 82.215  64.435  1.00 20.00 ? 351  ARG A CA  1 
ATOM   2737  C C   . ARG A 1 351 ? -36.172 81.283  63.550  1.00 20.00 ? 351  ARG A C   1 
ATOM   2738  O O   . ARG A 1 351 ? -36.562 80.992  62.421  1.00 20.00 ? 351  ARG A O   1 
ATOM   2739  C CB  . ARG A 1 351 ? -36.705 83.658  64.037  1.00 20.00 ? 351  ARG A CB  1 
ATOM   2740  C CG  . ARG A 1 351 ? -37.152 84.668  65.069  1.00 20.00 ? 351  ARG A CG  1 
ATOM   2741  C CD  . ARG A 1 351 ? -38.167 85.643  64.489  1.00 20.00 ? 351  ARG A CD  1 
ATOM   2742  N NE  . ARG A 1 351 ? -37.657 86.332  63.305  1.00 20.00 ? 351  ARG A NE  1 
ATOM   2743  C CZ  . ARG A 1 351 ? -36.661 87.213  63.323  1.00 20.00 ? 351  ARG A CZ  1 
ATOM   2744  N NH1 . ARG A 1 351 ? -36.064 87.514  64.469  1.00 20.00 ? 351  ARG A NH1 1 
ATOM   2745  N NH2 . ARG A 1 351 ? -36.262 87.793  62.195  1.00 20.00 ? 351  ARG A NH2 1 
ATOM   2746  N N   . PHE A 1 352 ? -35.036 80.825  64.065  1.00 20.00 ? 352  PHE A N   1 
ATOM   2747  C CA  . PHE A 1 352 ? -34.160 79.925  63.328  1.00 20.00 ? 352  PHE A CA  1 
ATOM   2748  C C   . PHE A 1 352 ? -34.772 78.524  63.256  1.00 20.00 ? 352  PHE A C   1 
ATOM   2749  O O   . PHE A 1 352 ? -34.756 77.875  62.207  1.00 20.00 ? 352  PHE A O   1 
ATOM   2750  C CB  . PHE A 1 352 ? -32.791 79.864  64.017  1.00 20.00 ? 352  PHE A CB  1 
ATOM   2751  C CG  . PHE A 1 352 ? -31.661 79.466  63.108  1.00 20.00 ? 352  PHE A CG  1 
ATOM   2752  C CD1 . PHE A 1 352 ? -31.534 78.153  62.663  1.00 20.00 ? 352  PHE A CD1 1 
ATOM   2753  C CD2 . PHE A 1 352 ? -30.700 80.399  62.721  1.00 20.00 ? 352  PHE A CD2 1 
ATOM   2754  C CE1 . PHE A 1 352 ? -30.463 77.774  61.847  1.00 20.00 ? 352  PHE A CE1 1 
ATOM   2755  C CE2 . PHE A 1 352 ? -29.622 80.031  61.904  1.00 20.00 ? 352  PHE A CE2 1 
ATOM   2756  C CZ  . PHE A 1 352 ? -29.505 78.719  61.469  1.00 20.00 ? 352  PHE A CZ  1 
ATOM   2757  N N   . CYS A 1 353 ? -35.313 78.065  64.378  1.00 20.00 ? 353  CYS A N   1 
ATOM   2758  C CA  . CYS A 1 353 ? -35.928 76.740  64.454  1.00 20.00 ? 353  CYS A CA  1 
ATOM   2759  C C   . CYS A 1 353 ? -37.416 76.829  64.795  1.00 20.00 ? 353  CYS A C   1 
ATOM   2760  O O   . CYS A 1 353 ? -37.828 76.497  65.909  1.00 20.00 ? 353  CYS A O   1 
ATOM   2761  C CB  . CYS A 1 353 ? -35.207 75.884  65.507  1.00 20.00 ? 353  CYS A CB  1 
ATOM   2762  S SG  . CYS A 1 353 ? -33.398 75.866  65.388  1.00 20.00 ? 353  CYS A SG  1 
ATOM   2763  N N   . PRO A 1 354 ? -38.242 77.286  63.841  1.00 20.00 ? 354  PRO A N   1 
ATOM   2764  C CA  . PRO A 1 354 ? -39.661 77.506  64.128  1.00 20.00 ? 354  PRO A CA  1 
ATOM   2765  C C   . PRO A 1 354 ? -40.409 76.187  64.350  1.00 20.00 ? 354  PRO A C   1 
ATOM   2766  O O   . PRO A 1 354 ? -41.518 76.168  64.898  1.00 20.00 ? 354  PRO A O   1 
ATOM   2767  C CB  . PRO A 1 354 ? -40.158 78.260  62.895  1.00 20.00 ? 354  PRO A CB  1 
ATOM   2768  C CG  . PRO A 1 354 ? -39.250 77.830  61.807  1.00 20.00 ? 354  PRO A CG  1 
ATOM   2769  C CD  . PRO A 1 354 ? -37.906 77.626  62.445  1.00 20.00 ? 354  PRO A CD  1 
ATOM   2770  N N   . HIS A 1 355 ? -39.786 75.090  63.929  1.00 20.00 ? 355  HIS A N   1 
ATOM   2771  C CA  . HIS A 1 355 ? -40.377 73.766  64.072  1.00 20.00 ? 355  HIS A CA  1 
ATOM   2772  C C   . HIS A 1 355 ? -40.202 73.217  65.489  1.00 20.00 ? 355  HIS A C   1 
ATOM   2773  O O   . HIS A 1 355 ? -40.764 72.172  65.836  1.00 20.00 ? 355  HIS A O   1 
ATOM   2774  C CB  . HIS A 1 355 ? -39.739 72.804  63.064  1.00 20.00 ? 355  HIS A CB  1 
ATOM   2775  C CG  . HIS A 1 355 ? -38.247 72.717  63.173  1.00 20.00 ? 355  HIS A CG  1 
ATOM   2776  N ND1 . HIS A 1 355 ? -37.433 73.830  63.185  1.00 20.00 ? 355  HIS A ND1 1 
ATOM   2777  C CD2 . HIS A 1 355 ? -37.423 71.647  63.279  1.00 20.00 ? 355  HIS A CD2 1 
ATOM   2778  C CE1 . HIS A 1 355 ? -36.173 73.450  63.294  1.00 20.00 ? 355  HIS A CE1 1 
ATOM   2779  N NE2 . HIS A 1 355 ? -36.139 72.130  63.353  1.00 20.00 ? 355  HIS A NE2 1 
ATOM   2780  N N   . LEU A 1 356 ? -39.438 73.931  66.311  1.00 20.00 ? 356  LEU A N   1 
ATOM   2781  C CA  . LEU A 1 356 ? -39.188 73.510  67.684  1.00 20.00 ? 356  LEU A CA  1 
ATOM   2782  C C   . LEU A 1 356 ? -39.799 74.451  68.702  1.00 20.00 ? 356  LEU A C   1 
ATOM   2783  O O   . LEU A 1 356 ? -39.930 75.643  68.454  1.00 20.00 ? 356  LEU A O   1 
ATOM   2784  C CB  . LEU A 1 356 ? -37.684 73.440  67.934  1.00 20.00 ? 356  LEU A CB  1 
ATOM   2785  C CG  . LEU A 1 356 ? -36.944 72.114  67.750  1.00 20.00 ? 356  LEU A CG  1 
ATOM   2786  C CD1 . LEU A 1 356 ? -37.515 71.348  66.571  1.00 20.00 ? 356  LEU A CD1 1 
ATOM   2787  C CD2 . LEU A 1 356 ? -35.454 72.395  67.537  1.00 20.00 ? 356  LEU A CD2 1 
ATOM   2788  N N   . THR A 1 357 ? -40.171 73.908  69.855  1.00 20.00 ? 357  THR A N   1 
ATOM   2789  C CA  . THR A 1 357 ? -40.764 74.712  70.922  1.00 20.00 ? 357  THR A CA  1 
ATOM   2790  C C   . THR A 1 357 ? -39.622 75.020  71.892  1.00 20.00 ? 357  THR A C   1 
ATOM   2791  O O   . THR A 1 357 ? -38.709 74.211  72.053  1.00 20.00 ? 357  THR A O   1 
ATOM   2792  C CB  . THR A 1 357 ? -41.890 73.950  71.678  1.00 20.00 ? 357  THR A CB  1 
ATOM   2793  O OG1 . THR A 1 357 ? -41.308 72.971  72.548  1.00 20.00 ? 357  THR A OG1 1 
ATOM   2794  C CG2 . THR A 1 357 ? -42.834 73.255  70.695  1.00 20.00 ? 357  THR A CG2 1 
ATOM   2795  N N   . GLN A 1 358 ? -39.662 76.180  72.536  1.00 20.00 ? 358  GLN A N   1 
ATOM   2796  C CA  . GLN A 1 358 ? -38.599 76.530  73.466  1.00 20.00 ? 358  GLN A CA  1 
ATOM   2797  C C   . GLN A 1 358 ? -38.273 75.391  74.416  1.00 20.00 ? 358  GLN A C   1 
ATOM   2798  O O   . GLN A 1 358 ? -37.131 75.249  74.851  1.00 20.00 ? 358  GLN A O   1 
ATOM   2799  C CB  . GLN A 1 358 ? -38.956 77.782  74.267  1.00 20.00 ? 358  GLN A CB  1 
ATOM   2800  C CG  . GLN A 1 358 ? -37.733 78.439  74.889  1.00 20.00 ? 358  GLN A CG  1 
ATOM   2801  C CD  . GLN A 1 358 ? -38.032 79.792  75.496  1.00 20.00 ? 358  GLN A CD  1 
ATOM   2802  O OE1 . GLN A 1 358 ? -39.171 80.084  75.853  1.00 20.00 ? 358  GLN A OE1 1 
ATOM   2803  N NE2 . GLN A 1 358 ? -37.007 80.627  75.618  1.00 20.00 ? 358  GLN A NE2 1 
ATOM   2804  N N   . ASP A 1 359 ? -39.279 74.576  74.719  1.00 20.00 ? 359  ASP A N   1 
ATOM   2805  C CA  . ASP A 1 359 ? -39.106 73.441  75.621  1.00 20.00 ? 359  ASP A CA  1 
ATOM   2806  C C   . ASP A 1 359 ? -38.252 72.342  75.016  1.00 20.00 ? 359  ASP A C   1 
ATOM   2807  O O   . ASP A 1 359 ? -37.904 71.377  75.695  1.00 20.00 ? 359  ASP A O   1 
ATOM   2808  C CB  . ASP A 1 359 ? -40.468 72.880  76.016  1.00 20.00 ? 359  ASP A CB  1 
ATOM   2809  C CG  . ASP A 1 359 ? -41.352 73.929  76.649  1.00 20.00 ? 359  ASP A CG  1 
ATOM   2810  O OD1 . ASP A 1 359 ? -41.110 74.274  77.828  1.00 20.00 ? 359  ASP A OD1 1 
ATOM   2811  O OD2 . ASP A 1 359 ? -42.278 74.420  75.965  1.00 20.00 ? 359  ASP A OD2 1 
ATOM   2812  N N   . GLN A 1 360 ? -37.921 72.488  73.738  1.00 20.00 ? 360  GLN A N   1 
ATOM   2813  C CA  . GLN A 1 360 ? -37.100 71.503  73.052  1.00 20.00 ? 360  GLN A CA  1 
ATOM   2814  C C   . GLN A 1 360 ? -35.698 72.075  72.861  1.00 20.00 ? 360  GLN A C   1 
ATOM   2815  O O   . GLN A 1 360 ? -34.916 71.578  72.054  1.00 20.00 ? 360  GLN A O   1 
ATOM   2816  C CB  . GLN A 1 360 ? -37.726 71.132  71.710  1.00 20.00 ? 360  GLN A CB  1 
ATOM   2817  C CG  . GLN A 1 360 ? -39.031 70.352  71.861  1.00 20.00 ? 360  GLN A CG  1 
ATOM   2818  C CD  . GLN A 1 360 ? -39.687 70.034  70.527  1.00 20.00 ? 360  GLN A CD  1 
ATOM   2819  O OE1 . GLN A 1 360 ? -40.066 70.930  69.770  1.00 20.00 ? 360  GLN A OE1 1 
ATOM   2820  N NE2 . GLN A 1 360 ? -39.823 68.751  70.236  1.00 20.00 ? 360  GLN A NE2 1 
ATOM   2821  N N   . PHE A 1 361 ? -35.402 73.126  73.626  1.00 20.00 ? 361  PHE A N   1 
ATOM   2822  C CA  . PHE A 1 361 ? -34.108 73.811  73.596  1.00 20.00 ? 361  PHE A CA  1 
ATOM   2823  C C   . PHE A 1 361 ? -33.550 74.009  72.195  1.00 20.00 ? 361  PHE A C   1 
ATOM   2824  O O   . PHE A 1 361 ? -32.598 73.338  71.791  1.00 20.00 ? 361  PHE A O   1 
ATOM   2825  C CB  . PHE A 1 361 ? -33.093 73.045  74.451  1.00 20.00 ? 361  PHE A CB  1 
ATOM   2826  C CG  . PHE A 1 361 ? -33.693 72.426  75.682  1.00 20.00 ? 361  PHE A CG  1 
ATOM   2827  C CD1 . PHE A 1 361 ? -34.388 73.208  76.598  1.00 20.00 ? 361  PHE A CD1 1 
ATOM   2828  C CD2 . PHE A 1 361 ? -33.589 71.059  75.912  1.00 20.00 ? 361  PHE A CD2 1 
ATOM   2829  C CE1 . PHE A 1 361 ? -34.976 72.640  77.725  1.00 20.00 ? 361  PHE A CE1 1 
ATOM   2830  C CE2 . PHE A 1 361 ? -34.174 70.477  77.038  1.00 20.00 ? 361  PHE A CE2 1 
ATOM   2831  C CZ  . PHE A 1 361 ? -34.870 71.271  77.946  1.00 20.00 ? 361  PHE A CZ  1 
ATOM   2832  N N   . PRO A 1 362 ? -34.146 74.939  71.434  1.00 20.00 ? 362  PRO A N   1 
ATOM   2833  C CA  . PRO A 1 362 ? -33.628 75.322  70.115  1.00 20.00 ? 362  PRO A CA  1 
ATOM   2834  C C   . PRO A 1 362 ? -32.226 75.962  70.118  1.00 20.00 ? 362  PRO A C   1 
ATOM   2835  O O   . PRO A 1 362 ? -31.392 75.634  69.272  1.00 20.00 ? 362  PRO A O   1 
ATOM   2836  C CB  . PRO A 1 362 ? -34.702 76.266  69.565  1.00 20.00 ? 362  PRO A CB  1 
ATOM   2837  C CG  . PRO A 1 362 ? -35.431 76.771  70.771  1.00 20.00 ? 362  PRO A CG  1 
ATOM   2838  C CD  . PRO A 1 362 ? -35.380 75.666  71.782  1.00 20.00 ? 362  PRO A CD  1 
ATOM   2839  N N   . ALA A 1 363 ? -31.971 76.873  71.054  1.00 20.00 ? 363  ALA A N   1 
ATOM   2840  C CA  . ALA A 1 363 ? -30.664 77.534  71.132  1.00 20.00 ? 363  ALA A CA  1 
ATOM   2841  C C   . ALA A 1 363 ? -29.566 76.510  71.391  1.00 20.00 ? 363  ALA A C   1 
ATOM   2842  O O   . ALA A 1 363 ? -28.520 76.530  70.742  1.00 20.00 ? 363  ALA A O   1 
ATOM   2843  C CB  . ALA A 1 363 ? -30.660 78.598  72.236  1.00 20.00 ? 363  ALA A CB  1 
ATOM   2844  N N   . GLN A 1 364 ? -29.816 75.613  72.336  1.00 20.00 ? 364  GLN A N   1 
ATOM   2845  C CA  . GLN A 1 364 ? -28.855 74.582  72.680  1.00 20.00 ? 364  GLN A CA  1 
ATOM   2846  C C   . GLN A 1 364 ? -28.630 73.629  71.514  1.00 20.00 ? 364  GLN A C   1 
ATOM   2847  O O   . GLN A 1 364 ? -27.512 73.158  71.286  1.00 20.00 ? 364  GLN A O   1 
ATOM   2848  C CB  . GLN A 1 364 ? -29.342 73.795  73.896  1.00 20.00 ? 364  GLN A CB  1 
ATOM   2849  C CG  . GLN A 1 364 ? -28.277 72.897  74.520  1.00 20.00 ? 364  GLN A CG  1 
ATOM   2850  C CD  . GLN A 1 364 ? -27.303 73.668  75.393  1.00 20.00 ? 364  GLN A CD  1 
ATOM   2851  O OE1 . GLN A 1 364 ? -27.693 74.275  76.392  1.00 20.00 ? 364  GLN A OE1 1 
ATOM   2852  N NE2 . GLN A 1 364 ? -26.030 73.649  75.018  1.00 20.00 ? 364  GLN A NE2 1 
ATOM   2853  N N   . SER A 1 365 ? -29.692 73.345  70.771  1.00 20.00 ? 365  SER A N   1 
ATOM   2854  C CA  . SER A 1 365 ? -29.583 72.443  69.634  1.00 20.00 ? 365  SER A CA  1 
ATOM   2855  C C   . SER A 1 365 ? -28.910 73.134  68.457  1.00 20.00 ? 365  SER A C   1 
ATOM   2856  O O   . SER A 1 365 ? -28.163 72.514  67.693  1.00 20.00 ? 365  SER A O   1 
ATOM   2857  C CB  . SER A 1 365 ? -30.959 71.925  69.224  1.00 20.00 ? 365  SER A CB  1 
ATOM   2858  O OG  . SER A 1 365 ? -30.826 70.755  68.434  1.00 20.00 ? 365  SER A OG  1 
ATOM   2859  N N   . LEU A 1 366 ? -29.180 74.423  68.308  1.00 20.00 ? 366  LEU A N   1 
ATOM   2860  C CA  . LEU A 1 366 ? -28.584 75.180  67.221  1.00 20.00 ? 366  LEU A CA  1 
ATOM   2861  C C   . LEU A 1 366 ? -27.071 75.162  67.437  1.00 20.00 ? 366  LEU A C   1 
ATOM   2862  O O   . LEU A 1 366 ? -26.304 74.841  66.533  1.00 20.00 ? 366  LEU A O   1 
ATOM   2863  C CB  . LEU A 1 366 ? -29.095 76.623  67.237  1.00 20.00 ? 366  LEU A CB  1 
ATOM   2864  C CG  . LEU A 1 366 ? -29.319 77.300  65.883  1.00 20.00 ? 366  LEU A CG  1 
ATOM   2865  C CD1 . LEU A 1 366 ? -29.040 78.786  66.016  1.00 20.00 ? 366  LEU A CD1 1 
ATOM   2866  C CD2 . LEU A 1 366 ? -28.424 76.684  64.822  1.00 20.00 ? 366  LEU A CD2 1 
ATOM   2867  N N   . ALA A 1 367 ? -26.654 75.498  68.655  1.00 20.00 ? 367  ALA A N   1 
ATOM   2868  C CA  . ALA A 1 367 ? -25.237 75.527  69.016  1.00 20.00 ? 367  ALA A CA  1 
ATOM   2869  C C   . ALA A 1 367 ? -24.544 74.199  68.732  1.00 20.00 ? 367  ALA A C   1 
ATOM   2870  O O   . ALA A 1 367 ? -23.447 74.170  68.160  1.00 20.00 ? 367  ALA A O   1 
ATOM   2871  C CB  . ALA A 1 367 ? -25.087 75.892  70.484  1.00 20.00 ? 367  ALA A CB  1 
ATOM   2872  N N   . ALA A 1 368 ? -25.177 73.101  69.133  1.00 20.00 ? 368  ALA A N   1 
ATOM   2873  C CA  . ALA A 1 368 ? -24.597 71.784  68.905  1.00 20.00 ? 368  ALA A CA  1 
ATOM   2874  C C   . ALA A 1 368 ? -24.420 71.568  67.408  1.00 20.00 ? 368  ALA A C   1 
ATOM   2875  O O   . ALA A 1 368 ? -23.374 71.099  66.949  1.00 20.00 ? 368  ALA A O   1 
ATOM   2876  C CB  . ALA A 1 368 ? -25.493 70.698  69.489  1.00 20.00 ? 368  ALA A CB  1 
ATOM   2877  N N   . SER A 1 369 ? -25.447 71.922  66.644  1.00 20.00 ? 369  SER A N   1 
ATOM   2878  C CA  . SER A 1 369 ? -25.393 71.759  65.198  1.00 20.00 ? 369  SER A CA  1 
ATOM   2879  C C   . SER A 1 369 ? -24.288 72.604  64.577  1.00 20.00 ? 369  SER A C   1 
ATOM   2880  O O   . SER A 1 369 ? -23.589 72.154  63.665  1.00 20.00 ? 369  SER A O   1 
ATOM   2881  C CB  . SER A 1 369 ? -26.744 72.124  64.581  1.00 20.00 ? 369  SER A CB  1 
ATOM   2882  O OG  . SER A 1 369 ? -27.609 70.998  64.543  1.00 20.00 ? 369  SER A OG  1 
ATOM   2883  N N   . ILE A 1 370 ? -24.126 73.827  65.078  1.00 20.00 ? 370  ILE A N   1 
ATOM   2884  C CA  . ILE A 1 370 ? -23.101 74.727  64.560  1.00 20.00 ? 370  ILE A CA  1 
ATOM   2885  C C   . ILE A 1 370 ? -21.700 74.130  64.713  1.00 20.00 ? 370  ILE A C   1 
ATOM   2886  O O   . ILE A 1 370 ? -20.852 74.285  63.828  1.00 20.00 ? 370  ILE A O   1 
ATOM   2887  C CB  . ILE A 1 370 ? -23.162 76.111  65.268  1.00 20.00 ? 370  ILE A CB  1 
ATOM   2888  C CG1 . ILE A 1 370 ? -24.303 76.946  64.677  1.00 20.00 ? 370  ILE A CG1 1 
ATOM   2889  C CG2 . ILE A 1 370 ? -21.829 76.853  65.099  1.00 20.00 ? 370  ILE A CG2 1 
ATOM   2890  C CD1 . ILE A 1 370 ? -24.762 78.099  65.553  1.00 20.00 ? 370  ILE A CD1 1 
ATOM   2891  N N   . TYR A 1 371 ? -21.467 73.431  65.825  1.00 20.00 ? 371  TYR A N   1 
ATOM   2892  C CA  . TYR A 1 371 ? -20.163 72.828  66.060  1.00 20.00 ? 371  TYR A CA  1 
ATOM   2893  C C   . TYR A 1 371 ? -19.894 71.634  65.170  1.00 20.00 ? 371  TYR A C   1 
ATOM   2894  O O   . TYR A 1 371 ? -18.810 71.518  64.591  1.00 20.00 ? 371  TYR A O   1 
ATOM   2895  C CB  . TYR A 1 371 ? -19.999 72.388  67.517  1.00 20.00 ? 371  TYR A CB  1 
ATOM   2896  C CG  . TYR A 1 371 ? -18.744 71.561  67.733  1.00 20.00 ? 371  TYR A CG  1 
ATOM   2897  C CD1 . TYR A 1 371 ? -17.484 72.149  67.700  1.00 20.00 ? 371  TYR A CD1 1 
ATOM   2898  C CD2 . TYR A 1 371 ? -18.819 70.180  67.905  1.00 20.00 ? 371  TYR A CD2 1 
ATOM   2899  C CE1 . TYR A 1 371 ? -16.330 71.383  67.823  1.00 20.00 ? 371  TYR A CE1 1 
ATOM   2900  C CE2 . TYR A 1 371 ? -17.676 69.407  68.030  1.00 20.00 ? 371  TYR A CE2 1 
ATOM   2901  C CZ  . TYR A 1 371 ? -16.436 70.007  67.985  1.00 20.00 ? 371  TYR A CZ  1 
ATOM   2902  O OH  . TYR A 1 371 ? -15.305 69.220  68.082  1.00 20.00 ? 371  TYR A OH  1 
ATOM   2903  N N   . MET A 1 372 ? -20.878 70.743  65.074  1.00 20.00 ? 372  MET A N   1 
ATOM   2904  C CA  . MET A 1 372 ? -20.747 69.543  64.254  1.00 20.00 ? 372  MET A CA  1 
ATOM   2905  C C   . MET A 1 372 ? -20.510 69.868  62.789  1.00 20.00 ? 372  MET A C   1 
ATOM   2906  O O   . MET A 1 372 ? -19.768 69.165  62.104  1.00 20.00 ? 372  MET A O   1 
ATOM   2907  C CB  . MET A 1 372 ? -21.999 68.678  64.392  1.00 20.00 ? 372  MET A CB  1 
ATOM   2908  C CG  . MET A 1 372 ? -22.210 68.124  65.787  1.00 20.00 ? 372  MET A CG  1 
ATOM   2909  S SD  . MET A 1 372 ? -23.631 66.999  65.915  1.00 20.00 ? 372  MET A SD  1 
ATOM   2910  C CE  . MET A 1 372 ? -24.878 68.108  66.581  1.00 20.00 ? 372  MET A CE  1 
ATOM   2911  N N   . GLU A 1 373 ? -21.120 70.948  62.317  1.00 20.00 ? 373  GLU A N   1 
ATOM   2912  C CA  . GLU A 1 373 ? -20.977 71.356  60.927  1.00 20.00 ? 373  GLU A CA  1 
ATOM   2913  C C   . GLU A 1 373 ? -19.769 72.221  60.568  1.00 20.00 ? 373  GLU A C   1 
ATOM   2914  O O   . GLU A 1 373 ? -19.278 72.140  59.438  1.00 20.00 ? 373  GLU A O   1 
ATOM   2915  C CB  . GLU A 1 373 ? -22.248 72.078  60.474  1.00 20.00 ? 373  GLU A CB  1 
ATOM   2916  C CG  . GLU A 1 373 ? -22.924 71.449  59.259  1.00 20.00 ? 373  GLU A CG  1 
ATOM   2917  C CD  . GLU A 1 373 ? -23.222 69.971  59.457  1.00 20.00 ? 373  GLU A CD  1 
ATOM   2918  O OE1 . GLU A 1 373 ? -24.101 69.641  60.289  1.00 20.00 ? 373  GLU A OE1 1 
ATOM   2919  O OE2 . GLU A 1 373 ? -22.571 69.142  58.782  1.00 20.00 ? 373  GLU A OE2 1 
ATOM   2920  N N   . THR A 1 374 ? -19.275 73.028  61.511  1.00 20.00 ? 374  THR A N   1 
ATOM   2921  C CA  . THR A 1 374 ? -18.125 73.901  61.237  1.00 20.00 ? 374  THR A CA  1 
ATOM   2922  C C   . THR A 1 374 ? -16.933 73.833  62.193  1.00 20.00 ? 374  THR A C   1 
ATOM   2923  O O   . THR A 1 374 ? -15.827 74.265  61.853  1.00 20.00 ? 374  THR A O   1 
ATOM   2924  C CB  . THR A 1 374 ? -18.566 75.368  61.211  1.00 20.00 ? 374  THR A CB  1 
ATOM   2925  O OG1 . THR A 1 374 ? -19.105 75.715  62.496  1.00 20.00 ? 374  THR A OG1 1 
ATOM   2926  C CG2 . THR A 1 374 ? -19.630 75.589  60.149  1.00 20.00 ? 374  THR A CG2 1 
ATOM   2927  N N   . GLY A 1 375 ? -17.152 73.317  63.392  1.00 20.00 ? 375  GLY A N   1 
ATOM   2928  C CA  . GLY A 1 375 ? -16.061 73.237  64.336  1.00 20.00 ? 375  GLY A CA  1 
ATOM   2929  C C   . GLY A 1 375 ? -15.937 74.519  65.148  1.00 20.00 ? 375  GLY A C   1 
ATOM   2930  O O   . GLY A 1 375 ? -14.898 74.770  65.757  1.00 20.00 ? 375  GLY A O   1 
ATOM   2931  N N   . VAL A 1 376 ? -16.975 75.354  65.135  1.00 20.00 ? 376  VAL A N   1 
ATOM   2932  C CA  . VAL A 1 376 ? -16.937 76.596  65.895  1.00 20.00 ? 376  VAL A CA  1 
ATOM   2933  C C   . VAL A 1 376 ? -17.887 76.423  67.075  1.00 20.00 ? 376  VAL A C   1 
ATOM   2934  O O   . VAL A 1 376 ? -18.984 75.884  66.923  1.00 20.00 ? 376  VAL A O   1 
ATOM   2935  C CB  . VAL A 1 376 ? -17.352 77.849  65.040  1.00 20.00 ? 376  VAL A CB  1 
ATOM   2936  C CG1 . VAL A 1 376 ? -17.372 77.510  63.566  1.00 20.00 ? 376  VAL A CG1 1 
ATOM   2937  C CG2 . VAL A 1 376 ? -18.685 78.386  65.486  1.00 20.00 ? 376  VAL A CG2 1 
ATOM   2938  N N   . ARG A 1 377 ? -17.453 76.855  68.256  1.00 20.00 ? 377  ARG A N   1 
ATOM   2939  C CA  . ARG A 1 377 ? -18.266 76.745  69.466  1.00 20.00 ? 377  ARG A CA  1 
ATOM   2940  C C   . ARG A 1 377 ? -18.931 78.073  69.757  1.00 20.00 ? 377  ARG A C   1 
ATOM   2941  O O   . ARG A 1 377 ? -18.301 79.117  69.662  1.00 20.00 ? 377  ARG A O   1 
ATOM   2942  C CB  . ARG A 1 377 ? -17.401 76.342  70.665  1.00 20.00 ? 377  ARG A CB  1 
ATOM   2943  C CG  . ARG A 1 377 ? -18.023 76.659  72.023  1.00 20.00 ? 377  ARG A CG  1 
ATOM   2944  C CD  . ARG A 1 377 ? -17.416 75.803  73.126  1.00 20.00 ? 377  ARG A CD  1 
ATOM   2945  N NE  . ARG A 1 377 ? -16.107 76.299  73.562  1.00 20.00 ? 377  ARG A NE  1 
ATOM   2946  C CZ  . ARG A 1 377 ? -15.432 75.817  74.603  1.00 20.00 ? 377  ARG A CZ  1 
ATOM   2947  N NH1 . ARG A 1 377 ? -15.940 74.826  75.321  1.00 20.00 ? 377  ARG A NH1 1 
ATOM   2948  N NH2 . ARG A 1 377 ? -14.244 76.318  74.923  1.00 20.00 ? 377  ARG A NH2 1 
ATOM   2949  N N   . SER A 1 378 ? -20.209 78.025  70.105  1.00 20.00 ? 378  SER A N   1 
ATOM   2950  C CA  . SER A 1 378 ? -20.975 79.227  70.412  1.00 20.00 ? 378  SER A CA  1 
ATOM   2951  C C   . SER A 1 378 ? -21.634 78.974  71.744  1.00 20.00 ? 378  SER A C   1 
ATOM   2952  O O   . SER A 1 378 ? -21.701 77.840  72.194  1.00 20.00 ? 378  SER A O   1 
ATOM   2953  C CB  . SER A 1 378 ? -22.042 79.476  69.345  1.00 20.00 ? 378  SER A CB  1 
ATOM   2954  O OG  . SER A 1 378 ? -22.855 78.334  69.171  1.00 20.00 ? 378  SER A OG  1 
ATOM   2955  N N   . MET A 1 379 ? -22.135 80.019  72.380  1.00 20.00 ? 379  MET A N   1 
ATOM   2956  C CA  . MET A 1 379 ? -22.769 79.829  73.667  1.00 20.00 ? 379  MET A CA  1 
ATOM   2957  C C   . MET A 1 379 ? -24.271 79.970  73.666  1.00 20.00 ? 379  MET A C   1 
ATOM   2958  O O   . MET A 1 379 ? -24.807 80.955  73.166  1.00 20.00 ? 379  MET A O   1 
ATOM   2959  C CB  . MET A 1 379 ? -22.196 80.810  74.681  1.00 20.00 ? 379  MET A CB  1 
ATOM   2960  C CG  . MET A 1 379 ? -22.528 80.455  76.125  1.00 20.00 ? 379  MET A CG  1 
ATOM   2961  S SD  . MET A 1 379 ? -22.143 81.792  77.260  1.00 20.00 ? 379  MET A SD  1 
ATOM   2962  C CE  . MET A 1 379 ? -23.047 83.079  76.515  1.00 20.00 ? 379  MET A CE  1 
ATOM   2963  N N   . GLU A 1 380 ? -24.950 78.991  74.250  1.00 20.00 ? 380  GLU A N   1 
ATOM   2964  C CA  . GLU A 1 380 ? -26.400 79.046  74.306  1.00 20.00 ? 380  GLU A CA  1 
ATOM   2965  C C   . GLU A 1 380 ? -26.803 80.038  75.398  1.00 20.00 ? 380  GLU A C   1 
ATOM   2966  O O   . GLU A 1 380 ? -26.307 79.984  76.527  1.00 20.00 ? 380  GLU A O   1 
ATOM   2967  C CB  . GLU A 1 380 ? -26.985 77.644  74.555  1.00 20.00 ? 380  GLU A CB  1 
ATOM   2968  C CG  . GLU A 1 380 ? -27.497 77.365  75.948  1.00 20.00 ? 380  GLU A CG  1 
ATOM   2969  C CD  . GLU A 1 380 ? -28.929 77.823  76.164  1.00 20.00 ? 380  GLU A CD  1 
ATOM   2970  O OE1 . GLU A 1 380 ? -29.848 77.296  75.496  1.00 20.00 ? 380  GLU A OE1 1 
ATOM   2971  O OE2 . GLU A 1 380 ? -29.127 78.714  77.016  1.00 20.00 ? 380  GLU A OE2 1 
ATOM   2972  N N   . ARG A 1 381 ? -27.664 80.977  75.022  1.00 20.00 ? 381  ARG A N   1 
ATOM   2973  C CA  . ARG A 1 381 ? -28.166 82.009  75.922  1.00 20.00 ? 381  ARG A CA  1 
ATOM   2974  C C   . ARG A 1 381 ? -29.686 81.959  75.841  1.00 20.00 ? 381  ARG A C   1 
ATOM   2975  O O   . ARG A 1 381 ? -30.322 82.919  75.402  1.00 20.00 ? 381  ARG A O   1 
ATOM   2976  C CB  . ARG A 1 381 ? -27.687 83.393  75.481  1.00 20.00 ? 381  ARG A CB  1 
ATOM   2977  C CG  . ARG A 1 381 ? -26.219 83.658  75.720  1.00 20.00 ? 381  ARG A CG  1 
ATOM   2978  C CD  . ARG A 1 381 ? -25.925 83.814  77.197  1.00 20.00 ? 381  ARG A CD  1 
ATOM   2979  N NE  . ARG A 1 381 ? -25.764 82.515  77.849  1.00 20.00 ? 381  ARG A NE  1 
ATOM   2980  C CZ  . ARG A 1 381 ? -25.226 82.345  79.053  1.00 20.00 ? 381  ARG A CZ  1 
ATOM   2981  N NH1 . ARG A 1 381 ? -24.795 83.393  79.739  1.00 20.00 ? 381  ARG A NH1 1 
ATOM   2982  N NH2 . ARG A 1 381 ? -25.128 81.132  79.580  1.00 20.00 ? 381  ARG A NH2 1 
ATOM   2983  N N   . GLY A 1 382 ? -30.255 80.830  76.261  1.00 20.00 ? 382  GLY A N   1 
ATOM   2984  C CA  . GLY A 1 382 ? -31.693 80.667  76.227  1.00 20.00 ? 382  GLY A CA  1 
ATOM   2985  C C   . GLY A 1 382 ? -32.298 80.038  77.465  1.00 20.00 ? 382  GLY A C   1 
ATOM   2986  O O   . GLY A 1 382 ? -31.886 80.326  78.588  1.00 20.00 ? 382  GLY A O   1 
ATOM   2987  N N   . ILE A 1 383 ? -33.286 79.174  77.249  1.00 20.00 ? 383  ILE A N   1 
ATOM   2988  C CA  . ILE A 1 383 ? -33.981 78.483  78.329  1.00 20.00 ? 383  ILE A CA  1 
ATOM   2989  C C   . ILE A 1 383 ? -33.075 77.634  79.219  1.00 20.00 ? 383  ILE A C   1 
ATOM   2990  O O   . ILE A 1 383 ? -33.276 77.583  80.430  1.00 20.00 ? 383  ILE A O   1 
ATOM   2991  C CB  . ILE A 1 383 ? -35.116 77.591  77.767  1.00 20.00 ? 383  ILE A CB  1 
ATOM   2992  C CG1 . ILE A 1 383 ? -35.852 76.886  78.905  1.00 20.00 ? 383  ILE A CG1 1 
ATOM   2993  C CG2 . ILE A 1 383 ? -34.544 76.563  76.814  1.00 20.00 ? 383  ILE A CG2 1 
ATOM   2994  C CD1 . ILE A 1 383 ? -37.085 76.113  78.446  1.00 20.00 ? 383  ILE A CD1 1 
ATOM   2995  N N   . VAL A 1 384 ? -32.078 76.971  78.638  1.00 20.00 ? 384  VAL A N   1 
ATOM   2996  C CA  . VAL A 1 384 ? -31.176 76.139  79.436  1.00 20.00 ? 384  VAL A CA  1 
ATOM   2997  C C   . VAL A 1 384 ? -30.361 76.962  80.431  1.00 20.00 ? 384  VAL A C   1 
ATOM   2998  O O   . VAL A 1 384 ? -30.211 76.579  81.588  1.00 20.00 ? 384  VAL A O   1 
ATOM   2999  C CB  . VAL A 1 384 ? -30.193 75.341  78.548  1.00 20.00 ? 384  VAL A CB  1 
ATOM   3000  C CG1 . VAL A 1 384 ? -29.366 74.390  79.416  1.00 20.00 ? 384  VAL A CG1 1 
ATOM   3001  C CG2 . VAL A 1 384 ? -30.961 74.563  77.485  1.00 20.00 ? 384  VAL A CG2 1 
ATOM   3002  N N   . SER A 1 385 ? -29.828 78.089  79.973  1.00 20.00 ? 385  SER A N   1 
ATOM   3003  C CA  . SER A 1 385 ? -29.032 78.958  80.831  1.00 20.00 ? 385  SER A CA  1 
ATOM   3004  C C   . SER A 1 385 ? -29.950 79.737  81.777  1.00 20.00 ? 385  SER A C   1 
ATOM   3005  O O   . SER A 1 385 ? -29.559 80.070  82.895  1.00 20.00 ? 385  SER A O   1 
ATOM   3006  C CB  . SER A 1 385 ? -28.211 79.937  79.982  1.00 20.00 ? 385  SER A CB  1 
ATOM   3007  O OG  . SER A 1 385 ? -27.232 79.267  79.201  1.00 20.00 ? 385  SER A OG  1 
ATOM   3008  N N   . ALA A 1 386 ? -31.165 80.028  81.320  1.00 20.00 ? 386  ALA A N   1 
ATOM   3009  C CA  . ALA A 1 386 ? -32.133 80.764  82.128  1.00 20.00 ? 386  ALA A CA  1 
ATOM   3010  C C   . ALA A 1 386 ? -32.429 80.003  83.424  1.00 20.00 ? 386  ALA A C   1 
ATOM   3011  O O   . ALA A 1 386 ? -32.811 80.599  84.438  1.00 20.00 ? 386  ALA A O   1 
ATOM   3012  C CB  . ALA A 1 386 ? -33.419 80.970  81.336  1.00 20.00 ? 386  ALA A CB  1 
ATOM   3013  N N   . GLY A 1 387 ? -32.237 78.685  83.375  1.00 20.00 ? 387  GLY A N   1 
ATOM   3014  C CA  . GLY A 1 387 ? -32.478 77.833  84.527  1.00 20.00 ? 387  GLY A CA  1 
ATOM   3015  C C   . GLY A 1 387 ? -33.955 77.572  84.769  1.00 20.00 ? 387  GLY A C   1 
ATOM   3016  O O   . GLY A 1 387 ? -34.803 77.879  83.930  1.00 20.00 ? 387  GLY A O   1 
ATOM   3017  N N   . ARG A 1 388 ? -34.263 76.987  85.920  1.00 20.00 ? 388  ARG A N   1 
ATOM   3018  C CA  . ARG A 1 388 ? -35.646 76.690  86.273  1.00 20.00 ? 388  ARG A CA  1 
ATOM   3019  C C   . ARG A 1 388 ? -35.970 77.272  87.652  1.00 20.00 ? 388  ARG A C   1 
ATOM   3020  O O   . ARG A 1 388 ? -35.159 77.198  88.577  1.00 20.00 ? 388  ARG A O   1 
ATOM   3021  C CB  . ARG A 1 388 ? -35.892 75.177  86.262  1.00 20.00 ? 388  ARG A CB  1 
ATOM   3022  C CG  . ARG A 1 388 ? -34.937 74.374  87.121  1.00 20.00 ? 388  ARG A CG  1 
ATOM   3023  C CD  . ARG A 1 388 ? -35.351 72.917  87.168  1.00 20.00 ? 388  ARG A CD  1 
ATOM   3024  N NE  . ARG A 1 388 ? -36.563 72.675  86.395  1.00 20.00 ? 388  ARG A NE  1 
ATOM   3025  C CZ  . ARG A 1 388 ? -36.676 71.730  85.471  1.00 20.00 ? 388  ARG A CZ  1 
ATOM   3026  N NH1 . ARG A 1 388 ? -35.649 70.938  85.207  1.00 20.00 ? 388  ARG A NH1 1 
ATOM   3027  N NH2 . ARG A 1 388 ? -37.813 71.579  84.806  1.00 20.00 ? 388  ARG A NH2 1 
ATOM   3028  N N   . SER A 1 389 ? -37.156 77.860  87.775  1.00 20.00 ? 389  SER A N   1 
ATOM   3029  C CA  . SER A 1 389 ? -37.597 78.461  89.029  1.00 20.00 ? 389  SER A CA  1 
ATOM   3030  C C   . SER A 1 389 ? -37.321 77.588  90.255  1.00 20.00 ? 389  SER A C   1 
ATOM   3031  O O   . SER A 1 389 ? -37.424 76.355  90.206  1.00 20.00 ? 389  SER A O   1 
ATOM   3032  C CB  . SER A 1 389 ? -39.093 78.787  88.955  1.00 20.00 ? 389  SER A CB  1 
ATOM   3033  O OG  . SER A 1 389 ? -39.753 78.451  90.164  1.00 20.00 ? 389  SER A OG  1 
ATOM   3034  N N   . LYS A 1 390 ? -36.962 78.243  91.355  1.00 20.00 ? 390  LYS A N   1 
ATOM   3035  C CA  . LYS A 1 390 ? -36.669 77.546  92.602  1.00 20.00 ? 390  LYS A CA  1 
ATOM   3036  C C   . LYS A 1 390 ? -37.976 77.033  93.191  1.00 20.00 ? 390  LYS A C   1 
ATOM   3037  O O   . LYS A 1 390 ? -38.105 75.851  93.523  1.00 20.00 ? 390  LYS A O   1 
ATOM   3038  C CB  . LYS A 1 390 ? -35.997 78.501  93.598  1.00 20.00 ? 390  LYS A CB  1 
ATOM   3039  C CG  . LYS A 1 390 ? -34.679 77.986  94.171  1.00 20.00 ? 390  LYS A CG  1 
ATOM   3040  C CD  . LYS A 1 390 ? -34.000 79.034  95.057  1.00 20.00 ? 390  LYS A CD  1 
ATOM   3041  C CE  . LYS A 1 390 ? -32.624 78.561  95.533  1.00 20.00 ? 390  LYS A CE  1 
ATOM   3042  N NZ  . LYS A 1 390 ? -32.279 79.060  96.899  1.00 20.00 ? 390  LYS A NZ  1 
ATOM   3043  N N   . GLU A 1 391 ? -38.942 77.940  93.306  1.00 20.00 ? 391  GLU A N   1 
ATOM   3044  C CA  . GLU A 1 391 ? -40.253 77.615  93.850  1.00 20.00 ? 391  GLU A CA  1 
ATOM   3045  C C   . GLU A 1 391 ? -41.010 76.617  92.971  1.00 20.00 ? 391  GLU A C   1 
ATOM   3046  O O   . GLU A 1 391 ? -41.085 75.432  93.299  1.00 20.00 ? 391  GLU A O   1 
ATOM   3047  C CB  . GLU A 1 391 ? -41.079 78.894  94.015  1.00 20.00 ? 391  GLU A CB  1 
ATOM   3048  C CG  . GLU A 1 391 ? -40.843 79.934  92.925  1.00 20.00 ? 391  GLU A CG  1 
ATOM   3049  C CD  . GLU A 1 391 ? -40.863 81.355  93.459  1.00 20.00 ? 391  GLU A CD  1 
ATOM   3050  O OE1 . GLU A 1 391 ? -41.690 81.645  94.351  1.00 20.00 ? 391  GLU A OE1 1 
ATOM   3051  O OE2 . GLU A 1 391 ? -40.050 82.180  92.984  1.00 20.00 ? 391  GLU A OE2 1 
ATOM   3052  N N   . THR A 1 392 ? -41.560 77.093  91.855  1.00 20.00 ? 392  THR A N   1 
ATOM   3053  C CA  . THR A 1 392 ? -42.310 76.231  90.942  1.00 20.00 ? 392  THR A CA  1 
ATOM   3054  C C   . THR A 1 392 ? -41.483 75.081  90.371  1.00 20.00 ? 392  THR A C   1 
ATOM   3055  O O   . THR A 1 392 ? -42.031 74.166  89.752  1.00 20.00 ? 392  THR A O   1 
ATOM   3056  C CB  . THR A 1 392 ? -42.903 77.040  89.767  1.00 20.00 ? 392  THR A CB  1 
ATOM   3057  O OG1 . THR A 1 392 ? -44.092 76.391  89.299  1.00 20.00 ? 392  THR A OG1 1 
ATOM   3058  C CG2 . THR A 1 392 ? -41.895 77.151  88.618  1.00 20.00 ? 392  THR A CG2 1 
ATOM   3059  N N   . GLY A 1 393 ? -40.171 75.130  90.582  1.00 20.00 ? 393  GLY A N   1 
ATOM   3060  C CA  . GLY A 1 393 ? -39.301 74.084  90.078  1.00 20.00 ? 393  GLY A CA  1 
ATOM   3061  C C   . GLY A 1 393 ? -39.520 73.836  88.598  1.00 20.00 ? 393  GLY A C   1 
ATOM   3062  O O   . GLY A 1 393 ? -39.549 72.689  88.146  1.00 20.00 ? 393  GLY A O   1 
ATOM   3063  N N   . GLU A 1 394 ? -39.680 74.912  87.835  1.00 20.00 ? 394  GLU A N   1 
ATOM   3064  C CA  . GLU A 1 394 ? -39.897 74.789  86.400  1.00 20.00 ? 394  GLU A CA  1 
ATOM   3065  C C   . GLU A 1 394 ? -38.989 75.712  85.592  1.00 20.00 ? 394  GLU A C   1 
ATOM   3066  O O   . GLU A 1 394 ? -38.533 76.741  86.083  1.00 20.00 ? 394  GLU A O   1 
ATOM   3067  C CB  . GLU A 1 394 ? -41.362 75.075  86.073  1.00 20.00 ? 394  GLU A CB  1 
ATOM   3068  C CG  . GLU A 1 394 ? -42.342 74.196  86.842  1.00 20.00 ? 394  GLU A CG  1 
ATOM   3069  C CD  . GLU A 1 394 ? -43.784 74.402  86.409  1.00 20.00 ? 394  GLU A CD  1 
ATOM   3070  O OE1 . GLU A 1 394 ? -44.277 75.551  86.497  1.00 20.00 ? 394  GLU A OE1 1 
ATOM   3071  O OE2 . GLU A 1 394 ? -44.424 73.414  85.981  1.00 20.00 ? 394  GLU A OE2 1 
ATOM   3072  N N   . ASN A 1 395 ? -38.738 75.329  84.345  1.00 20.00 ? 395  ASN A N   1 
ATOM   3073  C CA  . ASN A 1 395 ? -37.889 76.097  83.444  1.00 20.00 ? 395  ASN A CA  1 
ATOM   3074  C C   . ASN A 1 395 ? -38.391 77.509  83.228  1.00 20.00 ? 395  ASN A C   1 
ATOM   3075  O O   . ASN A 1 395 ? -39.586 77.730  83.033  1.00 20.00 ? 395  ASN A O   1 
ATOM   3076  C CB  . ASN A 1 395 ? -37.806 75.418  82.073  1.00 20.00 ? 395  ASN A CB  1 
ATOM   3077  C CG  . ASN A 1 395 ? -37.032 74.124  82.107  1.00 20.00 ? 395  ASN A CG  1 
ATOM   3078  O OD1 . ASN A 1 395 ? -35.992 74.026  82.760  1.00 20.00 ? 395  ASN A OD1 1 
ATOM   3079  N ND2 . ASN A 1 395 ? -37.534 73.116  81.398  1.00 20.00 ? 395  ASN A ND2 1 
ATOM   3080  N N   . HIS A 1 396 ? -37.472 78.466  83.262  1.00 20.00 ? 396  HIS A N   1 
ATOM   3081  C CA  . HIS A 1 396 ? -37.833 79.860  83.052  1.00 20.00 ? 396  HIS A CA  1 
ATOM   3082  C C   . HIS A 1 396 ? -37.937 79.961  81.535  1.00 20.00 ? 396  HIS A C   1 
ATOM   3083  O O   . HIS A 1 396 ? -37.179 79.310  80.817  1.00 20.00 ? 396  HIS A O   1 
ATOM   3084  C CB  . HIS A 1 396 ? -36.727 80.789  83.559  1.00 20.00 ? 396  HIS A CB  1 
ATOM   3085  C CG  . HIS A 1 396 ? -36.514 80.729  85.041  1.00 20.00 ? 396  HIS A CG  1 
ATOM   3086  N ND1 . HIS A 1 396 ? -35.267 80.834  85.618  1.00 20.00 ? 396  HIS A ND1 1 
ATOM   3087  C CD2 . HIS A 1 396 ? -37.390 80.577  86.063  1.00 20.00 ? 396  HIS A CD2 1 
ATOM   3088  C CE1 . HIS A 1 396 ? -35.383 80.748  86.932  1.00 20.00 ? 396  HIS A CE1 1 
ATOM   3089  N NE2 . HIS A 1 396 ? -36.660 80.592  87.228  1.00 20.00 ? 396  HIS A NE2 1 
ATOM   3090  N N   . ARG A 1 397 ? -38.874 80.755  81.036  1.00 20.00 ? 397  ARG A N   1 
ATOM   3091  C CA  . ARG A 1 397 ? -39.017 80.886  79.594  1.00 20.00 ? 397  ARG A CA  1 
ATOM   3092  C C   . ARG A 1 397 ? -38.591 82.267  79.124  1.00 20.00 ? 397  ARG A C   1 
ATOM   3093  O O   . ARG A 1 397 ? -39.423 83.152  78.908  1.00 20.00 ? 397  ARG A O   1 
ATOM   3094  C CB  . ARG A 1 397 ? -40.462 80.600  79.184  1.00 20.00 ? 397  ARG A CB  1 
ATOM   3095  C CG  . ARG A 1 397 ? -40.930 79.197  79.550  1.00 20.00 ? 397  ARG A CG  1 
ATOM   3096  C CD  . ARG A 1 397 ? -41.055 78.301  78.320  1.00 20.00 ? 397  ARG A CD  1 
ATOM   3097  N NE  . ARG A 1 397 ? -42.264 77.482  78.369  1.00 20.00 ? 397  ARG A NE  1 
ATOM   3098  C CZ  . ARG A 1 397 ? -42.536 76.599  79.329  1.00 20.00 ? 397  ARG A CZ  1 
ATOM   3099  N NH1 . ARG A 1 397 ? -41.680 76.414  80.331  1.00 20.00 ? 397  ARG A NH1 1 
ATOM   3100  N NH2 . ARG A 1 397 ? -43.671 75.908  79.296  1.00 20.00 ? 397  ARG A NH2 1 
ATOM   3101  N N   . PRO A 1 398 ? -37.274 82.468  78.957  1.00 20.00 ? 398  PRO A N   1 
ATOM   3102  C CA  . PRO A 1 398 ? -36.736 83.782  78.595  1.00 20.00 ? 398  PRO A CA  1 
ATOM   3103  C C   . PRO A 1 398 ? -37.331 84.324  77.300  1.00 20.00 ? 398  PRO A C   1 
ATOM   3104  O O   . PRO A 1 398 ? -37.724 83.564  76.414  1.00 20.00 ? 398  PRO A O   1 
ATOM   3105  C CB  . PRO A 1 398 ? -35.225 83.544  78.486  1.00 20.00 ? 398  PRO A CB  1 
ATOM   3106  C CG  . PRO A 1 398 ? -35.057 82.058  78.379  1.00 20.00 ? 398  PRO A CG  1 
ATOM   3107  C CD  . PRO A 1 398 ? -36.216 81.451  79.101  1.00 20.00 ? 398  PRO A CD  1 
ATOM   3108  N N   . LYS A 1 399 ? -37.391 85.646  77.196  1.00 20.00 ? 399  LYS A N   1 
ATOM   3109  C CA  . LYS A 1 399 ? -37.939 86.290  76.011  1.00 20.00 ? 399  LYS A CA  1 
ATOM   3110  C C   . LYS A 1 399 ? -37.140 85.909  74.784  1.00 20.00 ? 399  LYS A C   1 
ATOM   3111  O O   . LYS A 1 399 ? -37.698 85.630  73.723  1.00 20.00 ? 399  LYS A O   1 
ATOM   3112  C CB  . LYS A 1 399 ? -37.923 87.812  76.178  1.00 20.00 ? 399  LYS A CB  1 
ATOM   3113  C CG  . LYS A 1 399 ? -39.181 88.371  76.825  1.00 20.00 ? 399  LYS A CG  1 
ATOM   3114  C CD  . LYS A 1 399 ? -40.091 89.031  75.798  1.00 20.00 ? 399  LYS A CD  1 
ATOM   3115  C CE  . LYS A 1 399 ? -41.331 89.629  76.457  1.00 20.00 ? 399  LYS A CE  1 
ATOM   3116  N NZ  . LYS A 1 399 ? -41.589 91.035  76.012  1.00 20.00 ? 399  LYS A NZ  1 
ATOM   3117  N N   . LEU A 1 400 ? -35.824 85.892  74.930  1.00 20.00 ? 400  LEU A N   1 
ATOM   3118  C CA  . LEU A 1 400 ? -34.985 85.541  73.806  1.00 20.00 ? 400  LEU A CA  1 
ATOM   3119  C C   . LEU A 1 400 ? -34.273 84.218  73.971  1.00 20.00 ? 400  LEU A C   1 
ATOM   3120  O O   . LEU A 1 400 ? -33.652 83.948  74.991  1.00 20.00 ? 400  LEU A O   1 
ATOM   3121  C CB  . LEU A 1 400 ? -33.953 86.642  73.540  1.00 20.00 ? 400  LEU A CB  1 
ATOM   3122  C CG  . LEU A 1 400 ? -33.691 87.665  74.646  1.00 20.00 ? 400  LEU A CG  1 
ATOM   3123  C CD1 . LEU A 1 400 ? -33.016 86.971  75.819  1.00 20.00 ? 400  LEU A CD1 1 
ATOM   3124  C CD2 . LEU A 1 400 ? -32.819 88.798  74.109  1.00 20.00 ? 400  LEU A CD2 1 
ATOM   3125  N N   . GLU A 1 401 ? -34.403 83.387  72.952  1.00 20.00 ? 401  GLU A N   1 
ATOM   3126  C CA  . GLU A 1 401 ? -33.781 82.079  72.922  1.00 20.00 ? 401  GLU A CA  1 
ATOM   3127  C C   . GLU A 1 401 ? -32.709 82.321  71.865  1.00 20.00 ? 401  GLU A C   1 
ATOM   3128  O O   . GLU A 1 401 ? -32.958 82.172  70.667  1.00 20.00 ? 401  GLU A O   1 
ATOM   3129  C CB  . GLU A 1 401 ? -34.786 81.034  72.440  1.00 20.00 ? 401  GLU A CB  1 
ATOM   3130  C CG  . GLU A 1 401 ? -34.190 79.669  72.215  1.00 20.00 ? 401  GLU A CG  1 
ATOM   3131  C CD  . GLU A 1 401 ? -34.080 78.887  73.497  1.00 20.00 ? 401  GLU A CD  1 
ATOM   3132  O OE1 . GLU A 1 401 ? -34.342 79.489  74.563  1.00 20.00 ? 401  GLU A OE1 1 
ATOM   3133  O OE2 . GLU A 1 401 ? -33.736 77.681  73.438  1.00 20.00 ? 401  GLU A OE2 1 
ATOM   3134  N N   . THR A 1 402 ? -31.521 82.718  72.301  1.00 20.00 ? 402  THR A N   1 
ATOM   3135  C CA  . THR A 1 402 ? -30.448 82.986  71.355  1.00 20.00 ? 402  THR A CA  1 
ATOM   3136  C C   . THR A 1 402 ? -29.177 82.167  71.510  1.00 20.00 ? 402  THR A C   1 
ATOM   3137  O O   . THR A 1 402 ? -28.984 81.459  72.492  1.00 20.00 ? 402  THR A O   1 
ATOM   3138  C CB  . THR A 1 402 ? -30.037 84.453  71.430  1.00 20.00 ? 402  THR A CB  1 
ATOM   3139  O OG1 . THR A 1 402 ? -29.298 84.667  72.637  1.00 20.00 ? 402  THR A OG1 1 
ATOM   3140  C CG2 . THR A 1 402 ? -31.250 85.345  71.447  1.00 20.00 ? 402  THR A CG2 1 
ATOM   3141  N N   . VAL A 1 403 ? -28.323 82.274  70.499  1.00 20.00 ? 403  VAL A N   1 
ATOM   3142  C CA  . VAL A 1 403 ? -27.040 81.589  70.451  1.00 20.00 ? 403  VAL A CA  1 
ATOM   3143  C C   . VAL A 1 403 ? -26.087 82.747  70.211  1.00 20.00 ? 403  VAL A C   1 
ATOM   3144  O O   . VAL A 1 403 ? -26.182 83.444  69.199  1.00 20.00 ? 403  VAL A O   1 
ATOM   3145  C CB  . VAL A 1 403 ? -26.950 80.594  69.281  1.00 20.00 ? 403  VAL A CB  1 
ATOM   3146  C CG1 . VAL A 1 403 ? -25.518 80.121  69.104  1.00 20.00 ? 403  VAL A CG1 1 
ATOM   3147  C CG2 . VAL A 1 403 ? -27.857 79.414  69.549  1.00 20.00 ? 403  VAL A CG2 1 
ATOM   3148  N N   . ARG A 1 404 ? -25.186 82.971  71.156  1.00 20.00 ? 404  ARG A N   1 
ATOM   3149  C CA  . ARG A 1 404 ? -24.226 84.057  71.041  1.00 20.00 ? 404  ARG A CA  1 
ATOM   3150  C C   . ARG A 1 404 ? -22.882 83.646  70.457  1.00 20.00 ? 404  ARG A C   1 
ATOM   3151  O O   . ARG A 1 404 ? -22.244 82.707  70.930  1.00 20.00 ? 404  ARG A O   1 
ATOM   3152  C CB  . ARG A 1 404 ? -24.012 84.689  72.410  1.00 20.00 ? 404  ARG A CB  1 
ATOM   3153  C CG  . ARG A 1 404 ? -23.129 85.905  72.389  1.00 20.00 ? 404  ARG A CG  1 
ATOM   3154  C CD  . ARG A 1 404 ? -22.737 86.293  73.802  1.00 20.00 ? 404  ARG A CD  1 
ATOM   3155  N NE  . ARG A 1 404 ? -21.702 85.424  74.366  1.00 20.00 ? 404  ARG A NE  1 
ATOM   3156  C CZ  . ARG A 1 404 ? -21.390 85.377  75.661  1.00 20.00 ? 404  ARG A CZ  1 
ATOM   3157  N NH1 . ARG A 1 404 ? -22.034 86.145  76.529  1.00 20.00 ? 404  ARG A NH1 1 
ATOM   3158  N NH2 . ARG A 1 404 ? -20.431 84.569  76.093  1.00 20.00 ? 404  ARG A NH2 1 
ATOM   3159  N N   . LEU A 1 405 ? -22.480 84.358  69.407  1.00 20.00 ? 405  LEU A N   1 
ATOM   3160  C CA  . LEU A 1 405 ? -21.221 84.127  68.718  1.00 20.00 ? 405  LEU A CA  1 
ATOM   3161  C C   . LEU A 1 405 ? -20.384 85.326  69.160  1.00 20.00 ? 405  LEU A C   1 
ATOM   3162  O O   . LEU A 1 405 ? -20.483 86.406  68.587  1.00 20.00 ? 405  LEU A O   1 
ATOM   3163  C CB  . LEU A 1 405 ? -21.424 84.153  67.201  1.00 20.00 ? 405  LEU A CB  1 
ATOM   3164  C CG  . LEU A 1 405 ? -22.536 83.285  66.596  1.00 20.00 ? 405  LEU A CG  1 
ATOM   3165  C CD1 . LEU A 1 405 ? -22.943 83.866  65.245  1.00 20.00 ? 405  LEU A CD1 1 
ATOM   3166  C CD2 . LEU A 1 405 ? -22.053 81.866  66.431  1.00 20.00 ? 405  LEU A CD2 1 
ATOM   3167  N N   . THR A 1 406 ? -19.574 85.125  70.195  1.00 20.00 ? 406  THR A N   1 
ATOM   3168  C CA  . THR A 1 406 ? -18.718 86.167  70.750  1.00 20.00 ? 406  THR A CA  1 
ATOM   3169  C C   . THR A 1 406 ? -17.312 86.168  70.162  1.00 20.00 ? 406  THR A C   1 
ATOM   3170  O O   . THR A 1 406 ? -16.623 85.154  70.191  1.00 20.00 ? 406  THR A O   1 
ATOM   3171  C CB  . THR A 1 406 ? -18.642 85.987  72.262  1.00 20.00 ? 406  THR A CB  1 
ATOM   3172  O OG1 . THR A 1 406 ? -19.646 85.040  72.671  1.00 20.00 ? 406  THR A OG1 1 
ATOM   3173  C CG2 . THR A 1 406 ? -18.885 87.295  72.953  1.00 20.00 ? 406  THR A CG2 1 
ATOM   3174  N N   . ILE A 1 407 ? -16.881 87.314  69.646  1.00 20.00 ? 407  ILE A N   1 
ATOM   3175  C CA  . ILE A 1 407 ? -15.553 87.430  69.043  1.00 20.00 ? 407  ILE A CA  1 
ATOM   3176  C C   . ILE A 1 407 ? -14.433 87.964  69.944  1.00 20.00 ? 407  ILE A C   1 
ATOM   3177  O O   . ILE A 1 407 ? -14.442 89.133  70.343  1.00 20.00 ? 407  ILE A O   1 
ATOM   3178  C CB  . ILE A 1 407 ? -15.605 88.317  67.778  1.00 20.00 ? 407  ILE A CB  1 
ATOM   3179  C CG1 . ILE A 1 407 ? -16.945 88.127  67.051  1.00 20.00 ? 407  ILE A CG1 1 
ATOM   3180  C CG2 . ILE A 1 407 ? -14.431 87.975  66.860  1.00 20.00 ? 407  ILE A CG2 1 
ATOM   3181  C CD1 . ILE A 1 407 ? -17.166 86.740  66.520  1.00 20.00 ? 407  ILE A CD1 1 
ATOM   3182  N N   . PRO A 1 408 ? -13.437 87.116  70.251  1.00 20.00 ? 408  PRO A N   1 
ATOM   3183  C CA  . PRO A 1 408 ? -12.198 87.584  70.884  1.00 20.00 ? 408  PRO A CA  1 
ATOM   3184  C C   . PRO A 1 408 ? -11.495 88.630  70.031  1.00 20.00 ? 408  PRO A C   1 
ATOM   3185  O O   . PRO A 1 408 ? -11.654 88.659  68.807  1.00 20.00 ? 408  PRO A O   1 
ATOM   3186  C CB  . PRO A 1 408 ? -11.365 86.316  71.031  1.00 20.00 ? 408  PRO A CB  1 
ATOM   3187  C CG  . PRO A 1 408 ? -12.347 85.197  70.954  1.00 20.00 ? 408  PRO A CG  1 
ATOM   3188  C CD  . PRO A 1 408 ? -13.408 85.665  70.016  1.00 20.00 ? 408  PRO A CD  1 
ATOM   3189  N N   . ARG A 1 409 ? -10.717 89.485  70.685  1.00 20.00 ? 409  ARG A N   1 
ATOM   3190  C CA  . ARG A 1 409 ? -9.984  90.544  70.003  1.00 20.00 ? 409  ARG A CA  1 
ATOM   3191  C C   . ARG A 1 409 ? -8.644  90.091  69.396  1.00 20.00 ? 409  ARG A C   1 
ATOM   3192  O O   . ARG A 1 409 ? -7.825  89.464  70.064  1.00 20.00 ? 409  ARG A O   1 
ATOM   3193  C CB  . ARG A 1 409 ? -9.749  91.702  70.977  1.00 20.00 ? 409  ARG A CB  1 
ATOM   3194  C CG  . ARG A 1 409 ? -11.005 92.488  71.351  1.00 20.00 ? 409  ARG A CG  1 
ATOM   3195  C CD  . ARG A 1 409 ? -10.894 93.136  72.733  1.00 20.00 ? 409  ARG A CD  1 
ATOM   3196  N NE  . ARG A 1 409 ? -12.213 93.452  73.275  1.00 20.00 ? 409  ARG A NE  1 
ATOM   3197  C CZ  . ARG A 1 409 ? -12.983 92.591  73.932  1.00 20.00 ? 409  ARG A CZ  1 
ATOM   3198  N NH1 . ARG A 1 409 ? -12.568 91.348  74.139  1.00 20.00 ? 409  ARG A NH1 1 
ATOM   3199  N NH2 . ARG A 1 409 ? -14.179 92.967  74.373  1.00 20.00 ? 409  ARG A NH2 1 
ATOM   3200  N N   . ARG A 1 410 ? -8.448  90.402  68.117  1.00 20.00 ? 410  ARG A N   1 
ATOM   3201  C CA  . ARG A 1 410 ? -7.229  90.060  67.381  1.00 20.00 ? 410  ARG A CA  1 
ATOM   3202  C C   . ARG A 1 410 ? -6.862  88.580  67.299  1.00 20.00 ? 410  ARG A C   1 
ATOM   3203  O O   . ARG A 1 410 ? -5.693  88.237  67.182  1.00 20.00 ? 410  ARG A O   1 
ATOM   3204  C CB  . ARG A 1 410 ? -6.052  90.830  67.970  1.00 20.00 ? 410  ARG A CB  1 
ATOM   3205  C CG  . ARG A 1 410 ? -6.347  92.293  68.276  1.00 20.00 ? 410  ARG A CG  1 
ATOM   3206  C CD  . ARG A 1 410 ? -5.067  93.061  68.588  1.00 20.00 ? 410  ARG A CD  1 
ATOM   3207  N NE  . ARG A 1 410 ? -4.453  92.620  69.837  1.00 20.00 ? 410  ARG A NE  1 
ATOM   3208  C CZ  . ARG A 1 410 ? -3.658  93.378  70.588  1.00 20.00 ? 410  ARG A CZ  1 
ATOM   3209  N NH1 . ARG A 1 410 ? -3.381  94.619  70.219  1.00 20.00 ? 410  ARG A NH1 1 
ATOM   3210  N NH2 . ARG A 1 410 ? -3.134  92.893  71.709  1.00 20.00 ? 410  ARG A NH2 1 
ATOM   3211  N N   . VAL A 1 411 ? -7.859  87.705  67.320  1.00 20.00 ? 411  VAL A N   1 
ATOM   3212  C CA  . VAL A 1 411 ? -7.611  86.271  67.252  1.00 20.00 ? 411  VAL A CA  1 
ATOM   3213  C C   . VAL A 1 411 ? -8.045  85.635  65.939  1.00 20.00 ? 411  VAL A C   1 
ATOM   3214  O O   . VAL A 1 411 ? -7.422  84.683  65.475  1.00 20.00 ? 411  VAL A O   1 
ATOM   3215  C CB  . VAL A 1 411 ? -8.340  85.534  68.398  1.00 20.00 ? 411  VAL A CB  1 
ATOM   3216  C CG1 . VAL A 1 411 ? -8.061  84.042  68.322  1.00 20.00 ? 411  VAL A CG1 1 
ATOM   3217  C CG2 . VAL A 1 411 ? -7.891  86.085  69.748  1.00 20.00 ? 411  VAL A CG2 1 
ATOM   3218  N N   . TYR A 1 412 ? -9.105  86.159  65.332  1.00 20.00 ? 412  TYR A N   1 
ATOM   3219  C CA  . TYR A 1 412 ? -9.584  85.598  64.078  1.00 20.00 ? 412  TYR A CA  1 
ATOM   3220  C C   . TYR A 1 412 ? -9.555  86.529  62.874  1.00 20.00 ? 412  TYR A C   1 
ATOM   3221  O O   . TYR A 1 412 ? -9.430  87.751  62.997  1.00 20.00 ? 412  TYR A O   1 
ATOM   3222  C CB  . TYR A 1 412 ? -10.995 85.050  64.280  1.00 20.00 ? 412  TYR A CB  1 
ATOM   3223  C CG  . TYR A 1 412 ? -11.055 83.949  65.318  1.00 20.00 ? 412  TYR A CG  1 
ATOM   3224  C CD1 . TYR A 1 412 ? -10.459 82.713  65.081  1.00 20.00 ? 412  TYR A CD1 1 
ATOM   3225  C CD2 . TYR A 1 412 ? -11.662 84.161  66.549  1.00 20.00 ? 412  TYR A CD2 1 
ATOM   3226  C CE1 . TYR A 1 412 ? -10.457 81.715  66.043  1.00 20.00 ? 412  TYR A CE1 1 
ATOM   3227  C CE2 . TYR A 1 412 ? -11.668 83.170  67.523  1.00 20.00 ? 412  TYR A CE2 1 
ATOM   3228  C CZ  . TYR A 1 412 ? -11.059 81.952  67.264  1.00 20.00 ? 412  TYR A CZ  1 
ATOM   3229  O OH  . TYR A 1 412 ? -11.015 80.981  68.239  1.00 20.00 ? 412  TYR A OH  1 
ATOM   3230  N N   . THR A 1 413 ? -9.682  85.924  61.702  1.00 20.00 ? 413  THR A N   1 
ATOM   3231  C CA  . THR A 1 413 ? -9.673  86.644  60.440  1.00 20.00 ? 413  THR A CA  1 
ATOM   3232  C C   . THR A 1 413 ? -11.053 86.640  59.782  1.00 20.00 ? 413  THR A C   1 
ATOM   3233  O O   . THR A 1 413 ? -11.965 85.949  60.236  1.00 20.00 ? 413  THR A O   1 
ATOM   3234  C CB  . THR A 1 413 ? -8.705  85.987  59.467  1.00 20.00 ? 413  THR A CB  1 
ATOM   3235  O OG1 . THR A 1 413 ? -9.327  84.828  58.917  1.00 20.00 ? 413  THR A OG1 1 
ATOM   3236  C CG2 . THR A 1 413 ? -7.424  85.563  60.175  1.00 20.00 ? 413  THR A CG2 1 
ATOM   3237  N N   . TYR A 1 414 ? -11.197 87.410  58.708  1.00 20.00 ? 414  TYR A N   1 
ATOM   3238  C CA  . TYR A 1 414 ? -12.463 87.474  58.003  1.00 20.00 ? 414  TYR A CA  1 
ATOM   3239  C C   . TYR A 1 414 ? -12.733 86.089  57.425  1.00 20.00 ? 414  TYR A C   1 
ATOM   3240  O O   . TYR A 1 414 ? -13.885 85.676  57.306  1.00 20.00 ? 414  TYR A O   1 
ATOM   3241  C CB  . TYR A 1 414 ? -12.411 88.486  56.856  1.00 20.00 ? 414  TYR A CB  1 
ATOM   3242  C CG  . TYR A 1 414 ? -12.427 89.937  57.280  1.00 20.00 ? 414  TYR A CG  1 
ATOM   3243  C CD1 . TYR A 1 414 ? -13.512 90.473  57.970  1.00 20.00 ? 414  TYR A CD1 1 
ATOM   3244  C CD2 . TYR A 1 414 ? -11.360 90.775  56.984  1.00 20.00 ? 414  TYR A CD2 1 
ATOM   3245  C CE1 . TYR A 1 414 ? -13.530 91.812  58.355  1.00 20.00 ? 414  TYR A CE1 1 
ATOM   3246  C CE2 . TYR A 1 414 ? -11.367 92.115  57.365  1.00 20.00 ? 414  TYR A CE2 1 
ATOM   3247  C CZ  . TYR A 1 414 ? -12.453 92.624  58.050  1.00 20.00 ? 414  TYR A CZ  1 
ATOM   3248  O OH  . TYR A 1 414 ? -12.447 93.940  58.441  1.00 20.00 ? 414  TYR A OH  1 
ATOM   3249  N N   . ALA A 1 415 ? -11.670 85.370  57.075  1.00 20.00 ? 415  ALA A N   1 
ATOM   3250  C CA  . ALA A 1 415 ? -11.828 84.035  56.510  1.00 20.00 ? 415  ALA A CA  1 
ATOM   3251  C C   . ALA A 1 415 ? -12.449 83.114  57.532  1.00 20.00 ? 415  ALA A C   1 
ATOM   3252  O O   . ALA A 1 415 ? -13.197 82.201  57.189  1.00 20.00 ? 415  ALA A O   1 
ATOM   3253  C CB  . ALA A 1 415 ? -10.492 83.481  56.056  1.00 20.00 ? 415  ALA A CB  1 
ATOM   3254  N N   . HIS A 1 416 ? -12.131 83.346  58.796  1.00 20.00 ? 416  HIS A N   1 
ATOM   3255  C CA  . HIS A 1 416 ? -12.683 82.518  59.848  1.00 20.00 ? 416  HIS A CA  1 
ATOM   3256  C C   . HIS A 1 416 ? -14.156 82.884  59.988  1.00 20.00 ? 416  HIS A C   1 
ATOM   3257  O O   . HIS A 1 416 ? -15.000 82.022  60.215  1.00 20.00 ? 416  HIS A O   1 
ATOM   3258  C CB  . HIS A 1 416 ? -11.923 82.763  61.144  1.00 20.00 ? 416  HIS A CB  1 
ATOM   3259  C CG  . HIS A 1 416 ? -10.588 82.090  61.182  1.00 20.00 ? 416  HIS A CG  1 
ATOM   3260  N ND1 . HIS A 1 416 ? -9.444  82.726  61.612  1.00 20.00 ? 416  HIS A ND1 1 
ATOM   3261  C CD2 . HIS A 1 416 ? -10.216 80.832  60.850  1.00 20.00 ? 416  HIS A CD2 1 
ATOM   3262  C CE1 . HIS A 1 416 ? -8.427  81.888  61.547  1.00 20.00 ? 416  HIS A CE1 1 
ATOM   3263  N NE2 . HIS A 1 416 ? -8.869  80.731  61.087  1.00 20.00 ? 416  HIS A NE2 1 
ATOM   3264  N N   . MET A 1 417 ? -14.460 84.168  59.828  1.00 20.00 ? 417  MET A N   1 
ATOM   3265  C CA  . MET A 1 417 ? -15.835 84.646  59.929  1.00 20.00 ? 417  MET A CA  1 
ATOM   3266  C C   . MET A 1 417 ? -16.675 84.028  58.811  1.00 20.00 ? 417  MET A C   1 
ATOM   3267  O O   . MET A 1 417 ? -17.855 83.740  58.995  1.00 20.00 ? 417  MET A O   1 
ATOM   3268  C CB  . MET A 1 417 ? -15.875 86.169  59.829  1.00 20.00 ? 417  MET A CB  1 
ATOM   3269  C CG  . MET A 1 417 ? -15.181 86.883  60.989  1.00 20.00 ? 417  MET A CG  1 
ATOM   3270  S SD  . MET A 1 417 ? -15.890 86.535  62.613  1.00 20.00 ? 417  MET A SD  1 
ATOM   3271  C CE  . MET A 1 417 ? -14.710 85.418  63.300  1.00 20.00 ? 417  MET A CE  1 
ATOM   3272  N N   . ASP A 1 418 ? -16.063 83.827  57.649  1.00 20.00 ? 418  ASP A N   1 
ATOM   3273  C CA  . ASP A 1 418 ? -16.757 83.235  56.514  1.00 20.00 ? 418  ASP A CA  1 
ATOM   3274  C C   . ASP A 1 418 ? -17.086 81.783  56.838  1.00 20.00 ? 418  ASP A C   1 
ATOM   3275  O O   . ASP A 1 418 ? -18.132 81.277  56.443  1.00 20.00 ? 418  ASP A O   1 
ATOM   3276  C CB  . ASP A 1 418 ? -15.877 83.292  55.274  1.00 20.00 ? 418  ASP A CB  1 
ATOM   3277  C CG  . ASP A 1 418 ? -15.837 84.671  54.665  1.00 20.00 ? 418  ASP A CG  1 
ATOM   3278  O OD1 . ASP A 1 418 ? -16.741 85.478  54.961  1.00 20.00 ? 418  ASP A OD1 1 
ATOM   3279  O OD2 . ASP A 1 418 ? -14.906 84.948  53.889  1.00 20.00 ? 418  ASP A OD2 1 
ATOM   3280  N N   . VAL A 1 419 ? -16.187 81.111  57.553  1.00 20.00 ? 419  VAL A N   1 
ATOM   3281  C CA  . VAL A 1 419 ? -16.412 79.716  57.919  1.00 20.00 ? 419  VAL A CA  1 
ATOM   3282  C C   . VAL A 1 419 ? -17.642 79.580  58.822  1.00 20.00 ? 419  VAL A C   1 
ATOM   3283  O O   . VAL A 1 419 ? -18.427 78.654  58.663  1.00 20.00 ? 419  VAL A O   1 
ATOM   3284  C CB  . VAL A 1 419 ? -15.203 79.107  58.664  1.00 20.00 ? 419  VAL A CB  1 
ATOM   3285  C CG1 . VAL A 1 419 ? -15.546 77.711  59.157  1.00 20.00 ? 419  VAL A CG1 1 
ATOM   3286  C CG2 . VAL A 1 419 ? -14.005 79.036  57.747  1.00 20.00 ? 419  VAL A CG2 1 
ATOM   3287  N N   . VAL A 1 420 ? -17.815 80.495  59.770  1.00 20.00 ? 420  VAL A N   1 
ATOM   3288  C CA  . VAL A 1 420 ? -18.967 80.397  60.645  1.00 20.00 ? 420  VAL A CA  1 
ATOM   3289  C C   . VAL A 1 420 ? -20.221 80.900  59.947  1.00 20.00 ? 420  VAL A C   1 
ATOM   3290  O O   . VAL A 1 420 ? -21.290 80.334  60.144  1.00 20.00 ? 420  VAL A O   1 
ATOM   3291  C CB  . VAL A 1 420 ? -18.745 81.133  61.999  1.00 20.00 ? 420  VAL A CB  1 
ATOM   3292  C CG1 . VAL A 1 420 ? -17.421 81.843  61.994  1.00 20.00 ? 420  VAL A CG1 1 
ATOM   3293  C CG2 . VAL A 1 420 ? -19.883 82.082  62.288  1.00 20.00 ? 420  VAL A CG2 1 
ATOM   3294  N N   . ALA A 1 421 ? -20.094 81.938  59.124  1.00 20.00 ? 421  ALA A N   1 
ATOM   3295  C CA  . ALA A 1 421 ? -21.247 82.481  58.402  1.00 20.00 ? 421  ALA A CA  1 
ATOM   3296  C C   . ALA A 1 421 ? -21.785 81.463  57.387  1.00 20.00 ? 421  ALA A C   1 
ATOM   3297  O O   . ALA A 1 421 ? -22.984 81.176  57.355  1.00 20.00 ? 421  ALA A O   1 
ATOM   3298  C CB  . ALA A 1 421 ? -20.869 83.763  57.679  1.00 20.00 ? 421  ALA A CB  1 
ATOM   3299  N N   . ASP A 1 422 ? -20.898 80.924  56.558  1.00 20.00 ? 422  ASP A N   1 
ATOM   3300  C CA  . ASP A 1 422 ? -21.287 79.941  55.550  1.00 20.00 ? 422  ASP A CA  1 
ATOM   3301  C C   . ASP A 1 422 ? -21.902 78.701  56.183  1.00 20.00 ? 422  ASP A C   1 
ATOM   3302  O O   . ASP A 1 422 ? -22.841 78.112  55.640  1.00 20.00 ? 422  ASP A O   1 
ATOM   3303  C CB  . ASP A 1 422 ? -20.073 79.519  54.724  1.00 20.00 ? 422  ASP A CB  1 
ATOM   3304  C CG  . ASP A 1 422 ? -19.619 80.595  53.766  1.00 20.00 ? 422  ASP A CG  1 
ATOM   3305  O OD1 . ASP A 1 422 ? -20.327 81.619  53.639  1.00 20.00 ? 422  ASP A OD1 1 
ATOM   3306  O OD2 . ASP A 1 422 ? -18.552 80.415  53.142  1.00 20.00 ? 422  ASP A OD2 1 
ATOM   3307  N N   . GLY A 1 423 ? -21.362 78.306  57.332  1.00 20.00 ? 423  GLY A N   1 
ATOM   3308  C CA  . GLY A 1 423 ? -21.860 77.134  58.027  1.00 20.00 ? 423  GLY A CA  1 
ATOM   3309  C C   . GLY A 1 423 ? -23.240 77.329  58.609  1.00 20.00 ? 423  GLY A C   1 
ATOM   3310  O O   . GLY A 1 423 ? -24.073 76.424  58.573  1.00 20.00 ? 423  GLY A O   1 
ATOM   3311  N N   . ILE A 1 424 ? -23.485 78.511  59.156  1.00 20.00 ? 424  ILE A N   1 
ATOM   3312  C CA  . ILE A 1 424 ? -24.775 78.817  59.748  1.00 20.00 ? 424  ILE A CA  1 
ATOM   3313  C C   . ILE A 1 424 ? -25.815 79.055  58.657  1.00 20.00 ? 424  ILE A C   1 
ATOM   3314  O O   . ILE A 1 424 ? -26.988 78.718  58.816  1.00 20.00 ? 424  ILE A O   1 
ATOM   3315  C CB  . ILE A 1 424 ? -24.682 80.056  60.660  1.00 20.00 ? 424  ILE A CB  1 
ATOM   3316  C CG1 . ILE A 1 424 ? -23.989 79.676  61.967  1.00 20.00 ? 424  ILE A CG1 1 
ATOM   3317  C CG2 . ILE A 1 424 ? -26.069 80.590  60.978  1.00 20.00 ? 424  ILE A CG2 1 
ATOM   3318  C CD1 . ILE A 1 424 ? -23.420 80.856  62.707  1.00 20.00 ? 424  ILE A CD1 1 
ATOM   3319  N N   . ILE A 1 425 ? -25.385 79.643  57.548  1.00 20.00 ? 425  ILE A N   1 
ATOM   3320  C CA  . ILE A 1 425 ? -26.303 79.904  56.454  1.00 20.00 ? 425  ILE A CA  1 
ATOM   3321  C C   . ILE A 1 425 ? -26.802 78.563  55.924  1.00 20.00 ? 425  ILE A C   1 
ATOM   3322  O O   . ILE A 1 425 ? -27.989 78.396  55.663  1.00 20.00 ? 425  ILE A O   1 
ATOM   3323  C CB  . ILE A 1 425 ? -25.614 80.689  55.338  1.00 20.00 ? 425  ILE A CB  1 
ATOM   3324  C CG1 . ILE A 1 425 ? -25.594 82.173  55.706  1.00 20.00 ? 425  ILE A CG1 1 
ATOM   3325  C CG2 . ILE A 1 425 ? -26.329 80.469  54.019  1.00 20.00 ? 425  ILE A CG2 1 
ATOM   3326  C CD1 . ILE A 1 425 ? -24.619 83.003  54.892  1.00 20.00 ? 425  ILE A CD1 1 
ATOM   3327  N N   . LYS A 1 426 ? -25.892 77.604  55.790  1.00 20.00 ? 426  LYS A N   1 
ATOM   3328  C CA  . LYS A 1 426 ? -26.237 76.277  55.297  1.00 20.00 ? 426  LYS A CA  1 
ATOM   3329  C C   . LYS A 1 426 ? -27.203 75.586  56.253  1.00 20.00 ? 426  LYS A C   1 
ATOM   3330  O O   . LYS A 1 426 ? -28.112 74.868  55.832  1.00 20.00 ? 426  LYS A O   1 
ATOM   3331  C CB  . LYS A 1 426 ? -24.975 75.422  55.143  1.00 20.00 ? 426  LYS A CB  1 
ATOM   3332  C CG  . LYS A 1 426 ? -25.209 74.105  54.431  1.00 20.00 ? 426  LYS A CG  1 
ATOM   3333  C CD  . LYS A 1 426 ? -24.219 73.038  54.893  1.00 20.00 ? 426  LYS A CD  1 
ATOM   3334  C CE  . LYS A 1 426 ? -24.912 71.700  55.161  1.00 20.00 ? 426  LYS A CE  1 
ATOM   3335  N NZ  . LYS A 1 426 ? -25.429 71.586  56.566  1.00 20.00 ? 426  LYS A NZ  1 
ATOM   3336  N N   . LEU A 1 427 ? -27.002 75.803  57.546  1.00 20.00 ? 427  LEU A N   1 
ATOM   3337  C CA  . LEU A 1 427 ? -27.866 75.194  58.537  1.00 20.00 ? 427  LEU A CA  1 
ATOM   3338  C C   . LEU A 1 427 ? -29.251 75.801  58.407  1.00 20.00 ? 427  LEU A C   1 
ATOM   3339  O O   . LEU A 1 427 ? -30.255 75.099  58.448  1.00 20.00 ? 427  LEU A O   1 
ATOM   3340  C CB  . LEU A 1 427 ? -27.321 75.433  59.949  1.00 20.00 ? 427  LEU A CB  1 
ATOM   3341  C CG  . LEU A 1 427 ? -26.311 74.393  60.448  1.00 20.00 ? 427  LEU A CG  1 
ATOM   3342  C CD1 . LEU A 1 427 ? -25.763 74.812  61.797  1.00 20.00 ? 427  LEU A CD1 1 
ATOM   3343  C CD2 . LEU A 1 427 ? -26.983 73.037  60.547  1.00 20.00 ? 427  LEU A CD2 1 
ATOM   3344  N N   . TYR A 1 428 ? -29.294 77.115  58.241  1.00 20.00 ? 428  TYR A N   1 
ATOM   3345  C CA  . TYR A 1 428 ? -30.558 77.821  58.105  1.00 20.00 ? 428  TYR A CA  1 
ATOM   3346  C C   . TYR A 1 428 ? -31.383 77.319  56.914  1.00 20.00 ? 428  TYR A C   1 
ATOM   3347  O O   . TYR A 1 428 ? -32.594 77.145  57.018  1.00 20.00 ? 428  TYR A O   1 
ATOM   3348  C CB  . TYR A 1 428 ? -30.294 79.317  57.962  1.00 20.00 ? 428  TYR A CB  1 
ATOM   3349  C CG  . TYR A 1 428 ? -31.541 80.164  58.029  1.00 20.00 ? 428  TYR A CG  1 
ATOM   3350  C CD1 . TYR A 1 428 ? -32.397 80.079  59.116  1.00 20.00 ? 428  TYR A CD1 1 
ATOM   3351  C CD2 . TYR A 1 428 ? -31.859 81.055  57.008  1.00 20.00 ? 428  TYR A CD2 1 
ATOM   3352  C CE1 . TYR A 1 428 ? -33.534 80.853  59.193  1.00 20.00 ? 428  TYR A CE1 1 
ATOM   3353  C CE2 . TYR A 1 428 ? -32.993 81.837  57.073  1.00 20.00 ? 428  TYR A CE2 1 
ATOM   3354  C CZ  . TYR A 1 428 ? -33.827 81.729  58.173  1.00 20.00 ? 428  TYR A CZ  1 
ATOM   3355  O OH  . TYR A 1 428 ? -34.960 82.498  58.269  1.00 20.00 ? 428  TYR A OH  1 
ATOM   3356  N N   . GLN A 1 429 ? -30.716 77.085  55.790  1.00 20.00 ? 429  GLN A N   1 
ATOM   3357  C CA  . GLN A 1 429 ? -31.369 76.605  54.577  1.00 20.00 ? 429  GLN A CA  1 
ATOM   3358  C C   . GLN A 1 429 ? -31.968 75.207  54.716  1.00 20.00 ? 429  GLN A C   1 
ATOM   3359  O O   . GLN A 1 429 ? -32.691 74.737  53.836  1.00 20.00 ? 429  GLN A O   1 
ATOM   3360  C CB  . GLN A 1 429 ? -30.370 76.631  53.423  1.00 20.00 ? 429  GLN A CB  1 
ATOM   3361  C CG  . GLN A 1 429 ? -30.219 78.006  52.820  1.00 20.00 ? 429  GLN A CG  1 
ATOM   3362  C CD  . GLN A 1 429 ? -29.082 78.087  51.836  1.00 20.00 ? 429  GLN A CD  1 
ATOM   3363  O OE1 . GLN A 1 429 ? -28.395 77.095  51.573  1.00 20.00 ? 429  GLN A OE1 1 
ATOM   3364  N NE2 . GLN A 1 429 ? -28.871 79.276  51.282  1.00 20.00 ? 429  GLN A NE2 1 
ATOM   3365  N N   . HIS A 1 430 ? -31.665 74.545  55.823  1.00 20.00 ? 430  HIS A N   1 
ATOM   3366  C CA  . HIS A 1 430 ? -32.172 73.203  56.081  1.00 20.00 ? 430  HIS A CA  1 
ATOM   3367  C C   . HIS A 1 430 ? -32.506 73.131  57.566  1.00 20.00 ? 430  HIS A C   1 
ATOM   3368  O O   . HIS A 1 430 ? -32.375 72.079  58.193  1.00 20.00 ? 430  HIS A O   1 
ATOM   3369  C CB  . HIS A 1 430 ? -31.107 72.154  55.726  1.00 20.00 ? 430  HIS A CB  1 
ATOM   3370  C CG  . HIS A 1 430 ? -30.610 72.247  54.314  1.00 20.00 ? 430  HIS A CG  1 
ATOM   3371  N ND1 . HIS A 1 430 ? -29.329 72.655  53.998  1.00 20.00 ? 430  HIS A ND1 1 
ATOM   3372  C CD2 . HIS A 1 430 ? -31.222 71.988  53.134  1.00 20.00 ? 430  HIS A CD2 1 
ATOM   3373  C CE1 . HIS A 1 430 ? -29.176 72.644  52.685  1.00 20.00 ? 430  HIS A CE1 1 
ATOM   3374  N NE2 . HIS A 1 430 ? -30.310 72.244  52.138  1.00 20.00 ? 430  HIS A NE2 1 
ATOM   3375  N N   . LYS A 1 431 ? -32.953 74.263  58.110  1.00 20.00 ? 431  LYS A N   1 
ATOM   3376  C CA  . LYS A 1 431 ? -33.313 74.380  59.523  1.00 20.00 ? 431  LYS A CA  1 
ATOM   3377  C C   . LYS A 1 431 ? -34.297 73.346  60.034  1.00 20.00 ? 431  LYS A C   1 
ATOM   3378  O O   . LYS A 1 431 ? -34.306 73.019  61.222  1.00 20.00 ? 431  LYS A O   1 
ATOM   3379  C CB  . LYS A 1 431 ? -33.855 75.777  59.816  1.00 20.00 ? 431  LYS A CB  1 
ATOM   3380  C CG  . LYS A 1 431 ? -35.060 76.169  58.995  1.00 20.00 ? 431  LYS A CG  1 
ATOM   3381  C CD  . LYS A 1 431 ? -35.560 77.548  59.418  1.00 20.00 ? 431  LYS A CD  1 
ATOM   3382  C CE  . LYS A 1 431 ? -36.615 78.103  58.463  1.00 20.00 ? 431  LYS A CE  1 
ATOM   3383  N NZ  . LYS A 1 431 ? -37.520 77.042  57.920  1.00 20.00 ? 431  LYS A NZ  1 
ATOM   3384  N N   . GLU A 1 432 ? -35.129 72.835  59.139  1.00 20.00 ? 432  GLU A N   1 
ATOM   3385  C CA  . GLU A 1 432 ? -36.117 71.832  59.512  1.00 20.00 ? 432  GLU A CA  1 
ATOM   3386  C C   . GLU A 1 432 ? -35.413 70.558  59.964  1.00 20.00 ? 432  GLU A C   1 
ATOM   3387  O O   . GLU A 1 432 ? -35.973 69.755  60.706  1.00 20.00 ? 432  GLU A O   1 
ATOM   3388  C CB  . GLU A 1 432 ? -37.027 71.517  58.319  1.00 20.00 ? 432  GLU A CB  1 
ATOM   3389  C CG  . GLU A 1 432 ? -36.996 72.568  57.216  1.00 20.00 ? 432  GLU A CG  1 
ATOM   3390  C CD  . GLU A 1 432 ? -36.002 72.227  56.122  1.00 20.00 ? 432  GLU A CD  1 
ATOM   3391  O OE1 . GLU A 1 432 ? -35.662 71.029  55.978  1.00 20.00 ? 432  GLU A OE1 1 
ATOM   3392  O OE2 . GLU A 1 432 ? -35.562 73.158  55.409  1.00 20.00 ? 432  GLU A OE2 1 
ATOM   3393  N N   . ASP A 1 433 ? -34.178 70.384  59.513  1.00 20.00 ? 433  ASP A N   1 
ATOM   3394  C CA  . ASP A 1 433 ? -33.400 69.209  59.867  1.00 20.00 ? 433  ASP A CA  1 
ATOM   3395  C C   . ASP A 1 433 ? -32.886 69.250  61.301  1.00 20.00 ? 433  ASP A C   1 
ATOM   3396  O O   . ASP A 1 433 ? -32.536 68.211  61.865  1.00 20.00 ? 433  ASP A O   1 
ATOM   3397  C CB  . ASP A 1 433 ? -32.229 69.056  58.897  1.00 20.00 ? 433  ASP A CB  1 
ATOM   3398  C CG  . ASP A 1 433 ? -32.668 68.571  57.534  1.00 20.00 ? 433  ASP A CG  1 
ATOM   3399  O OD1 . ASP A 1 433 ? -33.800 68.051  57.434  1.00 20.00 ? 433  ASP A OD1 1 
ATOM   3400  O OD2 . ASP A 1 433 ? -31.891 68.708  56.565  1.00 20.00 ? 433  ASP A OD2 1 
ATOM   3401  N N   . ILE A 1 434 ? -32.834 70.442  61.890  1.00 20.00 ? 434  ILE A N   1 
ATOM   3402  C CA  . ILE A 1 434 ? -32.355 70.575  63.261  1.00 20.00 ? 434  ILE A CA  1 
ATOM   3403  C C   . ILE A 1 434 ? -33.363 69.899  64.188  1.00 20.00 ? 434  ILE A C   1 
ATOM   3404  O O   . ILE A 1 434 ? -34.556 70.200  64.150  1.00 20.00 ? 434  ILE A O   1 
ATOM   3405  C CB  . ILE A 1 434 ? -32.167 72.066  63.646  1.00 20.00 ? 434  ILE A CB  1 
ATOM   3406  C CG1 . ILE A 1 434 ? -30.998 72.652  62.845  1.00 20.00 ? 434  ILE A CG1 1 
ATOM   3407  C CG2 . ILE A 1 434 ? -31.886 72.204  65.138  1.00 20.00 ? 434  ILE A CG2 1 
ATOM   3408  C CD1 . ILE A 1 434 ? -30.946 74.170  62.834  1.00 20.00 ? 434  ILE A CD1 1 
ATOM   3409  N N   . ARG A 1 435 ? -32.876 68.970  65.003  1.00 20.00 ? 435  ARG A N   1 
ATOM   3410  C CA  . ARG A 1 435 ? -33.725 68.242  65.936  1.00 20.00 ? 435  ARG A CA  1 
ATOM   3411  C C   . ARG A 1 435 ? -33.784 68.892  67.308  1.00 20.00 ? 435  ARG A C   1 
ATOM   3412  O O   . ARG A 1 435 ? -32.906 69.672  67.678  1.00 20.00 ? 435  ARG A O   1 
ATOM   3413  C CB  . ARG A 1 435 ? -33.230 66.798  66.082  1.00 20.00 ? 435  ARG A CB  1 
ATOM   3414  C CG  . ARG A 1 435 ? -33.143 66.019  64.777  1.00 20.00 ? 435  ARG A CG  1 
ATOM   3415  C CD  . ARG A 1 435 ? -32.543 64.629  64.989  1.00 20.00 ? 435  ARG A CD  1 
ATOM   3416  N NE  . ARG A 1 435 ? -33.374 63.801  65.860  1.00 20.00 ? 435  ARG A NE  1 
ATOM   3417  C CZ  . ARG A 1 435 ? -33.000 62.622  66.350  1.00 20.00 ? 435  ARG A CZ  1 
ATOM   3418  N NH1 . ARG A 1 435 ? -31.804 62.129  66.054  1.00 20.00 ? 435  ARG A NH1 1 
ATOM   3419  N NH2 . ARG A 1 435 ? -33.816 61.939  67.143  1.00 20.00 ? 435  ARG A NH2 1 
ATOM   3420  N N   . GLY A 1 436 ? -34.833 68.565  68.056  1.00 20.00 ? 436  GLY A N   1 
ATOM   3421  C CA  . GLY A 1 436 ? -35.000 69.114  69.387  1.00 20.00 ? 436  GLY A CA  1 
ATOM   3422  C C   . GLY A 1 436 ? -34.150 68.300  70.340  1.00 20.00 ? 436  GLY A C   1 
ATOM   3423  O O   . GLY A 1 436 ? -33.735 67.185  70.016  1.00 20.00 ? 436  GLY A O   1 
ATOM   3424  N N   . LEU A 1 437 ? -33.890 68.844  71.519  1.00 20.00 ? 437  LEU A N   1 
ATOM   3425  C CA  . LEU A 1 437 ? -33.079 68.139  72.493  1.00 20.00 ? 437  LEU A CA  1 
ATOM   3426  C C   . LEU A 1 437 ? -33.847 67.851  73.763  1.00 20.00 ? 437  LEU A C   1 
ATOM   3427  O O   . LEU A 1 437 ? -34.898 68.439  74.013  1.00 20.00 ? 437  LEU A O   1 
ATOM   3428  C CB  . LEU A 1 437 ? -31.847 68.969  72.845  1.00 20.00 ? 437  LEU A CB  1 
ATOM   3429  C CG  . LEU A 1 437 ? -30.648 68.943  71.901  1.00 20.00 ? 437  LEU A CG  1 
ATOM   3430  C CD1 . LEU A 1 437 ? -29.559 69.822  72.496  1.00 20.00 ? 437  LEU A CD1 1 
ATOM   3431  C CD2 . LEU A 1 437 ? -30.151 67.517  71.706  1.00 20.00 ? 437  LEU A CD2 1 
ATOM   3432  N N   . THR A 1 438 ? -33.304 66.944  74.566  1.00 20.00 ? 438  THR A N   1 
ATOM   3433  C CA  . THR A 1 438 ? -33.922 66.571  75.820  1.00 20.00 ? 438  THR A CA  1 
ATOM   3434  C C   . THR A 1 438 ? -32.840 66.300  76.864  1.00 20.00 ? 438  THR A C   1 
ATOM   3435  O O   . THR A 1 438 ? -31.733 65.875  76.534  1.00 20.00 ? 438  THR A O   1 
ATOM   3436  C CB  . THR A 1 438 ? -34.829 65.321  75.640  1.00 20.00 ? 438  THR A CB  1 
ATOM   3437  O OG1 . THR A 1 438 ? -35.708 65.206  76.765  1.00 20.00 ? 438  THR A OG1 1 
ATOM   3438  C CG2 . THR A 1 438 ? -34.001 64.054  75.514  1.00 20.00 ? 438  THR A CG2 1 
ATOM   3439  N N   . PHE A 1 439 ? -33.169 66.569  78.123  1.00 20.00 ? 439  PHE A N   1 
ATOM   3440  C CA  . PHE A 1 439 ? -32.248 66.362  79.235  1.00 20.00 ? 439  PHE A CA  1 
ATOM   3441  C C   . PHE A 1 439 ? -32.069 64.869  79.546  1.00 20.00 ? 439  PHE A C   1 
ATOM   3442  O O   . PHE A 1 439 ? -33.053 64.133  79.648  1.00 20.00 ? 439  PHE A O   1 
ATOM   3443  C CB  . PHE A 1 439 ? -32.793 67.045  80.496  1.00 20.00 ? 439  PHE A CB  1 
ATOM   3444  C CG  . PHE A 1 439 ? -32.425 68.504  80.625  1.00 20.00 ? 439  PHE A CG  1 
ATOM   3445  C CD1 . PHE A 1 439 ? -31.097 68.923  80.536  1.00 20.00 ? 439  PHE A CD1 1 
ATOM   3446  C CD2 . PHE A 1 439 ? -33.414 69.457  80.868  1.00 20.00 ? 439  PHE A CD2 1 
ATOM   3447  C CE1 . PHE A 1 439 ? -30.759 70.273  80.689  1.00 20.00 ? 439  PHE A CE1 1 
ATOM   3448  C CE2 . PHE A 1 439 ? -33.089 70.808  81.023  1.00 20.00 ? 439  PHE A CE2 1 
ATOM   3449  C CZ  . PHE A 1 439 ? -31.759 71.216  80.933  1.00 20.00 ? 439  PHE A CZ  1 
ATOM   3450  N N   . VAL A 1 440 ? -30.820 64.420  79.681  1.00 20.00 ? 440  VAL A N   1 
ATOM   3451  C CA  . VAL A 1 440 ? -30.533 63.022  79.996  1.00 20.00 ? 440  VAL A CA  1 
ATOM   3452  C C   . VAL A 1 440 ? -29.806 63.088  81.331  1.00 20.00 ? 440  VAL A C   1 
ATOM   3453  O O   . VAL A 1 440 ? -29.532 62.075  81.973  1.00 20.00 ? 440  VAL A O   1 
ATOM   3454  C CB  . VAL A 1 440 ? -29.617 62.328  78.961  1.00 20.00 ? 440  VAL A CB  1 
ATOM   3455  C CG1 . VAL A 1 440 ? -30.207 62.459  77.568  1.00 20.00 ? 440  VAL A CG1 1 
ATOM   3456  C CG2 . VAL A 1 440 ? -28.212 62.897  79.038  1.00 20.00 ? 440  VAL A CG2 1 
ATOM   3457  N N   . TYR A 1 441 ? -29.496 64.315  81.726  1.00 20.00 ? 441  TYR A N   1 
ATOM   3458  C CA  . TYR A 1 441 ? -28.807 64.596  82.974  1.00 20.00 ? 441  TYR A CA  1 
ATOM   3459  C C   . TYR A 1 441 ? -28.826 66.105  83.187  1.00 20.00 ? 441  TYR A C   1 
ATOM   3460  O O   . TYR A 1 441 ? -28.236 66.853  82.408  1.00 20.00 ? 441  TYR A O   1 
ATOM   3461  C CB  . TYR A 1 441 ? -27.359 64.094  82.933  1.00 20.00 ? 441  TYR A CB  1 
ATOM   3462  C CG  . TYR A 1 441 ? -26.524 64.648  84.060  1.00 20.00 ? 441  TYR A CG  1 
ATOM   3463  C CD1 . TYR A 1 441 ? -26.818 64.336  85.384  1.00 20.00 ? 441  TYR A CD1 1 
ATOM   3464  C CD2 . TYR A 1 441 ? -25.490 65.544  83.811  1.00 20.00 ? 441  TYR A CD2 1 
ATOM   3465  C CE1 . TYR A 1 441 ? -26.111 64.910  86.432  1.00 20.00 ? 441  TYR A CE1 1 
ATOM   3466  C CE2 . TYR A 1 441 ? -24.774 66.127  84.855  1.00 20.00 ? 441  TYR A CE2 1 
ATOM   3467  C CZ  . TYR A 1 441 ? -25.094 65.809  86.163  1.00 20.00 ? 441  TYR A CZ  1 
ATOM   3468  O OH  . TYR A 1 441 ? -24.424 66.418  87.203  1.00 20.00 ? 441  TYR A OH  1 
ATOM   3469  N N   . GLU A 1 442 ? -29.524 66.549  84.229  1.00 20.00 ? 442  GLU A N   1 
ATOM   3470  C CA  . GLU A 1 442 ? -29.613 67.973  84.537  1.00 20.00 ? 442  GLU A CA  1 
ATOM   3471  C C   . GLU A 1 442 ? -29.126 68.241  85.953  1.00 20.00 ? 442  GLU A C   1 
ATOM   3472  O O   . GLU A 1 442 ? -29.847 68.009  86.917  1.00 20.00 ? 442  GLU A O   1 
ATOM   3473  C CB  . GLU A 1 442 ? -31.054 68.470  84.407  1.00 20.00 ? 442  GLU A CB  1 
ATOM   3474  C CG  . GLU A 1 442 ? -31.252 69.886  84.948  1.00 20.00 ? 442  GLU A CG  1 
ATOM   3475  C CD  . GLU A 1 442 ? -32.696 70.344  84.887  1.00 20.00 ? 442  GLU A CD  1 
ATOM   3476  O OE1 . GLU A 1 442 ? -33.520 69.642  84.256  1.00 20.00 ? 442  GLU A OE1 1 
ATOM   3477  O OE2 . GLU A 1 442 ? -33.006 71.409  85.469  1.00 20.00 ? 442  GLU A OE2 1 
ATOM   3478  N N   . PRO A 1 443 ? -27.891 68.736  86.098  1.00 20.00 ? 443  PRO A N   1 
ATOM   3479  C CA  . PRO A 1 443 ? -27.433 69.106  87.439  1.00 20.00 ? 443  PRO A CA  1 
ATOM   3480  C C   . PRO A 1 443 ? -28.361 70.132  88.078  1.00 20.00 ? 443  PRO A C   1 
ATOM   3481  O O   . PRO A 1 443 ? -29.177 70.747  87.392  1.00 20.00 ? 443  PRO A O   1 
ATOM   3482  C CB  . PRO A 1 443 ? -26.021 69.652  87.206  1.00 20.00 ? 443  PRO A CB  1 
ATOM   3483  C CG  . PRO A 1 443 ? -25.945 69.937  85.736  1.00 20.00 ? 443  PRO A CG  1 
ATOM   3484  C CD  . PRO A 1 443 ? -26.869 68.975  85.069  1.00 20.00 ? 443  PRO A CD  1 
ATOM   3485  N N   . LYS A 1 444 ? -28.233 70.306  89.390  1.00 20.00 ? 444  LYS A N   1 
ATOM   3486  C CA  . LYS A 1 444 ? -29.057 71.254  90.137  1.00 20.00 ? 444  LYS A CA  1 
ATOM   3487  C C   . LYS A 1 444 ? -28.555 72.693  90.030  1.00 20.00 ? 444  LYS A C   1 
ATOM   3488  O O   . LYS A 1 444 ? -29.355 73.635  89.931  1.00 20.00 ? 444  LYS A O   1 
ATOM   3489  C CB  . LYS A 1 444 ? -29.114 70.838  91.606  1.00 20.00 ? 444  LYS A CB  1 
ATOM   3490  C CG  . LYS A 1 444 ? -29.582 69.401  91.824  1.00 20.00 ? 444  LYS A CG  1 
ATOM   3491  C CD  . LYS A 1 444 ? -31.104 69.266  91.648  1.00 20.00 ? 444  LYS A CD  1 
ATOM   3492  C CE  . LYS A 1 444 ? -31.697 68.202  92.577  1.00 20.00 ? 444  LYS A CE  1 
ATOM   3493  N NZ  . LYS A 1 444 ? -33.056 67.754  92.146  1.00 20.00 ? 444  LYS A NZ  1 
ATOM   3494  N N   . GLN A 1 445 ? -27.233 72.858  90.064  1.00 20.00 ? 445  GLN A N   1 
ATOM   3495  C CA  . GLN A 1 445 ? -26.617 74.181  89.967  1.00 20.00 ? 445  GLN A CA  1 
ATOM   3496  C C   . GLN A 1 445 ? -25.742 74.236  88.724  1.00 20.00 ? 445  GLN A C   1 
ATOM   3497  O O   . GLN A 1 445 ? -25.134 73.230  88.345  1.00 20.00 ? 445  GLN A O   1 
ATOM   3498  C CB  . GLN A 1 445 ? -25.752 74.483  91.198  1.00 20.00 ? 445  GLN A CB  1 
ATOM   3499  C CG  . GLN A 1 445 ? -26.349 74.049  92.523  1.00 20.00 ? 445  GLN A CG  1 
ATOM   3500  C CD  . GLN A 1 445 ? -25.808 72.713  92.979  1.00 20.00 ? 445  GLN A CD  1 
ATOM   3501  O OE1 . GLN A 1 445 ? -25.492 71.854  92.158  1.00 20.00 ? 445  GLN A OE1 1 
ATOM   3502  N NE2 . GLN A 1 445 ? -25.696 72.529  94.292  1.00 20.00 ? 445  GLN A NE2 1 
ATOM   3503  N N   . LEU A 1 446 ? -25.679 75.407  88.094  1.00 20.00 ? 446  LEU A N   1 
ATOM   3504  C CA  . LEU A 1 446 ? -24.872 75.589  86.892  1.00 20.00 ? 446  LEU A CA  1 
ATOM   3505  C C   . LEU A 1 446 ? -25.237 74.560  85.815  1.00 20.00 ? 446  LEU A C   1 
ATOM   3506  O O   . LEU A 1 446 ? -24.361 74.070  85.092  1.00 20.00 ? 446  LEU A O   1 
ATOM   3507  C CB  . LEU A 1 446 ? -23.387 75.457  87.243  1.00 20.00 ? 446  LEU A CB  1 
ATOM   3508  C CG  . LEU A 1 446 ? -22.587 76.672  87.727  1.00 20.00 ? 446  LEU A CG  1 
ATOM   3509  C CD1 . LEU A 1 446 ? -21.537 76.996  86.685  1.00 20.00 ? 446  LEU A CD1 1 
ATOM   3510  C CD2 . LEU A 1 446 ? -23.488 77.872  87.983  1.00 20.00 ? 446  LEU A CD2 1 
ATOM   3511  N N   . ARG A 1 447 ? -26.531 74.254  85.712  1.00 20.00 ? 447  ARG A N   1 
ATOM   3512  C CA  . ARG A 1 447 ? -27.043 73.286  84.741  1.00 20.00 ? 447  ARG A CA  1 
ATOM   3513  C C   . ARG A 1 447 ? -26.555 73.483  83.306  1.00 20.00 ? 447  ARG A C   1 
ATOM   3514  O O   . ARG A 1 447 ? -26.310 72.505  82.595  1.00 20.00 ? 447  ARG A O   1 
ATOM   3515  C CB  . ARG A 1 447 ? -28.581 73.271  84.773  1.00 20.00 ? 447  ARG A CB  1 
ATOM   3516  C CG  . ARG A 1 447 ? -29.277 74.086  83.680  1.00 20.00 ? 447  ARG A CG  1 
ATOM   3517  C CD  . ARG A 1 447 ? -30.739 73.647  83.524  1.00 20.00 ? 447  ARG A CD  1 
ATOM   3518  N NE  . ARG A 1 447 ? -31.623 74.689  82.993  1.00 20.00 ? 447  ARG A NE  1 
ATOM   3519  C CZ  . ARG A 1 447 ? -32.926 74.519  82.782  1.00 20.00 ? 447  ARG A CZ  1 
ATOM   3520  N NH1 . ARG A 1 447 ? -33.492 73.352  83.059  1.00 20.00 ? 447  ARG A NH1 1 
ATOM   3521  N NH2 . ARG A 1 447 ? -33.662 75.504  82.289  1.00 20.00 ? 447  ARG A NH2 1 
ATOM   3522  N N   . PHE A 1 448 ? -26.412 74.735  82.881  1.00 20.00 ? 448  PHE A N   1 
ATOM   3523  C CA  . PHE A 1 448 ? -25.951 75.008  81.525  1.00 20.00 ? 448  PHE A CA  1 
ATOM   3524  C C   . PHE A 1 448 ? -24.502 74.569  81.369  1.00 20.00 ? 448  PHE A C   1 
ATOM   3525  O O   . PHE A 1 448 ? -24.073 74.167  80.287  1.00 20.00 ? 448  PHE A O   1 
ATOM   3526  C CB  . PHE A 1 448 ? -26.098 76.505  81.186  1.00 20.00 ? 448  PHE A CB  1 
ATOM   3527  C CG  . PHE A 1 448 ? -25.217 77.410  81.999  1.00 20.00 ? 448  PHE A CG  1 
ATOM   3528  C CD1 . PHE A 1 448 ? -23.856 77.506  81.732  1.00 20.00 ? 448  PHE A CD1 1 
ATOM   3529  C CD2 . PHE A 1 448 ? -25.746 78.156  83.044  1.00 20.00 ? 448  PHE A CD2 1 
ATOM   3530  C CE1 . PHE A 1 448 ? -23.029 78.328  82.497  1.00 20.00 ? 448  PHE A CE1 1 
ATOM   3531  C CE2 . PHE A 1 448 ? -24.934 78.979  83.813  1.00 20.00 ? 448  PHE A CE2 1 
ATOM   3532  C CZ  . PHE A 1 448 ? -23.570 79.064  83.539  1.00 20.00 ? 448  PHE A CZ  1 
ATOM   3533  N N   . PHE A 1 449 ? -23.759 74.620  82.468  1.00 20.00 ? 449  PHE A N   1 
ATOM   3534  C CA  . PHE A 1 449 ? -22.360 74.234  82.449  1.00 20.00 ? 449  PHE A CA  1 
ATOM   3535  C C   . PHE A 1 449 ? -22.103 72.735  82.318  1.00 20.00 ? 449  PHE A C   1 
ATOM   3536  O O   . PHE A 1 449 ? -21.153 72.338  81.650  1.00 20.00 ? 449  PHE A O   1 
ATOM   3537  C CB  . PHE A 1 449 ? -21.652 74.769  83.700  1.00 20.00 ? 449  PHE A CB  1 
ATOM   3538  C CG  . PHE A 1 449 ? -20.149 74.677  83.634  1.00 20.00 ? 449  PHE A CG  1 
ATOM   3539  C CD1 . PHE A 1 449 ? -19.438 75.345  82.639  1.00 20.00 ? 449  PHE A CD1 1 
ATOM   3540  C CD2 . PHE A 1 449 ? -19.443 73.921  84.568  1.00 20.00 ? 449  PHE A CD2 1 
ATOM   3541  C CE1 . PHE A 1 449 ? -18.043 75.264  82.576  1.00 20.00 ? 449  PHE A CE1 1 
ATOM   3542  C CE2 . PHE A 1 449 ? -18.048 73.831  84.514  1.00 20.00 ? 449  PHE A CE2 1 
ATOM   3543  C CZ  . PHE A 1 449 ? -17.348 74.506  83.514  1.00 20.00 ? 449  PHE A CZ  1 
ATOM   3544  N N   . THR A 1 450 ? -22.939 71.901  82.931  1.00 20.00 ? 450  THR A N   1 
ATOM   3545  C CA  . THR A 1 450 ? -22.727 70.455  82.840  1.00 20.00 ? 450  THR A CA  1 
ATOM   3546  C C   . THR A 1 450 ? -23.879 69.560  82.403  1.00 20.00 ? 450  THR A C   1 
ATOM   3547  O O   . THR A 1 450 ? -23.712 68.344  82.340  1.00 20.00 ? 450  THR A O   1 
ATOM   3548  C CB  . THR A 1 450 ? -22.212 69.880  84.175  1.00 20.00 ? 450  THR A CB  1 
ATOM   3549  O OG1 . THR A 1 450 ? -22.959 70.446  85.260  1.00 20.00 ? 450  THR A OG1 1 
ATOM   3550  C CG2 . THR A 1 450 ? -20.732 70.184  84.350  1.00 20.00 ? 450  THR A CG2 1 
ATOM   3551  N N   . ALA A 1 451 ? -25.041 70.128  82.108  1.00 20.00 ? 451  ALA A N   1 
ATOM   3552  C CA  . ALA A 1 451 ? -26.172 69.303  81.681  1.00 20.00 ? 451  ALA A CA  1 
ATOM   3553  C C   . ALA A 1 451 ? -25.830 68.558  80.382  1.00 20.00 ? 451  ALA A C   1 
ATOM   3554  O O   . ALA A 1 451 ? -25.065 69.054  79.553  1.00 20.00 ? 451  ALA A O   1 
ATOM   3555  C CB  . ALA A 1 451 ? -27.407 70.176  81.476  1.00 20.00 ? 451  ALA A CB  1 
ATOM   3556  N N   . ARG A 1 452 ? -26.385 67.362  80.207  1.00 20.00 ? 452  ARG A N   1 
ATOM   3557  C CA  . ARG A 1 452 ? -26.128 66.570  79.006  1.00 20.00 ? 452  ARG A CA  1 
ATOM   3558  C C   . ARG A 1 452 ? -27.468 66.269  78.356  1.00 20.00 ? 452  ARG A C   1 
ATOM   3559  O O   . ARG A 1 452 ? -28.453 66.008  79.044  1.00 20.00 ? 452  ARG A O   1 
ATOM   3560  C CB  . ARG A 1 452 ? -25.403 65.280  79.370  1.00 20.00 ? 452  ARG A CB  1 
ATOM   3561  C CG  . ARG A 1 452 ? -24.507 65.434  80.588  1.00 20.00 ? 452  ARG A CG  1 
ATOM   3562  C CD  . ARG A 1 452 ? -23.244 64.591  80.503  1.00 20.00 ? 452  ARG A CD  1 
ATOM   3563  N NE  . ARG A 1 452 ? -23.290 63.668  79.383  1.00 20.00 ? 452  ARG A NE  1 
ATOM   3564  C CZ  . ARG A 1 452 ? -22.255 63.365  78.605  1.00 20.00 ? 452  ARG A CZ  1 
ATOM   3565  N NH1 . ARG A 1 452 ? -21.063 63.909  78.817  1.00 20.00 ? 452  ARG A NH1 1 
ATOM   3566  N NH2 . ARG A 1 452 ? -22.421 62.506  77.608  1.00 20.00 ? 452  ARG A NH2 1 
ATOM   3567  N N   . PHE A 1 453 ? -27.506 66.311  77.029  1.00 20.00 ? 453  PHE A N   1 
ATOM   3568  C CA  . PHE A 1 453 ? -28.740 66.053  76.295  1.00 20.00 ? 453  PHE A CA  1 
ATOM   3569  C C   . PHE A 1 453 ? -28.672 64.926  75.290  1.00 20.00 ? 453  PHE A C   1 
ATOM   3570  O O   . PHE A 1 453 ? -27.656 64.253  75.126  1.00 20.00 ? 453  PHE A O   1 
ATOM   3571  C CB  . PHE A 1 453 ? -29.179 67.304  75.529  1.00 20.00 ? 453  PHE A CB  1 
ATOM   3572  C CG  . PHE A 1 453 ? -29.047 68.573  76.308  1.00 20.00 ? 453  PHE A CG  1 
ATOM   3573  C CD1 . PHE A 1 453 ? -27.791 69.112  76.582  1.00 20.00 ? 453  PHE A CD1 1 
ATOM   3574  C CD2 . PHE A 1 453 ? -30.181 69.236  76.775  1.00 20.00 ? 453  PHE A CD2 1 
ATOM   3575  C CE1 . PHE A 1 453 ? -27.668 70.287  77.309  1.00 20.00 ? 453  PHE A CE1 1 
ATOM   3576  C CE2 . PHE A 1 453 ? -30.065 70.416  77.504  1.00 20.00 ? 453  PHE A CE2 1 
ATOM   3577  C CZ  . PHE A 1 453 ? -28.806 70.939  77.770  1.00 20.00 ? 453  PHE A CZ  1 
ATOM   3578  N N   . ASP A 1 454 ? -29.795 64.753  74.610  1.00 20.00 ? 454  ASP A N   1 
ATOM   3579  C CA  . ASP A 1 454 ? -29.954 63.743  73.589  1.00 20.00 ? 454  ASP A CA  1 
ATOM   3580  C C   . ASP A 1 454 ? -31.091 64.204  72.691  1.00 20.00 ? 454  ASP A C   1 
ATOM   3581  O O   . ASP A 1 454 ? -32.019 64.882  73.151  1.00 20.00 ? 454  ASP A O   1 
ATOM   3582  C CB  . ASP A 1 454 ? -30.285 62.387  74.201  1.00 20.00 ? 454  ASP A CB  1 
ATOM   3583  C CG  . ASP A 1 454 ? -29.851 61.239  73.315  1.00 20.00 ? 454  ASP A CG  1 
ATOM   3584  O OD1 . ASP A 1 454 ? -29.516 61.497  72.137  1.00 20.00 ? 454  ASP A OD1 1 
ATOM   3585  O OD2 . ASP A 1 454 ? -29.842 60.087  73.794  1.00 20.00 ? 454  ASP A OD2 1 
ATOM   3586  N N   . PHE A 1 455 ? -31.010 63.841  71.413  1.00 20.00 ? 455  PHE A N   1 
ATOM   3587  C CA  . PHE A 1 455 ? -32.021 64.209  70.431  1.00 20.00 ? 455  PHE A CA  1 
ATOM   3588  C C   . PHE A 1 455 ? -33.395 63.608  70.678  1.00 20.00 ? 455  PHE A C   1 
ATOM   3589  O O   . PHE A 1 455 ? -33.528 62.489  71.186  1.00 20.00 ? 455  PHE A O   1 
ATOM   3590  C CB  . PHE A 1 455 ? -31.565 63.810  69.034  1.00 20.00 ? 455  PHE A CB  1 
ATOM   3591  C CG  . PHE A 1 455 ? -30.443 64.637  68.515  1.00 20.00 ? 455  PHE A CG  1 
ATOM   3592  C CD1 . PHE A 1 455 ? -30.473 66.021  68.634  1.00 20.00 ? 455  PHE A CD1 1 
ATOM   3593  C CD2 . PHE A 1 455 ? -29.346 64.036  67.914  1.00 20.00 ? 455  PHE A CD2 1 
ATOM   3594  C CE1 . PHE A 1 455 ? -29.419 66.799  68.161  1.00 20.00 ? 455  PHE A CE1 1 
ATOM   3595  C CE2 . PHE A 1 455 ? -28.283 64.806  67.436  1.00 20.00 ? 455  PHE A CE2 1 
ATOM   3596  C CZ  . PHE A 1 455 ? -28.320 66.190  67.560  1.00 20.00 ? 455  PHE A CZ  1 
ATOM   3597  N N   . ILE A 1 456 ? -34.416 64.366  70.297  1.00 20.00 ? 456  ILE A N   1 
ATOM   3598  C CA  . ILE A 1 456 ? -35.797 63.944  70.457  1.00 20.00 ? 456  ILE A CA  1 
ATOM   3599  C C   . ILE A 1 456 ? -36.230 63.297  69.150  1.00 20.00 ? 456  ILE A C   1 
ATOM   3600  O O   . ILE A 1 456 ? -35.911 63.883  68.091  1.00 20.00 ? 456  ILE A O   1 
ATOM   3601  C CB  . ILE A 1 456 ? -36.722 65.141  70.735  1.00 20.00 ? 456  ILE A CB  1 
ATOM   3602  C CG1 . ILE A 1 456 ? -36.489 65.670  72.150  1.00 20.00 ? 456  ILE A CG1 1 
ATOM   3603  C CG2 . ILE A 1 456 ? -38.174 64.723  70.574  1.00 20.00 ? 456  ILE A CG2 1 
ATOM   3604  C CD1 . ILE A 1 456 ? -37.091 67.044  72.390  1.00 20.00 ? 456  ILE A CD1 1 
ATOM   3605  O OXT . ILE A 1 456 ? -36.876 62.225  69.200  1.00 20.00 ? 456  ILE A OXT 1 
ATOM   3606  N N   . MET B 1 1   ? -10.969 77.766  42.888  1.00 20.00 ? 1    MET B N   1 
ATOM   3607  C CA  . MET B 1 1   ? -12.127 78.679  43.109  1.00 20.00 ? 1    MET B CA  1 
ATOM   3608  C C   . MET B 1 1   ? -12.301 78.950  44.598  1.00 20.00 ? 1    MET B C   1 
ATOM   3609  O O   . MET B 1 1   ? -12.760 80.022  45.005  1.00 20.00 ? 1    MET B O   1 
ATOM   3610  C CB  . MET B 1 1   ? -13.410 78.049  42.550  1.00 20.00 ? 1    MET B CB  1 
ATOM   3611  C CG  . MET B 1 1   ? -14.563 79.031  42.370  1.00 20.00 ? 1    MET B CG  1 
ATOM   3612  S SD  . MET B 1 1   ? -15.420 79.418  43.916  1.00 20.00 ? 1    MET B SD  1 
ATOM   3613  C CE  . MET B 1 1   ? -15.863 81.172  43.640  1.00 20.00 ? 1    MET B CE  1 
ATOM   3614  N N   . ASN B 1 2   ? -11.926 77.967  45.408  1.00 20.00 ? 2    ASN B N   1 
ATOM   3615  C CA  . ASN B 1 2   ? -12.043 78.092  46.853  1.00 20.00 ? 2    ASN B CA  1 
ATOM   3616  C C   . ASN B 1 2   ? -10.693 78.114  47.557  1.00 20.00 ? 2    ASN B C   1 
ATOM   3617  O O   . ASN B 1 2   ? -9.795  77.321  47.268  1.00 20.00 ? 2    ASN B O   1 
ATOM   3618  C CB  . ASN B 1 2   ? -12.916 76.959  47.407  1.00 20.00 ? 2    ASN B CB  1 
ATOM   3619  C CG  . ASN B 1 2   ? -14.407 77.250  47.265  1.00 20.00 ? 2    ASN B CG  1 
ATOM   3620  O OD1 . ASN B 1 2   ? -15.069 77.637  48.226  1.00 20.00 ? 2    ASN B OD1 1 
ATOM   3621  N ND2 . ASN B 1 2   ? -14.936 77.070  46.059  1.00 20.00 ? 2    ASN B ND2 1 
ATOM   3622  N N   . TYR B 1 3   ? -10.571 79.044  48.491  1.00 20.00 ? 3    TYR B N   1 
ATOM   3623  C CA  . TYR B 1 3   ? -9.360  79.208  49.254  1.00 20.00 ? 3    TYR B CA  1 
ATOM   3624  C C   . TYR B 1 3   ? -9.668  78.923  50.704  1.00 20.00 ? 3    TYR B C   1 
ATOM   3625  O O   . TYR B 1 3   ? -10.670 79.388  51.235  1.00 20.00 ? 3    TYR B O   1 
ATOM   3626  C CB  . TYR B 1 3   ? -8.850  80.635  49.085  1.00 20.00 ? 3    TYR B CB  1 
ATOM   3627  C CG  . TYR B 1 3   ? -8.724  81.056  47.638  1.00 20.00 ? 3    TYR B CG  1 
ATOM   3628  C CD1 . TYR B 1 3   ? -7.604  80.717  46.888  1.00 20.00 ? 3    TYR B CD1 1 
ATOM   3629  C CD2 . TYR B 1 3   ? -9.706  81.831  47.034  1.00 20.00 ? 3    TYR B CD2 1 
ATOM   3630  C CE1 . TYR B 1 3   ? -7.459  81.150  45.573  1.00 20.00 ? 3    TYR B CE1 1 
ATOM   3631  C CE2 . TYR B 1 3   ? -9.573  82.267  45.723  1.00 20.00 ? 3    TYR B CE2 1 
ATOM   3632  C CZ  . TYR B 1 3   ? -8.446  81.928  45.002  1.00 20.00 ? 3    TYR B CZ  1 
ATOM   3633  O OH  . TYR B 1 3   ? -8.294  82.399  43.720  1.00 20.00 ? 3    TYR B OH  1 
ATOM   3634  N N   . PRO B 1 4   ? -8.815  78.133  51.363  1.00 20.00 ? 4    PRO B N   1 
ATOM   3635  C CA  . PRO B 1 4   ? -9.072  77.749  52.752  1.00 20.00 ? 4    PRO B CA  1 
ATOM   3636  C C   . PRO B 1 4   ? -8.768  78.839  53.784  1.00 20.00 ? 4    PRO B C   1 
ATOM   3637  O O   . PRO B 1 4   ? -7.891  79.685  53.579  1.00 20.00 ? 4    PRO B O   1 
ATOM   3638  C CB  . PRO B 1 4   ? -8.189  76.522  52.948  1.00 20.00 ? 4    PRO B CB  1 
ATOM   3639  C CG  . PRO B 1 4   ? -7.047  76.725  51.996  1.00 20.00 ? 4    PRO B CG  1 
ATOM   3640  C CD  . PRO B 1 4   ? -7.570  77.541  50.838  1.00 20.00 ? 4    PRO B CD  1 
ATOM   3641  N N   . ALA B 1 5   ? -9.509  78.812  54.889  1.00 20.00 ? 5    ALA B N   1 
ATOM   3642  C CA  . ALA B 1 5   ? -9.328  79.773  55.961  1.00 20.00 ? 5    ALA B CA  1 
ATOM   3643  C C   . ALA B 1 5   ? -8.085  79.310  56.714  1.00 20.00 ? 5    ALA B C   1 
ATOM   3644  O O   . ALA B 1 5   ? -7.734  78.133  56.660  1.00 20.00 ? 5    ALA B O   1 
ATOM   3645  C CB  . ALA B 1 5   ? -10.542 79.764  56.881  1.00 20.00 ? 5    ALA B CB  1 
ATOM   3646  N N   . GLU B 1 6   ? -7.423  80.226  57.412  1.00 20.00 ? 6    GLU B N   1 
ATOM   3647  C CA  . GLU B 1 6   ? -6.219  79.877  58.160  1.00 20.00 ? 6    GLU B CA  1 
ATOM   3648  C C   . GLU B 1 6   ? -6.488  78.709  59.099  1.00 20.00 ? 6    GLU B C   1 
ATOM   3649  O O   . GLU B 1 6   ? -7.435  78.737  59.882  1.00 20.00 ? 6    GLU B O   1 
ATOM   3650  C CB  . GLU B 1 6   ? -5.716  81.087  58.955  1.00 20.00 ? 6    GLU B CB  1 
ATOM   3651  C CG  . GLU B 1 6   ? -5.306  82.272  58.098  1.00 20.00 ? 6    GLU B CG  1 
ATOM   3652  C CD  . GLU B 1 6   ? -6.488  83.137  57.714  1.00 20.00 ? 6    GLU B CD  1 
ATOM   3653  O OE1 . GLU B 1 6   ? -7.623  82.788  58.092  1.00 20.00 ? 6    GLU B OE1 1 
ATOM   3654  O OE2 . GLU B 1 6   ? -6.291  84.164  57.038  1.00 20.00 ? 6    GLU B OE2 1 
ATOM   3655  N N   . PRO B 1 7   ? -5.659  77.656  59.022  1.00 20.00 ? 7    PRO B N   1 
ATOM   3656  C CA  . PRO B 1 7   ? -5.773  76.506  59.926  1.00 20.00 ? 7    PRO B CA  1 
ATOM   3657  C C   . PRO B 1 7   ? -5.117  76.742  61.286  1.00 20.00 ? 7    PRO B C   1 
ATOM   3658  O O   . PRO B 1 7   ? -4.495  75.843  61.851  1.00 20.00 ? 7    PRO B O   1 
ATOM   3659  C CB  . PRO B 1 7   ? -5.099  75.380  59.152  1.00 20.00 ? 7    PRO B CB  1 
ATOM   3660  C CG  . PRO B 1 7   ? -4.057  76.078  58.327  1.00 20.00 ? 7    PRO B CG  1 
ATOM   3661  C CD  . PRO B 1 7   ? -4.562  77.483  58.050  1.00 20.00 ? 7    PRO B CD  1 
ATOM   3662  N N   . PHE B 1 8   ? -5.258  77.958  61.800  1.00 20.00 ? 8    PHE B N   1 
ATOM   3663  C CA  . PHE B 1 8   ? -4.690  78.331  63.090  1.00 20.00 ? 8    PHE B CA  1 
ATOM   3664  C C   . PHE B 1 8   ? -5.314  79.638  63.575  1.00 20.00 ? 8    PHE B C   1 
ATOM   3665  O O   . PHE B 1 8   ? -6.003  80.322  62.827  1.00 20.00 ? 8    PHE B O   1 
ATOM   3666  C CB  . PHE B 1 8   ? -3.168  78.513  62.967  1.00 20.00 ? 8    PHE B CB  1 
ATOM   3667  C CG  . PHE B 1 8   ? -2.747  79.466  61.871  1.00 20.00 ? 8    PHE B CG  1 
ATOM   3668  C CD1 . PHE B 1 8   ? -3.005  80.827  61.970  1.00 20.00 ? 8    PHE B CD1 1 
ATOM   3669  C CD2 . PHE B 1 8   ? -2.096  78.997  60.734  1.00 20.00 ? 8    PHE B CD2 1 
ATOM   3670  C CE1 . PHE B 1 8   ? -2.628  81.702  60.960  1.00 20.00 ? 8    PHE B CE1 1 
ATOM   3671  C CE2 . PHE B 1 8   ? -1.715  79.869  59.716  1.00 20.00 ? 8    PHE B CE2 1 
ATOM   3672  C CZ  . PHE B 1 8   ? -1.982  81.223  59.830  1.00 20.00 ? 8    PHE B CZ  1 
ATOM   3673  N N   . ARG B 1 9   ? -5.095  79.975  64.836  1.00 20.00 ? 9    ARG B N   1 
ATOM   3674  C CA  . ARG B 1 9   ? -5.637  81.212  65.374  1.00 20.00 ? 9    ARG B CA  1 
ATOM   3675  C C   . ARG B 1 9   ? -4.418  82.075  65.608  1.00 20.00 ? 9    ARG B C   1 
ATOM   3676  O O   . ARG B 1 9   ? -3.294  81.580  65.626  1.00 20.00 ? 9    ARG B O   1 
ATOM   3677  C CB  . ARG B 1 9   ? -6.335  81.001  66.717  1.00 20.00 ? 9    ARG B CB  1 
ATOM   3678  C CG  . ARG B 1 9   ? -7.210  79.792  66.787  1.00 20.00 ? 9    ARG B CG  1 
ATOM   3679  C CD  . ARG B 1 9   ? -7.930  79.764  68.101  1.00 20.00 ? 9    ARG B CD  1 
ATOM   3680  N NE  . ARG B 1 9   ? -8.722  78.551  68.247  1.00 20.00 ? 9    ARG B NE  1 
ATOM   3681  C CZ  . ARG B 1 9   ? -9.144  78.082  69.412  1.00 20.00 ? 9    ARG B CZ  1 
ATOM   3682  N NH1 . ARG B 1 9   ? -8.846  78.729  70.532  1.00 20.00 ? 9    ARG B NH1 1 
ATOM   3683  N NH2 . ARG B 1 9   ? -9.855  76.966  69.456  1.00 20.00 ? 9    ARG B NH2 1 
ATOM   3684  N N   . ILE B 1 10  ? -4.641  83.363  65.789  1.00 20.00 ? 10   ILE B N   1 
ATOM   3685  C CA  . ILE B 1 10  ? -3.553  84.279  66.029  1.00 20.00 ? 10   ILE B CA  1 
ATOM   3686  C C   . ILE B 1 10  ? -3.323  84.223  67.539  1.00 20.00 ? 10   ILE B C   1 
ATOM   3687  O O   . ILE B 1 10  ? -4.263  84.374  68.311  1.00 20.00 ? 10   ILE B O   1 
ATOM   3688  C CB  . ILE B 1 10  ? -3.955  85.706  65.585  1.00 20.00 ? 10   ILE B CB  1 
ATOM   3689  C CG1 . ILE B 1 10  ? -4.235  85.707  64.077  1.00 20.00 ? 10   ILE B CG1 1 
ATOM   3690  C CG2 . ILE B 1 10  ? -2.879  86.701  65.970  1.00 20.00 ? 10   ILE B CG2 1 
ATOM   3691  C CD1 . ILE B 1 10  ? -4.813  86.992  63.542  1.00 20.00 ? 10   ILE B CD1 1 
ATOM   3692  N N   . LYS B 1 11  ? -2.088  83.964  67.957  1.00 20.00 ? 11   LYS B N   1 
ATOM   3693  C CA  . LYS B 1 11  ? -1.759  83.893  69.377  1.00 20.00 ? 11   LYS B CA  1 
ATOM   3694  C C   . LYS B 1 11  ? -1.285  85.267  69.835  1.00 20.00 ? 11   LYS B C   1 
ATOM   3695  O O   . LYS B 1 11  ? -1.727  85.762  70.863  1.00 20.00 ? 11   LYS B O   1 
ATOM   3696  C CB  . LYS B 1 11  ? -0.677  82.839  69.629  1.00 20.00 ? 11   LYS B CB  1 
ATOM   3697  C CG  . LYS B 1 11  ? -0.100  82.873  71.030  1.00 20.00 ? 11   LYS B CG  1 
ATOM   3698  C CD  . LYS B 1 11  ? -1.083  82.353  72.060  1.00 20.00 ? 11   LYS B CD  1 
ATOM   3699  C CE  . LYS B 1 11  ? -0.493  82.471  73.447  1.00 20.00 ? 11   LYS B CE  1 
ATOM   3700  N NZ  . LYS B 1 11  ? -0.178  81.146  74.023  1.00 20.00 ? 11   LYS B NZ  1 
ATOM   3701  N N   . SER B 1 12  ? -0.386  85.880  69.069  1.00 20.00 ? 12   SER B N   1 
ATOM   3702  C CA  . SER B 1 12  ? 0.130   87.205  69.401  1.00 20.00 ? 12   SER B CA  1 
ATOM   3703  C C   . SER B 1 12  ? 0.312   87.954  68.096  1.00 20.00 ? 12   SER B C   1 
ATOM   3704  O O   . SER B 1 12  ? 0.510   87.338  67.057  1.00 20.00 ? 12   SER B O   1 
ATOM   3705  C CB  . SER B 1 12  ? 1.457   87.111  70.162  1.00 20.00 ? 12   SER B CB  1 
ATOM   3706  O OG  . SER B 1 12  ? 2.533   86.764  69.322  1.00 20.00 ? 12   SER B OG  1 
ATOM   3707  N N   . VAL B 1 13  ? 0.228   89.278  68.145  1.00 20.00 ? 13   VAL B N   1 
ATOM   3708  C CA  . VAL B 1 13  ? 0.381   90.089  66.947  1.00 20.00 ? 13   VAL B CA  1 
ATOM   3709  C C   . VAL B 1 13  ? 1.554   91.070  67.007  1.00 20.00 ? 13   VAL B C   1 
ATOM   3710  O O   . VAL B 1 13  ? 2.033   91.433  68.079  1.00 20.00 ? 13   VAL B O   1 
ATOM   3711  C CB  . VAL B 1 13  ? -0.897  90.913  66.672  1.00 20.00 ? 13   VAL B CB  1 
ATOM   3712  C CG1 . VAL B 1 13  ? -2.085  89.993  66.507  1.00 20.00 ? 13   VAL B CG1 1 
ATOM   3713  C CG2 . VAL B 1 13  ? -1.142  91.887  67.819  1.00 20.00 ? 13   VAL B CG2 1 
ATOM   3714  N N   . GLU B 1 14  ? 2.010   91.483  65.833  1.00 20.00 ? 14   GLU B N   1 
ATOM   3715  C CA  . GLU B 1 14  ? 3.112   92.422  65.719  1.00 20.00 ? 14   GLU B CA  1 
ATOM   3716  C C   . GLU B 1 14  ? 2.459   93.739  65.329  1.00 20.00 ? 14   GLU B C   1 
ATOM   3717  O O   . GLU B 1 14  ? 1.883   93.863  64.246  1.00 20.00 ? 14   GLU B O   1 
ATOM   3718  C CB  . GLU B 1 14  ? 4.085   91.977  64.629  1.00 20.00 ? 14   GLU B CB  1 
ATOM   3719  C CG  . GLU B 1 14  ? 5.321   92.850  64.498  1.00 20.00 ? 14   GLU B CG  1 
ATOM   3720  C CD  . GLU B 1 14  ? 6.416   92.193  63.671  1.00 20.00 ? 14   GLU B CD  1 
ATOM   3721  O OE1 . GLU B 1 14  ? 6.197   91.074  63.158  1.00 20.00 ? 14   GLU B OE1 1 
ATOM   3722  O OE2 . GLU B 1 14  ? 7.499   92.801  63.535  1.00 20.00 ? 14   GLU B OE2 1 
ATOM   3723  N N   . THR B 1 15  ? 2.522   94.714  66.224  1.00 20.00 ? 15   THR B N   1 
ATOM   3724  C CA  . THR B 1 15  ? 1.930   96.013  65.961  1.00 20.00 ? 15   THR B CA  1 
ATOM   3725  C C   . THR B 1 15  ? 2.655   96.695  64.799  1.00 20.00 ? 15   THR B C   1 
ATOM   3726  O O   . THR B 1 15  ? 3.861   96.506  64.608  1.00 20.00 ? 15   THR B O   1 
ATOM   3727  C CB  . THR B 1 15  ? 2.004   96.908  67.226  1.00 20.00 ? 15   THR B CB  1 
ATOM   3728  O OG1 . THR B 1 15  ? 3.294   96.770  67.839  1.00 20.00 ? 15   THR B OG1 1 
ATOM   3729  C CG2 . THR B 1 15  ? 0.932   96.492  68.237  1.00 20.00 ? 15   THR B CG2 1 
ATOM   3730  N N   . VAL B 1 16  ? 1.911   97.464  64.011  1.00 20.00 ? 16   VAL B N   1 
ATOM   3731  C CA  . VAL B 1 16  ? 2.488   98.170  62.876  1.00 20.00 ? 16   VAL B CA  1 
ATOM   3732  C C   . VAL B 1 16  ? 1.950   99.585  62.843  1.00 20.00 ? 16   VAL B C   1 
ATOM   3733  O O   . VAL B 1 16  ? 0.816   99.838  63.244  1.00 20.00 ? 16   VAL B O   1 
ATOM   3734  C CB  . VAL B 1 16  ? 2.151   97.486  61.527  1.00 20.00 ? 16   VAL B CB  1 
ATOM   3735  C CG1 . VAL B 1 16  ? 2.594   96.042  61.557  1.00 20.00 ? 16   VAL B CG1 1 
ATOM   3736  C CG2 . VAL B 1 16  ? 0.673   97.582  61.242  1.00 20.00 ? 16   VAL B CG2 1 
ATOM   3737  N N   . SER B 1 17  ? 2.772   100.512 62.375  1.00 20.00 ? 17   SER B N   1 
ATOM   3738  C CA  . SER B 1 17  ? 2.354   101.900 62.297  1.00 20.00 ? 17   SER B CA  1 
ATOM   3739  C C   . SER B 1 17  ? 1.841   102.155 60.891  1.00 20.00 ? 17   SER B C   1 
ATOM   3740  O O   . SER B 1 17  ? 2.527   101.864 59.904  1.00 20.00 ? 17   SER B O   1 
ATOM   3741  C CB  . SER B 1 17  ? 3.529   102.829 62.616  1.00 20.00 ? 17   SER B CB  1 
ATOM   3742  O OG  . SER B 1 17  ? 3.589   103.097 64.012  1.00 20.00 ? 17   SER B OG  1 
ATOM   3743  N N   . MET B 1 18  ? 0.624   102.674 60.799  1.00 20.00 ? 18   MET B N   1 
ATOM   3744  C CA  . MET B 1 18  ? 0.040   102.956 59.499  1.00 20.00 ? 18   MET B CA  1 
ATOM   3745  C C   . MET B 1 18  ? 0.303   104.415 59.156  1.00 20.00 ? 18   MET B C   1 
ATOM   3746  O O   . MET B 1 18  ? -0.466  105.293 59.550  1.00 20.00 ? 18   MET B O   1 
ATOM   3747  C CB  . MET B 1 18  ? -1.473  102.684 59.521  1.00 20.00 ? 18   MET B CB  1 
ATOM   3748  C CG  . MET B 1 18  ? -1.914  101.564 60.462  1.00 20.00 ? 18   MET B CG  1 
ATOM   3749  S SD  . MET B 1 18  ? -2.177  99.981  59.638  1.00 20.00 ? 18   MET B SD  1 
ATOM   3750  C CE  . MET B 1 18  ? -3.314  100.430 58.317  1.00 20.00 ? 18   MET B CE  1 
ATOM   3751  N N   . ILE B 1 19  ? 1.390   104.679 58.432  1.00 20.00 ? 19   ILE B N   1 
ATOM   3752  C CA  . ILE B 1 19  ? 1.717   106.050 58.062  1.00 20.00 ? 19   ILE B CA  1 
ATOM   3753  C C   . ILE B 1 19  ? 1.055   106.445 56.752  1.00 20.00 ? 19   ILE B C   1 
ATOM   3754  O O   . ILE B 1 19  ? 0.932   105.633 55.838  1.00 20.00 ? 19   ILE B O   1 
ATOM   3755  C CB  . ILE B 1 19  ? 3.236   106.272 57.952  1.00 20.00 ? 19   ILE B CB  1 
ATOM   3756  C CG1 . ILE B 1 19  ? 3.802   105.461 56.794  1.00 20.00 ? 19   ILE B CG1 1 
ATOM   3757  C CG2 . ILE B 1 19  ? 3.906   105.906 59.266  1.00 20.00 ? 19   ILE B CG2 1 
ATOM   3758  C CD1 . ILE B 1 19  ? 5.272   105.708 56.568  1.00 20.00 ? 19   ILE B CD1 1 
ATOM   3759  N N   . SER B 1 20  ? 0.637   107.707 56.684  1.00 20.00 ? 20   SER B N   1 
ATOM   3760  C CA  . SER B 1 20  ? -0.029  108.271 55.516  1.00 20.00 ? 20   SER B CA  1 
ATOM   3761  C C   . SER B 1 20  ? 0.765   108.136 54.240  1.00 20.00 ? 20   SER B C   1 
ATOM   3762  O O   . SER B 1 20  ? 1.960   107.858 54.264  1.00 20.00 ? 20   SER B O   1 
ATOM   3763  C CB  . SER B 1 20  ? -0.350  109.754 55.753  1.00 20.00 ? 20   SER B CB  1 
ATOM   3764  O OG  . SER B 1 20  ? 0.742   110.588 55.396  1.00 20.00 ? 20   SER B OG  1 
ATOM   3765  N N   . ARG B 1 21  ? 0.081   108.345 53.123  1.00 20.00 ? 21   ARG B N   1 
ATOM   3766  C CA  . ARG B 1 21  ? 0.701   108.255 51.814  1.00 20.00 ? 21   ARG B CA  1 
ATOM   3767  C C   . ARG B 1 21  ? 1.766   109.331 51.669  1.00 20.00 ? 21   ARG B C   1 
ATOM   3768  O O   . ARG B 1 21  ? 2.785   109.122 51.016  1.00 20.00 ? 21   ARG B O   1 
ATOM   3769  C CB  . ARG B 1 21  ? -0.350  108.435 50.722  1.00 20.00 ? 21   ARG B CB  1 
ATOM   3770  C CG  . ARG B 1 21  ? 0.173   108.142 49.341  1.00 20.00 ? 21   ARG B CG  1 
ATOM   3771  C CD  . ARG B 1 21  ? -0.738  108.695 48.273  1.00 20.00 ? 21   ARG B CD  1 
ATOM   3772  N NE  . ARG B 1 21  ? -0.084  109.790 47.575  1.00 20.00 ? 21   ARG B NE  1 
ATOM   3773  C CZ  . ARG B 1 21  ? 0.694   109.650 46.508  1.00 20.00 ? 21   ARG B CZ  1 
ATOM   3774  N NH1 . ARG B 1 21  ? 0.927   108.452 45.994  1.00 20.00 ? 21   ARG B NH1 1 
ATOM   3775  N NH2 . ARG B 1 21  ? 1.256   110.719 45.967  1.00 20.00 ? 21   ARG B NH2 1 
ATOM   3776  N N   . ASP B 1 22  ? 1.520   110.484 52.285  1.00 20.00 ? 22   ASP B N   1 
ATOM   3777  C CA  . ASP B 1 22  ? 2.456   111.604 52.228  1.00 20.00 ? 22   ASP B CA  1 
ATOM   3778  C C   . ASP B 1 22  ? 3.778   111.236 52.893  1.00 20.00 ? 22   ASP B C   1 
ATOM   3779  O O   . ASP B 1 22  ? 4.857   111.523 52.369  1.00 20.00 ? 22   ASP B O   1 
ATOM   3780  C CB  . ASP B 1 22  ? 1.847   112.827 52.921  1.00 20.00 ? 22   ASP B CB  1 
ATOM   3781  C CG  . ASP B 1 22  ? 1.227   113.806 51.937  1.00 20.00 ? 22   ASP B CG  1 
ATOM   3782  O OD1 . ASP B 1 22  ? 0.831   113.381 50.823  1.00 20.00 ? 22   ASP B OD1 1 
ATOM   3783  O OD2 . ASP B 1 22  ? 1.134   115.004 52.282  1.00 20.00 ? 22   ASP B OD2 1 
ATOM   3784  N N   . GLU B 1 23  ? 3.684   110.594 54.052  1.00 20.00 ? 23   GLU B N   1 
ATOM   3785  C CA  . GLU B 1 23  ? 4.870   110.183 54.787  1.00 20.00 ? 23   GLU B CA  1 
ATOM   3786  C C   . GLU B 1 23  ? 5.622   109.095 54.020  1.00 20.00 ? 23   GLU B C   1 
ATOM   3787  O O   . GLU B 1 23  ? 6.852   109.082 53.992  1.00 20.00 ? 23   GLU B O   1 
ATOM   3788  C CB  . GLU B 1 23  ? 4.474   109.652 56.162  1.00 20.00 ? 23   GLU B CB  1 
ATOM   3789  C CG  . GLU B 1 23  ? 3.745   110.654 57.037  1.00 20.00 ? 23   GLU B CG  1 
ATOM   3790  C CD  . GLU B 1 23  ? 3.247   110.030 58.326  1.00 20.00 ? 23   GLU B CD  1 
ATOM   3791  O OE1 . GLU B 1 23  ? 4.093   109.692 59.181  1.00 20.00 ? 23   GLU B OE1 1 
ATOM   3792  O OE2 . GLU B 1 23  ? 2.013   109.875 58.478  1.00 20.00 ? 23   GLU B OE2 1 
ATOM   3793  N N   . ARG B 1 24  ? 4.882   108.182 53.396  1.00 20.00 ? 24   ARG B N   1 
ATOM   3794  C CA  . ARG B 1 24  ? 5.507   107.103 52.639  1.00 20.00 ? 24   ARG B CA  1 
ATOM   3795  C C   . ARG B 1 24  ? 6.280   107.649 51.458  1.00 20.00 ? 24   ARG B C   1 
ATOM   3796  O O   . ARG B 1 24  ? 7.344   107.143 51.117  1.00 20.00 ? 24   ARG B O   1 
ATOM   3797  C CB  . ARG B 1 24  ? 4.456   106.119 52.144  1.00 20.00 ? 24   ARG B CB  1 
ATOM   3798  C CG  . ARG B 1 24  ? 3.817   105.325 53.257  1.00 20.00 ? 24   ARG B CG  1 
ATOM   3799  C CD  . ARG B 1 24  ? 3.009   104.180 52.700  1.00 20.00 ? 24   ARG B CD  1 
ATOM   3800  N NE  . ARG B 1 24  ? 2.110   104.631 51.644  1.00 20.00 ? 24   ARG B NE  1 
ATOM   3801  C CZ  . ARG B 1 24  ? 0.798   104.752 51.798  1.00 20.00 ? 24   ARG B CZ  1 
ATOM   3802  N NH1 . ARG B 1 24  ? 0.235   104.457 52.964  1.00 20.00 ? 24   ARG B NH1 1 
ATOM   3803  N NH2 . ARG B 1 24  ? 0.047   105.157 50.784  1.00 20.00 ? 24   ARG B NH2 1 
ATOM   3804  N N   . VAL B 1 25  ? 5.740   108.683 50.824  1.00 20.00 ? 25   VAL B N   1 
ATOM   3805  C CA  . VAL B 1 25  ? 6.401   109.289 49.674  1.00 20.00 ? 25   VAL B CA  1 
ATOM   3806  C C   . VAL B 1 25  ? 7.700   109.917 50.163  1.00 20.00 ? 25   VAL B C   1 
ATOM   3807  O O   . VAL B 1 25  ? 8.747   109.810 49.516  1.00 20.00 ? 25   VAL B O   1 
ATOM   3808  C CB  . VAL B 1 25  ? 5.515   110.374 49.037  1.00 20.00 ? 25   VAL B CB  1 
ATOM   3809  C CG1 . VAL B 1 25  ? 6.308   111.158 48.004  1.00 20.00 ? 25   VAL B CG1 1 
ATOM   3810  C CG2 . VAL B 1 25  ? 4.296   109.725 48.399  1.00 20.00 ? 25   VAL B CG2 1 
ATOM   3811  N N   . LYS B 1 26  ? 7.615   110.562 51.323  1.00 20.00 ? 26   LYS B N   1 
ATOM   3812  C CA  . LYS B 1 26  ? 8.761   111.214 51.935  1.00 20.00 ? 26   LYS B CA  1 
ATOM   3813  C C   . LYS B 1 26  ? 9.820   110.179 52.309  1.00 20.00 ? 26   LYS B C   1 
ATOM   3814  O O   . LYS B 1 26  ? 11.006  110.374 52.054  1.00 20.00 ? 26   LYS B O   1 
ATOM   3815  C CB  . LYS B 1 26  ? 8.317   111.976 53.188  1.00 20.00 ? 26   LYS B CB  1 
ATOM   3816  C CG  . LYS B 1 26  ? 7.988   113.448 52.940  1.00 20.00 ? 26   LYS B CG  1 
ATOM   3817  C CD  . LYS B 1 26  ? 6.774   113.916 53.734  1.00 20.00 ? 26   LYS B CD  1 
ATOM   3818  C CE  . LYS B 1 26  ? 7.021   113.909 55.240  1.00 20.00 ? 26   LYS B CE  1 
ATOM   3819  N NZ  . LYS B 1 26  ? 5.847   114.467 55.973  1.00 20.00 ? 26   LYS B NZ  1 
ATOM   3820  N N   . LYS B 1 27  ? 9.387   109.075 52.908  1.00 20.00 ? 27   LYS B N   1 
ATOM   3821  C CA  . LYS B 1 27  ? 10.309  108.015 53.311  1.00 20.00 ? 27   LYS B CA  1 
ATOM   3822  C C   . LYS B 1 27  ? 10.986  107.351 52.120  1.00 20.00 ? 27   LYS B C   1 
ATOM   3823  O O   . LYS B 1 27  ? 12.177  107.052 52.164  1.00 20.00 ? 27   LYS B O   1 
ATOM   3824  C CB  . LYS B 1 27  ? 9.570   106.959 54.121  1.00 20.00 ? 27   LYS B CB  1 
ATOM   3825  C CG  . LYS B 1 27  ? 9.809   107.068 55.610  1.00 20.00 ? 27   LYS B CG  1 
ATOM   3826  C CD  . LYS B 1 27  ? 8.596   107.630 56.332  1.00 20.00 ? 27   LYS B CD  1 
ATOM   3827  C CE  . LYS B 1 27  ? 8.864   107.784 57.830  1.00 20.00 ? 27   LYS B CE  1 
ATOM   3828  N NZ  . LYS B 1 27  ? 10.324  107.822 58.151  1.00 20.00 ? 27   LYS B NZ  1 
ATOM   3829  N N   . MET B 1 28  ? 10.222  107.115 51.058  1.00 20.00 ? 28   MET B N   1 
ATOM   3830  C CA  . MET B 1 28  ? 10.758  106.482 49.854  1.00 20.00 ? 28   MET B CA  1 
ATOM   3831  C C   . MET B 1 28  ? 11.816  107.385 49.232  1.00 20.00 ? 28   MET B C   1 
ATOM   3832  O O   . MET B 1 28  ? 12.826  106.912 48.708  1.00 20.00 ? 28   MET B O   1 
ATOM   3833  C CB  . MET B 1 28  ? 9.632   106.215 48.843  1.00 20.00 ? 28   MET B CB  1 
ATOM   3834  C CG  . MET B 1 28  ? 10.059  105.388 47.629  1.00 20.00 ? 28   MET B CG  1 
ATOM   3835  S SD  . MET B 1 28  ? 10.812  103.784 48.029  1.00 20.00 ? 28   MET B SD  1 
ATOM   3836  C CE  . MET B 1 28  ? 9.427   102.740 47.877  1.00 20.00 ? 28   MET B CE  1 
ATOM   3837  N N   . GLN B 1 29  ? 11.567  108.690 49.288  1.00 20.00 ? 29   GLN B N   1 
ATOM   3838  C CA  . GLN B 1 29  ? 12.487  109.677 48.743  1.00 20.00 ? 29   GLN B CA  1 
ATOM   3839  C C   . GLN B 1 29  ? 13.822  109.500 49.458  1.00 20.00 ? 29   GLN B C   1 
ATOM   3840  O O   . GLN B 1 29  ? 14.867  109.279 48.834  1.00 20.00 ? 29   GLN B O   1 
ATOM   3841  C CB  . GLN B 1 29  ? 11.978  111.090 49.036  1.00 20.00 ? 29   GLN B CB  1 
ATOM   3842  C CG  . GLN B 1 29  ? 11.055  111.702 48.009  1.00 20.00 ? 29   GLN B CG  1 
ATOM   3843  C CD  . GLN B 1 29  ? 10.889  113.192 48.241  1.00 20.00 ? 29   GLN B CD  1 
ATOM   3844  O OE1 . GLN B 1 29  ? 9.933   113.636 48.886  1.00 20.00 ? 29   GLN B OE1 1 
ATOM   3845  N NE2 . GLN B 1 29  ? 11.833  113.976 47.725  1.00 20.00 ? 29   GLN B NE2 1 
ATOM   3846  N N   . GLU B 1 30  ? 13.762  109.605 50.785  1.00 20.00 ? 30   GLU B N   1 
ATOM   3847  C CA  . GLU B 1 30  ? 14.931  109.473 51.647  1.00 20.00 ? 30   GLU B CA  1 
ATOM   3848  C C   . GLU B 1 30  ? 15.668  108.161 51.439  1.00 20.00 ? 30   GLU B C   1 
ATOM   3849  O O   . GLU B 1 30  ? 16.872  108.078 51.656  1.00 20.00 ? 30   GLU B O   1 
ATOM   3850  C CB  . GLU B 1 30  ? 14.508  109.601 53.115  1.00 20.00 ? 30   GLU B CB  1 
ATOM   3851  C CG  . GLU B 1 30  ? 13.593  110.800 53.396  1.00 20.00 ? 30   GLU B CG  1 
ATOM   3852  C CD  . GLU B 1 30  ? 13.288  110.990 54.878  1.00 20.00 ? 30   GLU B CD  1 
ATOM   3853  O OE1 . GLU B 1 30  ? 13.053  109.980 55.583  1.00 20.00 ? 30   GLU B OE1 1 
ATOM   3854  O OE2 . GLU B 1 30  ? 13.280  112.156 55.334  1.00 20.00 ? 30   GLU B OE2 1 
ATOM   3855  N N   . ALA B 1 31  ? 14.936  107.135 51.021  1.00 20.00 ? 31   ALA B N   1 
ATOM   3856  C CA  . ALA B 1 31  ? 15.517  105.821 50.784  1.00 20.00 ? 31   ALA B CA  1 
ATOM   3857  C C   . ALA B 1 31  ? 16.128  105.721 49.387  1.00 20.00 ? 31   ALA B C   1 
ATOM   3858  O O   . ALA B 1 31  ? 16.633  104.670 48.995  1.00 20.00 ? 31   ALA B O   1 
ATOM   3859  C CB  . ALA B 1 31  ? 14.450  104.749 50.969  1.00 20.00 ? 31   ALA B CB  1 
ATOM   3860  N N   . GLY B 1 32  ? 16.077  106.818 48.635  1.00 20.00 ? 32   GLY B N   1 
ATOM   3861  C CA  . GLY B 1 32  ? 16.637  106.813 47.293  1.00 20.00 ? 32   GLY B CA  1 
ATOM   3862  C C   . GLY B 1 32  ? 15.830  105.964 46.334  1.00 20.00 ? 32   GLY B C   1 
ATOM   3863  O O   . GLY B 1 32  ? 16.372  105.388 45.384  1.00 20.00 ? 32   GLY B O   1 
ATOM   3864  N N   . TYR B 1 33  ? 14.529  105.884 46.594  1.00 20.00 ? 33   TYR B N   1 
ATOM   3865  C CA  . TYR B 1 33  ? 13.617  105.109 45.766  1.00 20.00 ? 33   TYR B CA  1 
ATOM   3866  C C   . TYR B 1 33  ? 14.032  103.639 45.643  1.00 20.00 ? 33   TYR B C   1 
ATOM   3867  O O   . TYR B 1 33  ? 13.683  102.962 44.679  1.00 20.00 ? 33   TYR B O   1 
ATOM   3868  C CB  . TYR B 1 33  ? 13.483  105.772 44.382  1.00 20.00 ? 33   TYR B CB  1 
ATOM   3869  C CG  . TYR B 1 33  ? 12.809  107.136 44.446  1.00 20.00 ? 33   TYR B CG  1 
ATOM   3870  C CD1 . TYR B 1 33  ? 11.463  107.253 44.793  1.00 20.00 ? 33   TYR B CD1 1 
ATOM   3871  C CD2 . TYR B 1 33  ? 13.529  108.309 44.210  1.00 20.00 ? 33   TYR B CD2 1 
ATOM   3872  C CE1 . TYR B 1 33  ? 10.847  108.504 44.909  1.00 20.00 ? 33   TYR B CE1 1 
ATOM   3873  C CE2 . TYR B 1 33  ? 12.924  109.568 44.325  1.00 20.00 ? 33   TYR B CE2 1 
ATOM   3874  C CZ  . TYR B 1 33  ? 11.583  109.659 44.676  1.00 20.00 ? 33   TYR B CZ  1 
ATOM   3875  O OH  . TYR B 1 33  ? 10.979  110.900 44.802  1.00 20.00 ? 33   TYR B OH  1 
ATOM   3876  N N   . ASN B 1 34  ? 14.763  103.153 46.645  1.00 20.00 ? 34   ASN B N   1 
ATOM   3877  C CA  . ASN B 1 34  ? 15.240  101.765 46.695  1.00 20.00 ? 34   ASN B CA  1 
ATOM   3878  C C   . ASN B 1 34  ? 14.590  101.082 47.905  1.00 20.00 ? 34   ASN B C   1 
ATOM   3879  O O   . ASN B 1 34  ? 14.889  101.423 49.049  1.00 20.00 ? 34   ASN B O   1 
ATOM   3880  C CB  . ASN B 1 34  ? 16.761  101.742 46.848  1.00 20.00 ? 34   ASN B CB  1 
ATOM   3881  C CG  . ASN B 1 34  ? 17.335  100.342 46.782  1.00 20.00 ? 34   ASN B CG  1 
ATOM   3882  O OD1 . ASN B 1 34  ? 16.646  99.360  47.045  1.00 20.00 ? 34   ASN B OD1 1 
ATOM   3883  N ND2 . ASN B 1 34  ? 18.608  100.245 46.430  1.00 20.00 ? 34   ASN B ND2 1 
ATOM   3884  N N   . THR B 1 35  ? 13.715  100.112 47.656  1.00 20.00 ? 35   THR B N   1 
ATOM   3885  C CA  . THR B 1 35  ? 13.034  99.408  48.743  1.00 20.00 ? 35   THR B CA  1 
ATOM   3886  C C   . THR B 1 35  ? 13.946  98.717  49.742  1.00 20.00 ? 35   THR B C   1 
ATOM   3887  O O   . THR B 1 35  ? 13.527  98.428  50.857  1.00 20.00 ? 35   THR B O   1 
ATOM   3888  C CB  . THR B 1 35  ? 12.031  98.351  48.213  1.00 20.00 ? 35   THR B CB  1 
ATOM   3889  O OG1 . THR B 1 35  ? 12.702  97.446  47.328  1.00 20.00 ? 35   THR B OG1 1 
ATOM   3890  C CG2 . THR B 1 35  ? 10.884  99.021  47.483  1.00 20.00 ? 35   THR B CG2 1 
ATOM   3891  N N   . PHE B 1 36  ? 15.185  98.444  49.344  1.00 20.00 ? 36   PHE B N   1 
ATOM   3892  C CA  . PHE B 1 36  ? 16.142  97.781  50.224  1.00 20.00 ? 36   PHE B CA  1 
ATOM   3893  C C   . PHE B 1 36  ? 16.709  98.704  51.282  1.00 20.00 ? 36   PHE B C   1 
ATOM   3894  O O   . PHE B 1 36  ? 17.413  98.253  52.179  1.00 20.00 ? 36   PHE B O   1 
ATOM   3895  C CB  . PHE B 1 36  ? 17.300  97.224  49.416  1.00 20.00 ? 36   PHE B CB  1 
ATOM   3896  C CG  . PHE B 1 36  ? 17.360  95.737  49.403  1.00 20.00 ? 36   PHE B CG  1 
ATOM   3897  C CD1 . PHE B 1 36  ? 17.655  95.032  50.564  1.00 20.00 ? 36   PHE B CD1 1 
ATOM   3898  C CD2 . PHE B 1 36  ? 17.117  95.033  48.231  1.00 20.00 ? 36   PHE B CD2 1 
ATOM   3899  C CE1 . PHE B 1 36  ? 17.708  93.650  50.561  1.00 20.00 ? 36   PHE B CE1 1 
ATOM   3900  C CE2 . PHE B 1 36  ? 17.167  93.647  48.212  1.00 20.00 ? 36   PHE B CE2 1 
ATOM   3901  C CZ  . PHE B 1 36  ? 17.463  92.951  49.381  1.00 20.00 ? 36   PHE B CZ  1 
ATOM   3902  N N   . LEU B 1 37  ? 16.399  99.992  51.166  1.00 20.00 ? 37   LEU B N   1 
ATOM   3903  C CA  . LEU B 1 37  ? 16.870  101.003 52.099  1.00 20.00 ? 37   LEU B CA  1 
ATOM   3904  C C   . LEU B 1 37  ? 15.786  101.490 53.052  1.00 20.00 ? 37   LEU B C   1 
ATOM   3905  O O   . LEU B 1 37  ? 16.051  102.339 53.903  1.00 20.00 ? 37   LEU B O   1 
ATOM   3906  C CB  . LEU B 1 37  ? 17.432  102.200 51.322  1.00 20.00 ? 37   LEU B CB  1 
ATOM   3907  C CG  . LEU B 1 37  ? 18.934  102.258 51.018  1.00 20.00 ? 37   LEU B CG  1 
ATOM   3908  C CD1 . LEU B 1 37  ? 19.475  100.855 50.823  1.00 20.00 ? 37   LEU B CD1 1 
ATOM   3909  C CD2 . LEU B 1 37  ? 19.188  103.109 49.776  1.00 20.00 ? 37   LEU B CD2 1 
ATOM   3910  N N   . LEU B 1 38  ? 14.570  100.969 52.914  1.00 20.00 ? 38   LEU B N   1 
ATOM   3911  C CA  . LEU B 1 38  ? 13.473  101.381 53.788  1.00 20.00 ? 38   LEU B CA  1 
ATOM   3912  C C   . LEU B 1 38  ? 13.602  100.732 55.161  1.00 20.00 ? 38   LEU B C   1 
ATOM   3913  O O   . LEU B 1 38  ? 14.123  99.622  55.286  1.00 20.00 ? 38   LEU B O   1 
ATOM   3914  C CB  . LEU B 1 38  ? 12.121  100.988 53.187  1.00 20.00 ? 38   LEU B CB  1 
ATOM   3915  C CG  . LEU B 1 38  ? 11.604  101.730 51.952  1.00 20.00 ? 38   LEU B CG  1 
ATOM   3916  C CD1 . LEU B 1 38  ? 10.345  101.041 51.466  1.00 20.00 ? 38   LEU B CD1 1 
ATOM   3917  C CD2 . LEU B 1 38  ? 11.322  103.178 52.282  1.00 20.00 ? 38   LEU B CD2 1 
ATOM   3918  N N   . ASN B 1 39  ? 13.132  101.430 56.189  1.00 20.00 ? 39   ASN B N   1 
ATOM   3919  C CA  . ASN B 1 39  ? 13.197  100.902 57.543  1.00 20.00 ? 39   ASN B CA  1 
ATOM   3920  C C   . ASN B 1 39  ? 12.003  99.976  57.718  1.00 20.00 ? 39   ASN B C   1 
ATOM   3921  O O   . ASN B 1 39  ? 10.896  100.293 57.291  1.00 20.00 ? 39   ASN B O   1 
ATOM   3922  C CB  . ASN B 1 39  ? 13.114  102.026 58.570  1.00 20.00 ? 39   ASN B CB  1 
ATOM   3923  C CG  . ASN B 1 39  ? 14.292  102.948 58.505  1.00 20.00 ? 39   ASN B CG  1 
ATOM   3924  O OD1 . ASN B 1 39  ? 15.346  102.586 57.986  1.00 20.00 ? 39   ASN B OD1 1 
ATOM   3925  N ND2 . ASN B 1 39  ? 14.130  104.153 59.030  1.00 20.00 ? 39   ASN B ND2 1 
ATOM   3926  N N   . SER B 1 40  ? 12.235  98.834  58.345  1.00 20.00 ? 40   SER B N   1 
ATOM   3927  C CA  . SER B 1 40  ? 11.172  97.879  58.567  1.00 20.00 ? 40   SER B CA  1 
ATOM   3928  C C   . SER B 1 40  ? 9.976   98.548  59.232  1.00 20.00 ? 40   SER B C   1 
ATOM   3929  O O   . SER B 1 40  ? 8.829   98.273  58.890  1.00 20.00 ? 40   SER B O   1 
ATOM   3930  C CB  . SER B 1 40  ? 11.678  96.740  59.444  1.00 20.00 ? 40   SER B CB  1 
ATOM   3931  O OG  . SER B 1 40  ? 10.659  95.796  59.669  1.00 20.00 ? 40   SER B OG  1 
ATOM   3932  N N   . LYS B 1 41  ? 10.246  99.443  60.170  1.00 20.00 ? 41   LYS B N   1 
ATOM   3933  C CA  . LYS B 1 41  ? 9.180   100.144 60.884  1.00 20.00 ? 41   LYS B CA  1 
ATOM   3934  C C   . LYS B 1 41  ? 8.289   101.021 60.009  1.00 20.00 ? 41   LYS B C   1 
ATOM   3935  O O   . LYS B 1 41  ? 7.176   101.366 60.403  1.00 20.00 ? 41   LYS B O   1 
ATOM   3936  C CB  . LYS B 1 41  ? 9.778   100.999 62.005  1.00 20.00 ? 41   LYS B CB  1 
ATOM   3937  C CG  . LYS B 1 41  ? 10.787  102.031 61.522  1.00 20.00 ? 41   LYS B CG  1 
ATOM   3938  C CD  . LYS B 1 41  ? 11.307  102.887 62.678  1.00 20.00 ? 41   LYS B CD  1 
ATOM   3939  C CE  . LYS B 1 41  ? 11.208  104.372 62.360  1.00 20.00 ? 41   LYS B CE  1 
ATOM   3940  N NZ  . LYS B 1 41  ? 9.822   104.878 62.557  1.00 20.00 ? 41   LYS B NZ  1 
ATOM   3941  N N   . ASP B 1 42  ? 8.773   101.375 58.825  1.00 20.00 ? 42   ASP B N   1 
ATOM   3942  C CA  . ASP B 1 42  ? 8.009   102.217 57.909  1.00 20.00 ? 42   ASP B CA  1 
ATOM   3943  C C   . ASP B 1 42  ? 7.236   101.413 56.868  1.00 20.00 ? 42   ASP B C   1 
ATOM   3944  O O   . ASP B 1 42  ? 6.702   101.971 55.903  1.00 20.00 ? 42   ASP B O   1 
ATOM   3945  C CB  . ASP B 1 42  ? 8.953   103.189 57.203  1.00 20.00 ? 42   ASP B CB  1 
ATOM   3946  C CG  . ASP B 1 42  ? 9.638   104.126 58.168  1.00 20.00 ? 42   ASP B CG  1 
ATOM   3947  O OD1 . ASP B 1 42  ? 9.007   104.475 59.186  1.00 20.00 ? 42   ASP B OD1 1 
ATOM   3948  O OD2 . ASP B 1 42  ? 10.801  104.514 57.917  1.00 20.00 ? 42   ASP B OD2 1 
ATOM   3949  N N   . ILE B 1 43  ? 7.158   100.105 57.083  1.00 20.00 ? 43   ILE B N   1 
ATOM   3950  C CA  . ILE B 1 43  ? 6.463   99.216  56.171  1.00 20.00 ? 43   ILE B CA  1 
ATOM   3951  C C   . ILE B 1 43  ? 5.274   98.486  56.811  1.00 20.00 ? 43   ILE B C   1 
ATOM   3952  O O   . ILE B 1 43  ? 5.385   97.907  57.889  1.00 20.00 ? 43   ILE B O   1 
ATOM   3953  C CB  . ILE B 1 43  ? 7.483   98.196  55.591  1.00 20.00 ? 43   ILE B CB  1 
ATOM   3954  C CG1 . ILE B 1 43  ? 8.627   98.960  54.932  1.00 20.00 ? 43   ILE B CG1 1 
ATOM   3955  C CG2 . ILE B 1 43  ? 6.825   97.269  54.584  1.00 20.00 ? 43   ILE B CG2 1 
ATOM   3956  C CD1 . ILE B 1 43  ? 9.799   98.102  54.600  1.00 20.00 ? 43   ILE B CD1 1 
ATOM   3957  N N   . TYR B 1 44  ? 4.130   98.530  56.132  1.00 20.00 ? 44   TYR B N   1 
ATOM   3958  C CA  . TYR B 1 44  ? 2.910   97.882  56.604  1.00 20.00 ? 44   TYR B CA  1 
ATOM   3959  C C   . TYR B 1 44  ? 3.004   96.392  56.326  1.00 20.00 ? 44   TYR B C   1 
ATOM   3960  O O   . TYR B 1 44  ? 2.957   95.584  57.244  1.00 20.00 ? 44   TYR B O   1 
ATOM   3961  C CB  . TYR B 1 44  ? 1.713   98.466  55.866  1.00 20.00 ? 44   TYR B CB  1 
ATOM   3962  C CG  . TYR B 1 44  ? 0.376   97.833  56.183  1.00 20.00 ? 44   TYR B CG  1 
ATOM   3963  C CD1 . TYR B 1 44  ? 0.143   97.193  57.396  1.00 20.00 ? 44   TYR B CD1 1 
ATOM   3964  C CD2 . TYR B 1 44  ? -0.674  97.922  55.283  1.00 20.00 ? 44   TYR B CD2 1 
ATOM   3965  C CE1 . TYR B 1 44  ? -1.109  96.665  57.697  1.00 20.00 ? 44   TYR B CE1 1 
ATOM   3966  C CE2 . TYR B 1 44  ? -1.921  97.401  55.575  1.00 20.00 ? 44   TYR B CE2 1 
ATOM   3967  C CZ  . TYR B 1 44  ? -2.135  96.777  56.782  1.00 20.00 ? 44   TYR B CZ  1 
ATOM   3968  O OH  . TYR B 1 44  ? -3.384  96.286  57.069  1.00 20.00 ? 44   TYR B OH  1 
ATOM   3969  N N   . ILE B 1 45  ? 3.128   96.043  55.047  1.00 20.00 ? 45   ILE B N   1 
ATOM   3970  C CA  . ILE B 1 45  ? 3.236   94.653  54.613  1.00 20.00 ? 45   ILE B CA  1 
ATOM   3971  C C   . ILE B 1 45  ? 4.590   94.495  53.906  1.00 20.00 ? 45   ILE B C   1 
ATOM   3972  O O   . ILE B 1 45  ? 4.836   95.118  52.874  1.00 20.00 ? 45   ILE B O   1 
ATOM   3973  C CB  . ILE B 1 45  ? 2.057   94.289  53.675  1.00 20.00 ? 45   ILE B CB  1 
ATOM   3974  C CG1 . ILE B 1 45  ? 0.739   94.382  54.452  1.00 20.00 ? 45   ILE B CG1 1 
ATOM   3975  C CG2 . ILE B 1 45  ? 2.204   92.873  53.156  1.00 20.00 ? 45   ILE B CG2 1 
ATOM   3976  C CD1 . ILE B 1 45  ? -0.456  94.754  53.606  1.00 20.00 ? 45   ILE B CD1 1 
ATOM   3977  N N   . ASP B 1 46  ? 5.463   93.671  54.490  1.00 20.00 ? 46   ASP B N   1 
ATOM   3978  C CA  . ASP B 1 46  ? 6.813   93.406  53.967  1.00 20.00 ? 46   ASP B CA  1 
ATOM   3979  C C   . ASP B 1 46  ? 6.926   92.112  53.177  1.00 20.00 ? 46   ASP B C   1 
ATOM   3980  O O   . ASP B 1 46  ? 7.066   91.034  53.751  1.00 20.00 ? 46   ASP B O   1 
ATOM   3981  C CB  . ASP B 1 46  ? 7.815   93.363  55.132  1.00 20.00 ? 46   ASP B CB  1 
ATOM   3982  C CG  . ASP B 1 46  ? 9.243   93.696  54.707  1.00 20.00 ? 46   ASP B CG  1 
ATOM   3983  O OD1 . ASP B 1 46  ? 9.492   93.857  53.489  1.00 20.00 ? 46   ASP B OD1 1 
ATOM   3984  O OD2 . ASP B 1 46  ? 10.118  93.793  55.603  1.00 20.00 ? 46   ASP B OD2 1 
ATOM   3985  N N   . LEU B 1 47  ? 6.876   92.223  51.855  1.00 20.00 ? 47   LEU B N   1 
ATOM   3986  C CA  . LEU B 1 47  ? 6.975   91.054  50.992  1.00 20.00 ? 47   LEU B CA  1 
ATOM   3987  C C   . LEU B 1 47  ? 8.348   90.975  50.340  1.00 20.00 ? 47   LEU B C   1 
ATOM   3988  O O   . LEU B 1 47  ? 8.498   90.413  49.256  1.00 20.00 ? 47   LEU B O   1 
ATOM   3989  C CB  . LEU B 1 47  ? 5.889   91.110  49.920  1.00 20.00 ? 47   LEU B CB  1 
ATOM   3990  C CG  . LEU B 1 47  ? 4.497   91.343  50.504  1.00 20.00 ? 47   LEU B CG  1 
ATOM   3991  C CD1 . LEU B 1 47  ? 3.465   91.347  49.397  1.00 20.00 ? 47   LEU B CD1 1 
ATOM   3992  C CD2 . LEU B 1 47  ? 4.193   90.241  51.510  1.00 20.00 ? 47   LEU B CD2 1 
ATOM   3993  N N   . LEU B 1 48  ? 9.345   91.543  51.012  1.00 20.00 ? 48   LEU B N   1 
ATOM   3994  C CA  . LEU B 1 48  ? 10.714  91.539  50.509  1.00 20.00 ? 48   LEU B CA  1 
ATOM   3995  C C   . LEU B 1 48  ? 11.205  90.109  50.347  1.00 20.00 ? 48   LEU B C   1 
ATOM   3996  O O   . LEU B 1 48  ? 11.814  89.771  49.337  1.00 20.00 ? 48   LEU B O   1 
ATOM   3997  C CB  . LEU B 1 48  ? 11.639  92.266  51.485  1.00 20.00 ? 48   LEU B CB  1 
ATOM   3998  C CG  . LEU B 1 48  ? 12.803  93.139  51.008  1.00 20.00 ? 48   LEU B CG  1 
ATOM   3999  C CD1 . LEU B 1 48  ? 14.068  92.616  51.645  1.00 20.00 ? 48   LEU B CD1 1 
ATOM   4000  C CD2 . LEU B 1 48  ? 12.925  93.151  49.496  1.00 20.00 ? 48   LEU B CD2 1 
ATOM   4001  N N   . THR B 1 49  ? 10.934  89.268  51.339  1.00 20.00 ? 49   THR B N   1 
ATOM   4002  C CA  . THR B 1 49  ? 11.370  87.875  51.284  1.00 20.00 ? 49   THR B CA  1 
ATOM   4003  C C   . THR B 1 49  ? 10.594  86.945  52.207  1.00 20.00 ? 49   THR B C   1 
ATOM   4004  O O   . THR B 1 49  ? 9.913   87.386  53.127  1.00 20.00 ? 49   THR B O   1 
ATOM   4005  C CB  . THR B 1 49  ? 12.856  87.780  51.658  1.00 20.00 ? 49   THR B CB  1 
ATOM   4006  O OG1 . THR B 1 49  ? 13.278  86.411  51.641  1.00 20.00 ? 49   THR B OG1 1 
ATOM   4007  C CG2 . THR B 1 49  ? 13.078  88.355  53.028  1.00 20.00 ? 49   THR B CG2 1 
ATOM   4008  N N   . ASP B 1 50  ? 10.699  85.646  51.950  1.00 20.00 ? 50   ASP B N   1 
ATOM   4009  C CA  . ASP B 1 50  ? 10.015  84.640  52.763  1.00 20.00 ? 50   ASP B CA  1 
ATOM   4010  C C   . ASP B 1 50  ? 11.072  83.953  53.630  1.00 20.00 ? 50   ASP B C   1 
ATOM   4011  O O   . ASP B 1 50  ? 10.807  82.928  54.249  1.00 20.00 ? 50   ASP B O   1 
ATOM   4012  C CB  . ASP B 1 50  ? 9.331   83.587  51.878  1.00 20.00 ? 50   ASP B CB  1 
ATOM   4013  C CG  . ASP B 1 50  ? 10.327  82.738  51.113  1.00 20.00 ? 50   ASP B CG  1 
ATOM   4014  O OD1 . ASP B 1 50  ? 11.319  83.309  50.622  1.00 20.00 ? 50   ASP B OD1 1 
ATOM   4015  O OD2 . ASP B 1 50  ? 10.129  81.506  51.001  1.00 20.00 ? 50   ASP B OD2 1 
ATOM   4016  N N   . SER B 1 51  ? 12.269  84.530  53.672  1.00 20.00 ? 51   SER B N   1 
ATOM   4017  C CA  . SER B 1 51  ? 13.350  83.959  54.457  1.00 20.00 ? 51   SER B CA  1 
ATOM   4018  C C   . SER B 1 51  ? 13.493  84.510  55.862  1.00 20.00 ? 51   SER B C   1 
ATOM   4019  O O   . SER B 1 51  ? 13.822  85.680  56.055  1.00 20.00 ? 51   SER B O   1 
ATOM   4020  C CB  . SER B 1 51  ? 14.680  84.130  53.722  1.00 20.00 ? 51   SER B CB  1 
ATOM   4021  O OG  . SER B 1 51  ? 15.714  83.402  54.366  1.00 20.00 ? 51   SER B OG  1 
ATOM   4022  N N   . GLY B 1 52  ? 13.258  83.640  56.840  1.00 20.00 ? 52   GLY B N   1 
ATOM   4023  C CA  . GLY B 1 52  ? 13.363  84.017  58.237  1.00 20.00 ? 52   GLY B CA  1 
ATOM   4024  C C   . GLY B 1 52  ? 12.358  85.031  58.731  1.00 20.00 ? 52   GLY B C   1 
ATOM   4025  O O   . GLY B 1 52  ? 12.493  85.548  59.833  1.00 20.00 ? 52   GLY B O   1 
ATOM   4026  N N   . THR B 1 53  ? 11.338  85.306  57.927  1.00 20.00 ? 53   THR B N   1 
ATOM   4027  C CA  . THR B 1 53  ? 10.310  86.271  58.299  1.00 20.00 ? 53   THR B CA  1 
ATOM   4028  C C   . THR B 1 53  ? 9.019   85.573  58.759  1.00 20.00 ? 53   THR B C   1 
ATOM   4029  O O   . THR B 1 53  ? 7.994   86.221  58.973  1.00 20.00 ? 53   THR B O   1 
ATOM   4030  C CB  . THR B 1 53  ? 9.985   87.199  57.099  1.00 20.00 ? 53   THR B CB  1 
ATOM   4031  O OG1 . THR B 1 53  ? 9.898   86.417  55.901  1.00 20.00 ? 53   THR B OG1 1 
ATOM   4032  C CG2 . THR B 1 53  ? 11.081  88.246  56.909  1.00 20.00 ? 53   THR B CG2 1 
ATOM   4033  N N   . ASN B 1 54  ? 9.086   84.254  58.916  1.00 20.00 ? 54   ASN B N   1 
ATOM   4034  C CA  . ASN B 1 54  ? 7.950   83.444  59.341  1.00 20.00 ? 54   ASN B CA  1 
ATOM   4035  C C   . ASN B 1 54  ? 7.499   83.664  60.768  1.00 20.00 ? 54   ASN B C   1 
ATOM   4036  O O   . ASN B 1 54  ? 8.268   84.083  61.616  1.00 20.00 ? 54   ASN B O   1 
ATOM   4037  C CB  . ASN B 1 54  ? 8.277   81.963  59.182  1.00 20.00 ? 54   ASN B CB  1 
ATOM   4038  C CG  . ASN B 1 54  ? 9.022   81.677  57.922  1.00 20.00 ? 54   ASN B CG  1 
ATOM   4039  O OD1 . ASN B 1 54  ? 8.500   81.883  56.822  1.00 20.00 ? 54   ASN B OD1 1 
ATOM   4040  N ND2 . ASN B 1 54  ? 10.258  81.203  58.058  1.00 20.00 ? 54   ASN B ND2 1 
ATOM   4041  N N   . ALA B 1 55  ? 6.234   83.353  61.024  1.00 20.00 ? 55   ALA B N   1 
ATOM   4042  C CA  . ALA B 1 55  ? 5.655   83.500  62.350  1.00 20.00 ? 55   ALA B CA  1 
ATOM   4043  C C   . ALA B 1 55  ? 5.708   82.121  63.004  1.00 20.00 ? 55   ALA B C   1 
ATOM   4044  O O   . ALA B 1 55  ? 5.291   81.124  62.399  1.00 20.00 ? 55   ALA B O   1 
ATOM   4045  C CB  . ALA B 1 55  ? 4.215   83.977  62.246  1.00 20.00 ? 55   ALA B CB  1 
ATOM   4046  N N   . MET B 1 56  ? 6.230   82.071  64.230  1.00 20.00 ? 56   MET B N   1 
ATOM   4047  C CA  . MET B 1 56  ? 6.343   80.824  64.973  1.00 20.00 ? 56   MET B CA  1 
ATOM   4048  C C   . MET B 1 56  ? 5.074   80.510  65.766  1.00 20.00 ? 56   MET B C   1 
ATOM   4049  O O   . MET B 1 56  ? 4.218   81.373  65.955  1.00 20.00 ? 56   MET B O   1 
ATOM   4050  C CB  . MET B 1 56  ? 7.548   80.889  65.914  1.00 20.00 ? 56   MET B CB  1 
ATOM   4051  C CG  . MET B 1 56  ? 8.867   80.938  65.174  1.00 20.00 ? 56   MET B CG  1 
ATOM   4052  S SD  . MET B 1 56  ? 10.246  80.413  66.177  1.00 20.00 ? 56   MET B SD  1 
ATOM   4053  C CE  . MET B 1 56  ? 10.398  81.819  67.244  1.00 20.00 ? 56   MET B CE  1 
ATOM   4054  N N   . SER B 1 57  ? 4.964   79.266  66.226  1.00 20.00 ? 57   SER B N   1 
ATOM   4055  C CA  . SER B 1 57  ? 3.806   78.832  66.995  1.00 20.00 ? 57   SER B CA  1 
ATOM   4056  C C   . SER B 1 57  ? 4.057   78.948  68.484  1.00 20.00 ? 57   SER B C   1 
ATOM   4057  O O   . SER B 1 57  ? 5.187   79.156  68.922  1.00 20.00 ? 57   SER B O   1 
ATOM   4058  C CB  . SER B 1 57  ? 3.483   77.378  66.681  1.00 20.00 ? 57   SER B CB  1 
ATOM   4059  O OG  . SER B 1 57  ? 4.453   76.525  67.259  1.00 20.00 ? 57   SER B OG  1 
ATOM   4060  N N   . ASP B 1 58  ? 2.992   78.799  69.260  1.00 20.00 ? 58   ASP B N   1 
ATOM   4061  C CA  . ASP B 1 58  ? 3.101   78.876  70.703  1.00 20.00 ? 58   ASP B CA  1 
ATOM   4062  C C   . ASP B 1 58  ? 3.962   77.705  71.183  1.00 20.00 ? 58   ASP B C   1 
ATOM   4063  O O   . ASP B 1 58  ? 4.668   77.808  72.181  1.00 20.00 ? 58   ASP B O   1 
ATOM   4064  C CB  . ASP B 1 58  ? 1.704   78.822  71.344  1.00 20.00 ? 58   ASP B CB  1 
ATOM   4065  C CG  . ASP B 1 58  ? 0.867   77.651  70.844  1.00 20.00 ? 58   ASP B CG  1 
ATOM   4066  O OD1 . ASP B 1 58  ? 1.123   77.145  69.735  1.00 20.00 ? 58   ASP B OD1 1 
ATOM   4067  O OD2 . ASP B 1 58  ? -0.060  77.228  71.566  1.00 20.00 ? 58   ASP B OD2 1 
ATOM   4068  N N   . LYS B 1 59  ? 3.906   76.589  70.466  1.00 20.00 ? 59   LYS B N   1 
ATOM   4069  C CA  . LYS B 1 59  ? 4.688   75.416  70.834  1.00 20.00 ? 59   LYS B CA  1 
ATOM   4070  C C   . LYS B 1 59  ? 6.167   75.682  70.557  1.00 20.00 ? 59   LYS B C   1 
ATOM   4071  O O   . LYS B 1 59  ? 7.048   75.226  71.293  1.00 20.00 ? 59   LYS B O   1 
ATOM   4072  C CB  . LYS B 1 59  ? 4.229   74.197  70.037  1.00 20.00 ? 59   LYS B CB  1 
ATOM   4073  C CG  . LYS B 1 59  ? 2.751   73.902  70.160  1.00 20.00 ? 59   LYS B CG  1 
ATOM   4074  C CD  . LYS B 1 59  ? 2.429   73.252  71.495  1.00 20.00 ? 59   LYS B CD  1 
ATOM   4075  C CE  . LYS B 1 59  ? 0.965   72.800  71.552  1.00 20.00 ? 59   LYS B CE  1 
ATOM   4076  N NZ  . LYS B 1 59  ? 0.015   73.925  71.850  1.00 20.00 ? 59   LYS B NZ  1 
ATOM   4077  N N   . GLN B 1 60  ? 6.439   76.416  69.483  1.00 20.00 ? 60   GLN B N   1 
ATOM   4078  C CA  . GLN B 1 60  ? 7.811   76.731  69.136  1.00 20.00 ? 60   GLN B CA  1 
ATOM   4079  C C   . GLN B 1 60  ? 8.364   77.707  70.174  1.00 20.00 ? 60   GLN B C   1 
ATOM   4080  O O   . GLN B 1 60  ? 9.499   77.574  70.631  1.00 20.00 ? 60   GLN B O   1 
ATOM   4081  C CB  . GLN B 1 60  ? 7.870   77.348  67.745  1.00 20.00 ? 60   GLN B CB  1 
ATOM   4082  C CG  . GLN B 1 60  ? 7.729   76.342  66.618  1.00 20.00 ? 60   GLN B CG  1 
ATOM   4083  C CD  . GLN B 1 60  ? 7.833   76.997  65.261  1.00 20.00 ? 60   GLN B CD  1 
ATOM   4084  O OE1 . GLN B 1 60  ? 6.908   77.674  64.820  1.00 20.00 ? 60   GLN B OE1 1 
ATOM   4085  N NE2 . GLN B 1 60  ? 8.969   76.813  64.592  1.00 20.00 ? 60   GLN B NE2 1 
ATOM   4086  N N   . TRP B 1 61  ? 7.553   78.684  70.558  1.00 20.00 ? 61   TRP B N   1 
ATOM   4087  C CA  . TRP B 1 61  ? 7.983   79.666  71.541  1.00 20.00 ? 61   TRP B CA  1 
ATOM   4088  C C   . TRP B 1 61  ? 8.181   79.050  72.917  1.00 20.00 ? 61   TRP B C   1 
ATOM   4089  O O   . TRP B 1 61  ? 8.897   79.599  73.756  1.00 20.00 ? 61   TRP B O   1 
ATOM   4090  C CB  . TRP B 1 61  ? 6.985   80.819  71.593  1.00 20.00 ? 61   TRP B CB  1 
ATOM   4091  C CG  . TRP B 1 61  ? 7.369   81.923  70.655  1.00 20.00 ? 61   TRP B CG  1 
ATOM   4092  C CD1 . TRP B 1 61  ? 6.799   82.213  69.454  1.00 20.00 ? 61   TRP B CD1 1 
ATOM   4093  C CD2 . TRP B 1 61  ? 8.441   82.854  70.825  1.00 20.00 ? 61   TRP B CD2 1 
ATOM   4094  N NE1 . TRP B 1 61  ? 7.448   83.269  68.860  1.00 20.00 ? 61   TRP B NE1 1 
ATOM   4095  C CE2 . TRP B 1 61  ? 8.463   83.682  69.683  1.00 20.00 ? 61   TRP B CE2 1 
ATOM   4096  C CE3 . TRP B 1 61  ? 9.390   83.069  71.833  1.00 20.00 ? 61   TRP B CE3 1 
ATOM   4097  C CZ2 . TRP B 1 61  ? 9.395   84.711  69.519  1.00 20.00 ? 61   TRP B CZ2 1 
ATOM   4098  C CZ3 . TRP B 1 61  ? 10.319  84.091  71.669  1.00 20.00 ? 61   TRP B CZ3 1 
ATOM   4099  C CH2 . TRP B 1 61  ? 10.312  84.898  70.519  1.00 20.00 ? 61   TRP B CH2 1 
ATOM   4100  N N   . ALA B 1 62  ? 7.551   77.905  73.149  1.00 20.00 ? 62   ALA B N   1 
ATOM   4101  C CA  . ALA B 1 62  ? 7.680   77.218  74.427  1.00 20.00 ? 62   ALA B CA  1 
ATOM   4102  C C   . ALA B 1 62  ? 9.049   76.541  74.398  1.00 20.00 ? 62   ALA B C   1 
ATOM   4103  O O   . ALA B 1 62  ? 9.759   76.486  75.402  1.00 20.00 ? 62   ALA B O   1 
ATOM   4104  C CB  . ALA B 1 62  ? 6.587   76.173  74.578  1.00 20.00 ? 62   ALA B CB  1 
ATOM   4105  N N   . GLY B 1 63  ? 9.407   76.020  73.229  1.00 20.00 ? 63   GLY B N   1 
ATOM   4106  C CA  . GLY B 1 63  ? 10.684  75.357  73.073  1.00 20.00 ? 63   GLY B CA  1 
ATOM   4107  C C   . GLY B 1 63  ? 11.789  76.383  73.218  1.00 20.00 ? 63   GLY B C   1 
ATOM   4108  O O   . GLY B 1 63  ? 12.869  76.074  73.708  1.00 20.00 ? 63   GLY B O   1 
ATOM   4109  N N   . MET B 1 64  ? 11.505  77.609  72.792  1.00 20.00 ? 64   MET B N   1 
ATOM   4110  C CA  . MET B 1 64  ? 12.460  78.708  72.862  1.00 20.00 ? 64   MET B CA  1 
ATOM   4111  C C   . MET B 1 64  ? 12.845  79.008  74.298  1.00 20.00 ? 64   MET B C   1 
ATOM   4112  O O   . MET B 1 64  ? 13.895  79.601  74.551  1.00 20.00 ? 64   MET B O   1 
ATOM   4113  C CB  . MET B 1 64  ? 11.852  79.970  72.248  1.00 20.00 ? 64   MET B CB  1 
ATOM   4114  C CG  . MET B 1 64  ? 11.765  79.951  70.729  1.00 20.00 ? 64   MET B CG  1 
ATOM   4115  S SD  . MET B 1 64  ? 13.338  80.398  69.985  1.00 20.00 ? 64   MET B SD  1 
ATOM   4116  C CE  . MET B 1 64  ? 13.321  82.117  70.231  1.00 20.00 ? 64   MET B CE  1 
ATOM   4117  N N   . MET B 1 65  ? 11.982  78.602  75.227  1.00 20.00 ? 65   MET B N   1 
ATOM   4118  C CA  . MET B 1 65  ? 12.201  78.820  76.651  1.00 20.00 ? 65   MET B CA  1 
ATOM   4119  C C   . MET B 1 65  ? 12.999  77.727  77.358  1.00 20.00 ? 65   MET B C   1 
ATOM   4120  O O   . MET B 1 65  ? 13.424  77.916  78.506  1.00 20.00 ? 65   MET B O   1 
ATOM   4121  C CB  . MET B 1 65  ? 10.850  78.996  77.356  1.00 20.00 ? 65   MET B CB  1 
ATOM   4122  C CG  . MET B 1 65  ? 10.087  80.239  76.921  1.00 20.00 ? 65   MET B CG  1 
ATOM   4123  S SD  . MET B 1 65  ? 11.006  81.728  77.264  1.00 20.00 ? 65   MET B SD  1 
ATOM   4124  C CE  . MET B 1 65  ? 10.789  82.587  75.783  1.00 20.00 ? 65   MET B CE  1 
ATOM   4125  N N   . ILE B 1 66  ? 13.191  76.587  76.689  1.00 20.00 ? 66   ILE B N   1 
ATOM   4126  C CA  . ILE B 1 66  ? 13.939  75.488  77.278  1.00 20.00 ? 66   ILE B CA  1 
ATOM   4127  C C   . ILE B 1 66  ? 15.198  75.178  76.492  1.00 20.00 ? 66   ILE B C   1 
ATOM   4128  O O   . ILE B 1 66  ? 15.539  74.014  76.275  1.00 20.00 ? 66   ILE B O   1 
ATOM   4129  C CB  . ILE B 1 66  ? 13.104  74.189  77.380  1.00 20.00 ? 66   ILE B CB  1 
ATOM   4130  C CG1 . ILE B 1 66  ? 12.410  73.901  76.050  1.00 20.00 ? 66   ILE B CG1 1 
ATOM   4131  C CG2 . ILE B 1 66  ? 12.111  74.301  78.518  1.00 20.00 ? 66   ILE B CG2 1 
ATOM   4132  C CD1 . ILE B 1 66  ? 12.107  72.429  75.835  1.00 20.00 ? 66   ILE B CD1 1 
ATOM   4133  N N   . GLY B 1 67  ? 15.896  76.225  76.074  1.00 20.00 ? 67   GLY B N   1 
ATOM   4134  C CA  . GLY B 1 67  ? 17.112  76.017  75.327  1.00 20.00 ? 67   GLY B CA  1 
ATOM   4135  C C   . GLY B 1 67  ? 18.214  75.486  76.238  1.00 20.00 ? 67   GLY B C   1 
ATOM   4136  O O   . GLY B 1 67  ? 18.447  76.028  77.325  1.00 20.00 ? 67   GLY B O   1 
ATOM   4137  N N   . ASP B 1 68  ? 18.863  74.404  75.798  1.00 20.00 ? 68   ASP B N   1 
ATOM   4138  C CA  . ASP B 1 68  ? 19.954  73.757  76.524  1.00 20.00 ? 68   ASP B CA  1 
ATOM   4139  C C   . ASP B 1 68  ? 21.160  74.297  75.775  1.00 20.00 ? 68   ASP B C   1 
ATOM   4140  O O   . ASP B 1 68  ? 21.562  73.760  74.742  1.00 20.00 ? 68   ASP B O   1 
ATOM   4141  C CB  . ASP B 1 68  ? 19.873  72.235  76.371  1.00 20.00 ? 68   ASP B CB  1 
ATOM   4142  C CG  . ASP B 1 68  ? 20.927  71.507  77.176  1.00 20.00 ? 68   ASP B CG  1 
ATOM   4143  O OD1 . ASP B 1 68  ? 21.797  72.171  77.767  1.00 20.00 ? 68   ASP B OD1 1 
ATOM   4144  O OD2 . ASP B 1 68  ? 20.894  70.264  77.212  1.00 20.00 ? 68   ASP B OD2 1 
ATOM   4145  N N   . GLU B 1 69  ? 21.720  75.382  76.294  1.00 20.00 ? 69   GLU B N   1 
ATOM   4146  C CA  . GLU B 1 69  ? 22.862  76.009  75.673  1.00 20.00 ? 69   GLU B CA  1 
ATOM   4147  C C   . GLU B 1 69  ? 24.211  75.350  75.887  1.00 20.00 ? 69   GLU B C   1 
ATOM   4148  O O   . GLU B 1 69  ? 25.241  75.996  75.749  1.00 20.00 ? 69   GLU B O   1 
ATOM   4149  C CB  . GLU B 1 69  ? 22.910  77.472  76.097  1.00 20.00 ? 69   GLU B CB  1 
ATOM   4150  C CG  . GLU B 1 69  ? 21.587  78.191  75.873  1.00 20.00 ? 69   GLU B CG  1 
ATOM   4151  C CD  . GLU B 1 69  ? 21.123  78.128  74.424  1.00 20.00 ? 69   GLU B CD  1 
ATOM   4152  O OE1 . GLU B 1 69  ? 21.979  77.948  73.534  1.00 20.00 ? 69   GLU B OE1 1 
ATOM   4153  O OE2 . GLU B 1 69  ? 19.907  78.264  74.175  1.00 20.00 ? 69   GLU B OE2 1 
ATOM   4154  N N   . ALA B 1 70  ? 24.213  74.060  76.198  1.00 20.00 ? 70   ALA B N   1 
ATOM   4155  C CA  . ALA B 1 70  ? 25.470  73.351  76.418  1.00 20.00 ? 70   ALA B CA  1 
ATOM   4156  C C   . ALA B 1 70  ? 26.284  73.371  75.124  1.00 20.00 ? 70   ALA B C   1 
ATOM   4157  O O   . ALA B 1 70  ? 25.722  73.343  74.025  1.00 20.00 ? 70   ALA B O   1 
ATOM   4158  C CB  . ALA B 1 70  ? 25.201  71.918  76.850  1.00 20.00 ? 70   ALA B CB  1 
ATOM   4159  N N   . TYR B 1 71  ? 27.606  73.425  75.264  1.00 20.00 ? 71   TYR B N   1 
ATOM   4160  C CA  . TYR B 1 71  ? 28.507  73.452  74.121  1.00 20.00 ? 71   TYR B CA  1 
ATOM   4161  C C   . TYR B 1 71  ? 28.528  72.112  73.433  1.00 20.00 ? 71   TYR B C   1 
ATOM   4162  O O   . TYR B 1 71  ? 28.925  72.000  72.269  1.00 20.00 ? 71   TYR B O   1 
ATOM   4163  C CB  . TYR B 1 71  ? 29.925  73.794  74.564  1.00 20.00 ? 71   TYR B CB  1 
ATOM   4164  C CG  . TYR B 1 71  ? 30.748  74.412  73.463  1.00 20.00 ? 71   TYR B CG  1 
ATOM   4165  C CD1 . TYR B 1 71  ? 30.389  75.645  72.915  1.00 20.00 ? 71   TYR B CD1 1 
ATOM   4166  C CD2 . TYR B 1 71  ? 31.877  73.766  72.957  1.00 20.00 ? 71   TYR B CD2 1 
ATOM   4167  C CE1 . TYR B 1 71  ? 31.131  76.221  71.889  1.00 20.00 ? 71   TYR B CE1 1 
ATOM   4168  C CE2 . TYR B 1 71  ? 32.626  74.333  71.929  1.00 20.00 ? 71   TYR B CE2 1 
ATOM   4169  C CZ  . TYR B 1 71  ? 32.247  75.562  71.400  1.00 20.00 ? 71   TYR B CZ  1 
ATOM   4170  O OH  . TYR B 1 71  ? 32.971  76.134  70.375  1.00 20.00 ? 71   TYR B OH  1 
ATOM   4171  N N   . ALA B 1 72  ? 28.100  71.095  74.169  1.00 20.00 ? 72   ALA B N   1 
ATOM   4172  C CA  . ALA B 1 72  ? 28.058  69.739  73.655  1.00 20.00 ? 72   ALA B CA  1 
ATOM   4173  C C   . ALA B 1 72  ? 27.053  68.933  74.467  1.00 20.00 ? 72   ALA B C   1 
ATOM   4174  O O   . ALA B 1 72  ? 26.895  69.161  75.667  1.00 20.00 ? 72   ALA B O   1 
ATOM   4175  C CB  . ALA B 1 72  ? 29.443  69.113  73.751  1.00 20.00 ? 72   ALA B CB  1 
ATOM   4176  N N   . GLY B 1 73  ? 26.369  68.002  73.808  1.00 20.00 ? 73   GLY B N   1 
ATOM   4177  C CA  . GLY B 1 73  ? 25.385  67.178  74.488  1.00 20.00 ? 73   GLY B CA  1 
ATOM   4178  C C   . GLY B 1 73  ? 24.055  67.862  74.757  1.00 20.00 ? 73   GLY B C   1 
ATOM   4179  O O   . GLY B 1 73  ? 23.269  67.397  75.584  1.00 20.00 ? 73   GLY B O   1 
ATOM   4180  N N   . SER B 1 74  ? 23.796  68.964  74.064  1.00 20.00 ? 74   SER B N   1 
ATOM   4181  C CA  . SER B 1 74  ? 22.553  69.693  74.246  1.00 20.00 ? 74   SER B CA  1 
ATOM   4182  C C   . SER B 1 74  ? 21.356  68.817  73.889  1.00 20.00 ? 74   SER B C   1 
ATOM   4183  O O   . SER B 1 74  ? 21.404  68.049  72.934  1.00 20.00 ? 74   SER B O   1 
ATOM   4184  C CB  . SER B 1 74  ? 22.553  70.946  73.377  1.00 20.00 ? 74   SER B CB  1 
ATOM   4185  O OG  . SER B 1 74  ? 21.307  71.614  73.465  1.00 20.00 ? 74   SER B OG  1 
ATOM   4186  N N   . GLU B 1 75  ? 20.288  68.926  74.670  1.00 20.00 ? 75   GLU B N   1 
ATOM   4187  C CA  . GLU B 1 75  ? 19.074  68.148  74.437  1.00 20.00 ? 75   GLU B CA  1 
ATOM   4188  C C   . GLU B 1 75  ? 18.410  68.595  73.139  1.00 20.00 ? 75   GLU B C   1 
ATOM   4189  O O   . GLU B 1 75  ? 17.827  67.791  72.415  1.00 20.00 ? 75   GLU B O   1 
ATOM   4190  C CB  . GLU B 1 75  ? 18.095  68.348  75.594  1.00 20.00 ? 75   GLU B CB  1 
ATOM   4191  C CG  . GLU B 1 75  ? 18.291  67.392  76.747  1.00 20.00 ? 75   GLU B CG  1 
ATOM   4192  C CD  . GLU B 1 75  ? 18.149  65.943  76.329  1.00 20.00 ? 75   GLU B CD  1 
ATOM   4193  O OE1 . GLU B 1 75  ? 17.003  65.442  76.307  1.00 20.00 ? 75   GLU B OE1 1 
ATOM   4194  O OE2 . GLU B 1 75  ? 19.181  65.302  76.025  1.00 20.00 ? 75   GLU B OE2 1 
ATOM   4195  N N   . ASN B 1 76  ? 18.503  69.888  72.855  1.00 20.00 ? 76   ASN B N   1 
ATOM   4196  C CA  . ASN B 1 76  ? 17.916  70.451  71.654  1.00 20.00 ? 76   ASN B CA  1 
ATOM   4197  C C   . ASN B 1 76  ? 18.508  69.844  70.388  1.00 20.00 ? 76   ASN B C   1 
ATOM   4198  O O   . ASN B 1 76  ? 17.796  69.601  69.411  1.00 20.00 ? 76   ASN B O   1 
ATOM   4199  C CB  . ASN B 1 76  ? 18.101  71.964  71.653  1.00 20.00 ? 76   ASN B CB  1 
ATOM   4200  C CG  . ASN B 1 76  ? 17.695  72.591  72.970  1.00 20.00 ? 76   ASN B CG  1 
ATOM   4201  O OD1 . ASN B 1 76  ? 18.457  73.350  73.569  1.00 20.00 ? 76   ASN B OD1 1 
ATOM   4202  N ND2 . ASN B 1 76  ? 16.489  72.276  73.432  1.00 20.00 ? 76   ASN B ND2 1 
ATOM   4203  N N   . PHE B 1 77  ? 19.811  69.597  70.400  1.00 20.00 ? 77   PHE B N   1 
ATOM   4204  C CA  . PHE B 1 77  ? 20.461  69.015  69.241  1.00 20.00 ? 77   PHE B CA  1 
ATOM   4205  C C   . PHE B 1 77  ? 19.894  67.616  68.998  1.00 20.00 ? 77   PHE B C   1 
ATOM   4206  O O   . PHE B 1 77  ? 19.587  67.243  67.866  1.00 20.00 ? 77   PHE B O   1 
ATOM   4207  C CB  . PHE B 1 77  ? 21.978  68.920  69.460  1.00 20.00 ? 77   PHE B CB  1 
ATOM   4208  C CG  . PHE B 1 77  ? 22.673  68.092  68.424  1.00 20.00 ? 77   PHE B CG  1 
ATOM   4209  C CD1 . PHE B 1 77  ? 22.820  68.569  67.126  1.00 20.00 ? 77   PHE B CD1 1 
ATOM   4210  C CD2 . PHE B 1 77  ? 23.109  66.807  68.721  1.00 20.00 ? 77   PHE B CD2 1 
ATOM   4211  C CE1 . PHE B 1 77  ? 23.382  67.780  66.139  1.00 20.00 ? 77   PHE B CE1 1 
ATOM   4212  C CE2 . PHE B 1 77  ? 23.673  66.010  67.741  1.00 20.00 ? 77   PHE B CE2 1 
ATOM   4213  C CZ  . PHE B 1 77  ? 23.809  66.494  66.448  1.00 20.00 ? 77   PHE B CZ  1 
ATOM   4214  N N   . TYR B 1 78  ? 19.762  66.840  70.068  1.00 20.00 ? 78   TYR B N   1 
ATOM   4215  C CA  . TYR B 1 78  ? 19.231  65.488  69.954  1.00 20.00 ? 78   TYR B CA  1 
ATOM   4216  C C   . TYR B 1 78  ? 17.823  65.540  69.389  1.00 20.00 ? 78   TYR B C   1 
ATOM   4217  O O   . TYR B 1 78  ? 17.442  64.703  68.574  1.00 20.00 ? 78   TYR B O   1 
ATOM   4218  C CB  . TYR B 1 78  ? 19.217  64.795  71.319  1.00 20.00 ? 78   TYR B CB  1 
ATOM   4219  C CG  . TYR B 1 78  ? 20.589  64.614  71.922  1.00 20.00 ? 78   TYR B CG  1 
ATOM   4220  C CD1 . TYR B 1 78  ? 21.695  64.331  71.119  1.00 20.00 ? 78   TYR B CD1 1 
ATOM   4221  C CD2 . TYR B 1 78  ? 20.790  64.753  73.293  1.00 20.00 ? 78   TYR B CD2 1 
ATOM   4222  C CE1 . TYR B 1 78  ? 22.967  64.197  71.668  1.00 20.00 ? 78   TYR B CE1 1 
ATOM   4223  C CE2 . TYR B 1 78  ? 22.058  64.621  73.848  1.00 20.00 ? 78   TYR B CE2 1 
ATOM   4224  C CZ  . TYR B 1 78  ? 23.140  64.346  73.029  1.00 20.00 ? 78   TYR B CZ  1 
ATOM   4225  O OH  . TYR B 1 78  ? 24.398  64.233  73.574  1.00 20.00 ? 78   TYR B OH  1 
ATOM   4226  N N   . HIS B 1 79  ? 17.049  66.524  69.826  1.00 20.00 ? 79   HIS B N   1 
ATOM   4227  C CA  . HIS B 1 79  ? 15.687  66.657  69.336  1.00 20.00 ? 79   HIS B CA  1 
ATOM   4228  C C   . HIS B 1 79  ? 15.714  66.888  67.835  1.00 20.00 ? 79   HIS B C   1 
ATOM   4229  O O   . HIS B 1 79  ? 15.002  66.212  67.087  1.00 20.00 ? 79   HIS B O   1 
ATOM   4230  C CB  . HIS B 1 79  ? 14.973  67.821  70.020  1.00 20.00 ? 79   HIS B CB  1 
ATOM   4231  C CG  . HIS B 1 79  ? 14.696  67.584  71.472  1.00 20.00 ? 79   HIS B CG  1 
ATOM   4232  N ND1 . HIS B 1 79  ? 14.358  68.597  72.342  1.00 20.00 ? 79   HIS B ND1 1 
ATOM   4233  C CD2 . HIS B 1 79  ? 14.722  66.449  72.210  1.00 20.00 ? 79   HIS B CD2 1 
ATOM   4234  C CE1 . HIS B 1 79  ? 14.188  68.097  73.555  1.00 20.00 ? 79   HIS B CE1 1 
ATOM   4235  N NE2 . HIS B 1 79  ? 14.404  66.795  73.501  1.00 20.00 ? 79   HIS B NE2 1 
ATOM   4236  N N   . LEU B 1 80  ? 16.542  67.836  67.401  1.00 20.00 ? 80   LEU B N   1 
ATOM   4237  C CA  . LEU B 1 80  ? 16.665  68.166  65.983  1.00 20.00 ? 80   LEU B CA  1 
ATOM   4238  C C   . LEU B 1 80  ? 17.166  66.994  65.155  1.00 20.00 ? 80   LEU B C   1 
ATOM   4239  O O   . LEU B 1 80  ? 16.606  66.677  64.102  1.00 20.00 ? 80   LEU B O   1 
ATOM   4240  C CB  . LEU B 1 80  ? 17.610  69.352  65.791  1.00 20.00 ? 80   LEU B CB  1 
ATOM   4241  C CG  . LEU B 1 80  ? 17.939  69.708  64.336  1.00 20.00 ? 80   LEU B CG  1 
ATOM   4242  C CD1 . LEU B 1 80  ? 16.687  70.174  63.613  1.00 20.00 ? 80   LEU B CD1 1 
ATOM   4243  C CD2 . LEU B 1 80  ? 18.991  70.801  64.307  1.00 20.00 ? 80   LEU B CD2 1 
ATOM   4244  N N   . GLU B 1 81  ? 18.233  66.361  65.627  1.00 20.00 ? 81   GLU B N   1 
ATOM   4245  C CA  . GLU B 1 81  ? 18.812  65.225  64.932  1.00 20.00 ? 81   GLU B CA  1 
ATOM   4246  C C   . GLU B 1 81  ? 17.785  64.111  64.767  1.00 20.00 ? 81   GLU B C   1 
ATOM   4247  O O   . GLU B 1 81  ? 17.649  63.529  63.694  1.00 20.00 ? 81   GLU B O   1 
ATOM   4248  C CB  . GLU B 1 81  ? 20.018  64.709  65.706  1.00 20.00 ? 81   GLU B CB  1 
ATOM   4249  C CG  . GLU B 1 81  ? 20.527  63.378  65.209  1.00 20.00 ? 81   GLU B CG  1 
ATOM   4250  C CD  . GLU B 1 81  ? 21.686  62.871  66.026  1.00 20.00 ? 81   GLU B CD  1 
ATOM   4251  O OE1 . GLU B 1 81  ? 21.472  62.535  67.211  1.00 20.00 ? 81   GLU B OE1 1 
ATOM   4252  O OE2 . GLU B 1 81  ? 22.810  62.813  65.487  1.00 20.00 ? 81   GLU B OE2 1 
ATOM   4253  N N   . LYS B 1 82  ? 17.061  63.820  65.837  1.00 20.00 ? 82   LYS B N   1 
ATOM   4254  C CA  . LYS B 1 82  ? 16.052  62.779  65.798  1.00 20.00 ? 82   LYS B CA  1 
ATOM   4255  C C   . LYS B 1 82  ? 14.943  63.125  64.808  1.00 20.00 ? 82   LYS B C   1 
ATOM   4256  O O   . LYS B 1 82  ? 14.520  62.291  64.013  1.00 20.00 ? 82   LYS B O   1 
ATOM   4257  C CB  . LYS B 1 82  ? 15.451  62.582  67.190  1.00 20.00 ? 82   LYS B CB  1 
ATOM   4258  C CG  . LYS B 1 82  ? 14.291  61.597  67.212  1.00 20.00 ? 82   LYS B CG  1 
ATOM   4259  C CD  . LYS B 1 82  ? 13.903  61.187  68.629  1.00 20.00 ? 82   LYS B CD  1 
ATOM   4260  C CE  . LYS B 1 82  ? 12.726  60.210  68.615  1.00 20.00 ? 82   LYS B CE  1 
ATOM   4261  N NZ  . LYS B 1 82  ? 11.995  60.195  67.305  1.00 20.00 ? 82   LYS B NZ  1 
ATOM   4262  N N   . THR B 1 83  ? 14.467  64.359  64.858  1.00 20.00 ? 83   THR B N   1 
ATOM   4263  C CA  . THR B 1 83  ? 13.407  64.791  63.959  1.00 20.00 ? 83   THR B CA  1 
ATOM   4264  C C   . THR B 1 83  ? 13.785  64.684  62.481  1.00 20.00 ? 83   THR B C   1 
ATOM   4265  O O   . THR B 1 83  ? 13.062  64.073  61.691  1.00 20.00 ? 83   THR B O   1 
ATOM   4266  C CB  . THR B 1 83  ? 13.006  66.244  64.253  1.00 20.00 ? 83   THR B CB  1 
ATOM   4267  O OG1 . THR B 1 83  ? 12.502  66.335  65.590  1.00 20.00 ? 83   THR B OG1 1 
ATOM   4268  C CG2 . THR B 1 83  ? 11.933  66.712  63.281  1.00 20.00 ? 83   THR B CG2 1 
ATOM   4269  N N   . VAL B 1 84  ? 14.911  65.291  62.119  1.00 20.00 ? 84   VAL B N   1 
ATOM   4270  C CA  . VAL B 1 84  ? 15.391  65.278  60.745  1.00 20.00 ? 84   VAL B CA  1 
ATOM   4271  C C   . VAL B 1 84  ? 15.632  63.868  60.227  1.00 20.00 ? 84   VAL B C   1 
ATOM   4272  O O   . VAL B 1 84  ? 15.329  63.568  59.069  1.00 20.00 ? 84   VAL B O   1 
ATOM   4273  C CB  . VAL B 1 84  ? 16.682  66.099  60.604  1.00 20.00 ? 84   VAL B CB  1 
ATOM   4274  C CG1 . VAL B 1 84  ? 17.183  66.036  59.178  1.00 20.00 ? 84   VAL B CG1 1 
ATOM   4275  C CG2 . VAL B 1 84  ? 16.425  67.546  61.009  1.00 20.00 ? 84   VAL B CG2 1 
ATOM   4276  N N   . LYS B 1 85  ? 16.177  63.006  61.078  1.00 20.00 ? 85   LYS B N   1 
ATOM   4277  C CA  . LYS B 1 85  ? 16.444  61.624  60.686  1.00 20.00 ? 85   LYS B CA  1 
ATOM   4278  C C   . LYS B 1 85  ? 15.114  60.948  60.375  1.00 20.00 ? 85   LYS B C   1 
ATOM   4279  O O   . LYS B 1 85  ? 14.986  60.205  59.402  1.00 20.00 ? 85   LYS B O   1 
ATOM   4280  C CB  . LYS B 1 85  ? 17.136  60.866  61.818  1.00 20.00 ? 85   LYS B CB  1 
ATOM   4281  C CG  . LYS B 1 85  ? 18.655  60.930  61.786  1.00 20.00 ? 85   LYS B CG  1 
ATOM   4282  C CD  . LYS B 1 85  ? 19.270  59.718  62.481  1.00 20.00 ? 85   LYS B CD  1 
ATOM   4283  C CE  . LYS B 1 85  ? 20.210  60.134  63.601  1.00 20.00 ? 85   LYS B CE  1 
ATOM   4284  N NZ  . LYS B 1 85  ? 21.316  61.009  63.112  1.00 20.00 ? 85   LYS B NZ  1 
ATOM   4285  N N   . GLU B 1 86  ? 14.121  61.212  61.215  1.00 20.00 ? 86   GLU B N   1 
ATOM   4286  C CA  . GLU B 1 86  ? 12.800  60.635  61.039  1.00 20.00 ? 86   GLU B CA  1 
ATOM   4287  C C   . GLU B 1 86  ? 12.105  61.157  59.783  1.00 20.00 ? 86   GLU B C   1 
ATOM   4288  O O   . GLU B 1 86  ? 11.695  60.383  58.917  1.00 20.00 ? 86   GLU B O   1 
ATOM   4289  C CB  . GLU B 1 86  ? 11.928  60.936  62.263  1.00 20.00 ? 86   GLU B CB  1 
ATOM   4290  C CG  . GLU B 1 86  ? 10.434  60.673  62.047  1.00 20.00 ? 86   GLU B CG  1 
ATOM   4291  C CD  . GLU B 1 86  ? 9.619   60.736  63.330  1.00 20.00 ? 86   GLU B CD  1 
ATOM   4292  O OE1 . GLU B 1 86  ? 10.203  60.981  64.411  1.00 20.00 ? 86   GLU B OE1 1 
ATOM   4293  O OE2 . GLU B 1 86  ? 8.387   60.538  63.251  1.00 20.00 ? 86   GLU B OE2 1 
ATOM   4294  N N   . LEU B 1 87  ? 11.989  62.475  59.684  1.00 20.00 ? 87   LEU B N   1 
ATOM   4295  C CA  . LEU B 1 87  ? 11.338  63.095  58.543  1.00 20.00 ? 87   LEU B CA  1 
ATOM   4296  C C   . LEU B 1 87  ? 12.084  63.065  57.219  1.00 20.00 ? 87   LEU B C   1 
ATOM   4297  O O   . LEU B 1 87  ? 11.477  62.817  56.192  1.00 20.00 ? 87   LEU B O   1 
ATOM   4298  C CB  . LEU B 1 87  ? 10.963  64.538  58.885  1.00 20.00 ? 87   LEU B CB  1 
ATOM   4299  C CG  . LEU B 1 87  ? 10.012  64.698  60.075  1.00 20.00 ? 87   LEU B CG  1 
ATOM   4300  C CD1 . LEU B 1 87  ? 9.653   66.156  60.219  1.00 20.00 ? 87   LEU B CD1 1 
ATOM   4301  C CD2 . LEU B 1 87  ? 8.752   63.862  59.885  1.00 20.00 ? 87   LEU B CD2 1 
ATOM   4302  N N   . PHE B 1 88  ? 13.386  63.316  57.220  1.00 20.00 ? 88   PHE B N   1 
ATOM   4303  C CA  . PHE B 1 88  ? 14.122  63.297  55.960  1.00 20.00 ? 88   PHE B CA  1 
ATOM   4304  C C   . PHE B 1 88  ? 14.713  61.931  55.638  1.00 20.00 ? 88   PHE B C   1 
ATOM   4305  O O   . PHE B 1 88  ? 14.940  61.604  54.473  1.00 20.00 ? 88   PHE B O   1 
ATOM   4306  C CB  . PHE B 1 88  ? 15.221  64.364  55.964  1.00 20.00 ? 88   PHE B CB  1 
ATOM   4307  C CG  . PHE B 1 88  ? 14.709  65.763  55.751  1.00 20.00 ? 88   PHE B CG  1 
ATOM   4308  C CD1 . PHE B 1 88  ? 13.352  66.051  55.870  1.00 20.00 ? 88   PHE B CD1 1 
ATOM   4309  C CD2 . PHE B 1 88  ? 15.585  66.795  55.443  1.00 20.00 ? 88   PHE B CD2 1 
ATOM   4310  C CE1 . PHE B 1 88  ? 12.877  67.353  55.685  1.00 20.00 ? 88   PHE B CE1 1 
ATOM   4311  C CE2 . PHE B 1 88  ? 15.124  68.095  55.257  1.00 20.00 ? 88   PHE B CE2 1 
ATOM   4312  C CZ  . PHE B 1 88  ? 13.770  68.375  55.377  1.00 20.00 ? 88   PHE B CZ  1 
ATOM   4313  N N   . GLY B 1 89  ? 14.965  61.134  56.669  1.00 20.00 ? 89   GLY B N   1 
ATOM   4314  C CA  . GLY B 1 89  ? 15.521  59.814  56.444  1.00 20.00 ? 89   GLY B CA  1 
ATOM   4315  C C   . GLY B 1 89  ? 17.012  59.736  56.188  1.00 20.00 ? 89   GLY B C   1 
ATOM   4316  O O   . GLY B 1 89  ? 17.505  58.688  55.787  1.00 20.00 ? 89   GLY B O   1 
ATOM   4317  N N   . PHE B 1 90  ? 17.736  60.828  56.402  1.00 20.00 ? 90   PHE B N   1 
ATOM   4318  C CA  . PHE B 1 90  ? 19.178  60.806  56.177  1.00 20.00 ? 90   PHE B CA  1 
ATOM   4319  C C   . PHE B 1 90  ? 19.876  60.242  57.417  1.00 20.00 ? 90   PHE B C   1 
ATOM   4320  O O   . PHE B 1 90  ? 19.326  60.273  58.516  1.00 20.00 ? 90   PHE B O   1 
ATOM   4321  C CB  . PHE B 1 90  ? 19.692  62.210  55.853  1.00 20.00 ? 90   PHE B CB  1 
ATOM   4322  C CG  . PHE B 1 90  ? 19.333  62.677  54.468  1.00 20.00 ? 90   PHE B CG  1 
ATOM   4323  C CD1 . PHE B 1 90  ? 19.762  61.969  53.348  1.00 20.00 ? 90   PHE B CD1 1 
ATOM   4324  C CD2 . PHE B 1 90  ? 18.548  63.812  54.281  1.00 20.00 ? 90   PHE B CD2 1 
ATOM   4325  C CE1 . PHE B 1 90  ? 19.412  62.385  52.061  1.00 20.00 ? 90   PHE B CE1 1 
ATOM   4326  C CE2 . PHE B 1 90  ? 18.194  64.232  53.004  1.00 20.00 ? 90   PHE B CE2 1 
ATOM   4327  C CZ  . PHE B 1 90  ? 18.628  63.516  51.889  1.00 20.00 ? 90   PHE B CZ  1 
ATOM   4328  N N   . LYS B 1 91  ? 21.087  59.726  57.238  1.00 20.00 ? 91   LYS B N   1 
ATOM   4329  C CA  . LYS B 1 91  ? 21.849  59.148  58.339  1.00 20.00 ? 91   LYS B CA  1 
ATOM   4330  C C   . LYS B 1 91  ? 22.426  60.160  59.321  1.00 20.00 ? 91   LYS B C   1 
ATOM   4331  O O   . LYS B 1 91  ? 22.194  60.072  60.528  1.00 20.00 ? 91   LYS B O   1 
ATOM   4332  C CB  . LYS B 1 91  ? 22.980  58.281  57.777  1.00 20.00 ? 91   LYS B CB  1 
ATOM   4333  C CG  . LYS B 1 91  ? 22.516  57.262  56.742  1.00 20.00 ? 91   LYS B CG  1 
ATOM   4334  C CD  . LYS B 1 91  ? 22.562  55.848  57.296  1.00 20.00 ? 91   LYS B CD  1 
ATOM   4335  C CE  . LYS B 1 91  ? 23.980  55.288  57.257  1.00 20.00 ? 91   LYS B CE  1 
ATOM   4336  N NZ  . LYS B 1 91  ? 24.768  55.688  58.459  1.00 20.00 ? 91   LYS B NZ  1 
ATOM   4337  N N   . HIS B 1 92  ? 23.175  61.123  58.800  1.00 20.00 ? 92   HIS B N   1 
ATOM   4338  C CA  . HIS B 1 92  ? 23.785  62.142  59.637  1.00 20.00 ? 92   HIS B CA  1 
ATOM   4339  C C   . HIS B 1 92  ? 23.302  63.543  59.334  1.00 20.00 ? 92   HIS B C   1 
ATOM   4340  O O   . HIS B 1 92  ? 22.811  63.825  58.247  1.00 20.00 ? 92   HIS B O   1 
ATOM   4341  C CB  . HIS B 1 92  ? 25.303  62.092  59.482  1.00 20.00 ? 92   HIS B CB  1 
ATOM   4342  C CG  . HIS B 1 92  ? 25.846  60.708  59.333  1.00 20.00 ? 92   HIS B CG  1 
ATOM   4343  N ND1 . HIS B 1 92  ? 26.154  59.913  60.415  1.00 20.00 ? 92   HIS B ND1 1 
ATOM   4344  C CD2 . HIS B 1 92  ? 26.124  59.972  58.231  1.00 20.00 ? 92   HIS B CD2 1 
ATOM   4345  C CE1 . HIS B 1 92  ? 26.600  58.745  59.988  1.00 20.00 ? 92   HIS B CE1 1 
ATOM   4346  N NE2 . HIS B 1 92  ? 26.591  58.755  58.666  1.00 20.00 ? 92   HIS B NE2 1 
ATOM   4347  N N   . ILE B 1 93  ? 23.466  64.429  60.307  1.00 20.00 ? 93   ILE B N   1 
ATOM   4348  C CA  . ILE B 1 93  ? 23.049  65.810  60.154  1.00 20.00 ? 93   ILE B CA  1 
ATOM   4349  C C   . ILE B 1 93  ? 24.032  66.740  60.864  1.00 20.00 ? 93   ILE B C   1 
ATOM   4350  O O   . ILE B 1 93  ? 24.500  66.444  61.967  1.00 20.00 ? 93   ILE B O   1 
ATOM   4351  C CB  . ILE B 1 93  ? 21.616  66.015  60.732  1.00 20.00 ? 93   ILE B CB  1 
ATOM   4352  C CG1 . ILE B 1 93  ? 21.325  67.509  60.912  1.00 20.00 ? 93   ILE B CG1 1 
ATOM   4353  C CG2 . ILE B 1 93  ? 21.473  65.263  62.051  1.00 20.00 ? 93   ILE B CG2 1 
ATOM   4354  C CD1 . ILE B 1 93  ? 19.995  67.811  61.550  1.00 20.00 ? 93   ILE B CD1 1 
ATOM   4355  N N   . VAL B 1 94  ? 24.351  67.855  60.212  1.00 20.00 ? 94   VAL B N   1 
ATOM   4356  C CA  . VAL B 1 94  ? 25.269  68.852  60.755  1.00 20.00 ? 94   VAL B CA  1 
ATOM   4357  C C   . VAL B 1 94  ? 24.537  70.205  60.755  1.00 20.00 ? 94   VAL B C   1 
ATOM   4358  O O   . VAL B 1 94  ? 24.281  70.794  59.698  1.00 20.00 ? 94   VAL B O   1 
ATOM   4359  C CB  . VAL B 1 94  ? 26.565  68.976  59.892  1.00 20.00 ? 94   VAL B CB  1 
ATOM   4360  C CG1 . VAL B 1 94  ? 27.423  70.114  60.400  1.00 20.00 ? 94   VAL B CG1 1 
ATOM   4361  C CG2 . VAL B 1 94  ? 27.351  67.678  59.925  1.00 20.00 ? 94   VAL B CG2 1 
ATOM   4362  N N   . PRO B 1 95  ? 24.172  70.708  61.941  1.00 20.00 ? 95   PRO B N   1 
ATOM   4363  C CA  . PRO B 1 95  ? 23.486  72.001  61.957  1.00 20.00 ? 95   PRO B CA  1 
ATOM   4364  C C   . PRO B 1 95  ? 24.390  73.144  61.524  1.00 20.00 ? 95   PRO B C   1 
ATOM   4365  O O   . PRO B 1 95  ? 25.604  73.085  61.690  1.00 20.00 ? 95   PRO B O   1 
ATOM   4366  C CB  . PRO B 1 95  ? 23.016  72.148  63.402  1.00 20.00 ? 95   PRO B CB  1 
ATOM   4367  C CG  . PRO B 1 95  ? 23.887  71.229  64.193  1.00 20.00 ? 95   PRO B CG  1 
ATOM   4368  C CD  . PRO B 1 95  ? 24.338  70.135  63.287  1.00 20.00 ? 95   PRO B CD  1 
ATOM   4369  N N   . THR B 1 96  ? 23.787  74.174  60.944  1.00 20.00 ? 96   THR B N   1 
ATOM   4370  C CA  . THR B 1 96  ? 24.514  75.347  60.478  1.00 20.00 ? 96   THR B CA  1 
ATOM   4371  C C   . THR B 1 96  ? 23.608  76.521  60.797  1.00 20.00 ? 96   THR B C   1 
ATOM   4372  O O   . THR B 1 96  ? 22.395  76.341  60.956  1.00 20.00 ? 96   THR B O   1 
ATOM   4373  C CB  . THR B 1 96  ? 24.785  75.286  58.954  1.00 20.00 ? 96   THR B CB  1 
ATOM   4374  O OG1 . THR B 1 96  ? 23.554  75.096  58.252  1.00 20.00 ? 96   THR B OG1 1 
ATOM   4375  C CG2 . THR B 1 96  ? 25.720  74.132  58.618  1.00 20.00 ? 96   THR B CG2 1 
ATOM   4376  N N   . HIS B 1 97  ? 24.174  77.719  60.897  1.00 20.00 ? 97   HIS B N   1 
ATOM   4377  C CA  . HIS B 1 97  ? 23.373  78.900  61.211  1.00 20.00 ? 97   HIS B CA  1 
ATOM   4378  C C   . HIS B 1 97  ? 22.434  79.313  60.094  1.00 20.00 ? 97   HIS B C   1 
ATOM   4379  O O   . HIS B 1 97  ? 21.464  80.034  60.332  1.00 20.00 ? 97   HIS B O   1 
ATOM   4380  C CB  . HIS B 1 97  ? 24.278  80.083  61.588  1.00 20.00 ? 97   HIS B CB  1 
ATOM   4381  C CG  . HIS B 1 97  ? 24.775  80.867  60.413  1.00 20.00 ? 97   HIS B CG  1 
ATOM   4382  N ND1 . HIS B 1 97  ? 25.841  80.459  59.641  1.00 20.00 ? 97   HIS B ND1 1 
ATOM   4383  C CD2 . HIS B 1 97  ? 24.336  82.024  59.865  1.00 20.00 ? 97   HIS B CD2 1 
ATOM   4384  C CE1 . HIS B 1 97  ? 26.037  81.329  58.667  1.00 20.00 ? 97   HIS B CE1 1 
ATOM   4385  N NE2 . HIS B 1 97  ? 25.136  82.289  58.780  1.00 20.00 ? 97   HIS B NE2 1 
ATOM   4386  N N   . GLN B 1 98  ? 22.716  78.854  58.878  1.00 20.00 ? 98   GLN B N   1 
ATOM   4387  C CA  . GLN B 1 98  ? 21.882  79.190  57.725  1.00 20.00 ? 98   GLN B CA  1 
ATOM   4388  C C   . GLN B 1 98  ? 22.168  78.248  56.572  1.00 20.00 ? 98   GLN B C   1 
ATOM   4389  O O   . GLN B 1 98  ? 23.157  77.527  56.595  1.00 20.00 ? 98   GLN B O   1 
ATOM   4390  C CB  . GLN B 1 98  ? 22.174  80.621  57.277  1.00 20.00 ? 98   GLN B CB  1 
ATOM   4391  C CG  . GLN B 1 98  ? 20.955  81.429  56.961  1.00 20.00 ? 98   GLN B CG  1 
ATOM   4392  C CD  . GLN B 1 98  ? 21.249  82.910  56.949  1.00 20.00 ? 98   GLN B CD  1 
ATOM   4393  O OE1 . GLN B 1 98  ? 21.224  83.569  57.991  1.00 20.00 ? 98   GLN B OE1 1 
ATOM   4394  N NE2 . GLN B 1 98  ? 21.529  83.446  55.768  1.00 20.00 ? 98   GLN B NE2 1 
ATOM   4395  N N   . GLY B 1 99  ? 21.306  78.272  55.560  1.00 20.00 ? 99   GLY B N   1 
ATOM   4396  C CA  . GLY B 1 99  ? 21.490  77.410  54.405  1.00 20.00 ? 99   GLY B CA  1 
ATOM   4397  C C   . GLY B 1 99  ? 22.831  77.594  53.709  1.00 20.00 ? 99   GLY B C   1 
ATOM   4398  O O   . GLY B 1 99  ? 23.483  76.609  53.341  1.00 20.00 ? 99   GLY B O   1 
ATOM   4399  N N   . ARG B 1 100 ? 23.251  78.845  53.520  1.00 20.00 ? 100  ARG B N   1 
ATOM   4400  C CA  . ARG B 1 100 ? 24.527  79.108  52.861  1.00 20.00 ? 100  ARG B CA  1 
ATOM   4401  C C   . ARG B 1 100 ? 25.639  78.418  53.630  1.00 20.00 ? 100  ARG B C   1 
ATOM   4402  O O   . ARG B 1 100 ? 26.605  77.942  53.042  1.00 20.00 ? 100  ARG B O   1 
ATOM   4403  C CB  . ARG B 1 100 ? 24.853  80.600  52.823  1.00 20.00 ? 100  ARG B CB  1 
ATOM   4404  C CG  . ARG B 1 100 ? 23.754  81.503  52.351  1.00 20.00 ? 100  ARG B CG  1 
ATOM   4405  C CD  . ARG B 1 100 ? 23.574  82.643  53.342  1.00 20.00 ? 100  ARG B CD  1 
ATOM   4406  N NE  . ARG B 1 100 ? 23.599  83.960  52.710  1.00 20.00 ? 100  ARG B NE  1 
ATOM   4407  C CZ  . ARG B 1 100 ? 22.553  84.530  52.117  1.00 20.00 ? 100  ARG B CZ  1 
ATOM   4408  N NH1 . ARG B 1 100 ? 21.383  83.905  52.065  1.00 20.00 ? 100  ARG B NH1 1 
ATOM   4409  N NH2 . ARG B 1 100 ? 22.673  85.740  51.591  1.00 20.00 ? 100  ARG B NH2 1 
ATOM   4410  N N   . GLY B 1 101 ? 25.507  78.390  54.952  1.00 20.00 ? 101  GLY B N   1 
ATOM   4411  C CA  . GLY B 1 101 ? 26.516  77.756  55.778  1.00 20.00 ? 101  GLY B CA  1 
ATOM   4412  C C   . GLY B 1 101 ? 26.709  76.308  55.384  1.00 20.00 ? 101  GLY B C   1 
ATOM   4413  O O   . GLY B 1 101 ? 27.836  75.796  55.380  1.00 20.00 ? 101  GLY B O   1 
ATOM   4414  N N   . ALA B 1 102 ? 25.597  75.655  55.052  1.00 20.00 ? 102  ALA B N   1 
ATOM   4415  C CA  . ALA B 1 102 ? 25.601  74.252  54.644  1.00 20.00 ? 102  ALA B CA  1 
ATOM   4416  C C   . ALA B 1 102 ? 26.190  74.094  53.239  1.00 20.00 ? 102  ALA B C   1 
ATOM   4417  O O   . ALA B 1 102 ? 26.935  73.153  52.970  1.00 20.00 ? 102  ALA B O   1 
ATOM   4418  C CB  . ALA B 1 102 ? 24.181  73.700  54.680  1.00 20.00 ? 102  ALA B CB  1 
ATOM   4419  N N   . GLU B 1 103 ? 25.846  75.014  52.343  1.00 20.00 ? 103  GLU B N   1 
ATOM   4420  C CA  . GLU B 1 103 ? 26.351  74.966  50.976  1.00 20.00 ? 103  GLU B CA  1 
ATOM   4421  C C   . GLU B 1 103 ? 27.868  75.121  50.976  1.00 20.00 ? 103  GLU B C   1 
ATOM   4422  O O   . GLU B 1 103 ? 28.574  74.359  50.319  1.00 20.00 ? 103  GLU B O   1 
ATOM   4423  C CB  . GLU B 1 103 ? 25.718  76.075  50.146  1.00 20.00 ? 103  GLU B CB  1 
ATOM   4424  C CG  . GLU B 1 103 ? 24.241  75.875  49.933  1.00 20.00 ? 103  GLU B CG  1 
ATOM   4425  C CD  . GLU B 1 103 ? 23.544  77.143  49.503  1.00 20.00 ? 103  GLU B CD  1 
ATOM   4426  O OE1 . GLU B 1 103 ? 24.145  78.235  49.632  1.00 20.00 ? 103  GLU B OE1 1 
ATOM   4427  O OE2 . GLU B 1 103 ? 22.391  77.048  49.030  1.00 20.00 ? 103  GLU B OE2 1 
ATOM   4428  N N   . ASN B 1 104 ? 28.364  76.115  51.711  1.00 20.00 ? 104  ASN B N   1 
ATOM   4429  C CA  . ASN B 1 104 ? 29.801  76.363  51.798  1.00 20.00 ? 104  ASN B CA  1 
ATOM   4430  C C   . ASN B 1 104 ? 30.496  75.064  52.215  1.00 20.00 ? 104  ASN B C   1 
ATOM   4431  O O   . ASN B 1 104 ? 31.538  74.703  51.674  1.00 20.00 ? 104  ASN B O   1 
ATOM   4432  C CB  . ASN B 1 104 ? 30.078  77.473  52.825  1.00 20.00 ? 104  ASN B CB  1 
ATOM   4433  C CG  . ASN B 1 104 ? 31.528  77.495  53.299  1.00 20.00 ? 104  ASN B CG  1 
ATOM   4434  O OD1 . ASN B 1 104 ? 32.449  77.722  52.511  1.00 20.00 ? 104  ASN B OD1 1 
ATOM   4435  N ND2 . ASN B 1 104 ? 31.735  77.264  54.595  1.00 20.00 ? 104  ASN B ND2 1 
ATOM   4436  N N   . LEU B 1 105 ? 29.899  74.355  53.167  1.00 20.00 ? 105  LEU B N   1 
ATOM   4437  C CA  . LEU B 1 105 ? 30.461  73.099  53.653  1.00 20.00 ? 105  LEU B CA  1 
ATOM   4438  C C   . LEU B 1 105 ? 30.445  71.996  52.598  1.00 20.00 ? 105  LEU B C   1 
ATOM   4439  O O   . LEU B 1 105 ? 31.483  71.407  52.304  1.00 20.00 ? 105  LEU B O   1 
ATOM   4440  C CB  . LEU B 1 105 ? 29.700  72.621  54.897  1.00 20.00 ? 105  LEU B CB  1 
ATOM   4441  C CG  . LEU B 1 105 ? 30.349  72.745  56.284  1.00 20.00 ? 105  LEU B CG  1 
ATOM   4442  C CD1 . LEU B 1 105 ? 31.252  73.965  56.343  1.00 20.00 ? 105  LEU B CD1 1 
ATOM   4443  C CD2 . LEU B 1 105 ? 29.262  72.849  57.335  1.00 20.00 ? 105  LEU B CD2 1 
ATOM   4444  N N   . LEU B 1 106 ? 29.274  71.715  52.029  1.00 20.00 ? 106  LEU B N   1 
ATOM   4445  C CA  . LEU B 1 106 ? 29.150  70.669  51.010  1.00 20.00 ? 106  LEU B CA  1 
ATOM   4446  C C   . LEU B 1 106 ? 30.011  70.913  49.770  1.00 20.00 ? 106  LEU B C   1 
ATOM   4447  O O   . LEU B 1 106 ? 30.524  69.967  49.164  1.00 20.00 ? 106  LEU B O   1 
ATOM   4448  C CB  . LEU B 1 106 ? 27.682  70.502  50.583  1.00 20.00 ? 106  LEU B CB  1 
ATOM   4449  C CG  . LEU B 1 106 ? 27.416  69.573  49.387  1.00 20.00 ? 106  LEU B CG  1 
ATOM   4450  C CD1 . LEU B 1 106 ? 27.483  68.117  49.811  1.00 20.00 ? 106  LEU B CD1 1 
ATOM   4451  C CD2 . LEU B 1 106 ? 26.062  69.890  48.795  1.00 20.00 ? 106  LEU B CD2 1 
ATOM   4452  N N   . SER B 1 107 ? 30.161  72.179  49.400  1.00 20.00 ? 107  SER B N   1 
ATOM   4453  C CA  . SER B 1 107 ? 30.952  72.551  48.237  1.00 20.00 ? 107  SER B CA  1 
ATOM   4454  C C   . SER B 1 107 ? 32.436  72.296  48.465  1.00 20.00 ? 107  SER B C   1 
ATOM   4455  O O   . SER B 1 107 ? 33.136  71.811  47.578  1.00 20.00 ? 107  SER B O   1 
ATOM   4456  C CB  . SER B 1 107 ? 30.730  74.026  47.898  1.00 20.00 ? 107  SER B CB  1 
ATOM   4457  O OG  . SER B 1 107 ? 29.523  74.199  47.179  1.00 20.00 ? 107  SER B OG  1 
ATOM   4458  N N   . GLN B 1 108 ? 32.917  72.632  49.653  1.00 20.00 ? 108  GLN B N   1 
ATOM   4459  C CA  . GLN B 1 108 ? 34.318  72.431  49.978  1.00 20.00 ? 108  GLN B CA  1 
ATOM   4460  C C   . GLN B 1 108 ? 34.610  70.943  50.108  1.00 20.00 ? 108  GLN B C   1 
ATOM   4461  O O   . GLN B 1 108 ? 35.762  70.523  50.010  1.00 20.00 ? 108  GLN B O   1 
ATOM   4462  C CB  . GLN B 1 108 ? 34.652  73.111  51.301  1.00 20.00 ? 108  GLN B CB  1 
ATOM   4463  C CG  . GLN B 1 108 ? 34.544  74.613  51.271  1.00 20.00 ? 108  GLN B CG  1 
ATOM   4464  C CD  . GLN B 1 108 ? 35.432  75.270  52.315  1.00 20.00 ? 108  GLN B CD  1 
ATOM   4465  O OE1 . GLN B 1 108 ? 36.559  74.824  52.557  1.00 20.00 ? 108  GLN B OE1 1 
ATOM   4466  N NE2 . GLN B 1 108 ? 34.930  76.332  52.943  1.00 20.00 ? 108  GLN B NE2 1 
ATOM   4467  N N   . LEU B 1 109 ? 33.560  70.150  50.315  1.00 20.00 ? 109  LEU B N   1 
ATOM   4468  C CA  . LEU B 1 109 ? 33.699  68.705  50.472  1.00 20.00 ? 109  LEU B CA  1 
ATOM   4469  C C   . LEU B 1 109 ? 33.423  67.819  49.259  1.00 20.00 ? 109  LEU B C   1 
ATOM   4470  O O   . LEU B 1 109 ? 34.077  66.792  49.085  1.00 20.00 ? 109  LEU B O   1 
ATOM   4471  C CB  . LEU B 1 109 ? 32.804  68.226  51.622  1.00 20.00 ? 109  LEU B CB  1 
ATOM   4472  C CG  . LEU B 1 109 ? 33.051  68.798  53.021  1.00 20.00 ? 109  LEU B CG  1 
ATOM   4473  C CD1 . LEU B 1 109 ? 31.786  68.647  53.858  1.00 20.00 ? 109  LEU B CD1 1 
ATOM   4474  C CD2 . LEU B 1 109 ? 34.219  68.072  53.678  1.00 20.00 ? 109  LEU B CD2 1 
ATOM   4475  N N   . ALA B 1 110 ? 32.464  68.202  48.422  1.00 20.00 ? 110  ALA B N   1 
ATOM   4476  C CA  . ALA B 1 110 ? 32.137  67.394  47.252  1.00 20.00 ? 110  ALA B CA  1 
ATOM   4477  C C   . ALA B 1 110 ? 32.682  67.845  45.899  1.00 20.00 ? 110  ALA B C   1 
ATOM   4478  O O   . ALA B 1 110 ? 32.560  67.122  44.909  1.00 20.00 ? 110  ALA B O   1 
ATOM   4479  C CB  . ALA B 1 110 ? 30.617  67.230  47.166  1.00 20.00 ? 110  ALA B CB  1 
ATOM   4480  N N   . ILE B 1 111 ? 33.293  69.020  45.849  1.00 20.00 ? 111  ILE B N   1 
ATOM   4481  C CA  . ILE B 1 111 ? 33.834  69.523  44.594  1.00 20.00 ? 111  ILE B CA  1 
ATOM   4482  C C   . ILE B 1 111 ? 35.355  69.495  44.475  1.00 20.00 ? 111  ILE B C   1 
ATOM   4483  O O   . ILE B 1 111 ? 36.075  69.809  45.426  1.00 20.00 ? 111  ILE B O   1 
ATOM   4484  C CB  . ILE B 1 111 ? 33.364  70.957  44.350  1.00 20.00 ? 111  ILE B CB  1 
ATOM   4485  C CG1 . ILE B 1 111 ? 31.845  70.977  44.219  1.00 20.00 ? 111  ILE B CG1 1 
ATOM   4486  C CG2 . ILE B 1 111 ? 34.016  71.521  43.107  1.00 20.00 ? 111  ILE B CG2 1 
ATOM   4487  C CD1 . ILE B 1 111 ? 31.271  72.367  44.133  1.00 20.00 ? 111  ILE B CD1 1 
ATOM   4488  N N   . LYS B 1 112 ? 35.824  69.117  43.285  1.00 20.00 ? 112  LYS B N   1 
ATOM   4489  C CA  . LYS B 1 112 ? 37.248  69.032  42.962  1.00 20.00 ? 112  LYS B CA  1 
ATOM   4490  C C   . LYS B 1 112 ? 37.480  69.907  41.732  1.00 20.00 ? 112  LYS B C   1 
ATOM   4491  O O   . LYS B 1 112 ? 36.728  69.831  40.757  1.00 20.00 ? 112  LYS B O   1 
ATOM   4492  C CB  . LYS B 1 112 ? 37.646  67.591  42.639  1.00 20.00 ? 112  LYS B CB  1 
ATOM   4493  C CG  . LYS B 1 112 ? 37.627  66.662  43.836  1.00 20.00 ? 112  LYS B CG  1 
ATOM   4494  C CD  . LYS B 1 112 ? 38.603  65.517  43.650  1.00 20.00 ? 112  LYS B CD  1 
ATOM   4495  C CE  . LYS B 1 112 ? 37.897  64.171  43.752  1.00 20.00 ? 112  LYS B CE  1 
ATOM   4496  N NZ  . LYS B 1 112 ? 36.715  64.082  42.840  1.00 20.00 ? 112  LYS B NZ  1 
ATOM   4497  N N   . PRO B 1 113 ? 38.517  70.758  41.767  1.00 20.00 ? 113  PRO B N   1 
ATOM   4498  C CA  . PRO B 1 113 ? 38.659  71.804  40.747  1.00 20.00 ? 113  PRO B CA  1 
ATOM   4499  C C   . PRO B 1 113 ? 38.485  71.238  39.344  1.00 20.00 ? 113  PRO B C   1 
ATOM   4500  O O   . PRO B 1 113 ? 39.012  70.168  39.032  1.00 20.00 ? 113  PRO B O   1 
ATOM   4501  C CB  . PRO B 1 113 ? 40.066  72.343  40.976  1.00 20.00 ? 113  PRO B CB  1 
ATOM   4502  C CG  . PRO B 1 113 ? 40.326  72.079  42.424  1.00 20.00 ? 113  PRO B CG  1 
ATOM   4503  C CD  . PRO B 1 113 ? 39.618  70.789  42.746  1.00 20.00 ? 113  PRO B CD  1 
ATOM   4504  N N   . GLY B 1 114 ? 37.730  71.956  38.515  1.00 20.00 ? 114  GLY B N   1 
ATOM   4505  C CA  . GLY B 1 114 ? 37.489  71.523  37.149  1.00 20.00 ? 114  GLY B CA  1 
ATOM   4506  C C   . GLY B 1 114 ? 36.309  70.578  36.991  1.00 20.00 ? 114  GLY B C   1 
ATOM   4507  O O   . GLY B 1 114 ? 35.893  70.277  35.865  1.00 20.00 ? 114  GLY B O   1 
ATOM   4508  N N   . GLN B 1 115 ? 35.773  70.095  38.108  1.00 20.00 ? 115  GLN B N   1 
ATOM   4509  C CA  . GLN B 1 115 ? 34.642  69.185  38.053  1.00 20.00 ? 115  GLN B CA  1 
ATOM   4510  C C   . GLN B 1 115 ? 33.382  69.965  37.698  1.00 20.00 ? 115  GLN B C   1 
ATOM   4511  O O   . GLN B 1 115 ? 33.356  71.194  37.783  1.00 20.00 ? 115  GLN B O   1 
ATOM   4512  C CB  . GLN B 1 115 ? 34.480  68.467  39.391  1.00 20.00 ? 115  GLN B CB  1 
ATOM   4513  C CG  . GLN B 1 115 ? 35.314  67.205  39.485  1.00 20.00 ? 115  GLN B CG  1 
ATOM   4514  C CD  . GLN B 1 115 ? 34.952  66.346  40.675  1.00 20.00 ? 115  GLN B CD  1 
ATOM   4515  O OE1 . GLN B 1 115 ? 34.534  66.856  41.718  1.00 20.00 ? 115  GLN B OE1 1 
ATOM   4516  N NE2 . GLN B 1 115 ? 35.113  65.029  40.530  1.00 20.00 ? 115  GLN B NE2 1 
ATOM   4517  N N   . TYR B 1 116 ? 32.337  69.256  37.290  1.00 20.00 ? 116  TYR B N   1 
ATOM   4518  C CA  . TYR B 1 116 ? 31.089  69.915  36.922  1.00 20.00 ? 116  TYR B CA  1 
ATOM   4519  C C   . TYR B 1 116 ? 29.971  69.652  37.913  1.00 20.00 ? 116  TYR B C   1 
ATOM   4520  O O   . TYR B 1 116 ? 29.935  68.604  38.562  1.00 20.00 ? 116  TYR B O   1 
ATOM   4521  C CB  . TYR B 1 116 ? 30.636  69.450  35.534  1.00 20.00 ? 116  TYR B CB  1 
ATOM   4522  C CG  . TYR B 1 116 ? 31.469  70.006  34.406  1.00 20.00 ? 116  TYR B CG  1 
ATOM   4523  C CD1 . TYR B 1 116 ? 32.633  69.362  33.990  1.00 20.00 ? 116  TYR B CD1 1 
ATOM   4524  C CD2 . TYR B 1 116 ? 31.106  71.192  33.771  1.00 20.00 ? 116  TYR B CD2 1 
ATOM   4525  C CE1 . TYR B 1 116 ? 33.418  69.887  32.970  1.00 20.00 ? 116  TYR B CE1 1 
ATOM   4526  C CE2 . TYR B 1 116 ? 31.881  71.727  32.751  1.00 20.00 ? 116  TYR B CE2 1 
ATOM   4527  C CZ  . TYR B 1 116 ? 33.037  71.072  32.355  1.00 20.00 ? 116  TYR B CZ  1 
ATOM   4528  O OH  . TYR B 1 116 ? 33.812  71.616  31.352  1.00 20.00 ? 116  TYR B OH  1 
ATOM   4529  N N   . VAL B 1 117 ? 29.063  70.617  38.020  1.00 20.00 ? 117  VAL B N   1 
ATOM   4530  C CA  . VAL B 1 117 ? 27.915  70.520  38.917  1.00 20.00 ? 117  VAL B CA  1 
ATOM   4531  C C   . VAL B 1 117 ? 26.672  70.874  38.100  1.00 20.00 ? 117  VAL B C   1 
ATOM   4532  O O   . VAL B 1 117 ? 26.502  72.011  37.662  1.00 20.00 ? 117  VAL B O   1 
ATOM   4533  C CB  . VAL B 1 117 ? 28.032  71.490  40.114  1.00 20.00 ? 117  VAL B CB  1 
ATOM   4534  C CG1 . VAL B 1 117 ? 26.729  71.495  40.907  1.00 20.00 ? 117  VAL B CG1 1 
ATOM   4535  C CG2 . VAL B 1 117 ? 29.184  71.065  41.012  1.00 20.00 ? 117  VAL B CG2 1 
ATOM   4536  N N   . ALA B 1 118 ? 25.814  69.890  37.882  1.00 20.00 ? 118  ALA B N   1 
ATOM   4537  C CA  . ALA B 1 118 ? 24.601  70.113  37.115  1.00 20.00 ? 118  ALA B CA  1 
ATOM   4538  C C   . ALA B 1 118 ? 23.408  70.178  38.042  1.00 20.00 ? 118  ALA B C   1 
ATOM   4539  O O   . ALA B 1 118 ? 23.349  69.472  39.050  1.00 20.00 ? 118  ALA B O   1 
ATOM   4540  C CB  . ALA B 1 118 ? 24.404  68.994  36.098  1.00 20.00 ? 118  ALA B CB  1 
ATOM   4541  N N   . GLY B 1 119 ? 22.454  71.030  37.689  1.00 20.00 ? 119  GLY B N   1 
ATOM   4542  C CA  . GLY B 1 119 ? 21.260  71.182  38.494  1.00 20.00 ? 119  GLY B CA  1 
ATOM   4543  C C   . GLY B 1 119 ? 20.209  71.994  37.769  1.00 20.00 ? 119  GLY B C   1 
ATOM   4544  O O   . GLY B 1 119 ? 20.517  72.696  36.801  1.00 20.00 ? 119  GLY B O   1 
ATOM   4545  N N   . ASN B 1 120 ? 18.964  71.893  38.232  1.00 20.00 ? 120  ASN B N   1 
ATOM   4546  C CA  . ASN B 1 120 ? 17.871  72.626  37.619  1.00 20.00 ? 120  ASN B CA  1 
ATOM   4547  C C   . ASN B 1 120 ? 17.932  74.083  38.051  1.00 20.00 ? 120  ASN B C   1 
ATOM   4548  O O   . ASN B 1 120 ? 17.427  74.449  39.108  1.00 20.00 ? 120  ASN B O   1 
ATOM   4549  C CB  . ASN B 1 120 ? 16.525  72.006  38.010  1.00 20.00 ? 120  ASN B CB  1 
ATOM   4550  C CG  . ASN B 1 120 ? 16.384  71.790  39.506  1.00 20.00 ? 120  ASN B CG  1 
ATOM   4551  O OD1 . ASN B 1 120 ? 17.365  71.817  40.253  1.00 20.00 ? 120  ASN B OD1 1 
ATOM   4552  N ND2 . ASN B 1 120 ? 15.154  71.570  39.950  1.00 20.00 ? 120  ASN B ND2 1 
ATOM   4553  N N   . MET B 1 121 ? 18.566  74.910  37.224  1.00 20.00 ? 121  MET B N   1 
ATOM   4554  C CA  . MET B 1 121 ? 18.708  76.337  37.504  1.00 20.00 ? 121  MET B CA  1 
ATOM   4555  C C   . MET B 1 121 ? 19.632  76.520  38.706  1.00 20.00 ? 121  MET B C   1 
ATOM   4556  O O   . MET B 1 121 ? 20.266  75.560  39.153  1.00 20.00 ? 121  MET B O   1 
ATOM   4557  C CB  . MET B 1 121 ? 17.336  76.974  37.774  1.00 20.00 ? 121  MET B CB  1 
ATOM   4558  C CG  . MET B 1 121 ? 16.984  78.132  36.834  1.00 20.00 ? 121  MET B CG  1 
ATOM   4559  S SD  . MET B 1 121 ? 15.307  78.047  36.148  1.00 20.00 ? 121  MET B SD  1 
ATOM   4560  C CE  . MET B 1 121 ? 15.128  79.680  35.482  1.00 20.00 ? 121  MET B CE  1 
ATOM   4561  N N   . TYR B 1 122 ? 19.703  77.737  39.239  1.00 20.00 ? 122  TYR B N   1 
ATOM   4562  C CA  . TYR B 1 122 ? 20.572  77.993  40.387  1.00 20.00 ? 122  TYR B CA  1 
ATOM   4563  C C   . TYR B 1 122 ? 20.113  79.141  41.288  1.00 20.00 ? 122  TYR B C   1 
ATOM   4564  O O   . TYR B 1 122 ? 19.142  79.840  40.990  1.00 20.00 ? 122  TYR B O   1 
ATOM   4565  C CB  . TYR B 1 122 ? 21.977  78.320  39.888  1.00 20.00 ? 122  TYR B CB  1 
ATOM   4566  C CG  . TYR B 1 122 ? 22.004  79.645  39.173  1.00 20.00 ? 122  TYR B CG  1 
ATOM   4567  C CD1 . TYR B 1 122 ? 21.558  79.754  37.851  1.00 20.00 ? 122  TYR B CD1 1 
ATOM   4568  C CD2 . TYR B 1 122 ? 22.388  80.809  39.840  1.00 20.00 ? 122  TYR B CD2 1 
ATOM   4569  C CE1 . TYR B 1 122 ? 21.486  80.990  37.216  1.00 20.00 ? 122  TYR B CE1 1 
ATOM   4570  C CE2 . TYR B 1 122 ? 22.319  82.050  39.213  1.00 20.00 ? 122  TYR B CE2 1 
ATOM   4571  C CZ  . TYR B 1 122 ? 21.864  82.133  37.903  1.00 20.00 ? 122  TYR B CZ  1 
ATOM   4572  O OH  . TYR B 1 122 ? 21.765  83.366  37.293  1.00 20.00 ? 122  TYR B OH  1 
ATOM   4573  N N   . PHE B 1 123 ? 20.835  79.319  42.392  1.00 20.00 ? 123  PHE B N   1 
ATOM   4574  C CA  . PHE B 1 123 ? 20.558  80.370  43.366  1.00 20.00 ? 123  PHE B CA  1 
ATOM   4575  C C   . PHE B 1 123 ? 21.917  81.026  43.600  1.00 20.00 ? 123  PHE B C   1 
ATOM   4576  O O   . PHE B 1 123 ? 22.947  80.360  43.529  1.00 20.00 ? 123  PHE B O   1 
ATOM   4577  C CB  . PHE B 1 123 ? 20.004  79.790  44.675  1.00 20.00 ? 123  PHE B CB  1 
ATOM   4578  C CG  . PHE B 1 123 ? 19.691  80.837  45.718  1.00 20.00 ? 123  PHE B CG  1 
ATOM   4579  C CD1 . PHE B 1 123 ? 18.673  81.763  45.512  1.00 20.00 ? 123  PHE B CD1 1 
ATOM   4580  C CD2 . PHE B 1 123 ? 20.440  80.918  46.888  1.00 20.00 ? 123  PHE B CD2 1 
ATOM   4581  C CE1 . PHE B 1 123 ? 18.410  82.755  46.452  1.00 20.00 ? 123  PHE B CE1 1 
ATOM   4582  C CE2 . PHE B 1 123 ? 20.184  81.912  47.840  1.00 20.00 ? 123  PHE B CE2 1 
ATOM   4583  C CZ  . PHE B 1 123 ? 19.170  82.830  47.621  1.00 20.00 ? 123  PHE B CZ  1 
ATOM   4584  N N   . THR B 1 124 ? 21.917  82.325  43.872  1.00 20.00 ? 124  THR B N   1 
ATOM   4585  C CA  . THR B 1 124 ? 23.153  83.073  44.105  1.00 20.00 ? 124  THR B CA  1 
ATOM   4586  C C   . THR B 1 124 ? 24.189  82.482  45.062  1.00 20.00 ? 124  THR B C   1 
ATOM   4587  O O   . THR B 1 124 ? 25.308  82.182  44.651  1.00 20.00 ? 124  THR B O   1 
ATOM   4588  C CB  . THR B 1 124 ? 22.843  84.503  44.578  1.00 20.00 ? 124  THR B CB  1 
ATOM   4589  O OG1 . THR B 1 124 ? 22.240  84.460  45.879  1.00 20.00 ? 124  THR B OG1 1 
ATOM   4590  C CG2 . THR B 1 124 ? 21.894  85.187  43.596  1.00 20.00 ? 124  THR B CG2 1 
ATOM   4591  N N   . THR B 1 125 ? 23.823  82.326  46.333  1.00 20.00 ? 125  THR B N   1 
ATOM   4592  C CA  . THR B 1 125 ? 24.742  81.778  47.328  1.00 20.00 ? 125  THR B CA  1 
ATOM   4593  C C   . THR B 1 125 ? 25.220  80.359  47.024  1.00 20.00 ? 125  THR B C   1 
ATOM   4594  O O   . THR B 1 125 ? 26.408  80.054  47.184  1.00 20.00 ? 125  THR B O   1 
ATOM   4595  C CB  . THR B 1 125 ? 24.125  81.801  48.765  1.00 20.00 ? 125  THR B CB  1 
ATOM   4596  O OG1 . THR B 1 125 ? 22.959  80.968  48.814  1.00 20.00 ? 125  THR B OG1 1 
ATOM   4597  C CG2 . THR B 1 125 ? 23.750  83.218  49.161  1.00 20.00 ? 125  THR B CG2 1 
ATOM   4598  N N   . THR B 1 126 ? 24.315  79.496  46.575  1.00 20.00 ? 126  THR B N   1 
ATOM   4599  C CA  . THR B 1 126 ? 24.703  78.123  46.271  1.00 20.00 ? 126  THR B CA  1 
ATOM   4600  C C   . THR B 1 126 ? 25.658  78.012  45.081  1.00 20.00 ? 126  THR B C   1 
ATOM   4601  O O   . THR B 1 126 ? 26.672  77.310  45.156  1.00 20.00 ? 126  THR B O   1 
ATOM   4602  C CB  . THR B 1 126 ? 23.466  77.226  46.021  1.00 20.00 ? 126  THR B CB  1 
ATOM   4603  O OG1 . THR B 1 126 ? 23.550  76.646  44.715  1.00 20.00 ? 126  THR B OG1 1 
ATOM   4604  C CG2 . THR B 1 126 ? 22.187  78.029  46.139  1.00 20.00 ? 126  THR B CG2 1 
ATOM   4605  N N   . ARG B 1 127 ? 25.349  78.702  43.989  1.00 20.00 ? 127  ARG B N   1 
ATOM   4606  C CA  . ARG B 1 127 ? 26.207  78.650  42.810  1.00 20.00 ? 127  ARG B CA  1 
ATOM   4607  C C   . ARG B 1 127 ? 27.582  79.214  43.140  1.00 20.00 ? 127  ARG B C   1 
ATOM   4608  O O   . ARG B 1 127 ? 28.607  78.689  42.692  1.00 20.00 ? 127  ARG B O   1 
ATOM   4609  C CB  . ARG B 1 127 ? 25.586  79.444  41.657  1.00 20.00 ? 127  ARG B CB  1 
ATOM   4610  C CG  . ARG B 1 127 ? 26.051  78.994  40.280  1.00 20.00 ? 127  ARG B CG  1 
ATOM   4611  C CD  . ARG B 1 127 ? 26.499  80.176  39.422  1.00 20.00 ? 127  ARG B CD  1 
ATOM   4612  N NE  . ARG B 1 127 ? 25.601  80.406  38.297  1.00 20.00 ? 127  ARG B NE  1 
ATOM   4613  C CZ  . ARG B 1 127 ? 25.918  80.255  37.012  1.00 20.00 ? 127  ARG B CZ  1 
ATOM   4614  N NH1 . ARG B 1 127 ? 27.135  79.870  36.639  1.00 20.00 ? 127  ARG B NH1 1 
ATOM   4615  N NH2 . ARG B 1 127 ? 25.000  80.498  36.088  1.00 20.00 ? 127  ARG B NH2 1 
ATOM   4616  N N   . PHE B 1 128 ? 27.596  80.286  43.927  1.00 20.00 ? 128  PHE B N   1 
ATOM   4617  C CA  . PHE B 1 128 ? 28.848  80.920  44.317  1.00 20.00 ? 128  PHE B CA  1 
ATOM   4618  C C   . PHE B 1 128 ? 29.799  79.892  44.917  1.00 20.00 ? 128  PHE B C   1 
ATOM   4619  O O   . PHE B 1 128 ? 30.872  79.640  44.377  1.00 20.00 ? 128  PHE B O   1 
ATOM   4620  C CB  . PHE B 1 128 ? 28.598  82.034  45.340  1.00 20.00 ? 128  PHE B CB  1 
ATOM   4621  C CG  . PHE B 1 128 ? 29.828  82.430  46.116  1.00 20.00 ? 128  PHE B CG  1 
ATOM   4622  C CD1 . PHE B 1 128 ? 30.673  83.426  45.640  1.00 20.00 ? 128  PHE B CD1 1 
ATOM   4623  C CD2 . PHE B 1 128 ? 30.158  81.782  47.309  1.00 20.00 ? 128  PHE B CD2 1 
ATOM   4624  C CE1 . PHE B 1 128 ? 31.836  83.771  46.339  1.00 20.00 ? 128  PHE B CE1 1 
ATOM   4625  C CE2 . PHE B 1 128 ? 31.316  82.115  48.018  1.00 20.00 ? 128  PHE B CE2 1 
ATOM   4626  C CZ  . PHE B 1 128 ? 32.158  83.110  47.532  1.00 20.00 ? 128  PHE B CZ  1 
ATOM   4627  N N   . HIS B 1 129 ? 29.395  79.303  46.039  1.00 20.00 ? 129  HIS B N   1 
ATOM   4628  C CA  . HIS B 1 129 ? 30.213  78.306  46.712  1.00 20.00 ? 129  HIS B CA  1 
ATOM   4629  C C   . HIS B 1 129 ? 30.636  77.198  45.761  1.00 20.00 ? 129  HIS B C   1 
ATOM   4630  O O   . HIS B 1 129 ? 31.707  76.609  45.918  1.00 20.00 ? 129  HIS B O   1 
ATOM   4631  C CB  . HIS B 1 129 ? 29.449  77.735  47.899  1.00 20.00 ? 129  HIS B CB  1 
ATOM   4632  C CG  . HIS B 1 129 ? 29.305  78.703  49.032  1.00 20.00 ? 129  HIS B CG  1 
ATOM   4633  N ND1 . HIS B 1 129 ? 30.387  79.320  49.625  1.00 20.00 ? 129  HIS B ND1 1 
ATOM   4634  C CD2 . HIS B 1 129 ? 28.207  79.183  49.664  1.00 20.00 ? 129  HIS B CD2 1 
ATOM   4635  C CE1 . HIS B 1 129 ? 29.963  80.136  50.573  1.00 20.00 ? 129  HIS B CE1 1 
ATOM   4636  N NE2 . HIS B 1 129 ? 28.644  80.072  50.617  1.00 20.00 ? 129  HIS B NE2 1 
ATOM   4637  N N   . GLN B 1 130 ? 29.795  76.925  44.770  1.00 20.00 ? 130  GLN B N   1 
ATOM   4638  C CA  . GLN B 1 130 ? 30.088  75.889  43.792  1.00 20.00 ? 130  GLN B CA  1 
ATOM   4639  C C   . GLN B 1 130 ? 31.319  76.305  43.008  1.00 20.00 ? 130  GLN B C   1 
ATOM   4640  O O   . GLN B 1 130 ? 32.335  75.606  42.991  1.00 20.00 ? 130  GLN B O   1 
ATOM   4641  C CB  . GLN B 1 130 ? 28.915  75.721  42.828  1.00 20.00 ? 130  GLN B CB  1 
ATOM   4642  C CG  . GLN B 1 130 ? 28.008  74.554  43.155  1.00 20.00 ? 130  GLN B CG  1 
ATOM   4643  C CD  . GLN B 1 130 ? 26.597  74.774  42.655  1.00 20.00 ? 130  GLN B CD  1 
ATOM   4644  O OE1 . GLN B 1 130 ? 25.635  74.291  43.247  1.00 20.00 ? 130  GLN B OE1 1 
ATOM   4645  N NE2 . GLN B 1 130 ? 26.467  75.508  41.556  1.00 20.00 ? 130  GLN B NE2 1 
ATOM   4646  N N   . GLU B 1 131 ? 31.217  77.461  42.365  1.00 20.00 ? 131  GLU B N   1 
ATOM   4647  C CA  . GLU B 1 131 ? 32.307  77.994  41.568  1.00 20.00 ? 131  GLU B CA  1 
ATOM   4648  C C   . GLU B 1 131 ? 33.516  78.356  42.420  1.00 20.00 ? 131  GLU B C   1 
ATOM   4649  O O   . GLU B 1 131 ? 34.662  78.082  42.049  1.00 20.00 ? 131  GLU B O   1 
ATOM   4650  C CB  . GLU B 1 131 ? 31.827  79.216  40.799  1.00 20.00 ? 131  GLU B CB  1 
ATOM   4651  C CG  . GLU B 1 131 ? 30.971  78.859  39.606  1.00 20.00 ? 131  GLU B CG  1 
ATOM   4652  C CD  . GLU B 1 131 ? 30.092  80.002  39.163  1.00 20.00 ? 131  GLU B CD  1 
ATOM   4653  O OE1 . GLU B 1 131 ? 30.320  81.145  39.622  1.00 20.00 ? 131  GLU B OE1 1 
ATOM   4654  O OE2 . GLU B 1 131 ? 29.172  79.753  38.353  1.00 20.00 ? 131  GLU B OE2 1 
ATOM   4655  N N   . LYS B 1 132 ? 33.254  78.973  43.566  1.00 20.00 ? 132  LYS B N   1 
ATOM   4656  C CA  . LYS B 1 132 ? 34.318  79.373  44.471  1.00 20.00 ? 132  LYS B CA  1 
ATOM   4657  C C   . LYS B 1 132 ? 35.264  78.207  44.727  1.00 20.00 ? 132  LYS B C   1 
ATOM   4658  O O   . LYS B 1 132 ? 36.460  78.410  44.942  1.00 20.00 ? 132  LYS B O   1 
ATOM   4659  C CB  . LYS B 1 132 ? 33.723  79.863  45.794  1.00 20.00 ? 132  LYS B CB  1 
ATOM   4660  C CG  . LYS B 1 132 ? 34.744  80.102  46.895  1.00 20.00 ? 132  LYS B CG  1 
ATOM   4661  C CD  . LYS B 1 132 ? 34.737  78.959  47.906  1.00 20.00 ? 132  LYS B CD  1 
ATOM   4662  C CE  . LYS B 1 132 ? 33.710  79.186  49.019  1.00 20.00 ? 132  LYS B CE  1 
ATOM   4663  N NZ  . LYS B 1 132 ? 33.247  77.901  49.629  1.00 20.00 ? 132  LYS B NZ  1 
ATOM   4664  N N   . ASN B 1 133 ? 34.732  76.987  44.686  1.00 20.00 ? 133  ASN B N   1 
ATOM   4665  C CA  . ASN B 1 133 ? 35.541  75.795  44.922  1.00 20.00 ? 133  ASN B CA  1 
ATOM   4666  C C   . ASN B 1 133 ? 36.052  75.104  43.656  1.00 20.00 ? 133  ASN B C   1 
ATOM   4667  O O   . ASN B 1 133 ? 36.345  73.906  43.672  1.00 20.00 ? 133  ASN B O   1 
ATOM   4668  C CB  . ASN B 1 133 ? 34.754  74.801  45.787  1.00 20.00 ? 133  ASN B CB  1 
ATOM   4669  C CG  . ASN B 1 133 ? 34.584  75.291  47.216  1.00 20.00 ? 133  ASN B CG  1 
ATOM   4670  O OD1 . ASN B 1 133 ? 33.555  75.871  47.569  1.00 20.00 ? 133  ASN B OD1 1 
ATOM   4671  N ND2 . ASN B 1 133 ? 35.600  75.068  48.044  1.00 20.00 ? 133  ASN B ND2 1 
ATOM   4672  N N   . GLY B 1 134 ? 36.157  75.864  42.568  1.00 20.00 ? 134  GLY B N   1 
ATOM   4673  C CA  . GLY B 1 134 ? 36.636  75.314  41.312  1.00 20.00 ? 134  GLY B CA  1 
ATOM   4674  C C   . GLY B 1 134 ? 35.715  74.307  40.649  1.00 20.00 ? 134  GLY B C   1 
ATOM   4675  O O   . GLY B 1 134 ? 36.061  73.134  40.515  1.00 20.00 ? 134  GLY B O   1 
ATOM   4676  N N   . ALA B 1 135 ? 34.541  74.763  40.228  1.00 20.00 ? 135  ALA B N   1 
ATOM   4677  C CA  . ALA B 1 135 ? 33.576  73.891  39.576  1.00 20.00 ? 135  ALA B CA  1 
ATOM   4678  C C   . ALA B 1 135 ? 32.792  74.693  38.549  1.00 20.00 ? 135  ALA B C   1 
ATOM   4679  O O   . ALA B 1 135 ? 32.619  75.900  38.703  1.00 20.00 ? 135  ALA B O   1 
ATOM   4680  C CB  . ALA B 1 135 ? 32.637  73.297  40.606  1.00 20.00 ? 135  ALA B CB  1 
ATOM   4681  N N   . THR B 1 136 ? 32.321  74.025  37.500  1.00 20.00 ? 136  THR B N   1 
ATOM   4682  C CA  . THR B 1 136 ? 31.550  74.689  36.447  1.00 20.00 ? 136  THR B CA  1 
ATOM   4683  C C   . THR B 1 136 ? 30.076  74.295  36.567  1.00 20.00 ? 136  THR B C   1 
ATOM   4684  O O   . THR B 1 136 ? 29.746  73.105  36.544  1.00 20.00 ? 136  THR B O   1 
ATOM   4685  C CB  . THR B 1 136 ? 32.068  74.289  35.040  1.00 20.00 ? 136  THR B CB  1 
ATOM   4686  O OG1 . THR B 1 136 ? 33.464  74.593  34.939  1.00 20.00 ? 136  THR B OG1 1 
ATOM   4687  C CG2 . THR B 1 136 ? 31.316  75.042  33.953  1.00 20.00 ? 136  THR B CG2 1 
ATOM   4688  N N   . PHE B 1 137 ? 29.194  75.286  36.698  1.00 20.00 ? 137  PHE B N   1 
ATOM   4689  C CA  . PHE B 1 137 ? 27.762  75.007  36.823  1.00 20.00 ? 137  PHE B CA  1 
ATOM   4690  C C   . PHE B 1 137 ? 27.090  74.767  35.478  1.00 20.00 ? 137  PHE B C   1 
ATOM   4691  O O   . PHE B 1 137 ? 27.241  75.559  34.545  1.00 20.00 ? 137  PHE B O   1 
ATOM   4692  C CB  . PHE B 1 137 ? 27.034  76.151  37.535  1.00 20.00 ? 137  PHE B CB  1 
ATOM   4693  C CG  . PHE B 1 137 ? 25.529  76.001  37.533  1.00 20.00 ? 137  PHE B CG  1 
ATOM   4694  C CD1 . PHE B 1 137 ? 24.918  74.977  38.253  1.00 20.00 ? 137  PHE B CD1 1 
ATOM   4695  C CD2 . PHE B 1 137 ? 24.725  76.863  36.784  1.00 20.00 ? 137  PHE B CD2 1 
ATOM   4696  C CE1 . PHE B 1 137 ? 23.522  74.808  38.226  1.00 20.00 ? 137  PHE B CE1 1 
ATOM   4697  C CE2 . PHE B 1 137 ? 23.331  76.704  36.749  1.00 20.00 ? 137  PHE B CE2 1 
ATOM   4698  C CZ  . PHE B 1 137 ? 22.731  75.673  37.471  1.00 20.00 ? 137  PHE B CZ  1 
ATOM   4699  N N   . VAL B 1 138 ? 26.335  73.676  35.391  1.00 20.00 ? 138  VAL B N   1 
ATOM   4700  C CA  . VAL B 1 138 ? 25.638  73.332  34.163  1.00 20.00 ? 138  VAL B CA  1 
ATOM   4701  C C   . VAL B 1 138 ? 24.134  73.220  34.393  1.00 20.00 ? 138  VAL B C   1 
ATOM   4702  O O   . VAL B 1 138 ? 23.662  72.297  35.056  1.00 20.00 ? 138  VAL B O   1 
ATOM   4703  C CB  . VAL B 1 138 ? 26.165  72.002  33.583  1.00 20.00 ? 138  VAL B CB  1 
ATOM   4704  C CG1 . VAL B 1 138 ? 25.413  71.655  32.300  1.00 20.00 ? 138  VAL B CG1 1 
ATOM   4705  C CG2 . VAL B 1 138 ? 27.658  72.124  33.305  1.00 20.00 ? 138  VAL B CG2 1 
ATOM   4706  N N   . ASP B 1 139 ? 23.388  74.174  33.846  1.00 20.00 ? 139  ASP B N   1 
ATOM   4707  C CA  . ASP B 1 139 ? 21.942  74.177  33.993  1.00 20.00 ? 139  ASP B CA  1 
ATOM   4708  C C   . ASP B 1 139 ? 21.338  73.118  33.086  1.00 20.00 ? 139  ASP B C   1 
ATOM   4709  O O   . ASP B 1 139 ? 21.468  73.181  31.864  1.00 20.00 ? 139  ASP B O   1 
ATOM   4710  C CB  . ASP B 1 139 ? 21.370  75.547  33.640  1.00 20.00 ? 139  ASP B CB  1 
ATOM   4711  C CG  . ASP B 1 139 ? 19.920  75.705  34.080  1.00 20.00 ? 139  ASP B CG  1 
ATOM   4712  O OD1 . ASP B 1 139 ? 19.256  74.676  34.339  1.00 20.00 ? 139  ASP B OD1 1 
ATOM   4713  O OD2 . ASP B 1 139 ? 19.445  76.861  34.165  1.00 20.00 ? 139  ASP B OD2 1 
ATOM   4714  N N   . ILE B 1 140 ? 20.669  72.149  33.695  1.00 20.00 ? 140  ILE B N   1 
ATOM   4715  C CA  . ILE B 1 140 ? 20.044  71.070  32.954  1.00 20.00 ? 140  ILE B CA  1 
ATOM   4716  C C   . ILE B 1 140 ? 18.521  71.044  33.108  1.00 20.00 ? 140  ILE B C   1 
ATOM   4717  O O   . ILE B 1 140 ? 17.898  69.993  32.951  1.00 20.00 ? 140  ILE B O   1 
ATOM   4718  C CB  . ILE B 1 140 ? 20.632  69.715  33.407  1.00 20.00 ? 140  ILE B CB  1 
ATOM   4719  C CG1 . ILE B 1 140 ? 20.486  69.552  34.921  1.00 20.00 ? 140  ILE B CG1 1 
ATOM   4720  C CG2 . ILE B 1 140 ? 22.110  69.656  33.065  1.00 20.00 ? 140  ILE B CG2 1 
ATOM   4721  C CD1 . ILE B 1 140 ? 20.865  68.165  35.427  1.00 20.00 ? 140  ILE B CD1 1 
ATOM   4722  N N   . VAL B 1 141 ? 17.924  72.195  33.417  1.00 20.00 ? 141  VAL B N   1 
ATOM   4723  C CA  . VAL B 1 141 ? 16.474  72.275  33.585  1.00 20.00 ? 141  VAL B CA  1 
ATOM   4724  C C   . VAL B 1 141 ? 15.800  72.377  32.223  1.00 20.00 ? 141  VAL B C   1 
ATOM   4725  O O   . VAL B 1 141 ? 16.381  72.909  31.277  1.00 20.00 ? 141  VAL B O   1 
ATOM   4726  C CB  . VAL B 1 141 ? 16.061  73.509  34.438  1.00 20.00 ? 141  VAL B CB  1 
ATOM   4727  C CG1 . VAL B 1 141 ? 15.950  74.751  33.564  1.00 20.00 ? 141  VAL B CG1 1 
ATOM   4728  C CG2 . VAL B 1 141 ? 14.726  73.239  35.126  1.00 20.00 ? 141  VAL B CG2 1 
ATOM   4729  N N   . ARG B 1 142 ? 14.572  71.879  32.124  1.00 20.00 ? 142  ARG B N   1 
ATOM   4730  C CA  . ARG B 1 142 ? 13.844  71.929  30.860  1.00 20.00 ? 142  ARG B CA  1 
ATOM   4731  C C   . ARG B 1 142 ? 13.737  73.367  30.349  1.00 20.00 ? 142  ARG B C   1 
ATOM   4732  O O   . ARG B 1 142 ? 13.602  74.311  31.130  1.00 20.00 ? 142  ARG B O   1 
ATOM   4733  C CB  . ARG B 1 142 ? 12.452  71.303  31.016  1.00 20.00 ? 142  ARG B CB  1 
ATOM   4734  C CG  . ARG B 1 142 ? 11.703  71.714  32.272  1.00 20.00 ? 142  ARG B CG  1 
ATOM   4735  C CD  . ARG B 1 142 ? 10.201  71.724  32.018  1.00 20.00 ? 142  ARG B CD  1 
ATOM   4736  N NE  . ARG B 1 142 ? 9.511   70.611  32.666  1.00 20.00 ? 142  ARG B NE  1 
ATOM   4737  C CZ  . ARG B 1 142 ? 8.627   69.819  32.064  1.00 20.00 ? 142  ARG B CZ  1 
ATOM   4738  N NH1 . ARG B 1 142 ? 8.316   70.008  30.788  1.00 20.00 ? 142  ARG B NH1 1 
ATOM   4739  N NH2 . ARG B 1 142 ? 8.050   68.839  32.747  1.00 20.00 ? 142  ARG B NH2 1 
ATOM   4740  N N   . ASP B 1 143 ? 13.806  73.524  29.030  1.00 20.00 ? 143  ASP B N   1 
ATOM   4741  C CA  . ASP B 1 143 ? 13.726  74.839  28.396  1.00 20.00 ? 143  ASP B CA  1 
ATOM   4742  C C   . ASP B 1 143 ? 12.456  75.619  28.703  1.00 20.00 ? 143  ASP B C   1 
ATOM   4743  O O   . ASP B 1 143 ? 12.493  76.843  28.831  1.00 20.00 ? 143  ASP B O   1 
ATOM   4744  C CB  . ASP B 1 143 ? 13.873  74.701  26.880  1.00 20.00 ? 143  ASP B CB  1 
ATOM   4745  C CG  . ASP B 1 143 ? 15.225  74.152  26.474  1.00 20.00 ? 143  ASP B CG  1 
ATOM   4746  O OD1 . ASP B 1 143 ? 16.254  74.634  26.996  1.00 20.00 ? 143  ASP B OD1 1 
ATOM   4747  O OD2 . ASP B 1 143 ? 15.257  73.234  25.631  1.00 20.00 ? 143  ASP B OD2 1 
ATOM   4748  N N   . GLU B 1 144 ? 11.333  74.919  28.806  1.00 20.00 ? 144  GLU B N   1 
ATOM   4749  C CA  . GLU B 1 144 ? 10.067  75.574  29.096  1.00 20.00 ? 144  GLU B CA  1 
ATOM   4750  C C   . GLU B 1 144 ? 10.178  76.379  30.381  1.00 20.00 ? 144  GLU B C   1 
ATOM   4751  O O   . GLU B 1 144 ? 9.572   77.442  30.515  1.00 20.00 ? 144  GLU B O   1 
ATOM   4752  C CB  . GLU B 1 144 ? 8.961   74.534  29.227  1.00 20.00 ? 144  GLU B CB  1 
ATOM   4753  C CG  . GLU B 1 144 ? 8.645   73.815  27.925  1.00 20.00 ? 144  GLU B CG  1 
ATOM   4754  C CD  . GLU B 1 144 ? 9.408   72.510  27.765  1.00 20.00 ? 144  GLU B CD  1 
ATOM   4755  O OE1 . GLU B 1 144 ? 10.133  72.116  28.705  1.00 20.00 ? 144  GLU B OE1 1 
ATOM   4756  O OE2 . GLU B 1 144 ? 9.280   71.875  26.695  1.00 20.00 ? 144  GLU B OE2 1 
ATOM   4757  N N   . ALA B 1 145 ? 10.965  75.868  31.322  1.00 20.00 ? 145  ALA B N   1 
ATOM   4758  C CA  . ALA B 1 145 ? 11.165  76.531  32.605  1.00 20.00 ? 145  ALA B CA  1 
ATOM   4759  C C   . ALA B 1 145 ? 11.543  77.985  32.404  1.00 20.00 ? 145  ALA B C   1 
ATOM   4760  O O   . ALA B 1 145 ? 11.213  78.840  33.221  1.00 20.00 ? 145  ALA B O   1 
ATOM   4761  C CB  . ALA B 1 145 ? 12.257  75.823  33.391  1.00 20.00 ? 145  ALA B CB  1 
ATOM   4762  N N   . HIS B 1 146 ? 12.236  78.256  31.309  1.00 20.00 ? 146  HIS B N   1 
ATOM   4763  C CA  . HIS B 1 146 ? 12.671  79.605  30.993  1.00 20.00 ? 146  HIS B CA  1 
ATOM   4764  C C   . HIS B 1 146 ? 11.566  80.495  30.428  1.00 20.00 ? 146  HIS B C   1 
ATOM   4765  O O   . HIS B 1 146 ? 11.718  81.717  30.379  1.00 20.00 ? 146  HIS B O   1 
ATOM   4766  C CB  . HIS B 1 146 ? 13.853  79.545  30.019  1.00 20.00 ? 146  HIS B CB  1 
ATOM   4767  C CG  . HIS B 1 146 ? 15.077  78.908  30.603  1.00 20.00 ? 146  HIS B CG  1 
ATOM   4768  N ND1 . HIS B 1 146 ? 15.297  77.547  30.569  1.00 20.00 ? 146  HIS B ND1 1 
ATOM   4769  C CD2 . HIS B 1 146 ? 16.136  79.444  31.257  1.00 20.00 ? 146  HIS B CD2 1 
ATOM   4770  C CE1 . HIS B 1 146 ? 16.438  77.271  31.177  1.00 20.00 ? 146  HIS B CE1 1 
ATOM   4771  N NE2 . HIS B 1 146 ? 16.967  78.405  31.604  1.00 20.00 ? 146  HIS B NE2 1 
ATOM   4772  N N   . ASP B 1 147 ? 10.459  79.890  30.001  1.00 20.00 ? 147  ASP B N   1 
ATOM   4773  C CA  . ASP B 1 147 ? 9.348   80.660  29.447  1.00 20.00 ? 147  ASP B CA  1 
ATOM   4774  C C   . ASP B 1 147 ? 8.396   81.079  30.571  1.00 20.00 ? 147  ASP B C   1 
ATOM   4775  O O   . ASP B 1 147 ? 7.600   80.272  31.058  1.00 20.00 ? 147  ASP B O   1 
ATOM   4776  C CB  . ASP B 1 147 ? 8.594   79.834  28.404  1.00 20.00 ? 147  ASP B CB  1 
ATOM   4777  C CG  . ASP B 1 147 ? 7.468   80.618  27.740  1.00 20.00 ? 147  ASP B CG  1 
ATOM   4778  O OD1 . ASP B 1 147 ? 7.349   81.840  27.993  1.00 20.00 ? 147  ASP B OD1 1 
ATOM   4779  O OD2 . ASP B 1 147 ? 6.699   80.011  26.963  1.00 20.00 ? 147  ASP B OD2 1 
ATOM   4780  N N   . ALA B 1 148 ? 8.480   82.348  30.969  1.00 20.00 ? 148  ALA B N   1 
ATOM   4781  C CA  . ALA B 1 148 ? 7.645   82.897  32.035  1.00 20.00 ? 148  ALA B CA  1 
ATOM   4782  C C   . ALA B 1 148 ? 6.166   82.994  31.700  1.00 20.00 ? 148  ALA B C   1 
ATOM   4783  O O   . ALA B 1 148 ? 5.347   83.318  32.557  1.00 20.00 ? 148  ALA B O   1 
ATOM   4784  C CB  . ALA B 1 148 ? 8.163   84.271  32.436  1.00 20.00 ? 148  ALA B CB  1 
ATOM   4785  N N   . SER B 1 149 ? 5.814   82.715  30.457  1.00 20.00 ? 149  SER B N   1 
ATOM   4786  C CA  . SER B 1 149 ? 4.415   82.790  30.062  1.00 20.00 ? 149  SER B CA  1 
ATOM   4787  C C   . SER B 1 149 ? 3.784   81.409  29.968  1.00 20.00 ? 149  SER B C   1 
ATOM   4788  O O   . SER B 1 149 ? 2.565   81.266  30.060  1.00 20.00 ? 149  SER B O   1 
ATOM   4789  C CB  . SER B 1 149 ? 4.287   83.505  28.713  1.00 20.00 ? 149  SER B CB  1 
ATOM   4790  O OG  . SER B 1 149 ? 4.041   84.889  28.893  1.00 20.00 ? 149  SER B OG  1 
ATOM   4791  N N   . LEU B 1 150 ? 4.619   80.393  29.796  1.00 20.00 ? 150  LEU B N   1 
ATOM   4792  C CA  . LEU B 1 150 ? 4.133   79.027  29.684  1.00 20.00 ? 150  LEU B CA  1 
ATOM   4793  C C   . LEU B 1 150 ? 3.549   78.455  30.964  1.00 20.00 ? 150  LEU B C   1 
ATOM   4794  O O   . LEU B 1 150 ? 4.276   78.045  31.869  1.00 20.00 ? 150  LEU B O   1 
ATOM   4795  C CB  . LEU B 1 150 ? 5.252   78.114  29.189  1.00 20.00 ? 150  LEU B CB  1 
ATOM   4796  C CG  . LEU B 1 150 ? 4.817   76.739  28.677  1.00 20.00 ? 150  LEU B CG  1 
ATOM   4797  C CD1 . LEU B 1 150 ? 3.770   76.899  27.582  1.00 20.00 ? 150  LEU B CD1 1 
ATOM   4798  C CD2 . LEU B 1 150 ? 6.031   75.988  28.149  1.00 20.00 ? 150  LEU B CD2 1 
ATOM   4799  N N   . ASN B 1 151 ? 2.225   78.421  31.032  1.00 20.00 ? 151  ASN B N   1 
ATOM   4800  C CA  . ASN B 1 151 ? 1.552   77.889  32.202  1.00 20.00 ? 151  ASN B CA  1 
ATOM   4801  C C   . ASN B 1 151 ? 1.661   76.375  32.102  1.00 20.00 ? 151  ASN B C   1 
ATOM   4802  O O   . ASN B 1 151 ? 0.784   75.710  31.557  1.00 20.00 ? 151  ASN B O   1 
ATOM   4803  C CB  . ASN B 1 151 ? 0.085   78.319  32.216  1.00 20.00 ? 151  ASN B CB  1 
ATOM   4804  C CG  . ASN B 1 151 ? -0.545  78.183  33.584  1.00 20.00 ? 151  ASN B CG  1 
ATOM   4805  O OD1 . ASN B 1 151 ? -0.493  77.117  34.196  1.00 20.00 ? 151  ASN B OD1 1 
ATOM   4806  N ND2 . ASN B 1 151 ? -1.146  79.265  34.074  1.00 20.00 ? 151  ASN B ND2 1 
ATOM   4807  N N   . LEU B 1 152 ? 2.759   75.841  32.616  1.00 20.00 ? 152  LEU B N   1 
ATOM   4808  C CA  . LEU B 1 152 ? 2.993   74.408  32.585  1.00 20.00 ? 152  LEU B CA  1 
ATOM   4809  C C   . LEU B 1 152 ? 3.416   73.918  33.973  1.00 20.00 ? 152  LEU B C   1 
ATOM   4810  O O   . LEU B 1 152 ? 4.233   74.547  34.644  1.00 20.00 ? 152  LEU B O   1 
ATOM   4811  C CB  . LEU B 1 152 ? 4.065   74.095  31.532  1.00 20.00 ? 152  LEU B CB  1 
ATOM   4812  C CG  . LEU B 1 152 ? 5.057   72.961  31.780  1.00 20.00 ? 152  LEU B CG  1 
ATOM   4813  C CD1 . LEU B 1 152 ? 4.663   71.753  30.950  1.00 20.00 ? 152  LEU B CD1 1 
ATOM   4814  C CD2 . LEU B 1 152 ? 6.466   73.414  31.425  1.00 20.00 ? 152  LEU B CD2 1 
ATOM   4815  N N   . PRO B 1 153 ? 2.840   72.798  34.432  1.00 20.00 ? 153  PRO B N   1 
ATOM   4816  C CA  . PRO B 1 153 ? 3.174   72.251  35.750  1.00 20.00 ? 153  PRO B CA  1 
ATOM   4817  C C   . PRO B 1 153 ? 4.579   71.650  35.805  1.00 20.00 ? 153  PRO B C   1 
ATOM   4818  O O   . PRO B 1 153 ? 5.136   71.263  34.779  1.00 20.00 ? 153  PRO B O   1 
ATOM   4819  C CB  . PRO B 1 153 ? 2.094   71.196  35.983  1.00 20.00 ? 153  PRO B CB  1 
ATOM   4820  C CG  . PRO B 1 153 ? 1.728   70.749  34.614  1.00 20.00 ? 153  PRO B CG  1 
ATOM   4821  C CD  . PRO B 1 153 ? 1.827   71.981  33.741  1.00 20.00 ? 153  PRO B CD  1 
ATOM   4822  N N   . PHE B 1 154 ? 5.139   71.581  37.011  1.00 20.00 ? 154  PHE B N   1 
ATOM   4823  C CA  . PHE B 1 154 ? 6.473   71.033  37.243  1.00 20.00 ? 154  PHE B CA  1 
ATOM   4824  C C   . PHE B 1 154 ? 7.558   71.536  36.293  1.00 20.00 ? 154  PHE B C   1 
ATOM   4825  O O   . PHE B 1 154 ? 8.333   70.758  35.729  1.00 20.00 ? 154  PHE B O   1 
ATOM   4826  C CB  . PHE B 1 154 ? 6.403   69.508  37.221  1.00 20.00 ? 154  PHE B CB  1 
ATOM   4827  C CG  . PHE B 1 154 ? 5.464   68.939  38.254  1.00 20.00 ? 154  PHE B CG  1 
ATOM   4828  C CD1 . PHE B 1 154 ? 5.706   69.135  39.617  1.00 20.00 ? 154  PHE B CD1 1 
ATOM   4829  C CD2 . PHE B 1 154 ? 4.334   68.217  37.872  1.00 20.00 ? 154  PHE B CD2 1 
ATOM   4830  C CE1 . PHE B 1 154 ? 4.842   68.622  40.577  1.00 20.00 ? 154  PHE B CE1 1 
ATOM   4831  C CE2 . PHE B 1 154 ? 3.461   67.700  38.833  1.00 20.00 ? 154  PHE B CE2 1 
ATOM   4832  C CZ  . PHE B 1 154 ? 3.717   67.904  40.186  1.00 20.00 ? 154  PHE B CZ  1 
ATOM   4833  N N   . LYS B 1 155 ? 7.614   72.853  36.143  1.00 20.00 ? 155  LYS B N   1 
ATOM   4834  C CA  . LYS B 1 155 ? 8.586   73.503  35.283  1.00 20.00 ? 155  LYS B CA  1 
ATOM   4835  C C   . LYS B 1 155 ? 9.996   73.318  35.827  1.00 20.00 ? 155  LYS B C   1 
ATOM   4836  O O   . LYS B 1 155 ? 10.971  73.492  35.103  1.00 20.00 ? 155  LYS B O   1 
ATOM   4837  C CB  . LYS B 1 155 ? 8.298   75.001  35.210  1.00 20.00 ? 155  LYS B CB  1 
ATOM   4838  C CG  . LYS B 1 155 ? 7.247   75.417  34.207  1.00 20.00 ? 155  LYS B CG  1 
ATOM   4839  C CD  . LYS B 1 155 ? 6.935   76.891  34.376  1.00 20.00 ? 155  LYS B CD  1 
ATOM   4840  C CE  . LYS B 1 155 ? 7.181   77.663  33.094  1.00 20.00 ? 155  LYS B CE  1 
ATOM   4841  N NZ  . LYS B 1 155 ? 6.852   79.106  33.269  1.00 20.00 ? 155  LYS B NZ  1 
ATOM   4842  N N   . GLY B 1 156 ? 10.111  72.984  37.107  1.00 20.00 ? 156  GLY B N   1 
ATOM   4843  C CA  . GLY B 1 156 ? 11.429  72.798  37.687  1.00 20.00 ? 156  GLY B CA  1 
ATOM   4844  C C   . GLY B 1 156 ? 12.069  71.470  37.343  1.00 20.00 ? 156  GLY B C   1 
ATOM   4845  O O   . GLY B 1 156 ? 13.224  71.226  37.678  1.00 20.00 ? 156  GLY B O   1 
ATOM   4846  N N   . ASP B 1 157 ? 11.325  70.607  36.669  1.00 20.00 ? 157  ASP B N   1 
ATOM   4847  C CA  . ASP B 1 157 ? 11.849  69.305  36.297  1.00 20.00 ? 157  ASP B CA  1 
ATOM   4848  C C   . ASP B 1 157 ? 13.167  69.388  35.527  1.00 20.00 ? 157  ASP B C   1 
ATOM   4849  O O   . ASP B 1 157 ? 13.431  70.362  34.813  1.00 20.00 ? 157  ASP B O   1 
ATOM   4850  C CB  . ASP B 1 157 ? 10.804  68.542  35.480  1.00 20.00 ? 157  ASP B CB  1 
ATOM   4851  C CG  . ASP B 1 157 ? 9.810   67.806  36.358  1.00 20.00 ? 157  ASP B CG  1 
ATOM   4852  O OD1 . ASP B 1 157 ? 9.802   68.064  37.580  1.00 20.00 ? 157  ASP B OD1 1 
ATOM   4853  O OD2 . ASP B 1 157 ? 9.039   66.974  35.834  1.00 20.00 ? 157  ASP B OD2 1 
ATOM   4854  N N   . ILE B 1 158 ? 13.998  68.361  35.692  1.00 20.00 ? 158  ILE B N   1 
ATOM   4855  C CA  . ILE B 1 158 ? 15.291  68.296  35.023  1.00 20.00 ? 158  ILE B CA  1 
ATOM   4856  C C   . ILE B 1 158 ? 15.144  67.566  33.687  1.00 20.00 ? 158  ILE B C   1 
ATOM   4857  O O   . ILE B 1 158 ? 14.420  66.572  33.602  1.00 20.00 ? 158  ILE B O   1 
ATOM   4858  C CB  . ILE B 1 158 ? 16.339  67.540  35.898  1.00 20.00 ? 158  ILE B CB  1 
ATOM   4859  C CG1 . ILE B 1 158 ? 17.043  68.531  36.837  1.00 20.00 ? 158  ILE B CG1 1 
ATOM   4860  C CG2 . ILE B 1 158 ? 17.362  66.826  35.009  1.00 20.00 ? 158  ILE B CG2 1 
ATOM   4861  C CD1 . ILE B 1 158 ? 17.950  67.882  37.877  1.00 20.00 ? 158  ILE B CD1 1 
ATOM   4862  N N   . ASP B 1 159 ? 15.824  68.075  32.654  1.00 20.00 ? 159  ASP B N   1 
ATOM   4863  C CA  . ASP B 1 159 ? 15.790  67.482  31.311  1.00 20.00 ? 159  ASP B CA  1 
ATOM   4864  C C   . ASP B 1 159 ? 16.769  66.305  31.306  1.00 20.00 ? 159  ASP B C   1 
ATOM   4865  O O   . ASP B 1 159 ? 17.982  66.488  31.193  1.00 20.00 ? 159  ASP B O   1 
ATOM   4866  C CB  . ASP B 1 159 ? 16.207  68.518  30.255  1.00 20.00 ? 159  ASP B CB  1 
ATOM   4867  C CG  . ASP B 1 159 ? 16.125  67.978  28.833  1.00 20.00 ? 159  ASP B CG  1 
ATOM   4868  O OD1 . ASP B 1 159 ? 16.193  66.751  28.648  1.00 20.00 ? 159  ASP B OD1 1 
ATOM   4869  O OD2 . ASP B 1 159 ? 15.997  68.782  27.888  1.00 20.00 ? 159  ASP B OD2 1 
ATOM   4870  N N   . LEU B 1 160 ? 16.230  65.099  31.438  1.00 20.00 ? 160  LEU B N   1 
ATOM   4871  C CA  . LEU B 1 160 ? 17.036  63.892  31.457  1.00 20.00 ? 160  LEU B CA  1 
ATOM   4872  C C   . LEU B 1 160 ? 17.906  63.691  30.222  1.00 20.00 ? 160  LEU B C   1 
ATOM   4873  O O   . LEU B 1 160 ? 18.847  62.895  30.244  1.00 20.00 ? 160  LEU B O   1 
ATOM   4874  C CB  . LEU B 1 160 ? 16.129  62.688  31.663  1.00 20.00 ? 160  LEU B CB  1 
ATOM   4875  C CG  . LEU B 1 160 ? 15.570  62.623  33.090  1.00 20.00 ? 160  LEU B CG  1 
ATOM   4876  C CD1 . LEU B 1 160 ? 14.289  61.799  33.119  1.00 20.00 ? 160  LEU B CD1 1 
ATOM   4877  C CD2 . LEU B 1 160 ? 16.624  62.023  34.019  1.00 20.00 ? 160  LEU B CD2 1 
ATOM   4878  N N   . ASN B 1 161 ? 17.595  64.406  29.146  1.00 20.00 ? 161  ASN B N   1 
ATOM   4879  C CA  . ASN B 1 161 ? 18.372  64.288  27.917  1.00 20.00 ? 161  ASN B CA  1 
ATOM   4880  C C   . ASN B 1 161 ? 19.563  65.225  28.054  1.00 20.00 ? 161  ASN B C   1 
ATOM   4881  O O   . ASN B 1 161 ? 20.649  64.952  27.553  1.00 20.00 ? 161  ASN B O   1 
ATOM   4882  C CB  . ASN B 1 161 ? 17.533  64.693  26.696  1.00 20.00 ? 161  ASN B CB  1 
ATOM   4883  C CG  . ASN B 1 161 ? 16.399  63.719  26.411  1.00 20.00 ? 161  ASN B CG  1 
ATOM   4884  O OD1 . ASN B 1 161 ? 15.271  64.128  26.128  1.00 20.00 ? 161  ASN B OD1 1 
ATOM   4885  N ND2 . ASN B 1 161 ? 16.693  62.425  26.486  1.00 20.00 ? 161  ASN B ND2 1 
ATOM   4886  N N   . LYS B 1 162 ? 19.341  66.343  28.735  1.00 20.00 ? 162  LYS B N   1 
ATOM   4887  C CA  . LYS B 1 162 ? 20.394  67.322  28.944  1.00 20.00 ? 162  LYS B CA  1 
ATOM   4888  C C   . LYS B 1 162 ? 21.399  66.719  29.912  1.00 20.00 ? 162  LYS B C   1 
ATOM   4889  O O   . LYS B 1 162 ? 22.598  66.995  29.845  1.00 20.00 ? 162  LYS B O   1 
ATOM   4890  C CB  . LYS B 1 162 ? 19.809  68.597  29.539  1.00 20.00 ? 162  LYS B CB  1 
ATOM   4891  C CG  . LYS B 1 162 ? 18.976  69.420  28.572  1.00 20.00 ? 162  LYS B CG  1 
ATOM   4892  C CD  . LYS B 1 162 ? 19.148  70.901  28.853  1.00 20.00 ? 162  LYS B CD  1 
ATOM   4893  C CE  . LYS B 1 162 ? 17.983  71.718  28.317  1.00 20.00 ? 162  LYS B CE  1 
ATOM   4894  N NZ  . LYS B 1 162 ? 18.026  73.134  28.800  1.00 20.00 ? 162  LYS B NZ  1 
ATOM   4895  N N   . LEU B 1 163 ? 20.893  65.890  30.819  1.00 20.00 ? 163  LEU B N   1 
ATOM   4896  C CA  . LEU B 1 163 ? 21.736  65.235  31.808  1.00 20.00 ? 163  LEU B CA  1 
ATOM   4897  C C   . LEU B 1 163 ? 22.543  64.128  31.122  1.00 20.00 ? 163  LEU B C   1 
ATOM   4898  O O   . LEU B 1 163 ? 23.776  64.184  31.086  1.00 20.00 ? 163  LEU B O   1 
ATOM   4899  C CB  . LEU B 1 163 ? 20.871  64.649  32.933  1.00 20.00 ? 163  LEU B CB  1 
ATOM   4900  C CG  . LEU B 1 163 ? 21.552  63.741  33.965  1.00 20.00 ? 163  LEU B CG  1 
ATOM   4901  C CD1 . LEU B 1 163 ? 22.637  64.510  34.694  1.00 20.00 ? 163  LEU B CD1 1 
ATOM   4902  C CD2 . LEU B 1 163 ? 20.508  63.206  34.945  1.00 20.00 ? 163  LEU B CD2 1 
ATOM   4903  N N   . ALA B 1 164 ? 21.845  63.141  30.566  1.00 20.00 ? 164  ALA B N   1 
ATOM   4904  C CA  . ALA B 1 164 ? 22.494  62.024  29.880  1.00 20.00 ? 164  ALA B CA  1 
ATOM   4905  C C   . ALA B 1 164 ? 23.585  62.491  28.917  1.00 20.00 ? 164  ALA B C   1 
ATOM   4906  O O   . ALA B 1 164 ? 24.624  61.848  28.781  1.00 20.00 ? 164  ALA B O   1 
ATOM   4907  C CB  . ALA B 1 164 ? 21.451  61.201  29.126  1.00 20.00 ? 164  ALA B CB  1 
ATOM   4908  N N   . THR B 1 165 ? 23.338  63.611  28.249  1.00 20.00 ? 165  THR B N   1 
ATOM   4909  C CA  . THR B 1 165 ? 24.299  64.161  27.303  1.00 20.00 ? 165  THR B CA  1 
ATOM   4910  C C   . THR B 1 165 ? 25.526  64.632  28.059  1.00 20.00 ? 165  THR B C   1 
ATOM   4911  O O   . THR B 1 165 ? 26.660  64.405  27.629  1.00 20.00 ? 165  THR B O   1 
ATOM   4912  C CB  . THR B 1 165 ? 23.700  65.345  26.542  1.00 20.00 ? 165  THR B CB  1 
ATOM   4913  O OG1 . THR B 1 165 ? 22.803  64.852  25.538  1.00 20.00 ? 165  THR B OG1 1 
ATOM   4914  C CG2 . THR B 1 165 ? 24.794  66.168  25.890  1.00 20.00 ? 165  THR B CG2 1 
ATOM   4915  N N   . LEU B 1 166 ? 25.288  65.291  29.190  1.00 20.00 ? 166  LEU B N   1 
ATOM   4916  C CA  . LEU B 1 166 ? 26.366  65.805  30.027  1.00 20.00 ? 166  LEU B CA  1 
ATOM   4917  C C   . LEU B 1 166 ? 27.272  64.646  30.432  1.00 20.00 ? 166  LEU B C   1 
ATOM   4918  O O   . LEU B 1 166 ? 28.485  64.685  30.231  1.00 20.00 ? 166  LEU B O   1 
ATOM   4919  C CB  . LEU B 1 166 ? 25.783  66.471  31.276  1.00 20.00 ? 166  LEU B CB  1 
ATOM   4920  C CG  . LEU B 1 166 ? 26.517  67.661  31.907  1.00 20.00 ? 166  LEU B CG  1 
ATOM   4921  C CD1 . LEU B 1 166 ? 26.559  67.469  33.421  1.00 20.00 ? 166  LEU B CD1 1 
ATOM   4922  C CD2 . LEU B 1 166 ? 27.925  67.791  31.345  1.00 20.00 ? 166  LEU B CD2 1 
ATOM   4923  N N   . ILE B 1 167 ? 26.666  63.611  30.998  1.00 20.00 ? 167  ILE B N   1 
ATOM   4924  C CA  . ILE B 1 167 ? 27.399  62.434  31.434  1.00 20.00 ? 167  ILE B CA  1 
ATOM   4925  C C   . ILE B 1 167 ? 28.169  61.847  30.256  1.00 20.00 ? 167  ILE B C   1 
ATOM   4926  O O   . ILE B 1 167 ? 29.225  61.239  30.436  1.00 20.00 ? 167  ILE B O   1 
ATOM   4927  C CB  . ILE B 1 167 ? 26.434  61.360  31.975  1.00 20.00 ? 167  ILE B CB  1 
ATOM   4928  C CG1 . ILE B 1 167 ? 25.738  61.881  33.229  1.00 20.00 ? 167  ILE B CG1 1 
ATOM   4929  C CG2 . ILE B 1 167 ? 27.183  60.068  32.277  1.00 20.00 ? 167  ILE B CG2 1 
ATOM   4930  C CD1 . ILE B 1 167 ? 24.503  61.089  33.609  1.00 20.00 ? 167  ILE B CD1 1 
ATOM   4931  N N   . LYS B 1 168 ? 27.631  62.039  29.052  1.00 20.00 ? 168  LYS B N   1 
ATOM   4932  C CA  . LYS B 1 168 ? 28.249  61.533  27.831  1.00 20.00 ? 168  LYS B CA  1 
ATOM   4933  C C   . LYS B 1 168 ? 29.414  62.386  27.335  1.00 20.00 ? 168  LYS B C   1 
ATOM   4934  O O   . LYS B 1 168 ? 30.509  61.876  27.112  1.00 20.00 ? 168  LYS B O   1 
ATOM   4935  C CB  . LYS B 1 168 ? 27.196  61.416  26.726  1.00 20.00 ? 168  LYS B CB  1 
ATOM   4936  C CG  . LYS B 1 168 ? 27.764  61.330  25.309  1.00 20.00 ? 168  LYS B CG  1 
ATOM   4937  C CD  . LYS B 1 168 ? 26.926  62.132  24.307  1.00 20.00 ? 168  LYS B CD  1 
ATOM   4938  C CE  . LYS B 1 168 ? 25.885  61.254  23.619  1.00 20.00 ? 168  LYS B CE  1 
ATOM   4939  N NZ  . LYS B 1 168 ? 24.706  60.979  24.498  1.00 20.00 ? 168  LYS B NZ  1 
ATOM   4940  N N   . GLU B 1 169 ? 29.188  63.682  27.167  1.00 20.00 ? 169  GLU B N   1 
ATOM   4941  C CA  . GLU B 1 169 ? 30.244  64.569  26.690  1.00 20.00 ? 169  GLU B CA  1 
ATOM   4942  C C   . GLU B 1 169 ? 31.301  64.941  27.728  1.00 20.00 ? 169  GLU B C   1 
ATOM   4943  O O   . GLU B 1 169 ? 32.311  65.558  27.380  1.00 20.00 ? 169  GLU B O   1 
ATOM   4944  C CB  . GLU B 1 169 ? 29.634  65.856  26.127  1.00 20.00 ? 169  GLU B CB  1 
ATOM   4945  C CG  . GLU B 1 169 ? 28.243  65.679  25.535  1.00 20.00 ? 169  GLU B CG  1 
ATOM   4946  C CD  . GLU B 1 169 ? 28.229  65.783  24.018  1.00 20.00 ? 169  GLU B CD  1 
ATOM   4947  O OE1 . GLU B 1 169 ? 28.922  66.676  23.481  1.00 20.00 ? 169  GLU B OE1 1 
ATOM   4948  O OE2 . GLU B 1 169 ? 27.527  64.974  23.364  1.00 20.00 ? 169  GLU B OE2 1 
ATOM   4949  N N   . LYS B 1 170 ? 31.085  64.573  28.992  1.00 20.00 ? 170  LYS B N   1 
ATOM   4950  C CA  . LYS B 1 170 ? 32.050  64.905  30.043  1.00 20.00 ? 170  LYS B CA  1 
ATOM   4951  C C   . LYS B 1 170 ? 32.543  63.732  30.893  1.00 20.00 ? 170  LYS B C   1 
ATOM   4952  O O   . LYS B 1 170 ? 33.660  63.754  31.409  1.00 20.00 ? 170  LYS B O   1 
ATOM   4953  C CB  . LYS B 1 170 ? 31.466  65.985  30.956  1.00 20.00 ? 170  LYS B CB  1 
ATOM   4954  C CG  . LYS B 1 170 ? 30.935  67.198  30.204  1.00 20.00 ? 170  LYS B CG  1 
ATOM   4955  C CD  . LYS B 1 170 ? 32.076  68.079  29.721  1.00 20.00 ? 170  LYS B CD  1 
ATOM   4956  C CE  . LYS B 1 170 ? 31.566  69.393  29.160  1.00 20.00 ? 170  LYS B CE  1 
ATOM   4957  N NZ  . LYS B 1 170 ? 32.660  70.174  28.513  1.00 20.00 ? 170  LYS B NZ  1 
ATOM   4958  N N   . GLY B 1 171 ? 31.711  62.710  31.042  1.00 20.00 ? 171  GLY B N   1 
ATOM   4959  C CA  . GLY B 1 171 ? 32.112  61.565  31.834  1.00 20.00 ? 171  GLY B CA  1 
ATOM   4960  C C   . GLY B 1 171 ? 31.668  61.695  33.277  1.00 20.00 ? 171  GLY B C   1 
ATOM   4961  O O   . GLY B 1 171 ? 31.960  62.686  33.950  1.00 20.00 ? 171  GLY B O   1 
ATOM   4962  N N   . ALA B 1 172 ? 30.958  60.679  33.749  1.00 20.00 ? 172  ALA B N   1 
ATOM   4963  C CA  . ALA B 1 172 ? 30.456  60.647  35.114  1.00 20.00 ? 172  ALA B CA  1 
ATOM   4964  C C   . ALA B 1 172 ? 31.511  61.120  36.105  1.00 20.00 ? 172  ALA B C   1 
ATOM   4965  O O   . ALA B 1 172 ? 31.245  61.963  36.962  1.00 20.00 ? 172  ALA B O   1 
ATOM   4966  C CB  . ALA B 1 172 ? 30.018  59.228  35.466  1.00 20.00 ? 172  ALA B CB  1 
ATOM   4967  N N   . GLU B 1 173 ? 32.712  60.569  35.972  1.00 20.00 ? 173  GLU B N   1 
ATOM   4968  C CA  . GLU B 1 173 ? 33.826  60.908  36.841  1.00 20.00 ? 173  GLU B CA  1 
ATOM   4969  C C   . GLU B 1 173 ? 34.163  62.393  36.879  1.00 20.00 ? 173  GLU B C   1 
ATOM   4970  O O   . GLU B 1 173 ? 34.947  62.823  37.723  1.00 20.00 ? 173  GLU B O   1 
ATOM   4971  C CB  . GLU B 1 173 ? 35.064  60.111  36.423  1.00 20.00 ? 173  GLU B CB  1 
ATOM   4972  C CG  . GLU B 1 173 ? 35.818  60.699  35.238  1.00 20.00 ? 173  GLU B CG  1 
ATOM   4973  C CD  . GLU B 1 173 ? 35.357  60.148  33.892  1.00 20.00 ? 173  GLU B CD  1 
ATOM   4974  O OE1 . GLU B 1 173 ? 34.394  59.347  33.853  1.00 20.00 ? 173  GLU B OE1 1 
ATOM   4975  O OE2 . GLU B 1 173 ? 35.967  60.525  32.866  1.00 20.00 ? 173  GLU B OE2 1 
ATOM   4976  N N   . ASN B 1 174 ? 33.575  63.178  35.980  1.00 20.00 ? 174  ASN B N   1 
ATOM   4977  C CA  . ASN B 1 174 ? 33.858  64.614  35.957  1.00 20.00 ? 174  ASN B CA  1 
ATOM   4978  C C   . ASN B 1 174 ? 32.737  65.491  36.526  1.00 20.00 ? 174  ASN B C   1 
ATOM   4979  O O   . ASN B 1 174 ? 32.832  66.724  36.529  1.00 20.00 ? 174  ASN B O   1 
ATOM   4980  C CB  . ASN B 1 174 ? 34.202  65.053  34.534  1.00 20.00 ? 174  ASN B CB  1 
ATOM   4981  C CG  . ASN B 1 174 ? 35.522  64.477  34.059  1.00 20.00 ? 174  ASN B CG  1 
ATOM   4982  O OD1 . ASN B 1 174 ? 36.405  64.170  34.868  1.00 20.00 ? 174  ASN B OD1 1 
ATOM   4983  N ND2 . ASN B 1 174 ? 35.665  64.323  32.748  1.00 20.00 ? 174  ASN B ND2 1 
ATOM   4984  N N   . ILE B 1 175 ? 31.684  64.850  37.005  1.00 20.00 ? 175  ILE B N   1 
ATOM   4985  C CA  . ILE B 1 175 ? 30.551  65.561  37.582  1.00 20.00 ? 175  ILE B CA  1 
ATOM   4986  C C   . ILE B 1 175 ? 30.597  65.341  39.091  1.00 20.00 ? 175  ILE B C   1 
ATOM   4987  O O   . ILE B 1 175 ? 30.424  64.220  39.572  1.00 20.00 ? 175  ILE B O   1 
ATOM   4988  C CB  . ILE B 1 175 ? 29.209  65.021  37.046  1.00 20.00 ? 175  ILE B CB  1 
ATOM   4989  C CG1 . ILE B 1 175 ? 29.120  65.233  35.531  1.00 20.00 ? 175  ILE B CG1 1 
ATOM   4990  C CG2 . ILE B 1 175 ? 28.053  65.721  37.751  1.00 20.00 ? 175  ILE B CG2 1 
ATOM   4991  C CD1 . ILE B 1 175 ? 28.436  64.086  34.801  1.00 20.00 ? 175  ILE B CD1 1 
ATOM   4992  N N   . ALA B 1 176 ? 30.846  66.412  39.832  1.00 20.00 ? 176  ALA B N   1 
ATOM   4993  C CA  . ALA B 1 176 ? 30.916  66.334  41.286  1.00 20.00 ? 176  ALA B CA  1 
ATOM   4994  C C   . ALA B 1 176 ? 29.643  65.689  41.818  1.00 20.00 ? 176  ALA B C   1 
ATOM   4995  O O   . ALA B 1 176 ? 29.683  64.656  42.501  1.00 20.00 ? 176  ALA B O   1 
ATOM   4996  C CB  . ALA B 1 176 ? 31.074  67.723  41.863  1.00 20.00 ? 176  ALA B CB  1 
ATOM   4997  N N   . TYR B 1 177 ? 28.512  66.304  41.487  1.00 20.00 ? 177  TYR B N   1 
ATOM   4998  C CA  . TYR B 1 177 ? 27.213  65.811  41.917  1.00 20.00 ? 177  TYR B CA  1 
ATOM   4999  C C   . TYR B 1 177 ? 26.135  66.618  41.222  1.00 20.00 ? 177  TYR B C   1 
ATOM   5000  O O   . TYR B 1 177 ? 26.421  67.656  40.615  1.00 20.00 ? 177  TYR B O   1 
ATOM   5001  C CB  . TYR B 1 177 ? 27.059  65.958  43.438  1.00 20.00 ? 177  TYR B CB  1 
ATOM   5002  C CG  . TYR B 1 177 ? 27.239  67.375  43.951  1.00 20.00 ? 177  TYR B CG  1 
ATOM   5003  C CD1 . TYR B 1 177 ? 26.155  68.261  44.026  1.00 20.00 ? 177  TYR B CD1 1 
ATOM   5004  C CD2 . TYR B 1 177 ? 28.489  67.834  44.360  1.00 20.00 ? 177  TYR B CD2 1 
ATOM   5005  C CE1 . TYR B 1 177 ? 26.316  69.579  44.499  1.00 20.00 ? 177  TYR B CE1 1 
ATOM   5006  C CE2 . TYR B 1 177 ? 28.662  69.142  44.834  1.00 20.00 ? 177  TYR B CE2 1 
ATOM   5007  C CZ  . TYR B 1 177 ? 27.573  70.009  44.901  1.00 20.00 ? 177  TYR B CZ  1 
ATOM   5008  O OH  . TYR B 1 177 ? 27.755  71.296  45.373  1.00 20.00 ? 177  TYR B OH  1 
ATOM   5009  N N   . ILE B 1 178 ? 24.902  66.130  41.307  1.00 20.00 ? 178  ILE B N   1 
ATOM   5010  C CA  . ILE B 1 178 ? 23.761  66.801  40.698  1.00 20.00 ? 178  ILE B CA  1 
ATOM   5011  C C   . ILE B 1 178 ? 23.039  67.576  41.805  1.00 20.00 ? 178  ILE B C   1 
ATOM   5012  O O   . ILE B 1 178 ? 22.660  67.003  42.831  1.00 20.00 ? 178  ILE B O   1 
ATOM   5013  C CB  . ILE B 1 178 ? 22.775  65.788  40.081  1.00 20.00 ? 178  ILE B CB  1 
ATOM   5014  C CG1 . ILE B 1 178 ? 23.376  65.180  38.813  1.00 20.00 ? 178  ILE B CG1 1 
ATOM   5015  C CG2 . ILE B 1 178 ? 21.448  66.476  39.754  1.00 20.00 ? 178  ILE B CG2 1 
ATOM   5016  C CD1 . ILE B 1 178 ? 23.052  63.718  38.655  1.00 20.00 ? 178  ILE B CD1 1 
ATOM   5017  N N   . CYS B 1 179 ? 22.861  68.877  41.601  1.00 20.00 ? 179  CYS B N   1 
ATOM   5018  C CA  . CYS B 1 179 ? 22.187  69.712  42.588  1.00 20.00 ? 179  CYS B CA  1 
ATOM   5019  C C   . CYS B 1 179 ? 20.723  69.944  42.234  1.00 20.00 ? 179  CYS B C   1 
ATOM   5020  O O   . CYS B 1 179 ? 20.395  70.886  41.514  1.00 20.00 ? 179  CYS B O   1 
ATOM   5021  C CB  . CYS B 1 179 ? 22.894  71.062  42.712  1.00 20.00 ? 179  CYS B CB  1 
ATOM   5022  S SG  . CYS B 1 179 ? 22.262  72.098  44.055  1.00 20.00 ? 179  CYS B SG  1 
ATOM   5023  N N   . LEU B 1 180 ? 19.843  69.088  42.743  1.00 20.00 ? 180  LEU B N   1 
ATOM   5024  C CA  . LEU B 1 180 ? 18.417  69.218  42.471  1.00 20.00 ? 180  LEU B CA  1 
ATOM   5025  C C   . LEU B 1 180 ? 17.771  70.141  43.506  1.00 20.00 ? 180  LEU B C   1 
ATOM   5026  O O   . LEU B 1 180 ? 17.837  69.882  44.714  1.00 20.00 ? 180  LEU B O   1 
ATOM   5027  C CB  . LEU B 1 180 ? 17.761  67.844  42.515  1.00 20.00 ? 180  LEU B CB  1 
ATOM   5028  C CG  . LEU B 1 180 ? 16.501  67.700  41.672  1.00 20.00 ? 180  LEU B CG  1 
ATOM   5029  C CD1 . LEU B 1 180 ? 16.454  66.311  41.055  1.00 20.00 ? 180  LEU B CD1 1 
ATOM   5030  C CD2 . LEU B 1 180 ? 15.287  67.936  42.555  1.00 20.00 ? 180  LEU B CD2 1 
ATOM   5031  N N   . ALA B 1 181 ? 17.143  71.216  43.033  1.00 20.00 ? 181  ALA B N   1 
ATOM   5032  C CA  . ALA B 1 181 ? 16.495  72.170  43.924  1.00 20.00 ? 181  ALA B CA  1 
ATOM   5033  C C   . ALA B 1 181 ? 14.985  72.053  43.927  1.00 20.00 ? 181  ALA B C   1 
ATOM   5034  O O   . ALA B 1 181 ? 14.358  71.997  42.875  1.00 20.00 ? 181  ALA B O   1 
ATOM   5035  C CB  . ALA B 1 181 ? 16.889  73.586  43.547  1.00 20.00 ? 181  ALA B CB  1 
ATOM   5036  N N   . VAL B 1 182 ? 14.408  72.023  45.125  1.00 20.00 ? 182  VAL B N   1 
ATOM   5037  C CA  . VAL B 1 182 ? 12.964  71.919  45.288  1.00 20.00 ? 182  VAL B CA  1 
ATOM   5038  C C   . VAL B 1 182 ? 12.544  72.950  46.323  1.00 20.00 ? 182  VAL B C   1 
ATOM   5039  O O   . VAL B 1 182 ? 12.941  72.853  47.484  1.00 20.00 ? 182  VAL B O   1 
ATOM   5040  C CB  . VAL B 1 182 ? 12.541  70.521  45.795  1.00 20.00 ? 182  VAL B CB  1 
ATOM   5041  C CG1 . VAL B 1 182 ? 12.637  69.513  44.667  1.00 20.00 ? 182  VAL B CG1 1 
ATOM   5042  C CG2 . VAL B 1 182 ? 13.417  70.096  46.972  1.00 20.00 ? 182  VAL B CG2 1 
ATOM   5043  N N   . THR B 1 183 ? 11.766  73.952  45.917  1.00 20.00 ? 183  THR B N   1 
ATOM   5044  C CA  . THR B 1 183 ? 11.298  74.121  44.548  1.00 20.00 ? 183  THR B CA  1 
ATOM   5045  C C   . THR B 1 183 ? 12.381  74.909  43.813  1.00 20.00 ? 183  THR B C   1 
ATOM   5046  O O   . THR B 1 183 ? 13.439  75.168  44.378  1.00 20.00 ? 183  THR B O   1 
ATOM   5047  C CB  . THR B 1 183 ? 9.985   74.930  44.516  1.00 20.00 ? 183  THR B CB  1 
ATOM   5048  O OG1 . THR B 1 183 ? 10.190  76.187  45.169  1.00 20.00 ? 183  THR B OG1 1 
ATOM   5049  C CG2 . THR B 1 183 ? 8.873   74.183  45.234  1.00 20.00 ? 183  THR B CG2 1 
ATOM   5050  N N   . VAL B 1 184 ? 12.124  75.288  42.564  1.00 20.00 ? 184  VAL B N   1 
ATOM   5051  C CA  . VAL B 1 184 ? 13.101  76.045  41.786  1.00 20.00 ? 184  VAL B CA  1 
ATOM   5052  C C   . VAL B 1 184 ? 12.774  77.522  41.881  1.00 20.00 ? 184  VAL B C   1 
ATOM   5053  O O   . VAL B 1 184 ? 11.829  78.017  41.272  1.00 20.00 ? 184  VAL B O   1 
ATOM   5054  C CB  . VAL B 1 184 ? 13.101  75.608  40.320  1.00 20.00 ? 184  VAL B CB  1 
ATOM   5055  C CG1 . VAL B 1 184 ? 14.107  76.436  39.531  1.00 20.00 ? 184  VAL B CG1 1 
ATOM   5056  C CG2 . VAL B 1 184 ? 13.434  74.123  40.236  1.00 20.00 ? 184  VAL B CG2 1 
ATOM   5057  N N   . ASN B 1 185 ? 13.585  78.220  42.659  1.00 20.00 ? 185  ASN B N   1 
ATOM   5058  C CA  . ASN B 1 185 ? 13.434  79.641  42.894  1.00 20.00 ? 185  ASN B CA  1 
ATOM   5059  C C   . ASN B 1 185 ? 13.483  80.585  41.693  1.00 20.00 ? 185  ASN B C   1 
ATOM   5060  O O   . ASN B 1 185 ? 12.586  81.415  41.509  1.00 20.00 ? 185  ASN B O   1 
ATOM   5061  C CB  . ASN B 1 185 ? 14.475  80.068  43.922  1.00 20.00 ? 185  ASN B CB  1 
ATOM   5062  C CG  . ASN B 1 185 ? 14.343  81.510  44.305  1.00 20.00 ? 185  ASN B CG  1 
ATOM   5063  O OD1 . ASN B 1 185 ? 13.381  81.903  44.963  1.00 20.00 ? 185  ASN B OD1 1 
ATOM   5064  N ND2 . ASN B 1 185 ? 15.309  82.320  43.893  1.00 20.00 ? 185  ASN B ND2 1 
ATOM   5065  N N   . LEU B 1 186 ? 14.533  80.472  40.888  1.00 20.00 ? 186  LEU B N   1 
ATOM   5066  C CA  . LEU B 1 186 ? 14.696  81.326  39.712  1.00 20.00 ? 186  LEU B CA  1 
ATOM   5067  C C   . LEU B 1 186 ? 13.491  81.360  38.766  1.00 20.00 ? 186  LEU B C   1 
ATOM   5068  O O   . LEU B 1 186 ? 13.145  82.416  38.230  1.00 20.00 ? 186  LEU B O   1 
ATOM   5069  C CB  . LEU B 1 186 ? 15.954  80.904  38.934  1.00 20.00 ? 186  LEU B CB  1 
ATOM   5070  C CG  . LEU B 1 186 ? 17.092  81.931  38.782  1.00 20.00 ? 186  LEU B CG  1 
ATOM   5071  C CD1 . LEU B 1 186 ? 16.702  82.966  37.739  1.00 20.00 ? 186  LEU B CD1 1 
ATOM   5072  C CD2 . LEU B 1 186 ? 17.396  82.607  40.120  1.00 20.00 ? 186  LEU B CD2 1 
ATOM   5073  N N   . ALA B 1 187 ? 12.849  80.213  38.566  1.00 20.00 ? 187  ALA B N   1 
ATOM   5074  C CA  . ALA B 1 187 ? 11.690  80.142  37.679  1.00 20.00 ? 187  ALA B CA  1 
ATOM   5075  C C   . ALA B 1 187 ? 10.442  80.769  38.296  1.00 20.00 ? 187  ALA B C   1 
ATOM   5076  O O   . ALA B 1 187 ? 9.449   81.006  37.603  1.00 20.00 ? 187  ALA B O   1 
ATOM   5077  C CB  . ALA B 1 187 ? 11.416  78.682  37.288  1.00 20.00 ? 187  ALA B CB  1 
ATOM   5078  N N   . GLY B 1 188 ? 10.498  81.040  39.596  1.00 20.00 ? 188  GLY B N   1 
ATOM   5079  C CA  . GLY B 1 188 ? 9.359   81.636  40.272  1.00 20.00 ? 188  GLY B CA  1 
ATOM   5080  C C   . GLY B 1 188 ? 8.795   80.766  41.380  1.00 20.00 ? 188  GLY B C   1 
ATOM   5081  O O   . GLY B 1 188 ? 7.694   81.030  41.867  1.00 20.00 ? 188  GLY B O   1 
ATOM   5082  N N   . GLY B 1 189 ? 9.547   79.736  41.777  1.00 20.00 ? 189  GLY B N   1 
ATOM   5083  C CA  . GLY B 1 189 ? 9.106   78.834  42.833  1.00 20.00 ? 189  GLY B CA  1 
ATOM   5084  C C   . GLY B 1 189 ? 8.407   77.602  42.285  1.00 20.00 ? 189  GLY B C   1 
ATOM   5085  O O   . GLY B 1 189 ? 7.499   77.060  42.906  1.00 20.00 ? 189  GLY B O   1 
ATOM   5086  N N   . GLN B 1 190 ? 8.846   77.151  41.118  1.00 20.00 ? 190  GLN B N   1 
ATOM   5087  C CA  . GLN B 1 190 ? 8.262   75.985  40.474  1.00 20.00 ? 190  GLN B CA  1 
ATOM   5088  C C   . GLN B 1 190 ? 8.717   74.654  41.050  1.00 20.00 ? 190  GLN B C   1 
ATOM   5089  O O   . GLN B 1 190 ? 9.884   74.473  41.393  1.00 20.00 ? 190  GLN B O   1 
ATOM   5090  C CB  . GLN B 1 190 ? 8.561   76.030  38.976  1.00 20.00 ? 190  GLN B CB  1 
ATOM   5091  C CG  . GLN B 1 190 ? 8.263   77.376  38.357  1.00 20.00 ? 190  GLN B CG  1 
ATOM   5092  C CD  . GLN B 1 190 ? 6.815   77.784  38.544  1.00 20.00 ? 190  GLN B CD  1 
ATOM   5093  O OE1 . GLN B 1 190 ? 5.954   76.943  38.823  1.00 20.00 ? 190  GLN B OE1 1 
ATOM   5094  N NE2 . GLN B 1 190 ? 6.534   79.078  38.385  1.00 20.00 ? 190  GLN B NE2 1 
ATOM   5095  N N   . PRO B 1 191 ? 7.785   73.697  41.163  1.00 20.00 ? 191  PRO B N   1 
ATOM   5096  C CA  . PRO B 1 191 ? 8.060   72.379  41.733  1.00 20.00 ? 191  PRO B CA  1 
ATOM   5097  C C   . PRO B 1 191 ? 8.692   71.365  40.783  1.00 20.00 ? 191  PRO B C   1 
ATOM   5098  O O   . PRO B 1 191 ? 8.727   71.558  39.565  1.00 20.00 ? 191  PRO B O   1 
ATOM   5099  C CB  . PRO B 1 191 ? 6.689   71.917  42.201  1.00 20.00 ? 191  PRO B CB  1 
ATOM   5100  C CG  . PRO B 1 191 ? 5.759   72.518  41.181  1.00 20.00 ? 191  PRO B CG  1 
ATOM   5101  C CD  . PRO B 1 191 ? 6.364   73.840  40.788  1.00 20.00 ? 191  PRO B CD  1 
ATOM   5102  N N   . VAL B 1 192 ? 9.191   70.284  41.376  1.00 20.00 ? 192  VAL B N   1 
ATOM   5103  C CA  . VAL B 1 192 ? 9.827   69.193  40.660  1.00 20.00 ? 192  VAL B CA  1 
ATOM   5104  C C   . VAL B 1 192 ? 8.982   67.960  41.010  1.00 20.00 ? 192  VAL B C   1 
ATOM   5105  O O   . VAL B 1 192 ? 8.681   67.715  42.177  1.00 20.00 ? 192  VAL B O   1 
ATOM   5106  C CB  . VAL B 1 192 ? 11.291  68.990  41.134  1.00 20.00 ? 192  VAL B CB  1 
ATOM   5107  C CG1 . VAL B 1 192 ? 11.844  67.700  40.570  1.00 20.00 ? 192  VAL B CG1 1 
ATOM   5108  C CG2 . VAL B 1 192 ? 12.156  70.165  40.687  1.00 20.00 ? 192  VAL B CG2 1 
ATOM   5109  N N   . SER B 1 193 ? 8.581   67.201  39.997  1.00 20.00 ? 193  SER B N   1 
ATOM   5110  C CA  . SER B 1 193 ? 7.767   66.008  40.204  1.00 20.00 ? 193  SER B CA  1 
ATOM   5111  C C   . SER B 1 193 ? 8.554   64.858  40.804  1.00 20.00 ? 193  SER B C   1 
ATOM   5112  O O   . SER B 1 193 ? 9.774   64.802  40.672  1.00 20.00 ? 193  SER B O   1 
ATOM   5113  C CB  . SER B 1 193 ? 7.178   65.551  38.875  1.00 20.00 ? 193  SER B CB  1 
ATOM   5114  O OG  . SER B 1 193 ? 8.213   65.415  37.919  1.00 20.00 ? 193  SER B OG  1 
ATOM   5115  N N   . MET B 1 194 ? 7.848   63.938  41.457  1.00 20.00 ? 194  MET B N   1 
ATOM   5116  C CA  . MET B 1 194 ? 8.493   62.790  42.067  1.00 20.00 ? 194  MET B CA  1 
ATOM   5117  C C   . MET B 1 194 ? 9.036   61.909  40.954  1.00 20.00 ? 194  MET B C   1 
ATOM   5118  O O   . MET B 1 194 ? 10.076  61.276  41.100  1.00 20.00 ? 194  MET B O   1 
ATOM   5119  C CB  . MET B 1 194 ? 7.497   61.989  42.897  1.00 20.00 ? 194  MET B CB  1 
ATOM   5120  C CG  . MET B 1 194 ? 8.152   60.912  43.741  1.00 20.00 ? 194  MET B CG  1 
ATOM   5121  S SD  . MET B 1 194 ? 8.905   61.607  45.214  1.00 20.00 ? 194  MET B SD  1 
ATOM   5122  C CE  . MET B 1 194 ? 7.449   61.906  46.195  1.00 20.00 ? 194  MET B CE  1 
ATOM   5123  N N   . ALA B 1 195 ? 8.314   61.869  39.841  1.00 20.00 ? 195  ALA B N   1 
ATOM   5124  C CA  . ALA B 1 195 ? 8.716   61.071  38.693  1.00 20.00 ? 195  ALA B CA  1 
ATOM   5125  C C   . ALA B 1 195 ? 10.079  61.523  38.201  1.00 20.00 ? 195  ALA B C   1 
ATOM   5126  O O   . ALA B 1 195 ? 10.916  60.710  37.819  1.00 20.00 ? 195  ALA B O   1 
ATOM   5127  C CB  . ALA B 1 195 ? 7.693   61.217  37.570  1.00 20.00 ? 195  ALA B CB  1 
ATOM   5128  N N   . ASN B 1 196 ? 10.300  62.830  38.203  1.00 20.00 ? 196  ASN B N   1 
ATOM   5129  C CA  . ASN B 1 196 ? 11.573  63.369  37.748  1.00 20.00 ? 196  ASN B CA  1 
ATOM   5130  C C   . ASN B 1 196 ? 12.696  63.002  38.703  1.00 20.00 ? 196  ASN B C   1 
ATOM   5131  O O   . ASN B 1 196 ? 13.752  62.534  38.281  1.00 20.00 ? 196  ASN B O   1 
ATOM   5132  C CB  . ASN B 1 196 ? 11.493  64.890  37.617  1.00 20.00 ? 196  ASN B CB  1 
ATOM   5133  C CG  . ASN B 1 196 ? 12.634  65.461  36.804  1.00 20.00 ? 196  ASN B CG  1 
ATOM   5134  O OD1 . ASN B 1 196 ? 13.342  66.373  37.243  1.00 20.00 ? 196  ASN B OD1 1 
ATOM   5135  N ND2 . ASN B 1 196 ? 12.825  64.921  35.609  1.00 20.00 ? 196  ASN B ND2 1 
ATOM   5136  N N   . MET B 1 197 ? 12.466  63.213  39.993  1.00 20.00 ? 197  MET B N   1 
ATOM   5137  C CA  . MET B 1 197 ? 13.476  62.899  40.990  1.00 20.00 ? 197  MET B CA  1 
ATOM   5138  C C   . MET B 1 197 ? 13.884  61.433  40.894  1.00 20.00 ? 197  MET B C   1 
ATOM   5139  O O   . MET B 1 197 ? 15.068  61.105  40.965  1.00 20.00 ? 197  MET B O   1 
ATOM   5140  C CB  . MET B 1 197 ? 12.946  63.220  42.394  1.00 20.00 ? 197  MET B CB  1 
ATOM   5141  C CG  . MET B 1 197 ? 12.768  64.712  42.658  1.00 20.00 ? 197  MET B CG  1 
ATOM   5142  S SD  . MET B 1 197 ? 12.163  65.106  44.323  1.00 20.00 ? 197  MET B SD  1 
ATOM   5143  C CE  . MET B 1 197 ? 10.610  65.860  43.974  1.00 20.00 ? 197  MET B CE  1 
ATOM   5144  N N   . ARG B 1 198 ? 12.897  60.561  40.712  1.00 20.00 ? 198  ARG B N   1 
ATOM   5145  C CA  . ARG B 1 198 ? 13.132  59.124  40.607  1.00 20.00 ? 198  ARG B CA  1 
ATOM   5146  C C   . ARG B 1 198 ? 13.917  58.738  39.362  1.00 20.00 ? 198  ARG B C   1 
ATOM   5147  O O   . ARG B 1 198 ? 14.778  57.855  39.407  1.00 20.00 ? 198  ARG B O   1 
ATOM   5148  C CB  . ARG B 1 198 ? 11.795  58.387  40.615  1.00 20.00 ? 198  ARG B CB  1 
ATOM   5149  C CG  . ARG B 1 198 ? 11.896  56.884  40.556  1.00 20.00 ? 198  ARG B CG  1 
ATOM   5150  C CD  . ARG B 1 198 ? 10.518  56.295  40.331  1.00 20.00 ? 198  ARG B CD  1 
ATOM   5151  N NE  . ARG B 1 198 ? 9.590   56.655  41.401  1.00 20.00 ? 198  ARG B NE  1 
ATOM   5152  C CZ  . ARG B 1 198 ? 8.378   57.170  41.203  1.00 20.00 ? 198  ARG B CZ  1 
ATOM   5153  N NH1 . ARG B 1 198 ? 7.941   57.391  39.969  1.00 20.00 ? 198  ARG B NH1 1 
ATOM   5154  N NH2 . ARG B 1 198 ? 7.604   57.466  42.242  1.00 20.00 ? 198  ARG B NH2 1 
ATOM   5155  N N   . ALA B 1 199 ? 13.614  59.401  38.252  1.00 20.00 ? 199  ALA B N   1 
ATOM   5156  C CA  . ALA B 1 199 ? 14.287  59.132  36.986  1.00 20.00 ? 199  ALA B CA  1 
ATOM   5157  C C   . ALA B 1 199 ? 15.717  59.633  37.046  1.00 20.00 ? 199  ALA B C   1 
ATOM   5158  O O   . ALA B 1 199 ? 16.641  58.977  36.556  1.00 20.00 ? 199  ALA B O   1 
ATOM   5159  C CB  . ALA B 1 199 ? 13.547  59.811  35.843  1.00 20.00 ? 199  ALA B CB  1 
ATOM   5160  N N   . VAL B 1 200 ? 15.898  60.804  37.643  1.00 20.00 ? 200  VAL B N   1 
ATOM   5161  C CA  . VAL B 1 200 ? 17.224  61.385  37.762  1.00 20.00 ? 200  VAL B CA  1 
ATOM   5162  C C   . VAL B 1 200 ? 18.076  60.461  38.623  1.00 20.00 ? 200  VAL B C   1 
ATOM   5163  O O   . VAL B 1 200 ? 19.219  60.158  38.286  1.00 20.00 ? 200  VAL B O   1 
ATOM   5164  C CB  . VAL B 1 200 ? 17.157  62.783  38.406  1.00 20.00 ? 200  VAL B CB  1 
ATOM   5165  C CG1 . VAL B 1 200 ? 18.537  63.219  38.855  1.00 20.00 ? 200  VAL B CG1 1 
ATOM   5166  C CG2 . VAL B 1 200 ? 16.592  63.778  37.413  1.00 20.00 ? 200  VAL B CG2 1 
ATOM   5167  N N   . HIS B 1 201 ? 17.508  59.998  39.730  1.00 20.00 ? 201  HIS B N   1 
ATOM   5168  C CA  . HIS B 1 201 ? 18.227  59.109  40.626  1.00 20.00 ? 201  HIS B CA  1 
ATOM   5169  C C   . HIS B 1 201 ? 18.578  57.790  39.935  1.00 20.00 ? 201  HIS B C   1 
ATOM   5170  O O   . HIS B 1 201 ? 19.614  57.192  40.219  1.00 20.00 ? 201  HIS B O   1 
ATOM   5171  C CB  . HIS B 1 201 ? 17.390  58.838  41.872  1.00 20.00 ? 201  HIS B CB  1 
ATOM   5172  C CG  . HIS B 1 201 ? 17.874  57.676  42.678  1.00 20.00 ? 201  HIS B CG  1 
ATOM   5173  N ND1 . HIS B 1 201 ? 18.910  57.779  43.582  1.00 20.00 ? 201  HIS B ND1 1 
ATOM   5174  C CD2 . HIS B 1 201 ? 17.472  56.383  42.710  1.00 20.00 ? 201  HIS B CD2 1 
ATOM   5175  C CE1 . HIS B 1 201 ? 19.125  56.598  44.136  1.00 20.00 ? 201  HIS B CE1 1 
ATOM   5176  N NE2 . HIS B 1 201 ? 18.265  55.734  43.625  1.00 20.00 ? 201  HIS B NE2 1 
ATOM   5177  N N   . GLU B 1 202 ? 17.718  57.338  39.028  1.00 20.00 ? 202  GLU B N   1 
ATOM   5178  C CA  . GLU B 1 202 ? 17.960  56.088  38.309  1.00 20.00 ? 202  GLU B CA  1 
ATOM   5179  C C   . GLU B 1 202 ? 19.208  56.202  37.429  1.00 20.00 ? 202  GLU B C   1 
ATOM   5180  O O   . GLU B 1 202 ? 20.074  55.316  37.420  1.00 20.00 ? 202  GLU B O   1 
ATOM   5181  C CB  . GLU B 1 202 ? 16.758  55.742  37.430  1.00 20.00 ? 202  GLU B CB  1 
ATOM   5182  C CG  . GLU B 1 202 ? 15.739  54.830  38.089  1.00 20.00 ? 202  GLU B CG  1 
ATOM   5183  C CD  . GLU B 1 202 ? 14.538  54.567  37.190  1.00 20.00 ? 202  GLU B CD  1 
ATOM   5184  O OE1 . GLU B 1 202 ? 14.739  54.417  35.963  1.00 20.00 ? 202  GLU B OE1 1 
ATOM   5185  O OE2 . GLU B 1 202 ? 13.397  54.512  37.707  1.00 20.00 ? 202  GLU B OE2 1 
ATOM   5186  N N   . MET B 1 203 ? 19.289  57.301  36.686  1.00 20.00 ? 203  MET B N   1 
ATOM   5187  C CA  . MET B 1 203 ? 20.418  57.541  35.803  1.00 20.00 ? 203  MET B CA  1 
ATOM   5188  C C   . MET B 1 203 ? 21.706  57.716  36.590  1.00 20.00 ? 203  MET B C   1 
ATOM   5189  O O   . MET B 1 203 ? 22.676  56.996  36.371  1.00 20.00 ? 203  MET B O   1 
ATOM   5190  C CB  . MET B 1 203 ? 20.158  58.786  34.958  1.00 20.00 ? 203  MET B CB  1 
ATOM   5191  C CG  . MET B 1 203 ? 21.209  59.049  33.888  1.00 20.00 ? 203  MET B CG  1 
ATOM   5192  S SD  . MET B 1 203 ? 20.640  60.184  32.575  1.00 20.00 ? 203  MET B SD  1 
ATOM   5193  C CE  . MET B 1 203 ? 18.989  59.489  32.205  1.00 20.00 ? 203  MET B CE  1 
ATOM   5194  N N   . ALA B 1 204 ? 21.707  58.676  37.510  1.00 20.00 ? 204  ALA B N   1 
ATOM   5195  C CA  . ALA B 1 204 ? 22.877  58.960  38.340  1.00 20.00 ? 204  ALA B CA  1 
ATOM   5196  C C   . ALA B 1 204 ? 23.373  57.719  39.072  1.00 20.00 ? 204  ALA B C   1 
ATOM   5197  O O   . ALA B 1 204 ? 24.562  57.414  39.066  1.00 20.00 ? 204  ALA B O   1 
ATOM   5198  C CB  . ALA B 1 204 ? 22.547  60.065  39.345  1.00 20.00 ? 204  ALA B CB  1 
ATOM   5199  N N   . SER B 1 205 ? 22.450  57.007  39.706  1.00 20.00 ? 205  SER B N   1 
ATOM   5200  C CA  . SER B 1 205 ? 22.790  55.799  40.444  1.00 20.00 ? 205  SER B CA  1 
ATOM   5201  C C   . SER B 1 205 ? 23.522  54.830  39.524  1.00 20.00 ? 205  SER B C   1 
ATOM   5202  O O   . SER B 1 205 ? 24.381  54.061  39.965  1.00 20.00 ? 205  SER B O   1 
ATOM   5203  C CB  . SER B 1 205 ? 21.512  55.151  41.000  1.00 20.00 ? 205  SER B CB  1 
ATOM   5204  O OG  . SER B 1 205 ? 21.459  53.756  40.751  1.00 20.00 ? 205  SER B OG  1 
ATOM   5205  N N   . THR B 1 206 ? 23.186  54.884  38.238  1.00 20.00 ? 206  THR B N   1 
ATOM   5206  C CA  . THR B 1 206 ? 23.809  54.011  37.250  1.00 20.00 ? 206  THR B CA  1 
ATOM   5207  C C   . THR B 1 206 ? 25.292  54.344  37.076  1.00 20.00 ? 206  THR B C   1 
ATOM   5208  O O   . THR B 1 206 ? 26.145  53.453  37.109  1.00 20.00 ? 206  THR B O   1 
ATOM   5209  C CB  . THR B 1 206 ? 23.078  54.112  35.876  1.00 20.00 ? 206  THR B CB  1 
ATOM   5210  O OG1 . THR B 1 206 ? 21.863  53.347  35.922  1.00 20.00 ? 206  THR B OG1 1 
ATOM   5211  C CG2 . THR B 1 206 ? 23.960  53.577  34.751  1.00 20.00 ? 206  THR B CG2 1 
ATOM   5212  N N   . TYR B 1 207 ? 25.598  55.626  36.911  1.00 20.00 ? 207  TYR B N   1 
ATOM   5213  C CA  . TYR B 1 207 ? 26.976  56.057  36.732  1.00 20.00 ? 207  TYR B CA  1 
ATOM   5214  C C   . TYR B 1 207 ? 27.653  56.424  38.037  1.00 20.00 ? 207  TYR B C   1 
ATOM   5215  O O   . TYR B 1 207 ? 28.749  56.990  38.037  1.00 20.00 ? 207  TYR B O   1 
ATOM   5216  C CB  . TYR B 1 207 ? 27.024  57.247  35.785  1.00 20.00 ? 207  TYR B CB  1 
ATOM   5217  C CG  . TYR B 1 207 ? 26.343  56.979  34.469  1.00 20.00 ? 207  TYR B CG  1 
ATOM   5218  C CD1 . TYR B 1 207 ? 24.958  57.115  34.333  1.00 20.00 ? 207  TYR B CD1 1 
ATOM   5219  C CD2 . TYR B 1 207 ? 27.081  56.583  33.356  1.00 20.00 ? 207  TYR B CD2 1 
ATOM   5220  C CE1 . TYR B 1 207 ? 24.326  56.862  33.118  1.00 20.00 ? 207  TYR B CE1 1 
ATOM   5221  C CE2 . TYR B 1 207 ? 26.461  56.327  32.133  1.00 20.00 ? 207  TYR B CE2 1 
ATOM   5222  C CZ  . TYR B 1 207 ? 25.084  56.468  32.020  1.00 20.00 ? 207  TYR B CZ  1 
ATOM   5223  O OH  . TYR B 1 207 ? 24.471  56.216  30.809  1.00 20.00 ? 207  TYR B OH  1 
ATOM   5224  N N   . GLY B 1 208 ? 26.999  56.103  39.150  1.00 20.00 ? 208  GLY B N   1 
ATOM   5225  C CA  . GLY B 1 208 ? 27.559  56.408  40.456  1.00 20.00 ? 208  GLY B CA  1 
ATOM   5226  C C   . GLY B 1 208 ? 27.741  57.890  40.749  1.00 20.00 ? 208  GLY B C   1 
ATOM   5227  O O   . GLY B 1 208 ? 28.632  58.267  41.512  1.00 20.00 ? 208  GLY B O   1 
ATOM   5228  N N   . ILE B 1 209 ? 26.905  58.734  40.151  1.00 20.00 ? 209  ILE B N   1 
ATOM   5229  C CA  . ILE B 1 209 ? 26.994  60.177  40.366  1.00 20.00 ? 209  ILE B CA  1 
ATOM   5230  C C   . ILE B 1 209 ? 26.209  60.571  41.620  1.00 20.00 ? 209  ILE B C   1 
ATOM   5231  O O   . ILE B 1 209 ? 25.153  59.996  41.913  1.00 20.00 ? 209  ILE B O   1 
ATOM   5232  C CB  . ILE B 1 209 ? 26.442  60.963  39.148  1.00 20.00 ? 209  ILE B CB  1 
ATOM   5233  C CG1 . ILE B 1 209 ? 27.334  60.720  37.927  1.00 20.00 ? 209  ILE B CG1 1 
ATOM   5234  C CG2 . ILE B 1 209 ? 26.393  62.456  39.460  1.00 20.00 ? 209  ILE B CG2 1 
ATOM   5235  C CD1 . ILE B 1 209 ? 26.912  61.492  36.694  1.00 20.00 ? 209  ILE B CD1 1 
ATOM   5236  N N   . LYS B 1 210 ? 26.730  61.555  42.351  1.00 20.00 ? 210  LYS B N   1 
ATOM   5237  C CA  . LYS B 1 210 ? 26.099  62.037  43.576  1.00 20.00 ? 210  LYS B CA  1 
ATOM   5238  C C   . LYS B 1 210 ? 24.961  63.031  43.358  1.00 20.00 ? 210  LYS B C   1 
ATOM   5239  O O   . LYS B 1 210 ? 25.009  63.865  42.449  1.00 20.00 ? 210  LYS B O   1 
ATOM   5240  C CB  . LYS B 1 210 ? 27.154  62.669  44.484  1.00 20.00 ? 210  LYS B CB  1 
ATOM   5241  C CG  . LYS B 1 210 ? 27.324  61.959  45.803  1.00 20.00 ? 210  LYS B CG  1 
ATOM   5242  C CD  . LYS B 1 210 ? 27.614  60.485  45.598  1.00 20.00 ? 210  LYS B CD  1 
ATOM   5243  C CE  . LYS B 1 210 ? 28.525  59.951  46.696  1.00 20.00 ? 210  LYS B CE  1 
ATOM   5244  N NZ  . LYS B 1 210 ? 29.462  61.005  47.201  1.00 20.00 ? 210  LYS B NZ  1 
ATOM   5245  N N   . ILE B 1 211 ? 23.939  62.929  44.209  1.00 20.00 ? 211  ILE B N   1 
ATOM   5246  C CA  . ILE B 1 211 ? 22.769  63.803  44.145  1.00 20.00 ? 211  ILE B CA  1 
ATOM   5247  C C   . ILE B 1 211 ? 22.498  64.462  45.501  1.00 20.00 ? 211  ILE B C   1 
ATOM   5248  O O   . ILE B 1 211 ? 22.179  63.792  46.489  1.00 20.00 ? 211  ILE B O   1 
ATOM   5249  C CB  . ILE B 1 211 ? 21.492  63.022  43.718  1.00 20.00 ? 211  ILE B CB  1 
ATOM   5250  C CG1 . ILE B 1 211 ? 21.659  62.466  42.301  1.00 20.00 ? 211  ILE B CG1 1 
ATOM   5251  C CG2 . ILE B 1 211 ? 20.282  63.943  43.734  1.00 20.00 ? 211  ILE B CG2 1 
ATOM   5252  C CD1 . ILE B 1 211 ? 20.683  61.356  41.975  1.00 20.00 ? 211  ILE B CD1 1 
ATOM   5253  N N   . PHE B 1 212 ? 22.632  65.787  45.533  1.00 20.00 ? 212  PHE B N   1 
ATOM   5254  C CA  . PHE B 1 212 ? 22.406  66.569  46.740  1.00 20.00 ? 212  PHE B CA  1 
ATOM   5255  C C   . PHE B 1 212 ? 21.289  67.574  46.472  1.00 20.00 ? 212  PHE B C   1 
ATOM   5256  O O   . PHE B 1 212 ? 21.375  68.373  45.538  1.00 20.00 ? 212  PHE B O   1 
ATOM   5257  C CB  . PHE B 1 212 ? 23.685  67.303  47.140  1.00 20.00 ? 212  PHE B CB  1 
ATOM   5258  C CG  . PHE B 1 212 ? 24.746  66.397  47.691  1.00 20.00 ? 212  PHE B CG  1 
ATOM   5259  C CD1 . PHE B 1 212 ? 24.524  65.681  48.865  1.00 20.00 ? 212  PHE B CD1 1 
ATOM   5260  C CD2 . PHE B 1 212 ? 25.953  66.232  47.022  1.00 20.00 ? 212  PHE B CD2 1 
ATOM   5261  C CE1 . PHE B 1 212 ? 25.485  64.809  49.364  1.00 20.00 ? 212  PHE B CE1 1 
ATOM   5262  C CE2 . PHE B 1 212 ? 26.922  65.363  47.516  1.00 20.00 ? 212  PHE B CE2 1 
ATOM   5263  C CZ  . PHE B 1 212 ? 26.684  64.649  48.690  1.00 20.00 ? 212  PHE B CZ  1 
ATOM   5264  N N   . TYR B 1 213 ? 20.245  67.531  47.294  1.00 20.00 ? 213  TYR B N   1 
ATOM   5265  C CA  . TYR B 1 213 ? 19.109  68.433  47.146  1.00 20.00 ? 213  TYR B CA  1 
ATOM   5266  C C   . TYR B 1 213 ? 19.314  69.779  47.831  1.00 20.00 ? 213  TYR B C   1 
ATOM   5267  O O   . TYR B 1 213 ? 20.123  69.915  48.749  1.00 20.00 ? 213  TYR B O   1 
ATOM   5268  C CB  . TYR B 1 213 ? 17.845  67.816  47.758  1.00 20.00 ? 213  TYR B CB  1 
ATOM   5269  C CG  . TYR B 1 213 ? 17.170  66.714  46.973  1.00 20.00 ? 213  TYR B CG  1 
ATOM   5270  C CD1 . TYR B 1 213 ? 17.755  66.172  45.829  1.00 20.00 ? 213  TYR B CD1 1 
ATOM   5271  C CD2 . TYR B 1 213 ? 15.954  66.181  47.408  1.00 20.00 ? 213  TYR B CD2 1 
ATOM   5272  C CE1 . TYR B 1 213 ? 17.149  65.127  45.144  1.00 20.00 ? 213  TYR B CE1 1 
ATOM   5273  C CE2 . TYR B 1 213 ? 15.340  65.136  46.728  1.00 20.00 ? 213  TYR B CE2 1 
ATOM   5274  C CZ  . TYR B 1 213 ? 15.946  64.614  45.598  1.00 20.00 ? 213  TYR B CZ  1 
ATOM   5275  O OH  . TYR B 1 213 ? 15.353  63.577  44.927  1.00 20.00 ? 213  TYR B OH  1 
ATOM   5276  N N   . ASP B 1 214 ? 18.577  70.774  47.355  1.00 20.00 ? 214  ASP B N   1 
ATOM   5277  C CA  . ASP B 1 214 ? 18.623  72.118  47.911  1.00 20.00 ? 214  ASP B CA  1 
ATOM   5278  C C   . ASP B 1 214 ? 17.166  72.148  48.359  1.00 20.00 ? 214  ASP B C   1 
ATOM   5279  O O   . ASP B 1 214 ? 16.295  72.713  47.700  1.00 20.00 ? 214  ASP B O   1 
ATOM   5280  C CB  . ASP B 1 214 ? 18.876  73.174  46.844  1.00 20.00 ? 214  ASP B CB  1 
ATOM   5281  C CG  . ASP B 1 214 ? 18.828  74.584  47.406  1.00 20.00 ? 214  ASP B CG  1 
ATOM   5282  O OD1 . ASP B 1 214 ? 18.241  74.772  48.494  1.00 20.00 ? 214  ASP B OD1 1 
ATOM   5283  O OD2 . ASP B 1 214 ? 19.374  75.505  46.763  1.00 20.00 ? 214  ASP B OD2 1 
ATOM   5284  N N   . ALA B 1 215 ? 16.918  71.484  49.480  1.00 20.00 ? 215  ALA B N   1 
ATOM   5285  C CA  . ALA B 1 215 ? 15.596  71.369  50.069  1.00 20.00 ? 215  ALA B CA  1 
ATOM   5286  C C   . ALA B 1 215 ? 15.001  72.555  50.801  1.00 20.00 ? 215  ALA B C   1 
ATOM   5287  O O   . ALA B 1 215 ? 13.995  72.385  51.486  1.00 20.00 ? 215  ALA B O   1 
ATOM   5288  C CB  . ALA B 1 215 ? 15.586  70.168  50.993  1.00 20.00 ? 215  ALA B CB  1 
ATOM   5289  N N   . THR B 1 216 ? 15.568  73.748  50.652  1.00 20.00 ? 216  THR B N   1 
ATOM   5290  C CA  . THR B 1 216 ? 15.020  74.907  51.361  1.00 20.00 ? 216  THR B CA  1 
ATOM   5291  C C   . THR B 1 216 ? 13.490  75.004  51.373  1.00 20.00 ? 216  THR B C   1 
ATOM   5292  O O   . THR B 1 216 ? 12.892  75.312  52.407  1.00 20.00 ? 216  THR B O   1 
ATOM   5293  C CB  . THR B 1 216 ? 15.641  76.252  50.851  1.00 20.00 ? 216  THR B CB  1 
ATOM   5294  O OG1 . THR B 1 216 ? 15.294  76.474  49.481  1.00 20.00 ? 216  THR B OG1 1 
ATOM   5295  C CG2 . THR B 1 216 ? 17.153  76.212  50.984  1.00 20.00 ? 216  THR B CG2 1 
ATOM   5296  N N   . ARG B 1 217 ? 12.852  74.717  50.246  1.00 20.00 ? 217  ARG B N   1 
ATOM   5297  C CA  . ARG B 1 217 ? 11.396  74.785  50.175  1.00 20.00 ? 217  ARG B CA  1 
ATOM   5298  C C   . ARG B 1 217 ? 10.827  73.453  49.741  1.00 20.00 ? 217  ARG B C   1 
ATOM   5299  O O   . ARG B 1 217 ? 9.945   73.395  48.886  1.00 20.00 ? 217  ARG B O   1 
ATOM   5300  C CB  . ARG B 1 217 ? 10.965  75.866  49.189  1.00 20.00 ? 217  ARG B CB  1 
ATOM   5301  C CG  . ARG B 1 217 ? 11.115  77.253  49.739  1.00 20.00 ? 217  ARG B CG  1 
ATOM   5302  C CD  . ARG B 1 217 ? 10.818  78.295  48.699  1.00 20.00 ? 217  ARG B CD  1 
ATOM   5303  N NE  . ARG B 1 217 ? 11.294  79.608  49.116  1.00 20.00 ? 217  ARG B NE  1 
ATOM   5304  C CZ  . ARG B 1 217 ? 12.414  80.166  48.673  1.00 20.00 ? 217  ARG B CZ  1 
ATOM   5305  N NH1 . ARG B 1 217 ? 13.177  79.541  47.804  1.00 20.00 ? 217  ARG B NH1 1 
ATOM   5306  N NH2 . ARG B 1 217 ? 12.774  81.359  49.094  1.00 20.00 ? 217  ARG B NH2 1 
ATOM   5307  N N   . CYS B 1 218 ? 11.324  72.384  50.353  1.00 20.00 ? 218  CYS B N   1 
ATOM   5308  C CA  . CYS B 1 218 ? 10.873  71.045  50.026  1.00 20.00 ? 218  CYS B CA  1 
ATOM   5309  C C   . CYS B 1 218 ? 9.441   70.718  50.411  1.00 20.00 ? 218  CYS B C   1 
ATOM   5310  O O   . CYS B 1 218 ? 8.866   69.783  49.859  1.00 20.00 ? 218  CYS B O   1 
ATOM   5311  C CB  . CYS B 1 218 ? 11.805  70.019  50.661  1.00 20.00 ? 218  CYS B CB  1 
ATOM   5312  S SG  . CYS B 1 218 ? 11.813  70.089  52.446  1.00 20.00 ? 218  CYS B SG  1 
ATOM   5313  N N   . VAL B 1 219 ? 8.867   71.455  51.361  1.00 20.00 ? 219  VAL B N   1 
ATOM   5314  C CA  . VAL B 1 219 ? 7.491   71.180  51.767  1.00 20.00 ? 219  VAL B CA  1 
ATOM   5315  C C   . VAL B 1 219 ? 6.477   71.800  50.810  1.00 20.00 ? 219  VAL B C   1 
ATOM   5316  O O   . VAL B 1 219 ? 5.363   71.306  50.676  1.00 20.00 ? 219  VAL B O   1 
ATOM   5317  C CB  . VAL B 1 219 ? 7.208   71.645  53.210  1.00 20.00 ? 219  VAL B CB  1 
ATOM   5318  C CG1 . VAL B 1 219 ? 5.791   71.237  53.619  1.00 20.00 ? 219  VAL B CG1 1 
ATOM   5319  C CG2 . VAL B 1 219 ? 8.207   70.997  54.161  1.00 20.00 ? 219  VAL B CG2 1 
ATOM   5320  N N   . GLU B 1 220 ? 6.851   72.884  50.150  1.00 20.00 ? 220  GLU B N   1 
ATOM   5321  C CA  . GLU B 1 220 ? 5.945   73.524  49.207  1.00 20.00 ? 220  GLU B CA  1 
ATOM   5322  C C   . GLU B 1 220 ? 5.962   72.610  47.987  1.00 20.00 ? 220  GLU B C   1 
ATOM   5323  O O   . GLU B 1 220 ? 4.941   72.385  47.334  1.00 20.00 ? 220  GLU B O   1 
ATOM   5324  C CB  . GLU B 1 220 ? 6.453   74.914  48.833  1.00 20.00 ? 220  GLU B CB  1 
ATOM   5325  C CG  . GLU B 1 220 ? 6.368   75.892  49.988  1.00 20.00 ? 220  GLU B CG  1 
ATOM   5326  C CD  . GLU B 1 220 ? 7.070   77.206  49.722  1.00 20.00 ? 220  GLU B CD  1 
ATOM   5327  O OE1 . GLU B 1 220 ? 7.529   77.435  48.584  1.00 20.00 ? 220  GLU B OE1 1 
ATOM   5328  O OE2 . GLU B 1 220 ? 7.156   78.013  50.665  1.00 20.00 ? 220  GLU B OE2 1 
ATOM   5329  N N   . ASN B 1 221 ? 7.138   72.073  47.686  1.00 20.00 ? 221  ASN B N   1 
ATOM   5330  C CA  . ASN B 1 221 ? 7.288   71.175  46.548  1.00 20.00 ? 221  ASN B CA  1 
ATOM   5331  C C   . ASN B 1 221 ? 6.410   69.955  46.785  1.00 20.00 ? 221  ASN B C   1 
ATOM   5332  O O   . ASN B 1 221 ? 5.709   69.514  45.885  1.00 20.00 ? 221  ASN B O   1 
ATOM   5333  C CB  . ASN B 1 221 ? 8.743   70.744  46.387  1.00 20.00 ? 221  ASN B CB  1 
ATOM   5334  C CG  . ASN B 1 221 ? 9.007   70.090  45.046  1.00 20.00 ? 221  ASN B CG  1 
ATOM   5335  O OD1 . ASN B 1 221 ? 9.396   70.753  44.084  1.00 20.00 ? 221  ASN B OD1 1 
ATOM   5336  N ND2 . ASN B 1 221 ? 8.794   68.782  44.973  1.00 20.00 ? 221  ASN B ND2 1 
ATOM   5337  N N   . ALA B 1 222 ? 6.448   69.415  48.003  1.00 20.00 ? 222  ALA B N   1 
ATOM   5338  C CA  . ALA B 1 222 ? 5.642   68.245  48.348  1.00 20.00 ? 222  ALA B CA  1 
ATOM   5339  C C   . ALA B 1 222 ? 4.146   68.520  48.183  1.00 20.00 ? 222  ALA B C   1 
ATOM   5340  O O   . ALA B 1 222 ? 3.384   67.630  47.827  1.00 20.00 ? 222  ALA B O   1 
ATOM   5341  C CB  . ALA B 1 222 ? 5.922   67.822  49.774  1.00 20.00 ? 222  ALA B CB  1 
ATOM   5342  N N   . TYR B 1 223 ? 3.717   69.749  48.446  1.00 20.00 ? 223  TYR B N   1 
ATOM   5343  C CA  . TYR B 1 223 ? 2.306   70.060  48.305  1.00 20.00 ? 223  TYR B CA  1 
ATOM   5344  C C   . TYR B 1 223 ? 1.892   69.992  46.840  1.00 20.00 ? 223  TYR B C   1 
ATOM   5345  O O   . TYR B 1 223 ? 0.809   69.510  46.519  1.00 20.00 ? 223  TYR B O   1 
ATOM   5346  C CB  . TYR B 1 223 ? 1.974   71.447  48.863  1.00 20.00 ? 223  TYR B CB  1 
ATOM   5347  C CG  . TYR B 1 223 ? 0.550   71.840  48.547  1.00 20.00 ? 223  TYR B CG  1 
ATOM   5348  C CD1 . TYR B 1 223 ? -0.507  71.408  49.349  1.00 20.00 ? 223  TYR B CD1 1 
ATOM   5349  C CD2 . TYR B 1 223 ? 0.246   72.528  47.375  1.00 20.00 ? 223  TYR B CD2 1 
ATOM   5350  C CE1 . TYR B 1 223 ? -1.829  71.640  48.983  1.00 20.00 ? 223  TYR B CE1 1 
ATOM   5351  C CE2 . TYR B 1 223 ? -1.072  72.766  47.000  1.00 20.00 ? 223  TYR B CE2 1 
ATOM   5352  C CZ  . TYR B 1 223 ? -2.103  72.314  47.805  1.00 20.00 ? 223  TYR B CZ  1 
ATOM   5353  O OH  . TYR B 1 223 ? -3.399  72.517  47.407  1.00 20.00 ? 223  TYR B OH  1 
ATOM   5354  N N   . PHE B 1 224 ? 2.749   70.474  45.948  1.00 20.00 ? 224  PHE B N   1 
ATOM   5355  C CA  . PHE B 1 224 ? 2.432   70.447  44.524  1.00 20.00 ? 224  PHE B CA  1 
ATOM   5356  C C   . PHE B 1 224 ? 2.344   69.014  43.998  1.00 20.00 ? 224  PHE B C   1 
ATOM   5357  O O   . PHE B 1 224 ? 1.542   68.716  43.109  1.00 20.00 ? 224  PHE B O   1 
ATOM   5358  C CB  . PHE B 1 224 ? 3.474   71.234  43.737  1.00 20.00 ? 224  PHE B CB  1 
ATOM   5359  C CG  . PHE B 1 224 ? 3.285   72.724  43.805  1.00 20.00 ? 224  PHE B CG  1 
ATOM   5360  C CD1 . PHE B 1 224 ? 2.301   73.350  43.047  1.00 20.00 ? 224  PHE B CD1 1 
ATOM   5361  C CD2 . PHE B 1 224 ? 4.096   73.503  44.619  1.00 20.00 ? 224  PHE B CD2 1 
ATOM   5362  C CE1 . PHE B 1 224 ? 2.132   74.731  43.099  1.00 20.00 ? 224  PHE B CE1 1 
ATOM   5363  C CE2 . PHE B 1 224 ? 3.932   74.877  44.676  1.00 20.00 ? 224  PHE B CE2 1 
ATOM   5364  C CZ  . PHE B 1 224 ? 2.949   75.495  43.915  1.00 20.00 ? 224  PHE B CZ  1 
ATOM   5365  N N   . ILE B 1 225 ? 3.169   68.132  44.554  1.00 20.00 ? 225  ILE B N   1 
ATOM   5366  C CA  . ILE B 1 225 ? 3.186   66.731  44.154  1.00 20.00 ? 225  ILE B CA  1 
ATOM   5367  C C   . ILE B 1 225 ? 1.871   66.089  44.603  1.00 20.00 ? 225  ILE B C   1 
ATOM   5368  O O   . ILE B 1 225 ? 1.223   65.362  43.838  1.00 20.00 ? 225  ILE B O   1 
ATOM   5369  C CB  . ILE B 1 225 ? 4.384   65.982  44.802  1.00 20.00 ? 225  ILE B CB  1 
ATOM   5370  C CG1 . ILE B 1 225 ? 5.682   66.390  44.105  1.00 20.00 ? 225  ILE B CG1 1 
ATOM   5371  C CG2 . ILE B 1 225 ? 4.194   64.470  44.697  1.00 20.00 ? 225  ILE B CG2 1 
ATOM   5372  C CD1 . ILE B 1 225 ? 6.925   65.755  44.701  1.00 20.00 ? 225  ILE B CD1 1 
ATOM   5373  N N   . LYS B 1 226 ? 1.465   66.368  45.838  1.00 20.00 ? 226  LYS B N   1 
ATOM   5374  C CA  . LYS B 1 226 ? 0.226   65.802  46.346  1.00 20.00 ? 226  LYS B CA  1 
ATOM   5375  C C   . LYS B 1 226 ? -0.989  66.365  45.620  1.00 20.00 ? 226  LYS B C   1 
ATOM   5376  O O   . LYS B 1 226 ? -1.997  65.677  45.465  1.00 20.00 ? 226  LYS B O   1 
ATOM   5377  C CB  . LYS B 1 226 ? 0.074   66.067  47.838  1.00 20.00 ? 226  LYS B CB  1 
ATOM   5378  C CG  . LYS B 1 226 ? -1.170  65.429  48.426  1.00 20.00 ? 226  LYS B CG  1 
ATOM   5379  C CD  . LYS B 1 226 ? -1.318  65.751  49.887  1.00 20.00 ? 226  LYS B CD  1 
ATOM   5380  C CE  . LYS B 1 226 ? -2.676  65.310  50.404  1.00 20.00 ? 226  LYS B CE  1 
ATOM   5381  N NZ  . LYS B 1 226 ? -2.826  63.823  50.420  1.00 20.00 ? 226  LYS B NZ  1 
ATOM   5382  N N   . GLU B 1 227 ? -0.893  67.613  45.172  1.00 20.00 ? 227  GLU B N   1 
ATOM   5383  C CA  . GLU B 1 227 ? -2.004  68.243  44.470  1.00 20.00 ? 227  GLU B CA  1 
ATOM   5384  C C   . GLU B 1 227 ? -2.050  67.986  42.964  1.00 20.00 ? 227  GLU B C   1 
ATOM   5385  O O   . GLU B 1 227 ? -3.136  67.886  42.392  1.00 20.00 ? 227  GLU B O   1 
ATOM   5386  C CB  . GLU B 1 227 ? -1.999  69.767  44.706  1.00 20.00 ? 227  GLU B CB  1 
ATOM   5387  C CG  . GLU B 1 227 ? -3.124  70.500  43.973  1.00 20.00 ? 227  GLU B CG  1 
ATOM   5388  C CD  . GLU B 1 227 ? -2.987  72.011  43.985  1.00 20.00 ? 227  GLU B CD  1 
ATOM   5389  O OE1 . GLU B 1 227 ? -2.295  72.563  43.105  1.00 20.00 ? 227  GLU B OE1 1 
ATOM   5390  O OE2 . GLU B 1 227 ? -3.586  72.654  44.870  1.00 20.00 ? 227  GLU B OE2 1 
ATOM   5391  N N   . GLN B 1 228 ? -0.893  67.849  42.318  1.00 20.00 ? 228  GLN B N   1 
ATOM   5392  C CA  . GLN B 1 228 ? -0.893  67.624  40.878  1.00 20.00 ? 228  GLN B CA  1 
ATOM   5393  C C   . GLN B 1 228 ? -0.285  66.362  40.290  1.00 20.00 ? 228  GLN B C   1 
ATOM   5394  O O   . GLN B 1 228 ? -0.472  66.098  39.099  1.00 20.00 ? 228  GLN B O   1 
ATOM   5395  C CB  . GLN B 1 228 ? -0.257  68.829  40.190  1.00 20.00 ? 228  GLN B CB  1 
ATOM   5396  C CG  . GLN B 1 228 ? -0.951  70.136  40.500  1.00 20.00 ? 228  GLN B CG  1 
ATOM   5397  C CD  . GLN B 1 228 ? -0.160  71.337  40.034  1.00 20.00 ? 228  GLN B CD  1 
ATOM   5398  O OE1 . GLN B 1 228 ? 0.538   71.283  39.017  1.00 20.00 ? 228  GLN B OE1 1 
ATOM   5399  N NE2 . GLN B 1 228 ? -0.266  72.437  40.777  1.00 20.00 ? 228  GLN B NE2 1 
ATOM   5400  N N   . GLU B 1 229 ? 0.446   65.583  41.079  1.00 20.00 ? 229  GLU B N   1 
ATOM   5401  C CA  . GLU B 1 229 ? 1.034   64.369  40.525  1.00 20.00 ? 229  GLU B CA  1 
ATOM   5402  C C   . GLU B 1 229 ? 0.121   63.169  40.729  1.00 20.00 ? 229  GLU B C   1 
ATOM   5403  O O   . GLU B 1 229 ? -0.252  62.841  41.851  1.00 20.00 ? 229  GLU B O   1 
ATOM   5404  C CB  . GLU B 1 229 ? 2.400   64.093  41.135  1.00 20.00 ? 229  GLU B CB  1 
ATOM   5405  C CG  . GLU B 1 229 ? 3.153   63.026  40.383  1.00 20.00 ? 229  GLU B CG  1 
ATOM   5406  C CD  . GLU B 1 229 ? 4.646   63.188  40.469  1.00 20.00 ? 229  GLU B CD  1 
ATOM   5407  O OE1 . GLU B 1 229 ? 5.109   64.095  41.192  1.00 20.00 ? 229  GLU B OE1 1 
ATOM   5408  O OE2 . GLU B 1 229 ? 5.362   62.407  39.812  1.00 20.00 ? 229  GLU B OE2 1 
ATOM   5409  N N   . ALA B 1 230 ? -0.236  62.526  39.622  1.00 20.00 ? 230  ALA B N   1 
ATOM   5410  C CA  . ALA B 1 230 ? -1.110  61.363  39.637  1.00 20.00 ? 230  ALA B CA  1 
ATOM   5411  C C   . ALA B 1 230 ? -0.630  60.289  40.590  1.00 20.00 ? 230  ALA B C   1 
ATOM   5412  O O   . ALA B 1 230 ? 0.547   59.940  40.602  1.00 20.00 ? 230  ALA B O   1 
ATOM   5413  C CB  . ALA B 1 230 ? -1.235  60.793  38.233  1.00 20.00 ? 230  ALA B CB  1 
ATOM   5414  N N   . GLY B 1 231 ? -1.553  59.768  41.390  1.00 20.00 ? 231  GLY B N   1 
ATOM   5415  C CA  . GLY B 1 231 ? -1.206  58.728  42.340  1.00 20.00 ? 231  GLY B CA  1 
ATOM   5416  C C   . GLY B 1 231 ? -0.853  59.203  43.737  1.00 20.00 ? 231  GLY B C   1 
ATOM   5417  O O   . GLY B 1 231 ? -0.830  58.397  44.666  1.00 20.00 ? 231  GLY B O   1 
ATOM   5418  N N   . TYR B 1 232 ? -0.591  60.499  43.901  1.00 20.00 ? 232  TYR B N   1 
ATOM   5419  C CA  . TYR B 1 232 ? -0.237  61.045  45.211  1.00 20.00 ? 232  TYR B CA  1 
ATOM   5420  C C   . TYR B 1 232 ? -1.365  61.844  45.840  1.00 20.00 ? 232  TYR B C   1 
ATOM   5421  O O   . TYR B 1 232 ? -1.168  62.530  46.844  1.00 20.00 ? 232  TYR B O   1 
ATOM   5422  C CB  . TYR B 1 232 ? 1.014   61.925  45.094  1.00 20.00 ? 232  TYR B CB  1 
ATOM   5423  C CG  . TYR B 1 232 ? 2.278   61.129  44.896  1.00 20.00 ? 232  TYR B CG  1 
ATOM   5424  C CD1 . TYR B 1 232 ? 2.970   60.608  45.984  1.00 20.00 ? 232  TYR B CD1 1 
ATOM   5425  C CD2 . TYR B 1 232 ? 2.749   60.841  43.617  1.00 20.00 ? 232  TYR B CD2 1 
ATOM   5426  C CE1 . TYR B 1 232 ? 4.101   59.809  45.804  1.00 20.00 ? 232  TYR B CE1 1 
ATOM   5427  C CE2 . TYR B 1 232 ? 3.878   60.043  43.423  1.00 20.00 ? 232  TYR B CE2 1 
ATOM   5428  C CZ  . TYR B 1 232 ? 4.545   59.529  44.520  1.00 20.00 ? 232  TYR B CZ  1 
ATOM   5429  O OH  . TYR B 1 232 ? 5.635   58.716  44.335  1.00 20.00 ? 232  TYR B OH  1 
ATOM   5430  N N   . GLU B 1 233 ? -2.549  61.750  45.249  1.00 20.00 ? 233  GLU B N   1 
ATOM   5431  C CA  . GLU B 1 233 ? -3.705  62.467  45.757  1.00 20.00 ? 233  GLU B CA  1 
ATOM   5432  C C   . GLU B 1 233 ? -3.982  62.088  47.202  1.00 20.00 ? 233  GLU B C   1 
ATOM   5433  O O   . GLU B 1 233 ? -4.379  62.934  48.002  1.00 20.00 ? 233  GLU B O   1 
ATOM   5434  C CB  . GLU B 1 233 ? -4.947  62.149  44.914  1.00 20.00 ? 233  GLU B CB  1 
ATOM   5435  C CG  . GLU B 1 233 ? -4.726  62.214  43.406  1.00 20.00 ? 233  GLU B CG  1 
ATOM   5436  C CD  . GLU B 1 233 ? -4.280  60.882  42.809  1.00 20.00 ? 233  GLU B CD  1 
ATOM   5437  O OE1 . GLU B 1 233 ? -4.165  59.891  43.567  1.00 20.00 ? 233  GLU B OE1 1 
ATOM   5438  O OE2 . GLU B 1 233 ? -4.044  60.829  41.579  1.00 20.00 ? 233  GLU B OE2 1 
ATOM   5439  N N   . ASN B 1 234 ? -3.768  60.819  47.536  1.00 20.00 ? 234  ASN B N   1 
ATOM   5440  C CA  . ASN B 1 234 ? -4.013  60.351  48.891  1.00 20.00 ? 234  ASN B CA  1 
ATOM   5441  C C   . ASN B 1 234 ? -2.785  60.056  49.739  1.00 20.00 ? 234  ASN B C   1 
ATOM   5442  O O   . ASN B 1 234 ? -2.898  59.392  50.768  1.00 20.00 ? 234  ASN B O   1 
ATOM   5443  C CB  . ASN B 1 234 ? -4.908  59.109  48.857  1.00 20.00 ? 234  ASN B CB  1 
ATOM   5444  C CG  . ASN B 1 234 ? -6.185  59.330  48.060  1.00 20.00 ? 234  ASN B CG  1 
ATOM   5445  O OD1 . ASN B 1 234 ? -6.955  60.255  48.338  1.00 20.00 ? 234  ASN B OD1 1 
ATOM   5446  N ND2 . ASN B 1 234 ? -6.414  58.481  47.061  1.00 20.00 ? 234  ASN B ND2 1 
ATOM   5447  N N   . VAL B 1 235 ? -1.616  60.530  49.317  1.00 20.00 ? 235  VAL B N   1 
ATOM   5448  C CA  . VAL B 1 235 ? -0.392  60.293  50.088  1.00 20.00 ? 235  VAL B CA  1 
ATOM   5449  C C   . VAL B 1 235 ? -0.191  61.483  51.020  1.00 20.00 ? 235  VAL B C   1 
ATOM   5450  O O   . VAL B 1 235 ? -0.484  62.619  50.640  1.00 20.00 ? 235  VAL B O   1 
ATOM   5451  C CB  . VAL B 1 235 ? 0.837   60.156  49.179  1.00 20.00 ? 235  VAL B CB  1 
ATOM   5452  C CG1 . VAL B 1 235 ? 2.079   59.927  50.024  1.00 20.00 ? 235  VAL B CG1 1 
ATOM   5453  C CG2 . VAL B 1 235 ? 0.639   58.992  48.222  1.00 20.00 ? 235  VAL B CG2 1 
ATOM   5454  N N   . SER B 1 236 ? 0.286   61.228  52.237  1.00 20.00 ? 236  SER B N   1 
ATOM   5455  C CA  . SER B 1 236 ? 0.508   62.300  53.206  1.00 20.00 ? 236  SER B CA  1 
ATOM   5456  C C   . SER B 1 236 ? 1.718   63.131  52.840  1.00 20.00 ? 236  SER B C   1 
ATOM   5457  O O   . SER B 1 236 ? 2.657   62.627  52.222  1.00 20.00 ? 236  SER B O   1 
ATOM   5458  C CB  . SER B 1 236 ? 0.707   61.717  54.600  1.00 20.00 ? 236  SER B CB  1 
ATOM   5459  O OG  . SER B 1 236 ? 1.977   61.103  54.702  1.00 20.00 ? 236  SER B OG  1 
ATOM   5460  N N   . ILE B 1 237 ? 1.688   64.410  53.213  1.00 20.00 ? 237  ILE B N   1 
ATOM   5461  C CA  . ILE B 1 237 ? 2.795   65.323  52.926  1.00 20.00 ? 237  ILE B CA  1 
ATOM   5462  C C   . ILE B 1 237 ? 4.060   64.703  53.493  1.00 20.00 ? 237  ILE B C   1 
ATOM   5463  O O   . ILE B 1 237 ? 5.118   64.695  52.852  1.00 20.00 ? 237  ILE B O   1 
ATOM   5464  C CB  . ILE B 1 237 ? 2.590   66.691  53.604  1.00 20.00 ? 237  ILE B CB  1 
ATOM   5465  C CG1 . ILE B 1 237 ? 1.548   67.509  52.843  1.00 20.00 ? 237  ILE B CG1 1 
ATOM   5466  C CG2 . ILE B 1 237 ? 3.904   67.440  53.671  1.00 20.00 ? 237  ILE B CG2 1 
ATOM   5467  C CD1 . ILE B 1 237 ? 1.935   67.814  51.425  1.00 20.00 ? 237  ILE B CD1 1 
ATOM   5468  N N   . LYS B 1 238 ? 3.938   64.181  54.709  1.00 20.00 ? 238  LYS B N   1 
ATOM   5469  C CA  . LYS B 1 238 ? 5.050   63.546  55.398  1.00 20.00 ? 238  LYS B CA  1 
ATOM   5470  C C   . LYS B 1 238 ? 5.611   62.393  54.570  1.00 20.00 ? 238  LYS B C   1 
ATOM   5471  O O   . LYS B 1 238 ? 6.822   62.275  54.389  1.00 20.00 ? 238  LYS B O   1 
ATOM   5472  C CB  . LYS B 1 238 ? 4.584   63.022  56.759  1.00 20.00 ? 238  LYS B CB  1 
ATOM   5473  C CG  . LYS B 1 238 ? 5.681   62.372  57.575  1.00 20.00 ? 238  LYS B CG  1 
ATOM   5474  C CD  . LYS B 1 238 ? 5.321   62.310  59.044  1.00 20.00 ? 238  LYS B CD  1 
ATOM   5475  C CE  . LYS B 1 238 ? 4.450   61.103  59.360  1.00 20.00 ? 238  LYS B CE  1 
ATOM   5476  N NZ  . LYS B 1 238 ? 4.543   60.737  60.807  1.00 20.00 ? 238  LYS B NZ  1 
ATOM   5477  N N   . ASP B 1 239 ? 4.723   61.544  54.068  1.00 20.00 ? 239  ASP B N   1 
ATOM   5478  C CA  . ASP B 1 239 ? 5.135   60.403  53.267  1.00 20.00 ? 239  ASP B CA  1 
ATOM   5479  C C   . ASP B 1 239 ? 5.730   60.808  51.931  1.00 20.00 ? 239  ASP B C   1 
ATOM   5480  O O   . ASP B 1 239 ? 6.575   60.104  51.387  1.00 20.00 ? 239  ASP B O   1 
ATOM   5481  C CB  . ASP B 1 239 ? 3.949   59.476  53.039  1.00 20.00 ? 239  ASP B CB  1 
ATOM   5482  C CG  . ASP B 1 239 ? 3.790   58.459  54.143  1.00 20.00 ? 239  ASP B CG  1 
ATOM   5483  O OD1 . ASP B 1 239 ? 4.717   58.325  54.978  1.00 20.00 ? 239  ASP B OD1 1 
ATOM   5484  O OD2 . ASP B 1 239 ? 2.735   57.793  54.172  1.00 20.00 ? 239  ASP B OD2 1 
ATOM   5485  N N   . ILE B 1 240 ? 5.280   61.938  51.398  1.00 20.00 ? 240  ILE B N   1 
ATOM   5486  C CA  . ILE B 1 240 ? 5.793   62.413  50.118  1.00 20.00 ? 240  ILE B CA  1 
ATOM   5487  C C   . ILE B 1 240 ? 7.192   62.997  50.321  1.00 20.00 ? 240  ILE B C   1 
ATOM   5488  O O   . ILE B 1 240 ? 8.071   62.842  49.477  1.00 20.00 ? 240  ILE B O   1 
ATOM   5489  C CB  . ILE B 1 240 ? 4.886   63.510  49.523  1.00 20.00 ? 240  ILE B CB  1 
ATOM   5490  C CG1 . ILE B 1 240 ? 3.584   62.898  49.014  1.00 20.00 ? 240  ILE B CG1 1 
ATOM   5491  C CG2 . ILE B 1 240 ? 5.615   64.225  48.389  1.00 20.00 ? 240  ILE B CG2 1 
ATOM   5492  C CD1 . ILE B 1 240 ? 2.529   63.924  48.727  1.00 20.00 ? 240  ILE B CD1 1 
ATOM   5493  N N   . VAL B 1 241 ? 7.392   63.671  51.448  1.00 20.00 ? 241  VAL B N   1 
ATOM   5494  C CA  . VAL B 1 241 ? 8.688   64.267  51.738  1.00 20.00 ? 241  VAL B CA  1 
ATOM   5495  C C   . VAL B 1 241 ? 9.725   63.169  51.948  1.00 20.00 ? 241  VAL B C   1 
ATOM   5496  O O   . VAL B 1 241 ? 10.876  63.289  51.517  1.00 20.00 ? 241  VAL B O   1 
ATOM   5497  C CB  . VAL B 1 241 ? 8.616   65.168  53.004  1.00 20.00 ? 241  VAL B CB  1 
ATOM   5498  C CG1 . VAL B 1 241 ? 10.029  65.482  53.520  1.00 20.00 ? 241  VAL B CG1 1 
ATOM   5499  C CG2 . VAL B 1 241 ? 7.879   66.465  52.678  1.00 20.00 ? 241  VAL B CG2 1 
ATOM   5500  N N   . HIS B 1 242 ? 9.311   62.092  52.603  1.00 20.00 ? 242  HIS B N   1 
ATOM   5501  C CA  . HIS B 1 242 ? 10.218  60.986  52.861  1.00 20.00 ? 242  HIS B CA  1 
ATOM   5502  C C   . HIS B 1 242 ? 10.720  60.348  51.573  1.00 20.00 ? 242  HIS B C   1 
ATOM   5503  O O   . HIS B 1 242 ? 11.919  60.108  51.428  1.00 20.00 ? 242  HIS B O   1 
ATOM   5504  C CB  . HIS B 1 242 ? 9.540   59.932  53.728  1.00 20.00 ? 242  HIS B CB  1 
ATOM   5505  C CG  . HIS B 1 242 ? 10.495  58.959  54.344  1.00 20.00 ? 242  HIS B CG  1 
ATOM   5506  N ND1 . HIS B 1 242 ? 11.000  59.116  55.618  1.00 20.00 ? 242  HIS B ND1 1 
ATOM   5507  C CD2 . HIS B 1 242 ? 11.034  57.815  53.864  1.00 20.00 ? 242  HIS B CD2 1 
ATOM   5508  C CE1 . HIS B 1 242 ? 11.811  58.110  55.895  1.00 20.00 ? 242  HIS B CE1 1 
ATOM   5509  N NE2 . HIS B 1 242 ? 11.848  57.307  54.847  1.00 20.00 ? 242  HIS B NE2 1 
ATOM   5510  N N   . GLU B 1 243 ? 9.807   60.079  50.638  1.00 20.00 ? 243  GLU B N   1 
ATOM   5511  C CA  . GLU B 1 243 ? 10.191  59.469  49.371  1.00 20.00 ? 243  GLU B CA  1 
ATOM   5512  C C   . GLU B 1 243 ? 11.052  60.422  48.554  1.00 20.00 ? 243  GLU B C   1 
ATOM   5513  O O   . GLU B 1 243 ? 11.992  59.994  47.885  1.00 20.00 ? 243  GLU B O   1 
ATOM   5514  C CB  . GLU B 1 243 ? 8.963   59.066  48.550  1.00 20.00 ? 243  GLU B CB  1 
ATOM   5515  C CG  . GLU B 1 243 ? 9.287   58.050  47.448  1.00 20.00 ? 243  GLU B CG  1 
ATOM   5516  C CD  . GLU B 1 243 ? 8.293   58.072  46.307  1.00 20.00 ? 243  GLU B CD  1 
ATOM   5517  O OE1 . GLU B 1 243 ? 7.089   58.252  46.569  1.00 20.00 ? 243  GLU B OE1 1 
ATOM   5518  O OE2 . GLU B 1 243 ? 8.714   57.909  45.145  1.00 20.00 ? 243  GLU B OE2 1 
ATOM   5519  N N   . MET B 1 244 ? 10.728  61.711  48.604  1.00 20.00 ? 244  MET B N   1 
ATOM   5520  C CA  . MET B 1 244 ? 11.486  62.714  47.866  1.00 20.00 ? 244  MET B CA  1 
ATOM   5521  C C   . MET B 1 244 ? 12.958  62.545  48.153  1.00 20.00 ? 244  MET B C   1 
ATOM   5522  O O   . MET B 1 244 ? 13.768  62.446  47.239  1.00 20.00 ? 244  MET B O   1 
ATOM   5523  C CB  . MET B 1 244 ? 11.089  64.121  48.299  1.00 20.00 ? 244  MET B CB  1 
ATOM   5524  C CG  . MET B 1 244 ? 10.010  64.761  47.466  1.00 20.00 ? 244  MET B CG  1 
ATOM   5525  S SD  . MET B 1 244 ? 9.498   66.354  48.135  1.00 20.00 ? 244  MET B SD  1 
ATOM   5526  C CE  . MET B 1 244 ? 10.866  67.404  47.659  1.00 20.00 ? 244  MET B CE  1 
ATOM   5527  N N   . PHE B 1 245 ? 13.297  62.507  49.437  1.00 20.00 ? 245  PHE B N   1 
ATOM   5528  C CA  . PHE B 1 245 ? 14.684  62.360  49.872  1.00 20.00 ? 245  PHE B CA  1 
ATOM   5529  C C   . PHE B 1 245 ? 15.314  60.988  49.709  1.00 20.00 ? 245  PHE B C   1 
ATOM   5530  O O   . PHE B 1 245 ? 16.531  60.853  49.799  1.00 20.00 ? 245  PHE B O   1 
ATOM   5531  C CB  . PHE B 1 245 ? 14.813  62.830  51.323  1.00 20.00 ? 245  PHE B CB  1 
ATOM   5532  C CG  . PHE B 1 245 ? 14.644  64.309  51.475  1.00 20.00 ? 245  PHE B CG  1 
ATOM   5533  C CD1 . PHE B 1 245 ? 15.621  65.179  50.995  1.00 20.00 ? 245  PHE B CD1 1 
ATOM   5534  C CD2 . PHE B 1 245 ? 13.482  64.838  52.024  1.00 20.00 ? 245  PHE B CD2 1 
ATOM   5535  C CE1 . PHE B 1 245 ? 15.442  66.555  51.055  1.00 20.00 ? 245  PHE B CE1 1 
ATOM   5536  C CE2 . PHE B 1 245 ? 13.294  66.217  52.087  1.00 20.00 ? 245  PHE B CE2 1 
ATOM   5537  C CZ  . PHE B 1 245 ? 14.277  67.076  51.600  1.00 20.00 ? 245  PHE B CZ  1 
ATOM   5538  N N   . SER B 1 246 ? 14.494  59.974  49.462  1.00 20.00 ? 246  SER B N   1 
ATOM   5539  C CA  . SER B 1 246 ? 15.006  58.619  49.284  1.00 20.00 ? 246  SER B CA  1 
ATOM   5540  C C   . SER B 1 246 ? 15.789  58.542  47.979  1.00 20.00 ? 246  SER B C   1 
ATOM   5541  O O   . SER B 1 246 ? 16.454  57.550  47.705  1.00 20.00 ? 246  SER B O   1 
ATOM   5542  C CB  . SER B 1 246 ? 13.852  57.607  49.263  1.00 20.00 ? 246  SER B CB  1 
ATOM   5543  O OG  . SER B 1 246 ? 13.147  57.647  48.031  1.00 20.00 ? 246  SER B OG  1 
ATOM   5544  N N   . TYR B 1 247 ? 15.712  59.598  47.175  1.00 20.00 ? 247  TYR B N   1 
ATOM   5545  C CA  . TYR B 1 247 ? 16.422  59.635  45.900  1.00 20.00 ? 247  TYR B CA  1 
ATOM   5546  C C   . TYR B 1 247 ? 17.603  60.585  45.961  1.00 20.00 ? 247  TYR B C   1 
ATOM   5547  O O   . TYR B 1 247 ? 18.118  60.992  44.926  1.00 20.00 ? 247  TYR B O   1 
ATOM   5548  C CB  . TYR B 1 247 ? 15.503  60.098  44.762  1.00 20.00 ? 247  TYR B CB  1 
ATOM   5549  C CG  . TYR B 1 247 ? 14.255  59.270  44.576  1.00 20.00 ? 247  TYR B CG  1 
ATOM   5550  C CD1 . TYR B 1 247 ? 14.333  57.919  44.246  1.00 20.00 ? 247  TYR B CD1 1 
ATOM   5551  C CD2 . TYR B 1 247 ? 12.995  59.835  44.745  1.00 20.00 ? 247  TYR B CD2 1 
ATOM   5552  C CE1 . TYR B 1 247 ? 13.184  57.151  44.094  1.00 20.00 ? 247  TYR B CE1 1 
ATOM   5553  C CE2 . TYR B 1 247 ? 11.844  59.078  44.595  1.00 20.00 ? 247  TYR B CE2 1 
ATOM   5554  C CZ  . TYR B 1 247 ? 11.946  57.738  44.272  1.00 20.00 ? 247  TYR B CZ  1 
ATOM   5555  O OH  . TYR B 1 247 ? 10.805  56.988  44.144  1.00 20.00 ? 247  TYR B OH  1 
ATOM   5556  N N   . ALA B 1 248 ? 18.031  60.951  47.161  1.00 20.00 ? 248  ALA B N   1 
ATOM   5557  C CA  . ALA B 1 248 ? 19.160  61.863  47.291  1.00 20.00 ? 248  ALA B CA  1 
ATOM   5558  C C   . ALA B 1 248 ? 20.254  61.263  48.161  1.00 20.00 ? 248  ALA B C   1 
ATOM   5559  O O   . ALA B 1 248 ? 20.024  60.274  48.856  1.00 20.00 ? 248  ALA B O   1 
ATOM   5560  C CB  . ALA B 1 248 ? 18.691  63.193  47.879  1.00 20.00 ? 248  ALA B CB  1 
ATOM   5561  N N   . ASP B 1 249 ? 21.441  61.865  48.112  1.00 20.00 ? 249  ASP B N   1 
ATOM   5562  C CA  . ASP B 1 249 ? 22.586  61.403  48.893  1.00 20.00 ? 249  ASP B CA  1 
ATOM   5563  C C   . ASP B 1 249 ? 22.817  62.335  50.078  1.00 20.00 ? 249  ASP B C   1 
ATOM   5564  O O   . ASP B 1 249 ? 23.634  62.065  50.960  1.00 20.00 ? 249  ASP B O   1 
ATOM   5565  C CB  . ASP B 1 249 ? 23.834  61.356  48.016  1.00 20.00 ? 249  ASP B CB  1 
ATOM   5566  C CG  . ASP B 1 249 ? 23.748  60.281  46.953  1.00 20.00 ? 249  ASP B CG  1 
ATOM   5567  O OD1 . ASP B 1 249 ? 23.714  59.078  47.312  1.00 20.00 ? 249  ASP B OD1 1 
ATOM   5568  O OD2 . ASP B 1 249 ? 23.704  60.642  45.759  1.00 20.00 ? 249  ASP B OD2 1 
ATOM   5569  N N   . GLY B 1 250 ? 22.075  63.434  50.084  1.00 20.00 ? 250  GLY B N   1 
ATOM   5570  C CA  . GLY B 1 250 ? 22.185  64.406  51.149  1.00 20.00 ? 250  GLY B CA  1 
ATOM   5571  C C   . GLY B 1 250 ? 21.433  65.647  50.726  1.00 20.00 ? 250  GLY B C   1 
ATOM   5572  O O   . GLY B 1 250 ? 20.722  65.624  49.724  1.00 20.00 ? 250  GLY B O   1 
ATOM   5573  N N   . CYS B 1 251 ? 21.578  66.724  51.488  1.00 20.00 ? 251  CYS B N   1 
ATOM   5574  C CA  . CYS B 1 251 ? 20.905  67.975  51.173  1.00 20.00 ? 251  CYS B CA  1 
ATOM   5575  C C   . CYS B 1 251 ? 21.427  69.134  52.012  1.00 20.00 ? 251  CYS B C   1 
ATOM   5576  O O   . CYS B 1 251 ? 22.154  68.953  52.998  1.00 20.00 ? 251  CYS B O   1 
ATOM   5577  C CB  . CYS B 1 251 ? 19.386  67.836  51.369  1.00 20.00 ? 251  CYS B CB  1 
ATOM   5578  S SG  . CYS B 1 251 ? 18.768  67.786  53.090  1.00 20.00 ? 251  CYS B SG  1 
ATOM   5579  N N   . THR B 1 252 ? 21.089  70.333  51.571  1.00 20.00 ? 252  THR B N   1 
ATOM   5580  C CA  . THR B 1 252 ? 21.485  71.549  52.255  1.00 20.00 ? 252  THR B CA  1 
ATOM   5581  C C   . THR B 1 252 ? 20.125  72.187  52.487  1.00 20.00 ? 252  THR B C   1 
ATOM   5582  O O   . THR B 1 252 ? 19.347  72.397  51.548  1.00 20.00 ? 252  THR B O   1 
ATOM   5583  C CB  . THR B 1 252 ? 22.351  72.455  51.383  1.00 20.00 ? 252  THR B CB  1 
ATOM   5584  O OG1 . THR B 1 252 ? 21.740  72.616  50.100  1.00 20.00 ? 252  THR B OG1 1 
ATOM   5585  C CG2 . THR B 1 252 ? 23.727  71.855  51.217  1.00 20.00 ? 252  THR B CG2 1 
ATOM   5586  N N   . MET B 1 253 ? 19.826  72.477  53.743  1.00 20.00 ? 253  MET B N   1 
ATOM   5587  C CA  . MET B 1 253 ? 18.549  73.071  54.068  1.00 20.00 ? 253  MET B CA  1 
ATOM   5588  C C   . MET B 1 253 ? 18.606  74.429  54.768  1.00 20.00 ? 253  MET B C   1 
ATOM   5589  O O   . MET B 1 253 ? 19.487  74.702  55.594  1.00 20.00 ? 253  MET B O   1 
ATOM   5590  C CB  . MET B 1 253 ? 17.764  72.063  54.917  1.00 20.00 ? 253  MET B CB  1 
ATOM   5591  C CG  . MET B 1 253 ? 16.447  72.560  55.442  1.00 20.00 ? 253  MET B CG  1 
ATOM   5592  S SD  . MET B 1 253 ? 15.158  72.374  54.227  1.00 20.00 ? 253  MET B SD  1 
ATOM   5593  C CE  . MET B 1 253 ? 13.736  72.771  55.191  1.00 20.00 ? 253  MET B CE  1 
ATOM   5594  N N   . SER B 1 254 ? 17.665  75.287  54.404  1.00 20.00 ? 254  SER B N   1 
ATOM   5595  C CA  . SER B 1 254 ? 17.584  76.606  54.998  1.00 20.00 ? 254  SER B CA  1 
ATOM   5596  C C   . SER B 1 254 ? 16.334  76.576  55.861  1.00 20.00 ? 254  SER B C   1 
ATOM   5597  O O   . SER B 1 254 ? 15.217  76.663  55.345  1.00 20.00 ? 254  SER B O   1 
ATOM   5598  C CB  . SER B 1 254 ? 17.427  77.689  53.941  1.00 20.00 ? 254  SER B CB  1 
ATOM   5599  O OG  . SER B 1 254 ? 17.193  78.933  54.578  1.00 20.00 ? 254  SER B OG  1 
ATOM   5600  N N   . GLY B 1 255 ? 16.512  76.421  57.168  1.00 20.00 ? 255  GLY B N   1 
ATOM   5601  C CA  . GLY B 1 255 ? 15.358  76.385  58.044  1.00 20.00 ? 255  GLY B CA  1 
ATOM   5602  C C   . GLY B 1 255 ? 14.556  77.668  57.949  1.00 20.00 ? 255  GLY B C   1 
ATOM   5603  O O   . GLY B 1 255 ? 13.362  77.685  58.224  1.00 20.00 ? 255  GLY B O   1 
ATOM   5604  N N   . LYS B 1 256 ? 15.214  78.747  57.541  1.00 20.00 ? 256  LYS B N   1 
ATOM   5605  C CA  . LYS B 1 256 ? 14.573  80.049  57.408  1.00 20.00 ? 256  LYS B CA  1 
ATOM   5606  C C   . LYS B 1 256 ? 13.392  80.049  56.448  1.00 20.00 ? 256  LYS B C   1 
ATOM   5607  O O   . LYS B 1 256 ? 12.646  81.030  56.370  1.00 20.00 ? 256  LYS B O   1 
ATOM   5608  C CB  . LYS B 1 256 ? 15.603  81.090  56.957  1.00 20.00 ? 256  LYS B CB  1 
ATOM   5609  C CG  . LYS B 1 256 ? 16.775  81.246  57.919  1.00 20.00 ? 256  LYS B CG  1 
ATOM   5610  C CD  . LYS B 1 256 ? 17.806  82.216  57.379  1.00 20.00 ? 256  LYS B CD  1 
ATOM   5611  C CE  . LYS B 1 256 ? 17.254  83.619  57.325  1.00 20.00 ? 256  LYS B CE  1 
ATOM   5612  N NZ  . LYS B 1 256 ? 18.336  84.629  57.314  1.00 20.00 ? 256  LYS B NZ  1 
ATOM   5613  N N   . LYS B 1 257 ? 13.233  78.955  55.708  1.00 20.00 ? 257  LYS B N   1 
ATOM   5614  C CA  . LYS B 1 257 ? 12.136  78.845  54.757  1.00 20.00 ? 257  LYS B CA  1 
ATOM   5615  C C   . LYS B 1 257 ? 11.074  77.884  55.295  1.00 20.00 ? 257  LYS B C   1 
ATOM   5616  O O   . LYS B 1 257 ? 10.352  78.206  56.231  1.00 20.00 ? 257  LYS B O   1 
ATOM   5617  C CB  . LYS B 1 257 ? 12.651  78.387  53.378  1.00 20.00 ? 257  LYS B CB  1 
ATOM   5618  C CG  . LYS B 1 257 ? 13.173  79.492  52.441  1.00 20.00 ? 257  LYS B CG  1 
ATOM   5619  C CD  . LYS B 1 257 ? 14.567  79.937  52.797  1.00 20.00 ? 257  LYS B CD  1 
ATOM   5620  C CE  . LYS B 1 257 ? 15.122  81.012  51.875  1.00 20.00 ? 257  LYS B CE  1 
ATOM   5621  N NZ  . LYS B 1 257 ? 16.525  80.668  51.637  1.00 20.00 ? 257  LYS B NZ  1 
ATOM   5622  N N   . ASP B 1 258 ? 11.017  76.690  54.719  1.00 20.00 ? 258  ASP B N   1 
ATOM   5623  C CA  . ASP B 1 258 ? 10.044  75.689  55.115  1.00 20.00 ? 258  ASP B CA  1 
ATOM   5624  C C   . ASP B 1 258 ? 10.095  75.078  56.510  1.00 20.00 ? 258  ASP B C   1 
ATOM   5625  O O   . ASP B 1 258 ? 9.244   74.241  56.843  1.00 20.00 ? 258  ASP B O   1 
ATOM   5626  C CB  . ASP B 1 258 ? 10.015  74.582  54.059  1.00 20.00 ? 258  ASP B CB  1 
ATOM   5627  C CG  . ASP B 1 258 ? 9.003   74.863  52.953  1.00 20.00 ? 258  ASP B CG  1 
ATOM   5628  O OD1 . ASP B 1 258 ? 8.160   75.762  53.129  1.00 20.00 ? 258  ASP B OD1 1 
ATOM   5629  O OD2 . ASP B 1 258 ? 9.042   74.188  51.904  1.00 20.00 ? 258  ASP B OD2 1 
ATOM   5630  N N   . CYS B 1 259 ? 11.064  75.478  57.332  1.00 20.00 ? 259  CYS B N   1 
ATOM   5631  C CA  . CYS B 1 259 ? 11.149  74.927  58.685  1.00 20.00 ? 259  CYS B CA  1 
ATOM   5632  C C   . CYS B 1 259 ? 10.439  75.856  59.671  1.00 20.00 ? 259  CYS B C   1 
ATOM   5633  O O   . CYS B 1 259 ? 10.484  75.659  60.887  1.00 20.00 ? 259  CYS B O   1 
ATOM   5634  C CB  . CYS B 1 259 ? 12.600  74.719  59.099  1.00 20.00 ? 259  CYS B CB  1 
ATOM   5635  S SG  . CYS B 1 259 ? 13.307  73.214  58.424  1.00 20.00 ? 259  CYS B SG  1 
ATOM   5636  N N   . LEU B 1 260 ? 9.799   76.883  59.119  1.00 20.00 ? 260  LEU B N   1 
ATOM   5637  C CA  . LEU B 1 260 ? 9.052   77.869  59.891  1.00 20.00 ? 260  LEU B CA  1 
ATOM   5638  C C   . LEU B 1 260 ? 9.801   78.548  61.019  1.00 20.00 ? 260  LEU B C   1 
ATOM   5639  O O   . LEU B 1 260 ? 9.258   78.701  62.113  1.00 20.00 ? 260  LEU B O   1 
ATOM   5640  C CB  . LEU B 1 260 ? 7.780   77.219  60.449  1.00 20.00 ? 260  LEU B CB  1 
ATOM   5641  C CG  . LEU B 1 260 ? 6.731   76.810  59.402  1.00 20.00 ? 260  LEU B CG  1 
ATOM   5642  C CD1 . LEU B 1 260 ? 5.728   75.848  59.998  1.00 20.00 ? 260  LEU B CD1 1 
ATOM   5643  C CD2 . LEU B 1 260 ? 6.027   78.050  58.894  1.00 20.00 ? 260  LEU B CD2 1 
ATOM   5644  N N   . VAL B 1 261 ? 11.036  78.966  60.761  1.00 20.00 ? 261  VAL B N   1 
ATOM   5645  C CA  . VAL B 1 261 ? 11.824  79.633  61.788  1.00 20.00 ? 261  VAL B CA  1 
ATOM   5646  C C   . VAL B 1 261 ? 12.363  80.962  61.277  1.00 20.00 ? 261  VAL B C   1 
ATOM   5647  O O   . VAL B 1 261 ? 12.075  81.353  60.145  1.00 20.00 ? 261  VAL B O   1 
ATOM   5648  C CB  . VAL B 1 261 ? 12.988  78.744  62.288  1.00 20.00 ? 261  VAL B CB  1 
ATOM   5649  C CG1 . VAL B 1 261 ? 12.446  77.699  63.245  1.00 20.00 ? 261  VAL B CG1 1 
ATOM   5650  C CG2 . VAL B 1 261 ? 13.700  78.069  61.114  1.00 20.00 ? 261  VAL B CG2 1 
ATOM   5651  N N   . ASN B 1 262 ? 13.129  81.656  62.118  1.00 20.00 ? 262  ASN B N   1 
ATOM   5652  C CA  . ASN B 1 262 ? 13.705  82.951  61.752  1.00 20.00 ? 262  ASN B CA  1 
ATOM   5653  C C   . ASN B 1 262 ? 15.201  82.873  61.499  1.00 20.00 ? 262  ASN B C   1 
ATOM   5654  O O   . ASN B 1 262 ? 15.808  83.836  61.030  1.00 20.00 ? 262  ASN B O   1 
ATOM   5655  C CB  . ASN B 1 262 ? 13.427  83.978  62.849  1.00 20.00 ? 262  ASN B CB  1 
ATOM   5656  C CG  . ASN B 1 262 ? 11.952  84.095  63.168  1.00 20.00 ? 262  ASN B CG  1 
ATOM   5657  O OD1 . ASN B 1 262 ? 11.532  83.924  64.315  1.00 20.00 ? 262  ASN B OD1 1 
ATOM   5658  N ND2 . ASN B 1 262 ? 11.152  84.382  62.148  1.00 20.00 ? 262  ASN B ND2 1 
ATOM   5659  N N   . ILE B 1 263 ? 15.787  81.725  61.827  1.00 20.00 ? 263  ILE B N   1 
ATOM   5660  C CA  . ILE B 1 263 ? 17.214  81.482  61.645  1.00 20.00 ? 263  ILE B CA  1 
ATOM   5661  C C   . ILE B 1 263 ? 17.442  79.973  61.743  1.00 20.00 ? 263  ILE B C   1 
ATOM   5662  O O   . ILE B 1 263 ? 16.647  79.257  62.355  1.00 20.00 ? 263  ILE B O   1 
ATOM   5663  C CB  . ILE B 1 263 ? 18.072  82.237  62.722  1.00 20.00 ? 263  ILE B CB  1 
ATOM   5664  C CG1 . ILE B 1 263 ? 19.551  82.223  62.328  1.00 20.00 ? 263  ILE B CG1 1 
ATOM   5665  C CG2 . ILE B 1 263 ? 17.915  81.596  64.095  1.00 20.00 ? 263  ILE B CG2 1 
ATOM   5666  C CD1 . ILE B 1 263 ? 19.919  83.237  61.262  1.00 20.00 ? 263  ILE B CD1 1 
ATOM   5667  N N   . GLY B 1 264 ? 18.508  79.486  61.118  1.00 20.00 ? 264  GLY B N   1 
ATOM   5668  C CA  . GLY B 1 264 ? 18.793  78.062  61.169  1.00 20.00 ? 264  GLY B CA  1 
ATOM   5669  C C   . GLY B 1 264 ? 18.838  77.340  59.835  1.00 20.00 ? 264  GLY B C   1 
ATOM   5670  O O   . GLY B 1 264 ? 18.243  77.765  58.850  1.00 20.00 ? 264  GLY B O   1 
ATOM   5671  N N   . GLY B 1 265 ? 19.561  76.229  59.821  1.00 20.00 ? 265  GLY B N   1 
ATOM   5672  C CA  . GLY B 1 265 ? 19.701  75.428  58.627  1.00 20.00 ? 265  GLY B CA  1 
ATOM   5673  C C   . GLY B 1 265 ? 20.542  74.226  58.989  1.00 20.00 ? 265  GLY B C   1 
ATOM   5674  O O   . GLY B 1 265 ? 20.969  74.090  60.139  1.00 20.00 ? 265  GLY B O   1 
ATOM   5675  N N   . PHE B 1 266 ? 20.781  73.349  58.023  1.00 20.00 ? 266  PHE B N   1 
ATOM   5676  C CA  . PHE B 1 266 ? 21.586  72.166  58.287  1.00 20.00 ? 266  PHE B CA  1 
ATOM   5677  C C   . PHE B 1 266 ? 22.028  71.434  57.034  1.00 20.00 ? 266  PHE B C   1 
ATOM   5678  O O   . PHE B 1 266 ? 21.536  71.683  55.935  1.00 20.00 ? 266  PHE B O   1 
ATOM   5679  C CB  . PHE B 1 266 ? 20.847  71.193  59.221  1.00 20.00 ? 266  PHE B CB  1 
ATOM   5680  C CG  . PHE B 1 266 ? 19.468  70.821  58.760  1.00 20.00 ? 266  PHE B CG  1 
ATOM   5681  C CD1 . PHE B 1 266 ? 19.278  69.810  57.825  1.00 20.00 ? 266  PHE B CD1 1 
ATOM   5682  C CD2 . PHE B 1 266 ? 18.352  71.456  59.283  1.00 20.00 ? 266  PHE B CD2 1 
ATOM   5683  C CE1 . PHE B 1 266 ? 17.990  69.439  57.421  1.00 20.00 ? 266  PHE B CE1 1 
ATOM   5684  C CE2 . PHE B 1 266 ? 17.067  71.092  58.883  1.00 20.00 ? 266  PHE B CE2 1 
ATOM   5685  C CZ  . PHE B 1 266 ? 16.891  70.082  57.952  1.00 20.00 ? 266  PHE B CZ  1 
ATOM   5686  N N   . LEU B 1 267 ? 22.980  70.533  57.217  1.00 20.00 ? 267  LEU B N   1 
ATOM   5687  C CA  . LEU B 1 267 ? 23.511  69.745  56.121  1.00 20.00 ? 267  LEU B CA  1 
ATOM   5688  C C   . LEU B 1 267 ? 23.282  68.290  56.483  1.00 20.00 ? 267  LEU B C   1 
ATOM   5689  O O   . LEU B 1 267 ? 23.557  67.891  57.610  1.00 20.00 ? 267  LEU B O   1 
ATOM   5690  C CB  . LEU B 1 267 ? 25.011  70.024  55.957  1.00 20.00 ? 267  LEU B CB  1 
ATOM   5691  C CG  . LEU B 1 267 ? 25.759  69.130  54.968  1.00 20.00 ? 267  LEU B CG  1 
ATOM   5692  C CD1 . LEU B 1 267 ? 25.621  69.710  53.574  1.00 20.00 ? 267  LEU B CD1 1 
ATOM   5693  C CD2 . LEU B 1 267 ? 27.220  69.012  55.368  1.00 20.00 ? 267  LEU B CD2 1 
ATOM   5694  N N   . CYS B 1 268 ? 22.757  67.512  55.541  1.00 20.00 ? 268  CYS B N   1 
ATOM   5695  C CA  . CYS B 1 268 ? 22.492  66.089  55.762  1.00 20.00 ? 268  CYS B CA  1 
ATOM   5696  C C   . CYS B 1 268 ? 23.238  65.267  54.725  1.00 20.00 ? 268  CYS B C   1 
ATOM   5697  O O   . CYS B 1 268 ? 23.578  65.765  53.652  1.00 20.00 ? 268  CYS B O   1 
ATOM   5698  C CB  . CYS B 1 268 ? 21.005  65.781  55.638  1.00 20.00 ? 268  CYS B CB  1 
ATOM   5699  S SG  . CYS B 1 268 ? 19.957  66.615  56.834  1.00 20.00 ? 268  CYS B SG  1 
ATOM   5700  N N   . MET B 1 269 ? 23.483  64.003  55.049  1.00 20.00 ? 269  MET B N   1 
ATOM   5701  C CA  . MET B 1 269 ? 24.188  63.101  54.149  1.00 20.00 ? 269  MET B CA  1 
ATOM   5702  C C   . MET B 1 269 ? 24.206  61.715  54.765  1.00 20.00 ? 269  MET B C   1 
ATOM   5703  O O   . MET B 1 269 ? 24.019  61.560  55.970  1.00 20.00 ? 269  MET B O   1 
ATOM   5704  C CB  . MET B 1 269 ? 25.624  63.587  53.911  1.00 20.00 ? 269  MET B CB  1 
ATOM   5705  C CG  . MET B 1 269 ? 26.604  63.241  55.021  1.00 20.00 ? 269  MET B CG  1 
ATOM   5706  S SD  . MET B 1 269 ? 26.895  64.641  56.121  1.00 20.00 ? 269  MET B SD  1 
ATOM   5707  C CE  . MET B 1 269 ? 27.974  65.655  55.095  1.00 20.00 ? 269  MET B CE  1 
ATOM   5708  N N   . ASN B 1 270 ? 24.436  60.703  53.945  1.00 20.00 ? 270  ASN B N   1 
ATOM   5709  C CA  . ASN B 1 270 ? 24.466  59.351  54.461  1.00 20.00 ? 270  ASN B CA  1 
ATOM   5710  C C   . ASN B 1 270 ? 25.896  58.828  54.554  1.00 20.00 ? 270  ASN B C   1 
ATOM   5711  O O   . ASN B 1 270 ? 26.214  58.008  55.416  1.00 20.00 ? 270  ASN B O   1 
ATOM   5712  C CB  . ASN B 1 270 ? 23.611  58.449  53.570  1.00 20.00 ? 270  ASN B CB  1 
ATOM   5713  C CG  . ASN B 1 270 ? 22.138  58.825  53.605  1.00 20.00 ? 270  ASN B CG  1 
ATOM   5714  O OD1 . ASN B 1 270 ? 21.570  59.042  54.675  1.00 20.00 ? 270  ASN B OD1 1 
ATOM   5715  N ND2 . ASN B 1 270 ? 21.513  58.905  52.433  1.00 20.00 ? 270  ASN B ND2 1 
ATOM   5716  N N   . ASP B 1 271 ? 26.757  59.324  53.675  1.00 20.00 ? 271  ASP B N   1 
ATOM   5717  C CA  . ASP B 1 271 ? 28.155  58.914  53.644  1.00 20.00 ? 271  ASP B CA  1 
ATOM   5718  C C   . ASP B 1 271 ? 28.887  59.232  54.949  1.00 20.00 ? 271  ASP B C   1 
ATOM   5719  O O   . ASP B 1 271 ? 28.937  60.389  55.372  1.00 20.00 ? 271  ASP B O   1 
ATOM   5720  C CB  . ASP B 1 271 ? 28.857  59.603  52.474  1.00 20.00 ? 271  ASP B CB  1 
ATOM   5721  C CG  . ASP B 1 271 ? 30.226  59.027  52.199  1.00 20.00 ? 271  ASP B CG  1 
ATOM   5722  O OD1 . ASP B 1 271 ? 30.355  57.786  52.174  1.00 20.00 ? 271  ASP B OD1 1 
ATOM   5723  O OD2 . ASP B 1 271 ? 31.174  59.815  52.007  1.00 20.00 ? 271  ASP B OD2 1 
ATOM   5724  N N   . GLU B 1 272 ? 29.467  58.211  55.577  1.00 20.00 ? 272  GLU B N   1 
ATOM   5725  C CA  . GLU B 1 272 ? 30.187  58.415  56.829  1.00 20.00 ? 272  GLU B CA  1 
ATOM   5726  C C   . GLU B 1 272 ? 31.516  59.126  56.642  1.00 20.00 ? 272  GLU B C   1 
ATOM   5727  O O   . GLU B 1 272 ? 31.981  59.822  57.537  1.00 20.00 ? 272  GLU B O   1 
ATOM   5728  C CB  . GLU B 1 272 ? 30.428  57.082  57.532  1.00 20.00 ? 272  GLU B CB  1 
ATOM   5729  C CG  . GLU B 1 272 ? 29.482  56.829  58.679  1.00 20.00 ? 272  GLU B CG  1 
ATOM   5730  C CD  . GLU B 1 272 ? 28.366  55.882  58.293  1.00 20.00 ? 272  GLU B CD  1 
ATOM   5731  O OE1 . GLU B 1 272 ? 28.617  54.658  58.236  1.00 20.00 ? 272  GLU B OE1 1 
ATOM   5732  O OE2 . GLU B 1 272 ? 27.238  56.358  58.042  1.00 20.00 ? 272  GLU B OE2 1 
ATOM   5733  N N   . GLU B 1 273 ? 32.136  58.947  55.484  1.00 20.00 ? 273  GLU B N   1 
ATOM   5734  C CA  . GLU B 1 273 ? 33.413  59.596  55.227  1.00 20.00 ? 273  GLU B CA  1 
ATOM   5735  C C   . GLU B 1 273 ? 33.152  61.085  55.134  1.00 20.00 ? 273  GLU B C   1 
ATOM   5736  O O   . GLU B 1 273 ? 33.875  61.898  55.715  1.00 20.00 ? 273  GLU B O   1 
ATOM   5737  C CB  . GLU B 1 273 ? 34.015  59.101  53.910  1.00 20.00 ? 273  GLU B CB  1 
ATOM   5738  C CG  . GLU B 1 273 ? 35.239  58.210  54.074  1.00 20.00 ? 273  GLU B CG  1 
ATOM   5739  C CD  . GLU B 1 273 ? 34.889  56.726  54.082  1.00 20.00 ? 273  GLU B CD  1 
ATOM   5740  O OE1 . GLU B 1 273 ? 33.809  56.355  53.559  1.00 20.00 ? 273  GLU B OE1 1 
ATOM   5741  O OE2 . GLU B 1 273 ? 35.697  55.932  54.614  1.00 20.00 ? 273  GLU B OE2 1 
ATOM   5742  N N   . MET B 1 274 ? 32.103  61.431  54.393  1.00 20.00 ? 274  MET B N   1 
ATOM   5743  C CA  . MET B 1 274 ? 31.711  62.824  54.197  1.00 20.00 ? 274  MET B CA  1 
ATOM   5744  C C   . MET B 1 274 ? 31.318  63.461  55.522  1.00 20.00 ? 274  MET B C   1 
ATOM   5745  O O   . MET B 1 274 ? 31.669  64.601  55.806  1.00 20.00 ? 274  MET B O   1 
ATOM   5746  C CB  . MET B 1 274 ? 30.533  62.900  53.238  1.00 20.00 ? 274  MET B CB  1 
ATOM   5747  C CG  . MET B 1 274 ? 30.834  63.606  51.944  1.00 20.00 ? 274  MET B CG  1 
ATOM   5748  S SD  . MET B 1 274 ? 29.298  63.905  51.068  1.00 20.00 ? 274  MET B SD  1 
ATOM   5749  C CE  . MET B 1 274 ? 28.783  65.424  51.856  1.00 20.00 ? 274  MET B CE  1 
ATOM   5750  N N   . PHE B 1 275 ? 30.576  62.711  56.326  1.00 20.00 ? 275  PHE B N   1 
ATOM   5751  C CA  . PHE B 1 275 ? 30.134  63.195  57.622  1.00 20.00 ? 275  PHE B CA  1 
ATOM   5752  C C   . PHE B 1 275 ? 31.325  63.570  58.496  1.00 20.00 ? 275  PHE B C   1 
ATOM   5753  O O   . PHE B 1 275 ? 31.358  64.653  59.078  1.00 20.00 ? 275  PHE B O   1 
ATOM   5754  C CB  . PHE B 1 275 ? 29.319  62.116  58.325  1.00 20.00 ? 275  PHE B CB  1 
ATOM   5755  C CG  . PHE B 1 275 ? 28.861  62.504  59.696  1.00 20.00 ? 275  PHE B CG  1 
ATOM   5756  C CD1 . PHE B 1 275 ? 28.425  63.799  59.954  1.00 20.00 ? 275  PHE B CD1 1 
ATOM   5757  C CD2 . PHE B 1 275 ? 28.857  61.576  60.726  1.00 20.00 ? 275  PHE B CD2 1 
ATOM   5758  C CE1 . PHE B 1 275 ? 27.990  64.164  61.217  1.00 20.00 ? 275  PHE B CE1 1 
ATOM   5759  C CE2 . PHE B 1 275 ? 28.426  61.928  61.992  1.00 20.00 ? 275  PHE B CE2 1 
ATOM   5760  C CZ  . PHE B 1 275 ? 27.990  63.229  62.238  1.00 20.00 ? 275  PHE B CZ  1 
ATOM   5761  N N   . SER B 1 276 ? 32.299  62.665  58.577  1.00 20.00 ? 276  SER B N   1 
ATOM   5762  C CA  . SER B 1 276 ? 33.498  62.878  59.379  1.00 20.00 ? 276  SER B CA  1 
ATOM   5763  C C   . SER B 1 276 ? 34.303  64.070  58.908  1.00 20.00 ? 276  SER B C   1 
ATOM   5764  O O   . SER B 1 276 ? 34.895  64.780  59.714  1.00 20.00 ? 276  SER B O   1 
ATOM   5765  C CB  . SER B 1 276 ? 34.383  61.630  59.354  1.00 20.00 ? 276  SER B CB  1 
ATOM   5766  O OG  . SER B 1 276 ? 33.622  60.458  59.616  1.00 20.00 ? 276  SER B OG  1 
ATOM   5767  N N   . ALA B 1 277 ? 34.337  64.281  57.600  1.00 20.00 ? 277  ALA B N   1 
ATOM   5768  C CA  . ALA B 1 277 ? 35.078  65.403  57.044  1.00 20.00 ? 277  ALA B CA  1 
ATOM   5769  C C   . ALA B 1 277 ? 34.295  66.683  57.294  1.00 20.00 ? 277  ALA B C   1 
ATOM   5770  O O   . ALA B 1 277 ? 34.875  67.740  57.534  1.00 20.00 ? 277  ALA B O   1 
ATOM   5771  C CB  . ALA B 1 277 ? 35.288  65.203  55.554  1.00 20.00 ? 277  ALA B CB  1 
ATOM   5772  N N   . ALA B 1 278 ? 32.970  66.582  57.238  1.00 20.00 ? 278  ALA B N   1 
ATOM   5773  C CA  . ALA B 1 278 ? 32.105  67.735  57.458  1.00 20.00 ? 278  ALA B CA  1 
ATOM   5774  C C   . ALA B 1 278 ? 32.257  68.217  58.890  1.00 20.00 ? 278  ALA B C   1 
ATOM   5775  O O   . ALA B 1 278 ? 32.293  69.418  59.154  1.00 20.00 ? 278  ALA B O   1 
ATOM   5776  C CB  . ALA B 1 278 ? 30.658  67.361  57.182  1.00 20.00 ? 278  ALA B CB  1 
ATOM   5777  N N   . LYS B 1 279 ? 32.349  67.268  59.813  1.00 20.00 ? 279  LYS B N   1 
ATOM   5778  C CA  . LYS B 1 279 ? 32.494  67.587  61.227  1.00 20.00 ? 279  LYS B CA  1 
ATOM   5779  C C   . LYS B 1 279 ? 33.728  68.448  61.475  1.00 20.00 ? 279  LYS B C   1 
ATOM   5780  O O   . LYS B 1 279 ? 33.684  69.418  62.235  1.00 20.00 ? 279  LYS B O   1 
ATOM   5781  C CB  . LYS B 1 279 ? 32.602  66.298  62.046  1.00 20.00 ? 279  LYS B CB  1 
ATOM   5782  C CG  . LYS B 1 279 ? 31.360  65.982  62.859  1.00 20.00 ? 279  LYS B CG  1 
ATOM   5783  C CD  . LYS B 1 279 ? 31.024  64.508  62.792  1.00 20.00 ? 279  LYS B CD  1 
ATOM   5784  C CE  . LYS B 1 279 ? 31.631  63.759  63.971  1.00 20.00 ? 279  LYS B CE  1 
ATOM   5785  N NZ  . LYS B 1 279 ? 31.700  62.287  63.723  1.00 20.00 ? 279  LYS B NZ  1 
ATOM   5786  N N   . GLU B 1 280 ? 34.829  68.088  60.828  1.00 20.00 ? 280  GLU B N   1 
ATOM   5787  C CA  . GLU B 1 280 ? 36.073  68.822  60.978  1.00 20.00 ? 280  GLU B CA  1 
ATOM   5788  C C   . GLU B 1 280 ? 35.994  70.233  60.403  1.00 20.00 ? 280  GLU B C   1 
ATOM   5789  O O   . GLU B 1 280 ? 36.526  71.185  60.977  1.00 20.00 ? 280  GLU B O   1 
ATOM   5790  C CB  . GLU B 1 280 ? 37.205  68.055  60.295  1.00 20.00 ? 280  GLU B CB  1 
ATOM   5791  C CG  . GLU B 1 280 ? 38.579  68.664  60.504  1.00 20.00 ? 280  GLU B CG  1 
ATOM   5792  C CD  . GLU B 1 280 ? 39.701  67.706  60.130  1.00 20.00 ? 280  GLU B CD  1 
ATOM   5793  O OE1 . GLU B 1 280 ? 39.498  66.885  59.203  1.00 20.00 ? 280  GLU B OE1 1 
ATOM   5794  O OE2 . GLU B 1 280 ? 40.782  67.778  60.764  1.00 20.00 ? 280  GLU B OE2 1 
ATOM   5795  N N   . LEU B 1 281 ? 35.321  70.363  59.269  1.00 20.00 ? 281  LEU B N   1 
ATOM   5796  C CA  . LEU B 1 281 ? 35.175  71.652  58.608  1.00 20.00 ? 281  LEU B CA  1 
ATOM   5797  C C   . LEU B 1 281 ? 34.201  72.622  59.280  1.00 20.00 ? 281  LEU B C   1 
ATOM   5798  O O   . LEU B 1 281 ? 34.426  73.836  59.290  1.00 20.00 ? 281  LEU B O   1 
ATOM   5799  C CB  . LEU B 1 281 ? 34.748  71.428  57.155  1.00 20.00 ? 281  LEU B CB  1 
ATOM   5800  C CG  . LEU B 1 281 ? 35.250  72.420  56.112  1.00 20.00 ? 281  LEU B CG  1 
ATOM   5801  C CD1 . LEU B 1 281 ? 36.768  72.384  56.071  1.00 20.00 ? 281  LEU B CD1 1 
ATOM   5802  C CD2 . LEU B 1 281 ? 34.663  72.064  54.752  1.00 20.00 ? 281  LEU B CD2 1 
ATOM   5803  N N   . VAL B 1 282 ? 33.116  72.094  59.834  1.00 20.00 ? 282  VAL B N   1 
ATOM   5804  C CA  . VAL B 1 282 ? 32.131  72.944  60.490  1.00 20.00 ? 282  VAL B CA  1 
ATOM   5805  C C   . VAL B 1 282 ? 32.751  73.721  61.651  1.00 20.00 ? 282  VAL B C   1 
ATOM   5806  O O   . VAL B 1 282 ? 32.428  74.892  61.879  1.00 20.00 ? 282  VAL B O   1 
ATOM   5807  C CB  . VAL B 1 282 ? 30.923  72.103  60.998  1.00 20.00 ? 282  VAL B CB  1 
ATOM   5808  C CG1 . VAL B 1 282 ? 31.322  71.279  62.203  1.00 20.00 ? 282  VAL B CG1 1 
ATOM   5809  C CG2 . VAL B 1 282 ? 29.757  73.014  61.339  1.00 20.00 ? 282  VAL B CG2 1 
ATOM   5810  N N   . VAL B 1 283 ? 33.662  73.072  62.366  1.00 20.00 ? 283  VAL B N   1 
ATOM   5811  C CA  . VAL B 1 283 ? 34.332  73.686  63.504  1.00 20.00 ? 283  VAL B CA  1 
ATOM   5812  C C   . VAL B 1 283 ? 34.871  75.098  63.251  1.00 20.00 ? 283  VAL B C   1 
ATOM   5813  O O   . VAL B 1 283 ? 34.566  76.037  63.992  1.00 20.00 ? 283  VAL B O   1 
ATOM   5814  C CB  . VAL B 1 283 ? 35.496  72.797  63.991  1.00 20.00 ? 283  VAL B CB  1 
ATOM   5815  C CG1 . VAL B 1 283 ? 36.183  73.443  65.174  1.00 20.00 ? 283  VAL B CG1 1 
ATOM   5816  C CG2 . VAL B 1 283 ? 34.973  71.433  64.383  1.00 20.00 ? 283  VAL B CG2 1 
ATOM   5817  N N   . VAL B 1 284 ? 35.662  75.250  62.198  1.00 20.00 ? 284  VAL B N   1 
ATOM   5818  C CA  . VAL B 1 284 ? 36.237  76.547  61.873  1.00 20.00 ? 284  VAL B CA  1 
ATOM   5819  C C   . VAL B 1 284 ? 35.305  77.568  61.232  1.00 20.00 ? 284  VAL B C   1 
ATOM   5820  O O   . VAL B 1 284 ? 35.636  78.754  61.189  1.00 20.00 ? 284  VAL B O   1 
ATOM   5821  C CB  . VAL B 1 284 ? 37.476  76.381  60.954  1.00 20.00 ? 284  VAL B CB  1 
ATOM   5822  C CG1 . VAL B 1 284 ? 38.529  75.529  61.654  1.00 20.00 ? 284  VAL B CG1 1 
ATOM   5823  C CG2 . VAL B 1 284 ? 37.074  75.739  59.630  1.00 20.00 ? 284  VAL B CG2 1 
ATOM   5824  N N   . TYR B 1 285 ? 34.144  77.131  60.749  1.00 20.00 ? 285  TYR B N   1 
ATOM   5825  C CA  . TYR B 1 285 ? 33.210  78.063  60.112  1.00 20.00 ? 285  TYR B CA  1 
ATOM   5826  C C   . TYR B 1 285 ? 31.944  78.440  60.882  1.00 20.00 ? 285  TYR B C   1 
ATOM   5827  O O   . TYR B 1 285 ? 31.622  79.625  60.984  1.00 20.00 ? 285  TYR B O   1 
ATOM   5828  C CB  . TYR B 1 285 ? 32.813  77.532  58.728  1.00 20.00 ? 285  TYR B CB  1 
ATOM   5829  C CG  . TYR B 1 285 ? 33.904  77.681  57.691  1.00 20.00 ? 285  TYR B CG  1 
ATOM   5830  C CD1 . TYR B 1 285 ? 34.201  78.928  57.142  1.00 20.00 ? 285  TYR B CD1 1 
ATOM   5831  C CD2 . TYR B 1 285 ? 34.658  76.579  57.274  1.00 20.00 ? 285  TYR B CD2 1 
ATOM   5832  C CE1 . TYR B 1 285 ? 35.221  79.078  56.204  1.00 20.00 ? 285  TYR B CE1 1 
ATOM   5833  C CE2 . TYR B 1 285 ? 35.684  76.718  56.333  1.00 20.00 ? 285  TYR B CE2 1 
ATOM   5834  C CZ  . TYR B 1 285 ? 35.956  77.970  55.806  1.00 20.00 ? 285  TYR B CZ  1 
ATOM   5835  O OH  . TYR B 1 285 ? 36.960  78.131  54.878  1.00 20.00 ? 285  TYR B OH  1 
ATOM   5836  N N   . GLU B 1 286 ? 31.231  77.443  61.413  1.00 20.00 ? 286  GLU B N   1 
ATOM   5837  C CA  . GLU B 1 286 ? 29.991  77.670  62.169  1.00 20.00 ? 286  GLU B CA  1 
ATOM   5838  C C   . GLU B 1 286 ? 30.133  77.454  63.675  1.00 20.00 ? 286  GLU B C   1 
ATOM   5839  O O   . GLU B 1 286 ? 29.691  78.275  64.475  1.00 20.00 ? 286  GLU B O   1 
ATOM   5840  C CB  . GLU B 1 286 ? 28.883  76.749  61.640  1.00 20.00 ? 286  GLU B CB  1 
ATOM   5841  C CG  . GLU B 1 286 ? 28.834  76.646  60.128  1.00 20.00 ? 286  GLU B CG  1 
ATOM   5842  C CD  . GLU B 1 286 ? 28.020  77.755  59.508  1.00 20.00 ? 286  GLU B CD  1 
ATOM   5843  O OE1 . GLU B 1 286 ? 27.037  78.187  60.143  1.00 20.00 ? 286  GLU B OE1 1 
ATOM   5844  O OE2 . GLU B 1 286 ? 28.360  78.195  58.389  1.00 20.00 ? 286  GLU B OE2 1 
ATOM   5845  N N   . GLY B 1 287 ? 30.746  76.337  64.043  1.00 20.00 ? 287  GLY B N   1 
ATOM   5846  C CA  . GLY B 1 287 ? 30.947  76.003  65.440  1.00 20.00 ? 287  GLY B CA  1 
ATOM   5847  C C   . GLY B 1 287 ? 30.969  74.494  65.545  1.00 20.00 ? 287  GLY B C   1 
ATOM   5848  O O   . GLY B 1 287 ? 30.986  73.807  64.523  1.00 20.00 ? 287  GLY B O   1 
ATOM   5849  N N   . MET B 1 288 ? 30.965  73.970  66.765  1.00 20.00 ? 288  MET B N   1 
ATOM   5850  C CA  . MET B 1 288 ? 30.985  72.525  66.970  1.00 20.00 ? 288  MET B CA  1 
ATOM   5851  C C   . MET B 1 288 ? 29.904  71.834  66.134  1.00 20.00 ? 288  MET B C   1 
ATOM   5852  O O   . MET B 1 288 ? 28.893  72.450  65.771  1.00 20.00 ? 288  MET B O   1 
ATOM   5853  C CB  . MET B 1 288 ? 30.772  72.202  68.455  1.00 20.00 ? 288  MET B CB  1 
ATOM   5854  C CG  . MET B 1 288 ? 32.057  72.150  69.266  1.00 20.00 ? 288  MET B CG  1 
ATOM   5855  S SD  . MET B 1 288 ? 33.466  71.603  68.264  1.00 20.00 ? 288  MET B SD  1 
ATOM   5856  C CE  . MET B 1 288 ? 34.129  70.295  69.287  1.00 20.00 ? 288  MET B CE  1 
ATOM   5857  N N   . PRO B 1 289 ? 30.101  70.539  65.823  1.00 20.00 ? 289  PRO B N   1 
ATOM   5858  C CA  . PRO B 1 289 ? 29.058  69.769  65.128  1.00 20.00 ? 289  PRO B CA  1 
ATOM   5859  C C   . PRO B 1 289 ? 27.781  69.658  65.956  1.00 20.00 ? 289  PRO B C   1 
ATOM   5860  O O   . PRO B 1 289 ? 26.690  69.459  65.420  1.00 20.00 ? 289  PRO B O   1 
ATOM   5861  C CB  . PRO B 1 289 ? 29.705  68.399  64.893  1.00 20.00 ? 289  PRO B CB  1 
ATOM   5862  C CG  . PRO B 1 289 ? 31.186  68.617  65.113  1.00 20.00 ? 289  PRO B CG  1 
ATOM   5863  C CD  . PRO B 1 289 ? 31.297  69.725  66.105  1.00 20.00 ? 289  PRO B CD  1 
ATOM   5864  N N   . SER B 1 290 ? 27.935  69.805  67.267  1.00 20.00 ? 290  SER B N   1 
ATOM   5865  C CA  . SER B 1 290 ? 26.825  69.723  68.208  1.00 20.00 ? 290  SER B CA  1 
ATOM   5866  C C   . SER B 1 290 ? 25.902  70.944  68.263  1.00 20.00 ? 290  SER B C   1 
ATOM   5867  O O   . SER B 1 290 ? 24.946  70.952  69.027  1.00 20.00 ? 290  SER B O   1 
ATOM   5868  C CB  . SER B 1 290 ? 27.376  69.447  69.611  1.00 20.00 ? 290  SER B CB  1 
ATOM   5869  O OG  . SER B 1 290 ? 28.518  70.256  69.877  1.00 20.00 ? 290  SER B OG  1 
ATOM   5870  N N   . TYR B 1 291 ? 26.180  71.974  67.473  1.00 20.00 ? 291  TYR B N   1 
ATOM   5871  C CA  . TYR B 1 291 ? 25.328  73.153  67.495  1.00 20.00 ? 291  TYR B CA  1 
ATOM   5872  C C   . TYR B 1 291 ? 25.494  74.015  66.252  1.00 20.00 ? 291  TYR B C   1 
ATOM   5873  O O   . TYR B 1 291 ? 24.592  74.776  65.888  1.00 20.00 ? 291  TYR B O   1 
ATOM   5874  C CB  . TYR B 1 291 ? 25.590  73.975  68.767  1.00 20.00 ? 291  TYR B CB  1 
ATOM   5875  C CG  . TYR B 1 291 ? 26.869  74.790  68.760  1.00 20.00 ? 291  TYR B CG  1 
ATOM   5876  C CD1 . TYR B 1 291 ? 26.925  76.035  68.126  1.00 20.00 ? 291  TYR B CD1 1 
ATOM   5877  C CD2 . TYR B 1 291 ? 28.024  74.326  69.404  1.00 20.00 ? 291  TYR B CD2 1 
ATOM   5878  C CE1 . TYR B 1 291 ? 28.097  76.798  68.135  1.00 20.00 ? 291  TYR B CE1 1 
ATOM   5879  C CE2 . TYR B 1 291 ? 29.200  75.084  69.417  1.00 20.00 ? 291  TYR B CE2 1 
ATOM   5880  C CZ  . TYR B 1 291 ? 29.227  76.314  68.784  1.00 20.00 ? 291  TYR B CZ  1 
ATOM   5881  O OH  . TYR B 1 291 ? 30.373  77.068  68.805  1.00 20.00 ? 291  TYR B OH  1 
ATOM   5882  N N   . GLY B 1 292 ? 26.653  73.895  65.611  1.00 20.00 ? 292  GLY B N   1 
ATOM   5883  C CA  . GLY B 1 292 ? 26.947  74.650  64.403  1.00 20.00 ? 292  GLY B CA  1 
ATOM   5884  C C   . GLY B 1 292 ? 26.501  76.099  64.250  1.00 20.00 ? 292  GLY B C   1 
ATOM   5885  O O   . GLY B 1 292 ? 25.891  76.455  63.235  1.00 20.00 ? 292  GLY B O   1 
ATOM   5886  N N   . GLY B 1 293 ? 26.805  76.941  65.234  1.00 20.00 ? 293  GLY B N   1 
ATOM   5887  C CA  . GLY B 1 293 ? 26.425  78.344  65.157  1.00 20.00 ? 293  GLY B CA  1 
ATOM   5888  C C   . GLY B 1 293 ? 24.959  78.659  65.379  1.00 20.00 ? 293  GLY B C   1 
ATOM   5889  O O   . GLY B 1 293 ? 24.445  79.665  64.897  1.00 20.00 ? 293  GLY B O   1 
ATOM   5890  N N   . LEU B 1 294 ? 24.287  77.794  66.127  1.00 20.00 ? 294  LEU B N   1 
ATOM   5891  C CA  . LEU B 1 294 ? 22.876  77.962  66.426  1.00 20.00 ? 294  LEU B CA  1 
ATOM   5892  C C   . LEU B 1 294 ? 22.704  77.818  67.930  1.00 20.00 ? 294  LEU B C   1 
ATOM   5893  O O   . LEU B 1 294 ? 23.325  76.951  68.532  1.00 20.00 ? 294  LEU B O   1 
ATOM   5894  C CB  . LEU B 1 294 ? 22.077  76.860  65.735  1.00 20.00 ? 294  LEU B CB  1 
ATOM   5895  C CG  . LEU B 1 294 ? 20.985  77.112  64.698  1.00 20.00 ? 294  LEU B CG  1 
ATOM   5896  C CD1 . LEU B 1 294 ? 21.220  78.391  63.928  1.00 20.00 ? 294  LEU B CD1 1 
ATOM   5897  C CD2 . LEU B 1 294 ? 20.959  75.912  63.772  1.00 20.00 ? 294  LEU B CD2 1 
ATOM   5898  N N   . ALA B 1 295 ? 21.874  78.659  68.539  1.00 20.00 ? 295  ALA B N   1 
ATOM   5899  C CA  . ALA B 1 295 ? 21.652  78.568  69.981  1.00 20.00 ? 295  ALA B CA  1 
ATOM   5900  C C   . ALA B 1 295 ? 20.819  77.316  70.213  1.00 20.00 ? 295  ALA B C   1 
ATOM   5901  O O   . ALA B 1 295 ? 20.136  76.846  69.308  1.00 20.00 ? 295  ALA B O   1 
ATOM   5902  C CB  . ALA B 1 295 ? 20.901  79.783  70.484  1.00 20.00 ? 295  ALA B CB  1 
ATOM   5903  N N   . GLY B 1 296 ? 20.877  76.775  71.422  1.00 20.00 ? 296  GLY B N   1 
ATOM   5904  C CA  . GLY B 1 296 ? 20.111  75.580  71.719  1.00 20.00 ? 296  GLY B CA  1 
ATOM   5905  C C   . GLY B 1 296 ? 18.634  75.770  71.458  1.00 20.00 ? 296  GLY B C   1 
ATOM   5906  O O   . GLY B 1 296 ? 17.976  74.903  70.893  1.00 20.00 ? 296  GLY B O   1 
ATOM   5907  N N   . ARG B 1 297 ? 18.115  76.919  71.880  1.00 20.00 ? 297  ARG B N   1 
ATOM   5908  C CA  . ARG B 1 297 ? 16.707  77.267  71.712  1.00 20.00 ? 297  ARG B CA  1 
ATOM   5909  C C   . ARG B 1 297 ? 16.267  77.273  70.246  1.00 20.00 ? 297  ARG B C   1 
ATOM   5910  O O   . ARG B 1 297 ? 15.124  76.942  69.927  1.00 20.00 ? 297  ARG B O   1 
ATOM   5911  C CB  . ARG B 1 297 ? 16.443  78.649  72.320  1.00 20.00 ? 297  ARG B CB  1 
ATOM   5912  C CG  . ARG B 1 297 ? 17.390  79.750  71.838  1.00 20.00 ? 297  ARG B CG  1 
ATOM   5913  C CD  . ARG B 1 297 ? 16.913  81.133  72.282  1.00 20.00 ? 297  ARG B CD  1 
ATOM   5914  N NE  . ARG B 1 297 ? 17.739  82.229  71.773  1.00 20.00 ? 297  ARG B NE  1 
ATOM   5915  C CZ  . ARG B 1 297 ? 18.724  82.804  72.457  1.00 20.00 ? 297  ARG B CZ  1 
ATOM   5916  N NH1 . ARG B 1 297 ? 19.011  82.391  73.683  1.00 20.00 ? 297  ARG B NH1 1 
ATOM   5917  N NH2 . ARG B 1 297 ? 19.424  83.793  71.917  1.00 20.00 ? 297  ARG B NH2 1 
ATOM   5918  N N   . ASP B 1 298 ? 17.185  77.647  69.361  1.00 20.00 ? 298  ASP B N   1 
ATOM   5919  C CA  . ASP B 1 298 ? 16.897  77.704  67.941  1.00 20.00 ? 298  ASP B CA  1 
ATOM   5920  C C   . ASP B 1 298 ? 16.879  76.348  67.273  1.00 20.00 ? 298  ASP B C   1 
ATOM   5921  O O   . ASP B 1 298 ? 16.250  76.175  66.232  1.00 20.00 ? 298  ASP B O   1 
ATOM   5922  C CB  . ASP B 1 298 ? 17.891  78.631  67.266  1.00 20.00 ? 298  ASP B CB  1 
ATOM   5923  C CG  . ASP B 1 298 ? 17.584  80.082  67.541  1.00 20.00 ? 298  ASP B CG  1 
ATOM   5924  O OD1 . ASP B 1 298 ? 16.425  80.477  67.335  1.00 20.00 ? 298  ASP B OD1 1 
ATOM   5925  O OD2 . ASP B 1 298 ? 18.484  80.835  67.962  1.00 20.00 ? 298  ASP B OD2 1 
ATOM   5926  N N   . MET B 1 299 ? 17.572  75.384  67.865  1.00 20.00 ? 299  MET B N   1 
ATOM   5927  C CA  . MET B 1 299 ? 17.602  74.045  67.301  1.00 20.00 ? 299  MET B CA  1 
ATOM   5928  C C   . MET B 1 299 ? 16.292  73.392  67.728  1.00 20.00 ? 299  MET B C   1 
ATOM   5929  O O   . MET B 1 299 ? 15.726  72.561  67.016  1.00 20.00 ? 299  MET B O   1 
ATOM   5930  C CB  . MET B 1 299 ? 18.800  73.267  67.844  1.00 20.00 ? 299  MET B CB  1 
ATOM   5931  C CG  . MET B 1 299 ? 20.103  73.639  67.177  1.00 20.00 ? 299  MET B CG  1 
ATOM   5932  S SD  . MET B 1 299 ? 21.411  72.472  67.510  1.00 20.00 ? 299  MET B SD  1 
ATOM   5933  C CE  . MET B 1 299 ? 21.952  73.028  69.126  1.00 20.00 ? 299  MET B CE  1 
ATOM   5934  N N   . GLU B 1 300 ? 15.803  73.782  68.901  1.00 20.00 ? 300  GLU B N   1 
ATOM   5935  C CA  . GLU B 1 300 ? 14.557  73.235  69.406  1.00 20.00 ? 300  GLU B CA  1 
ATOM   5936  C C   . GLU B 1 300 ? 13.423  73.764  68.525  1.00 20.00 ? 300  GLU B C   1 
ATOM   5937  O O   . GLU B 1 300 ? 12.574  73.009  68.061  1.00 20.00 ? 300  GLU B O   1 
ATOM   5938  C CB  . GLU B 1 300 ? 14.331  73.679  70.852  1.00 20.00 ? 300  GLU B CB  1 
ATOM   5939  C CG  . GLU B 1 300 ? 13.138  73.019  71.521  1.00 20.00 ? 300  GLU B CG  1 
ATOM   5940  C CD  . GLU B 1 300 ? 13.312  71.515  71.701  1.00 20.00 ? 300  GLU B CD  1 
ATOM   5941  O OE1 . GLU B 1 300 ? 14.463  71.043  71.737  1.00 20.00 ? 300  GLU B OE1 1 
ATOM   5942  O OE2 . GLU B 1 300 ? 12.296  70.799  71.811  1.00 20.00 ? 300  GLU B OE2 1 
ATOM   5943  N N   . ALA B 1 301 ? 13.421  75.071  68.291  1.00 20.00 ? 301  ALA B N   1 
ATOM   5944  C CA  . ALA B 1 301 ? 12.393  75.710  67.468  1.00 20.00 ? 301  ALA B CA  1 
ATOM   5945  C C   . ALA B 1 301 ? 12.336  75.134  66.051  1.00 20.00 ? 301  ALA B C   1 
ATOM   5946  O O   . ALA B 1 301 ? 11.255  74.921  65.495  1.00 20.00 ? 301  ALA B O   1 
ATOM   5947  C CB  . ALA B 1 301 ? 12.642  77.216  67.405  1.00 20.00 ? 301  ALA B CB  1 
ATOM   5948  N N   . MET B 1 302 ? 13.507  74.897  65.470  1.00 20.00 ? 302  MET B N   1 
ATOM   5949  C CA  . MET B 1 302 ? 13.588  74.353  64.128  1.00 20.00 ? 302  MET B CA  1 
ATOM   5950  C C   . MET B 1 302 ? 13.075  72.913  64.100  1.00 20.00 ? 302  MET B C   1 
ATOM   5951  O O   . MET B 1 302 ? 12.429  72.506  63.142  1.00 20.00 ? 302  MET B O   1 
ATOM   5952  C CB  . MET B 1 302 ? 15.031  74.421  63.632  1.00 20.00 ? 302  MET B CB  1 
ATOM   5953  C CG  . MET B 1 302 ? 15.225  73.961  62.200  1.00 20.00 ? 302  MET B CG  1 
ATOM   5954  S SD  . MET B 1 302 ? 16.722  74.690  61.472  1.00 20.00 ? 302  MET B SD  1 
ATOM   5955  C CE  . MET B 1 302 ? 17.965  73.705  62.220  1.00 20.00 ? 302  MET B CE  1 
ATOM   5956  N N   . ALA B 1 303 ? 13.358  72.143  65.148  1.00 20.00 ? 303  ALA B N   1 
ATOM   5957  C CA  . ALA B 1 303 ? 12.900  70.756  65.202  1.00 20.00 ? 303  ALA B CA  1 
ATOM   5958  C C   . ALA B 1 303 ? 11.382  70.744  65.254  1.00 20.00 ? 303  ALA B C   1 
ATOM   5959  O O   . ALA B 1 303 ? 10.731  69.919  64.624  1.00 20.00 ? 303  ALA B O   1 
ATOM   5960  C CB  . ALA B 1 303 ? 13.469  70.053  66.434  1.00 20.00 ? 303  ALA B CB  1 
ATOM   5961  N N   . ILE B 1 304 ? 10.818  71.674  66.017  1.00 20.00 ? 304  ILE B N   1 
ATOM   5962  C CA  . ILE B 1 304 ? 9.369   71.769  66.156  1.00 20.00 ? 304  ILE B CA  1 
ATOM   5963  C C   . ILE B 1 304 ? 8.738   72.269  64.865  1.00 20.00 ? 304  ILE B C   1 
ATOM   5964  O O   . ILE B 1 304 ? 7.731   71.723  64.414  1.00 20.00 ? 304  ILE B O   1 
ATOM   5965  C CB  . ILE B 1 304 ? 8.985   72.715  67.317  1.00 20.00 ? 304  ILE B CB  1 
ATOM   5966  C CG1 . ILE B 1 304 ? 9.492   72.128  68.641  1.00 20.00 ? 304  ILE B CG1 1 
ATOM   5967  C CG2 . ILE B 1 304 ? 7.469   72.894  67.379  1.00 20.00 ? 304  ILE B CG2 1 
ATOM   5968  C CD1 . ILE B 1 304 ? 9.522   73.121  69.772  1.00 20.00 ? 304  ILE B CD1 1 
ATOM   5969  N N   . GLY B 1 305 ? 9.341   73.299  64.277  1.00 20.00 ? 305  GLY B N   1 
ATOM   5970  C CA  . GLY B 1 305 ? 8.827   73.862  63.039  1.00 20.00 ? 305  GLY B CA  1 
ATOM   5971  C C   . GLY B 1 305 ? 8.738   72.871  61.892  1.00 20.00 ? 305  GLY B C   1 
ATOM   5972  O O   . GLY B 1 305 ? 7.737   72.827  61.182  1.00 20.00 ? 305  GLY B O   1 
ATOM   5973  N N   . LEU B 1 306 ? 9.786   72.077  61.708  1.00 20.00 ? 306  LEU B N   1 
ATOM   5974  C CA  . LEU B 1 306 ? 9.832   71.084  60.645  1.00 20.00 ? 306  LEU B CA  1 
ATOM   5975  C C   . LEU B 1 306 ? 8.646   70.144  60.774  1.00 20.00 ? 306  LEU B C   1 
ATOM   5976  O O   . LEU B 1 306 ? 8.036   69.742  59.787  1.00 20.00 ? 306  LEU B O   1 
ATOM   5977  C CB  . LEU B 1 306 ? 11.143  70.304  60.728  1.00 20.00 ? 306  LEU B CB  1 
ATOM   5978  C CG  . LEU B 1 306 ? 11.507  69.360  59.578  1.00 20.00 ? 306  LEU B CG  1 
ATOM   5979  C CD1 . LEU B 1 306 ? 11.283  70.035  58.221  1.00 20.00 ? 306  LEU B CD1 1 
ATOM   5980  C CD2 . LEU B 1 306 ? 12.955  68.948  59.731  1.00 20.00 ? 306  LEU B CD2 1 
ATOM   5981  N N   . ARG B 1 307 ? 8.309   69.804  62.006  1.00 20.00 ? 307  ARG B N   1 
ATOM   5982  C CA  . ARG B 1 307 ? 7.194   68.915  62.273  1.00 20.00 ? 307  ARG B CA  1 
ATOM   5983  C C   . ARG B 1 307 ? 5.883   69.616  61.896  1.00 20.00 ? 307  ARG B C   1 
ATOM   5984  O O   . ARG B 1 307 ? 5.029   69.048  61.219  1.00 20.00 ? 307  ARG B O   1 
ATOM   5985  C CB  . ARG B 1 307 ? 7.188   68.561  63.755  1.00 20.00 ? 307  ARG B CB  1 
ATOM   5986  C CG  . ARG B 1 307 ? 6.829   67.137  64.043  1.00 20.00 ? 307  ARG B CG  1 
ATOM   5987  C CD  . ARG B 1 307 ? 7.871   66.454  64.905  1.00 20.00 ? 307  ARG B CD  1 
ATOM   5988  N NE  . ARG B 1 307 ? 7.762   65.017  64.698  1.00 20.00 ? 307  ARG B NE  1 
ATOM   5989  C CZ  . ARG B 1 307 ? 8.735   64.128  64.860  1.00 20.00 ? 307  ARG B CZ  1 
ATOM   5990  N NH1 . ARG B 1 307 ? 9.948   64.489  65.250  1.00 20.00 ? 307  ARG B NH1 1 
ATOM   5991  N NH2 . ARG B 1 307 ? 8.473   62.858  64.628  1.00 20.00 ? 307  ARG B NH2 1 
ATOM   5992  N N   . GLU B 1 308 ? 5.735   70.861  62.335  1.00 20.00 ? 308  GLU B N   1 
ATOM   5993  C CA  . GLU B 1 308 ? 4.536   71.635  62.046  1.00 20.00 ? 308  GLU B CA  1 
ATOM   5994  C C   . GLU B 1 308 ? 4.282   71.769  60.545  1.00 20.00 ? 308  GLU B C   1 
ATOM   5995  O O   . GLU B 1 308 ? 3.138   71.732  60.098  1.00 20.00 ? 308  GLU B O   1 
ATOM   5996  C CB  . GLU B 1 308 ? 4.648   73.028  62.682  1.00 20.00 ? 308  GLU B CB  1 
ATOM   5997  C CG  . GLU B 1 308 ? 4.605   73.007  64.211  1.00 20.00 ? 308  GLU B CG  1 
ATOM   5998  C CD  . GLU B 1 308 ? 4.471   74.383  64.838  1.00 20.00 ? 308  GLU B CD  1 
ATOM   5999  O OE1 . GLU B 1 308 ? 4.427   75.384  64.092  1.00 20.00 ? 308  GLU B OE1 1 
ATOM   6000  O OE2 . GLU B 1 308 ? 4.416   74.460  66.090  1.00 20.00 ? 308  GLU B OE2 1 
ATOM   6001  N N   . ALA B 1 309 ? 5.350   71.915  59.768  1.00 20.00 ? 309  ALA B N   1 
ATOM   6002  C CA  . ALA B 1 309 ? 5.227   72.058  58.323  1.00 20.00 ? 309  ALA B CA  1 
ATOM   6003  C C   . ALA B 1 309 ? 4.663   70.822  57.631  1.00 20.00 ? 309  ALA B C   1 
ATOM   6004  O O   . ALA B 1 309 ? 4.255   70.887  56.474  1.00 20.00 ? 309  ALA B O   1 
ATOM   6005  C CB  . ALA B 1 309 ? 6.575   72.417  57.724  1.00 20.00 ? 309  ALA B CB  1 
ATOM   6006  N N   . MET B 1 310 ? 4.633   69.697  58.333  1.00 20.00 ? 310  MET B N   1 
ATOM   6007  C CA  . MET B 1 310 ? 4.109   68.469  57.746  1.00 20.00 ? 310  MET B CA  1 
ATOM   6008  C C   . MET B 1 310 ? 2.586   68.434  57.726  1.00 20.00 ? 310  MET B C   1 
ATOM   6009  O O   . MET B 1 310 ? 1.998   67.566  57.093  1.00 20.00 ? 310  MET B O   1 
ATOM   6010  C CB  . MET B 1 310 ? 4.627   67.249  58.507  1.00 20.00 ? 310  MET B CB  1 
ATOM   6011  C CG  . MET B 1 310 ? 6.132   67.054  58.438  1.00 20.00 ? 310  MET B CG  1 
ATOM   6012  S SD  . MET B 1 310 ? 6.726   66.771  56.763  1.00 20.00 ? 310  MET B SD  1 
ATOM   6013  C CE  . MET B 1 310 ? 7.924   68.106  56.601  1.00 20.00 ? 310  MET B CE  1 
ATOM   6014  N N   . GLN B 1 311 ? 1.942   69.369  58.417  1.00 20.00 ? 311  GLN B N   1 
ATOM   6015  C CA  . GLN B 1 311 ? 0.481   69.403  58.445  1.00 20.00 ? 311  GLN B CA  1 
ATOM   6016  C C   . GLN B 1 311 ? -0.098  69.877  57.113  1.00 20.00 ? 311  GLN B C   1 
ATOM   6017  O O   . GLN B 1 311 ? 0.126   71.011  56.688  1.00 20.00 ? 311  GLN B O   1 
ATOM   6018  C CB  . GLN B 1 311 ? -0.025  70.308  59.576  1.00 20.00 ? 311  GLN B CB  1 
ATOM   6019  C CG  . GLN B 1 311 ? -1.525  70.147  59.861  1.00 20.00 ? 311  GLN B CG  1 
ATOM   6020  C CD  . GLN B 1 311 ? -2.116  71.320  60.625  1.00 20.00 ? 311  GLN B CD  1 
ATOM   6021  O OE1 . GLN B 1 311 ? -1.464  72.347  60.813  1.00 20.00 ? 311  GLN B OE1 1 
ATOM   6022  N NE2 . GLN B 1 311 ? -3.359  71.172  61.068  1.00 20.00 ? 311  GLN B NE2 1 
ATOM   6023  N N   . TYR B 1 312 ? -0.864  69.003  56.471  1.00 20.00 ? 312  TYR B N   1 
ATOM   6024  C CA  . TYR B 1 312 ? -1.482  69.312  55.190  1.00 20.00 ? 312  TYR B CA  1 
ATOM   6025  C C   . TYR B 1 312 ? -2.208  70.652  55.163  1.00 20.00 ? 312  TYR B C   1 
ATOM   6026  O O   . TYR B 1 312 ? -1.907  71.504  54.325  1.00 20.00 ? 312  TYR B O   1 
ATOM   6027  C CB  . TYR B 1 312 ? -2.457  68.198  54.784  1.00 20.00 ? 312  TYR B CB  1 
ATOM   6028  C CG  . TYR B 1 312 ? -3.187  68.486  53.489  1.00 20.00 ? 312  TYR B CG  1 
ATOM   6029  C CD1 . TYR B 1 312 ? -2.513  68.456  52.269  1.00 20.00 ? 312  TYR B CD1 1 
ATOM   6030  C CD2 . TYR B 1 312 ? -4.533  68.847  53.487  1.00 20.00 ? 312  TYR B CD2 1 
ATOM   6031  C CE1 . TYR B 1 312 ? -3.153  68.785  51.084  1.00 20.00 ? 312  TYR B CE1 1 
ATOM   6032  C CE2 . TYR B 1 312 ? -5.185  69.179  52.303  1.00 20.00 ? 312  TYR B CE2 1 
ATOM   6033  C CZ  . TYR B 1 312 ? -4.482  69.145  51.110  1.00 20.00 ? 312  TYR B CZ  1 
ATOM   6034  O OH  . TYR B 1 312 ? -5.107  69.481  49.942  1.00 20.00 ? 312  TYR B OH  1 
ATOM   6035  N N   . GLU B 1 313 ? -3.159  70.844  56.073  1.00 20.00 ? 313  GLU B N   1 
ATOM   6036  C CA  . GLU B 1 313 ? -3.915  72.098  56.119  1.00 20.00 ? 313  GLU B CA  1 
ATOM   6037  C C   . GLU B 1 313 ? -3.022  73.324  56.144  1.00 20.00 ? 313  GLU B C   1 
ATOM   6038  O O   . GLU B 1 313 ? -3.333  74.338  55.532  1.00 20.00 ? 313  GLU B O   1 
ATOM   6039  C CB  . GLU B 1 313 ? -4.850  72.145  57.339  1.00 20.00 ? 313  GLU B CB  1 
ATOM   6040  C CG  . GLU B 1 313 ? -6.011  71.169  57.292  1.00 20.00 ? 313  GLU B CG  1 
ATOM   6041  C CD  . GLU B 1 313 ? -5.564  69.752  57.542  1.00 20.00 ? 313  GLU B CD  1 
ATOM   6042  O OE1 . GLU B 1 313 ? -4.408  69.565  57.975  1.00 20.00 ? 313  GLU B OE1 1 
ATOM   6043  O OE2 . GLU B 1 313 ? -6.359  68.819  57.306  1.00 20.00 ? 313  GLU B OE2 1 
ATOM   6044  N N   . TYR B 1 314 ? -1.914  73.234  56.865  1.00 20.00 ? 314  TYR B N   1 
ATOM   6045  C CA  . TYR B 1 314 ? -0.996  74.353  56.953  1.00 20.00 ? 314  TYR B CA  1 
ATOM   6046  C C   . TYR B 1 314 ? -0.385  74.692  55.590  1.00 20.00 ? 314  TYR B C   1 
ATOM   6047  O O   . TYR B 1 314 ? -0.500  75.826  55.110  1.00 20.00 ? 314  TYR B O   1 
ATOM   6048  C CB  . TYR B 1 314 ? 0.147   74.048  57.941  1.00 20.00 ? 314  TYR B CB  1 
ATOM   6049  C CG  . TYR B 1 314 ? 1.440   74.745  57.538  1.00 20.00 ? 314  TYR B CG  1 
ATOM   6050  C CD1 . TYR B 1 314 ? 1.554   76.138  57.612  1.00 20.00 ? 314  TYR B CD1 1 
ATOM   6051  C CD2 . TYR B 1 314 ? 2.492   74.031  56.957  1.00 20.00 ? 314  TYR B CD2 1 
ATOM   6052  C CE1 . TYR B 1 314 ? 2.669   76.796  57.107  1.00 20.00 ? 314  TYR B CE1 1 
ATOM   6053  C CE2 . TYR B 1 314 ? 3.611   74.689  56.449  1.00 20.00 ? 314  TYR B CE2 1 
ATOM   6054  C CZ  . TYR B 1 314 ? 3.689   76.062  56.523  1.00 20.00 ? 314  TYR B CZ  1 
ATOM   6055  O OH  . TYR B 1 314 ? 4.780   76.710  55.994  1.00 20.00 ? 314  TYR B OH  1 
ATOM   6056  N N   . ILE B 1 315 ? 0.280   73.706  54.985  1.00 20.00 ? 315  ILE B N   1 
ATOM   6057  C CA  . ILE B 1 315 ? 0.922   73.902  53.690  1.00 20.00 ? 315  ILE B CA  1 
ATOM   6058  C C   . ILE B 1 315 ? -0.059  74.223  52.575  1.00 20.00 ? 315  ILE B C   1 
ATOM   6059  O O   . ILE B 1 315 ? 0.263   75.020  51.690  1.00 20.00 ? 315  ILE B O   1 
ATOM   6060  C CB  . ILE B 1 315 ? 1.820   72.680  53.303  1.00 20.00 ? 315  ILE B CB  1 
ATOM   6061  C CG1 . ILE B 1 315 ? 2.801   73.080  52.191  1.00 20.00 ? 315  ILE B CG1 1 
ATOM   6062  C CG2 . ILE B 1 315 ? 0.966   71.507  52.836  1.00 20.00 ? 315  ILE B CG2 1 
ATOM   6063  C CD1 . ILE B 1 315 ? 3.776   74.200  52.558  1.00 20.00 ? 315  ILE B CD1 1 
ATOM   6064  N N   . GLU B 1 316 ? -1.250  73.623  52.621  1.00 20.00 ? 316  GLU B N   1 
ATOM   6065  C CA  . GLU B 1 316 ? -2.269  73.871  51.598  1.00 20.00 ? 316  GLU B CA  1 
ATOM   6066  C C   . GLU B 1 316 ? -2.663  75.345  51.631  1.00 20.00 ? 316  GLU B C   1 
ATOM   6067  O O   . GLU B 1 316 ? -2.731  76.004  50.588  1.00 20.00 ? 316  GLU B O   1 
ATOM   6068  C CB  . GLU B 1 316 ? -3.514  73.019  51.838  1.00 20.00 ? 316  GLU B CB  1 
ATOM   6069  C CG  . GLU B 1 316 ? -4.678  73.438  50.944  1.00 20.00 ? 316  GLU B CG  1 
ATOM   6070  C CD  . GLU B 1 316 ? -5.996  72.845  51.372  1.00 20.00 ? 316  GLU B CD  1 
ATOM   6071  O OE1 . GLU B 1 316 ? -6.147  72.515  52.560  1.00 20.00 ? 316  GLU B OE1 1 
ATOM   6072  O OE2 . GLU B 1 316 ? -6.889  72.707  50.515  1.00 20.00 ? 316  GLU B OE2 1 
ATOM   6073  N N   . HIS B 1 317 ? -2.934  75.858  52.830  1.00 20.00 ? 317  HIS B N   1 
ATOM   6074  C CA  . HIS B 1 317 ? -3.313  77.259  52.986  1.00 20.00 ? 317  HIS B CA  1 
ATOM   6075  C C   . HIS B 1 317 ? -2.129  78.150  52.586  1.00 20.00 ? 317  HIS B C   1 
ATOM   6076  O O   . HIS B 1 317 ? -2.307  79.207  51.978  1.00 20.00 ? 317  HIS B O   1 
ATOM   6077  C CB  . HIS B 1 317 ? -3.708  77.563  54.436  1.00 20.00 ? 317  HIS B CB  1 
ATOM   6078  C CG  . HIS B 1 317 ? -3.796  79.029  54.734  1.00 20.00 ? 317  HIS B CG  1 
ATOM   6079  N ND1 . HIS B 1 317 ? -2.759  79.733  55.307  1.00 20.00 ? 317  HIS B ND1 1 
ATOM   6080  C CD2 . HIS B 1 317 ? -4.765  79.936  54.469  1.00 20.00 ? 317  HIS B CD2 1 
ATOM   6081  C CE1 . HIS B 1 317 ? -3.082  81.012  55.377  1.00 20.00 ? 317  HIS B CE1 1 
ATOM   6082  N NE2 . HIS B 1 317 ? -4.295  81.163  54.874  1.00 20.00 ? 317  HIS B NE2 1 
ATOM   6083  N N   . ARG B 1 318 ? -0.921  77.717  52.931  1.00 20.00 ? 318  ARG B N   1 
ATOM   6084  C CA  . ARG B 1 318 ? 0.281   78.476  52.603  1.00 20.00 ? 318  ARG B CA  1 
ATOM   6085  C C   . ARG B 1 318 ? 0.341   78.712  51.099  1.00 20.00 ? 318  ARG B C   1 
ATOM   6086  O O   . ARG B 1 318 ? 0.332   79.854  50.635  1.00 20.00 ? 318  ARG B O   1 
ATOM   6087  C CB  . ARG B 1 318 ? 1.533   77.715  53.054  1.00 20.00 ? 318  ARG B CB  1 
ATOM   6088  C CG  . ARG B 1 318 ? 2.807   78.549  53.051  1.00 20.00 ? 318  ARG B CG  1 
ATOM   6089  C CD  . ARG B 1 318 ? 3.381   78.661  51.644  1.00 20.00 ? 318  ARG B CD  1 
ATOM   6090  N NE  . ARG B 1 318 ? 4.734   79.226  51.594  1.00 20.00 ? 318  ARG B NE  1 
ATOM   6091  C CZ  . ARG B 1 318 ? 5.010   80.522  51.689  1.00 20.00 ? 318  ARG B CZ  1 
ATOM   6092  N NH1 . ARG B 1 318 ? 4.033   81.396  51.845  1.00 20.00 ? 318  ARG B NH1 1 
ATOM   6093  N NH2 . ARG B 1 318 ? 6.256   80.951  51.598  1.00 20.00 ? 318  ARG B NH2 1 
ATOM   6094  N N   . VAL B 1 319 ? 0.390   77.625  50.339  1.00 20.00 ? 319  VAL B N   1 
ATOM   6095  C CA  . VAL B 1 319 ? 0.454   77.721  48.888  1.00 20.00 ? 319  VAL B CA  1 
ATOM   6096  C C   . VAL B 1 319 ? -0.765  78.421  48.289  1.00 20.00 ? 319  VAL B C   1 
ATOM   6097  O O   . VAL B 1 319 ? -0.627  79.265  47.409  1.00 20.00 ? 319  VAL B O   1 
ATOM   6098  C CB  . VAL B 1 319 ? 0.609   76.325  48.247  1.00 20.00 ? 319  VAL B CB  1 
ATOM   6099  C CG1 . VAL B 1 319 ? 0.512   76.431  46.719  1.00 20.00 ? 319  VAL B CG1 1 
ATOM   6100  C CG2 . VAL B 1 319 ? 1.951   75.721  48.651  1.00 20.00 ? 319  VAL B CG2 1 
ATOM   6101  N N   . LYS B 1 320 ? -1.955  78.093  48.778  1.00 20.00 ? 320  LYS B N   1 
ATOM   6102  C CA  . LYS B 1 320 ? -3.172  78.714  48.255  1.00 20.00 ? 320  LYS B CA  1 
ATOM   6103  C C   . LYS B 1 320 ? -3.302  80.209  48.509  1.00 20.00 ? 320  LYS B C   1 
ATOM   6104  O O   . LYS B 1 320 ? -3.976  80.908  47.757  1.00 20.00 ? 320  LYS B O   1 
ATOM   6105  C CB  . LYS B 1 320 ? -4.407  77.981  48.778  1.00 20.00 ? 320  LYS B CB  1 
ATOM   6106  C CG  . LYS B 1 320 ? -4.974  77.005  47.777  1.00 20.00 ? 320  LYS B CG  1 
ATOM   6107  C CD  . LYS B 1 320 ? -5.545  75.780  48.454  1.00 20.00 ? 320  LYS B CD  1 
ATOM   6108  C CE  . LYS B 1 320 ? -6.020  74.776  47.435  1.00 20.00 ? 320  LYS B CE  1 
ATOM   6109  N NZ  . LYS B 1 320 ? -7.142  73.967  47.987  1.00 20.00 ? 320  LYS B NZ  1 
ATOM   6110  N N   . GLN B 1 321 ? -2.665  80.710  49.561  1.00 20.00 ? 321  GLN B N   1 
ATOM   6111  C CA  . GLN B 1 321 ? -2.737  82.131  49.859  1.00 20.00 ? 321  GLN B CA  1 
ATOM   6112  C C   . GLN B 1 321 ? -1.887  82.884  48.824  1.00 20.00 ? 321  GLN B C   1 
ATOM   6113  O O   . GLN B 1 321 ? -2.136  84.054  48.518  1.00 20.00 ? 321  GLN B O   1 
ATOM   6114  C CB  . GLN B 1 321 ? -2.221  82.402  51.271  1.00 20.00 ? 321  GLN B CB  1 
ATOM   6115  C CG  . GLN B 1 321 ? -2.154  83.875  51.621  1.00 20.00 ? 321  GLN B CG  1 
ATOM   6116  C CD  . GLN B 1 321 ? -1.509  84.128  52.974  1.00 20.00 ? 321  GLN B CD  1 
ATOM   6117  O OE1 . GLN B 1 321 ? -0.311  83.896  53.163  1.00 20.00 ? 321  GLN B OE1 1 
ATOM   6118  N NE2 . GLN B 1 321 ? -2.301  84.607  53.923  1.00 20.00 ? 321  GLN B NE2 1 
ATOM   6119  N N   . VAL B 1 322 ? -0.864  82.219  48.296  1.00 20.00 ? 322  VAL B N   1 
ATOM   6120  C CA  . VAL B 1 322 ? -0.008  82.849  47.297  1.00 20.00 ? 322  VAL B CA  1 
ATOM   6121  C C   . VAL B 1 322 ? -0.790  82.799  45.986  1.00 20.00 ? 322  VAL B C   1 
ATOM   6122  O O   . VAL B 1 322 ? -0.832  83.767  45.237  1.00 20.00 ? 322  VAL B O   1 
ATOM   6123  C CB  . VAL B 1 322 ? 1.336   82.099  47.131  1.00 20.00 ? 322  VAL B CB  1 
ATOM   6124  C CG1 . VAL B 1 322 ? 2.111   82.665  45.944  1.00 20.00 ? 322  VAL B CG1 1 
ATOM   6125  C CG2 . VAL B 1 322 ? 2.157   82.224  48.407  1.00 20.00 ? 322  VAL B CG2 1 
ATOM   6126  N N   . ARG B 1 323 ? -1.430  81.662  45.737  1.00 20.00 ? 323  ARG B N   1 
ATOM   6127  C CA  . ARG B 1 323 ? -2.222  81.454  44.539  1.00 20.00 ? 323  ARG B CA  1 
ATOM   6128  C C   . ARG B 1 323 ? -3.302  82.531  44.485  1.00 20.00 ? 323  ARG B C   1 
ATOM   6129  O O   . ARG B 1 323 ? -3.598  83.072  43.423  1.00 20.00 ? 323  ARG B O   1 
ATOM   6130  C CB  . ARG B 1 323 ? -2.858  80.060  44.589  1.00 20.00 ? 323  ARG B CB  1 
ATOM   6131  C CG  . ARG B 1 323 ? -3.419  79.532  43.268  1.00 20.00 ? 323  ARG B CG  1 
ATOM   6132  C CD  . ARG B 1 323 ? -3.807  78.048  43.388  1.00 20.00 ? 323  ARG B CD  1 
ATOM   6133  N NE  . ARG B 1 323 ? -2.647  77.169  43.241  1.00 20.00 ? 323  ARG B NE  1 
ATOM   6134  C CZ  . ARG B 1 323 ? -2.623  75.881  43.584  1.00 20.00 ? 323  ARG B CZ  1 
ATOM   6135  N NH1 . ARG B 1 323 ? -3.698  75.306  44.102  1.00 20.00 ? 323  ARG B NH1 1 
ATOM   6136  N NH2 . ARG B 1 323 ? -1.521  75.163  43.401  1.00 20.00 ? 323  ARG B NH2 1 
ATOM   6137  N N   . TYR B 1 324 ? -3.875  82.846  45.643  1.00 20.00 ? 324  TYR B N   1 
ATOM   6138  C CA  . TYR B 1 324 ? -4.925  83.856  45.761  1.00 20.00 ? 324  TYR B CA  1 
ATOM   6139  C C   . TYR B 1 324 ? -4.456  85.207  45.223  1.00 20.00 ? 324  TYR B C   1 
ATOM   6140  O O   . TYR B 1 324 ? -5.180  85.877  44.485  1.00 20.00 ? 324  TYR B O   1 
ATOM   6141  C CB  . TYR B 1 324 ? -5.334  83.988  47.233  1.00 20.00 ? 324  TYR B CB  1 
ATOM   6142  C CG  . TYR B 1 324 ? -6.338  85.078  47.531  1.00 20.00 ? 324  TYR B CG  1 
ATOM   6143  C CD1 . TYR B 1 324 ? -5.926  86.390  47.766  1.00 20.00 ? 324  TYR B CD1 1 
ATOM   6144  C CD2 . TYR B 1 324 ? -7.703  84.795  47.606  1.00 20.00 ? 324  TYR B CD2 1 
ATOM   6145  C CE1 . TYR B 1 324 ? -6.846  87.398  48.072  1.00 20.00 ? 324  TYR B CE1 1 
ATOM   6146  C CE2 . TYR B 1 324 ? -8.632  85.790  47.911  1.00 20.00 ? 324  TYR B CE2 1 
ATOM   6147  C CZ  . TYR B 1 324 ? -8.193  87.089  48.144  1.00 20.00 ? 324  TYR B CZ  1 
ATOM   6148  O OH  . TYR B 1 324 ? -9.102  88.073  48.464  1.00 20.00 ? 324  TYR B OH  1 
ATOM   6149  N N   . LEU B 1 325 ? -3.250  85.611  45.612  1.00 20.00 ? 325  LEU B N   1 
ATOM   6150  C CA  . LEU B 1 325 ? -2.692  86.877  45.162  1.00 20.00 ? 325  LEU B CA  1 
ATOM   6151  C C   . LEU B 1 325 ? -2.548  86.822  43.641  1.00 20.00 ? 325  LEU B C   1 
ATOM   6152  O O   . LEU B 1 325 ? -2.913  87.767  42.939  1.00 20.00 ? 325  LEU B O   1 
ATOM   6153  C CB  . LEU B 1 325 ? -1.318  87.104  45.798  1.00 20.00 ? 325  LEU B CB  1 
ATOM   6154  C CG  . LEU B 1 325 ? -0.899  88.505  46.248  1.00 20.00 ? 325  LEU B CG  1 
ATOM   6155  C CD1 . LEU B 1 325 ? 0.611   88.625  46.148  1.00 20.00 ? 325  LEU B CD1 1 
ATOM   6156  C CD2 . LEU B 1 325 ? -1.579  89.570  45.417  1.00 20.00 ? 325  LEU B CD2 1 
ATOM   6157  N N   . GLY B 1 326 ? -2.013  85.710  43.139  1.00 20.00 ? 326  GLY B N   1 
ATOM   6158  C CA  . GLY B 1 326 ? -1.830  85.550  41.703  1.00 20.00 ? 326  GLY B CA  1 
ATOM   6159  C C   . GLY B 1 326 ? -3.139  85.623  40.936  1.00 20.00 ? 326  GLY B C   1 
ATOM   6160  O O   . GLY B 1 326 ? -3.260  86.364  39.963  1.00 20.00 ? 326  GLY B O   1 
ATOM   6161  N N   . ASP B 1 327 ? -4.126  84.856  41.386  1.00 20.00 ? 327  ASP B N   1 
ATOM   6162  C CA  . ASP B 1 327 ? -5.441  84.816  40.755  1.00 20.00 ? 327  ASP B CA  1 
ATOM   6163  C C   . ASP B 1 327 ? -6.082  86.197  40.655  1.00 20.00 ? 327  ASP B C   1 
ATOM   6164  O O   . ASP B 1 327 ? -6.597  86.579  39.604  1.00 20.00 ? 327  ASP B O   1 
ATOM   6165  C CB  . ASP B 1 327 ? -6.366  83.891  41.545  1.00 20.00 ? 327  ASP B CB  1 
ATOM   6166  C CG  . ASP B 1 327 ? -5.943  82.438  41.473  1.00 20.00 ? 327  ASP B CG  1 
ATOM   6167  O OD1 . ASP B 1 327 ? -5.113  82.091  40.607  1.00 20.00 ? 327  ASP B OD1 1 
ATOM   6168  O OD2 . ASP B 1 327 ? -6.444  81.639  42.286  1.00 20.00 ? 327  ASP B OD2 1 
ATOM   6169  N N   . LYS B 1 328 ? -6.057  86.942  41.750  1.00 20.00 ? 328  LYS B N   1 
ATOM   6170  C CA  . LYS B 1 328 ? -6.637  88.277  41.771  1.00 20.00 ? 328  LYS B CA  1 
ATOM   6171  C C   . LYS B 1 328 ? -5.938  89.210  40.790  1.00 20.00 ? 328  LYS B C   1 
ATOM   6172  O O   . LYS B 1 328 ? -6.573  90.058  40.170  1.00 20.00 ? 328  LYS B O   1 
ATOM   6173  C CB  . LYS B 1 328 ? -6.542  88.873  43.175  1.00 20.00 ? 328  LYS B CB  1 
ATOM   6174  C CG  . LYS B 1 328 ? -7.576  88.349  44.155  1.00 20.00 ? 328  LYS B CG  1 
ATOM   6175  C CD  . LYS B 1 328 ? -8.588  89.429  44.523  1.00 20.00 ? 328  LYS B CD  1 
ATOM   6176  C CE  . LYS B 1 328 ? -7.948  90.576  45.306  1.00 20.00 ? 328  LYS B CE  1 
ATOM   6177  N NZ  . LYS B 1 328 ? -8.888  91.725  45.518  1.00 20.00 ? 328  LYS B NZ  1 
ATOM   6178  N N   . LEU B 1 329 ? -4.628  89.068  40.663  1.00 20.00 ? 329  LEU B N   1 
ATOM   6179  C CA  . LEU B 1 329 ? -3.868  89.913  39.754  1.00 20.00 ? 329  LEU B CA  1 
ATOM   6180  C C   . LEU B 1 329 ? -4.154  89.533  38.300  1.00 20.00 ? 329  LEU B C   1 
ATOM   6181  O O   . LEU B 1 329 ? -4.387  90.398  37.458  1.00 20.00 ? 329  LEU B O   1 
ATOM   6182  C CB  . LEU B 1 329 ? -2.370  89.782  40.053  1.00 20.00 ? 329  LEU B CB  1 
ATOM   6183  C CG  . LEU B 1 329 ? -1.874  90.406  41.366  1.00 20.00 ? 329  LEU B CG  1 
ATOM   6184  C CD1 . LEU B 1 329 ? -0.411  90.059  41.597  1.00 20.00 ? 329  LEU B CD1 1 
ATOM   6185  C CD2 . LEU B 1 329 ? -2.048  91.916  41.304  1.00 20.00 ? 329  LEU B CD2 1 
ATOM   6186  N N   . ARG B 1 330 ? -4.141  88.235  38.011  1.00 20.00 ? 330  ARG B N   1 
ATOM   6187  C CA  . ARG B 1 330 ? -4.398  87.737  36.658  1.00 20.00 ? 330  ARG B CA  1 
ATOM   6188  C C   . ARG B 1 330 ? -5.796  88.128  36.188  1.00 20.00 ? 330  ARG B C   1 
ATOM   6189  O O   . ARG B 1 330 ? -6.008  88.479  35.028  1.00 20.00 ? 330  ARG B O   1 
ATOM   6190  C CB  . ARG B 1 330 ? -4.248  86.209  36.620  1.00 20.00 ? 330  ARG B CB  1 
ATOM   6191  C CG  . ARG B 1 330 ? -4.386  85.594  35.240  1.00 20.00 ? 330  ARG B CG  1 
ATOM   6192  C CD  . ARG B 1 330 ? -4.425  84.058  35.294  1.00 20.00 ? 330  ARG B CD  1 
ATOM   6193  N NE  . ARG B 1 330 ? -3.238  83.484  35.927  1.00 20.00 ? 330  ARG B NE  1 
ATOM   6194  C CZ  . ARG B 1 330 ? -3.229  82.949  37.145  1.00 20.00 ? 330  ARG B CZ  1 
ATOM   6195  N NH1 . ARG B 1 330 ? -4.347  82.917  37.859  1.00 20.00 ? 330  ARG B NH1 1 
ATOM   6196  N NH2 . ARG B 1 330 ? -2.107  82.449  37.653  1.00 20.00 ? 330  ARG B NH2 1 
ATOM   6197  N N   . GLU B 1 331 ? -6.750  88.067  37.104  1.00 20.00 ? 331  GLU B N   1 
ATOM   6198  C CA  . GLU B 1 331 ? -8.127  88.410  36.796  1.00 20.00 ? 331  GLU B CA  1 
ATOM   6199  C C   . GLU B 1 331 ? -8.252  89.833  36.287  1.00 20.00 ? 331  GLU B C   1 
ATOM   6200  O O   . GLU B 1 331 ? -9.160  90.136  35.524  1.00 20.00 ? 331  GLU B O   1 
ATOM   6201  C CB  . GLU B 1 331 ? -8.993  88.249  38.041  1.00 20.00 ? 331  GLU B CB  1 
ATOM   6202  C CG  . GLU B 1 331 ? -10.296 87.509  37.809  1.00 20.00 ? 331  GLU B CG  1 
ATOM   6203  C CD  . GLU B 1 331 ? -11.259 87.663  38.974  1.00 20.00 ? 331  GLU B CD  1 
ATOM   6204  O OE1 . GLU B 1 331 ? -10.887 87.298  40.113  1.00 20.00 ? 331  GLU B OE1 1 
ATOM   6205  O OE2 . GLU B 1 331 ? -12.389 88.152  38.749  1.00 20.00 ? 331  GLU B OE2 1 
ATOM   6206  N N   . ALA B 1 332 ? -7.345  90.705  36.714  1.00 20.00 ? 332  ALA B N   1 
ATOM   6207  C CA  . ALA B 1 332 ? -7.371  92.101  36.290  1.00 20.00 ? 332  ALA B CA  1 
ATOM   6208  C C   . ALA B 1 332 ? -6.436  92.381  35.118  1.00 20.00 ? 332  ALA B C   1 
ATOM   6209  O O   . ALA B 1 332 ? -6.249  93.529  34.740  1.00 20.00 ? 332  ALA B O   1 
ATOM   6210  C CB  . ALA B 1 332 ? -7.019  93.008  37.459  1.00 20.00 ? 332  ALA B CB  1 
ATOM   6211  N N   . GLY B 1 333 ? -5.845  91.334  34.556  1.00 20.00 ? 333  GLY B N   1 
ATOM   6212  C CA  . GLY B 1 333 ? -4.943  91.508  33.432  1.00 20.00 ? 333  GLY B CA  1 
ATOM   6213  C C   . GLY B 1 333 ? -3.571  92.055  33.774  1.00 20.00 ? 333  GLY B C   1 
ATOM   6214  O O   . GLY B 1 333 ? -2.942  92.723  32.957  1.00 20.00 ? 333  GLY B O   1 
ATOM   6215  N N   . VAL B 1 334 ? -3.098  91.789  34.984  1.00 20.00 ? 334  VAL B N   1 
ATOM   6216  C CA  . VAL B 1 334 ? -1.786  92.279  35.375  1.00 20.00 ? 334  VAL B CA  1 
ATOM   6217  C C   . VAL B 1 334 ? -0.793  91.233  34.887  1.00 20.00 ? 334  VAL B C   1 
ATOM   6218  O O   . VAL B 1 334 ? -1.037  90.032  35.012  1.00 20.00 ? 334  VAL B O   1 
ATOM   6219  C CB  . VAL B 1 334 ? -1.683  92.454  36.920  1.00 20.00 ? 334  VAL B CB  1 
ATOM   6220  C CG1 . VAL B 1 334 ? -0.241  92.704  37.329  1.00 20.00 ? 334  VAL B CG1 1 
ATOM   6221  C CG2 . VAL B 1 334 ? -2.558  93.625  37.370  1.00 20.00 ? 334  VAL B CG2 1 
ATOM   6222  N N   . PRO B 1 335 ? 0.319   91.671  34.280  1.00 20.00 ? 335  PRO B N   1 
ATOM   6223  C CA  . PRO B 1 335 ? 1.300   90.690  33.808  1.00 20.00 ? 335  PRO B CA  1 
ATOM   6224  C C   . PRO B 1 335 ? 2.121   90.069  34.940  1.00 20.00 ? 335  PRO B C   1 
ATOM   6225  O O   . PRO B 1 335 ? 2.825   90.767  35.663  1.00 20.00 ? 335  PRO B O   1 
ATOM   6226  C CB  . PRO B 1 335 ? 2.166   91.487  32.833  1.00 20.00 ? 335  PRO B CB  1 
ATOM   6227  C CG  . PRO B 1 335 ? 2.033   92.906  33.266  1.00 20.00 ? 335  PRO B CG  1 
ATOM   6228  C CD  . PRO B 1 335 ? 0.715   93.058  33.970  1.00 20.00 ? 335  PRO B CD  1 
ATOM   6229  N N   . ILE B 1 336 ? 2.016   88.752  35.085  1.00 20.00 ? 336  ILE B N   1 
ATOM   6230  C CA  . ILE B 1 336 ? 2.747   88.030  36.121  1.00 20.00 ? 336  ILE B CA  1 
ATOM   6231  C C   . ILE B 1 336 ? 3.391   86.807  35.501  1.00 20.00 ? 336  ILE B C   1 
ATOM   6232  O O   . ILE B 1 336 ? 3.101   86.468  34.361  1.00 20.00 ? 336  ILE B O   1 
ATOM   6233  C CB  . ILE B 1 336 ? 1.822   87.533  37.273  1.00 20.00 ? 336  ILE B CB  1 
ATOM   6234  C CG1 . ILE B 1 336 ? 0.852   86.478  36.741  1.00 20.00 ? 336  ILE B CG1 1 
ATOM   6235  C CG2 . ILE B 1 336 ? 1.077   88.701  37.907  1.00 20.00 ? 336  ILE B CG2 1 
ATOM   6236  C CD1 . ILE B 1 336 ? 0.129   85.704  37.822  1.00 20.00 ? 336  ILE B CD1 1 
ATOM   6237  N N   . VAL B 1 337 ? 4.261   86.154  36.266  1.00 20.00 ? 337  VAL B N   1 
ATOM   6238  C CA  . VAL B 1 337 ? 4.951   84.960  35.807  1.00 20.00 ? 337  VAL B CA  1 
ATOM   6239  C C   . VAL B 1 337 ? 4.007   83.784  36.047  1.00 20.00 ? 337  VAL B C   1 
ATOM   6240  O O   . VAL B 1 337 ? 3.314   83.731  37.068  1.00 20.00 ? 337  VAL B O   1 
ATOM   6241  C CB  . VAL B 1 337 ? 6.282   84.745  36.583  1.00 20.00 ? 337  VAL B CB  1 
ATOM   6242  C CG1 . VAL B 1 337 ? 6.763   83.301  36.444  1.00 20.00 ? 337  VAL B CG1 1 
ATOM   6243  C CG2 . VAL B 1 337 ? 7.336   85.698  36.055  1.00 20.00 ? 337  VAL B CG2 1 
ATOM   6244  N N   . GLU B 1 338 ? 3.966   82.854  35.098  1.00 20.00 ? 338  GLU B N   1 
ATOM   6245  C CA  . GLU B 1 338 ? 3.103   81.690  35.215  1.00 20.00 ? 338  GLU B CA  1 
ATOM   6246  C C   . GLU B 1 338 ? 3.898   80.400  35.279  1.00 20.00 ? 338  GLU B C   1 
ATOM   6247  O O   . GLU B 1 338 ? 5.028   80.325  34.807  1.00 20.00 ? 338  GLU B O   1 
ATOM   6248  C CB  . GLU B 1 338 ? 2.149   81.636  34.029  1.00 20.00 ? 338  GLU B CB  1 
ATOM   6249  C CG  . GLU B 1 338 ? 1.302   82.873  33.879  1.00 20.00 ? 338  GLU B CG  1 
ATOM   6250  C CD  . GLU B 1 338 ? 0.052   82.822  34.731  1.00 20.00 ? 338  GLU B CD  1 
ATOM   6251  O OE1 . GLU B 1 338 ? -0.013  81.970  35.646  1.00 20.00 ? 338  GLU B OE1 1 
ATOM   6252  O OE2 . GLU B 1 338 ? -0.870  83.634  34.489  1.00 20.00 ? 338  GLU B OE2 1 
ATOM   6253  N N   . PRO B 1 339 ? 3.311   79.360  35.870  1.00 20.00 ? 339  PRO B N   1 
ATOM   6254  C CA  . PRO B 1 339 ? 2.217   79.535  36.832  1.00 20.00 ? 339  PRO B CA  1 
ATOM   6255  C C   . PRO B 1 339 ? 2.734   80.135  38.137  1.00 20.00 ? 339  PRO B C   1 
ATOM   6256  O O   . PRO B 1 339 ? 3.922   80.412  38.269  1.00 20.00 ? 339  PRO B O   1 
ATOM   6257  C CB  . PRO B 1 339 ? 1.671   78.122  37.021  1.00 20.00 ? 339  PRO B CB  1 
ATOM   6258  C CG  . PRO B 1 339 ? 2.780   77.208  36.598  1.00 20.00 ? 339  PRO B CG  1 
ATOM   6259  C CD  . PRO B 1 339 ? 3.675   77.948  35.662  1.00 20.00 ? 339  PRO B CD  1 
ATOM   6260  N N   . THR B 1 340 ? 1.839   80.336  39.093  1.00 20.00 ? 340  THR B N   1 
ATOM   6261  C CA  . THR B 1 340 ? 2.217   80.902  40.380  1.00 20.00 ? 340  THR B CA  1 
ATOM   6262  C C   . THR B 1 340 ? 2.993   79.874  41.191  1.00 20.00 ? 340  THR B C   1 
ATOM   6263  O O   . THR B 1 340 ? 2.583   78.715  41.299  1.00 20.00 ? 340  THR B O   1 
ATOM   6264  C CB  . THR B 1 340 ? 0.972   81.335  41.185  1.00 20.00 ? 340  THR B CB  1 
ATOM   6265  O OG1 . THR B 1 340 ? 0.387   82.493  40.574  1.00 20.00 ? 340  THR B OG1 1 
ATOM   6266  C CG2 . THR B 1 340 ? 1.352   81.670  42.611  1.00 20.00 ? 340  THR B CG2 1 
ATOM   6267  N N   . GLY B 1 341 ? 4.115   80.308  41.755  1.00 20.00 ? 341  GLY B N   1 
ATOM   6268  C CA  . GLY B 1 341 ? 4.940   79.418  42.554  1.00 20.00 ? 341  GLY B CA  1 
ATOM   6269  C C   . GLY B 1 341 ? 4.344   79.182  43.927  1.00 20.00 ? 341  GLY B C   1 
ATOM   6270  O O   . GLY B 1 341 ? 3.210   79.586  44.202  1.00 20.00 ? 341  GLY B O   1 
ATOM   6271  N N   . GLY B 1 342 ? 5.106   78.541  44.803  1.00 20.00 ? 342  GLY B N   1 
ATOM   6272  C CA  . GLY B 1 342 ? 4.590   78.280  46.130  1.00 20.00 ? 342  GLY B CA  1 
ATOM   6273  C C   . GLY B 1 342 ? 4.920   79.312  47.186  1.00 20.00 ? 342  GLY B C   1 
ATOM   6274  O O   . GLY B 1 342 ? 4.287   79.345  48.237  1.00 20.00 ? 342  GLY B O   1 
ATOM   6275  N N   . HIS B 1 343 ? 5.881   80.183  46.913  1.00 20.00 ? 343  HIS B N   1 
ATOM   6276  C CA  . HIS B 1 343 ? 6.253   81.189  47.900  1.00 20.00 ? 343  HIS B CA  1 
ATOM   6277  C C   . HIS B 1 343 ? 6.218   82.625  47.404  1.00 20.00 ? 343  HIS B C   1 
ATOM   6278  O O   . HIS B 1 343 ? 6.534   83.542  48.164  1.00 20.00 ? 343  HIS B O   1 
ATOM   6279  C CB  . HIS B 1 343 ? 7.668   80.897  48.402  1.00 20.00 ? 343  HIS B CB  1 
ATOM   6280  C CG  . HIS B 1 343 ? 8.724   81.191  47.380  1.00 20.00 ? 343  HIS B CG  1 
ATOM   6281  N ND1 . HIS B 1 343 ? 8.967   80.363  46.305  1.00 20.00 ? 343  HIS B ND1 1 
ATOM   6282  C CD2 . HIS B 1 343 ? 9.540   82.261  47.222  1.00 20.00 ? 343  HIS B CD2 1 
ATOM   6283  C CE1 . HIS B 1 343 ? 9.885   80.912  45.529  1.00 20.00 ? 343  HIS B CE1 1 
ATOM   6284  N NE2 . HIS B 1 343 ? 10.248  82.064  46.063  1.00 20.00 ? 343  HIS B NE2 1 
ATOM   6285  N N   . ALA B 1 344 ? 5.860   82.846  46.146  1.00 20.00 ? 344  ALA B N   1 
ATOM   6286  C CA  . ALA B 1 344 ? 5.839   84.222  45.677  1.00 20.00 ? 344  ALA B CA  1 
ATOM   6287  C C   . ALA B 1 344 ? 5.177   84.447  44.336  1.00 20.00 ? 344  ALA B C   1 
ATOM   6288  O O   . ALA B 1 344 ? 4.961   83.518  43.565  1.00 20.00 ? 344  ALA B O   1 
ATOM   6289  C CB  . ALA B 1 344 ? 7.274   84.762  45.630  1.00 20.00 ? 344  ALA B CB  1 
ATOM   6290  N N   . VAL B 1 345 ? 4.864   85.711  44.076  1.00 20.00 ? 345  VAL B N   1 
ATOM   6291  C CA  . VAL B 1 345 ? 4.233   86.116  42.835  1.00 20.00 ? 345  VAL B CA  1 
ATOM   6292  C C   . VAL B 1 345 ? 5.218   87.088  42.206  1.00 20.00 ? 345  VAL B C   1 
ATOM   6293  O O   . VAL B 1 345 ? 5.718   87.983  42.880  1.00 20.00 ? 345  VAL B O   1 
ATOM   6294  C CB  . VAL B 1 345 ? 2.894   86.839  43.078  1.00 20.00 ? 345  VAL B CB  1 
ATOM   6295  C CG1 . VAL B 1 345 ? 2.392   87.443  41.776  1.00 20.00 ? 345  VAL B CG1 1 
ATOM   6296  C CG2 . VAL B 1 345 ? 1.866   85.864  43.634  1.00 20.00 ? 345  VAL B CG2 1 
ATOM   6297  N N   . PHE B 1 346 ? 5.516   86.899  40.926  1.00 20.00 ? 346  PHE B N   1 
ATOM   6298  C CA  . PHE B 1 346 ? 6.449   87.778  40.234  1.00 20.00 ? 346  PHE B CA  1 
ATOM   6299  C C   . PHE B 1 346 ? 5.706   88.615  39.213  1.00 20.00 ? 346  PHE B C   1 
ATOM   6300  O O   . PHE B 1 346 ? 5.006   88.080  38.354  1.00 20.00 ? 346  PHE B O   1 
ATOM   6301  C CB  . PHE B 1 346 ? 7.524   86.964  39.505  1.00 20.00 ? 346  PHE B CB  1 
ATOM   6302  C CG  . PHE B 1 346 ? 8.509   86.287  40.419  1.00 20.00 ? 346  PHE B CG  1 
ATOM   6303  C CD1 . PHE B 1 346 ? 8.141   85.167  41.163  1.00 20.00 ? 346  PHE B CD1 1 
ATOM   6304  C CD2 . PHE B 1 346 ? 9.817   86.752  40.517  1.00 20.00 ? 346  PHE B CD2 1 
ATOM   6305  C CE1 . PHE B 1 346 ? 9.062   84.521  41.987  1.00 20.00 ? 346  PHE B CE1 1 
ATOM   6306  C CE2 . PHE B 1 346 ? 10.744  86.113  41.336  1.00 20.00 ? 346  PHE B CE2 1 
ATOM   6307  C CZ  . PHE B 1 346 ? 10.366  84.996  42.072  1.00 20.00 ? 346  PHE B CZ  1 
ATOM   6308  N N   . LEU B 1 347 ? 5.856   89.930  39.307  1.00 20.00 ? 347  LEU B N   1 
ATOM   6309  C CA  . LEU B 1 347 ? 5.199   90.834  38.375  1.00 20.00 ? 347  LEU B CA  1 
ATOM   6310  C C   . LEU B 1 347 ? 6.148   91.051  37.194  1.00 20.00 ? 347  LEU B C   1 
ATOM   6311  O O   . LEU B 1 347 ? 7.369   91.139  37.373  1.00 20.00 ? 347  LEU B O   1 
ATOM   6312  C CB  . LEU B 1 347 ? 4.919   92.185  39.037  1.00 20.00 ? 347  LEU B CB  1 
ATOM   6313  C CG  . LEU B 1 347 ? 3.927   92.301  40.192  1.00 20.00 ? 347  LEU B CG  1 
ATOM   6314  C CD1 . LEU B 1 347 ? 3.874   93.745  40.652  1.00 20.00 ? 347  LEU B CD1 1 
ATOM   6315  C CD2 . LEU B 1 347 ? 2.552   91.855  39.758  1.00 20.00 ? 347  LEU B CD2 1 
ATOM   6316  N N   . ASP B 1 348 ? 5.601   91.127  35.986  1.00 20.00 ? 348  ASP B N   1 
ATOM   6317  C CA  . ASP B 1 348 ? 6.440   91.343  34.812  1.00 20.00 ? 348  ASP B CA  1 
ATOM   6318  C C   . ASP B 1 348 ? 6.521   92.849  34.612  1.00 20.00 ? 348  ASP B C   1 
ATOM   6319  O O   . ASP B 1 348 ? 5.639   93.444  33.998  1.00 20.00 ? 348  ASP B O   1 
ATOM   6320  C CB  . ASP B 1 348 ? 5.824   90.690  33.580  1.00 20.00 ? 348  ASP B CB  1 
ATOM   6321  C CG  . ASP B 1 348 ? 6.763   90.696  32.387  1.00 20.00 ? 348  ASP B CG  1 
ATOM   6322  O OD1 . ASP B 1 348 ? 7.628   91.598  32.300  1.00 20.00 ? 348  ASP B OD1 1 
ATOM   6323  O OD2 . ASP B 1 348 ? 6.635   89.795  31.532  1.00 20.00 ? 348  ASP B OD2 1 
ATOM   6324  N N   . ALA B 1 349 ? 7.575   93.461  35.144  1.00 20.00 ? 349  ALA B N   1 
ATOM   6325  C CA  . ALA B 1 349 ? 7.770   94.901  35.028  1.00 20.00 ? 349  ALA B CA  1 
ATOM   6326  C C   . ALA B 1 349 ? 7.867   95.363  33.582  1.00 20.00 ? 349  ALA B C   1 
ATOM   6327  O O   . ALA B 1 349 ? 7.487   96.487  33.262  1.00 20.00 ? 349  ALA B O   1 
ATOM   6328  C CB  . ALA B 1 349 ? 9.016   95.315  35.788  1.00 20.00 ? 349  ALA B CB  1 
ATOM   6329  N N   . ARG B 1 350 ? 8.380   94.500  32.710  1.00 20.00 ? 350  ARG B N   1 
ATOM   6330  C CA  . ARG B 1 350 ? 8.520   94.834  31.299  1.00 20.00 ? 350  ARG B CA  1 
ATOM   6331  C C   . ARG B 1 350 ? 7.154   95.106  30.687  1.00 20.00 ? 350  ARG B C   1 
ATOM   6332  O O   . ARG B 1 350 ? 6.950   96.117  30.022  1.00 20.00 ? 350  ARG B O   1 
ATOM   6333  C CB  . ARG B 1 350 ? 9.198   93.687  30.548  1.00 20.00 ? 350  ARG B CB  1 
ATOM   6334  C CG  . ARG B 1 350 ? 10.679  93.892  30.324  1.00 20.00 ? 350  ARG B CG  1 
ATOM   6335  C CD  . ARG B 1 350 ? 11.364  92.627  29.800  1.00 20.00 ? 350  ARG B CD  1 
ATOM   6336  N NE  . ARG B 1 350 ? 12.522  92.957  28.973  1.00 20.00 ? 350  ARG B NE  1 
ATOM   6337  C CZ  . ARG B 1 350 ? 13.779  92.599  29.225  1.00 20.00 ? 350  ARG B CZ  1 
ATOM   6338  N NH1 . ARG B 1 350 ? 14.085  91.879  30.295  1.00 20.00 ? 350  ARG B NH1 1 
ATOM   6339  N NH2 . ARG B 1 350 ? 14.744  92.985  28.399  1.00 20.00 ? 350  ARG B NH2 1 
ATOM   6340  N N   . ARG B 1 351 ? 6.214   94.195  30.921  1.00 20.00 ? 351  ARG B N   1 
ATOM   6341  C CA  . ARG B 1 351 ? 4.864   94.339  30.390  1.00 20.00 ? 351  ARG B CA  1 
ATOM   6342  C C   . ARG B 1 351 ? 4.046   95.309  31.227  1.00 20.00 ? 351  ARG B C   1 
ATOM   6343  O O   . ARG B 1 351 ? 3.086   95.901  30.744  1.00 20.00 ? 351  ARG B O   1 
ATOM   6344  C CB  . ARG B 1 351 ? 4.169   92.981  30.346  1.00 20.00 ? 351  ARG B CB  1 
ATOM   6345  C CG  . ARG B 1 351 ? 5.085   91.856  29.912  1.00 20.00 ? 351  ARG B CG  1 
ATOM   6346  C CD  . ARG B 1 351 ? 4.520   91.120  28.715  1.00 20.00 ? 351  ARG B CD  1 
ATOM   6347  N NE  . ARG B 1 351 ? 3.194   90.583  28.998  1.00 20.00 ? 351  ARG B NE  1 
ATOM   6348  C CZ  . ARG B 1 351 ? 2.961   89.512  29.752  1.00 20.00 ? 351  ARG B CZ  1 
ATOM   6349  N NH1 . ARG B 1 351 ? 3.970   88.846  30.310  1.00 20.00 ? 351  ARG B NH1 1 
ATOM   6350  N NH2 . ARG B 1 351 ? 1.711   89.107  29.952  1.00 20.00 ? 351  ARG B NH2 1 
ATOM   6351  N N   . PHE B 1 352 ? 4.434   95.470  32.485  1.00 20.00 ? 352  PHE B N   1 
ATOM   6352  C CA  . PHE B 1 352 ? 3.732   96.373  33.382  1.00 20.00 ? 352  PHE B CA  1 
ATOM   6353  C C   . PHE B 1 352 ? 3.985   97.820  32.959  1.00 20.00 ? 352  PHE B C   1 
ATOM   6354  O O   . PHE B 1 352 ? 3.078   98.652  32.986  1.00 20.00 ? 352  PHE B O   1 
ATOM   6355  C CB  . PHE B 1 352 ? 4.213   96.153  34.819  1.00 20.00 ? 352  PHE B CB  1 
ATOM   6356  C CG  . PHE B 1 352 ? 3.207   96.541  35.867  1.00 20.00 ? 352  PHE B CG  1 
ATOM   6357  C CD1 . PHE B 1 352 ? 2.922   97.880  36.116  1.00 20.00 ? 352  PHE B CD1 1 
ATOM   6358  C CD2 . PHE B 1 352 ? 2.554   95.567  36.618  1.00 20.00 ? 352  PHE B CD2 1 
ATOM   6359  C CE1 . PHE B 1 352 ? 2.004   98.247  37.098  1.00 20.00 ? 352  PHE B CE1 1 
ATOM   6360  C CE2 . PHE B 1 352 ? 1.627   95.922  37.607  1.00 20.00 ? 352  PHE B CE2 1 
ATOM   6361  C CZ  . PHE B 1 352 ? 1.354   97.265  37.847  1.00 20.00 ? 352  PHE B CZ  1 
ATOM   6362  N N   . CYS B 1 353 ? 5.219   98.109  32.563  1.00 20.00 ? 353  CYS B N   1 
ATOM   6363  C CA  . CYS B 1 353 ? 5.594   99.457  32.136  1.00 20.00 ? 353  CYS B CA  1 
ATOM   6364  C C   . CYS B 1 353 ? 6.190   99.465  30.727  1.00 20.00 ? 353  CYS B C   1 
ATOM   6365  O O   . CYS B 1 353 ? 7.405   99.534  30.560  1.00 20.00 ? 353  CYS B O   1 
ATOM   6366  C CB  . CYS B 1 353 ? 6.614   100.058 33.110  1.00 20.00 ? 353  CYS B CB  1 
ATOM   6367  S SG  . CYS B 1 353 ? 6.427   99.549  34.827  1.00 20.00 ? 353  CYS B SG  1 
ATOM   6368  N N   . PRO B 1 354 ? 5.337   99.401  29.694  1.00 20.00 ? 354  PRO B N   1 
ATOM   6369  C CA  . PRO B 1 354 ? 5.810   99.310  28.308  1.00 20.00 ? 354  PRO B CA  1 
ATOM   6370  C C   . PRO B 1 354 ? 6.326   100.650 27.809  1.00 20.00 ? 354  PRO B C   1 
ATOM   6371  O O   . PRO B 1 354 ? 6.909   100.745 26.730  1.00 20.00 ? 354  PRO B O   1 
ATOM   6372  C CB  . PRO B 1 354 ? 4.577   98.863  27.547  1.00 20.00 ? 354  PRO B CB  1 
ATOM   6373  C CG  . PRO B 1 354 ? 3.444   99.478  28.330  1.00 20.00 ? 354  PRO B CG  1 
ATOM   6374  C CD  . PRO B 1 354 ? 3.865   99.416  29.775  1.00 20.00 ? 354  PRO B CD  1 
ATOM   6375  N N   . HIS B 1 355 ? 6.103   101.684 28.609  1.00 20.00 ? 355  HIS B N   1 
ATOM   6376  C CA  . HIS B 1 355 ? 6.532   103.036 28.278  1.00 20.00 ? 355  HIS B CA  1 
ATOM   6377  C C   . HIS B 1 355 ? 7.947   103.301 28.781  1.00 20.00 ? 355  HIS B C   1 
ATOM   6378  O O   . HIS B 1 355 ? 8.504   104.376 28.550  1.00 20.00 ? 355  HIS B O   1 
ATOM   6379  C CB  . HIS B 1 355 ? 5.582   104.046 28.926  1.00 20.00 ? 355  HIS B CB  1 
ATOM   6380  C CG  . HIS B 1 355 ? 5.555   103.973 30.425  1.00 20.00 ? 355  HIS B CG  1 
ATOM   6381  N ND1 . HIS B 1 355 ? 5.249   102.816 31.110  1.00 20.00 ? 355  HIS B ND1 1 
ATOM   6382  C CD2 . HIS B 1 355 ? 5.825   104.907 31.369  1.00 20.00 ? 355  HIS B CD2 1 
ATOM   6383  C CE1 . HIS B 1 355 ? 5.332   103.040 32.409  1.00 20.00 ? 355  HIS B CE1 1 
ATOM   6384  N NE2 . HIS B 1 355 ? 5.681   104.300 32.592  1.00 20.00 ? 355  HIS B NE2 1 
ATOM   6385  N N   . LEU B 1 356 ? 8.524   102.321 29.465  1.00 20.00 ? 356  LEU B N   1 
ATOM   6386  C CA  . LEU B 1 356 ? 9.870   102.459 30.005  1.00 20.00 ? 356  LEU B CA  1 
ATOM   6387  C C   . LEU B 1 356 ? 10.816  101.429 29.425  1.00 20.00 ? 356  LEU B C   1 
ATOM   6388  O O   . LEU B 1 356 ? 10.422  100.294 29.180  1.00 20.00 ? 356  LEU B O   1 
ATOM   6389  C CB  . LEU B 1 356 ? 9.829   102.275 31.525  1.00 20.00 ? 356  LEU B CB  1 
ATOM   6390  C CG  . LEU B 1 356 ? 9.811   103.479 32.470  1.00 20.00 ? 356  LEU B CG  1 
ATOM   6391  C CD1 . LEU B 1 356 ? 8.925   104.564 31.917  1.00 20.00 ? 356  LEU B CD1 1 
ATOM   6392  C CD2 . LEU B 1 356 ? 9.320   103.038 33.835  1.00 20.00 ? 356  LEU B CD2 1 
ATOM   6393  N N   . THR B 1 357 ? 12.063  101.824 29.195  1.00 20.00 ? 357  THR B N   1 
ATOM   6394  C CA  . THR B 1 357 ? 13.053  100.898 28.651  1.00 20.00 ? 357  THR B CA  1 
ATOM   6395  C C   . THR B 1 357 ? 13.758  100.316 29.882  1.00 20.00 ? 357  THR B C   1 
ATOM   6396  O O   . THR B 1 357 ? 13.837  100.973 30.923  1.00 20.00 ? 357  THR B O   1 
ATOM   6397  C CB  . THR B 1 357 ? 14.084  101.611 27.735  1.00 20.00 ? 357  THR B CB  1 
ATOM   6398  O OG1 . THR B 1 357 ? 14.844  102.547 28.504  1.00 20.00 ? 357  THR B OG1 1 
ATOM   6399  C CG2 . THR B 1 357 ? 13.386  102.341 26.609  1.00 20.00 ? 357  THR B CG2 1 
ATOM   6400  N N   . GLN B 1 358 ? 14.256  99.088  29.774  1.00 20.00 ? 358  GLN B N   1 
ATOM   6401  C CA  . GLN B 1 358 ? 14.938  98.447  30.896  1.00 20.00 ? 358  GLN B CA  1 
ATOM   6402  C C   . GLN B 1 358 ? 16.040  99.295  31.503  1.00 20.00 ? 358  GLN B C   1 
ATOM   6403  O O   . GLN B 1 358 ? 16.375  99.141  32.679  1.00 20.00 ? 358  GLN B O   1 
ATOM   6404  C CB  . GLN B 1 358 ? 15.524  97.100  30.476  1.00 20.00 ? 358  GLN B CB  1 
ATOM   6405  C CG  . GLN B 1 358 ? 15.918  96.234  31.659  1.00 20.00 ? 358  GLN B CG  1 
ATOM   6406  C CD  . GLN B 1 358 ? 16.259  94.820  31.256  1.00 20.00 ? 358  GLN B CD  1 
ATOM   6407  O OE1 . GLN B 1 358 ? 16.731  94.584  30.146  1.00 20.00 ? 358  GLN B OE1 1 
ATOM   6408  N NE2 . GLN B 1 358 ? 16.023  93.868  32.153  1.00 20.00 ? 358  GLN B NE2 1 
ATOM   6409  N N   . ASP B 1 359 ? 16.600  100.191 30.698  1.00 20.00 ? 359  ASP B N   1 
ATOM   6410  C CA  . ASP B 1 359 ? 17.670  101.066 31.152  1.00 20.00 ? 359  ASP B CA  1 
ATOM   6411  C C   . ASP B 1 359 ? 17.146  102.184 32.040  1.00 20.00 ? 359  ASP B C   1 
ATOM   6412  O O   . ASP B 1 359 ? 17.909  103.019 32.536  1.00 20.00 ? 359  ASP B O   1 
ATOM   6413  C CB  . ASP B 1 359 ? 18.403  101.626 29.942  1.00 20.00 ? 359  ASP B CB  1 
ATOM   6414  C CG  . ASP B 1 359 ? 18.946  100.528 29.057  1.00 20.00 ? 359  ASP B CG  1 
ATOM   6415  O OD1 . ASP B 1 359 ? 19.963  99.917  29.451  1.00 20.00 ? 359  ASP B OD1 1 
ATOM   6416  O OD2 . ASP B 1 359 ? 18.350  100.261 27.986  1.00 20.00 ? 359  ASP B OD2 1 
ATOM   6417  N N   . GLN B 1 360 ? 15.837  102.198 32.237  1.00 20.00 ? 360  GLN B N   1 
ATOM   6418  C CA  . GLN B 1 360 ? 15.221  103.208 33.071  1.00 20.00 ? 360  GLN B CA  1 
ATOM   6419  C C   . GLN B 1 360 ? 14.734  102.482 34.321  1.00 20.00 ? 360  GLN B C   1 
ATOM   6420  O O   . GLN B 1 360 ? 14.005  103.037 35.137  1.00 20.00 ? 360  GLN B O   1 
ATOM   6421  C CB  . GLN B 1 360 ? 14.063  103.868 32.326  1.00 20.00 ? 360  GLN B CB  1 
ATOM   6422  C CG  . GLN B 1 360 ? 14.508  104.776 31.192  1.00 20.00 ? 360  GLN B CG  1 
ATOM   6423  C CD  . GLN B 1 360 ? 13.339  105.276 30.360  1.00 20.00 ? 360  GLN B CD  1 
ATOM   6424  O OE1 . GLN B 1 360 ? 12.555  104.489 29.837  1.00 20.00 ? 360  GLN B OE1 1 
ATOM   6425  N NE2 . GLN B 1 360 ? 13.216  106.593 30.239  1.00 20.00 ? 360  GLN B NE2 1 
ATOM   6426  N N   . PHE B 1 361 ? 15.165  101.228 34.452  1.00 20.00 ? 361  PHE B N   1 
ATOM   6427  C CA  . PHE B 1 361 ? 14.816  100.363 35.581  1.00 20.00 ? 361  PHE B CA  1 
ATOM   6428  C C   . PHE B 1 361 ? 13.319  100.317 35.899  1.00 20.00 ? 361  PHE B C   1 
ATOM   6429  O O   . PHE B 1 361 ? 12.855  100.908 36.883  1.00 20.00 ? 361  PHE B O   1 
ATOM   6430  C CB  . PHE B 1 361 ? 15.592  100.793 36.829  1.00 20.00 ? 361  PHE B CB  1 
ATOM   6431  C CG  . PHE B 1 361 ? 17.012  101.212 36.553  1.00 20.00 ? 361  PHE B CG  1 
ATOM   6432  C CD1 . PHE B 1 361 ? 17.840  100.438 35.746  1.00 20.00 ? 361  PHE B CD1 1 
ATOM   6433  C CD2 . PHE B 1 361 ? 17.526  102.380 37.114  1.00 20.00 ? 361  PHE B CD2 1 
ATOM   6434  C CE1 . PHE B 1 361 ? 19.156  100.819 35.501  1.00 20.00 ? 361  PHE B CE1 1 
ATOM   6435  C CE2 . PHE B 1 361 ? 18.841  102.768 36.874  1.00 20.00 ? 361  PHE B CE2 1 
ATOM   6436  C CZ  . PHE B 1 361 ? 19.654  101.987 36.067  1.00 20.00 ? 361  PHE B CZ  1 
ATOM   6437  N N   . PRO B 1 362 ? 12.541  99.601  35.072  1.00 20.00 ? 362  PRO B N   1 
ATOM   6438  C CA  . PRO B 1 362 ? 11.102  99.462  35.303  1.00 20.00 ? 362  PRO B CA  1 
ATOM   6439  C C   . PRO B 1 362 ? 10.767  98.728  36.605  1.00 20.00 ? 362  PRO B C   1 
ATOM   6440  O O   . PRO B 1 362 ? 9.962   99.206  37.404  1.00 20.00 ? 362  PRO B O   1 
ATOM   6441  C CB  . PRO B 1 362 ? 10.612  98.705  34.070  1.00 20.00 ? 362  PRO B CB  1 
ATOM   6442  C CG  . PRO B 1 362 ? 11.812  97.989  33.571  1.00 20.00 ? 362  PRO B CG  1 
ATOM   6443  C CD  . PRO B 1 362 ? 12.973  98.880  33.863  1.00 20.00 ? 362  PRO B CD  1 
ATOM   6444  N N   . ALA B 1 363 ? 11.387  97.572  36.819  1.00 20.00 ? 363  ALA B N   1 
ATOM   6445  C CA  . ALA B 1 363 ? 11.139  96.791  38.026  1.00 20.00 ? 363  ALA B CA  1 
ATOM   6446  C C   . ALA B 1 363 ? 11.442  97.587  39.286  1.00 20.00 ? 363  ALA B C   1 
ATOM   6447  O O   . ALA B 1 363 ? 10.666  97.562  40.242  1.00 20.00 ? 363  ALA B O   1 
ATOM   6448  C CB  . ALA B 1 363 ? 11.969  95.518  38.005  1.00 20.00 ? 363  ALA B CB  1 
ATOM   6449  N N   . GLN B 1 364 ? 12.571  98.291  39.285  1.00 20.00 ? 364  GLN B N   1 
ATOM   6450  C CA  . GLN B 1 364 ? 12.967  99.091  40.436  1.00 20.00 ? 364  GLN B CA  1 
ATOM   6451  C C   . GLN B 1 364 ? 11.947  100.196 40.692  1.00 20.00 ? 364  GLN B C   1 
ATOM   6452  O O   . GLN B 1 364 ? 11.551  100.424 41.837  1.00 20.00 ? 364  GLN B O   1 
ATOM   6453  C CB  . GLN B 1 364 ? 14.367  99.688  40.216  1.00 20.00 ? 364  GLN B CB  1 
ATOM   6454  C CG  . GLN B 1 364 ? 15.000  100.300 41.470  1.00 20.00 ? 364  GLN B CG  1 
ATOM   6455  C CD  . GLN B 1 364 ? 15.615  99.271  42.413  1.00 20.00 ? 364  GLN B CD  1 
ATOM   6456  O OE1 . GLN B 1 364 ? 16.583  98.596  42.070  1.00 20.00 ? 364  GLN B OE1 1 
ATOM   6457  N NE2 . GLN B 1 364 ? 15.057  99.161  43.614  1.00 20.00 ? 364  GLN B NE2 1 
ATOM   6458  N N   . SER B 1 365 ? 11.503  100.864 39.628  1.00 20.00 ? 365  SER B N   1 
ATOM   6459  C CA  . SER B 1 365 ? 10.526  101.939 39.778  1.00 20.00 ? 365  SER B CA  1 
ATOM   6460  C C   . SER B 1 365 ? 9.145   101.422 40.146  1.00 20.00 ? 365  SER B C   1 
ATOM   6461  O O   . SER B 1 365 ? 8.395   102.091 40.853  1.00 20.00 ? 365  SER B O   1 
ATOM   6462  C CB  . SER B 1 365 ? 10.427  102.770 38.499  1.00 20.00 ? 365  SER B CB  1 
ATOM   6463  O OG  . SER B 1 365 ? 9.720   103.970 38.762  1.00 20.00 ? 365  SER B OG  1 
ATOM   6464  N N   . LEU B 1 366 ? 8.804   100.233 39.662  1.00 20.00 ? 366  LEU B N   1 
ATOM   6465  C CA  . LEU B 1 366 ? 7.505   99.644  39.959  1.00 20.00 ? 366  LEU B CA  1 
ATOM   6466  C C   . LEU B 1 366 ? 7.448   99.334  41.451  1.00 20.00 ? 366  LEU B C   1 
ATOM   6467  O O   . LEU B 1 366 ? 6.419   99.544  42.098  1.00 20.00 ? 366  LEU B O   1 
ATOM   6468  C CB  . LEU B 1 366 ? 7.313   98.355  39.158  1.00 20.00 ? 366  LEU B CB  1 
ATOM   6469  C CG  . LEU B 1 366 ? 5.899   97.947  38.735  1.00 20.00 ? 366  LEU B CG  1 
ATOM   6470  C CD1 . LEU B 1 366 ? 5.795   96.433  38.750  1.00 20.00 ? 366  LEU B CD1 1 
ATOM   6471  C CD2 . LEU B 1 366 ? 4.864   98.572  39.658  1.00 20.00 ? 366  LEU B CD2 1 
ATOM   6472  N N   . ALA B 1 367 ? 8.565   98.835  41.988  1.00 20.00 ? 367  ALA B N   1 
ATOM   6473  C CA  . ALA B 1 367 ? 8.670   98.488  43.405  1.00 20.00 ? 367  ALA B CA  1 
ATOM   6474  C C   . ALA B 1 367 ? 8.526   99.713  44.303  1.00 20.00 ? 367  ALA B C   1 
ATOM   6475  O O   . ALA B 1 367 ? 7.895   99.639  45.354  1.00 20.00 ? 367  ALA B O   1 
ATOM   6476  C CB  . ALA B 1 367 ? 10.002  97.791  43.674  1.00 20.00 ? 367  ALA B CB  1 
ATOM   6477  N N   . ALA B 1 368 ? 9.105   100.836 43.887  1.00 20.00 ? 368  ALA B N   1 
ATOM   6478  C CA  . ALA B 1 368 ? 9.032   102.072 44.661  1.00 20.00 ? 368  ALA B CA  1 
ATOM   6479  C C   . ALA B 1 368 ? 7.616   102.622 44.645  1.00 20.00 ? 368  ALA B C   1 
ATOM   6480  O O   . ALA B 1 368 ? 7.134   103.170 45.637  1.00 20.00 ? 368  ALA B O   1 
ATOM   6481  C CB  . ALA B 1 368 ? 9.984   103.104 44.093  1.00 20.00 ? 368  ALA B CB  1 
ATOM   6482  N N   . SER B 1 369 ? 6.948   102.479 43.508  1.00 20.00 ? 369  SER B N   1 
ATOM   6483  C CA  . SER B 1 369 ? 5.587   102.963 43.373  1.00 20.00 ? 369  SER B CA  1 
ATOM   6484  C C   . SER B 1 369 ? 4.643   102.131 44.226  1.00 20.00 ? 369  SER B C   1 
ATOM   6485  O O   . SER B 1 369 ? 3.737   102.665 44.859  1.00 20.00 ? 369  SER B O   1 
ATOM   6486  C CB  . SER B 1 369 ? 5.157   102.901 41.909  1.00 20.00 ? 369  SER B CB  1 
ATOM   6487  O OG  . SER B 1 369 ? 5.609   104.050 41.220  1.00 20.00 ? 369  SER B OG  1 
ATOM   6488  N N   . ILE B 1 370 ? 4.861   100.821 44.240  1.00 20.00 ? 370  ILE B N   1 
ATOM   6489  C CA  . ILE B 1 370 ? 4.027   99.918  45.016  1.00 20.00 ? 370  ILE B CA  1 
ATOM   6490  C C   . ILE B 1 370 ? 4.066   100.282 46.493  1.00 20.00 ? 370  ILE B C   1 
ATOM   6491  O O   . ILE B 1 370 ? 3.048   100.194 47.185  1.00 20.00 ? 370  ILE B O   1 
ATOM   6492  C CB  . ILE B 1 370 ? 4.476   98.444  44.831  1.00 20.00 ? 370  ILE B CB  1 
ATOM   6493  C CG1 . ILE B 1 370 ? 4.103   97.964  43.422  1.00 20.00 ? 370  ILE B CG1 1 
ATOM   6494  C CG2 . ILE B 1 370 ? 3.820   97.555  45.877  1.00 20.00 ? 370  ILE B CG2 1 
ATOM   6495  C CD1 . ILE B 1 370 ? 4.634   96.594  43.074  1.00 20.00 ? 370  ILE B CD1 1 
ATOM   6496  N N   . TYR B 1 371 ? 5.235   100.691 46.983  1.00 20.00 ? 371  TYR B N   1 
ATOM   6497  C CA  . TYR B 1 371 ? 5.343   101.057 48.389  1.00 20.00 ? 371  TYR B CA  1 
ATOM   6498  C C   . TYR B 1 371 ? 4.624   102.372 48.667  1.00 20.00 ? 371  TYR B C   1 
ATOM   6499  O O   . TYR B 1 371 ? 3.746   102.425 49.530  1.00 20.00 ? 371  TYR B O   1 
ATOM   6500  C CB  . TYR B 1 371 ? 6.800   101.181 48.834  1.00 20.00 ? 371  TYR B CB  1 
ATOM   6501  C CG  . TYR B 1 371 ? 6.933   101.810 50.211  1.00 20.00 ? 371  TYR B CG  1 
ATOM   6502  C CD1 . TYR B 1 371 ? 6.613   101.089 51.366  1.00 20.00 ? 371  TYR B CD1 1 
ATOM   6503  C CD2 . TYR B 1 371 ? 7.340   103.134 50.358  1.00 20.00 ? 371  TYR B CD2 1 
ATOM   6504  C CE1 . TYR B 1 371 ? 6.694   101.676 52.633  1.00 20.00 ? 371  TYR B CE1 1 
ATOM   6505  C CE2 . TYR B 1 371 ? 7.424   103.729 51.619  1.00 20.00 ? 371  TYR B CE2 1 
ATOM   6506  C CZ  . TYR B 1 371 ? 7.100   102.996 52.748  1.00 20.00 ? 371  TYR B CZ  1 
ATOM   6507  O OH  . TYR B 1 371 ? 7.178   103.589 53.990  1.00 20.00 ? 371  TYR B OH  1 
ATOM   6508  N N   . MET B 1 372 ? 5.000   103.425 47.943  1.00 20.00 ? 372  MET B N   1 
ATOM   6509  C CA  . MET B 1 372 ? 4.390   104.746 48.115  1.00 20.00 ? 372  MET B CA  1 
ATOM   6510  C C   . MET B 1 372 ? 2.863   104.748 48.031  1.00 20.00 ? 372  MET B C   1 
ATOM   6511  O O   . MET B 1 372 ? 2.196   105.552 48.681  1.00 20.00 ? 372  MET B O   1 
ATOM   6512  C CB  . MET B 1 372 ? 4.936   105.705 47.069  1.00 20.00 ? 372  MET B CB  1 
ATOM   6513  C CG  . MET B 1 372 ? 6.416   105.949 47.185  1.00 20.00 ? 372  MET B CG  1 
ATOM   6514  S SD  . MET B 1 372 ? 6.980   107.243 46.067  1.00 20.00 ? 372  MET B SD  1 
ATOM   6515  C CE  . MET B 1 372 ? 7.401   106.285 44.623  1.00 20.00 ? 372  MET B CE  1 
ATOM   6516  N N   . GLU B 1 373 ? 2.321   103.840 47.234  1.00 20.00 ? 373  GLU B N   1 
ATOM   6517  C CA  . GLU B 1 373 ? 0.885   103.729 47.052  1.00 20.00 ? 373  GLU B CA  1 
ATOM   6518  C C   . GLU B 1 373 ? 0.161   102.818 48.043  1.00 20.00 ? 373  GLU B C   1 
ATOM   6519  O O   . GLU B 1 373 ? -0.981  103.101 48.421  1.00 20.00 ? 373  GLU B O   1 
ATOM   6520  C CB  . GLU B 1 373 ? 0.596   103.241 45.637  1.00 20.00 ? 373  GLU B CB  1 
ATOM   6521  C CG  . GLU B 1 373 ? -0.364  104.111 44.869  1.00 20.00 ? 373  GLU B CG  1 
ATOM   6522  C CD  . GLU B 1 373 ? 0.098   105.549 44.794  1.00 20.00 ? 373  GLU B CD  1 
ATOM   6523  O OE1 . GLU B 1 373 ? 1.183   105.798 44.219  1.00 20.00 ? 373  GLU B OE1 1 
ATOM   6524  O OE2 . GLU B 1 373 ? -0.628  106.427 45.315  1.00 20.00 ? 373  GLU B OE2 1 
ATOM   6525  N N   . THR B 1 374 ? 0.808   101.731 48.465  1.00 20.00 ? 374  THR B N   1 
ATOM   6526  C CA  . THR B 1 374 ? 0.174   100.803 49.406  1.00 20.00 ? 374  THR B CA  1 
ATOM   6527  C C   . THR B 1 374 ? 0.861   100.588 50.752  1.00 20.00 ? 374  THR B C   1 
ATOM   6528  O O   . THR B 1 374 ? 0.215   100.190 51.726  1.00 20.00 ? 374  THR B O   1 
ATOM   6529  C CB  . THR B 1 374 ? 0.006   99.398  48.779  1.00 20.00 ? 374  THR B CB  1 
ATOM   6530  O OG1 . THR B 1 374 ? 1.285   98.911  48.353  1.00 20.00 ? 374  THR B OG1 1 
ATOM   6531  C CG2 . THR B 1 374 ? -0.932  99.443  47.595  1.00 20.00 ? 374  THR B CG2 1 
ATOM   6532  N N   . GLY B 1 375 ? 2.162   100.835 50.813  1.00 20.00 ? 375  GLY B N   1 
ATOM   6533  C CA  . GLY B 1 375 ? 2.868   100.637 52.064  1.00 20.00 ? 375  GLY B CA  1 
ATOM   6534  C C   . GLY B 1 375 ? 3.431   99.224  52.124  1.00 20.00 ? 375  GLY B C   1 
ATOM   6535  O O   . GLY B 1 375 ? 3.802   98.742  53.196  1.00 20.00 ? 375  GLY B O   1 
ATOM   6536  N N   . VAL B 1 376 ? 3.468   98.544  50.979  1.00 20.00 ? 376  VAL B N   1 
ATOM   6537  C CA  . VAL B 1 376 ? 3.998   97.189  50.934  1.00 20.00 ? 376  VAL B CA  1 
ATOM   6538  C C   . VAL B 1 376 ? 5.367   97.204  50.247  1.00 20.00 ? 376  VAL B C   1 
ATOM   6539  O O   . VAL B 1 376 ? 5.559   97.859  49.211  1.00 20.00 ? 376  VAL B O   1 
ATOM   6540  C CB  . VAL B 1 376 ? 3.040   96.198  50.196  1.00 20.00 ? 376  VAL B CB  1 
ATOM   6541  C CG1 . VAL B 1 376 ? 1.670   96.812  50.040  1.00 20.00 ? 376  VAL B CG1 1 
ATOM   6542  C CG2 . VAL B 1 376 ? 3.604   95.798  48.848  1.00 20.00 ? 376  VAL B CG2 1 
ATOM   6543  N N   . ARG B 1 377 ? 6.327   96.498  50.831  1.00 20.00 ? 377  ARG B N   1 
ATOM   6544  C CA  . ARG B 1 377 ? 7.655   96.457  50.241  1.00 20.00 ? 377  ARG B CA  1 
ATOM   6545  C C   . ARG B 1 377 ? 7.844   95.190  49.416  1.00 20.00 ? 377  ARG B C   1 
ATOM   6546  O O   . ARG B 1 377 ? 7.532   94.093  49.870  1.00 20.00 ? 377  ARG B O   1 
ATOM   6547  C CB  . ARG B 1 377 ? 8.736   96.532  51.322  1.00 20.00 ? 377  ARG B CB  1 
ATOM   6548  C CG  . ARG B 1 377 ? 10.097  96.041  50.841  1.00 20.00 ? 377  ARG B CG  1 
ATOM   6549  C CD  . ARG B 1 377 ? 11.214  96.612  51.683  1.00 20.00 ? 377  ARG B CD  1 
ATOM   6550  N NE  . ARG B 1 377 ? 11.424  95.828  52.896  1.00 20.00 ? 377  ARG B NE  1 
ATOM   6551  C CZ  . ARG B 1 377 ? 12.401  96.056  53.764  1.00 20.00 ? 377  ARG B CZ  1 
ATOM   6552  N NH1 . ARG B 1 377 ? 13.255  97.046  53.550  1.00 20.00 ? 377  ARG B NH1 1 
ATOM   6553  N NH2 . ARG B 1 377 ? 12.517  95.307  54.851  1.00 20.00 ? 377  ARG B NH2 1 
ATOM   6554  N N   . SER B 1 378 ? 8.350   95.360  48.199  1.00 20.00 ? 378  SER B N   1 
ATOM   6555  C CA  . SER B 1 378 ? 8.597   94.251  47.287  1.00 20.00 ? 378  SER B CA  1 
ATOM   6556  C C   . SER B 1 378 ? 10.069  94.316  46.891  1.00 20.00 ? 378  SER B C   1 
ATOM   6557  O O   . SER B 1 378 ? 10.749  95.303  47.170  1.00 20.00 ? 378  SER B O   1 
ATOM   6558  C CB  . SER B 1 378 ? 7.711   94.371  46.043  1.00 20.00 ? 378  SER B CB  1 
ATOM   6559  O OG  . SER B 1 378 ? 8.083   95.491  45.261  1.00 20.00 ? 378  SER B OG  1 
ATOM   6560  N N   . MET B 1 379 ? 10.566  93.268  46.247  1.00 20.00 ? 379  MET B N   1 
ATOM   6561  C CA  . MET B 1 379 ? 11.960  93.250  45.838  1.00 20.00 ? 379  MET B CA  1 
ATOM   6562  C C   . MET B 1 379 ? 12.104  93.303  44.331  1.00 20.00 ? 379  MET B C   1 
ATOM   6563  O O   . MET B 1 379 ? 11.339  92.679  43.605  1.00 20.00 ? 379  MET B O   1 
ATOM   6564  C CB  . MET B 1 379 ? 12.650  91.989  46.364  1.00 20.00 ? 379  MET B CB  1 
ATOM   6565  C CG  . MET B 1 379 ? 14.167  92.130  46.496  1.00 20.00 ? 379  MET B CG  1 
ATOM   6566  S SD  . MET B 1 379 ? 14.961  90.580  46.939  1.00 20.00 ? 379  MET B SD  1 
ATOM   6567  C CE  . MET B 1 379 ? 14.378  89.583  45.661  1.00 20.00 ? 379  MET B CE  1 
ATOM   6568  N N   . GLU B 1 380 ? 13.081  94.059  43.852  1.00 20.00 ? 380  GLU B N   1 
ATOM   6569  C CA  . GLU B 1 380 ? 13.280  94.148  42.418  1.00 20.00 ? 380  GLU B CA  1 
ATOM   6570  C C   . GLU B 1 380 ? 14.196  93.004  42.039  1.00 20.00 ? 380  GLU B C   1 
ATOM   6571  O O   . GLU B 1 380 ? 15.165  92.702  42.736  1.00 20.00 ? 380  GLU B O   1 
ATOM   6572  C CB  . GLU B 1 380 ? 13.895  95.500  42.018  1.00 20.00 ? 380  GLU B CB  1 
ATOM   6573  C CG  . GLU B 1 380 ? 15.396  95.518  41.847  1.00 20.00 ? 380  GLU B CG  1 
ATOM   6574  C CD  . GLU B 1 380 ? 15.843  95.148  40.449  1.00 20.00 ? 380  GLU B CD  1 
ATOM   6575  O OE1 . GLU B 1 380 ? 15.554  95.896  39.497  1.00 20.00 ? 380  GLU B OE1 1 
ATOM   6576  O OE2 . GLU B 1 380 ? 16.498  94.103  40.306  1.00 20.00 ? 380  GLU B OE2 1 
ATOM   6577  N N   . ARG B 1 381 ? 13.854  92.338  40.950  1.00 20.00 ? 381  ARG B N   1 
ATOM   6578  C CA  . ARG B 1 381 ? 14.641  91.225  40.467  1.00 20.00 ? 381  ARG B CA  1 
ATOM   6579  C C   . ARG B 1 381 ? 14.844  91.478  38.986  1.00 20.00 ? 381  ARG B C   1 
ATOM   6580  O O   . ARG B 1 381 ? 14.362  90.717  38.152  1.00 20.00 ? 381  ARG B O   1 
ATOM   6581  C CB  . ARG B 1 381 ? 13.892  89.908  40.681  1.00 20.00 ? 381  ARG B CB  1 
ATOM   6582  C CG  . ARG B 1 381 ? 13.872  89.428  42.124  1.00 20.00 ? 381  ARG B CG  1 
ATOM   6583  C CD  . ARG B 1 381 ? 15.252  88.983  42.577  1.00 20.00 ? 381  ARG B CD  1 
ATOM   6584  N NE  . ARG B 1 381 ? 16.042  90.097  43.100  1.00 20.00 ? 381  ARG B NE  1 
ATOM   6585  C CZ  . ARG B 1 381 ? 17.137  89.946  43.838  1.00 20.00 ? 381  ARG B CZ  1 
ATOM   6586  N NH1 . ARG B 1 381 ? 17.562  88.723  44.133  1.00 20.00 ? 381  ARG B NH1 1 
ATOM   6587  N NH2 . ARG B 1 381 ? 17.803  91.010  44.284  1.00 20.00 ? 381  ARG B NH2 1 
ATOM   6588  N N   . GLY B 1 382 ? 15.542  92.564  38.665  1.00 20.00 ? 382  GLY B N   1 
ATOM   6589  C CA  . GLY B 1 382 ? 15.792  92.898  37.276  1.00 20.00 ? 382  GLY B CA  1 
ATOM   6590  C C   . GLY B 1 382 ? 17.208  93.373  37.008  1.00 20.00 ? 382  GLY B C   1 
ATOM   6591  O O   . GLY B 1 382 ? 18.172  92.867  37.582  1.00 20.00 ? 382  GLY B O   1 
ATOM   6592  N N   . ILE B 1 383 ? 17.321  94.359  36.125  1.00 20.00 ? 383  ILE B N   1 
ATOM   6593  C CA  . ILE B 1 383 ? 18.596  94.949  35.734  1.00 20.00 ? 383  ILE B CA  1 
ATOM   6594  C C   . ILE B 1 383 ? 19.419  95.495  36.910  1.00 20.00 ? 383  ILE B C   1 
ATOM   6595  O O   . ILE B 1 383 ? 20.641  95.323  36.943  1.00 20.00 ? 383  ILE B O   1 
ATOM   6596  C CB  . ILE B 1 383 ? 18.350  96.074  34.687  1.00 20.00 ? 383  ILE B CB  1 
ATOM   6597  C CG1 . ILE B 1 383 ? 19.673  96.637  34.182  1.00 20.00 ? 383  ILE B CG1 1 
ATOM   6598  C CG2 . ILE B 1 383 ? 17.492  97.181  35.292  1.00 20.00 ? 383  ILE B CG2 1 
ATOM   6599  C CD1 . ILE B 1 383 ? 19.505  97.635  33.041  1.00 20.00 ? 383  ILE B CD1 1 
ATOM   6600  N N   . VAL B 1 384 ? 18.759  96.139  37.875  1.00 20.00 ? 384  VAL B N   1 
ATOM   6601  C CA  . VAL B 1 384 ? 19.457  96.701  39.035  1.00 20.00 ? 384  VAL B CA  1 
ATOM   6602  C C   . VAL B 1 384 ? 20.130  95.641  39.899  1.00 20.00 ? 384  VAL B C   1 
ATOM   6603  O O   . VAL B 1 384 ? 21.201  95.876  40.461  1.00 20.00 ? 384  VAL B O   1 
ATOM   6604  C CB  . VAL B 1 384 ? 18.508  97.528  39.934  1.00 20.00 ? 384  VAL B CB  1 
ATOM   6605  C CG1 . VAL B 1 384 ? 19.298  98.187  41.060  1.00 20.00 ? 384  VAL B CG1 1 
ATOM   6606  C CG2 . VAL B 1 384 ? 17.802  98.582  39.110  1.00 20.00 ? 384  VAL B CG2 1 
ATOM   6607  N N   . SER B 1 385 ? 19.498  94.479  40.009  1.00 20.00 ? 385  SER B N   1 
ATOM   6608  C CA  . SER B 1 385 ? 20.044  93.389  40.805  1.00 20.00 ? 385  SER B CA  1 
ATOM   6609  C C   . SER B 1 385 ? 21.050  92.588  39.978  1.00 20.00 ? 385  SER B C   1 
ATOM   6610  O O   . SER B 1 385 ? 22.003  92.026  40.520  1.00 20.00 ? 385  SER B O   1 
ATOM   6611  C CB  . SER B 1 385 ? 18.916  92.469  41.295  1.00 20.00 ? 385  SER B CB  1 
ATOM   6612  O OG  . SER B 1 385 ? 18.117  93.110  42.278  1.00 20.00 ? 385  SER B OG  1 
ATOM   6613  N N   . ALA B 1 386 ? 20.836  92.541  38.665  1.00 20.00 ? 386  ALA B N   1 
ATOM   6614  C CA  . ALA B 1 386 ? 21.726  91.809  37.764  1.00 20.00 ? 386  ALA B CA  1 
ATOM   6615  C C   . ALA B 1 386 ? 23.113  92.444  37.746  1.00 20.00 ? 386  ALA B C   1 
ATOM   6616  O O   . ALA B 1 386 ? 24.092  91.806  37.361  1.00 20.00 ? 386  ALA B O   1 
ATOM   6617  C CB  . ALA B 1 386 ? 21.146  91.792  36.354  1.00 20.00 ? 386  ALA B CB  1 
ATOM   6618  N N   . GLY B 1 387 ? 23.182  93.707  38.162  1.00 20.00 ? 387  GLY B N   1 
ATOM   6619  C CA  . GLY B 1 387 ? 24.446  94.425  38.193  1.00 20.00 ? 387  GLY B CA  1 
ATOM   6620  C C   . GLY B 1 387 ? 24.990  94.718  36.808  1.00 20.00 ? 387  GLY B C   1 
ATOM   6621  O O   . GLY B 1 387 ? 24.298  94.530  35.801  1.00 20.00 ? 387  GLY B O   1 
ATOM   6622  N N   . ARG B 1 388 ? 26.233  95.184  36.752  1.00 20.00 ? 388  ARG B N   1 
ATOM   6623  C CA  . ARG B 1 388 ? 26.857  95.497  35.474  1.00 20.00 ? 388  ARG B CA  1 
ATOM   6624  C C   . ARG B 1 388 ? 28.124  94.672  35.290  1.00 20.00 ? 388  ARG B C   1 
ATOM   6625  O O   . ARG B 1 388 ? 28.812  94.356  36.257  1.00 20.00 ? 388  ARG B O   1 
ATOM   6626  C CB  . ARG B 1 388 ? 27.178  96.991  35.387  1.00 20.00 ? 388  ARG B CB  1 
ATOM   6627  C CG  . ARG B 1 388 ? 27.997  97.522  36.535  1.00 20.00 ? 388  ARG B CG  1 
ATOM   6628  C CD  . ARG B 1 388 ? 28.259  99.005  36.363  1.00 20.00 ? 388  ARG B CD  1 
ATOM   6629  N NE  . ARG B 1 388 ? 27.646  99.528  35.149  1.00 20.00 ? 388  ARG B NE  1 
ATOM   6630  C CZ  . ARG B 1 388 ? 26.871  100.604 35.117  1.00 20.00 ? 388  ARG B CZ  1 
ATOM   6631  N NH1 . ARG B 1 388 ? 26.617  101.268 36.239  1.00 20.00 ? 388  ARG B NH1 1 
ATOM   6632  N NH2 . ARG B 1 388 ? 26.353  101.018 33.968  1.00 20.00 ? 388  ARG B NH2 1 
ATOM   6633  N N   . SER B 1 389 ? 28.419  94.315  34.045  1.00 20.00 ? 389  SER B N   1 
ATOM   6634  C CA  . SER B 1 389 ? 29.603  93.523  33.720  1.00 20.00 ? 389  SER B CA  1 
ATOM   6635  C C   . SER B 1 389 ? 30.899  94.128  34.258  1.00 20.00 ? 389  SER B C   1 
ATOM   6636  O O   . SER B 1 389 ? 31.082  95.352  34.247  1.00 20.00 ? 389  SER B O   1 
ATOM   6637  C CB  . SER B 1 389 ? 29.732  93.369  32.207  1.00 20.00 ? 389  SER B CB  1 
ATOM   6638  O OG  . SER B 1 389 ? 30.971  93.900  31.768  1.00 20.00 ? 389  SER B OG  1 
ATOM   6639  N N   . LYS B 1 390 ? 31.801  93.261  34.716  1.00 20.00 ? 390  LYS B N   1 
ATOM   6640  C CA  . LYS B 1 390 ? 33.082  93.710  35.253  1.00 20.00 ? 390  LYS B CA  1 
ATOM   6641  C C   . LYS B 1 390 ? 33.933  94.249  34.103  1.00 20.00 ? 390  LYS B C   1 
ATOM   6642  O O   . LYS B 1 390 ? 34.434  95.375  34.154  1.00 20.00 ? 390  LYS B O   1 
ATOM   6643  C CB  . LYS B 1 390 ? 33.810  92.547  35.944  1.00 20.00 ? 390  LYS B CB  1 
ATOM   6644  C CG  . LYS B 1 390 ? 34.223  92.835  37.390  1.00 20.00 ? 390  LYS B CG  1 
ATOM   6645  C CD  . LYS B 1 390 ? 34.984  91.659  38.001  1.00 20.00 ? 390  LYS B CD  1 
ATOM   6646  C CE  . LYS B 1 390 ? 35.323  91.897  39.473  1.00 20.00 ? 390  LYS B CE  1 
ATOM   6647  N NZ  . LYS B 1 390 ? 36.424  91.002  39.962  1.00 20.00 ? 390  LYS B NZ  1 
ATOM   6648  N N   . GLU B 1 391 ? 34.077  93.437  33.060  1.00 20.00 ? 391  GLU B N   1 
ATOM   6649  C CA  . GLU B 1 391 ? 34.858  93.814  31.893  1.00 20.00 ? 391  GLU B CA  1 
ATOM   6650  C C   . GLU B 1 391 ? 34.292  95.051  31.207  1.00 20.00 ? 391  GLU B C   1 
ATOM   6651  O O   . GLU B 1 391 ? 34.830  96.150  31.352  1.00 20.00 ? 391  GLU B O   1 
ATOM   6652  C CB  . GLU B 1 391 ? 34.898  92.656  30.899  1.00 20.00 ? 391  GLU B CB  1 
ATOM   6653  C CG  . GLU B 1 391 ? 33.631  91.817  30.894  1.00 20.00 ? 391  GLU B CG  1 
ATOM   6654  C CD  . GLU B 1 391 ? 33.908  90.339  30.675  1.00 20.00 ? 391  GLU B CD  1 
ATOM   6655  O OE1 . GLU B 1 391 ? 34.861  90.015  29.928  1.00 20.00 ? 391  GLU B OE1 1 
ATOM   6656  O OE2 . GLU B 1 391 ? 33.172  89.504  31.251  1.00 20.00 ? 391  GLU B OE2 1 
ATOM   6657  N N   . THR B 1 392 ? 33.207  94.867  30.460  1.00 20.00 ? 392  THR B N   1 
ATOM   6658  C CA  . THR B 1 392 ? 32.571  95.974  29.750  1.00 20.00 ? 392  THR B CA  1 
ATOM   6659  C C   . THR B 1 392 ? 32.078  97.069  30.692  1.00 20.00 ? 392  THR B C   1 
ATOM   6660  O O   . THR B 1 392 ? 31.727  98.170  30.251  1.00 20.00 ? 392  THR B O   1 
ATOM   6661  C CB  . THR B 1 392 ? 31.383  95.480  28.887  1.00 20.00 ? 392  THR B CB  1 
ATOM   6662  O OG1 . THR B 1 392 ? 31.225  96.348  27.757  1.00 20.00 ? 392  THR B OG1 1 
ATOM   6663  C CG2 . THR B 1 392 ? 30.090  95.474  29.693  1.00 20.00 ? 392  THR B CG2 1 
ATOM   6664  N N   . GLY B 1 393 ? 32.054  96.764  31.987  1.00 20.00 ? 393  GLY B N   1 
ATOM   6665  C CA  . GLY B 1 393 ? 31.602  97.736  32.964  1.00 20.00 ? 393  GLY B CA  1 
ATOM   6666  C C   . GLY B 1 393 ? 30.269  98.319  32.556  1.00 20.00 ? 393  GLY B C   1 
ATOM   6667  O O   . GLY B 1 393 ? 30.057  99.527  32.657  1.00 20.00 ? 393  GLY B O   1 
ATOM   6668  N N   . GLU B 1 394 ? 29.372  97.461  32.082  1.00 20.00 ? 394  GLU B N   1 
ATOM   6669  C CA  . GLU B 1 394 ? 28.046  97.898  31.654  1.00 20.00 ? 394  GLU B CA  1 
ATOM   6670  C C   . GLU B 1 394 ? 26.950  97.044  32.289  1.00 20.00 ? 394  GLU B C   1 
ATOM   6671  O O   . GLU B 1 394 ? 27.184  95.889  32.650  1.00 20.00 ? 394  GLU B O   1 
ATOM   6672  C CB  . GLU B 1 394 ? 27.925  97.811  30.132  1.00 20.00 ? 394  GLU B CB  1 
ATOM   6673  C CG  . GLU B 1 394 ? 28.845  98.738  29.370  1.00 20.00 ? 394  GLU B CG  1 
ATOM   6674  C CD  . GLU B 1 394 ? 28.547  98.727  27.883  1.00 20.00 ? 394  GLU B CD  1 
ATOM   6675  O OE1 . GLU B 1 394 ? 28.411  97.618  27.317  1.00 20.00 ? 394  GLU B OE1 1 
ATOM   6676  O OE2 . GLU B 1 394 ? 28.441  99.820  27.282  1.00 20.00 ? 394  GLU B OE2 1 
ATOM   6677  N N   . ASN B 1 395 ? 25.752  97.610  32.411  1.00 20.00 ? 395  ASN B N   1 
ATOM   6678  C CA  . ASN B 1 395 ? 24.620  96.899  33.003  1.00 20.00 ? 395  ASN B CA  1 
ATOM   6679  C C   . ASN B 1 395 ? 24.270  95.613  32.268  1.00 20.00 ? 395  ASN B C   1 
ATOM   6680  O O   . ASN B 1 395 ? 24.260  95.566  31.034  1.00 20.00 ? 395  ASN B O   1 
ATOM   6681  C CB  . ASN B 1 395 ? 23.378  97.795  33.024  1.00 20.00 ? 395  ASN B CB  1 
ATOM   6682  C CG  . ASN B 1 395 ? 23.530  98.973  33.951  1.00 20.00 ? 395  ASN B CG  1 
ATOM   6683  O OD1 . ASN B 1 395 ? 24.178  98.873  34.989  1.00 20.00 ? 395  ASN B OD1 1 
ATOM   6684  N ND2 . ASN B 1 395 ? 22.935  100.100 33.584  1.00 20.00 ? 395  ASN B ND2 1 
ATOM   6685  N N   . HIS B 1 396 ? 23.994  94.564  33.033  1.00 20.00 ? 396  HIS B N   1 
ATOM   6686  C CA  . HIS B 1 396 ? 23.633  93.286  32.445  1.00 20.00 ? 396  HIS B CA  1 
ATOM   6687  C C   . HIS B 1 396 ? 22.156  93.461  32.133  1.00 20.00 ? 396  HIS B C   1 
ATOM   6688  O O   . HIS B 1 396 ? 21.438  94.098  32.905  1.00 20.00 ? 396  HIS B O   1 
ATOM   6689  C CB  . HIS B 1 396 ? 23.821  92.159  33.456  1.00 20.00 ? 396  HIS B CB  1 
ATOM   6690  C CG  . HIS B 1 396 ? 25.246  91.945  33.863  1.00 20.00 ? 396  HIS B CG  1 
ATOM   6691  N ND1 . HIS B 1 396 ? 25.641  91.869  35.182  1.00 20.00 ? 396  HIS B ND1 1 
ATOM   6692  C CD2 . HIS B 1 396 ? 26.372  91.794  33.123  1.00 20.00 ? 396  HIS B CD2 1 
ATOM   6693  C CE1 . HIS B 1 396 ? 26.949  91.680  35.237  1.00 20.00 ? 396  HIS B CE1 1 
ATOM   6694  N NE2 . HIS B 1 396 ? 27.417  91.631  34.002  1.00 20.00 ? 396  HIS B NE2 1 
ATOM   6695  N N   . ARG B 1 397 ? 21.695  92.917  31.013  1.00 20.00 ? 397  ARG B N   1 
ATOM   6696  C CA  . ARG B 1 397 ? 20.285  93.051  30.650  1.00 20.00 ? 397  ARG B CA  1 
ATOM   6697  C C   . ARG B 1 397 ? 19.497  91.752  30.814  1.00 20.00 ? 397  ARG B C   1 
ATOM   6698  O O   . ARG B 1 397 ? 19.265  91.020  29.846  1.00 20.00 ? 397  ARG B O   1 
ATOM   6699  C CB  . ARG B 1 397 ? 20.158  93.564  29.208  1.00 20.00 ? 397  ARG B CB  1 
ATOM   6700  C CG  . ARG B 1 397 ? 20.817  94.928  28.963  1.00 20.00 ? 397  ARG B CG  1 
ATOM   6701  C CD  . ARG B 1 397 ? 19.784  96.044  28.830  1.00 20.00 ? 397  ARG B CD  1 
ATOM   6702  N NE  . ARG B 1 397 ? 20.109  96.994  27.764  1.00 20.00 ? 397  ARG B NE  1 
ATOM   6703  C CZ  . ARG B 1 397 ? 21.167  97.802  27.769  1.00 20.00 ? 397  ARG B CZ  1 
ATOM   6704  N NH1 . ARG B 1 397 ? 22.022  97.784  28.784  1.00 20.00 ? 397  ARG B NH1 1 
ATOM   6705  N NH2 . ARG B 1 397 ? 21.361  98.641  26.760  1.00 20.00 ? 397  ARG B NH2 1 
ATOM   6706  N N   . PRO B 1 398 ? 19.058  91.457  32.050  1.00 20.00 ? 398  PRO B N   1 
ATOM   6707  C CA  . PRO B 1 398 ? 18.404  90.177  32.330  1.00 20.00 ? 398  PRO B CA  1 
ATOM   6708  C C   . PRO B 1 398 ? 17.171  89.942  31.474  1.00 20.00 ? 398  PRO B C   1 
ATOM   6709  O O   . PRO B 1 398 ? 16.489  90.885  31.060  1.00 20.00 ? 398  PRO B O   1 
ATOM   6710  C CB  . PRO B 1 398 ? 18.058  90.260  33.816  1.00 20.00 ? 398  PRO B CB  1 
ATOM   6711  C CG  . PRO B 1 398 ? 18.085  91.713  34.141  1.00 20.00 ? 398  PRO B CG  1 
ATOM   6712  C CD  . PRO B 1 398 ? 19.137  92.304  33.253  1.00 20.00 ? 398  PRO B CD  1 
ATOM   6713  N N   . LYS B 1 399 ? 16.894  88.669  31.215  1.00 20.00 ? 399  LYS B N   1 
ATOM   6714  C CA  . LYS B 1 399 ? 15.747  88.277  30.411  1.00 20.00 ? 399  LYS B CA  1 
ATOM   6715  C C   . LYS B 1 399 ? 14.463  88.763  31.071  1.00 20.00 ? 399  LYS B C   1 
ATOM   6716  O O   . LYS B 1 399 ? 13.613  89.382  30.425  1.00 20.00 ? 399  LYS B O   1 
ATOM   6717  C CB  . LYS B 1 399 ? 15.699  86.754  30.260  1.00 20.00 ? 399  LYS B CB  1 
ATOM   6718  C CG  . LYS B 1 399 ? 16.421  86.229  29.024  1.00 20.00 ? 399  LYS B CG  1 
ATOM   6719  C CD  . LYS B 1 399 ? 15.451  85.628  28.002  1.00 20.00 ? 399  LYS B CD  1 
ATOM   6720  C CE  . LYS B 1 399 ? 16.170  85.247  26.699  1.00 20.00 ? 399  LYS B CE  1 
ATOM   6721  N NZ  . LYS B 1 399 ? 15.525  84.098  25.979  1.00 20.00 ? 399  LYS B NZ  1 
ATOM   6722  N N   . LEU B 1 400 ? 14.318  88.483  32.361  1.00 20.00 ? 400  LEU B N   1 
ATOM   6723  C CA  . LEU B 1 400 ? 13.124  88.911  33.063  1.00 20.00 ? 400  LEU B CA  1 
ATOM   6724  C C   . LEU B 1 400 ? 13.363  90.094  33.989  1.00 20.00 ? 400  LEU B C   1 
ATOM   6725  O O   . LEU B 1 400 ? 14.286  90.099  34.811  1.00 20.00 ? 400  LEU B O   1 
ATOM   6726  C CB  . LEU B 1 400 ? 12.522  87.752  33.850  1.00 20.00 ? 400  LEU B CB  1 
ATOM   6727  C CG  . LEU B 1 400 ? 13.475  86.621  34.207  1.00 20.00 ? 400  LEU B CG  1 
ATOM   6728  C CD1 . LEU B 1 400 ? 14.444  87.094  35.283  1.00 20.00 ? 400  LEU B CD1 1 
ATOM   6729  C CD2 . LEU B 1 400 ? 12.673  85.419  34.676  1.00 20.00 ? 400  LEU B CD2 1 
ATOM   6730  N N   . GLU B 1 401 ? 12.522  91.104  33.812  1.00 20.00 ? 401  GLU B N   1 
ATOM   6731  C CA  . GLU B 1 401 ? 12.561  92.326  34.587  1.00 20.00 ? 401  GLU B CA  1 
ATOM   6732  C C   . GLU B 1 401 ? 11.318  92.183  35.442  1.00 20.00 ? 401  GLU B C   1 
ATOM   6733  O O   . GLU B 1 401 ? 10.212  92.533  35.016  1.00 20.00 ? 401  GLU B O   1 
ATOM   6734  C CB  . GLU B 1 401 ? 12.429  93.534  33.664  1.00 20.00 ? 401  GLU B CB  1 
ATOM   6735  C CG  . GLU B 1 401 ? 12.458  94.860  34.387  1.00 20.00 ? 401  GLU B CG  1 
ATOM   6736  C CD  . GLU B 1 401 ? 13.861  95.280  34.749  1.00 20.00 ? 401  GLU B CD  1 
ATOM   6737  O OE1 . GLU B 1 401 ? 14.804  94.524  34.428  1.00 20.00 ? 401  GLU B OE1 1 
ATOM   6738  O OE2 . GLU B 1 401 ? 14.022  96.365  35.349  1.00 20.00 ? 401  GLU B OE2 1 
ATOM   6739  N N   . THR B 1 402 ? 11.500  91.659  36.647  1.00 20.00 ? 402  THR B N   1 
ATOM   6740  C CA  . THR B 1 402 ? 10.385  91.456  37.559  1.00 20.00 ? 402  THR B CA  1 
ATOM   6741  C C   . THR B 1 402 ? 10.502  92.057  38.953  1.00 20.00 ? 402  THR B C   1 
ATOM   6742  O O   . THR B 1 402 ? 11.580  92.429  39.403  1.00 20.00 ? 402  THR B O   1 
ATOM   6743  C CB  . THR B 1 402 ? 10.137  89.962  37.752  1.00 20.00 ? 402  THR B CB  1 
ATOM   6744  O OG1 . THR B 1 402 ? 11.156  89.423  38.599  1.00 20.00 ? 402  THR B OG1 1 
ATOM   6745  C CG2 . THR B 1 402 ? 10.177  89.249  36.435  1.00 20.00 ? 402  THR B CG2 1 
ATOM   6746  N N   . VAL B 1 403 ? 9.354   92.150  39.617  1.00 20.00 ? 403  VAL B N   1 
ATOM   6747  C CA  . VAL B 1 403 ? 9.246   92.677  40.971  1.00 20.00 ? 403  VAL B CA  1 
ATOM   6748  C C   . VAL B 1 403 ? 8.679   91.477  41.732  1.00 20.00 ? 403  VAL B C   1 
ATOM   6749  O O   . VAL B 1 403 ? 7.606   90.969  41.402  1.00 20.00 ? 403  VAL B O   1 
ATOM   6750  C CB  . VAL B 1 403 ? 8.264   93.859  41.062  1.00 20.00 ? 403  VAL B CB  1 
ATOM   6751  C CG1 . VAL B 1 403 ? 7.933   94.139  42.521  1.00 20.00 ? 403  VAL B CG1 1 
ATOM   6752  C CG2 . VAL B 1 403 ? 8.877   95.106  40.414  1.00 20.00 ? 403  VAL B CG2 1 
ATOM   6753  N N   . ARG B 1 404 ? 9.407   91.014  42.739  1.00 20.00 ? 404  ARG B N   1 
ATOM   6754  C CA  . ARG B 1 404 ? 8.973   89.868  43.523  1.00 20.00 ? 404  ARG B CA  1 
ATOM   6755  C C   . ARG B 1 404 ? 8.172   90.203  44.771  1.00 20.00 ? 404  ARG B C   1 
ATOM   6756  O O   . ARG B 1 404 ? 8.572   91.035  45.576  1.00 20.00 ? 404  ARG B O   1 
ATOM   6757  C CB  . ARG B 1 404 ? 10.194  89.030  43.909  1.00 20.00 ? 404  ARG B CB  1 
ATOM   6758  C CG  . ARG B 1 404 ? 9.866   87.677  44.486  1.00 20.00 ? 404  ARG B CG  1 
ATOM   6759  C CD  . ARG B 1 404 ? 11.142  86.970  44.901  1.00 20.00 ? 404  ARG B CD  1 
ATOM   6760  N NE  . ARG B 1 404 ? 11.586  87.390  46.227  1.00 20.00 ? 404  ARG B NE  1 
ATOM   6761  C CZ  . ARG B 1 404 ? 12.767  87.083  46.752  1.00 20.00 ? 404  ARG B CZ  1 
ATOM   6762  N NH1 . ARG B 1 404 ? 13.629  86.349  46.062  1.00 20.00 ? 404  ARG B NH1 1 
ATOM   6763  N NH2 . ARG B 1 404 ? 13.085  87.508  47.966  1.00 20.00 ? 404  ARG B NH2 1 
ATOM   6764  N N   . LEU B 1 405 ? 7.034   89.535  44.909  1.00 20.00 ? 405  LEU B N   1 
ATOM   6765  C CA  . LEU B 1 405 ? 6.132   89.710  46.041  1.00 20.00 ? 405  LEU B CA  1 
ATOM   6766  C C   . LEU B 1 405 ? 6.219   88.364  46.755  1.00 20.00 ? 405  LEU B C   1 
ATOM   6767  O O   . LEU B 1 405 ? 5.467   87.435  46.453  1.00 20.00 ? 405  LEU B O   1 
ATOM   6768  C CB  . LEU B 1 405 ? 4.698   89.970  45.552  1.00 20.00 ? 405  LEU B CB  1 
ATOM   6769  C CG  . LEU B 1 405 ? 4.422   91.186  44.647  1.00 20.00 ? 405  LEU B CG  1 
ATOM   6770  C CD1 . LEU B 1 405 ? 3.133   90.962  43.871  1.00 20.00 ? 405  LEU B CD1 1 
ATOM   6771  C CD2 . LEU B 1 405 ? 4.303   92.459  45.477  1.00 20.00 ? 405  LEU B CD2 1 
ATOM   6772  N N   . THR B 1 406 ? 7.163   88.270  47.688  1.00 20.00 ? 406  THR B N   1 
ATOM   6773  C CA  . THR B 1 406 ? 7.410   87.063  48.469  1.00 20.00 ? 406  THR B CA  1 
ATOM   6774  C C   . THR B 1 406 ? 6.600   87.038  49.760  1.00 20.00 ? 406  THR B C   1 
ATOM   6775  O O   . THR B 1 406 ? 6.609   88.000  50.527  1.00 20.00 ? 406  THR B O   1 
ATOM   6776  C CB  . THR B 1 406 ? 8.909   86.979  48.781  1.00 20.00 ? 406  THR B CB  1 
ATOM   6777  O OG1 . THR B 1 406 ? 9.597   87.973  48.006  1.00 20.00 ? 406  THR B OG1 1 
ATOM   6778  C CG2 . THR B 1 406 ? 9.456   85.610  48.430  1.00 20.00 ? 406  THR B CG2 1 
ATOM   6779  N N   . ILE B 1 407 ? 5.911   85.925  50.005  1.00 20.00 ? 407  ILE B N   1 
ATOM   6780  C CA  . ILE B 1 407 ? 5.086   85.790  51.207  1.00 20.00 ? 407  ILE B CA  1 
ATOM   6781  C C   . ILE B 1 407 ? 5.685   84.965  52.341  1.00 20.00 ? 407  ILE B C   1 
ATOM   6782  O O   . ILE B 1 407 ? 5.911   83.763  52.198  1.00 20.00 ? 407  ILE B O   1 
ATOM   6783  C CB  . ILE B 1 407 ? 3.701   85.188  50.861  1.00 20.00 ? 407  ILE B CB  1 
ATOM   6784  C CG1 . ILE B 1 407 ? 3.286   85.588  49.446  1.00 20.00 ? 407  ILE B CG1 1 
ATOM   6785  C CG2 . ILE B 1 407 ? 2.666   85.664  51.865  1.00 20.00 ? 407  ILE B CG2 1 
ATOM   6786  C CD1 . ILE B 1 407 ? 2.939   87.051  49.297  1.00 20.00 ? 407  ILE B CD1 1 
ATOM   6787  N N   . PRO B 1 408 ? 5.930   85.602  53.498  1.00 20.00 ? 408  PRO B N   1 
ATOM   6788  C CA  . PRO B 1 408 ? 6.264   84.883  54.730  1.00 20.00 ? 408  PRO B CA  1 
ATOM   6789  C C   . PRO B 1 408 ? 5.151   83.928  55.144  1.00 20.00 ? 408  PRO B C   1 
ATOM   6790  O O   . PRO B 1 408 ? 3.974   84.180  54.887  1.00 20.00 ? 408  PRO B O   1 
ATOM   6791  C CB  . PRO B 1 408 ? 6.473   85.998  55.755  1.00 20.00 ? 408  PRO B CB  1 
ATOM   6792  C CG  . PRO B 1 408 ? 6.775   87.203  54.945  1.00 20.00 ? 408  PRO B CG  1 
ATOM   6793  C CD  . PRO B 1 408 ? 5.912   87.057  53.716  1.00 20.00 ? 408  PRO B CD  1 
ATOM   6794  N N   . ARG B 1 409 ? 5.538   82.832  55.787  1.00 20.00 ? 409  ARG B N   1 
ATOM   6795  C CA  . ARG B 1 409 ? 4.598   81.823  56.246  1.00 20.00 ? 409  ARG B CA  1 
ATOM   6796  C C   . ARG B 1 409 ? 3.900   82.188  57.556  1.00 20.00 ? 409  ARG B C   1 
ATOM   6797  O O   . ARG B 1 409 ? 4.557   82.539  58.532  1.00 20.00 ? 409  ARG B O   1 
ATOM   6798  C CB  . ARG B 1 409 ? 5.330   80.495  56.440  1.00 20.00 ? 409  ARG B CB  1 
ATOM   6799  C CG  . ARG B 1 409 ? 5.851   79.880  55.159  1.00 20.00 ? 409  ARG B CG  1 
ATOM   6800  C CD  . ARG B 1 409 ? 7.108   79.052  55.392  1.00 20.00 ? 409  ARG B CD  1 
ATOM   6801  N NE  . ARG B 1 409 ? 7.797   78.806  54.127  1.00 20.00 ? 409  ARG B NE  1 
ATOM   6802  C CZ  . ARG B 1 409 ? 8.685   79.635  53.591  1.00 20.00 ? 409  ARG B CZ  1 
ATOM   6803  N NH1 . ARG B 1 409 ? 8.990   80.761  54.218  1.00 20.00 ? 409  ARG B NH1 1 
ATOM   6804  N NH2 . ARG B 1 409 ? 9.262   79.346  52.430  1.00 20.00 ? 409  ARG B NH2 1 
ATOM   6805  N N   . ARG B 1 410 ? 2.572   82.093  57.559  1.00 20.00 ? 410  ARG B N   1 
ATOM   6806  C CA  . ARG B 1 410 ? 1.739   82.390  58.729  1.00 20.00 ? 410  ARG B CA  1 
ATOM   6807  C C   . ARG B 1 410 ? 1.810   83.796  59.285  1.00 20.00 ? 410  ARG B C   1 
ATOM   6808  O O   . ARG B 1 410 ? 1.544   83.997  60.469  1.00 20.00 ? 410  ARG B O   1 
ATOM   6809  C CB  . ARG B 1 410 ? 2.070   81.410  59.861  1.00 20.00 ? 410  ARG B CB  1 
ATOM   6810  C CG  . ARG B 1 410 ? 2.063   79.961  59.435  1.00 20.00 ? 410  ARG B CG  1 
ATOM   6811  C CD  . ARG B 1 410 ? 2.043   79.019  60.620  1.00 20.00 ? 410  ARG B CD  1 
ATOM   6812  N NE  . ARG B 1 410 ? 3.274   79.066  61.403  1.00 20.00 ? 410  ARG B NE  1 
ATOM   6813  C CZ  . ARG B 1 410 ? 3.717   78.066  62.161  1.00 20.00 ? 410  ARG B CZ  1 
ATOM   6814  N NH1 . ARG B 1 410 ? 3.028   76.938  62.240  1.00 20.00 ? 410  ARG B NH1 1 
ATOM   6815  N NH2 . ARG B 1 410 ? 4.851   78.190  62.837  1.00 20.00 ? 410  ARG B NH2 1 
ATOM   6816  N N   . VAL B 1 411 ? 2.141   84.768  58.441  1.00 20.00 ? 411  VAL B N   1 
ATOM   6817  C CA  . VAL B 1 411 ? 2.246   86.154  58.881  1.00 20.00 ? 411  VAL B CA  1 
ATOM   6818  C C   . VAL B 1 411 ? 1.114   87.093  58.458  1.00 20.00 ? 411  VAL B C   1 
ATOM   6819  O O   . VAL B 1 411 ? 0.713   87.969  59.231  1.00 20.00 ? 411  VAL B O   1 
ATOM   6820  C CB  . VAL B 1 411 ? 3.577   86.769  58.390  1.00 20.00 ? 411  VAL B CB  1 
ATOM   6821  C CG1 . VAL B 1 411 ? 3.700   88.206  58.874  1.00 20.00 ? 411  VAL B CG1 1 
ATOM   6822  C CG2 . VAL B 1 411 ? 4.742   85.952  58.895  1.00 20.00 ? 411  VAL B CG2 1 
ATOM   6823  N N   . TYR B 1 412 ? 0.605   86.918  57.239  1.00 20.00 ? 412  TYR B N   1 
ATOM   6824  C CA  . TYR B 1 412 ? -0.471  87.771  56.735  1.00 20.00 ? 412  TYR B CA  1 
ATOM   6825  C C   . TYR B 1 412 ? -1.766  87.040  56.439  1.00 20.00 ? 412  TYR B C   1 
ATOM   6826  O O   . TYR B 1 412 ? -1.798  85.814  56.422  1.00 20.00 ? 412  TYR B O   1 
ATOM   6827  C CB  . TYR B 1 412 ? -0.002  88.487  55.469  1.00 20.00 ? 412  TYR B CB  1 
ATOM   6828  C CG  . TYR B 1 412 ? 1.235   89.317  55.684  1.00 20.00 ? 412  TYR B CG  1 
ATOM   6829  C CD1 . TYR B 1 412 ? 1.155   90.582  56.260  1.00 20.00 ? 412  TYR B CD1 1 
ATOM   6830  C CD2 . TYR B 1 412 ? 2.493   88.831  55.331  1.00 20.00 ? 412  TYR B CD2 1 
ATOM   6831  C CE1 . TYR B 1 412 ? 2.298   91.346  56.483  1.00 20.00 ? 412  TYR B CE1 1 
ATOM   6832  C CE2 . TYR B 1 412 ? 3.636   89.584  55.549  1.00 20.00 ? 412  TYR B CE2 1 
ATOM   6833  C CZ  . TYR B 1 412 ? 3.533   90.836  56.125  1.00 20.00 ? 412  TYR B CZ  1 
ATOM   6834  O OH  . TYR B 1 412 ? 4.673   91.571  56.353  1.00 20.00 ? 412  TYR B OH  1 
ATOM   6835  N N   . THR B 1 413 ? -2.819  87.821  56.194  1.00 20.00 ? 413  THR B N   1 
ATOM   6836  C CA  . THR B 1 413 ? -4.160  87.318  55.888  1.00 20.00 ? 413  THR B CA  1 
ATOM   6837  C C   . THR B 1 413 ? -4.579  87.635  54.447  1.00 20.00 ? 413  THR B C   1 
ATOM   6838  O O   . THR B 1 413 ? -3.884  88.371  53.745  1.00 20.00 ? 413  THR B O   1 
ATOM   6839  C CB  . THR B 1 413 ? -5.198  87.978  56.786  1.00 20.00 ? 413  THR B CB  1 
ATOM   6840  O OG1 . THR B 1 413 ? -5.358  89.343  56.372  1.00 20.00 ? 413  THR B OG1 1 
ATOM   6841  C CG2 . THR B 1 413 ? -4.757  87.937  58.242  1.00 20.00 ? 413  THR B CG2 1 
ATOM   6842  N N   . TYR B 1 414 ? -5.718  87.093  54.010  1.00 20.00 ? 414  TYR B N   1 
ATOM   6843  C CA  . TYR B 1 414 ? -6.210  87.343  52.647  1.00 20.00 ? 414  TYR B CA  1 
ATOM   6844  C C   . TYR B 1 414 ? -6.591  88.815  52.540  1.00 20.00 ? 414  TYR B C   1 
ATOM   6845  O O   . TYR B 1 414 ? -6.646  89.371  51.450  1.00 20.00 ? 414  TYR B O   1 
ATOM   6846  C CB  . TYR B 1 414 ? -7.454  86.513  52.334  1.00 20.00 ? 414  TYR B CB  1 
ATOM   6847  C CG  . TYR B 1 414 ? -7.219  85.041  52.135  1.00 20.00 ? 414  TYR B CG  1 
ATOM   6848  C CD1 . TYR B 1 414 ? -6.402  84.576  51.105  1.00 20.00 ? 414  TYR B CD1 1 
ATOM   6849  C CD2 . TYR B 1 414 ? -7.849  84.105  52.955  1.00 20.00 ? 414  TYR B CD2 1 
ATOM   6850  C CE1 . TYR B 1 414 ? -6.218  83.201  50.891  1.00 20.00 ? 414  TYR B CE1 1 
ATOM   6851  C CE2 . TYR B 1 414 ? -7.674  82.736  52.753  1.00 20.00 ? 414  TYR B CE2 1 
ATOM   6852  C CZ  . TYR B 1 414 ? -6.857  82.295  51.716  1.00 20.00 ? 414  TYR B CZ  1 
ATOM   6853  O OH  . TYR B 1 414 ? -6.688  80.949  51.509  1.00 20.00 ? 414  TYR B OH  1 
ATOM   6854  N N   . ALA B 1 415 ? -6.875  89.436  53.680  1.00 20.00 ? 415  ALA B N   1 
ATOM   6855  C CA  . ALA B 1 415 ? -7.247  90.845  53.694  1.00 20.00 ? 415  ALA B CA  1 
ATOM   6856  C C   . ALA B 1 415 ? -5.993  91.628  53.378  1.00 20.00 ? 415  ALA B C   1 
ATOM   6857  O O   . ALA B 1 415 ? -6.046  92.712  52.795  1.00 20.00 ? 415  ALA B O   1 
ATOM   6858  C CB  . ALA B 1 415 ? -7.774  91.243  55.058  1.00 20.00 ? 415  ALA B CB  1 
ATOM   6859  N N   . HIS B 1 416 ? -4.856  91.071  53.778  1.00 20.00 ? 416  HIS B N   1 
ATOM   6860  C CA  . HIS B 1 416 ? -3.586  91.720  53.531  1.00 20.00 ? 416  HIS B CA  1 
ATOM   6861  C C   . HIS B 1 416 ? -3.284  91.555  52.052  1.00 20.00 ? 416  HIS B C   1 
ATOM   6862  O O   . HIS B 1 416 ? -2.810  92.484  51.404  1.00 20.00 ? 416  HIS B O   1 
ATOM   6863  C CB  . HIS B 1 416 ? -2.493  91.094  54.401  1.00 20.00 ? 416  HIS B CB  1 
ATOM   6864  C CG  . HIS B 1 416 ? -2.509  91.587  55.817  1.00 20.00 ? 416  HIS B CG  1 
ATOM   6865  N ND1 . HIS B 1 416 ? -2.390  90.745  56.902  1.00 20.00 ? 416  HIS B ND1 1 
ATOM   6866  C CD2 . HIS B 1 416 ? -2.696  92.830  56.323  1.00 20.00 ? 416  HIS B CD2 1 
ATOM   6867  C CE1 . HIS B 1 416 ? -2.508  91.448  58.015  1.00 20.00 ? 416  HIS B CE1 1 
ATOM   6868  N NE2 . HIS B 1 416 ? -2.695  92.716  57.690  1.00 20.00 ? 416  HIS B NE2 1 
ATOM   6869  N N   . MET B 1 417 ? -3.589  90.376  51.518  1.00 20.00 ? 417  MET B N   1 
ATOM   6870  C CA  . MET B 1 417 ? -3.353  90.094  50.111  1.00 20.00 ? 417  MET B CA  1 
ATOM   6871  C C   . MET B 1 417 ? -4.205  91.026  49.247  1.00 20.00 ? 417  MET B C   1 
ATOM   6872  O O   . MET B 1 417 ? -3.770  91.457  48.183  1.00 20.00 ? 417  MET B O   1 
ATOM   6873  C CB  . MET B 1 417 ? -3.687  88.638  49.797  1.00 20.00 ? 417  MET B CB  1 
ATOM   6874  C CG  . MET B 1 417 ? -2.759  87.621  50.462  1.00 20.00 ? 417  MET B CG  1 
ATOM   6875  S SD  . MET B 1 417 ? -1.038  87.889  50.037  1.00 20.00 ? 417  MET B SD  1 
ATOM   6876  C CE  . MET B 1 417 ? -0.417  88.643  51.543  1.00 20.00 ? 417  MET B CE  1 
ATOM   6877  N N   . ASP B 1 418 ? -5.415  91.337  49.710  1.00 20.00 ? 418  ASP B N   1 
ATOM   6878  C CA  . ASP B 1 418 ? -6.308  92.223  48.967  1.00 20.00 ? 418  ASP B CA  1 
ATOM   6879  C C   . ASP B 1 418 ? -5.718  93.629  48.944  1.00 20.00 ? 418  ASP B C   1 
ATOM   6880  O O   . ASP B 1 418 ? -5.870  94.356  47.963  1.00 20.00 ? 418  ASP B O   1 
ATOM   6881  C CB  . ASP B 1 418 ? -7.697  92.252  49.607  1.00 20.00 ? 418  ASP B CB  1 
ATOM   6882  C CG  . ASP B 1 418 ? -8.488  90.985  49.345  1.00 20.00 ? 418  ASP B CG  1 
ATOM   6883  O OD1 . ASP B 1 418 ? -8.240  90.322  48.317  1.00 20.00 ? 418  ASP B OD1 1 
ATOM   6884  O OD2 . ASP B 1 418 ? -9.359  90.647  50.172  1.00 20.00 ? 418  ASP B OD2 1 
ATOM   6885  N N   . VAL B 1 419 ? -5.044  94.015  50.025  1.00 20.00 ? 419  VAL B N   1 
ATOM   6886  C CA  . VAL B 1 419 ? -4.434  95.342  50.093  1.00 20.00 ? 419  VAL B CA  1 
ATOM   6887  C C   . VAL B 1 419 ? -3.331  95.488  49.038  1.00 20.00 ? 419  VAL B C   1 
ATOM   6888  O O   . VAL B 1 419 ? -3.233  96.525  48.374  1.00 20.00 ? 419  VAL B O   1 
ATOM   6889  C CB  . VAL B 1 419 ? -3.795  95.619  51.464  1.00 20.00 ? 419  VAL B CB  1 
ATOM   6890  C CG1 . VAL B 1 419 ? -2.858  96.813  51.362  1.00 20.00 ? 419  VAL B CG1 1 
ATOM   6891  C CG2 . VAL B 1 419 ? -4.867  95.896  52.492  1.00 20.00 ? 419  VAL B CG2 1 
ATOM   6892  N N   . VAL B 1 420 ? -2.488  94.469  48.890  1.00 20.00 ? 420  VAL B N   1 
ATOM   6893  C CA  . VAL B 1 420 ? -1.427  94.574  47.894  1.00 20.00 ? 420  VAL B CA  1 
ATOM   6894  C C   . VAL B 1 420 ? -1.978  94.373  46.487  1.00 20.00 ? 420  VAL B C   1 
ATOM   6895  O O   . VAL B 1 420 ? -1.502  94.996  45.547  1.00 20.00 ? 420  VAL B O   1 
ATOM   6896  C CB  . VAL B 1 420 ? -0.245  93.582  48.171  1.00 20.00 ? 420  VAL B CB  1 
ATOM   6897  C CG1 . VAL B 1 420 ? -0.587  92.663  49.312  1.00 20.00 ? 420  VAL B CG1 1 
ATOM   6898  C CG2 . VAL B 1 420 ? 0.114   92.791  46.917  1.00 20.00 ? 420  VAL B CG2 1 
ATOM   6899  N N   . ALA B 1 421 ? -2.990  93.522  46.346  1.00 20.00 ? 421  ALA B N   1 
ATOM   6900  C CA  . ALA B 1 421 ? -3.587  93.261  45.039  1.00 20.00 ? 421  ALA B CA  1 
ATOM   6901  C C   . ALA B 1 421 ? -4.359  94.456  44.502  1.00 20.00 ? 421  ALA B C   1 
ATOM   6902  O O   . ALA B 1 421 ? -4.185  94.845  43.354  1.00 20.00 ? 421  ALA B O   1 
ATOM   6903  C CB  . ALA B 1 421 ? -4.503  92.040  45.106  1.00 20.00 ? 421  ALA B CB  1 
ATOM   6904  N N   . ASP B 1 422 ? -5.213  95.047  45.326  1.00 20.00 ? 422  ASP B N   1 
ATOM   6905  C CA  . ASP B 1 422 ? -5.986  96.197  44.877  1.00 20.00 ? 422  ASP B CA  1 
ATOM   6906  C C   . ASP B 1 422 ? -5.097  97.403  44.559  1.00 20.00 ? 422  ASP B C   1 
ATOM   6907  O O   . ASP B 1 422 ? -5.429  98.216  43.699  1.00 20.00 ? 422  ASP B O   1 
ATOM   6908  C CB  . ASP B 1 422 ? -7.032  96.580  45.932  1.00 20.00 ? 422  ASP B CB  1 
ATOM   6909  C CG  . ASP B 1 422 ? -8.140  95.526  46.082  1.00 20.00 ? 422  ASP B CG  1 
ATOM   6910  O OD1 . ASP B 1 422 ? -8.308  94.664  45.183  1.00 20.00 ? 422  ASP B OD1 1 
ATOM   6911  O OD2 . ASP B 1 422 ? -8.852  95.561  47.111  1.00 20.00 ? 422  ASP B OD2 1 
ATOM   6912  N N   . GLY B 1 423 ? -3.971  97.518  45.256  1.00 20.00 ? 423  GLY B N   1 
ATOM   6913  C CA  . GLY B 1 423 ? -3.062  98.626  45.027  1.00 20.00 ? 423  GLY B CA  1 
ATOM   6914  C C   . GLY B 1 423 ? -2.263  98.488  43.740  1.00 20.00 ? 423  GLY B C   1 
ATOM   6915  O O   . GLY B 1 423 ? -1.967  99.485  43.079  1.00 20.00 ? 423  GLY B O   1 
ATOM   6916  N N   . ILE B 1 424 ? -1.905  97.257  43.383  1.00 20.00 ? 424  ILE B N   1 
ATOM   6917  C CA  . ILE B 1 424 ? -1.141  97.009  42.165  1.00 20.00 ? 424  ILE B CA  1 
ATOM   6918  C C   . ILE B 1 424 ? -2.063  97.094  40.950  1.00 20.00 ? 424  ILE B C   1 
ATOM   6919  O O   . ILE B 1 424 ? -1.657  97.533  39.882  1.00 20.00 ? 424  ILE B O   1 
ATOM   6920  C CB  . ILE B 1 424 ? -0.484  95.622  42.193  1.00 20.00 ? 424  ILE B CB  1 
ATOM   6921  C CG1 . ILE B 1 424 ? 0.599   95.583  43.268  1.00 20.00 ? 424  ILE B CG1 1 
ATOM   6922  C CG2 . ILE B 1 424 ? 0.130   95.310  40.843  1.00 20.00 ? 424  ILE B CG2 1 
ATOM   6923  C CD1 . ILE B 1 424 ? 1.053   94.176  43.593  1.00 20.00 ? 424  ILE B CD1 1 
ATOM   6924  N N   . ILE B 1 425 ? -3.304  96.655  41.112  1.00 20.00 ? 425  ILE B N   1 
ATOM   6925  C CA  . ILE B 1 425 ? -4.267  96.698  40.019  1.00 20.00 ? 425  ILE B CA  1 
ATOM   6926  C C   . ILE B 1 425 ? -4.549  98.168  39.702  1.00 20.00 ? 425  ILE B C   1 
ATOM   6927  O O   . ILE B 1 425 ? -4.651  98.555  38.543  1.00 20.00 ? 425  ILE B O   1 
ATOM   6928  C CB  . ILE B 1 425 ? -5.579  95.980  40.409  1.00 20.00 ? 425  ILE B CB  1 
ATOM   6929  C CG1 . ILE B 1 425 ? -5.388  94.468  40.299  1.00 20.00 ? 425  ILE B CG1 1 
ATOM   6930  C CG2 . ILE B 1 425 ? -6.713  96.413  39.499  1.00 20.00 ? 425  ILE B CG2 1 
ATOM   6931  C CD1 . ILE B 1 425 ? -6.403  93.679  41.085  1.00 20.00 ? 425  ILE B CD1 1 
ATOM   6932  N N   . LYS B 1 426 ? -4.667  98.987  40.740  1.00 20.00 ? 426  LYS B N   1 
ATOM   6933  C CA  . LYS B 1 426 ? -4.929  100.402 40.554  1.00 20.00 ? 426  LYS B CA  1 
ATOM   6934  C C   . LYS B 1 426 ? -3.725  101.044 39.879  1.00 20.00 ? 426  LYS B C   1 
ATOM   6935  O O   . LYS B 1 426 ? -3.874  101.939 39.049  1.00 20.00 ? 426  LYS B O   1 
ATOM   6936  C CB  . LYS B 1 426 ? -5.184  101.079 41.897  1.00 20.00 ? 426  LYS B CB  1 
ATOM   6937  C CG  . LYS B 1 426 ? -5.557  102.545 41.779  1.00 20.00 ? 426  LYS B CG  1 
ATOM   6938  C CD  . LYS B 1 426 ? -4.889  103.386 42.863  1.00 20.00 ? 426  LYS B CD  1 
ATOM   6939  C CE  . LYS B 1 426 ? -4.289  104.680 42.299  1.00 20.00 ? 426  LYS B CE  1 
ATOM   6940  N NZ  . LYS B 1 426 ? -2.824  104.572 42.018  1.00 20.00 ? 426  LYS B NZ  1 
ATOM   6941  N N   . LEU B 1 427 ? -2.530  100.589 40.242  1.00 20.00 ? 427  LEU B N   1 
ATOM   6942  C CA  . LEU B 1 427 ? -1.309  101.127 39.659  1.00 20.00 ? 427  LEU B CA  1 
ATOM   6943  C C   . LEU B 1 427 ? -1.248  100.753 38.178  1.00 20.00 ? 427  LEU B C   1 
ATOM   6944  O O   . LEU B 1 427 ? -0.847  101.554 37.336  1.00 20.00 ? 427  LEU B O   1 
ATOM   6945  C CB  . LEU B 1 427 ? -0.079  100.567 40.387  1.00 20.00 ? 427  LEU B CB  1 
ATOM   6946  C CG  . LEU B 1 427 ? 0.547   101.449 41.474  1.00 20.00 ? 427  LEU B CG  1 
ATOM   6947  C CD1 . LEU B 1 427 ? 1.628   100.684 42.201  1.00 20.00 ? 427  LEU B CD1 1 
ATOM   6948  C CD2 . LEU B 1 427 ? 1.142   102.696 40.844  1.00 20.00 ? 427  LEU B CD2 1 
ATOM   6949  N N   . TYR B 1 428 ? -1.657  99.529  37.869  1.00 20.00 ? 428  TYR B N   1 
ATOM   6950  C CA  . TYR B 1 428 ? -1.650  99.041  36.497  1.00 20.00 ? 428  TYR B CA  1 
ATOM   6951  C C   . TYR B 1 428 ? -2.574  99.847  35.595  1.00 20.00 ? 428  TYR B C   1 
ATOM   6952  O O   . TYR B 1 428 ? -2.250  100.112 34.435  1.00 20.00 ? 428  TYR B O   1 
ATOM   6953  C CB  . TYR B 1 428 ? -2.062  97.571  36.461  1.00 20.00 ? 428  TYR B CB  1 
ATOM   6954  C CG  . TYR B 1 428 ? -1.943  96.953  35.093  1.00 20.00 ? 428  TYR B CG  1 
ATOM   6955  C CD1 . TYR B 1 428 ? -0.714  96.887  34.441  1.00 20.00 ? 428  TYR B CD1 1 
ATOM   6956  C CD2 . TYR B 1 428 ? -3.058  96.420  34.453  1.00 20.00 ? 428  TYR B CD2 1 
ATOM   6957  C CE1 . TYR B 1 428 ? -0.593  96.300  33.184  1.00 20.00 ? 428  TYR B CE1 1 
ATOM   6958  C CE2 . TYR B 1 428 ? -2.951  95.831  33.197  1.00 20.00 ? 428  TYR B CE2 1 
ATOM   6959  C CZ  . TYR B 1 428 ? -1.717  95.774  32.571  1.00 20.00 ? 428  TYR B CZ  1 
ATOM   6960  O OH  . TYR B 1 428 ? -1.613  95.183  31.339  1.00 20.00 ? 428  TYR B OH  1 
ATOM   6961  N N   . GLN B 1 429 ? -3.723  100.242 36.130  1.00 20.00 ? 429  GLN B N   1 
ATOM   6962  C CA  . GLN B 1 429 ? -4.676  101.012 35.358  1.00 20.00 ? 429  GLN B CA  1 
ATOM   6963  C C   . GLN B 1 429 ? -4.107  102.360 34.968  1.00 20.00 ? 429  GLN B C   1 
ATOM   6964  O O   . GLN B 1 429 ? -4.586  102.978 34.028  1.00 20.00 ? 429  GLN B O   1 
ATOM   6965  C CB  . GLN B 1 429 ? -5.973  101.191 36.138  1.00 20.00 ? 429  GLN B CB  1 
ATOM   6966  C CG  . GLN B 1 429 ? -7.000  100.141 35.799  1.00 20.00 ? 429  GLN B CG  1 
ATOM   6967  C CD  . GLN B 1 429 ? -7.768  99.676  37.012  1.00 20.00 ? 429  GLN B CD  1 
ATOM   6968  O OE1 . GLN B 1 429 ? -7.868  100.397 38.009  1.00 20.00 ? 429  GLN B OE1 1 
ATOM   6969  N NE2 . GLN B 1 429 ? -8.320  98.468  36.940  1.00 20.00 ? 429  GLN B NE2 1 
ATOM   6970  N N   . HIS B 1 430 ? -3.088  102.814 35.689  1.00 20.00 ? 430  HIS B N   1 
ATOM   6971  C CA  . HIS B 1 430 ? -2.450  104.100 35.403  1.00 20.00 ? 430  HIS B CA  1 
ATOM   6972  C C   . HIS B 1 430 ? -0.939  103.903 35.293  1.00 20.00 ? 430  HIS B C   1 
ATOM   6973  O O   . HIS B 1 430 ? -0.163  104.780 35.680  1.00 20.00 ? 430  HIS B O   1 
ATOM   6974  C CB  . HIS B 1 430 ? -2.745  105.119 36.510  1.00 20.00 ? 430  HIS B CB  1 
ATOM   6975  C CG  . HIS B 1 430 ? -4.204  105.364 36.732  1.00 20.00 ? 430  HIS B CG  1 
ATOM   6976  N ND1 . HIS B 1 430 ? -4.862  104.954 37.873  1.00 20.00 ? 430  HIS B ND1 1 
ATOM   6977  C CD2 . HIS B 1 430 ? -5.140  105.958 35.952  1.00 20.00 ? 430  HIS B CD2 1 
ATOM   6978  C CE1 . HIS B 1 430 ? -6.139  105.283 37.785  1.00 20.00 ? 430  HIS B CE1 1 
ATOM   6979  N NE2 . HIS B 1 430 ? -6.335  105.893 36.629  1.00 20.00 ? 430  HIS B NE2 1 
ATOM   6980  N N   . LYS B 1 431 ? -0.532  102.748 34.766  1.00 20.00 ? 431  LYS B N   1 
ATOM   6981  C CA  . LYS B 1 431 ? 0.882   102.415 34.600  1.00 20.00 ? 431  LYS B CA  1 
ATOM   6982  C C   . LYS B 1 431 ? 1.679   103.502 33.896  1.00 20.00 ? 431  LYS B C   1 
ATOM   6983  O O   . LYS B 1 431 ? 2.804   103.800 34.284  1.00 20.00 ? 431  LYS B O   1 
ATOM   6984  C CB  . LYS B 1 431 ? 1.031   101.101 33.830  1.00 20.00 ? 431  LYS B CB  1 
ATOM   6985  C CG  . LYS B 1 431 ? 0.250   101.046 32.532  1.00 20.00 ? 431  LYS B CG  1 
ATOM   6986  C CD  . LYS B 1 431 ? 0.414   99.698  31.847  1.00 20.00 ? 431  LYS B CD  1 
ATOM   6987  C CE  . LYS B 1 431 ? -0.448  99.597  30.595  1.00 20.00 ? 431  LYS B CE  1 
ATOM   6988  N NZ  . LYS B 1 431 ? -0.400  100.843 29.777  1.00 20.00 ? 431  LYS B NZ  1 
ATOM   6989  N N   . GLU B 1 432 ? 1.100   104.096 32.861  1.00 20.00 ? 432  GLU B N   1 
ATOM   6990  C CA  . GLU B 1 432 ? 1.778   105.149 32.118  1.00 20.00 ? 432  GLU B CA  1 
ATOM   6991  C C   . GLU B 1 432 ? 2.305   106.228 33.059  1.00 20.00 ? 432  GLU B C   1 
ATOM   6992  O O   . GLU B 1 432 ? 3.213   106.980 32.705  1.00 20.00 ? 432  GLU B O   1 
ATOM   6993  C CB  . GLU B 1 432 ? 0.826   105.782 31.093  1.00 20.00 ? 432  GLU B CB  1 
ATOM   6994  C CG  . GLU B 1 432 ? -0.441  104.980 30.813  1.00 20.00 ? 432  GLU B CG  1 
ATOM   6995  C CD  . GLU B 1 432 ? -1.627  105.454 31.639  1.00 20.00 ? 432  GLU B CD  1 
ATOM   6996  O OE1 . GLU B 1 432 ? -1.605  106.618 32.104  1.00 20.00 ? 432  GLU B OE1 1 
ATOM   6997  O OE2 . GLU B 1 432 ? -2.580  104.662 31.822  1.00 20.00 ? 432  GLU B OE2 1 
ATOM   6998  N N   . ASP B 1 433 ? 1.747   106.297 34.263  1.00 20.00 ? 433  ASP B N   1 
ATOM   6999  C CA  . ASP B 1 433 ? 2.179   107.299 35.236  1.00 20.00 ? 433  ASP B CA  1 
ATOM   7000  C C   . ASP B 1 433 ? 3.497   106.956 35.932  1.00 20.00 ? 433  ASP B C   1 
ATOM   7001  O O   . ASP B 1 433 ? 4.169   107.838 36.471  1.00 20.00 ? 433  ASP B O   1 
ATOM   7002  C CB  . ASP B 1 433 ? 1.087   107.519 36.289  1.00 20.00 ? 433  ASP B CB  1 
ATOM   7003  C CG  . ASP B 1 433 ? -0.089  108.323 35.758  1.00 20.00 ? 433  ASP B CG  1 
ATOM   7004  O OD1 . ASP B 1 433 ? 0.080   109.050 34.751  1.00 20.00 ? 433  ASP B OD1 1 
ATOM   7005  O OD2 . ASP B 1 433 ? -1.185  108.222 36.353  1.00 20.00 ? 433  ASP B OD2 1 
ATOM   7006  N N   . ILE B 1 434 ? 3.859   105.676 35.928  1.00 20.00 ? 434  ILE B N   1 
ATOM   7007  C CA  . ILE B 1 434 ? 5.097   105.235 36.561  1.00 20.00 ? 434  ILE B CA  1 
ATOM   7008  C C   . ILE B 1 434 ? 6.292   105.834 35.817  1.00 20.00 ? 434  ILE B C   1 
ATOM   7009  O O   . ILE B 1 434 ? 6.428   105.677 34.602  1.00 20.00 ? 434  ILE B O   1 
ATOM   7010  C CB  . ILE B 1 434 ? 5.189   103.693 36.574  1.00 20.00 ? 434  ILE B CB  1 
ATOM   7011  C CG1 . ILE B 1 434 ? 4.099   103.121 37.486  1.00 20.00 ? 434  ILE B CG1 1 
ATOM   7012  C CG2 . ILE B 1 434 ? 6.550   103.253 37.082  1.00 20.00 ? 434  ILE B CG2 1 
ATOM   7013  C CD1 . ILE B 1 434 ? 3.751   101.680 37.204  1.00 20.00 ? 434  ILE B CD1 1 
ATOM   7014  N N   . ARG B 1 435 ? 7.154   106.524 36.556  1.00 20.00 ? 435  ARG B N   1 
ATOM   7015  C CA  . ARG B 1 435 ? 8.333   107.161 35.975  1.00 20.00 ? 435  ARG B CA  1 
ATOM   7016  C C   . ARG B 1 435 ? 9.599   106.323 35.972  1.00 20.00 ? 435  ARG B C   1 
ATOM   7017  O O   . ARG B 1 435 ? 9.777   105.446 36.806  1.00 20.00 ? 435  ARG B O   1 
ATOM   7018  C CB  . ARG B 1 435 ? 8.617   108.485 36.697  1.00 20.00 ? 435  ARG B CB  1 
ATOM   7019  C CG  . ARG B 1 435 ? 7.536   109.539 36.510  1.00 20.00 ? 435  ARG B CG  1 
ATOM   7020  C CD  . ARG B 1 435 ? 7.809   110.782 37.342  1.00 20.00 ? 435  ARG B CD  1 
ATOM   7021  N NE  . ARG B 1 435 ? 8.901   111.569 36.779  1.00 20.00 ? 435  ARG B NE  1 
ATOM   7022  C CZ  . ARG B 1 435 ? 9.454   112.618 37.380  1.00 20.00 ? 435  ARG B CZ  1 
ATOM   7023  N NH1 . ARG B 1 435 ? 9.016   113.012 38.571  1.00 20.00 ? 435  ARG B NH1 1 
ATOM   7024  N NH2 . ARG B 1 435 ? 10.456  113.265 36.795  1.00 20.00 ? 435  ARG B NH2 1 
ATOM   7025  N N   . GLY B 1 436 ? 10.479  106.608 35.017  1.00 20.00 ? 436  GLY B N   1 
ATOM   7026  C CA  . GLY B 1 436 ? 11.730  105.877 34.919  1.00 20.00 ? 436  GLY B CA  1 
ATOM   7027  C C   . GLY B 1 436 ? 12.674  106.383 35.993  1.00 20.00 ? 436  GLY B C   1 
ATOM   7028  O O   . GLY B 1 436 ? 12.476  107.474 36.535  1.00 20.00 ? 436  GLY B O   1 
ATOM   7029  N N   . LEU B 1 437 ? 13.704  105.604 36.306  1.00 20.00 ? 437  LEU B N   1 
ATOM   7030  C CA  . LEU B 1 437 ? 14.665  106.002 37.332  1.00 20.00 ? 437  LEU B CA  1 
ATOM   7031  C C   . LEU B 1 437 ? 16.084  106.124 36.822  1.00 20.00 ? 437  LEU B C   1 
ATOM   7032  O O   . LEU B 1 437 ? 16.450  105.588 35.771  1.00 20.00 ? 437  LEU B O   1 
ATOM   7033  C CB  . LEU B 1 437 ? 14.677  105.001 38.490  1.00 20.00 ? 437  LEU B CB  1 
ATOM   7034  C CG  . LEU B 1 437 ? 13.529  104.957 39.491  1.00 20.00 ? 437  LEU B CG  1 
ATOM   7035  C CD1 . LEU B 1 437 ? 13.792  103.814 40.464  1.00 20.00 ? 437  LEU B CD1 1 
ATOM   7036  C CD2 . LEU B 1 437 ? 13.401  106.279 40.219  1.00 20.00 ? 437  LEU B CD2 1 
ATOM   7037  N N   . THR B 1 438 ? 16.894  106.819 37.610  1.00 20.00 ? 438  THR B N   1 
ATOM   7038  C CA  . THR B 1 438 ? 18.285  107.025 37.269  1.00 20.00 ? 438  THR B CA  1 
ATOM   7039  C C   . THR B 1 438 ? 19.155  106.992 38.531  1.00 20.00 ? 438  THR B C   1 
ATOM   7040  O O   . THR B 1 438 ? 18.728  107.423 39.610  1.00 20.00 ? 438  THR B O   1 
ATOM   7041  C CB  . THR B 1 438 ? 18.463  108.372 36.502  1.00 20.00 ? 438  THR B CB  1 
ATOM   7042  O OG1 . THR B 1 438 ? 19.701  108.345 35.785  1.00 20.00 ? 438  THR B OG1 1 
ATOM   7043  C CG2 . THR B 1 438 ? 18.439  109.567 37.455  1.00 20.00 ? 438  THR B CG2 1 
ATOM   7044  N N   . PHE B 1 439 ? 20.365  106.454 38.385  1.00 20.00 ? 439  PHE B N   1 
ATOM   7045  C CA  . PHE B 1 439 ? 21.327  106.345 39.484  1.00 20.00 ? 439  PHE B CA  1 
ATOM   7046  C C   . PHE B 1 439 ? 21.846  107.712 39.956  1.00 20.00 ? 439  PHE B C   1 
ATOM   7047  O O   . PHE B 1 439 ? 22.412  108.466 39.161  1.00 20.00 ? 439  PHE B O   1 
ATOM   7048  C CB  . PHE B 1 439 ? 22.545  105.529 39.042  1.00 20.00 ? 439  PHE B CB  1 
ATOM   7049  C CG  . PHE B 1 439 ? 22.352  104.046 39.107  1.00 20.00 ? 439  PHE B CG  1 
ATOM   7050  C CD1 . PHE B 1 439 ? 21.862  103.440 40.257  1.00 20.00 ? 439  PHE B CD1 1 
ATOM   7051  C CD2 . PHE B 1 439 ? 22.696  103.244 38.024  1.00 20.00 ? 439  PHE B CD2 1 
ATOM   7052  C CE1 . PHE B 1 439 ? 21.720  102.048 40.325  1.00 20.00 ? 439  PHE B CE1 1 
ATOM   7053  C CE2 . PHE B 1 439 ? 22.558  101.855 38.080  1.00 20.00 ? 439  PHE B CE2 1 
ATOM   7054  C CZ  . PHE B 1 439 ? 22.069  101.256 39.233  1.00 20.00 ? 439  PHE B CZ  1 
ATOM   7055  N N   . VAL B 1 440 ? 21.657  108.031 41.236  1.00 20.00 ? 440  VAL B N   1 
ATOM   7056  C CA  . VAL B 1 440 ? 22.132  109.305 41.776  1.00 20.00 ? 440  VAL B CA  1 
ATOM   7057  C C   . VAL B 1 440 ? 23.340  108.918 42.603  1.00 20.00 ? 440  VAL B C   1 
ATOM   7058  O O   . VAL B 1 440 ? 24.093  109.764 43.091  1.00 20.00 ? 440  VAL B O   1 
ATOM   7059  C CB  . VAL B 1 440 ? 21.112  109.991 42.716  1.00 20.00 ? 440  VAL B CB  1 
ATOM   7060  C CG1 . VAL B 1 440 ? 19.869  110.394 41.938  1.00 20.00 ? 440  VAL B CG1 1 
ATOM   7061  C CG2 . VAL B 1 440 ? 20.772  109.074 43.875  1.00 20.00 ? 440  VAL B CG2 1 
ATOM   7062  N N   . TYR B 1 441 ? 23.504  107.608 42.746  1.00 20.00 ? 441  TYR B N   1 
ATOM   7063  C CA  . TYR B 1 441 ? 24.598  107.022 43.501  1.00 20.00 ? 441  TYR B CA  1 
ATOM   7064  C C   . TYR B 1 441 ? 24.527  105.508 43.342  1.00 20.00 ? 441  TYR B C   1 
ATOM   7065  O O   . TYR B 1 441 ? 23.550  104.878 43.740  1.00 20.00 ? 441  TYR B O   1 
ATOM   7066  C CB  . TYR B 1 441 ? 24.482  107.386 44.984  1.00 20.00 ? 441  TYR B CB  1 
ATOM   7067  C CG  . TYR B 1 441 ? 25.288  106.480 45.891  1.00 20.00 ? 441  TYR B CG  1 
ATOM   7068  C CD1 . TYR B 1 441 ? 26.682  106.551 45.918  1.00 20.00 ? 441  TYR B CD1 1 
ATOM   7069  C CD2 . TYR B 1 441 ? 24.662  105.531 46.700  1.00 20.00 ? 441  TYR B CD2 1 
ATOM   7070  C CE1 . TYR B 1 441 ? 27.434  105.697 46.724  1.00 20.00 ? 441  TYR B CE1 1 
ATOM   7071  C CE2 . TYR B 1 441 ? 25.405  104.672 47.511  1.00 20.00 ? 441  TYR B CE2 1 
ATOM   7072  C CZ  . TYR B 1 441 ? 26.788  104.759 47.516  1.00 20.00 ? 441  TYR B CZ  1 
ATOM   7073  O OH  . TYR B 1 441 ? 27.521  103.898 48.303  1.00 20.00 ? 441  TYR B OH  1 
ATOM   7074  N N   . GLU B 1 442 ? 25.565  104.932 42.753  1.00 20.00 ? 442  GLU B N   1 
ATOM   7075  C CA  . GLU B 1 442 ? 25.624  103.495 42.537  1.00 20.00 ? 442  GLU B CA  1 
ATOM   7076  C C   . GLU B 1 442 ? 26.889  102.944 43.172  1.00 20.00 ? 442  GLU B C   1 
ATOM   7077  O O   . GLU B 1 442 ? 27.983  103.088 42.625  1.00 20.00 ? 442  GLU B O   1 
ATOM   7078  C CB  . GLU B 1 442 ? 25.620  103.185 41.036  1.00 20.00 ? 442  GLU B CB  1 
ATOM   7079  C CG  . GLU B 1 442 ? 26.066  101.773 40.676  1.00 20.00 ? 442  GLU B CG  1 
ATOM   7080  C CD  . GLU B 1 442 ? 26.288  101.594 39.182  1.00 20.00 ? 442  GLU B CD  1 
ATOM   7081  O OE1 . GLU B 1 442 ? 26.185  102.598 38.445  1.00 20.00 ? 442  GLU B OE1 1 
ATOM   7082  O OE2 . GLU B 1 442 ? 26.564  100.457 38.740  1.00 20.00 ? 442  GLU B OE2 1 
ATOM   7083  N N   . PRO B 1 443 ? 26.759  102.305 44.343  1.00 20.00 ? 443  PRO B N   1 
ATOM   7084  C CA  . PRO B 1 443 ? 27.903  101.574 44.897  1.00 20.00 ? 443  PRO B CA  1 
ATOM   7085  C C   . PRO B 1 443 ? 28.452  100.570 43.890  1.00 20.00 ? 443  PRO B C   1 
ATOM   7086  O O   . PRO B 1 443 ? 27.765  100.181 42.946  1.00 20.00 ? 443  PRO B O   1 
ATOM   7087  C CB  . PRO B 1 443 ? 27.335  100.901 46.152  1.00 20.00 ? 443  PRO B CB  1 
ATOM   7088  C CG  . PRO B 1 443 ? 25.845  100.963 45.996  1.00 20.00 ? 443  PRO B CG  1 
ATOM   7089  C CD  . PRO B 1 443 ? 25.574  102.208 45.209  1.00 20.00 ? 443  PRO B CD  1 
ATOM   7090  N N   . LYS B 1 444 ? 29.698  100.161 44.094  1.00 20.00 ? 444  LYS B N   1 
ATOM   7091  C CA  . LYS B 1 444 ? 30.345  99.205  43.204  1.00 20.00 ? 444  LYS B CA  1 
ATOM   7092  C C   . LYS B 1 444 ? 29.933  97.768  43.520  1.00 20.00 ? 444  LYS B C   1 
ATOM   7093  O O   . LYS B 1 444 ? 29.755  96.950  42.610  1.00 20.00 ? 444  LYS B O   1 
ATOM   7094  C CB  . LYS B 1 444 ? 31.873  99.346  43.301  1.00 20.00 ? 444  LYS B CB  1 
ATOM   7095  C CG  . LYS B 1 444 ? 32.376  100.793 43.268  1.00 20.00 ? 444  LYS B CG  1 
ATOM   7096  C CD  . LYS B 1 444 ? 32.518  101.310 41.836  1.00 20.00 ? 444  LYS B CD  1 
ATOM   7097  C CE  . LYS B 1 444 ? 33.645  102.331 41.724  1.00 20.00 ? 444  LYS B CE  1 
ATOM   7098  N NZ  . LYS B 1 444 ? 33.659  103.022 40.402  1.00 20.00 ? 444  LYS B NZ  1 
ATOM   7099  N N   . GLN B 1 445 ? 29.792  97.465  44.809  1.00 20.00 ? 445  GLN B N   1 
ATOM   7100  C CA  . GLN B 1 445 ? 29.399  96.124  45.259  1.00 20.00 ? 445  GLN B CA  1 
ATOM   7101  C C   . GLN B 1 445 ? 28.020  96.169  45.918  1.00 20.00 ? 445  GLN B C   1 
ATOM   7102  O O   . GLN B 1 445 ? 27.709  97.118  46.643  1.00 20.00 ? 445  GLN B O   1 
ATOM   7103  C CB  . GLN B 1 445 ? 30.413  95.572  46.273  1.00 20.00 ? 445  GLN B CB  1 
ATOM   7104  C CG  . GLN B 1 445 ? 31.862  95.904  45.974  1.00 20.00 ? 445  GLN B CG  1 
ATOM   7105  C CD  . GLN B 1 445 ? 32.362  97.074  46.792  1.00 20.00 ? 445  GLN B CD  1 
ATOM   7106  O OE1 . GLN B 1 445 ? 31.596  97.974  47.142  1.00 20.00 ? 445  GLN B OE1 1 
ATOM   7107  N NE2 . GLN B 1 445 ? 33.655  97.070  47.102  1.00 20.00 ? 445  GLN B NE2 1 
ATOM   7108  N N   . LEU B 1 446 ? 27.200  95.147  45.675  1.00 20.00 ? 446  LEU B N   1 
ATOM   7109  C CA  . LEU B 1 446 ? 25.860  95.106  46.265  1.00 20.00 ? 446  LEU B CA  1 
ATOM   7110  C C   . LEU B 1 446 ? 25.093  96.374  45.902  1.00 20.00 ? 446  LEU B C   1 
ATOM   7111  O O   . LEU B 1 446 ? 24.406  96.949  46.752  1.00 20.00 ? 446  LEU B O   1 
ATOM   7112  C CB  . LEU B 1 446 ? 25.959  95.031  47.793  1.00 20.00 ? 446  LEU B CB  1 
ATOM   7113  C CG  . LEU B 1 446 ? 26.195  93.698  48.503  1.00 20.00 ? 446  LEU B CG  1 
ATOM   7114  C CD1 . LEU B 1 446 ? 24.968  93.378  49.360  1.00 20.00 ? 446  LEU B CD1 1 
ATOM   7115  C CD2 . LEU B 1 446 ? 26.475  92.593  47.483  1.00 20.00 ? 446  LEU B CD2 1 
ATOM   7116  N N   . ARG B 1 447 ? 25.200  96.814  44.651  1.00 20.00 ? 447  ARG B N   1 
ATOM   7117  C CA  . ARG B 1 447 ? 24.500  98.026  44.242  1.00 20.00 ? 447  ARG B CA  1 
ATOM   7118  C C   . ARG B 1 447 ? 23.009  97.997  44.554  1.00 20.00 ? 447  ARG B C   1 
ATOM   7119  O O   . ARG B 1 447 ? 22.460  98.983  45.059  1.00 20.00 ? 447  ARG B O   1 
ATOM   7120  C CB  . ARG B 1 447 ? 24.743  98.322  42.752  1.00 20.00 ? 447  ARG B CB  1 
ATOM   7121  C CG  . ARG B 1 447 ? 23.899  97.543  41.742  1.00 20.00 ? 447  ARG B CG  1 
ATOM   7122  C CD  . ARG B 1 447 ? 24.192  98.071  40.336  1.00 20.00 ? 447  ARG B CD  1 
ATOM   7123  N NE  . ARG B 1 447 ? 23.521  97.330  39.271  1.00 20.00 ? 447  ARG B NE  1 
ATOM   7124  C CZ  . ARG B 1 447 ? 23.489  97.724  38.000  1.00 20.00 ? 447  ARG B CZ  1 
ATOM   7125  N NH1 . ARG B 1 447 ? 24.095  98.848  37.643  1.00 20.00 ? 447  ARG B NH1 1 
ATOM   7126  N NH2 . ARG B 1 447 ? 22.841  97.007  37.089  1.00 20.00 ? 447  ARG B NH2 1 
ATOM   7127  N N   . PHE B 1 448 ? 22.359  96.866  44.280  1.00 20.00 ? 448  PHE B N   1 
ATOM   7128  C CA  . PHE B 1 448 ? 20.932  96.757  44.548  1.00 20.00 ? 448  PHE B CA  1 
ATOM   7129  C C   . PHE B 1 448 ? 20.631  96.975  46.025  1.00 20.00 ? 448  PHE B C   1 
ATOM   7130  O O   . PHE B 1 448 ? 19.540  97.437  46.383  1.00 20.00 ? 448  PHE B O   1 
ATOM   7131  C CB  . PHE B 1 448 ? 20.386  95.394  44.093  1.00 20.00 ? 448  PHE B CB  1 
ATOM   7132  C CG  . PHE B 1 448 ? 20.863  94.229  44.917  1.00 20.00 ? 448  PHE B CG  1 
ATOM   7133  C CD1 . PHE B 1 448 ? 20.349  93.998  46.193  1.00 20.00 ? 448  PHE B CD1 1 
ATOM   7134  C CD2 . PHE B 1 448 ? 21.818  93.349  44.411  1.00 20.00 ? 448  PHE B CD2 1 
ATOM   7135  C CE1 . PHE B 1 448 ? 20.779  92.906  46.959  1.00 20.00 ? 448  PHE B CE1 1 
ATOM   7136  C CE2 . PHE B 1 448 ? 22.256  92.252  45.166  1.00 20.00 ? 448  PHE B CE2 1 
ATOM   7137  C CZ  . PHE B 1 448 ? 21.733  92.032  46.445  1.00 20.00 ? 448  PHE B CZ  1 
ATOM   7138  N N   . PHE B 1 449 ? 21.605  96.669  46.880  1.00 20.00 ? 449  PHE B N   1 
ATOM   7139  C CA  . PHE B 1 449 ? 21.416  96.836  48.313  1.00 20.00 ? 449  PHE B CA  1 
ATOM   7140  C C   . PHE B 1 449 ? 21.513  98.268  48.812  1.00 20.00 ? 449  PHE B C   1 
ATOM   7141  O O   . PHE B 1 449 ? 20.847  98.624  49.784  1.00 20.00 ? 449  PHE B O   1 
ATOM   7142  C CB  . PHE B 1 449 ? 22.410  95.973  49.090  1.00 20.00 ? 449  PHE B CB  1 
ATOM   7143  C CG  . PHE B 1 449 ? 22.161  95.958  50.574  1.00 20.00 ? 449  PHE B CG  1 
ATOM   7144  C CD1 . PHE B 1 449 ? 20.978  95.431  51.086  1.00 20.00 ? 449  PHE B CD1 1 
ATOM   7145  C CD2 . PHE B 1 449 ? 23.100  96.482  51.461  1.00 20.00 ? 449  PHE B CD2 1 
ATOM   7146  C CE1 . PHE B 1 449 ? 20.726  95.422  52.465  1.00 20.00 ? 449  PHE B CE1 1 
ATOM   7147  C CE2 . PHE B 1 449 ? 22.860  96.479  52.845  1.00 20.00 ? 449  PHE B CE2 1 
ATOM   7148  C CZ  . PHE B 1 449 ? 21.669  95.947  53.345  1.00 20.00 ? 449  PHE B CZ  1 
ATOM   7149  N N   . THR B 1 450 ? 22.317  99.100  48.155  1.00 20.00 ? 450  THR B N   1 
ATOM   7150  C CA  . THR B 1 450 ? 22.442  100.477 48.613  1.00 20.00 ? 450  THR B CA  1 
ATOM   7151  C C   . THR B 1 450 ? 22.353  101.574 47.565  1.00 20.00 ? 450  THR B C   1 
ATOM   7152  O O   . THR B 1 450 ? 22.407  102.755 47.902  1.00 20.00 ? 450  THR B O   1 
ATOM   7153  C CB  . THR B 1 450 ? 23.754  100.655 49.393  1.00 20.00 ? 450  THR B CB  1 
ATOM   7154  O OG1 . THR B 1 450 ? 24.738  99.737  48.887  1.00 20.00 ? 450  THR B OG1 1 
ATOM   7155  C CG2 . THR B 1 450 ? 23.526  100.375 50.878  1.00 20.00 ? 450  THR B CG2 1 
ATOM   7156  N N   . ALA B 1 451 ? 22.216  101.199 46.301  1.00 20.00 ? 451  ALA B N   1 
ATOM   7157  C CA  . ALA B 1 451 ? 22.122  102.195 45.243  1.00 20.00 ? 451  ALA B CA  1 
ATOM   7158  C C   . ALA B 1 451 ? 20.960  103.152 45.510  1.00 20.00 ? 451  ALA B C   1 
ATOM   7159  O O   . ALA B 1 451 ? 19.952  102.765 46.106  1.00 20.00 ? 451  ALA B O   1 
ATOM   7160  C CB  . ALA B 1 451 ? 21.935  101.506 43.901  1.00 20.00 ? 451  ALA B CB  1 
ATOM   7161  N N   . ARG B 1 452 ? 21.109  104.403 45.084  1.00 20.00 ? 452  ARG B N   1 
ATOM   7162  C CA  . ARG B 1 452 ? 20.065  105.407 45.275  1.00 20.00 ? 452  ARG B CA  1 
ATOM   7163  C C   . ARG B 1 452 ? 19.728  105.987 43.901  1.00 20.00 ? 452  ARG B C   1 
ATOM   7164  O O   . ARG B 1 452 ? 20.603  106.128 43.045  1.00 20.00 ? 452  ARG B O   1 
ATOM   7165  C CB  . ARG B 1 452 ? 20.549  106.492 46.241  1.00 20.00 ? 452  ARG B CB  1 
ATOM   7166  C CG  . ARG B 1 452 ? 21.225  105.906 47.474  1.00 20.00 ? 452  ARG B CG  1 
ATOM   7167  C CD  . ARG B 1 452 ? 21.354  106.891 48.625  1.00 20.00 ? 452  ARG B CD  1 
ATOM   7168  N NE  . ARG B 1 452 ? 20.438  108.019 48.513  1.00 20.00 ? 452  ARG B NE  1 
ATOM   7169  C CZ  . ARG B 1 452 ? 19.456  108.288 49.370  1.00 20.00 ? 452  ARG B CZ  1 
ATOM   7170  N NH1 . ARG B 1 452 ? 19.240  107.506 50.424  1.00 20.00 ? 452  ARG B NH1 1 
ATOM   7171  N NH2 . ARG B 1 452 ? 18.682  109.347 49.165  1.00 20.00 ? 452  ARG B NH2 1 
ATOM   7172  N N   . PHE B 1 453 ? 18.458  106.311 43.683  1.00 20.00 ? 453  PHE B N   1 
ATOM   7173  C CA  . PHE B 1 453 ? 18.039  106.862 42.401  1.00 20.00 ? 453  PHE B CA  1 
ATOM   7174  C C   . PHE B 1 453 ? 17.219  108.130 42.507  1.00 20.00 ? 453  PHE B C   1 
ATOM   7175  O O   . PHE B 1 453 ? 17.012  108.686 43.586  1.00 20.00 ? 453  PHE B O   1 
ATOM   7176  C CB  . PHE B 1 453 ? 17.190  105.848 41.631  1.00 20.00 ? 453  PHE B CB  1 
ATOM   7177  C CG  . PHE B 1 453 ? 17.667  104.432 41.737  1.00 20.00 ? 453  PHE B CG  1 
ATOM   7178  C CD1 . PHE B 1 453 ? 17.555  103.728 42.927  1.00 20.00 ? 453  PHE B CD1 1 
ATOM   7179  C CD2 . PHE B 1 453 ? 18.187  103.788 40.625  1.00 20.00 ? 453  PHE B CD2 1 
ATOM   7180  C CE1 . PHE B 1 453 ? 17.958  102.394 43.002  1.00 20.00 ? 453  PHE B CE1 1 
ATOM   7181  C CE2 . PHE B 1 453 ? 18.588  102.462 40.692  1.00 20.00 ? 453  PHE B CE2 1 
ATOM   7182  C CZ  . PHE B 1 453 ? 18.474  101.763 41.879  1.00 20.00 ? 453  PHE B CZ  1 
ATOM   7183  N N   . ASP B 1 454 ? 16.745  108.566 41.347  1.00 20.00 ? 454  ASP B N   1 
ATOM   7184  C CA  . ASP B 1 454 ? 15.930  109.753 41.228  1.00 20.00 ? 454  ASP B CA  1 
ATOM   7185  C C   . ASP B 1 454 ? 15.159  109.587 39.939  1.00 20.00 ? 454  ASP B C   1 
ATOM   7186  O O   . ASP B 1 454 ? 15.604  108.888 39.029  1.00 20.00 ? 454  ASP B O   1 
ATOM   7187  C CB  . ASP B 1 454 ? 16.791  111.010 41.175  1.00 20.00 ? 454  ASP B CB  1 
ATOM   7188  C CG  . ASP B 1 454 ? 16.040  112.239 41.637  1.00 20.00 ? 454  ASP B CG  1 
ATOM   7189  O OD1 . ASP B 1 454 ? 14.861  112.100 42.031  1.00 20.00 ? 454  ASP B OD1 1 
ATOM   7190  O OD2 . ASP B 1 454 ? 16.626  113.342 41.606  1.00 20.00 ? 454  ASP B OD2 1 
ATOM   7191  N N   . PHE B 1 455 ? 13.998  110.225 39.875  1.00 20.00 ? 455  PHE B N   1 
ATOM   7192  C CA  . PHE B 1 455 ? 13.140  110.161 38.707  1.00 20.00 ? 455  PHE B CA  1 
ATOM   7193  C C   . PHE B 1 455 ? 13.702  110.890 37.495  1.00 20.00 ? 455  PHE B C   1 
ATOM   7194  O O   . PHE B 1 455 ? 14.452  111.863 37.621  1.00 20.00 ? 455  PHE B O   1 
ATOM   7195  C CB  . PHE B 1 455 ? 11.770  110.731 39.054  1.00 20.00 ? 455  PHE B CB  1 
ATOM   7196  C CG  . PHE B 1 455 ? 10.988  109.877 40.001  1.00 20.00 ? 455  PHE B CG  1 
ATOM   7197  C CD1 . PHE B 1 455 ? 10.939  108.496 39.831  1.00 20.00 ? 455  PHE B CD1 1 
ATOM   7198  C CD2 . PHE B 1 455 ? 10.279  110.451 41.051  1.00 20.00 ? 455  PHE B CD2 1 
ATOM   7199  C CE1 . PHE B 1 455 ? 10.190  107.692 40.692  1.00 20.00 ? 455  PHE B CE1 1 
ATOM   7200  C CE2 . PHE B 1 455 ? 9.527   109.658 41.920  1.00 20.00 ? 455  PHE B CE2 1 
ATOM   7201  C CZ  . PHE B 1 455 ? 9.481   108.273 41.739  1.00 20.00 ? 455  PHE B CZ  1 
ATOM   7202  N N   . ILE B 1 456 ? 13.330  110.401 36.318  1.00 20.00 ? 456  ILE B N   1 
ATOM   7203  C CA  . ILE B 1 456 ? 13.774  110.987 35.060  1.00 20.00 ? 456  ILE B CA  1 
ATOM   7204  C C   . ILE B 1 456 ? 12.683  111.949 34.589  1.00 20.00 ? 456  ILE B C   1 
ATOM   7205  O O   . ILE B 1 456 ? 11.492  111.595 34.740  1.00 20.00 ? 456  ILE B O   1 
ATOM   7206  C CB  . ILE B 1 456 ? 13.985  109.904 33.974  1.00 20.00 ? 456  ILE B CB  1 
ATOM   7207  C CG1 . ILE B 1 456 ? 15.143  108.983 34.357  1.00 20.00 ? 456  ILE B CG1 1 
ATOM   7208  C CG2 . ILE B 1 456 ? 14.282  110.561 32.639  1.00 20.00 ? 456  ILE B CG2 1 
ATOM   7209  C CD1 . ILE B 1 456 ? 15.174  107.695 33.558  1.00 20.00 ? 456  ILE B CD1 1 
ATOM   7210  O OXT . ILE B 1 456 ? 13.029  113.038 34.082  1.00 20.00 ? 456  ILE B OXT 1 
ATOM   7211  N N   . MET C 1 1   ? 25.658  71.925  110.236 1.00 20.00 ? 1    MET C N   1 
ATOM   7212  C CA  . MET C 1 1   ? 27.019  72.480  109.973 1.00 20.00 ? 1    MET C CA  1 
ATOM   7213  C C   . MET C 1 1   ? 27.251  72.629  108.480 1.00 20.00 ? 1    MET C C   1 
ATOM   7214  O O   . MET C 1 1   ? 28.089  73.427  108.040 1.00 20.00 ? 1    MET C O   1 
ATOM   7215  C CB  . MET C 1 1   ? 28.093  71.556  110.557 1.00 20.00 ? 1    MET C CB  1 
ATOM   7216  C CG  . MET C 1 1   ? 29.470  72.205  110.710 1.00 20.00 ? 1    MET C CG  1 
ATOM   7217  S SD  . MET C 1 1   ? 30.420  72.281  109.163 1.00 20.00 ? 1    MET C SD  1 
ATOM   7218  C CE  . MET C 1 1   ? 31.491  73.705  109.491 1.00 20.00 ? 1    MET C CE  1 
ATOM   7219  N N   . ASN C 1 2   ? 26.510  71.853  107.698 1.00 20.00 ? 2    ASN C N   1 
ATOM   7220  C CA  . ASN C 1 2   ? 26.658  71.921  106.260 1.00 20.00 ? 2    ASN C CA  1 
ATOM   7221  C C   . ASN C 1 2   ? 25.394  72.351  105.544 1.00 20.00 ? 2    ASN C C   1 
ATOM   7222  O O   . ASN C 1 2   ? 24.283  71.928  105.877 1.00 20.00 ? 2    ASN C O   1 
ATOM   7223  C CB  . ASN C 1 2   ? 27.167  70.590  105.724 1.00 20.00 ? 2    ASN C CB  1 
ATOM   7224  C CG  . ASN C 1 2   ? 28.674  70.495  105.788 1.00 20.00 ? 2    ASN C CG  1 
ATOM   7225  O OD1 . ASN C 1 2   ? 29.370  70.865  104.837 1.00 20.00 ? 2    ASN C OD1 1 
ATOM   7226  N ND2 . ASN C 1 2   ? 29.194  70.015  106.919 1.00 20.00 ? 2    ASN C ND2 1 
ATOM   7227  N N   . TYR C 1 3   ? 25.600  73.209  104.552 1.00 20.00 ? 3    TYR C N   1 
ATOM   7228  C CA  . TYR C 1 3   ? 24.539  73.763  103.734 1.00 20.00 ? 3    TYR C CA  1 
ATOM   7229  C C   . TYR C 1 3   ? 24.751  73.424  102.270 1.00 20.00 ? 3    TYR C C   1 
ATOM   7230  O O   . TYR C 1 3   ? 25.820  73.678  101.720 1.00 20.00 ? 3    TYR C O   1 
ATOM   7231  C CB  . TYR C 1 3   ? 24.528  75.274  103.919 1.00 20.00 ? 3    TYR C CB  1 
ATOM   7232  C CG  . TYR C 1 3   ? 24.568  75.676  105.374 1.00 20.00 ? 3    TYR C CG  1 
ATOM   7233  C CD1 . TYR C 1 3   ? 23.390  75.836  106.093 1.00 20.00 ? 3    TYR C CD1 1 
ATOM   7234  C CD2 . TYR C 1 3   ? 25.775  75.883  106.032 1.00 20.00 ? 3    TYR C CD2 1 
ATOM   7235  C CE1 . TYR C 1 3   ? 23.404  76.193  107.420 1.00 20.00 ? 3    TYR C CE1 1 
ATOM   7236  C CE2 . TYR C 1 3   ? 25.798  76.243  107.368 1.00 20.00 ? 3    TYR C CE2 1 
ATOM   7237  C CZ  . TYR C 1 3   ? 24.605  76.398  108.052 1.00 20.00 ? 3    TYR C CZ  1 
ATOM   7238  O OH  . TYR C 1 3   ? 24.595  76.788  109.365 1.00 20.00 ? 3    TYR C OH  1 
ATOM   7239  N N   . PRO C 1 4   ? 23.726  72.856  101.615 1.00 20.00 ? 4    PRO C N   1 
ATOM   7240  C CA  . PRO C 1 4   ? 23.887  72.354  100.249 1.00 20.00 ? 4    PRO C CA  1 
ATOM   7241  C C   . PRO C 1 4   ? 23.888  73.487  99.238  1.00 20.00 ? 4    PRO C C   1 
ATOM   7242  O O   . PRO C 1 4   ? 23.291  74.541  99.467  1.00 20.00 ? 4    PRO C O   1 
ATOM   7243  C CB  . PRO C 1 4   ? 22.694  71.423  100.065 1.00 20.00 ? 4    PRO C CB  1 
ATOM   7244  C CG  . PRO C 1 4   ? 21.644  71.976  100.986 1.00 20.00 ? 4    PRO C CG  1 
ATOM   7245  C CD  . PRO C 1 4   ? 22.352  72.672  102.120 1.00 20.00 ? 4    PRO C CD  1 
ATOM   7246  N N   . ALA C 1 5   ? 24.568  73.273  98.120  1.00 20.00 ? 5    ALA C N   1 
ATOM   7247  C CA  . ALA C 1 5   ? 24.636  74.285  97.080  1.00 20.00 ? 5    ALA C CA  1 
ATOM   7248  C C   . ALA C 1 5   ? 23.301  74.275  96.347  1.00 20.00 ? 5    ALA C C   1 
ATOM   7249  O O   . ALA C 1 5   ? 22.571  73.291  96.393  1.00 20.00 ? 5    ALA C O   1 
ATOM   7250  C CB  . ALA C 1 5   ? 25.773  73.963  96.112  1.00 20.00 ? 5    ALA C CB  1 
ATOM   7251  N N   . GLU C 1 6   ? 22.980  75.370  95.675  1.00 20.00 ? 6    GLU C N   1 
ATOM   7252  C CA  . GLU C 1 6   ? 21.724  75.450  94.940  1.00 20.00 ? 6    GLU C CA  1 
ATOM   7253  C C   . GLU C 1 6   ? 21.613  74.254  94.013  1.00 20.00 ? 6    GLU C C   1 
ATOM   7254  O O   . GLU C 1 6   ? 22.517  73.997  93.218  1.00 20.00 ? 6    GLU C O   1 
ATOM   7255  C CB  . GLU C 1 6   ? 21.670  76.737  94.118  1.00 20.00 ? 6    GLU C CB  1 
ATOM   7256  C CG  . GLU C 1 6   ? 21.608  78.006  94.954  1.00 20.00 ? 6    GLU C CG  1 
ATOM   7257  C CD  . GLU C 1 6   ? 22.984  78.463  95.411  1.00 20.00 ? 6    GLU C CD  1 
ATOM   7258  O OE1 . GLU C 1 6   ? 23.980  77.785  95.105  1.00 20.00 ? 6    GLU C OE1 1 
ATOM   7259  O OE2 . GLU C 1 6   ? 23.071  79.509  96.077  1.00 20.00 ? 6    GLU C OE2 1 
ATOM   7260  N N   . PRO C 1 7   ? 20.495  73.508  94.097  1.00 20.00 ? 7    PRO C N   1 
ATOM   7261  C CA  . PRO C 1 7   ? 20.270  72.351  93.228  1.00 20.00 ? 7    PRO C CA  1 
ATOM   7262  C C   . PRO C 1 7   ? 19.764  72.732  91.844  1.00 20.00 ? 7    PRO C C   1 
ATOM   7263  O O   . PRO C 1 7   ? 18.956  72.018  91.248  1.00 20.00 ? 7    PRO C O   1 
ATOM   7264  C CB  . PRO C 1 7   ? 19.249  71.519  94.001  1.00 20.00 ? 7    PRO C CB  1 
ATOM   7265  C CG  . PRO C 1 7   ? 18.474  72.513  94.779  1.00 20.00 ? 7    PRO C CG  1 
ATOM   7266  C CD  . PRO C 1 7   ? 19.375  73.710  95.034  1.00 20.00 ? 7    PRO C CD  1 
ATOM   7267  N N   . PHE C 1 8   ? 20.238  73.860  91.338  1.00 20.00 ? 8    PHE C N   1 
ATOM   7268  C CA  . PHE C 1 8   ? 19.835  74.335  90.024  1.00 20.00 ? 8    PHE C CA  1 
ATOM   7269  C C   . PHE C 1 8   ? 20.835  75.382  89.565  1.00 20.00 ? 8    PHE C C   1 
ATOM   7270  O O   . PHE C 1 8   ? 21.680  75.828  90.350  1.00 20.00 ? 8    PHE C O   1 
ATOM   7271  C CB  . PHE C 1 8   ? 18.439  74.967  90.095  1.00 20.00 ? 8    PHE C CB  1 
ATOM   7272  C CG  . PHE C 1 8   ? 18.294  75.989  91.186  1.00 20.00 ? 8    PHE C CG  1 
ATOM   7273  C CD1 . PHE C 1 8   ? 18.857  77.253  91.051  1.00 20.00 ? 8    PHE C CD1 1 
ATOM   7274  C CD2 . PHE C 1 8   ? 17.630  75.673  92.370  1.00 20.00 ? 8    PHE C CD2 1 
ATOM   7275  C CE1 . PHE C 1 8   ? 18.767  78.186  92.081  1.00 20.00 ? 8    PHE C CE1 1 
ATOM   7276  C CE2 . PHE C 1 8   ? 17.531  76.593  93.403  1.00 20.00 ? 8    PHE C CE2 1 
ATOM   7277  C CZ  . PHE C 1 8   ? 18.101  77.854  93.262  1.00 20.00 ? 8    PHE C CZ  1 
ATOM   7278  N N   . ARG C 1 9   ? 20.740  75.764  88.296  1.00 20.00 ? 9    ARG C N   1 
ATOM   7279  C CA  . ARG C 1 9   ? 21.628  76.766  87.736  1.00 20.00 ? 9    ARG C CA  1 
ATOM   7280  C C   . ARG C 1 9   ? 20.771  77.982  87.478  1.00 20.00 ? 9    ARG C C   1 
ATOM   7281  O O   . ARG C 1 9   ? 19.552  77.882  87.440  1.00 20.00 ? 9    ARG C O   1 
ATOM   7282  C CB  . ARG C 1 9   ? 22.213  76.314  86.396  1.00 20.00 ? 9    ARG C CB  1 
ATOM   7283  C CG  . ARG C 1 9   ? 22.616  74.860  86.291  1.00 20.00 ? 9    ARG C CG  1 
ATOM   7284  C CD  . ARG C 1 9   ? 23.243  74.627  84.924  1.00 20.00 ? 9    ARG C CD  1 
ATOM   7285  N NE  . ARG C 1 9   ? 23.729  73.263  84.749  1.00 20.00 ? 9    ARG C NE  1 
ATOM   7286  C CZ  . ARG C 1 9   ? 24.138  72.771  83.586  1.00 20.00 ? 9    ARG C CZ  1 
ATOM   7287  N NH1 . ARG C 1 9   ? 24.116  73.528  82.506  1.00 20.00 ? 9    ARG C NH1 1 
ATOM   7288  N NH2 . ARG C 1 9   ? 24.566  71.524  83.501  1.00 20.00 ? 9    ARG C NH2 1 
ATOM   7289  N N   . ILE C 1 10  ? 21.399  79.136  87.296  1.00 20.00 ? 10   ILE C N   1 
ATOM   7290  C CA  . ILE C 1 10  ? 20.650  80.350  87.030  1.00 20.00 ? 10   ILE C CA  1 
ATOM   7291  C C   . ILE C 1 10  ? 20.395  80.377  85.516  1.00 20.00 ? 10   ILE C C   1 
ATOM   7292  O O   . ILE C 1 10  ? 21.328  80.186  84.718  1.00 20.00 ? 10   ILE C O   1 
ATOM   7293  C CB  . ILE C 1 10  ? 21.455  81.596  87.457  1.00 20.00 ? 10   ILE C CB  1 
ATOM   7294  C CG1 . ILE C 1 10  ? 21.623  81.601  88.975  1.00 20.00 ? 10   ILE C CG1 1 
ATOM   7295  C CG2 . ILE C 1 10  ? 20.739  82.861  87.032  1.00 20.00 ? 10   ILE C CG2 1 
ATOM   7296  C CD1 . ILE C 1 10  ? 22.673  82.575  89.467  1.00 20.00 ? 10   ILE C CD1 1 
ATOM   7297  N N   . LYS C 1 11  ? 19.135  80.578  85.124  1.00 20.00 ? 11   LYS C N   1 
ATOM   7298  C CA  . LYS C 1 11  ? 18.767  80.625  83.709  1.00 20.00 ? 11   LYS C CA  1 
ATOM   7299  C C   . LYS C 1 11  ? 18.712  82.074  83.262  1.00 20.00 ? 11   LYS C C   1 
ATOM   7300  O O   . LYS C 1 11  ? 19.179  82.427  82.183  1.00 20.00 ? 11   LYS C O   1 
ATOM   7301  C CB  . LYS C 1 11  ? 17.409  79.955  83.482  1.00 20.00 ? 11   LYS C CB  1 
ATOM   7302  C CG  . LYS C 1 11  ? 16.841  80.127  82.067  1.00 20.00 ? 11   LYS C CG  1 
ATOM   7303  C CD  . LYS C 1 11  ? 17.716  79.442  81.014  1.00 20.00 ? 11   LYS C CD  1 
ATOM   7304  C CE  . LYS C 1 11  ? 17.161  79.640  79.614  1.00 20.00 ? 11   LYS C CE  1 
ATOM   7305  N NZ  . LYS C 1 11  ? 16.180  78.586  79.271  1.00 20.00 ? 11   LYS C NZ  1 
ATOM   7306  N N   . SER C 1 12  ? 18.124  82.917  84.095  1.00 20.00 ? 12   SER C N   1 
ATOM   7307  C CA  . SER C 1 12  ? 18.021  84.332  83.778  1.00 20.00 ? 12   SER C CA  1 
ATOM   7308  C C   . SER C 1 12  ? 18.068  85.115  85.085  1.00 20.00 ? 12   SER C C   1 
ATOM   7309  O O   . SER C 1 12  ? 17.656  84.611  86.137  1.00 20.00 ? 12   SER C O   1 
ATOM   7310  C CB  . SER C 1 12  ? 16.733  84.622  82.995  1.00 20.00 ? 12   SER C CB  1 
ATOM   7311  O OG  . SER C 1 12  ? 15.618  84.786  83.847  1.00 20.00 ? 12   SER C OG  1 
ATOM   7312  N N   . VAL C 1 13  ? 18.589  86.338  85.026  1.00 20.00 ? 13   VAL C N   1 
ATOM   7313  C CA  . VAL C 1 13  ? 18.690  87.173  86.216  1.00 20.00 ? 13   VAL C CA  1 
ATOM   7314  C C   . VAL C 1 13  ? 17.852  88.428  86.128  1.00 20.00 ? 13   VAL C C   1 
ATOM   7315  O O   . VAL C 1 13  ? 17.481  88.883  85.050  1.00 20.00 ? 13   VAL C O   1 
ATOM   7316  C CB  . VAL C 1 13  ? 20.157  87.614  86.487  1.00 20.00 ? 13   VAL C CB  1 
ATOM   7317  C CG1 . VAL C 1 13  ? 21.087  86.421  86.486  1.00 20.00 ? 13   VAL C CG1 1 
ATOM   7318  C CG2 . VAL C 1 13  ? 20.593  88.625  85.438  1.00 20.00 ? 13   VAL C CG2 1 
ATOM   7319  N N   . GLU C 1 14  ? 17.553  88.981  87.290  1.00 20.00 ? 14   GLU C N   1 
ATOM   7320  C CA  . GLU C 1 14  ? 16.767  90.190  87.392  1.00 20.00 ? 14   GLU C CA  1 
ATOM   7321  C C   . GLU C 1 14  ? 17.797  91.221  87.803  1.00 20.00 ? 14   GLU C C   1 
ATOM   7322  O O   . GLU C 1 14  ? 18.397  91.111  88.871  1.00 20.00 ? 14   GLU C O   1 
ATOM   7323  C CB  . GLU C 1 14  ? 15.705  90.037  88.476  1.00 20.00 ? 14   GLU C CB  1 
ATOM   7324  C CG  . GLU C 1 14  ? 14.744  91.203  88.578  1.00 20.00 ? 14   GLU C CG  1 
ATOM   7325  C CD  . GLU C 1 14  ? 13.524  90.895  89.434  1.00 20.00 ? 14   GLU C CD  1 
ATOM   7326  O OE1 . GLU C 1 14  ? 13.473  89.818  90.068  1.00 20.00 ? 14   GLU C OE1 1 
ATOM   7327  O OE2 . GLU C 1 14  ? 12.608  91.735  89.467  1.00 20.00 ? 14   GLU C OE2 1 
ATOM   7328  N N   . THR C 1 15  ? 18.034  92.193  86.934  1.00 20.00 ? 15   THR C N   1 
ATOM   7329  C CA  . THR C 1 15  ? 19.002  93.250  87.204  1.00 20.00 ? 15   THR C CA  1 
ATOM   7330  C C   . THR C 1 15  ? 18.544  94.180  88.333  1.00 20.00 ? 15   THR C C   1 
ATOM   7331  O O   . THR C 1 15  ? 17.353  94.492  88.456  1.00 20.00 ? 15   THR C O   1 
ATOM   7332  C CB  . THR C 1 15  ? 19.247  94.105  85.934  1.00 20.00 ? 15   THR C CB  1 
ATOM   7333  O OG1 . THR C 1 15  ? 18.003  94.342  85.259  1.00 20.00 ? 15   THR C OG1 1 
ATOM   7334  C CG2 . THR C 1 15  ? 20.197  93.384  84.987  1.00 20.00 ? 15   THR C CG2 1 
ATOM   7335  N N   . VAL C 1 16  ? 19.493  94.605  89.166  1.00 20.00 ? 16   VAL C N   1 
ATOM   7336  C CA  . VAL C 1 16  ? 19.184  95.502  90.274  1.00 20.00 ? 16   VAL C CA  1 
ATOM   7337  C C   . VAL C 1 16  ? 20.164  96.671  90.291  1.00 20.00 ? 16   VAL C C   1 
ATOM   7338  O O   . VAL C 1 16  ? 21.331  96.532  89.916  1.00 20.00 ? 16   VAL C O   1 
ATOM   7339  C CB  . VAL C 1 16  ? 19.236  94.786  91.657  1.00 20.00 ? 16   VAL C CB  1 
ATOM   7340  C CG1 . VAL C 1 16  ? 18.469  93.485  91.604  1.00 20.00 ? 16   VAL C CG1 1 
ATOM   7341  C CG2 . VAL C 1 16  ? 20.661  94.549  92.074  1.00 20.00 ? 16   VAL C CG2 1 
ATOM   7342  N N   . SER C 1 17  ? 19.675  97.832  90.711  1.00 20.00 ? 17   SER C N   1 
ATOM   7343  C CA  . SER C 1 17  ? 20.501  99.024  90.781  1.00 20.00 ? 17   SER C CA  1 
ATOM   7344  C C   . SER C 1 17  ? 21.037  99.124  92.199  1.00 20.00 ? 17   SER C C   1 
ATOM   7345  O O   . SER C 1 17  ? 20.268  99.172  93.163  1.00 20.00 ? 17   SER C O   1 
ATOM   7346  C CB  . SER C 1 17  ? 19.671  100.261 90.450  1.00 20.00 ? 17   SER C CB  1 
ATOM   7347  O OG  . SER C 1 17  ? 19.634  100.476 89.047  1.00 20.00 ? 17   SER C OG  1 
ATOM   7348  N N   . MET C 1 18  ? 22.357  99.140  92.327  1.00 20.00 ? 18   MET C N   1 
ATOM   7349  C CA  . MET C 1 18  ? 22.983  99.231  93.638  1.00 20.00 ? 18   MET C CA  1 
ATOM   7350  C C   . MET C 1 18  ? 23.203  100.688 93.990  1.00 20.00 ? 18   MET C C   1 
ATOM   7351  O O   . MET C 1 18  ? 24.248  101.254 93.669  1.00 20.00 ? 18   MET C O   1 
ATOM   7352  C CB  . MET C 1 18  ? 24.333  98.508  93.635  1.00 20.00 ? 18   MET C CB  1 
ATOM   7353  C CG  . MET C 1 18  ? 24.346  97.207  92.864  1.00 20.00 ? 18   MET C CG  1 
ATOM   7354  S SD  . MET C 1 18  ? 23.959  95.823  93.932  1.00 20.00 ? 18   MET C SD  1 
ATOM   7355  C CE  . MET C 1 18  ? 25.479  95.639  94.821  1.00 20.00 ? 18   MET C CE  1 
ATOM   7356  N N   . ILE C 1 19  ? 22.227  101.306 94.641  1.00 20.00 ? 19   ILE C N   1 
ATOM   7357  C CA  . ILE C 1 19  ? 22.374  102.706 95.012  1.00 20.00 ? 19   ILE C CA  1 
ATOM   7358  C C   . ILE C 1 19  ? 23.237  102.800 96.260  1.00 20.00 ? 19   ILE C C   1 
ATOM   7359  O O   . ILE C 1 19  ? 23.380  101.829 96.995  1.00 20.00 ? 19   ILE C O   1 
ATOM   7360  C CB  . ILE C 1 19  ? 20.999  103.382 95.258  1.00 20.00 ? 19   ILE C CB  1 
ATOM   7361  C CG1 . ILE C 1 19  ? 20.237  102.663 96.372  1.00 20.00 ? 19   ILE C CG1 1 
ATOM   7362  C CG2 . ILE C 1 19  ? 20.188  103.372 93.964  1.00 20.00 ? 19   ILE C CG2 1 
ATOM   7363  C CD1 . ILE C 1 19  ? 18.903  103.302 96.691  1.00 20.00 ? 19   ILE C CD1 1 
ATOM   7364  N N   . SER C 1 20  ? 23.818  103.970 96.494  1.00 20.00 ? 20   SER C N   1 
ATOM   7365  C CA  . SER C 1 20  ? 24.669  104.158 97.656  1.00 20.00 ? 20   SER C CA  1 
ATOM   7366  C C   . SER C 1 20  ? 23.881  104.201 98.952  1.00 20.00 ? 20   SER C C   1 
ATOM   7367  O O   . SER C 1 20  ? 22.647  104.168 98.951  1.00 20.00 ? 20   SER C O   1 
ATOM   7368  C CB  . SER C 1 20  ? 25.494  105.436 97.503  1.00 20.00 ? 20   SER C CB  1 
ATOM   7369  O OG  . SER C 1 20  ? 24.665  106.565 97.293  1.00 20.00 ? 20   SER C OG  1 
ATOM   7370  N N   . ARG C 1 21  ? 24.607  104.263 100.061 1.00 20.00 ? 21   ARG C N   1 
ATOM   7371  C CA  . ARG C 1 21  ? 23.985  104.312 101.370 1.00 20.00 ? 21   ARG C CA  1 
ATOM   7372  C C   . ARG C 1 21  ? 23.315  105.668 101.533 1.00 20.00 ? 21   ARG C C   1 
ATOM   7373  O O   . ARG C 1 21  ? 22.261  105.782 102.160 1.00 20.00 ? 21   ARG C O   1 
ATOM   7374  C CB  . ARG C 1 21  ? 25.038  104.108 102.460 1.00 20.00 ? 21   ARG C CB  1 
ATOM   7375  C CG  . ARG C 1 21  ? 24.694  104.786 103.764 1.00 20.00 ? 21   ARG C CG  1 
ATOM   7376  C CD  . ARG C 1 21  ? 25.674  104.448 104.865 1.00 20.00 ? 21   ARG C CD  1 
ATOM   7377  N NE  . ARG C 1 21  ? 24.966  104.239 106.120 1.00 20.00 ? 21   ARG C NE  1 
ATOM   7378  C CZ  . ARG C 1 21  ? 24.382  105.200 106.828 1.00 20.00 ? 21   ARG C CZ  1 
ATOM   7379  N NH1 . ARG C 1 21  ? 24.424  106.465 106.425 1.00 20.00 ? 21   ARG C NH1 1 
ATOM   7380  N NH2 . ARG C 1 21  ? 23.763  104.892 107.954 1.00 20.00 ? 21   ARG C NH2 1 
ATOM   7381  N N   . ASP C 1 22  ? 23.936  106.694 100.959 1.00 20.00 ? 22   ASP C N   1 
ATOM   7382  C CA  . ASP C 1 22  ? 23.412  108.048 101.031 1.00 20.00 ? 22   ASP C CA  1 
ATOM   7383  C C   . ASP C 1 22  ? 22.084  108.118 100.311 1.00 20.00 ? 22   ASP C C   1 
ATOM   7384  O O   . ASP C 1 22  ? 21.155  108.765 100.785 1.00 20.00 ? 22   ASP C O   1 
ATOM   7385  C CB  . ASP C 1 22  ? 24.394  109.025 100.397 1.00 20.00 ? 22   ASP C CB  1 
ATOM   7386  C CG  . ASP C 1 22  ? 25.338  109.635 101.414 1.00 20.00 ? 22   ASP C CG  1 
ATOM   7387  O OD1 . ASP C 1 22  ? 25.782  108.908 102.332 1.00 20.00 ? 22   ASP C OD1 1 
ATOM   7388  O OD2 . ASP C 1 22  ? 25.632  110.846 101.298 1.00 20.00 ? 22   ASP C OD2 1 
ATOM   7389  N N   . GLU C 1 23  ? 22.005  107.446 99.164  1.00 20.00 ? 23   GLU C N   1 
ATOM   7390  C CA  . GLU C 1 23  ? 20.791  107.415 98.360  1.00 20.00 ? 23   GLU C CA  1 
ATOM   7391  C C   . GLU C 1 23  ? 19.700  106.654 99.107  1.00 20.00 ? 23   GLU C C   1 
ATOM   7392  O O   . GLU C 1 23  ? 18.550  107.085 99.130  1.00 20.00 ? 23   GLU C O   1 
ATOM   7393  C CB  . GLU C 1 23  ? 21.052  106.724 97.025  1.00 20.00 ? 23   GLU C CB  1 
ATOM   7394  C CG  . GLU C 1 23  ? 21.740  107.586 95.987  1.00 20.00 ? 23   GLU C CG  1 
ATOM   7395  C CD  . GLU C 1 23  ? 22.112  106.791 94.741  1.00 20.00 ? 23   GLU C CD  1 
ATOM   7396  O OE1 . GLU C 1 23  ? 21.225  106.564 93.887  1.00 20.00 ? 23   GLU C OE1 1 
ATOM   7397  O OE2 . GLU C 1 23  ? 23.290  106.387 94.613  1.00 20.00 ? 23   GLU C OE2 1 
ATOM   7398  N N   . ARG C 1 24  ? 20.070  105.524 99.712  1.00 20.00 ? 24   ARG C N   1 
ATOM   7399  C CA  . ARG C 1 24  ? 19.134  104.691 100.466 1.00 20.00 ? 24   ARG C CA  1 
ATOM   7400  C C   . ARG C 1 24  ? 18.574  105.450 101.656 1.00 20.00 ? 24   ARG C C   1 
ATOM   7401  O O   . ARG C 1 24  ? 17.410  105.280 102.009 1.00 20.00 ? 24   ARG C O   1 
ATOM   7402  C CB  . ARG C 1 24  ? 19.818  103.418 100.967 1.00 20.00 ? 24   ARG C CB  1 
ATOM   7403  C CG  . ARG C 1 24  ? 20.157  102.447 99.871  1.00 20.00 ? 24   ARG C CG  1 
ATOM   7404  C CD  . ARG C 1 24  ? 20.516  101.081 100.428 1.00 20.00 ? 24   ARG C CD  1 
ATOM   7405  N NE  . ARG C 1 24  ? 21.503  101.158 101.500 1.00 20.00 ? 24   ARG C NE  1 
ATOM   7406  C CZ  . ARG C 1 24  ? 22.767  100.763 101.381 1.00 20.00 ? 24   ARG C CZ  1 
ATOM   7407  N NH1 . ARG C 1 24  ? 23.206  100.260 100.237 1.00 20.00 ? 24   ARG C NH1 1 
ATOM   7408  N NH2 . ARG C 1 24  ? 23.592  100.870 102.409 1.00 20.00 ? 24   ARG C NH2 1 
ATOM   7409  N N   . VAL C 1 25  ? 19.407  106.274 102.288 1.00 20.00 ? 25   VAL C N   1 
ATOM   7410  C CA  . VAL C 1 25  ? 18.957  107.049 103.437 1.00 20.00 ? 25   VAL C CA  1 
ATOM   7411  C C   . VAL C 1 25  ? 17.926  108.072 102.950 1.00 20.00 ? 25   VAL C C   1 
ATOM   7412  O O   . VAL C 1 25  ? 16.931  108.336 103.630 1.00 20.00 ? 25   VAL C O   1 
ATOM   7413  C CB  . VAL C 1 25  ? 20.124  107.791 104.118 1.00 20.00 ? 25   VAL C CB  1 
ATOM   7414  C CG1 . VAL C 1 25  ? 19.585  108.776 105.152 1.00 20.00 ? 25   VAL C CG1 1 
ATOM   7415  C CG2 . VAL C 1 25  ? 21.051  106.795 104.779 1.00 20.00 ? 25   VAL C CG2 1 
ATOM   7416  N N   . LYS C 1 26  ? 18.167  108.641 101.769 1.00 20.00 ? 26   LYS C N   1 
ATOM   7417  C CA  . LYS C 1 26  ? 17.251  109.624 101.205 1.00 20.00 ? 26   LYS C CA  1 
ATOM   7418  C C   . LYS C 1 26  ? 15.946  108.925 100.840 1.00 20.00 ? 26   LYS C C   1 
ATOM   7419  O O   . LYS C 1 26  ? 14.854  109.420 101.111 1.00 20.00 ? 26   LYS C O   1 
ATOM   7420  C CB  . LYS C 1 26  ? 17.869  110.278 99.967  1.00 20.00 ? 26   LYS C CB  1 
ATOM   7421  C CG  . LYS C 1 26  ? 18.878  111.371 100.303 1.00 20.00 ? 26   LYS C CG  1 
ATOM   7422  C CD  . LYS C 1 26  ? 19.181  112.287 99.122  1.00 20.00 ? 26   LYS C CD  1 
ATOM   7423  C CE  . LYS C 1 26  ? 19.697  111.523 97.903  1.00 20.00 ? 26   LYS C CE  1 
ATOM   7424  N NZ  . LYS C 1 26  ? 20.995  112.057 97.382  1.00 20.00 ? 26   LYS C NZ  1 
ATOM   7425  N N   . LYS C 1 27  ? 16.066  107.755 100.235 1.00 20.00 ? 27   LYS C N   1 
ATOM   7426  C CA  . LYS C 1 27  ? 14.896  107.000 99.844  1.00 20.00 ? 27   LYS C CA  1 
ATOM   7427  C C   . LYS C 1 27  ? 14.061  106.632 101.069 1.00 20.00 ? 27   LYS C C   1 
ATOM   7428  O O   . LYS C 1 27  ? 12.842  106.802 101.071 1.00 20.00 ? 27   LYS C O   1 
ATOM   7429  C CB  . LYS C 1 27  ? 15.321  105.742 99.086  1.00 20.00 ? 27   LYS C CB  1 
ATOM   7430  C CG  . LYS C 1 27  ? 15.088  105.836 97.595  1.00 20.00 ? 27   LYS C CG  1 
ATOM   7431  C CD  . LYS C 1 27  ? 16.377  106.103 96.846  1.00 20.00 ? 27   LYS C CD  1 
ATOM   7432  C CE  . LYS C 1 27  ? 16.139  106.286 95.351  1.00 20.00 ? 27   LYS C CE  1 
ATOM   7433  N NZ  . LYS C 1 27  ? 14.995  107.193 95.087  1.00 20.00 ? 27   LYS C NZ  1 
ATOM   7434  N N   . MET C 1 28  ? 14.718  106.138 102.114 1.00 20.00 ? 28   MET C N   1 
ATOM   7435  C CA  . MET C 1 28  ? 14.020  105.752 103.340 1.00 20.00 ? 28   MET C CA  1 
ATOM   7436  C C   . MET C 1 28  ? 13.268  106.953 103.924 1.00 20.00 ? 28   MET C C   1 
ATOM   7437  O O   . MET C 1 28  ? 12.128  106.834 104.371 1.00 20.00 ? 28   MET C O   1 
ATOM   7438  C CB  . MET C 1 28  ? 15.023  105.206 104.363 1.00 20.00 ? 28   MET C CB  1 
ATOM   7439  C CG  . MET C 1 28  ? 14.405  104.401 105.501 1.00 20.00 ? 28   MET C CG  1 
ATOM   7440  S SD  . MET C 1 28  ? 13.242  103.134 104.967 1.00 20.00 ? 28   MET C SD  1 
ATOM   7441  C CE  . MET C 1 28  ? 14.070  101.726 105.374 1.00 20.00 ? 28   MET C CE  1 
ATOM   7442  N N   . GLN C 1 29  ? 13.925  108.106 103.918 1.00 20.00 ? 29   GLN C N   1 
ATOM   7443  C CA  . GLN C 1 29  ? 13.353  109.338 104.430 1.00 20.00 ? 29   GLN C CA  1 
ATOM   7444  C C   . GLN C 1 29  ? 12.060  109.632 103.698 1.00 20.00 ? 29   GLN C C   1 
ATOM   7445  O O   . GLN C 1 29  ? 11.028  109.898 104.309 1.00 20.00 ? 29   GLN C O   1 
ATOM   7446  C CB  . GLN C 1 29  ? 14.300  110.494 104.156 1.00 20.00 ? 29   GLN C CB  1 
ATOM   7447  C CG  . GLN C 1 29  ? 15.099  110.990 105.322 1.00 20.00 ? 29   GLN C CG  1 
ATOM   7448  C CD  . GLN C 1 29  ? 15.709  112.345 105.018 1.00 20.00 ? 29   GLN C CD  1 
ATOM   7449  O OE1 . GLN C 1 29  ? 16.680  112.451 104.263 1.00 20.00 ? 29   GLN C OE1 1 
ATOM   7450  N NE2 . GLN C 1 29  ? 15.134  113.392 105.594 1.00 20.00 ? 29   GLN C NE2 1 
ATOM   7451  N N   . GLU C 1 30  ? 12.144  109.600 102.372 1.00 20.00 ? 30   GLU C N   1 
ATOM   7452  C CA  . GLU C 1 30  ? 11.005  109.863 101.504 1.00 20.00 ? 30   GLU C CA  1 
ATOM   7453  C C   . GLU C 1 30  ? 9.862   108.880 101.657 1.00 20.00 ? 30   GLU C C   1 
ATOM   7454  O O   . GLU C 1 30  ? 8.735   109.183 101.296 1.00 20.00 ? 30   GLU C O   1 
ATOM   7455  C CB  . GLU C 1 30  ? 11.462  109.883 100.050 1.00 20.00 ? 30   GLU C CB  1 
ATOM   7456  C CG  . GLU C 1 30  ? 12.468  110.973 99.751  1.00 20.00 ? 30   GLU C CG  1 
ATOM   7457  C CD  . GLU C 1 30  ? 12.678  111.170 98.266  1.00 20.00 ? 30   GLU C CD  1 
ATOM   7458  O OE1 . GLU C 1 30  ? 12.553  110.178 97.510  1.00 20.00 ? 30   GLU C OE1 1 
ATOM   7459  O OE2 . GLU C 1 30  ? 12.966  112.319 97.861  1.00 20.00 ? 30   GLU C OE2 1 
ATOM   7460  N N   . ALA C 1 31  ? 10.158  107.699 102.184 1.00 20.00 ? 31   ALA C N   1 
ATOM   7461  C CA  . ALA C 1 31  ? 9.145   106.677 102.381 1.00 20.00 ? 31   ALA C CA  1 
ATOM   7462  C C   . ALA C 1 31  ? 8.593   106.746 103.798 1.00 20.00 ? 31   ALA C C   1 
ATOM   7463  O O   . ALA C 1 31  ? 7.905   105.828 104.239 1.00 20.00 ? 31   ALA C O   1 
ATOM   7464  C CB  . ALA C 1 31  ? 9.743   105.306 102.128 1.00 20.00 ? 31   ALA C CB  1 
ATOM   7465  N N   . GLY C 1 32  ? 8.912   107.830 104.508 1.00 20.00 ? 32   GLY C N   1 
ATOM   7466  C CA  . GLY C 1 32  ? 8.445   108.012 105.876 1.00 20.00 ? 32   GLY C CA  1 
ATOM   7467  C C   . GLY C 1 32  ? 8.991   106.972 106.837 1.00 20.00 ? 32   GLY C C   1 
ATOM   7468  O O   . GLY C 1 32  ? 8.379   106.666 107.861 1.00 20.00 ? 32   GLY C O   1 
ATOM   7469  N N   . TYR C 1 33  ? 10.155  106.433 106.503 1.00 20.00 ? 33   TYR C N   1 
ATOM   7470  C CA  . TYR C 1 33  ? 10.805  105.417 107.320 1.00 20.00 ? 33   TYR C CA  1 
ATOM   7471  C C   . TYR C 1 33  ? 9.967   104.155 107.438 1.00 20.00 ? 33   TYR C C   1 
ATOM   7472  O O   . TYR C 1 33  ? 10.101  103.396 108.400 1.00 20.00 ? 33   TYR C O   1 
ATOM   7473  C CB  . TYR C 1 33  ? 11.135  105.977 108.706 1.00 20.00 ? 33   TYR C CB  1 
ATOM   7474  C CG  . TYR C 1 33  ? 12.204  107.037 108.640 1.00 20.00 ? 33   TYR C CG  1 
ATOM   7475  C CD1 . TYR C 1 33  ? 13.507  106.715 108.252 1.00 20.00 ? 33   TYR C CD1 1 
ATOM   7476  C CD2 . TYR C 1 33  ? 11.903  108.371 108.900 1.00 20.00 ? 33   TYR C CD2 1 
ATOM   7477  C CE1 . TYR C 1 33  ? 14.483  107.699 108.120 1.00 20.00 ? 33   TYR C CE1 1 
ATOM   7478  C CE2 . TYR C 1 33  ? 12.868  109.357 108.773 1.00 20.00 ? 33   TYR C CE2 1 
ATOM   7479  C CZ  . TYR C 1 33  ? 14.155  109.017 108.382 1.00 20.00 ? 33   TYR C CZ  1 
ATOM   7480  O OH  . TYR C 1 33  ? 15.107  109.999 108.256 1.00 20.00 ? 33   TYR C OH  1 
ATOM   7481  N N   . ASN C 1 34  ? 9.098   103.950 106.451 1.00 20.00 ? 34   ASN C N   1 
ATOM   7482  C CA  . ASN C 1 34  ? 8.219   102.788 106.393 1.00 20.00 ? 34   ASN C CA  1 
ATOM   7483  C C   . ASN C 1 34  ? 8.680   101.987 105.174 1.00 20.00 ? 34   ASN C C   1 
ATOM   7484  O O   . ASN C 1 34  ? 8.657   102.489 104.059 1.00 20.00 ? 34   ASN C O   1 
ATOM   7485  C CB  . ASN C 1 34  ? 6.767   103.241 106.216 1.00 20.00 ? 34   ASN C CB  1 
ATOM   7486  C CG  . ASN C 1 34  ? 5.787   102.086 106.228 1.00 20.00 ? 34   ASN C CG  1 
ATOM   7487  O OD1 . ASN C 1 34  ? 6.173   100.926 106.105 1.00 20.00 ? 34   ASN C OD1 1 
ATOM   7488  N ND2 . ASN C 1 34  ? 4.505   102.402 106.371 1.00 20.00 ? 34   ASN C ND2 1 
ATOM   7489  N N   . THR C 1 35  ? 9.112   100.750 105.384 1.00 20.00 ? 35   THR C N   1 
ATOM   7490  C CA  . THR C 1 35  ? 9.575   99.920  104.278 1.00 20.00 ? 35   THR C CA  1 
ATOM   7491  C C   . THR C 1 35  ? 8.482   99.534  103.291 1.00 20.00 ? 35   THR C C   1 
ATOM   7492  O O   . THR C 1 35  ? 8.776   99.119  102.172 1.00 20.00 ? 35   THR C O   1 
ATOM   7493  C CB  . THR C 1 35  ? 10.213  98.626  104.781 1.00 20.00 ? 35   THR C CB  1 
ATOM   7494  O OG1 . THR C 1 35  ? 9.261   97.907  105.572 1.00 20.00 ? 35   THR C OG1 1 
ATOM   7495  C CG2 . THR C 1 35  ? 11.441  98.931  105.608 1.00 20.00 ? 35   THR C CG2 1 
ATOM   7496  N N   . PHE C 1 36  ? 7.225   99.654  103.706 1.00 20.00 ? 36   PHE C N   1 
ATOM   7497  C CA  . PHE C 1 36  ? 6.106   99.309  102.832 1.00 20.00 ? 36   PHE C CA  1 
ATOM   7498  C C   . PHE C 1 36  ? 5.919   100.364 101.751 1.00 20.00 ? 36   PHE C C   1 
ATOM   7499  O O   . PHE C 1 36  ? 5.227   100.136 100.763 1.00 20.00 ? 36   PHE C O   1 
ATOM   7500  C CB  . PHE C 1 36  ? 4.812   99.176  103.646 1.00 20.00 ? 36   PHE C CB  1 
ATOM   7501  C CG  . PHE C 1 36  ? 4.274   97.763  103.720 1.00 20.00 ? 36   PHE C CG  1 
ATOM   7502  C CD1 . PHE C 1 36  ? 3.722   97.154  102.593 1.00 20.00 ? 36   PHE C CD1 1 
ATOM   7503  C CD2 . PHE C 1 36  ? 4.293   97.055  104.925 1.00 20.00 ? 36   PHE C CD2 1 
ATOM   7504  C CE1 . PHE C 1 36  ? 3.194   95.862  102.662 1.00 20.00 ? 36   PHE C CE1 1 
ATOM   7505  C CE2 . PHE C 1 36  ? 3.767   95.761  105.005 1.00 20.00 ? 36   PHE C CE2 1 
ATOM   7506  C CZ  . PHE C 1 36  ? 3.217   95.166  103.870 1.00 20.00 ? 36   PHE C CZ  1 
ATOM   7507  N N   . LEU C 1 37  ? 6.556   101.515 101.942 1.00 20.00 ? 37   LEU C N   1 
ATOM   7508  C CA  . LEU C 1 37  ? 6.463   102.617 100.994 1.00 20.00 ? 37   LEU C CA  1 
ATOM   7509  C C   . LEU C 1 37  ? 7.656   102.725 100.054 1.00 20.00 ? 37   LEU C C   1 
ATOM   7510  O O   . LEU C 1 37  ? 7.709   103.628 99.223  1.00 20.00 ? 37   LEU C O   1 
ATOM   7511  C CB  . LEU C 1 37  ? 6.295   103.935 101.747 1.00 20.00 ? 37   LEU C CB  1 
ATOM   7512  C CG  . LEU C 1 37  ? 4.882   104.479 101.979 1.00 20.00 ? 37   LEU C CG  1 
ATOM   7513  C CD1 . LEU C 1 37  ? 3.880   103.349 102.076 1.00 20.00 ? 37   LEU C CD1 1 
ATOM   7514  C CD2 . LEU C 1 37  ? 4.872   105.298 103.251 1.00 20.00 ? 37   LEU C CD2 1 
ATOM   7515  N N   . LEU C 1 38  ? 8.613   101.814 100.178 1.00 20.00 ? 38   LEU C N   1 
ATOM   7516  C CA  . LEU C 1 38  ? 9.783   101.848 99.311  1.00 20.00 ? 38   LEU C CA  1 
ATOM   7517  C C   . LEU C 1 38  ? 9.434   101.312 97.919  1.00 20.00 ? 38   LEU C C   1 
ATOM   7518  O O   . LEU C 1 38  ? 8.578   100.440 97.779  1.00 20.00 ? 38   LEU C O   1 
ATOM   7519  C CB  . LEU C 1 38  ? 10.917  101.003 99.905  1.00 20.00 ? 38   LEU C CB  1 
ATOM   7520  C CG  . LEU C 1 38  ? 11.736  101.586 101.061 1.00 20.00 ? 38   LEU C CG  1 
ATOM   7521  C CD1 . LEU C 1 38  ? 12.618  100.487 101.615 1.00 20.00 ? 38   LEU C CD1 1 
ATOM   7522  C CD2 . LEU C 1 38  ? 12.576  102.771 100.592 1.00 20.00 ? 38   LEU C CD2 1 
ATOM   7523  N N   . ASN C 1 39  ? 10.090  101.842 96.890  1.00 20.00 ? 39   ASN C N   1 
ATOM   7524  C CA  . ASN C 1 39  ? 9.834   101.390 95.528  1.00 20.00 ? 39   ASN C CA  1 
ATOM   7525  C C   . ASN C 1 39  ? 10.618  100.109 95.350  1.00 20.00 ? 39   ASN C C   1 
ATOM   7526  O O   . ASN C 1 39  ? 11.778  100.045 95.736  1.00 20.00 ? 39   ASN C O   1 
ATOM   7527  C CB  . ASN C 1 39  ? 10.331  102.412 94.510  1.00 20.00 ? 39   ASN C CB  1 
ATOM   7528  C CG  . ASN C 1 39  ? 9.477   103.652 94.468  1.00 20.00 ? 39   ASN C CG  1 
ATOM   7529  O OD1 . ASN C 1 39  ? 8.295   103.620 94.796  1.00 20.00 ? 39   ASN C OD1 1 
ATOM   7530  N ND2 . ASN C 1 39  ? 10.079  104.763 94.065  1.00 20.00 ? 39   ASN C ND2 1 
ATOM   7531  N N   . SER C 1 40  ? 9.995   99.090  94.767  1.00 20.00 ? 40   SER C N   1 
ATOM   7532  C CA  . SER C 1 40  ? 10.672  97.816  94.555  1.00 20.00 ? 40   SER C CA  1 
ATOM   7533  C C   . SER C 1 40  ? 12.010  98.020  93.844  1.00 20.00 ? 40   SER C C   1 
ATOM   7534  O O   . SER C 1 40  ? 12.971  97.302  94.105  1.00 20.00 ? 40   SER C O   1 
ATOM   7535  C CB  . SER C 1 40  ? 9.781   96.880  93.721  1.00 20.00 ? 40   SER C CB  1 
ATOM   7536  O OG  . SER C 1 40  ? 10.487  95.723  93.282  1.00 20.00 ? 40   SER C OG  1 
ATOM   7537  N N   . LYS C 1 41  ? 12.066  99.012  92.956  1.00 20.00 ? 41   LYS C N   1 
ATOM   7538  C CA  . LYS C 1 41  ? 13.278  99.323  92.190  1.00 20.00 ? 41   LYS C CA  1 
ATOM   7539  C C   . LYS C 1 41  ? 14.473  99.866  92.984  1.00 20.00 ? 41   LYS C C   1 
ATOM   7540  O O   . LYS C 1 41  ? 15.606  99.835  92.502  1.00 20.00 ? 41   LYS C O   1 
ATOM   7541  C CB  . LYS C 1 41  ? 12.934  100.297 91.055  1.00 20.00 ? 41   LYS C CB  1 
ATOM   7542  C CG  . LYS C 1 41  ? 12.358  101.621 91.524  1.00 20.00 ? 41   LYS C CG  1 
ATOM   7543  C CD  . LYS C 1 41  ? 12.106  102.558 90.356  1.00 20.00 ? 41   LYS C CD  1 
ATOM   7544  C CE  . LYS C 1 41  ? 12.553  103.973 90.678  1.00 20.00 ? 41   LYS C CE  1 
ATOM   7545  N NZ  . LYS C 1 41  ? 14.027  104.102 90.576  1.00 20.00 ? 41   LYS C NZ  1 
ATOM   7546  N N   . ASP C 1 42  ? 14.229  100.346 94.196  1.00 20.00 ? 42   ASP C N   1 
ATOM   7547  C CA  . ASP C 1 42  ? 15.297  100.884 95.028  1.00 20.00 ? 42   ASP C CA  1 
ATOM   7548  C C   . ASP C 1 42  ? 15.751  99.864  96.059  1.00 20.00 ? 42   ASP C C   1 
ATOM   7549  O O   . ASP C 1 42  ? 16.481  100.190 96.996  1.00 20.00 ? 42   ASP C O   1 
ATOM   7550  C CB  . ASP C 1 42  ? 14.804  102.130 95.757  1.00 20.00 ? 42   ASP C CB  1 
ATOM   7551  C CG  . ASP C 1 42  ? 14.369  103.205 94.814  1.00 20.00 ? 42   ASP C CG  1 
ATOM   7552  O OD1 . ASP C 1 42  ? 15.075  103.417 93.808  1.00 20.00 ? 42   ASP C OD1 1 
ATOM   7553  O OD2 . ASP C 1 42  ? 13.326  103.833 95.077  1.00 20.00 ? 42   ASP C OD2 1 
ATOM   7554  N N   . ILE C 1 43  ? 15.331  98.623  95.880  1.00 20.00 ? 43   ILE C N   1 
ATOM   7555  C CA  . ILE C 1 43  ? 15.694  97.580  96.812  1.00 20.00 ? 43   ILE C CA  1 
ATOM   7556  C C   . ILE C 1 43  ? 16.590  96.525  96.180  1.00 20.00 ? 43   ILE C C   1 
ATOM   7557  O O   . ILE C 1 43  ? 16.326  96.043  95.079  1.00 20.00 ? 43   ILE C O   1 
ATOM   7558  C CB  . ILE C 1 43  ? 14.399  96.918  97.399  1.00 20.00 ? 43   ILE C CB  1 
ATOM   7559  C CG1 . ILE C 1 43  ? 13.540  97.991  98.072  1.00 20.00 ? 43   ILE C CG1 1 
ATOM   7560  C CG2 . ILE C 1 43  ? 14.751  95.833  98.413  1.00 20.00 ? 43   ILE C CG2 1 
ATOM   7561  C CD1 . ILE C 1 43  ? 12.128  97.570  98.350  1.00 20.00 ? 43   ILE C CD1 1 
ATOM   7562  N N   . TYR C 1 44  ? 17.662  96.187  96.891  1.00 20.00 ? 44   TYR C N   1 
ATOM   7563  C CA  . TYR C 1 44  ? 18.622  95.192  96.445  1.00 20.00 ? 44   TYR C CA  1 
ATOM   7564  C C   . TYR C 1 44  ? 18.072  93.804  96.786  1.00 20.00 ? 44   TYR C C   1 
ATOM   7565  O O   . TYR C 1 44  ? 17.890  92.967  95.905  1.00 20.00 ? 44   TYR C O   1 
ATOM   7566  C CB  . TYR C 1 44  ? 19.963  95.439  97.145  1.00 20.00 ? 44   TYR C CB  1 
ATOM   7567  C CG  . TYR C 1 44  ? 21.064  94.440  96.850  1.00 20.00 ? 44   TYR C CG  1 
ATOM   7568  C CD1 . TYR C 1 44  ? 21.109  93.738  95.665  1.00 20.00 ? 44   TYR C CD1 1 
ATOM   7569  C CD2 . TYR C 1 44  ? 22.068  94.209  97.763  1.00 20.00 ? 44   TYR C CD2 1 
ATOM   7570  C CE1 . TYR C 1 44  ? 22.131  92.830  95.405  1.00 20.00 ? 44   TYR C CE1 1 
ATOM   7571  C CE2 . TYR C 1 44  ? 23.085  93.310  97.510  1.00 20.00 ? 44   TYR C CE2 1 
ATOM   7572  C CZ  . TYR C 1 44  ? 23.114  92.623  96.336  1.00 20.00 ? 44   TYR C CZ  1 
ATOM   7573  O OH  . TYR C 1 44  ? 24.128  91.725  96.102  1.00 20.00 ? 44   TYR C OH  1 
ATOM   7574  N N   . ILE C 1 45  ? 17.798  93.561  98.064  1.00 20.00 ? 45   ILE C N   1 
ATOM   7575  C CA  . ILE C 1 45  ? 17.266  92.273  98.502  1.00 20.00 ? 45   ILE C CA  1 
ATOM   7576  C C   . ILE C 1 45  ? 15.911  92.531  99.174  1.00 20.00 ? 45   ILE C C   1 
ATOM   7577  O O   . ILE C 1 45  ? 15.827  93.237  100.183 1.00 20.00 ? 45   ILE C O   1 
ATOM   7578  C CB  . ILE C 1 45  ? 18.252  91.580  99.468  1.00 20.00 ? 45   ILE C CB  1 
ATOM   7579  C CG1 . ILE C 1 45  ? 19.612  91.419  98.782  1.00 20.00 ? 45   ILE C CG1 1 
ATOM   7580  C CG2 . ILE C 1 45  ? 17.761  90.195  99.822  1.00 20.00 ? 45   ILE C CG2 1 
ATOM   7581  C CD1 . ILE C 1 45  ? 20.742  91.059  99.715  1.00 20.00 ? 45   ILE C CD1 1 
ATOM   7582  N N   . ASP C 1 46  ? 14.847  91.974  98.595  1.00 20.00 ? 46   ASP C N   1 
ATOM   7583  C CA  . ASP C 1 46  ? 13.498  92.150  99.124  1.00 20.00 ? 46   ASP C CA  1 
ATOM   7584  C C   . ASP C 1 46  ? 13.010  90.941  99.897  1.00 20.00 ? 46   ASP C C   1 
ATOM   7585  O O   . ASP C 1 46  ? 12.622  89.945  99.304  1.00 20.00 ? 46   ASP C O   1 
ATOM   7586  C CB  . ASP C 1 46  ? 12.530  92.442  97.965  1.00 20.00 ? 46   ASP C CB  1 
ATOM   7587  C CG  . ASP C 1 46  ? 11.271  93.193  98.404  1.00 20.00 ? 46   ASP C CG  1 
ATOM   7588  O OD1 . ASP C 1 46  ? 11.060  93.349  99.615  1.00 20.00 ? 46   ASP C OD1 1 
ATOM   7589  O OD2 . ASP C 1 46  ? 10.487  93.629  97.530  1.00 20.00 ? 46   ASP C OD2 1 
ATOM   7590  N N   . LEU C 1 47  ? 13.028  91.034  101.224 1.00 20.00 ? 47   LEU C N   1 
ATOM   7591  C CA  . LEU C 1 47  ? 12.576  89.940  102.074 1.00 20.00 ? 47   LEU C CA  1 
ATOM   7592  C C   . LEU C 1 47  ? 11.262  90.338  102.748 1.00 20.00 ? 47   LEU C C   1 
ATOM   7593  O O   . LEU C 1 47  ? 10.974  89.965  103.888 1.00 20.00 ? 47   LEU C O   1 
ATOM   7594  C CB  . LEU C 1 47  ? 13.640  89.596  103.120 1.00 20.00 ? 47   LEU C CB  1 
ATOM   7595  C CG  . LEU C 1 47  ? 15.031  89.300  102.549 1.00 20.00 ? 47   LEU C CG  1 
ATOM   7596  C CD1 . LEU C 1 47  ? 16.003  88.989  103.669 1.00 20.00 ? 47   LEU C CD1 1 
ATOM   7597  C CD2 . LEU C 1 47  ? 14.940  88.130  101.594 1.00 20.00 ? 47   LEU C CD2 1 
ATOM   7598  N N   . LEU C 1 48  ? 10.459  91.104  102.021 1.00 20.00 ? 48   LEU C N   1 
ATOM   7599  C CA  . LEU C 1 48  ? 9.173   91.559  102.525 1.00 20.00 ? 48   LEU C CA  1 
ATOM   7600  C C   . LEU C 1 48  ? 8.264   90.347  102.727 1.00 20.00 ? 48   LEU C C   1 
ATOM   7601  O O   . LEU C 1 48  ? 7.663   90.181  103.787 1.00 20.00 ? 48   LEU C O   1 
ATOM   7602  C CB  . LEU C 1 48  ? 8.538   92.535  101.524 1.00 20.00 ? 48   LEU C CB  1 
ATOM   7603  C CG  . LEU C 1 48  ? 7.719   93.742  101.993 1.00 20.00 ? 48   LEU C CG  1 
ATOM   7604  C CD1 . LEU C 1 48  ? 6.334   93.646  101.412 1.00 20.00 ? 48   LEU C CD1 1 
ATOM   7605  C CD2 . LEU C 1 48  ? 7.661   93.811  103.502 1.00 20.00 ? 48   LEU C CD2 1 
ATOM   7606  N N   . THR C 1 49  ? 8.199   89.489  101.710 1.00 20.00 ? 49   THR C N   1 
ATOM   7607  C CA  . THR C 1 49  ? 7.365   88.286  101.751 1.00 20.00 ? 49   THR C CA  1 
ATOM   7608  C C   . THR C 1 49  ? 7.864   87.206  100.798 1.00 20.00 ? 49   THR C C   1 
ATOM   7609  O O   . THR C 1 49  ? 8.588   87.490  99.851  1.00 20.00 ? 49   THR C O   1 
ATOM   7610  C CB  . THR C 1 49  ? 5.895   88.628  101.347 1.00 20.00 ? 49   THR C CB  1 
ATOM   7611  O OG1 . THR C 1 49  ? 5.095   87.440  101.366 1.00 20.00 ? 49   THR C OG1 1 
ATOM   7612  C CG2 . THR C 1 49  ? 5.846   89.201  99.944  1.00 20.00 ? 49   THR C CG2 1 
ATOM   7613  N N   . ASP C 1 50  ? 7.469   85.963  101.065 1.00 20.00 ? 50   ASP C N   1 
ATOM   7614  C CA  . ASP C 1 50  ? 7.846   84.822  100.238 1.00 20.00 ? 50   ASP C CA  1 
ATOM   7615  C C   . ASP C 1 50  ? 6.602   84.487  99.422  1.00 20.00 ? 50   ASP C C   1 
ATOM   7616  O O   . ASP C 1 50  ? 6.503   83.404  98.846  1.00 20.00 ? 50   ASP C O   1 
ATOM   7617  C CB  . ASP C 1 50  ? 8.191   83.604  101.103 1.00 20.00 ? 50   ASP C CB  1 
ATOM   7618  C CG  . ASP C 1 50  ? 6.977   83.053  101.857 1.00 20.00 ? 50   ASP C CG  1 
ATOM   7619  O OD1 . ASP C 1 50  ? 6.164   83.865  102.341 1.00 20.00 ? 50   ASP C OD1 1 
ATOM   7620  O OD2 . ASP C 1 50  ? 6.837   81.817  101.975 1.00 20.00 ? 50   ASP C OD2 1 
ATOM   7621  N N   . SER C 1 51  ? 5.654   85.424  99.386  1.00 20.00 ? 51   SER C N   1 
ATOM   7622  C CA  . SER C 1 51  ? 4.404   85.231  98.653  1.00 20.00 ? 51   SER C CA  1 
ATOM   7623  C C   . SER C 1 51  ? 4.389   85.761  97.235  1.00 20.00 ? 51   SER C C   1 
ATOM   7624  O O   . SER C 1 51  ? 4.367   86.960  97.028  1.00 20.00 ? 51   SER C O   1 
ATOM   7625  C CB  . SER C 1 51  ? 3.243   85.869  99.415  1.00 20.00 ? 51   SER C CB  1 
ATOM   7626  O OG  . SER C 1 51  ? 2.003   85.485  98.837  1.00 20.00 ? 51   SER C OG  1 
ATOM   7627  N N   . GLY C 1 52  ? 4.380   84.851  96.268  1.00 20.00 ? 52   GLY C N   1 
ATOM   7628  C CA  . GLY C 1 52  ? 4.360   85.238  94.871  1.00 20.00 ? 52   GLY C CA  1 
ATOM   7629  C C   . GLY C 1 52  ? 5.638   85.872  94.364  1.00 20.00 ? 52   GLY C C   1 
ATOM   7630  O O   . GLY C 1 52  ? 5.663   86.409  93.257  1.00 20.00 ? 52   GLY C O   1 
ATOM   7631  N N   . THR C 1 53  ? 6.701   85.801  95.161  1.00 20.00 ? 53   THR C N   1 
ATOM   7632  C CA  . THR C 1 53  ? 7.978   86.381  94.784  1.00 20.00 ? 53   THR C CA  1 
ATOM   7633  C C   . THR C 1 53  ? 8.986   85.327  94.355  1.00 20.00 ? 53   THR C C   1 
ATOM   7634  O O   . THR C 1 53  ? 10.167  85.632  94.188  1.00 20.00 ? 53   THR C O   1 
ATOM   7635  C CB  . THR C 1 53  ? 8.580   87.175  95.951  1.00 20.00 ? 53   THR C CB  1 
ATOM   7636  O OG1 . THR C 1 53  ? 8.410   86.434  97.160  1.00 20.00 ? 53   THR C OG1 1 
ATOM   7637  C CG2 . THR C 1 53  ? 7.895   88.522  96.102  1.00 20.00 ? 53   THR C CG2 1 
ATOM   7638  N N   . ASN C 1 54  ? 8.522   84.095  94.170  1.00 20.00 ? 54   ASN C N   1 
ATOM   7639  C CA  . ASN C 1 54  ? 9.388   82.988  93.760  1.00 20.00 ? 54   ASN C CA  1 
ATOM   7640  C C   . ASN C 1 54  ? 9.914   83.060  92.338  1.00 20.00 ? 54   ASN C C   1 
ATOM   7641  O O   . ASN C 1 54  ? 9.358   83.747  91.489  1.00 20.00 ? 54   ASN C O   1 
ATOM   7642  C CB  . ASN C 1 54  ? 8.653   81.672  93.914  1.00 20.00 ? 54   ASN C CB  1 
ATOM   7643  C CG  . ASN C 1 54  ? 7.903   81.586  95.208  1.00 20.00 ? 54   ASN C CG  1 
ATOM   7644  O OD1 . ASN C 1 54  ? 8.498   81.645  96.284  1.00 20.00 ? 54   ASN C OD1 1 
ATOM   7645  N ND2 . ASN C 1 54  ? 6.585   81.448  95.120  1.00 20.00 ? 54   ASN C ND2 1 
ATOM   7646  N N   . ALA C 1 55  ? 10.988  82.327  92.079  1.00 20.00 ? 55   ALA C N   1 
ATOM   7647  C CA  . ALA C 1 55  ? 11.574  82.314  90.755  1.00 20.00 ? 55   ALA C CA  1 
ATOM   7648  C C   . ALA C 1 55  ? 11.070  81.043  90.120  1.00 20.00 ? 55   ALA C C   1 
ATOM   7649  O O   . ALA C 1 55  ? 11.113  79.988  90.748  1.00 20.00 ? 55   ALA C O   1 
ATOM   7650  C CB  . ALA C 1 55  ? 13.089  82.303  90.841  1.00 20.00 ? 55   ALA C CB  1 
ATOM   7651  N N   . MET C 1 56  ? 10.568  81.152  88.890  1.00 20.00 ? 56   MET C N   1 
ATOM   7652  C CA  . MET C 1 56  ? 10.046  80.000  88.161  1.00 20.00 ? 56   MET C CA  1 
ATOM   7653  C C   . MET C 1 56  ? 11.176  79.367  87.361  1.00 20.00 ? 56   MET C C   1 
ATOM   7654  O O   . MET C 1 56  ? 12.219  79.985  87.163  1.00 20.00 ? 56   MET C O   1 
ATOM   7655  C CB  . MET C 1 56  ? 8.921   80.428  87.208  1.00 20.00 ? 56   MET C CB  1 
ATOM   7656  C CG  . MET C 1 56  ? 7.670   80.947  87.888  1.00 20.00 ? 56   MET C CG  1 
ATOM   7657  S SD  . MET C 1 56  ? 6.229   80.922  86.801  1.00 20.00 ? 56   MET C SD  1 
ATOM   7658  C CE  . MET C 1 56  ? 6.565   82.352  85.819  1.00 20.00 ? 56   MET C CE  1 
ATOM   7659  N N   . SER C 1 57  ? 10.966  78.140  86.900  1.00 20.00 ? 57   SER C N   1 
ATOM   7660  C CA  . SER C 1 57  ? 11.979  77.443  86.125  1.00 20.00 ? 57   SER C CA  1 
ATOM   7661  C C   . SER C 1 57  ? 11.784  77.673  84.635  1.00 20.00 ? 57   SER C C   1 
ATOM   7662  O O   . SER C 1 57  ? 10.842  78.350  84.216  1.00 20.00 ? 57   SER C O   1 
ATOM   7663  C CB  . SER C 1 57  ? 11.919  75.947  86.408  1.00 20.00 ? 57   SER C CB  1 
ATOM   7664  O OG  . SER C 1 57  ? 10.702  75.413  85.925  1.00 20.00 ? 57   SER C OG  1 
ATOM   7665  N N   . ASP C 1 58  ? 12.687  77.112  83.835  1.00 20.00 ? 58   ASP C N   1 
ATOM   7666  C CA  . ASP C 1 58  ? 12.591  77.262  82.394  1.00 20.00 ? 58   ASP C CA  1 
ATOM   7667  C C   . ASP C 1 58  ? 11.397  76.454  81.887  1.00 20.00 ? 58   ASP C C   1 
ATOM   7668  O O   . ASP C 1 58  ? 10.727  76.869  80.950  1.00 20.00 ? 58   ASP C O   1 
ATOM   7669  C CB  . ASP C 1 58  ? 13.886  76.801  81.702  1.00 20.00 ? 58   ASP C CB  1 
ATOM   7670  C CG  . ASP C 1 58  ? 14.398  75.470  82.219  1.00 20.00 ? 58   ASP C CG  1 
ATOM   7671  O OD1 . ASP C 1 58  ? 13.957  75.008  83.294  1.00 20.00 ? 58   ASP C OD1 1 
ATOM   7672  O OD2 . ASP C 1 58  ? 15.263  74.884  81.539  1.00 20.00 ? 58   ASP C OD2 1 
ATOM   7673  N N   . LYS C 1 59  ? 11.134  75.309  82.520  1.00 20.00 ? 59   LYS C N   1 
ATOM   7674  C CA  . LYS C 1 59  ? 10.018  74.452  82.131  1.00 20.00 ? 59   LYS C CA  1 
ATOM   7675  C C   . LYS C 1 59  ? 8.709   75.169  82.419  1.00 20.00 ? 59   LYS C C   1 
ATOM   7676  O O   . LYS C 1 59  ? 7.740   75.014  81.687  1.00 20.00 ? 59   LYS C O   1 
ATOM   7677  C CB  . LYS C 1 59  ? 10.045  73.121  82.897  1.00 20.00 ? 59   LYS C CB  1 
ATOM   7678  C CG  . LYS C 1 59  ? 11.372  72.391  82.868  1.00 20.00 ? 59   LYS C CG  1 
ATOM   7679  C CD  . LYS C 1 59  ? 11.604  71.719  81.529  1.00 20.00 ? 59   LYS C CD  1 
ATOM   7680  C CE  . LYS C 1 59  ? 12.922  70.956  81.521  1.00 20.00 ? 59   LYS C CE  1 
ATOM   7681  N NZ  . LYS C 1 59  ? 14.004  71.646  80.745  1.00 20.00 ? 59   LYS C NZ  1 
ATOM   7682  N N   . GLN C 1 60  ? 8.681   75.948  83.496  1.00 20.00 ? 60   GLN C N   1 
ATOM   7683  C CA  . GLN C 1 60  ? 7.485   76.696  83.874  1.00 20.00 ? 60   GLN C CA  1 
ATOM   7684  C C   . GLN C 1 60  ? 7.286   77.844  82.889  1.00 20.00 ? 60   GLN C C   1 
ATOM   7685  O O   . GLN C 1 60  ? 6.160   78.193  82.545  1.00 20.00 ? 60   GLN C O   1 
ATOM   7686  C CB  . GLN C 1 60  ? 7.625   77.264  85.282  1.00 20.00 ? 60   GLN C CB  1 
ATOM   7687  C CG  . GLN C 1 60  ? 7.245   76.314  86.395  1.00 20.00 ? 60   GLN C CG  1 
ATOM   7688  C CD  . GLN C 1 60  ? 7.466   76.921  87.768  1.00 20.00 ? 60   GLN C CD  1 
ATOM   7689  O OE1 . GLN C 1 60  ? 8.586   77.298  88.127  1.00 20.00 ? 60   GLN C OE1 1 
ATOM   7690  N NE2 . GLN C 1 60  ? 6.398   77.021  88.548  1.00 20.00 ? 60   GLN C NE2 1 
ATOM   7691  N N   . TRP C 1 61  ? 8.381   78.442  82.434  1.00 20.00 ? 61   TRP C N   1 
ATOM   7692  C CA  . TRP C 1 61  ? 8.262   79.540  81.489  1.00 20.00 ? 61   TRP C CA  1 
ATOM   7693  C C   . TRP C 1 61  ? 7.870   78.986  80.127  1.00 20.00 ? 61   TRP C C   1 
ATOM   7694  O O   . TRP C 1 61  ? 7.264   79.681  79.312  1.00 20.00 ? 61   TRP C O   1 
ATOM   7695  C CB  . TRP C 1 61  ? 9.567   80.336  81.418  1.00 20.00 ? 61   TRP C CB  1 
ATOM   7696  C CG  . TRP C 1 61  ? 9.542   81.498  82.344  1.00 20.00 ? 61   TRP C CG  1 
ATOM   7697  C CD1 . TRP C 1 61  ? 10.221  81.633  83.525  1.00 20.00 ? 61   TRP C CD1 1 
ATOM   7698  C CD2 . TRP C 1 61  ? 8.741   82.674  82.203  1.00 20.00 ? 61   TRP C CD2 1 
ATOM   7699  N NE1 . TRP C 1 61  ? 9.887   82.822  84.125  1.00 20.00 ? 61   TRP C NE1 1 
ATOM   7700  C CE2 . TRP C 1 61  ? 8.981   83.481  83.335  1.00 20.00 ? 61   TRP C CE2 1 
ATOM   7701  C CE3 . TRP C 1 61  ? 7.837   83.124  81.226  1.00 20.00 ? 61   TRP C CE3 1 
ATOM   7702  C CZ2 . TRP C 1 61  ? 8.350   84.721  83.517  1.00 20.00 ? 61   TRP C CZ2 1 
ATOM   7703  C CZ3 . TRP C 1 61  ? 7.213   84.356  81.409  1.00 20.00 ? 61   TRP C CZ3 1 
ATOM   7704  C CH2 . TRP C 1 61  ? 7.476   85.139  82.548  1.00 20.00 ? 61   TRP C CH2 1 
ATOM   7705  N N   . ALA C 1 62  ? 8.215   77.730  79.876  1.00 20.00 ? 62   ALA C N   1 
ATOM   7706  C CA  . ALA C 1 62  ? 7.867   77.117  78.605  1.00 20.00 ? 62   ALA C CA  1 
ATOM   7707  C C   . ALA C 1 62  ? 6.350   76.965  78.668  1.00 20.00 ? 62   ALA C C   1 
ATOM   7708  O O   . ALA C 1 62  ? 5.639   77.248  77.704  1.00 20.00 ? 62   ALA C O   1 
ATOM   7709  C CB  . ALA C 1 62  ? 8.529   75.757  78.473  1.00 20.00 ? 62   ALA C CB  1 
ATOM   7710  N N   . GLY C 1 63  ? 5.866   76.530  79.828  1.00 20.00 ? 63   GLY C N   1 
ATOM   7711  C CA  . GLY C 1 63  ? 4.443   76.340  80.035  1.00 20.00 ? 63   GLY C CA  1 
ATOM   7712  C C   . GLY C 1 63  ? 3.660   77.633  79.920  1.00 20.00 ? 63   GLY C C   1 
ATOM   7713  O O   . GLY C 1 63  ? 2.473   77.624  79.602  1.00 20.00 ? 63   GLY C O   1 
ATOM   7714  N N   . MET C 1 64  ? 4.322   78.753  80.181  1.00 20.00 ? 64   MET C N   1 
ATOM   7715  C CA  . MET C 1 64  ? 3.671   80.054  80.097  1.00 20.00 ? 64   MET C CA  1 
ATOM   7716  C C   . MET C 1 64  ? 3.429   80.435  78.648  1.00 20.00 ? 64   MET C C   1 
ATOM   7717  O O   . MET C 1 64  ? 2.641   81.327  78.368  1.00 20.00 ? 64   MET C O   1 
ATOM   7718  C CB  . MET C 1 64  ? 4.535   81.136  80.744  1.00 20.00 ? 64   MET C CB  1 
ATOM   7719  C CG  . MET C 1 64  ? 4.671   81.005  82.242  1.00 20.00 ? 64   MET C CG  1 
ATOM   7720  S SD  . MET C 1 64  ? 3.323   81.797  83.115  1.00 20.00 ? 64   MET C SD  1 
ATOM   7721  C CE  . MET C 1 64  ? 3.628   83.467  82.717  1.00 20.00 ? 64   MET C CE  1 
ATOM   7722  N N   . MET C 1 65  ? 4.113   79.760  77.730  1.00 20.00 ? 65   MET C N   1 
ATOM   7723  C CA  . MET C 1 65  ? 3.971   80.039  76.305  1.00 20.00 ? 65   MET C CA  1 
ATOM   7724  C C   . MET C 1 65  ? 2.853   79.246  75.625  1.00 20.00 ? 65   MET C C   1 
ATOM   7725  O O   . MET C 1 65  ? 2.437   79.579  74.517  1.00 20.00 ? 65   MET C O   1 
ATOM   7726  C CB  . MET C 1 65  ? 5.303   79.772  75.596  1.00 20.00 ? 65   MET C CB  1 
ATOM   7727  C CG  . MET C 1 65  ? 6.424   80.659  76.081  1.00 20.00 ? 65   MET C CG  1 
ATOM   7728  S SD  . MET C 1 65  ? 6.047   82.395  75.814  1.00 20.00 ? 65   MET C SD  1 
ATOM   7729  C CE  . MET C 1 65  ? 6.321   83.036  77.372  1.00 20.00 ? 65   MET C CE  1 
ATOM   7730  N N   . ILE C 1 66  ? 2.366   78.202  76.286  1.00 20.00 ? 66   ILE C N   1 
ATOM   7731  C CA  . ILE C 1 66  ? 1.297   77.386  75.721  1.00 20.00 ? 66   ILE C CA  1 
ATOM   7732  C C   . ILE C 1 66  ? -0.010  77.493  76.516  1.00 20.00 ? 66   ILE C C   1 
ATOM   7733  O O   . ILE C 1 66  ? -0.705  76.502  76.723  1.00 20.00 ? 66   ILE C O   1 
ATOM   7734  C CB  . ILE C 1 66  ? 1.698   75.898  75.654  1.00 20.00 ? 66   ILE C CB  1 
ATOM   7735  C CG1 . ILE C 1 66  ? 2.260   75.450  77.001  1.00 20.00 ? 66   ILE C CG1 1 
ATOM   7736  C CG2 . ILE C 1 66  ? 2.709   75.677  74.528  1.00 20.00 ? 66   ILE C CG2 1 
ATOM   7737  C CD1 . ILE C 1 66  ? 2.148   73.952  77.226  1.00 20.00 ? 66   ILE C CD1 1 
ATOM   7738  N N   . GLY C 1 67  ? -0.345  78.696  76.959  1.00 20.00 ? 67   GLY C N   1 
ATOM   7739  C CA  . GLY C 1 67  ? -1.569  78.857  77.713  1.00 20.00 ? 67   GLY C CA  1 
ATOM   7740  C C   . GLY C 1 67  ? -2.784  78.738  76.798  1.00 20.00 ? 67   GLY C C   1 
ATOM   7741  O O   . GLY C 1 67  ? -2.854  79.400  75.764  1.00 20.00 ? 67   GLY C O   1 
ATOM   7742  N N   . ASP C 1 68  ? -3.719  77.867  77.172  1.00 20.00 ? 68   ASP C N   1 
ATOM   7743  C CA  . ASP C 1 68  ? -4.953  77.623  76.426  1.00 20.00 ? 68   ASP C CA  1 
ATOM   7744  C C   . ASP C 1 68  ? -5.930  78.477  77.203  1.00 20.00 ? 68   ASP C C   1 
ATOM   7745  O O   . ASP C 1 68  ? -6.478  78.048  78.220  1.00 20.00 ? 68   ASP C O   1 
ATOM   7746  C CB  . ASP C 1 68  ? -5.344  76.147  76.527  1.00 20.00 ? 68   ASP C CB  1 
ATOM   7747  C CG  . ASP C 1 68  ? -6.610  75.809  75.751  1.00 20.00 ? 68   ASP C CG  1 
ATOM   7748  O OD1 . ASP C 1 68  ? -7.289  76.723  75.245  1.00 20.00 ? 68   ASP C OD1 1 
ATOM   7749  O OD2 . ASP C 1 68  ? -6.932  74.609  75.653  1.00 20.00 ? 68   ASP C OD2 1 
ATOM   7750  N N   . GLU C 1 69  ? -6.130  79.699  76.730  1.00 20.00 ? 69   GLU C N   1 
ATOM   7751  C CA  . GLU C 1 69  ? -7.029  80.632  77.386  1.00 20.00 ? 69   GLU C CA  1 
ATOM   7752  C C   . GLU C 1 69  ? -8.529  80.436  77.198  1.00 20.00 ? 69   GLU C C   1 
ATOM   7753  O O   . GLU C 1 69  ? -9.303  81.342  77.491  1.00 20.00 ? 69   GLU C O   1 
ATOM   7754  C CB  . GLU C 1 69  ? -6.647  82.058  76.995  1.00 20.00 ? 69   GLU C CB  1 
ATOM   7755  C CG  . GLU C 1 69  ? -5.168  82.355  77.172  1.00 20.00 ? 69   GLU C CG  1 
ATOM   7756  C CD  . GLU C 1 69  ? -4.694  82.134  78.590  1.00 20.00 ? 69   GLU C CD  1 
ATOM   7757  O OE1 . GLU C 1 69  ? -5.510  82.274  79.532  1.00 20.00 ? 69   GLU C OE1 1 
ATOM   7758  O OE2 . GLU C 1 69  ? -3.500  81.816  78.758  1.00 20.00 ? 69   GLU C OE2 1 
ATOM   7759  N N   . ALA C 1 70  ? -8.943  79.257  76.746  1.00 20.00 ? 70   ALA C N   1 
ATOM   7760  C CA  . ALA C 1 70  ? -10.360 79.003  76.545  1.00 20.00 ? 70   ALA C CA  1 
ATOM   7761  C C   . ALA C 1 70  ? -11.095 79.184  77.859  1.00 20.00 ? 70   ALA C C   1 
ATOM   7762  O O   . ALA C 1 70  ? -10.567 78.882  78.926  1.00 20.00 ? 70   ALA C O   1 
ATOM   7763  C CB  . ALA C 1 70  ? -10.577 77.604  76.015  1.00 20.00 ? 70   ALA C CB  1 
ATOM   7764  N N   . TYR C 1 71  ? -12.322 79.677  77.775  1.00 20.00 ? 71   TYR C N   1 
ATOM   7765  C CA  . TYR C 1 71  ? -13.151 79.908  78.949  1.00 20.00 ? 71   TYR C CA  1 
ATOM   7766  C C   . TYR C 1 71  ? -13.511 78.611  79.650  1.00 20.00 ? 71   TYR C C   1 
ATOM   7767  O O   . TYR C 1 71  ? -13.760 78.599  80.850  1.00 20.00 ? 71   TYR C O   1 
ATOM   7768  C CB  . TYR C 1 71  ? -14.436 80.625  78.540  1.00 20.00 ? 71   TYR C CB  1 
ATOM   7769  C CG  . TYR C 1 71  ? -15.014 81.489  79.625  1.00 20.00 ? 71   TYR C CG  1 
ATOM   7770  C CD1 . TYR C 1 71  ? -14.311 82.593  80.106  1.00 20.00 ? 71   TYR C CD1 1 
ATOM   7771  C CD2 . TYR C 1 71  ? -16.260 81.208  80.175  1.00 20.00 ? 71   TYR C CD2 1 
ATOM   7772  C CE1 . TYR C 1 71  ? -14.833 83.396  81.111  1.00 20.00 ? 71   TYR C CE1 1 
ATOM   7773  C CE2 . TYR C 1 71  ? -16.792 82.004  81.178  1.00 20.00 ? 71   TYR C CE2 1 
ATOM   7774  C CZ  . TYR C 1 71  ? -16.072 83.096  81.644  1.00 20.00 ? 71   TYR C CZ  1 
ATOM   7775  O OH  . TYR C 1 71  ? -16.580 83.884  82.652  1.00 20.00 ? 71   TYR C OH  1 
ATOM   7776  N N   . ALA C 1 72  ? -13.557 77.525  78.887  1.00 20.00 ? 72   ALA C N   1 
ATOM   7777  C CA  . ALA C 1 72  ? -13.887 76.218  79.427  1.00 20.00 ? 72   ALA C CA  1 
ATOM   7778  C C   . ALA C 1 72  ? -13.174 75.142  78.619  1.00 20.00 ? 72   ALA C C   1 
ATOM   7779  O O   . ALA C 1 72  ? -12.959 75.305  77.421  1.00 20.00 ? 72   ALA C O   1 
ATOM   7780  C CB  . ALA C 1 72  ? -15.380 76.003  79.365  1.00 20.00 ? 72   ALA C CB  1 
ATOM   7781  N N   . GLY C 1 73  ? -12.811 74.048  79.279  1.00 20.00 ? 73   GLY C N   1 
ATOM   7782  C CA  . GLY C 1 73  ? -12.132 72.960  78.602  1.00 20.00 ? 73   GLY C CA  1 
ATOM   7783  C C   . GLY C 1 73  ? -10.665 73.206  78.333  1.00 20.00 ? 73   GLY C C   1 
ATOM   7784  O O   . GLY C 1 73  ? -10.048 72.481  77.557  1.00 20.00 ? 73   GLY C O   1 
ATOM   7785  N N   . SER C 1 74  ? -10.098 74.224  78.968  1.00 20.00 ? 74   SER C N   1 
ATOM   7786  C CA  . SER C 1 74  ? -8.683  74.536  78.768  1.00 20.00 ? 74   SER C CA  1 
ATOM   7787  C C   . SER C 1 74  ? -7.787  73.338  79.096  1.00 20.00 ? 74   SER C C   1 
ATOM   7788  O O   . SER C 1 74  ? -8.033  72.603  80.060  1.00 20.00 ? 74   SER C O   1 
ATOM   7789  C CB  . SER C 1 74  ? -8.281  75.732  79.629  1.00 20.00 ? 74   SER C CB  1 
ATOM   7790  O OG  . SER C 1 74  ? -6.873  75.860  79.667  1.00 20.00 ? 74   SER C OG  1 
ATOM   7791  N N   . GLU C 1 75  ? -6.751  73.138  78.285  1.00 20.00 ? 75   GLU C N   1 
ATOM   7792  C CA  . GLU C 1 75  ? -5.820  72.036  78.486  1.00 20.00 ? 75   GLU C CA  1 
ATOM   7793  C C   . GLU C 1 75  ? -5.040  72.212  79.786  1.00 20.00 ? 75   GLU C C   1 
ATOM   7794  O O   . GLU C 1 75  ? -4.688  71.238  80.446  1.00 20.00 ? 75   GLU C O   1 
ATOM   7795  C CB  . GLU C 1 75  ? -4.839  71.964  77.315  1.00 20.00 ? 75   GLU C CB  1 
ATOM   7796  C CG  . GLU C 1 75  ? -5.293  71.082  76.172  1.00 20.00 ? 75   GLU C CG  1 
ATOM   7797  C CD  . GLU C 1 75  ? -5.623  69.668  76.620  1.00 20.00 ? 75   GLU C CD  1 
ATOM   7798  O OE1 . GLU C 1 75  ? -4.688  68.842  76.735  1.00 20.00 ? 75   GLU C OE1 1 
ATOM   7799  O OE2 . GLU C 1 75  ? -6.819  69.387  76.859  1.00 20.00 ? 75   GLU C OE2 1 
ATOM   7800  N N   . ASN C 1 76  ? -4.784  73.463  80.154  1.00 20.00 ? 76   ASN C N   1 
ATOM   7801  C CA  . ASN C 1 76  ? -4.044  73.769  81.365  1.00 20.00 ? 76   ASN C CA  1 
ATOM   7802  C C   . ASN C 1 76  ? -4.820  73.383  82.603  1.00 20.00 ? 76   ASN C C   1 
ATOM   7803  O O   . ASN C 1 76  ? -4.244  72.958  83.597  1.00 20.00 ? 76   ASN C O   1 
ATOM   7804  C CB  . ASN C 1 76  ? -3.699  75.251  81.398  1.00 20.00 ? 76   ASN C CB  1 
ATOM   7805  C CG  . ASN C 1 76  ? -3.137  75.739  80.079  1.00 20.00 ? 76   ASN C CG  1 
ATOM   7806  O OD1 . ASN C 1 76  ? -3.641  76.696  79.495  1.00 20.00 ? 76   ASN C OD1 1 
ATOM   7807  N ND2 . ASN C 1 76  ? -2.089  75.080  79.601  1.00 20.00 ? 76   ASN C ND2 1 
ATOM   7808  N N   . PHE C 1 77  ? -6.135  73.524  82.546  1.00 20.00 ? 77   PHE C N   1 
ATOM   7809  C CA  . PHE C 1 77  ? -6.959  73.173  83.687  1.00 20.00 ? 77   PHE C CA  1 
ATOM   7810  C C   . PHE C 1 77  ? -6.823  71.690  83.943  1.00 20.00 ? 77   PHE C C   1 
ATOM   7811  O O   . PHE C 1 77  ? -6.648  71.266  85.086  1.00 20.00 ? 77   PHE C O   1 
ATOM   7812  C CB  . PHE C 1 77  ? -8.433  73.495  83.437  1.00 20.00 ? 77   PHE C CB  1 
ATOM   7813  C CG  . PHE C 1 77  ? -9.342  72.955  84.500  1.00 20.00 ? 77   PHE C CG  1 
ATOM   7814  C CD1 . PHE C 1 77  ? -9.338  73.504  85.775  1.00 20.00 ? 77   PHE C CD1 1 
ATOM   7815  C CD2 . PHE C 1 77  ? -10.146 71.851  84.250  1.00 20.00 ? 77   PHE C CD2 1 
ATOM   7816  C CE1 . PHE C 1 77  ? -10.116 72.958  86.785  1.00 20.00 ? 77   PHE C CE1 1 
ATOM   7817  C CE2 . PHE C 1 77  ? -10.929 71.297  85.254  1.00 20.00 ? 77   PHE C CE2 1 
ATOM   7818  C CZ  . PHE C 1 77  ? -10.914 71.848  86.523  1.00 20.00 ? 77   PHE C CZ  1 
ATOM   7819  N N   . TYR C 1 78  ? -6.916  70.898  82.881  1.00 20.00 ? 78   TYR C N   1 
ATOM   7820  C CA  . TYR C 1 78  ? -6.797  69.449  83.021  1.00 20.00 ? 78   TYR C CA  1 
ATOM   7821  C C   . TYR C 1 78  ? -5.431  69.090  83.608  1.00 20.00 ? 78   TYR C C   1 
ATOM   7822  O O   . TYR C 1 78  ? -5.327  68.201  84.455  1.00 20.00 ? 78   TYR C O   1 
ATOM   7823  C CB  . TYR C 1 78  ? -6.971  68.754  81.667  1.00 20.00 ? 78   TYR C CB  1 
ATOM   7824  C CG  . TYR C 1 78  ? -8.324  68.972  81.026  1.00 20.00 ? 78   TYR C CG  1 
ATOM   7825  C CD1 . TYR C 1 78  ? -9.484  69.043  81.801  1.00 20.00 ? 78   TYR C CD1 1 
ATOM   7826  C CD2 . TYR C 1 78  ? -8.442  69.126  79.642  1.00 20.00 ? 78   TYR C CD2 1 
ATOM   7827  C CE1 . TYR C 1 78  ? -10.734 69.266  81.212  1.00 20.00 ? 78   TYR C CE1 1 
ATOM   7828  C CE2 . TYR C 1 78  ? -9.685  69.350  79.042  1.00 20.00 ? 78   TYR C CE2 1 
ATOM   7829  C CZ  . TYR C 1 78  ? -10.827 69.420  79.831  1.00 20.00 ? 78   TYR C CZ  1 
ATOM   7830  O OH  . TYR C 1 78  ? -12.052 69.647  79.235  1.00 20.00 ? 78   TYR C OH  1 
ATOM   7831  N N   . HIS C 1 79  ? -4.386  69.783  83.156  1.00 20.00 ? 79   HIS C N   1 
ATOM   7832  C CA  . HIS C 1 79  ? -3.038  69.530  83.645  1.00 20.00 ? 79   HIS C CA  1 
ATOM   7833  C C   . HIS C 1 79  ? -2.967  69.774  85.149  1.00 20.00 ? 79   HIS C C   1 
ATOM   7834  O O   . HIS C 1 79  ? -2.417  68.959  85.886  1.00 20.00 ? 79   HIS C O   1 
ATOM   7835  C CB  . HIS C 1 79  ? -2.026  70.430  82.928  1.00 20.00 ? 79   HIS C CB  1 
ATOM   7836  C CG  . HIS C 1 79  ? -1.857  70.119  81.471  1.00 20.00 ? 79   HIS C CG  1 
ATOM   7837  N ND1 . HIS C 1 79  ? -1.412  71.051  80.557  1.00 20.00 ? 79   HIS C ND1 1 
ATOM   7838  C CD2 . HIS C 1 79  ? -2.080  68.982  80.767  1.00 20.00 ? 79   HIS C CD2 1 
ATOM   7839  C CE1 . HIS C 1 79  ? -1.367  70.504  79.355  1.00 20.00 ? 79   HIS C CE1 1 
ATOM   7840  N NE2 . HIS C 1 79  ? -1.768  69.249  79.455  1.00 20.00 ? 79   HIS C NE2 1 
ATOM   7841  N N   . LEU C 1 80  ? -3.532  70.887  85.608  1.00 20.00 ? 80   LEU C N   1 
ATOM   7842  C CA  . LEU C 1 80  ? -3.517  71.211  87.036  1.00 20.00 ? 80   LEU C CA  1 
ATOM   7843  C C   . LEU C 1 80  ? -4.380  70.260  87.865  1.00 20.00 ? 80   LEU C C   1 
ATOM   7844  O O   . LEU C 1 80  ? -3.984  69.837  88.946  1.00 20.00 ? 80   LEU C O   1 
ATOM   7845  C CB  . LEU C 1 80  ? -3.996  72.649  87.261  1.00 20.00 ? 80   LEU C CB  1 
ATOM   7846  C CG  . LEU C 1 80  ? -4.214  73.068  88.717  1.00 20.00 ? 80   LEU C CG  1 
ATOM   7847  C CD1 . LEU C 1 80  ? -2.874  73.061  89.452  1.00 20.00 ? 80   LEU C CD1 1 
ATOM   7848  C CD2 . LEU C 1 80  ? -4.842  74.446  88.765  1.00 20.00 ? 80   LEU C CD2 1 
ATOM   7849  N N   . GLU C 1 81  ? -5.565  69.935  87.357  1.00 20.00 ? 81   GLU C N   1 
ATOM   7850  C CA  . GLU C 1 81  ? -6.482  69.038  88.048  1.00 20.00 ? 81   GLU C CA  1 
ATOM   7851  C C   . GLU C 1 81  ? -5.877  67.639  88.199  1.00 20.00 ? 81   GLU C C   1 
ATOM   7852  O O   . GLU C 1 81  ? -5.961  67.018  89.263  1.00 20.00 ? 81   GLU C O   1 
ATOM   7853  C CB  . GLU C 1 81  ? -7.804  68.960  87.278  1.00 20.00 ? 81   GLU C CB  1 
ATOM   7854  C CG  . GLU C 1 81  ? -8.717  67.837  87.728  1.00 20.00 ? 81   GLU C CG  1 
ATOM   7855  C CD  . GLU C 1 81  ? -9.945  67.701  86.858  1.00 20.00 ? 81   GLU C CD  1 
ATOM   7856  O OE1 . GLU C 1 81  ? -9.792  67.517  85.631  1.00 20.00 ? 81   GLU C OE1 1 
ATOM   7857  O OE2 . GLU C 1 81  ? -11.063 67.781  87.402  1.00 20.00 ? 81   GLU C OE2 1 
ATOM   7858  N N   . LYS C 1 82  ? -5.267  67.141  87.134  1.00 20.00 ? 82   LYS C N   1 
ATOM   7859  C CA  . LYS C 1 82  ? -4.655  65.819  87.171  1.00 20.00 ? 82   LYS C CA  1 
ATOM   7860  C C   . LYS C 1 82  ? -3.472  65.792  88.140  1.00 20.00 ? 82   LYS C C   1 
ATOM   7861  O O   . LYS C 1 82  ? -3.319  64.864  88.929  1.00 20.00 ? 82   LYS C O   1 
ATOM   7862  C CB  . LYS C 1 82  ? -4.183  65.432  85.771  1.00 20.00 ? 82   LYS C CB  1 
ATOM   7863  C CG  . LYS C 1 82  ? -3.552  64.057  85.703  1.00 20.00 ? 82   LYS C CG  1 
ATOM   7864  C CD  . LYS C 1 82  ? -2.867  63.802  84.366  1.00 20.00 ? 82   LYS C CD  1 
ATOM   7865  C CE  . LYS C 1 82  ? -2.048  62.513  84.414  1.00 20.00 ? 82   LYS C CE  1 
ATOM   7866  N NZ  . LYS C 1 82  ? -1.428  62.284  85.760  1.00 20.00 ? 82   LYS C NZ  1 
ATOM   7867  N N   . THR C 1 83  ? -2.645  66.827  88.080  1.00 20.00 ? 83   THR C N   1 
ATOM   7868  C CA  . THR C 1 83  ? -1.476  66.938  88.938  1.00 20.00 ? 83   THR C CA  1 
ATOM   7869  C C   . THR C 1 83  ? -1.821  66.958  90.426  1.00 20.00 ? 83   THR C C   1 
ATOM   7870  O O   . THR C 1 83  ? -1.260  66.193  91.208  1.00 20.00 ? 83   THR C O   1 
ATOM   7871  C CB  . THR C 1 83  ? -0.676  68.214  88.583  1.00 20.00 ? 83   THR C CB  1 
ATOM   7872  O OG1 . THR C 1 83  ? -0.051  68.030  87.306  1.00 20.00 ? 83   THR C OG1 1 
ATOM   7873  C CG2 . THR C 1 83  ? 0.389   68.505  89.632  1.00 20.00 ? 83   THR C CG2 1 
ATOM   7874  N N   . VAL C 1 84  ? -2.747  67.831  90.808  1.00 20.00 ? 84   VAL C N   1 
ATOM   7875  C CA  . VAL C 1 84  ? -3.165  67.954  92.198  1.00 20.00 ? 84   VAL C CA  1 
ATOM   7876  C C   . VAL C 1 84  ? -3.842  66.682  92.707  1.00 20.00 ? 84   VAL C C   1 
ATOM   7877  O O   . VAL C 1 84  ? -3.625  66.261  93.843  1.00 20.00 ? 84   VAL C O   1 
ATOM   7878  C CB  . VAL C 1 84  ? -4.101  69.170  92.371  1.00 20.00 ? 84   VAL C CB  1 
ATOM   7879  C CG1 . VAL C 1 84  ? -4.735  69.154  93.750  1.00 20.00 ? 84   VAL C CG1 1 
ATOM   7880  C CG2 . VAL C 1 84  ? -3.311  70.459  92.167  1.00 20.00 ? 84   VAL C CG2 1 
ATOM   7881  N N   . LYS C 1 85  ? -4.662  66.068  91.866  1.00 20.00 ? 85   LYS C N   1 
ATOM   7882  C CA  . LYS C 1 85  ? -5.353  64.845  92.249  1.00 20.00 ? 85   LYS C CA  1 
ATOM   7883  C C   . LYS C 1 85  ? -4.311  63.778  92.562  1.00 20.00 ? 85   LYS C C   1 
ATOM   7884  O O   . LYS C 1 85  ? -4.444  63.030  93.532  1.00 20.00 ? 85   LYS C O   1 
ATOM   7885  C CB  . LYS C 1 85  ? -6.237  64.351  91.102  1.00 20.00 ? 85   LYS C CB  1 
ATOM   7886  C CG  . LYS C 1 85  ? -7.603  65.003  91.048  1.00 20.00 ? 85   LYS C CG  1 
ATOM   7887  C CD  . LYS C 1 85  ? -8.639  64.024  90.522  1.00 20.00 ? 85   LYS C CD  1 
ATOM   7888  C CE  . LYS C 1 85  ? -9.404  64.605  89.345  1.00 20.00 ? 85   LYS C CE  1 
ATOM   7889  N NZ  . LYS C 1 85  ? -10.131 65.846  89.726  1.00 20.00 ? 85   LYS C NZ  1 
ATOM   7890  N N   . GLU C 1 86  ? -3.269  63.724  91.735  1.00 20.00 ? 86   GLU C N   1 
ATOM   7891  C CA  . GLU C 1 86  ? -2.188  62.755  91.894  1.00 20.00 ? 86   GLU C CA  1 
ATOM   7892  C C   . GLU C 1 86  ? -1.292  62.977  93.119  1.00 20.00 ? 86   GLU C C   1 
ATOM   7893  O O   . GLU C 1 86  ? -0.999  62.037  93.853  1.00 20.00 ? 86   GLU C O   1 
ATOM   7894  C CB  . GLU C 1 86  ? -1.323  62.738  90.623  1.00 20.00 ? 86   GLU C CB  1 
ATOM   7895  C CG  . GLU C 1 86  ? 0.043   62.075  90.798  1.00 20.00 ? 86   GLU C CG  1 
ATOM   7896  C CD  . GLU C 1 86  ? 0.864   62.019  89.515  1.00 20.00 ? 86   GLU C CD  1 
ATOM   7897  O OE1 . GLU C 1 86  ? 0.414   62.553  88.477  1.00 20.00 ? 86   GLU C OE1 1 
ATOM   7898  O OE2 . GLU C 1 86  ? 1.968   61.434  89.550  1.00 20.00 ? 86   GLU C OE2 1 
ATOM   7899  N N   . LEU C 1 87  ? -0.861  64.213  93.334  1.00 20.00 ? 87   LEU C N   1 
ATOM   7900  C CA  . LEU C 1 87  ? 0.003   64.545  94.460  1.00 20.00 ? 87   LEU C CA  1 
ATOM   7901  C C   . LEU C 1 87  ? -0.688  64.760  95.795  1.00 20.00 ? 87   LEU C C   1 
ATOM   7902  O O   . LEU C 1 87  ? -0.198  64.295  96.820  1.00 20.00 ? 87   LEU C O   1 
ATOM   7903  C CB  . LEU C 1 87  ? 0.844   65.787  94.122  1.00 20.00 ? 87   LEU C CB  1 
ATOM   7904  C CG  . LEU C 1 87  ? 1.763   65.694  92.896  1.00 20.00 ? 87   LEU C CG  1 
ATOM   7905  C CD1 . LEU C 1 87  ? 2.482   67.006  92.692  1.00 20.00 ? 87   LEU C CD1 1 
ATOM   7906  C CD2 . LEU C 1 87  ? 2.769   64.573  93.077  1.00 20.00 ? 87   LEU C CD2 1 
ATOM   7907  N N   . PHE C 1 88  ? -1.813  65.469  95.795  1.00 20.00 ? 88   PHE C N   1 
ATOM   7908  C CA  . PHE C 1 88  ? -2.551  65.732  97.030  1.00 20.00 ? 88   PHE C CA  1 
ATOM   7909  C C   . PHE C 1 88  ? -3.554  64.619  97.340  1.00 20.00 ? 88   PHE C C   1 
ATOM   7910  O O   . PHE C 1 88  ? -3.852  64.344  98.503  1.00 20.00 ? 88   PHE C O   1 
ATOM   7911  C CB  . PHE C 1 88  ? -3.272  67.081  96.942  1.00 20.00 ? 88   PHE C CB  1 
ATOM   7912  C CG  . PHE C 1 88  ? -2.371  68.282  97.160  1.00 20.00 ? 88   PHE C CG  1 
ATOM   7913  C CD1 . PHE C 1 88  ? -0.982  68.160  97.099  1.00 20.00 ? 88   PHE C CD1 1 
ATOM   7914  C CD2 . PHE C 1 88  ? -2.922  69.537  97.436  1.00 20.00 ? 88   PHE C CD2 1 
ATOM   7915  C CE1 . PHE C 1 88  ? -0.156  69.266  97.309  1.00 20.00 ? 88   PHE C CE1 1 
ATOM   7916  C CE2 . PHE C 1 88  ? -2.105  70.650  97.650  1.00 20.00 ? 88   PHE C CE2 1 
ATOM   7917  C CZ  . PHE C 1 88  ? -0.721  70.516  97.587  1.00 20.00 ? 88   PHE C CZ  1 
ATOM   7918  N N   . GLY C 1 89  ? -4.086  63.987  96.303  1.00 20.00 ? 89   GLY C N   1 
ATOM   7919  C CA  . GLY C 1 89  ? -5.036  62.914  96.517  1.00 20.00 ? 89   GLY C CA  1 
ATOM   7920  C C   . GLY C 1 89  ? -6.476  63.287  96.794  1.00 20.00 ? 89   GLY C C   1 
ATOM   7921  O O   . GLY C 1 89  ? -7.244  62.466  97.301  1.00 20.00 ? 89   GLY C O   1 
ATOM   7922  N N   . PHE C 1 90  ? -6.864  64.515  96.478  1.00 20.00 ? 90   PHE C N   1 
ATOM   7923  C CA  . PHE C 1 90  ? -8.240  64.916  96.719  1.00 20.00 ? 90   PHE C CA  1 
ATOM   7924  C C   . PHE C 1 90  ? -9.043  64.614  95.466  1.00 20.00 ? 90   PHE C C   1 
ATOM   7925  O O   . PHE C 1 90  ? -8.505  64.600  94.365  1.00 20.00 ? 90   PHE C O   1 
ATOM   7926  C CB  . PHE C 1 90  ? -8.316  66.401  97.064  1.00 20.00 ? 90   PHE C CB  1 
ATOM   7927  C CG  . PHE C 1 90  ? -7.836  66.718  98.449  1.00 20.00 ? 90   PHE C CG  1 
ATOM   7928  C CD1 . PHE C 1 90  ? -8.503  66.220  99.557  1.00 20.00 ? 90   PHE C CD1 1 
ATOM   7929  C CD2 . PHE C 1 90  ? -6.695  67.485  98.647  1.00 20.00 ? 90   PHE C CD2 1 
ATOM   7930  C CE1 . PHE C 1 90  ? -8.043  66.478  100.837 1.00 20.00 ? 90   PHE C CE1 1 
ATOM   7931  C CE2 . PHE C 1 90  ? -6.236  67.742  99.922  1.00 20.00 ? 90   PHE C CE2 1 
ATOM   7932  C CZ  . PHE C 1 90  ? -6.912  67.237  101.018 1.00 20.00 ? 90   PHE C CZ  1 
ATOM   7933  N N   . LYS C 1 91  ? -10.332 64.360  95.639  1.00 20.00 ? 91   LYS C N   1 
ATOM   7934  C CA  . LYS C 1 91  ? -11.212 64.054  94.521  1.00 20.00 ? 91   LYS C CA  1 
ATOM   7935  C C   . LYS C 1 91  ? -11.468 65.220  93.572  1.00 20.00 ? 91   LYS C C   1 
ATOM   7936  O O   . LYS C 1 91  ? -11.325 65.073  92.360  1.00 20.00 ? 91   LYS C O   1 
ATOM   7937  C CB  . LYS C 1 91  ? -12.558 63.548  95.043  1.00 20.00 ? 91   LYS C CB  1 
ATOM   7938  C CG  . LYS C 1 91  ? -12.446 62.418  96.029  1.00 20.00 ? 91   LYS C CG  1 
ATOM   7939  C CD  . LYS C 1 91  ? -12.969 61.135  95.434  1.00 20.00 ? 91   LYS C CD  1 
ATOM   7940  C CE  . LYS C 1 91  ? -14.484 61.143  95.408  1.00 20.00 ? 91   LYS C CE  1 
ATOM   7941  N NZ  . LYS C 1 91  ? -14.992 62.011  94.310  1.00 20.00 ? 91   LYS C NZ  1 
ATOM   7942  N N   . HIS C 1 92  ? -11.848 66.374  94.118  1.00 20.00 ? 92   HIS C N   1 
ATOM   7943  C CA  . HIS C 1 92  ? -12.130 67.544  93.296  1.00 20.00 ? 92   HIS C CA  1 
ATOM   7944  C C   . HIS C 1 92  ? -11.289 68.766  93.620  1.00 20.00 ? 92   HIS C C   1 
ATOM   7945  O O   . HIS C 1 92  ? -10.835 68.949  94.747  1.00 20.00 ? 92   HIS C O   1 
ATOM   7946  C CB  . HIS C 1 92  ? -13.618 67.892  93.409  1.00 20.00 ? 92   HIS C CB  1 
ATOM   7947  C CG  . HIS C 1 92  ? -14.515 66.690  93.450  1.00 20.00 ? 92   HIS C CG  1 
ATOM   7948  N ND1 . HIS C 1 92  ? -14.890 65.996  92.317  1.00 20.00 ? 92   HIS C ND1 1 
ATOM   7949  C CD2 . HIS C 1 92  ? -15.075 66.030  94.494  1.00 20.00 ? 92   HIS C CD2 1 
ATOM   7950  C CE1 . HIS C 1 92  ? -15.638 64.961  92.660  1.00 20.00 ? 92   HIS C CE1 1 
ATOM   7951  N NE2 . HIS C 1 92  ? -15.765 64.961  93.975  1.00 20.00 ? 92   HIS C NE2 1 
ATOM   7952  N N   . ILE C 1 93  ? -11.106 69.617  92.620  1.00 20.00 ? 93   ILE C N   1 
ATOM   7953  C CA  . ILE C 1 93  ? -10.319 70.825  92.794  1.00 20.00 ? 93   ILE C CA  1 
ATOM   7954  C C   . ILE C 1 93  ? -10.978 72.001  92.094  1.00 20.00 ? 93   ILE C C   1 
ATOM   7955  O O   . ILE C 1 93  ? -11.537 71.855  91.008  1.00 20.00 ? 93   ILE C O   1 
ATOM   7956  C CB  . ILE C 1 93  ? -8.905  70.629  92.212  1.00 20.00 ? 93   ILE C CB  1 
ATOM   7957  C CG1 . ILE C 1 93  ? -8.152  71.959  92.173  1.00 20.00 ? 93   ILE C CG1 1 
ATOM   7958  C CG2 . ILE C 1 93  ? -9.011  70.041  90.821  1.00 20.00 ? 93   ILE C CG2 1 
ATOM   7959  C CD1 . ILE C 1 93  ? -6.876  71.914  91.362  1.00 20.00 ? 93   ILE C CD1 1 
ATOM   7960  N N   . VAL C 1 94  ? -10.925 73.163  92.730  1.00 20.00 ? 94   VAL C N   1 
ATOM   7961  C CA  . VAL C 1 94  ? -11.505 74.372  92.175  1.00 20.00 ? 94   VAL C CA  1 
ATOM   7962  C C   . VAL C 1 94  ? -10.419 75.425  92.257  1.00 20.00 ? 94   VAL C C   1 
ATOM   7963  O O   . VAL C 1 94  ? -10.000 75.802  93.348  1.00 20.00 ? 94   VAL C O   1 
ATOM   7964  C CB  . VAL C 1 94  ? -12.708 74.867  92.989  1.00 20.00 ? 94   VAL C CB  1 
ATOM   7965  C CG1 . VAL C 1 94  ? -13.210 76.177  92.410  1.00 20.00 ? 94   VAL C CG1 1 
ATOM   7966  C CG2 . VAL C 1 94  ? -13.816 73.822  92.987  1.00 20.00 ? 94   VAL C CG2 1 
ATOM   7967  N N   . PRO C 1 95  ? -9.927  75.900  91.106  1.00 20.00 ? 95   PRO C N   1 
ATOM   7968  C CA  . PRO C 1 95  ? -8.879  76.924  91.133  1.00 20.00 ? 95   PRO C CA  1 
ATOM   7969  C C   . PRO C 1 95  ? -9.406  78.285  91.558  1.00 20.00 ? 95   PRO C C   1 
ATOM   7970  O O   . PRO C 1 95  ? -10.579 78.592  91.368  1.00 20.00 ? 95   PRO C O   1 
ATOM   7971  C CB  . PRO C 1 95  ? -8.340  76.949  89.701  1.00 20.00 ? 95   PRO C CB  1 
ATOM   7972  C CG  . PRO C 1 95  ? -9.402  76.338  88.856  1.00 20.00 ? 95   PRO C CG  1 
ATOM   7973  C CD  . PRO C 1 95  ? -10.308 75.506  89.739  1.00 20.00 ? 95   PRO C CD  1 
ATOM   7974  N N   . THR C 1 96  ? -8.526  79.086  92.153  1.00 20.00 ? 96   THR C N   1 
ATOM   7975  C CA  . THR C 1 96  ? -8.859  80.426  92.618  1.00 20.00 ? 96   THR C CA  1 
ATOM   7976  C C   . THR C 1 96  ? -7.633  81.262  92.312  1.00 20.00 ? 96   THR C C   1 
ATOM   7977  O O   . THR C 1 96  ? -6.530  80.734  92.208  1.00 20.00 ? 96   THR C O   1 
ATOM   7978  C CB  . THR C 1 96  ? -9.147  80.466  94.140  1.00 20.00 ? 96   THR C CB  1 
ATOM   7979  O OG1 . THR C 1 96  ? -7.977  80.072  94.860  1.00 20.00 ? 96   THR C OG1 1 
ATOM   7980  C CG2 . THR C 1 96  ? -10.288 79.510  94.499  1.00 20.00 ? 96   THR C CG2 1 
ATOM   7981  N N   . HIS C 1 97  ? -7.815  82.563  92.158  1.00 20.00 ? 97   HIS C N   1 
ATOM   7982  C CA  . HIS C 1 97  ? -6.686  83.417  91.855  1.00 20.00 ? 97   HIS C CA  1 
ATOM   7983  C C   . HIS C 1 97  ? -5.632  83.411  92.966  1.00 20.00 ? 97   HIS C C   1 
ATOM   7984  O O   . HIS C 1 97  ? -4.440  83.608  92.708  1.00 20.00 ? 97   HIS C O   1 
ATOM   7985  C CB  . HIS C 1 97  ? -7.175  84.846  91.559  1.00 20.00 ? 97   HIS C CB  1 
ATOM   7986  C CG  . HIS C 1 97  ? -7.377  85.693  92.777  1.00 20.00 ? 97   HIS C CG  1 
ATOM   7987  N ND1 . HIS C 1 97  ? -8.509  85.618  93.559  1.00 20.00 ? 97   HIS C ND1 1 
ATOM   7988  C CD2 . HIS C 1 97  ? -6.589  86.638  93.345  1.00 20.00 ? 97   HIS C CD2 1 
ATOM   7989  C CE1 . HIS C 1 97  ? -8.408  86.478  94.558  1.00 20.00 ? 97   HIS C CE1 1 
ATOM   7990  N NE2 . HIS C 1 97  ? -7.252  87.109  94.450  1.00 20.00 ? 97   HIS C NE2 1 
ATOM   7991  N N   . GLN C 1 98  ? -6.066  83.137  94.190  1.00 20.00 ? 98   GLN C N   1 
ATOM   7992  C CA  . GLN C 1 98  ? -5.163  83.111  95.328  1.00 20.00 ? 98   GLN C CA  1 
ATOM   7993  C C   . GLN C 1 98  ? -5.746  82.279  96.445  1.00 20.00 ? 98   GLN C C   1 
ATOM   7994  O O   . GLN C 1 98  ? -6.869  81.816  96.352  1.00 20.00 ? 98   GLN C O   1 
ATOM   7995  C CB  . GLN C 1 98  ? -4.969  84.529  95.845  1.00 20.00 ? 98   GLN C CB  1 
ATOM   7996  C CG  . GLN C 1 98  ? -3.558  84.953  95.961  1.00 20.00 ? 98   GLN C CG  1 
ATOM   7997  C CD  . GLN C 1 98  ? -3.442  86.442  96.164  1.00 20.00 ? 98   GLN C CD  1 
ATOM   7998  O OE1 . GLN C 1 98  ? -3.214  87.191  95.218  1.00 20.00 ? 98   GLN C OE1 1 
ATOM   7999  N NE2 . GLN C 1 98  ? -3.600  86.883  97.404  1.00 20.00 ? 98   GLN C NE2 1 
ATOM   8000  N N   . GLY C 1 99  ? -4.966  82.118  97.509  1.00 20.00 ? 99   GLY C N   1 
ATOM   8001  C CA  . GLY C 1 99  ? -5.394  81.347  98.662  1.00 20.00 ? 99   GLY C CA  1 
ATOM   8002  C C   . GLY C 1 99  ? -6.599  81.936  99.372  1.00 20.00 ? 99   GLY C C   1 
ATOM   8003  O O   . GLY C 1 99  ? -7.458  81.183  99.811  1.00 20.00 ? 99   GLY C O   1 
ATOM   8004  N N   . ARG C 1 100 ? -6.667  83.264  99.498  1.00 20.00 ? 100  ARG C N   1 
ATOM   8005  C CA  . ARG C 1 100 ? -7.796  83.923  100.164 1.00 20.00 ? 100  ARG C CA  1 
ATOM   8006  C C   . ARG C 1 100 ? -9.078  83.660  99.388  1.00 20.00 ? 100  ARG C C   1 
ATOM   8007  O O   . ARG C 1 100 ? -10.147 83.547  99.977  1.00 20.00 ? 100  ARG C O   1 
ATOM   8008  C CB  . ARG C 1 100 ? -7.604  85.436  100.248 1.00 20.00 ? 100  ARG C CB  1 
ATOM   8009  C CG  . ARG C 1 100 ? -6.223  85.893  100.614 1.00 20.00 ? 100  ARG C CG  1 
ATOM   8010  C CD  . ARG C 1 100 ? -5.729  86.916  99.621  1.00 20.00 ? 100  ARG C CD  1 
ATOM   8011  N NE  . ARG C 1 100 ? -5.377  88.170  100.269 1.00 20.00 ? 100  ARG C NE  1 
ATOM   8012  C CZ  . ARG C 1 100 ? -4.243  88.377  100.928 1.00 20.00 ? 100  ARG C CZ  1 
ATOM   8013  N NH1 . ARG C 1 100 ? -3.345  87.411  101.031 1.00 20.00 ? 100  ARG C NH1 1 
ATOM   8014  N NH2 . ARG C 1 100 ? -4.005  89.558  101.478 1.00 20.00 ? 100  ARG C NH2 1 
ATOM   8015  N N   . GLY C 1 101 ? -8.966  83.583  98.065  1.00 20.00 ? 101  GLY C N   1 
ATOM   8016  C CA  . GLY C 1 101 ? -10.132 83.331  97.242  1.00 20.00 ? 101  GLY C CA  1 
ATOM   8017  C C   . GLY C 1 101 ? -10.729 81.978  97.597  1.00 20.00 ? 101  GLY C C   1 
ATOM   8018  O O   . GLY C 1 101 ? -11.949 81.810  97.602  1.00 20.00 ? 101  GLY C O   1 
ATOM   8019  N N   . ALA C 1 102 ? -9.870  81.006  97.900  1.00 20.00 ? 102  ALA C N   1 
ATOM   8020  C CA  . ALA C 1 102 ? -10.339 79.671  98.256  1.00 20.00 ? 102  ALA C CA  1 
ATOM   8021  C C   . ALA C 1 102 ? -10.903 79.669  99.668  1.00 20.00 ? 102  ALA C C   1 
ATOM   8022  O O   . ALA C 1 102 ? -11.837 78.933  99.970  1.00 20.00 ? 102  ALA C O   1 
ATOM   8023  C CB  . ALA C 1 102 ? -9.205  78.660  98.142  1.00 20.00 ? 102  ALA C CB  1 
ATOM   8024  N N   . GLU C 1 103 ? -10.337 80.500  100.535 1.00 20.00 ? 103  GLU C N   1 
ATOM   8025  C CA  . GLU C 1 103 ? -10.799 80.579  101.916 1.00 20.00 ? 103  GLU C CA  1 
ATOM   8026  C C   . GLU C 1 103 ? -12.201 81.191  101.968 1.00 20.00 ? 103  GLU C C   1 
ATOM   8027  O O   . GLU C 1 103 ? -13.062 80.745  102.720 1.00 20.00 ? 103  GLU C O   1 
ATOM   8028  C CB  . GLU C 1 103 ? -9.810  81.408  102.741 1.00 20.00 ? 103  GLU C CB  1 
ATOM   8029  C CG  . GLU C 1 103 ? -8.456  80.741  102.912 1.00 20.00 ? 103  GLU C CG  1 
ATOM   8030  C CD  . GLU C 1 103 ? -7.401  81.667  103.482 1.00 20.00 ? 103  GLU C CD  1 
ATOM   8031  O OE1 . GLU C 1 103 ? -7.493  82.892  103.306 1.00 20.00 ? 103  GLU C OE1 1 
ATOM   8032  O OE2 . GLU C 1 103 ? -6.459  81.168  104.113 1.00 20.00 ? 103  GLU C OE2 1 
ATOM   8033  N N   . ASN C 1 104 ? -12.417 82.223  101.164 1.00 20.00 ? 104  ASN C N   1 
ATOM   8034  C CA  . ASN C 1 104 ? -13.702 82.899  101.100 1.00 20.00 ? 104  ASN C CA  1 
ATOM   8035  C C   . ASN C 1 104 ? -14.746 81.834  100.771 1.00 20.00 ? 104  ASN C C   1 
ATOM   8036  O O   . ASN C 1 104 ? -15.782 81.731  101.430 1.00 20.00 ? 104  ASN C O   1 
ATOM   8037  C CB  . ASN C 1 104 ? -13.648 83.972  100.002 1.00 20.00 ? 104  ASN C CB  1 
ATOM   8038  C CG  . ASN C 1 104 ? -15.025 84.496  99.601  1.00 20.00 ? 104  ASN C CG  1 
ATOM   8039  O OD1 . ASN C 1 104 ? -15.824 84.904  100.446 1.00 20.00 ? 104  ASN C OD1 1 
ATOM   8040  N ND2 . ASN C 1 104 ? -15.299 84.499  98.300  1.00 20.00 ? 104  ASN C ND2 1 
ATOM   8041  N N   . LEU C 1 105 ? -14.446 81.022  99.764  1.00 20.00 ? 105  LEU C N   1 
ATOM   8042  C CA  . LEU C 1 105 ? -15.338 79.953  99.326  1.00 20.00 ? 105  LEU C CA  1 
ATOM   8043  C C   . LEU C 1 105 ? -15.622 78.886  100.391 1.00 20.00 ? 105  LEU C C   1 
ATOM   8044  O O   . LEU C 1 105 ? -16.779 78.598  100.699 1.00 20.00 ? 105  LEU C O   1 
ATOM   8045  C CB  . LEU C 1 105 ? -14.757 79.281  98.081  1.00 20.00 ? 105  LEU C CB  1 
ATOM   8046  C CG  . LEU C 1 105 ? -15.323 79.645  96.705  1.00 20.00 ? 105  LEU C CG  1 
ATOM   8047  C CD1 . LEU C 1 105 ? -15.838 81.062  96.703  1.00 20.00 ? 105  LEU C CD1 1 
ATOM   8048  C CD2 . LEU C 1 105 ? -14.244 79.467  95.650  1.00 20.00 ? 105  LEU C CD2 1 
ATOM   8049  N N   . LEU C 1 106 ? -14.572 78.287  100.944 1.00 20.00 ? 106  LEU C N   1 
ATOM   8050  C CA  . LEU C 1 106 ? -14.742 77.259  101.963 1.00 20.00 ? 106  LEU C CA  1 
ATOM   8051  C C   . LEU C 1 106 ? -15.503 77.758  103.186 1.00 20.00 ? 106  LEU C C   1 
ATOM   8052  O O   . LEU C 1 106 ? -16.348 77.053  103.730 1.00 20.00 ? 106  LEU C O   1 
ATOM   8053  C CB  . LEU C 1 106 ? -13.380 76.714  102.395 1.00 20.00 ? 106  LEU C CB  1 
ATOM   8054  C CG  . LEU C 1 106 ? -13.358 75.656  103.502 1.00 20.00 ? 106  LEU C CG  1 
ATOM   8055  C CD1 . LEU C 1 106 ? -13.866 74.336  102.973 1.00 20.00 ? 106  LEU C CD1 1 
ATOM   8056  C CD2 . LEU C 1 106 ? -11.943 75.494  104.014 1.00 20.00 ? 106  LEU C CD2 1 
ATOM   8057  N N   . SER C 1 107 ? -15.207 78.974  103.623 1.00 20.00 ? 107  SER C N   1 
ATOM   8058  C CA  . SER C 1 107 ? -15.884 79.526  104.790 1.00 20.00 ? 107  SER C CA  1 
ATOM   8059  C C   . SER C 1 107 ? -17.373 79.730  104.553 1.00 20.00 ? 107  SER C C   1 
ATOM   8060  O O   . SER C 1 107 ? -18.189 79.479  105.439 1.00 20.00 ? 107  SER C O   1 
ATOM   8061  C CB  . SER C 1 107 ? -15.246 80.849  105.198 1.00 20.00 ? 107  SER C CB  1 
ATOM   8062  O OG  . SER C 1 107 ? -14.011 80.617  105.852 1.00 20.00 ? 107  SER C OG  1 
ATOM   8063  N N   . GLN C 1 108 ? -17.730 80.185  103.358 1.00 20.00 ? 108  GLN C N   1 
ATOM   8064  C CA  . GLN C 1 108 ? -19.127 80.408  103.046 1.00 20.00 ? 108  GLN C CA  1 
ATOM   8065  C C   . GLN C 1 108 ? -19.852 79.077  102.924 1.00 20.00 ? 108  GLN C C   1 
ATOM   8066  O O   . GLN C 1 108 ? -21.049 78.985  103.177 1.00 20.00 ? 108  GLN C O   1 
ATOM   8067  C CB  . GLN C 1 108 ? -19.264 81.170  101.731 1.00 20.00 ? 108  GLN C CB  1 
ATOM   8068  C CG  . GLN C 1 108 ? -18.770 82.591  101.771 1.00 20.00 ? 108  GLN C CG  1 
ATOM   8069  C CD  . GLN C 1 108 ? -19.310 83.407  100.620 1.00 20.00 ? 108  GLN C CD  1 
ATOM   8070  O OE1 . GLN C 1 108 ? -20.507 83.400  100.356 1.00 20.00 ? 108  GLN C OE1 1 
ATOM   8071  N NE2 . GLN C 1 108 ? -18.430 84.115  99.927  1.00 20.00 ? 108  GLN C NE2 1 
ATOM   8072  N N   . LEU C 1 109 ? -19.119 78.039  102.554 1.00 20.00 ? 109  LEU C N   1 
ATOM   8073  C CA  . LEU C 1 109 ? -19.719 76.729  102.393 1.00 20.00 ? 109  LEU C CA  1 
ATOM   8074  C C   . LEU C 1 109 ? -19.732 75.797  103.581 1.00 20.00 ? 109  LEU C C   1 
ATOM   8075  O O   . LEU C 1 109 ? -20.613 74.954  103.669 1.00 20.00 ? 109  LEU C O   1 
ATOM   8076  C CB  . LEU C 1 109 ? -19.042 75.989  101.240 1.00 20.00 ? 109  LEU C CB  1 
ATOM   8077  C CG  . LEU C 1 109 ? -19.096 76.604  99.844  1.00 20.00 ? 109  LEU C CG  1 
ATOM   8078  C CD1 . LEU C 1 109 ? -17.950 76.064  98.999  1.00 20.00 ? 109  LEU C CD1 1 
ATOM   8079  C CD2 . LEU C 1 109 ? -20.430 76.278  99.202  1.00 20.00 ? 109  LEU C CD2 1 
ATOM   8080  N N   . ALA C 1 110 ? -18.777 75.927  104.492 1.00 20.00 ? 110  ALA C N   1 
ATOM   8081  C CA  . ALA C 1 110 ? -18.737 75.032  105.647 1.00 20.00 ? 110  ALA C CA  1 
ATOM   8082  C C   . ALA C 1 110 ? -19.036 75.594  107.025 1.00 20.00 ? 110  ALA C C   1 
ATOM   8083  O O   . ALA C 1 110 ? -18.957 74.871  108.016 1.00 20.00 ? 110  ALA C O   1 
ATOM   8084  C CB  . ALA C 1 110 ? -17.389 74.329  105.680 1.00 20.00 ? 110  ALA C CB  1 
ATOM   8085  N N   . ILE C 1 111 ? -19.387 76.868  107.101 1.00 20.00 ? 111  ILE C N   1 
ATOM   8086  C CA  . ILE C 1 111 ? -19.680 77.471  108.387 1.00 20.00 ? 111  ILE C CA  1 
ATOM   8087  C C   . ILE C 1 111 ? -21.121 77.948  108.496 1.00 20.00 ? 111  ILE C C   1 
ATOM   8088  O O   . ILE C 1 111 ? -21.685 78.498  107.552 1.00 20.00 ? 111  ILE C O   1 
ATOM   8089  C CB  . ILE C 1 111 ? -18.746 78.678  108.654 1.00 20.00 ? 111  ILE C CB  1 
ATOM   8090  C CG1 . ILE C 1 111 ? -17.297 78.199  108.765 1.00 20.00 ? 111  ILE C CG1 1 
ATOM   8091  C CG2 . ILE C 1 111 ? -19.158 79.399  109.933 1.00 20.00 ? 111  ILE C CG2 1 
ATOM   8092  C CD1 . ILE C 1 111 ? -16.274 79.323  108.683 1.00 20.00 ? 111  ILE C CD1 1 
ATOM   8093  N N   . LYS C 1 112 ? -21.703 77.726  109.665 1.00 20.00 ? 112  LYS C N   1 
ATOM   8094  C CA  . LYS C 1 112 ? -23.069 78.126  109.942 1.00 20.00 ? 112  LYS C CA  1 
ATOM   8095  C C   . LYS C 1 112 ? -22.955 79.014  111.157 1.00 20.00 ? 112  LYS C C   1 
ATOM   8096  O O   . LYS C 1 112 ? -22.098 78.792  112.002 1.00 20.00 ? 112  LYS C O   1 
ATOM   8097  C CB  . LYS C 1 112 ? -23.927 76.915  110.270 1.00 20.00 ? 112  LYS C CB  1 
ATOM   8098  C CG  . LYS C 1 112 ? -24.292 76.080  109.065 1.00 20.00 ? 112  LYS C CG  1 
ATOM   8099  C CD  . LYS C 1 112 ? -25.523 75.240  109.342 1.00 20.00 ? 112  LYS C CD  1 
ATOM   8100  C CE  . LYS C 1 112 ? -25.218 73.748  109.240 1.00 20.00 ? 112  LYS C CE  1 
ATOM   8101  N NZ  . LYS C 1 112 ? -24.105 73.328  110.154 1.00 20.00 ? 112  LYS C NZ  1 
ATOM   8102  N N   . PRO C 1 113 ? -23.799 80.047  111.253 1.00 20.00 ? 113  PRO C N   1 
ATOM   8103  C CA  . PRO C 1 113 ? -23.690 81.020  112.343 1.00 20.00 ? 113  PRO C CA  1 
ATOM   8104  C C   . PRO C 1 113 ? -23.659 80.387  113.733 1.00 20.00 ? 113  PRO C C   1 
ATOM   8105  O O   . PRO C 1 113 ? -24.421 79.465  114.024 1.00 20.00 ? 113  PRO C O   1 
ATOM   8106  C CB  . PRO C 1 113 ? -24.914 81.908  112.152 1.00 20.00 ? 113  PRO C CB  1 
ATOM   8107  C CG  . PRO C 1 113 ? -25.239 81.786  110.713 1.00 20.00 ? 113  PRO C CG  1 
ATOM   8108  C CD  . PRO C 1 113 ? -24.896 80.379  110.331 1.00 20.00 ? 113  PRO C CD  1 
ATOM   8109  N N   . GLY C 1 114 ? -22.769 80.885  114.584 1.00 20.00 ? 114  GLY C N   1 
ATOM   8110  C CA  . GLY C 1 114 ? -22.660 80.359  115.929 1.00 20.00 ? 114  GLY C CA  1 
ATOM   8111  C C   . GLY C 1 114 ? -21.735 79.168  116.095 1.00 20.00 ? 114  GLY C C   1 
ATOM   8112  O O   . GLY C 1 114 ? -21.350 78.848  117.220 1.00 20.00 ? 114  GLY C O   1 
ATOM   8113  N N   . GLN C 1 115 ? -21.375 78.512  114.989 1.00 20.00 ? 115  GLN C N   1 
ATOM   8114  C CA  . GLN C 1 115 ? -20.485 77.341  115.038 1.00 20.00 ? 115  GLN C CA  1 
ATOM   8115  C C   . GLN C 1 115 ? -19.060 77.718  115.412 1.00 20.00 ? 115  GLN C C   1 
ATOM   8116  O O   . GLN C 1 115 ? -18.710 78.893  115.452 1.00 20.00 ? 115  GLN C O   1 
ATOM   8117  C CB  . GLN C 1 115 ? -20.487 76.609  113.693 1.00 20.00 ? 115  GLN C CB  1 
ATOM   8118  C CG  . GLN C 1 115 ? -21.706 75.727  113.488 1.00 20.00 ? 115  GLN C CG  1 
ATOM   8119  C CD  . GLN C 1 115 ? -21.580 74.812  112.296 1.00 20.00 ? 115  GLN C CD  1 
ATOM   8120  O OE1 . GLN C 1 115 ? -21.097 75.211  111.246 1.00 20.00 ? 115  GLN C OE1 1 
ATOM   8121  N NE2 . GLN C 1 115 ? -22.022 73.573  112.451 1.00 20.00 ? 115  GLN C NE2 1 
ATOM   8122  N N   . TYR C 1 116 ? -18.235 76.718  115.684 1.00 20.00 ? 116  TYR C N   1 
ATOM   8123  C CA  . TYR C 1 116 ? -16.854 76.976  116.055 1.00 20.00 ? 116  TYR C CA  1 
ATOM   8124  C C   . TYR C 1 116 ? -15.863 76.424  115.053 1.00 20.00 ? 116  TYR C C   1 
ATOM   8125  O O   . TYR C 1 116 ? -16.124 75.422  114.393 1.00 20.00 ? 116  TYR C O   1 
ATOM   8126  C CB  . TYR C 1 116 ? -16.556 76.364  117.426 1.00 20.00 ? 116  TYR C CB  1 
ATOM   8127  C CG  . TYR C 1 116 ? -17.177 77.115  118.579 1.00 20.00 ? 116  TYR C CG  1 
ATOM   8128  C CD1 . TYR C 1 116 ? -18.506 76.908  118.936 1.00 20.00 ? 116  TYR C CD1 1 
ATOM   8129  C CD2 . TYR C 1 116 ? -16.441 78.047  119.301 1.00 20.00 ? 116  TYR C CD2 1 
ATOM   8130  C CE1 . TYR C 1 116 ? -19.085 77.611  119.982 1.00 20.00 ? 116  TYR C CE1 1 
ATOM   8131  C CE2 . TYR C 1 116 ? -17.010 78.753  120.347 1.00 20.00 ? 116  TYR C CE2 1 
ATOM   8132  C CZ  . TYR C 1 116 ? -18.328 78.531  120.681 1.00 20.00 ? 116  TYR C CZ  1 
ATOM   8133  O OH  . TYR C 1 116 ? -18.887 79.222  121.726 1.00 20.00 ? 116  TYR C OH  1 
ATOM   8134  N N   . VAL C 1 117 ? -14.725 77.098  114.939 1.00 20.00 ? 117  VAL C N   1 
ATOM   8135  C CA  . VAL C 1 117 ? -13.666 76.681  114.032 1.00 20.00 ? 117  VAL C CA  1 
ATOM   8136  C C   . VAL C 1 117 ? -12.404 76.637  114.892 1.00 20.00 ? 117  VAL C C   1 
ATOM   8137  O O   . VAL C 1 117 ? -11.955 77.665  115.393 1.00 20.00 ? 117  VAL C O   1 
ATOM   8138  C CB  . VAL C 1 117 ? -13.450 77.675  112.876 1.00 20.00 ? 117  VAL C CB  1 
ATOM   8139  C CG1 . VAL C 1 117 ? -12.120 77.393  112.207 1.00 20.00 ? 117  VAL C CG1 1 
ATOM   8140  C CG2 . VAL C 1 117 ? -14.583 77.554  111.858 1.00 20.00 ? 117  VAL C CG2 1 
ATOM   8141  N N   . ALA C 1 118 ? -11.859 75.442  115.085 1.00 20.00 ? 118  ALA C N   1 
ATOM   8142  C CA  . ALA C 1 118 ? -10.654 75.274  115.886 1.00 20.00 ? 118  ALA C CA  1 
ATOM   8143  C C   . ALA C 1 118 ? -9.458  75.104  114.960 1.00 20.00 ? 118  ALA C C   1 
ATOM   8144  O O   . ALA C 1 118 ? -9.567  74.471  113.911 1.00 20.00 ? 118  ALA C O   1 
ATOM   8145  C CB  . ALA C 1 118 ? -10.791 74.055  116.782 1.00 20.00 ? 118  ALA C CB  1 
ATOM   8146  N N   . GLY C 1 119 ? -8.320  75.669  115.343 1.00 20.00 ? 119  GLY C N   1 
ATOM   8147  C CA  . GLY C 1 119 ? -7.140  75.546  114.508 1.00 20.00 ? 119  GLY C CA  1 
ATOM   8148  C C   . GLY C 1 119 ? -5.871  75.813  115.282 1.00 20.00 ? 119  GLY C C   1 
ATOM   8149  O O   . GLY C 1 119 ? -5.921  76.346  116.383 1.00 20.00 ? 119  GLY C O   1 
ATOM   8150  N N   . ASN C 1 120 ? -4.733  75.418  114.723 1.00 20.00 ? 120  ASN C N   1 
ATOM   8151  C CA  . ASN C 1 120 ? -3.464  75.641  115.390 1.00 20.00 ? 120  ASN C CA  1 
ATOM   8152  C C   . ASN C 1 120 ? -3.028  77.024  114.960 1.00 20.00 ? 120  ASN C C   1 
ATOM   8153  O O   . ASN C 1 120 ? -2.389  77.194  113.930 1.00 20.00 ? 120  ASN C O   1 
ATOM   8154  C CB  . ASN C 1 120 ? -2.421  74.594  114.978 1.00 20.00 ? 120  ASN C CB  1 
ATOM   8155  C CG  . ASN C 1 120 ? -2.391  74.351  113.494 1.00 20.00 ? 120  ASN C CG  1 
ATOM   8156  O OD1 . ASN C 1 120 ? -3.345  74.651  112.781 1.00 20.00 ? 120  ASN C OD1 1 
ATOM   8157  N ND2 . ASN C 1 120 ? -1.290  73.802  113.015 1.00 20.00 ? 120  ASN C ND2 1 
ATOM   8158  N N   . MET C 1 121 ? -3.398  78.014  115.762 1.00 20.00 ? 121  MET C N   1 
ATOM   8159  C CA  . MET C 1 121 ? -3.066  79.404  115.493 1.00 20.00 ? 121  MET C CA  1 
ATOM   8160  C C   . MET C 1 121 ? -3.886  79.868  114.286 1.00 20.00 ? 121  MET C C   1 
ATOM   8161  O O   . MET C 1 121 ? -4.780  79.150  113.835 1.00 20.00 ? 121  MET C O   1 
ATOM   8162  C CB  . MET C 1 121 ? -1.561  79.555  115.237 1.00 20.00 ? 121  MET C CB  1 
ATOM   8163  C CG  . MET C 1 121 ? -0.878  80.483  116.219 1.00 20.00 ? 121  MET C CG  1 
ATOM   8164  S SD  . MET C 1 121 ? 0.654   79.820  116.894 1.00 20.00 ? 121  MET C SD  1 
ATOM   8165  C CE  . MET C 1 121 ? 1.332   81.290  117.651 1.00 20.00 ? 121  MET C CE  1 
ATOM   8166  N N   . TYR C 1 122 ? -3.589  81.052  113.756 1.00 20.00 ? 122  TYR C N   1 
ATOM   8167  C CA  . TYR C 1 122 ? -4.340  81.547  112.613 1.00 20.00 ? 122  TYR C CA  1 
ATOM   8168  C C   . TYR C 1 122 ? -3.549  82.506  111.730 1.00 20.00 ? 122  TYR C C   1 
ATOM   8169  O O   . TYR C 1 122 ? -2.450  82.932  112.078 1.00 20.00 ? 122  TYR C O   1 
ATOM   8170  C CB  . TYR C 1 122 ? -5.578  82.280  113.116 1.00 20.00 ? 122  TYR C CB  1 
ATOM   8171  C CG  . TYR C 1 122 ? -5.207  83.578  113.788 1.00 20.00 ? 122  TYR C CG  1 
ATOM   8172  C CD1 . TYR C 1 122 ? -4.879  83.611  115.139 1.00 20.00 ? 122  TYR C CD1 1 
ATOM   8173  C CD2 . TYR C 1 122 ? -5.093  84.757  113.052 1.00 20.00 ? 122  TYR C CD2 1 
ATOM   8174  C CE1 . TYR C 1 122 ? -4.438  84.784  115.739 1.00 20.00 ? 122  TYR C CE1 1 
ATOM   8175  C CE2 . TYR C 1 122 ? -4.655  85.932  113.637 1.00 20.00 ? 122  TYR C CE2 1 
ATOM   8176  C CZ  . TYR C 1 122 ? -4.324  85.942  114.979 1.00 20.00 ? 122  TYR C CZ  1 
ATOM   8177  O OH  . TYR C 1 122 ? -3.854  87.103  115.551 1.00 20.00 ? 122  TYR C OH  1 
ATOM   8178  N N   . PHE C 1 123 ? -4.142  82.837  110.587 1.00 20.00 ? 123  PHE C N   1 
ATOM   8179  C CA  . PHE C 1 123 ? -3.563  83.753  109.614 1.00 20.00 ? 123  PHE C CA  1 
ATOM   8180  C C   . PHE C 1 123 ? -4.647  84.806  109.369 1.00 20.00 ? 123  PHE C C   1 
ATOM   8181  O O   . PHE C 1 123 ? -5.833  84.480  109.324 1.00 20.00 ? 123  PHE C O   1 
ATOM   8182  C CB  . PHE C 1 123 ? -3.223  83.053  108.302 1.00 20.00 ? 123  PHE C CB  1 
ATOM   8183  C CG  . PHE C 1 123 ? -2.667  83.984  107.262 1.00 20.00 ? 123  PHE C CG  1 
ATOM   8184  C CD1 . PHE C 1 123 ? -1.436  84.607  107.461 1.00 20.00 ? 123  PHE C CD1 1 
ATOM   8185  C CD2 . PHE C 1 123 ? -3.387  84.276  106.108 1.00 20.00 ? 123  PHE C CD2 1 
ATOM   8186  C CE1 . PHE C 1 123 ? -0.930  85.515  106.523 1.00 20.00 ? 123  PHE C CE1 1 
ATOM   8187  C CE2 . PHE C 1 123 ? -2.894  85.178  105.166 1.00 20.00 ? 123  PHE C CE2 1 
ATOM   8188  C CZ  . PHE C 1 123 ? -1.662  85.801  105.375 1.00 20.00 ? 123  PHE C CZ  1 
ATOM   8189  N N   . THR C 1 124 ? -4.245  86.062  109.207 1.00 20.00 ? 124  THR C N   1 
ATOM   8190  C CA  . THR C 1 124 ? -5.195  87.142  108.981 1.00 20.00 ? 124  THR C CA  1 
ATOM   8191  C C   . THR C 1 124 ? -6.361  86.882  108.025 1.00 20.00 ? 124  THR C C   1 
ATOM   8192  O O   . THR C 1 124 ? -7.513  86.891  108.450 1.00 20.00 ? 124  THR C O   1 
ATOM   8193  C CB  . THR C 1 124 ? -4.474  88.431  108.540 1.00 20.00 ? 124  THR C CB  1 
ATOM   8194  O OG1 . THR C 1 124 ? -3.790  88.213  107.303 1.00 20.00 ? 124  THR C OG1 1 
ATOM   8195  C CG2 . THR C 1 124 ? -3.473  88.846  109.594 1.00 20.00 ? 124  THR C CG2 1 
ATOM   8196  N N   . THR C 1 125 ? -6.080  86.645  106.750 1.00 20.00 ? 125  THR C N   1 
ATOM   8197  C CA  . THR C 1 125 ? -7.151  86.399  105.781 1.00 20.00 ? 125  THR C CA  1 
ATOM   8198  C C   . THR C 1 125 ? -8.066  85.224  106.096 1.00 20.00 ? 125  THR C C   1 
ATOM   8199  O O   . THR C 1 125 ? -9.289  85.351  106.062 1.00 20.00 ? 125  THR C O   1 
ATOM   8200  C CB  . THR C 1 125 ? -6.602  86.189  104.336 1.00 20.00 ? 125  THR C CB  1 
ATOM   8201  O OG1 . THR C 1 125 ? -5.775  85.018  104.291 1.00 20.00 ? 125  THR C OG1 1 
ATOM   8202  C CG2 . THR C 1 125 ? -5.805  87.409  103.880 1.00 20.00 ? 125  THR C CG2 1 
ATOM   8203  N N   . THR C 1 126 ? -7.475  84.078  106.402 1.00 20.00 ? 126  THR C N   1 
ATOM   8204  C CA  . THR C 1 126 ? -8.262  82.900  106.705 1.00 20.00 ? 126  THR C CA  1 
ATOM   8205  C C   . THR C 1 126 ? -9.196  83.076  107.906 1.00 20.00 ? 126  THR C C   1 
ATOM   8206  O O   . THR C 1 126 ? -10.347 82.619  107.873 1.00 20.00 ? 126  THR C O   1 
ATOM   8207  C CB  . THR C 1 126 ? -7.350  81.669  106.892 1.00 20.00 ? 126  THR C CB  1 
ATOM   8208  O OG1 . THR C 1 126 ? -7.583  81.081  108.171 1.00 20.00 ? 126  THR C OG1 1 
ATOM   8209  C CG2 . THR C 1 126 ? -5.904  82.056  106.772 1.00 20.00 ? 126  THR C CG2 1 
ATOM   8210  N N   . ARG C 1 127 ? -8.717  83.752  108.949 1.00 20.00 ? 127  ARG C N   1 
ATOM   8211  C CA  . ARG C 1 127 ? -9.525  83.982  110.150 1.00 20.00 ? 127  ARG C CA  1 
ATOM   8212  C C   . ARG C 1 127 ? -10.656 84.967  109.857 1.00 20.00 ? 127  ARG C C   1 
ATOM   8213  O O   . ARG C 1 127 ? -11.757 84.833  110.384 1.00 20.00 ? 127  ARG C O   1 
ATOM   8214  C CB  . ARG C 1 127 ? -8.663  84.530  111.293 1.00 20.00 ? 127  ARG C CB  1 
ATOM   8215  C CG  . ARG C 1 127 ? -9.336  84.435  112.644 1.00 20.00 ? 127  ARG C CG  1 
ATOM   8216  C CD  . ARG C 1 127 ? -8.729  85.379  113.672 1.00 20.00 ? 127  ARG C CD  1 
ATOM   8217  N NE  . ARG C 1 127 ? -9.588  85.469  114.849 1.00 20.00 ? 127  ARG C NE  1 
ATOM   8218  C CZ  . ARG C 1 127 ? -9.180  85.325  116.106 1.00 20.00 ? 127  ARG C CZ  1 
ATOM   8219  N NH1 . ARG C 1 127 ? -7.908  85.083  116.385 1.00 20.00 ? 127  ARG C NH1 1 
ATOM   8220  N NH2 . ARG C 1 127 ? -10.061 85.402  117.092 1.00 20.00 ? 127  ARG C NH2 1 
ATOM   8221  N N   . PHE C 1 128 ? -10.372 85.964  109.024 1.00 20.00 ? 128  PHE C N   1 
ATOM   8222  C CA  . PHE C 1 128 ? -11.371 86.959  108.668 1.00 20.00 ? 128  PHE C CA  1 
ATOM   8223  C C   . PHE C 1 128 ? -12.592 86.292  108.046 1.00 20.00 ? 128  PHE C C   1 
ATOM   8224  O O   . PHE C 1 128 ? -13.717 86.555  108.446 1.00 20.00 ? 128  PHE C O   1 
ATOM   8225  C CB  . PHE C 1 128 ? -10.806 87.968  107.668 1.00 20.00 ? 128  PHE C CB  1 
ATOM   8226  C CG  . PHE C 1 128 ? -11.868 88.726  106.916 1.00 20.00 ? 128  PHE C CG  1 
ATOM   8227  C CD1 . PHE C 1 128 ? -12.423 89.887  107.449 1.00 20.00 ? 128  PHE C CD1 1 
ATOM   8228  C CD2 . PHE C 1 128 ? -12.348 88.257  105.698 1.00 20.00 ? 128  PHE C CD2 1 
ATOM   8229  C CE1 . PHE C 1 128 ? -13.441 90.565  106.782 1.00 20.00 ? 128  PHE C CE1 1 
ATOM   8230  C CE2 . PHE C 1 128 ? -13.368 88.931  105.026 1.00 20.00 ? 128  PHE C CE2 1 
ATOM   8231  C CZ  . PHE C 1 128 ? -13.914 90.086  105.574 1.00 20.00 ? 128  PHE C CZ  1 
ATOM   8232  N N   . HIS C 1 129 ? -12.364 85.440  107.053 1.00 20.00 ? 129  HIS C N   1 
ATOM   8233  C CA  . HIS C 1 129 ? -13.460 84.750  106.383 1.00 20.00 ? 129  HIS C CA  1 
ATOM   8234  C C   . HIS C 1 129 ? -14.202 83.818  107.323 1.00 20.00 ? 129  HIS C C   1 
ATOM   8235  O O   . HIS C 1 129 ? -15.400 83.582  107.159 1.00 20.00 ? 129  HIS C O   1 
ATOM   8236  C CB  . HIS C 1 129 ? -12.936 83.983  105.170 1.00 20.00 ? 129  HIS C CB  1 
ATOM   8237  C CG  . HIS C 1 129 ? -12.454 84.873  104.071 1.00 20.00 ? 129  HIS C CG  1 
ATOM   8238  N ND1 . HIS C 1 129 ? -13.281 85.763  103.425 1.00 20.00 ? 129  HIS C ND1 1 
ATOM   8239  C CD2 . HIS C 1 129 ? -11.224 85.044  103.534 1.00 20.00 ? 129  HIS C CD2 1 
ATOM   8240  C CE1 . HIS C 1 129 ? -12.582 86.446  102.537 1.00 20.00 ? 129  HIS C CE1 1 
ATOM   8241  N NE2 . HIS C 1 129 ? -11.330 86.027  102.583 1.00 20.00 ? 129  HIS C NE2 1 
ATOM   8242  N N   . GLN C 1 130 ? -13.495 83.291  108.313 1.00 20.00 ? 130  GLN C N   1 
ATOM   8243  C CA  . GLN C 1 130 ? -14.119 82.392  109.269 1.00 20.00 ? 130  GLN C CA  1 
ATOM   8244  C C   . GLN C 1 130 ? -15.125 83.194  110.089 1.00 20.00 ? 130  GLN C C   1 
ATOM   8245  O O   . GLN C 1 130 ? -16.302 82.853  110.153 1.00 20.00 ? 130  GLN C O   1 
ATOM   8246  C CB  . GLN C 1 130 ? -13.067 81.787  110.193 1.00 20.00 ? 130  GLN C CB  1 
ATOM   8247  C CG  . GLN C 1 130 ? -12.482 80.491  109.674 1.00 20.00 ? 130  GLN C CG  1 
ATOM   8248  C CD  . GLN C 1 130 ? -11.167 80.153  110.331 1.00 20.00 ? 130  GLN C CD  1 
ATOM   8249  O OE1 . GLN C 1 130 ? -10.361 79.412  109.777 1.00 20.00 ? 130  GLN C OE1 1 
ATOM   8250  N NE2 . GLN C 1 130 ? -10.940 80.696  111.519 1.00 20.00 ? 130  GLN C NE2 1 
ATOM   8251  N N   . GLU C 1 131 ? -14.652 84.271  110.704 1.00 20.00 ? 131  GLU C N   1 
ATOM   8252  C CA  . GLU C 1 131 ? -15.504 85.122  111.517 1.00 20.00 ? 131  GLU C CA  1 
ATOM   8253  C C   . GLU C 1 131 ? -16.538 85.838  110.664 1.00 20.00 ? 131  GLU C C   1 
ATOM   8254  O O   . GLU C 1 131 ? -17.682 86.007  111.080 1.00 20.00 ? 131  GLU C O   1 
ATOM   8255  C CB  . GLU C 1 131 ? -14.657 86.148  112.274 1.00 20.00 ? 131  GLU C CB  1 
ATOM   8256  C CG  . GLU C 1 131 ? -13.772 85.522  113.339 1.00 20.00 ? 131  GLU C CG  1 
ATOM   8257  C CD  . GLU C 1 131 ? -12.826 86.513  113.976 1.00 20.00 ? 131  GLU C CD  1 
ATOM   8258  O OE1 . GLU C 1 131 ? -12.803 87.680  113.532 1.00 20.00 ? 131  GLU C OE1 1 
ATOM   8259  O OE2 . GLU C 1 131 ? -12.108 86.126  114.922 1.00 20.00 ? 131  GLU C OE2 1 
ATOM   8260  N N   . LYS C 1 132 ? -16.131 86.255  109.470 1.00 20.00 ? 132  LYS C N   1 
ATOM   8261  C CA  . LYS C 1 132 ? -17.027 86.954  108.558 1.00 20.00 ? 132  LYS C CA  1 
ATOM   8262  C C   . LYS C 1 132 ? -18.271 86.126  108.292 1.00 20.00 ? 132  LYS C C   1 
ATOM   8263  O O   . LYS C 1 132 ? -19.355 86.669  108.119 1.00 20.00 ? 132  LYS C O   1 
ATOM   8264  C CB  . LYS C 1 132 ? -16.322 87.243  107.231 1.00 20.00 ? 132  LYS C CB  1 
ATOM   8265  C CG  . LYS C 1 132 ? -17.210 87.881  106.171 1.00 20.00 ? 132  LYS C CG  1 
ATOM   8266  C CD  . LYS C 1 132 ? -17.588 86.877  105.079 1.00 20.00 ? 132  LYS C CD  1 
ATOM   8267  C CE  . LYS C 1 132 ? -16.533 86.797  103.967 1.00 20.00 ? 132  LYS C CE  1 
ATOM   8268  N NZ  . LYS C 1 132 ? -16.294 85.392  103.499 1.00 20.00 ? 132  LYS C NZ  1 
ATOM   8269  N N   . ASN C 1 133 ? -18.121 84.808  108.280 1.00 20.00 ? 133  ASN C N   1 
ATOM   8270  C CA  . ASN C 1 133 ? -19.258 83.940  108.024 1.00 20.00 ? 133  ASN C CA  1 
ATOM   8271  C C   . ASN C 1 133 ? -20.006 83.415  109.241 1.00 20.00 ? 133  ASN C C   1 
ATOM   8272  O O   . ASN C 1 133 ? -20.773 82.465  109.135 1.00 20.00 ? 133  ASN C O   1 
ATOM   8273  C CB  . ASN C 1 133 ? -18.821 82.788  107.126 1.00 20.00 ? 133  ASN C CB  1 
ATOM   8274  C CG  . ASN C 1 133 ? -18.505 83.256  105.715 1.00 20.00 ? 133  ASN C CG  1 
ATOM   8275  O OD1 . ASN C 1 133 ? -17.341 83.418  105.342 1.00 20.00 ? 133  ASN C OD1 1 
ATOM   8276  N ND2 . ASN C 1 133 ? -19.546 83.493  104.927 1.00 20.00 ? 133  ASN C ND2 1 
ATOM   8277  N N   . GLY C 1 134 ? -19.787 84.041  110.391 1.00 20.00 ? 134  GLY C N   1 
ATOM   8278  C CA  . GLY C 1 134 ? -20.461 83.624  111.607 1.00 20.00 ? 134  GLY C CA  1 
ATOM   8279  C C   . GLY C 1 134 ? -19.847 82.523  112.449 1.00 20.00 ? 134  GLY C C   1 
ATOM   8280  O O   . GLY C 1 134 ? -20.565 81.711  113.013 1.00 20.00 ? 134  GLY C O   1 
ATOM   8281  N N   . ALA C 1 135 ? -18.529 82.478  112.550 1.00 20.00 ? 135  ALA C N   1 
ATOM   8282  C CA  . ALA C 1 135 ? -17.896 81.442  113.351 1.00 20.00 ? 135  ALA C CA  1 
ATOM   8283  C C   . ALA C 1 135 ? -16.984 82.080  114.382 1.00 20.00 ? 135  ALA C C   1 
ATOM   8284  O O   . ALA C 1 135 ? -16.569 83.222  114.226 1.00 20.00 ? 135  ALA C O   1 
ATOM   8285  C CB  . ALA C 1 135 ? -17.098 80.512  112.463 1.00 20.00 ? 135  ALA C CB  1 
ATOM   8286  N N   . THR C 1 136 ? -16.686 81.339  115.442 1.00 20.00 ? 136  THR C N   1 
ATOM   8287  C CA  . THR C 1 136 ? -15.808 81.826  116.507 1.00 20.00 ? 136  THR C CA  1 
ATOM   8288  C C   . THR C 1 136 ? -14.533 80.989  116.432 1.00 20.00 ? 136  THR C C   1 
ATOM   8289  O O   . THR C 1 136 ? -14.589 79.760  116.525 1.00 20.00 ? 136  THR C O   1 
ATOM   8290  C CB  . THR C 1 136 ? -16.433 81.629  117.910 1.00 20.00 ? 136  THR C CB  1 
ATOM   8291  O OG1 . THR C 1 136 ? -17.632 82.407  118.023 1.00 20.00 ? 136  THR C OG1 1 
ATOM   8292  C CG2 . THR C 1 136 ? -15.454 82.055  118.989 1.00 20.00 ? 136  THR C CG2 1 
ATOM   8293  N N   . PHE C 1 137 ? -13.389 81.645  116.262 1.00 20.00 ? 137  PHE C N   1 
ATOM   8294  C CA  . PHE C 1 137 ? -12.123 80.926  116.176 1.00 20.00 ? 137  PHE C CA  1 
ATOM   8295  C C   . PHE C 1 137 ? -11.543 80.525  117.526 1.00 20.00 ? 137  PHE C C   1 
ATOM   8296  O O   . PHE C 1 137 ? -11.427 81.345  118.432 1.00 20.00 ? 137  PHE C O   1 
ATOM   8297  C CB  . PHE C 1 137 ? -11.080 81.750  115.424 1.00 20.00 ? 137  PHE C CB  1 
ATOM   8298  C CG  . PHE C 1 137 ? -9.709  81.148  115.468 1.00 20.00 ? 137  PHE C CG  1 
ATOM   8299  C CD1 . PHE C 1 137 ? -9.405  80.036  114.694 1.00 20.00 ? 137  PHE C CD1 1 
ATOM   8300  C CD2 . PHE C 1 137 ? -8.735  81.664  116.316 1.00 20.00 ? 137  PHE C CD2 1 
ATOM   8301  C CE1 . PHE C 1 137 ? -8.154  79.443  114.763 1.00 20.00 ? 137  PHE C CE1 1 
ATOM   8302  C CE2 . PHE C 1 137 ? -7.477  81.077  116.394 1.00 20.00 ? 137  PHE C CE2 1 
ATOM   8303  C CZ  . PHE C 1 137 ? -7.186  79.963  115.616 1.00 20.00 ? 137  PHE C CZ  1 
ATOM   8304  N N   . VAL C 1 138 ? -11.150 79.262  117.640 1.00 20.00 ? 138  VAL C N   1 
ATOM   8305  C CA  . VAL C 1 138 ? -10.580 78.746  118.872 1.00 20.00 ? 138  VAL C CA  1 
ATOM   8306  C C   . VAL C 1 138 ? -9.194  78.180  118.613 1.00 20.00 ? 138  VAL C C   1 
ATOM   8307  O O   . VAL C 1 138 ? -9.030  77.228  117.864 1.00 20.00 ? 138  VAL C O   1 
ATOM   8308  C CB  . VAL C 1 138 ? -11.473 77.636  119.465 1.00 20.00 ? 138  VAL C CB  1 
ATOM   8309  C CG1 . VAL C 1 138 ? -10.848 77.084  120.732 1.00 20.00 ? 138  VAL C CG1 1 
ATOM   8310  C CG2 . VAL C 1 138 ? -12.859 78.181  119.743 1.00 20.00 ? 138  VAL C CG2 1 
ATOM   8311  N N   . ASP C 1 139 ? -8.195  78.770  119.247 1.00 20.00 ? 139  ASP C N   1 
ATOM   8312  C CA  . ASP C 1 139 ? -6.821  78.324  119.086 1.00 20.00 ? 139  ASP C CA  1 
ATOM   8313  C C   . ASP C 1 139 ? -6.552  77.077  119.923 1.00 20.00 ? 139  ASP C C   1 
ATOM   8314  O O   . ASP C 1 139 ? -6.679  77.100  121.147 1.00 20.00 ? 139  ASP C O   1 
ATOM   8315  C CB  . ASP C 1 139 ? -5.870  79.447  119.502 1.00 20.00 ? 139  ASP C CB  1 
ATOM   8316  C CG  . ASP C 1 139 ? -4.422  79.150  119.155 1.00 20.00 ? 139  ASP C CG  1 
ATOM   8317  O OD1 . ASP C 1 139 ? -4.116  78.016  118.728 1.00 20.00 ? 139  ASP C OD1 1 
ATOM   8318  O OD2 . ASP C 1 139 ? -3.588  80.062  119.311 1.00 20.00 ? 139  ASP C OD2 1 
ATOM   8319  N N   . ILE C 1 140 ? -6.189  75.980  119.272 1.00 20.00 ? 140  ILE C N   1 
ATOM   8320  C CA  . ILE C 1 140 ? -5.916  74.758  120.013 1.00 20.00 ? 140  ILE C CA  1 
ATOM   8321  C C   . ILE C 1 140 ? -4.478  74.258  119.841 1.00 20.00 ? 140  ILE C C   1 
ATOM   8322  O O   . ILE C 1 140 ? -4.199  73.083  120.027 1.00 20.00 ? 140  ILE C O   1 
ATOM   8323  C CB  . ILE C 1 140 ? -6.911  73.629  119.640 1.00 20.00 ? 140  ILE C CB  1 
ATOM   8324  C CG1 . ILE C 1 140 ? -6.894  73.376  118.134 1.00 20.00 ? 140  ILE C CG1 1 
ATOM   8325  C CG2 . ILE C 1 140 ? -8.316  74.023  120.070 1.00 20.00 ? 140  ILE C CG2 1 
ATOM   8326  C CD1 . ILE C 1 140 ? -7.723  72.189  117.717 1.00 20.00 ? 140  ILE C CD1 1 
ATOM   8327  N N   . VAL C 1 141 ? -3.570  75.162  119.488 1.00 20.00 ? 141  VAL C N   1 
ATOM   8328  C CA  . VAL C 1 141 ? -2.169  74.809  119.301 1.00 20.00 ? 141  VAL C CA  1 
ATOM   8329  C C   . VAL C 1 141 ? -1.549  74.621  120.687 1.00 20.00 ? 141  VAL C C   1 
ATOM   8330  O O   . VAL C 1 141 ? -2.085  75.106  121.686 1.00 20.00 ? 141  VAL C O   1 
ATOM   8331  C CB  . VAL C 1 141 ? -1.386  75.937  118.555 1.00 20.00 ? 141  VAL C CB  1 
ATOM   8332  C CG1 . VAL C 1 141 ? -1.128  77.107  119.485 1.00 20.00 ? 141  VAL C CG1 1 
ATOM   8333  C CG2 . VAL C 1 141 ? -0.074  75.405  118.034 1.00 20.00 ? 141  VAL C CG2 1 
ATOM   8334  N N   . ARG C 1 142 ? -0.429  73.911  120.750 1.00 20.00 ? 142  ARG C N   1 
ATOM   8335  C CA  . ARG C 1 142 ? 0.241   73.680  122.022 1.00 20.00 ? 142  ARG C CA  1 
ATOM   8336  C C   . ARG C 1 142 ? 0.716   75.027  122.574 1.00 20.00 ? 142  ARG C C   1 
ATOM   8337  O O   . ARG C 1 142 ? 1.096   75.921  121.819 1.00 20.00 ? 142  ARG C O   1 
ATOM   8338  C CB  . ARG C 1 142 ? 1.436   72.743  121.821 1.00 20.00 ? 142  ARG C CB  1 
ATOM   8339  C CG  . ARG C 1 142 ? 2.336   73.143  120.657 1.00 20.00 ? 142  ARG C CG  1 
ATOM   8340  C CD  . ARG C 1 142 ? 3.223   71.998  120.227 1.00 20.00 ? 142  ARG C CD  1 
ATOM   8341  N NE  . ARG C 1 142 ? 3.863   71.361  121.364 1.00 20.00 ? 142  ARG C NE  1 
ATOM   8342  C CZ  . ARG C 1 142 ? 4.569   70.239  121.310 1.00 20.00 ? 142  ARG C CZ  1 
ATOM   8343  N NH1 . ARG C 1 142 ? 4.743   69.598  120.161 1.00 20.00 ? 142  ARG C NH1 1 
ATOM   8344  N NH2 . ARG C 1 142 ? 5.106   69.758  122.421 1.00 20.00 ? 142  ARG C NH2 1 
ATOM   8345  N N   . ASP C 1 143 ? 0.689   75.165  123.892 1.00 20.00 ? 143  ASP C N   1 
ATOM   8346  C CA  . ASP C 1 143 ? 1.110   76.400  124.547 1.00 20.00 ? 143  ASP C CA  1 
ATOM   8347  C C   . ASP C 1 143 ? 2.563   76.809  124.284 1.00 20.00 ? 143  ASP C C   1 
ATOM   8348  O O   . ASP C 1 143 ? 2.874   77.997  124.248 1.00 20.00 ? 143  ASP C O   1 
ATOM   8349  C CB  . ASP C 1 143 ? 0.888   76.282  126.056 1.00 20.00 ? 143  ASP C CB  1 
ATOM   8350  C CG  . ASP C 1 143 ? -0.578  76.286  126.430 1.00 20.00 ? 143  ASP C CG  1 
ATOM   8351  O OD1 . ASP C 1 143 ? -1.302  77.221  126.018 1.00 20.00 ? 143  ASP C OD1 1 
ATOM   8352  O OD2 . ASP C 1 143 ? -1.006  75.349  127.138 1.00 20.00 ? 143  ASP C OD2 1 
ATOM   8353  N N   . GLU C 1 144 ? 3.447   75.833  124.108 1.00 20.00 ? 144  GLU C N   1 
ATOM   8354  C CA  . GLU C 1 144 ? 4.854   76.121  123.855 1.00 20.00 ? 144  GLU C CA  1 
ATOM   8355  C C   . GLU C 1 144 ? 5.025   76.907  122.572 1.00 20.00 ? 144  GLU C C   1 
ATOM   8356  O O   . GLU C 1 144 ? 5.995   77.637  122.411 1.00 20.00 ? 144  GLU C O   1 
ATOM   8357  C CB  . GLU C 1 144 ? 5.656   74.823  123.760 1.00 20.00 ? 144  GLU C CB  1 
ATOM   8358  C CG  . GLU C 1 144 ? 5.724   74.064  125.063 1.00 20.00 ? 144  GLU C CG  1 
ATOM   8359  C CD  . GLU C 1 144 ? 4.643   73.016  125.174 1.00 20.00 ? 144  GLU C CD  1 
ATOM   8360  O OE1 . GLU C 1 144 ? 3.996   72.721  124.142 1.00 20.00 ? 144  GLU C OE1 1 
ATOM   8361  O OE2 . GLU C 1 144 ? 4.443   72.488  126.292 1.00 20.00 ? 144  GLU C OE2 1 
ATOM   8362  N N   . ALA C 1 145 ? 4.080   76.743  121.655 1.00 20.00 ? 145  ALA C N   1 
ATOM   8363  C CA  . ALA C 1 145 ? 4.130   77.442  120.385 1.00 20.00 ? 145  ALA C CA  1 
ATOM   8364  C C   . ALA C 1 145 ? 4.134   78.938  120.625 1.00 20.00 ? 145  ALA C C   1 
ATOM   8365  O O   . ALA C 1 145 ? 4.575   79.704  119.777 1.00 20.00 ? 145  ALA C O   1 
ATOM   8366  C CB  . ALA C 1 145 ? 2.938   77.063  119.534 1.00 20.00 ? 145  ALA C CB  1 
ATOM   8367  N N   . HIS C 1 146 ? 3.649   79.357  121.787 1.00 20.00 ? 146  HIS C N   1 
ATOM   8368  C CA  . HIS C 1 146 ? 3.608   80.773  122.110 1.00 20.00 ? 146  HIS C CA  1 
ATOM   8369  C C   . HIS C 1 146 ? 4.893   81.283  122.744 1.00 20.00 ? 146  HIS C C   1 
ATOM   8370  O O   . HIS C 1 146 ? 5.049   82.482  122.952 1.00 20.00 ? 146  HIS C O   1 
ATOM   8371  C CB  . HIS C 1 146 ? 2.426   81.056  123.027 1.00 20.00 ? 146  HIS C CB  1 
ATOM   8372  C CG  . HIS C 1 146 ? 1.101   80.786  122.388 1.00 20.00 ? 146  HIS C CG  1 
ATOM   8373  N ND1 . HIS C 1 146 ? 0.408   79.610  122.578 1.00 20.00 ? 146  HIS C ND1 1 
ATOM   8374  C CD2 . HIS C 1 146 ? 0.353   81.530  121.539 1.00 20.00 ? 146  HIS C CD2 1 
ATOM   8375  C CE1 . HIS C 1 146 ? -0.709  79.639  121.872 1.00 20.00 ? 146  HIS C CE1 1 
ATOM   8376  N NE2 . HIS C 1 146 ? -0.766  80.793  121.233 1.00 20.00 ? 146  HIS C NE2 1 
ATOM   8377  N N   . ASP C 1 147 ? 5.810   80.374  123.051 1.00 20.00 ? 147  ASP C N   1 
ATOM   8378  C CA  . ASP C 1 147 ? 7.081   80.746  123.658 1.00 20.00 ? 147  ASP C CA  1 
ATOM   8379  C C   . ASP C 1 147 ? 8.076   80.850  122.512 1.00 20.00 ? 147  ASP C C   1 
ATOM   8380  O O   . ASP C 1 147 ? 8.579   79.839  122.032 1.00 20.00 ? 147  ASP C O   1 
ATOM   8381  C CB  . ASP C 1 147 ? 7.520   79.669  124.651 1.00 20.00 ? 147  ASP C CB  1 
ATOM   8382  C CG  . ASP C 1 147 ? 8.816   80.017  125.365 1.00 20.00 ? 147  ASP C CG  1 
ATOM   8383  O OD1 . ASP C 1 147 ? 9.386   81.098  125.097 1.00 20.00 ? 147  ASP C OD1 1 
ATOM   8384  O OD2 . ASP C 1 147 ? 9.269   79.198  126.196 1.00 20.00 ? 147  ASP C OD2 1 
ATOM   8385  N N   . ALA C 1 148 ? 8.352   82.076  122.074 1.00 20.00 ? 148  ALA C N   1 
ATOM   8386  C CA  . ALA C 1 148 ? 9.279   82.320  120.975 1.00 20.00 ? 148  ALA C CA  1 
ATOM   8387  C C   . ALA C 1 148 ? 10.737  82.000  121.273 1.00 20.00 ? 148  ALA C C   1 
ATOM   8388  O O   . ALA C 1 148 ? 11.584  82.079  120.387 1.00 20.00 ? 148  ALA C O   1 
ATOM   8389  C CB  . ALA C 1 148 ? 9.151   83.756  120.514 1.00 20.00 ? 148  ALA C CB  1 
ATOM   8390  N N   . SER C 1 149 ? 11.037  81.636  122.512 1.00 20.00 ? 149  SER C N   1 
ATOM   8391  C CA  . SER C 1 149 ? 12.409  81.312  122.879 1.00 20.00 ? 149  SER C CA  1 
ATOM   8392  C C   . SER C 1 149 ? 12.633  79.807  122.918 1.00 20.00 ? 149  SER C C   1 
ATOM   8393  O O   . SER C 1 149 ? 13.739  79.330  122.679 1.00 20.00 ? 149  SER C O   1 
ATOM   8394  C CB  . SER C 1 149 ? 12.743  81.916  124.244 1.00 20.00 ? 149  SER C CB  1 
ATOM   8395  O OG  . SER C 1 149 ? 12.957  83.314  124.141 1.00 20.00 ? 149  SER C OG  1 
ATOM   8396  N N   . LEU C 1 150 ? 11.570  79.066  123.205 1.00 20.00 ? 150  LEU C N   1 
ATOM   8397  C CA  . LEU C 1 150 ? 11.635  77.618  123.287 1.00 20.00 ? 150  LEU C CA  1 
ATOM   8398  C C   . LEU C 1 150 ? 12.047  76.929  121.998 1.00 20.00 ? 150  LEU C C   1 
ATOM   8399  O O   . LEU C 1 150 ? 11.297  76.893  121.029 1.00 20.00 ? 150  LEU C O   1 
ATOM   8400  C CB  . LEU C 1 150 ? 10.290  77.072  123.753 1.00 20.00 ? 150  LEU C CB  1 
ATOM   8401  C CG  . LEU C 1 150 ? 10.263  75.633  124.259 1.00 20.00 ? 150  LEU C CG  1 
ATOM   8402  C CD1 . LEU C 1 150 ? 11.378  75.410  125.269 1.00 20.00 ? 150  LEU C CD1 1 
ATOM   8403  C CD2 . LEU C 1 150 ? 8.902   75.350  124.886 1.00 20.00 ? 150  LEU C CD2 1 
ATOM   8404  N N   . ASN C 1 151 ? 13.251  76.373  121.998 1.00 20.00 ? 151  ASN C N   1 
ATOM   8405  C CA  . ASN C 1 151 ? 13.759  75.679  120.831 1.00 20.00 ? 151  ASN C CA  1 
ATOM   8406  C C   . ASN C 1 151 ? 13.247  74.253  120.888 1.00 20.00 ? 151  ASN C C   1 
ATOM   8407  O O   . ASN C 1 151 ? 13.944  73.351  121.353 1.00 20.00 ? 151  ASN C O   1 
ATOM   8408  C CB  . ASN C 1 151 ? 15.283  75.672  120.830 1.00 20.00 ? 151  ASN C CB  1 
ATOM   8409  C CG  . ASN C 1 151 ? 15.855  75.221  119.505 1.00 20.00 ? 151  ASN C CG  1 
ATOM   8410  O OD1 . ASN C 1 151 ? 15.538  74.137  119.017 1.00 20.00 ? 151  ASN C OD1 1 
ATOM   8411  N ND2 . ASN C 1 151 ? 16.697  76.056  118.908 1.00 20.00 ? 151  ASN C ND2 1 
ATOM   8412  N N   . LEU C 1 152 ? 12.026  74.055  120.405 1.00 20.00 ? 152  LEU C N   1 
ATOM   8413  C CA  . LEU C 1 152 ? 11.413  72.739  120.404 1.00 20.00 ? 152  LEU C CA  1 
ATOM   8414  C C   . LEU C 1 152 ? 10.830  72.369  119.036 1.00 20.00 ? 152  LEU C C   1 
ATOM   8415  O O   . LEU C 1 152 ? 10.270  73.209  118.339 1.00 20.00 ? 152  LEU C O   1 
ATOM   8416  C CB  . LEU C 1 152 ? 10.338  72.705  121.491 1.00 20.00 ? 152  LEU C CB  1 
ATOM   8417  C CG  . LEU C 1 152 ? 8.977   72.069  121.241 1.00 20.00 ? 152  LEU C CG  1 
ATOM   8418  C CD1 . LEU C 1 152 ? 8.852   70.802  122.088 1.00 20.00 ? 152  LEU C CD1 1 
ATOM   8419  C CD2 . LEU C 1 152 ? 7.880   73.067  121.602 1.00 20.00 ? 152  LEU C CD2 1 
ATOM   8420  N N   . PRO C 1 153 ? 10.978  71.098  118.630 1.00 20.00 ? 153  PRO C N   1 
ATOM   8421  C CA  . PRO C 1 153 ? 10.476  70.631  117.331 1.00 20.00 ? 153  PRO C CA  1 
ATOM   8422  C C   . PRO C 1 153 ? 8.958   70.508  117.241 1.00 20.00 ? 153  PRO C C   1 
ATOM   8423  O O   . PRO C 1 153 ? 8.281   70.263  118.236 1.00 20.00 ? 153  PRO C O   1 
ATOM   8424  C CB  . PRO C 1 153 ? 11.156  69.274  117.145 1.00 20.00 ? 153  PRO C CB  1 
ATOM   8425  C CG  . PRO C 1 153 ? 11.391  68.789  118.529 1.00 20.00 ? 153  PRO C CG  1 
ATOM   8426  C CD  . PRO C 1 153 ? 11.651  70.019  119.375 1.00 20.00 ? 153  PRO C CD  1 
ATOM   8427  N N   . PHE C 1 154 ? 8.441   70.683  116.032 1.00 20.00 ? 154  PHE C N   1 
ATOM   8428  C CA  . PHE C 1 154 ? 7.015   70.591  115.775 1.00 20.00 ? 154  PHE C CA  1 
ATOM   8429  C C   . PHE C 1 154 ? 6.159   71.414  116.726 1.00 20.00 ? 154  PHE C C   1 
ATOM   8430  O O   . PHE C 1 154 ? 5.224   70.905  117.333 1.00 20.00 ? 154  PHE C O   1 
ATOM   8431  C CB  . PHE C 1 154 ? 6.596   69.119  115.797 1.00 20.00 ? 154  PHE C CB  1 
ATOM   8432  C CG  . PHE C 1 154 ? 7.274   68.292  114.742 1.00 20.00 ? 154  PHE C CG  1 
ATOM   8433  C CD1 . PHE C 1 154 ? 7.055   68.553  113.395 1.00 20.00 ? 154  PHE C CD1 1 
ATOM   8434  C CD2 . PHE C 1 154 ? 8.168   67.291  115.091 1.00 20.00 ? 154  PHE C CD2 1 
ATOM   8435  C CE1 . PHE C 1 154 ? 7.719   67.837  112.413 1.00 20.00 ? 154  PHE C CE1 1 
ATOM   8436  C CE2 . PHE C 1 154 ? 8.842   66.564  114.114 1.00 20.00 ? 154  PHE C CE2 1 
ATOM   8437  C CZ  . PHE C 1 154 ? 8.616   66.839  112.771 1.00 20.00 ? 154  PHE C CZ  1 
ATOM   8438  N N   . LYS C 1 155 ? 6.489   72.695  116.843 1.00 20.00 ? 155  LYS C N   1 
ATOM   8439  C CA  . LYS C 1 155 ? 5.766   73.617  117.707 1.00 20.00 ? 155  LYS C CA  1 
ATOM   8440  C C   . LYS C 1 155 ? 4.378   73.894  117.157 1.00 20.00 ? 155  LYS C C   1 
ATOM   8441  O O   . LYS C 1 155 ? 3.537   74.461  117.850 1.00 20.00 ? 155  LYS C O   1 
ATOM   8442  C CB  . LYS C 1 155 ? 6.506   74.952  117.789 1.00 20.00 ? 155  LYS C CB  1 
ATOM   8443  C CG  . LYS C 1 155 ? 7.451   75.100  118.956 1.00 20.00 ? 155  LYS C CG  1 
ATOM   8444  C CD  . LYS C 1 155 ? 8.272   76.363  118.785 1.00 20.00 ? 155  LYS C CD  1 
ATOM   8445  C CE  . LYS C 1 155 ? 8.180   77.259  119.986 1.00 20.00 ? 155  LYS C CE  1 
ATOM   8446  N NZ  . LYS C 1 155 ? 9.143   78.374  119.839 1.00 20.00 ? 155  LYS C NZ  1 
ATOM   8447  N N   . GLY C 1 156 ? 4.149   73.517  115.903 1.00 20.00 ? 156  GLY C N   1 
ATOM   8448  C CA  . GLY C 1 156 ? 2.855   73.745  115.289 1.00 20.00 ? 156  GLY C CA  1 
ATOM   8449  C C   . GLY C 1 156 ? 1.784   72.736  115.648 1.00 20.00 ? 156  GLY C C   1 
ATOM   8450  O O   . GLY C 1 156 ? 0.612   72.933  115.345 1.00 20.00 ? 156  GLY C O   1 
ATOM   8451  N N   . ASP C 1 157 ? 2.181   71.653  116.299 1.00 20.00 ? 157  ASP C N   1 
ATOM   8452  C CA  . ASP C 1 157 ? 1.233   70.622  116.684 1.00 20.00 ? 157  ASP C CA  1 
ATOM   8453  C C   . ASP C 1 157 ? 0.038   71.127  117.486 1.00 20.00 ? 157  ASP C C   1 
ATOM   8454  O O   . ASP C 1 157 ? 0.138   72.072  118.275 1.00 20.00 ? 157  ASP C O   1 
ATOM   8455  C CB  . ASP C 1 157 ? 1.938   69.531  117.486 1.00 20.00 ? 157  ASP C CB  1 
ATOM   8456  C CG  . ASP C 1 157 ? 2.692   68.563  116.605 1.00 20.00 ? 157  ASP C CG  1 
ATOM   8457  O OD1 . ASP C 1 157 ? 2.851   68.866  115.408 1.00 20.00 ? 157  ASP C OD1 1 
ATOM   8458  O OD2 . ASP C 1 157 ? 3.126   67.507  117.104 1.00 20.00 ? 157  ASP C OD2 1 
ATOM   8459  N N   . ILE C 1 158 ? -1.089  70.458  117.268 1.00 20.00 ? 158  ILE C N   1 
ATOM   8460  C CA  . ILE C 1 158 ? -2.347  70.758  117.926 1.00 20.00 ? 158  ILE C CA  1 
ATOM   8461  C C   . ILE C 1 158 ? -2.369  70.027  119.281 1.00 20.00 ? 158  ILE C C   1 
ATOM   8462  O O   . ILE C 1 158 ? -1.913  68.884  119.385 1.00 20.00 ? 158  ILE C O   1 
ATOM   8463  C CB  . ILE C 1 158 ? -3.524  70.246  117.055 1.00 20.00 ? 158  ILE C CB  1 
ATOM   8464  C CG1 . ILE C 1 158 ? -3.926  71.315  116.036 1.00 20.00 ? 158  ILE C CG1 1 
ATOM   8465  C CG2 . ILE C 1 158 ? -4.703  69.838  117.934 1.00 20.00 ? 158  ILE C CG2 1 
ATOM   8466  C CD1 . ILE C 1 158 ? -5.053  70.884  115.105 1.00 20.00 ? 158  ILE C CD1 1 
ATOM   8467  N N   . ASP C 1 159 ? -2.876  70.685  120.319 1.00 20.00 ? 159  ASP C N   1 
ATOM   8468  C CA  . ASP C 1 159 ? -2.944  70.060  121.636 1.00 20.00 ? 159  ASP C CA  1 
ATOM   8469  C C   . ASP C 1 159 ? -4.221  69.231  121.628 1.00 20.00 ? 159  ASP C C   1 
ATOM   8470  O O   . ASP C 1 159 ? -5.323  69.776  121.643 1.00 20.00 ? 159  ASP C O   1 
ATOM   8471  C CB  . ASP C 1 159 ? -3.016  71.115  122.744 1.00 20.00 ? 159  ASP C CB  1 
ATOM   8472  C CG  . ASP C 1 159 ? -3.000  70.503  124.135 1.00 20.00 ? 159  ASP C CG  1 
ATOM   8473  O OD1 . ASP C 1 159 ? -3.484  69.366  124.289 1.00 20.00 ? 159  ASP C OD1 1 
ATOM   8474  O OD2 . ASP C 1 159 ? -2.501  71.148  125.076 1.00 20.00 ? 159  ASP C OD2 1 
ATOM   8475  N N   . LEU C 1 160 ? -4.072  67.913  121.595 1.00 20.00 ? 160  LEU C N   1 
ATOM   8476  C CA  . LEU C 1 160 ? -5.223  67.025  121.576 1.00 20.00 ? 160  LEU C CA  1 
ATOM   8477  C C   . LEU C 1 160 ? -6.146  67.139  122.792 1.00 20.00 ? 160  LEU C C   1 
ATOM   8478  O O   . LEU C 1 160 ? -7.311  66.778  122.722 1.00 20.00 ? 160  LEU C O   1 
ATOM   8479  C CB  . LEU C 1 160 ? -4.755  65.583  121.378 1.00 20.00 ? 160  LEU C CB  1 
ATOM   8480  C CG  . LEU C 1 160 ? -4.174  65.334  119.983 1.00 20.00 ? 160  LEU C CG  1 
ATOM   8481  C CD1 . LEU C 1 160 ? -3.374  64.053  119.983 1.00 20.00 ? 160  LEU C CD1 1 
ATOM   8482  C CD2 . LEU C 1 160 ? -5.284  65.251  118.967 1.00 20.00 ? 160  LEU C CD2 1 
ATOM   8483  N N   . ASN C 1 161 ? -5.630  67.646  123.903 1.00 20.00 ? 161  ASN C N   1 
ATOM   8484  C CA  . ASN C 1 161 ? -6.449  67.793  125.102 1.00 20.00 ? 161  ASN C CA  1 
ATOM   8485  C C   . ASN C 1 161 ? -7.343  69.010  124.928 1.00 20.00 ? 161  ASN C C   1 
ATOM   8486  O O   . ASN C 1 161 ? -8.485  69.026  125.373 1.00 20.00 ? 161  ASN C O   1 
ATOM   8487  C CB  . ASN C 1 161 ? -5.571  67.993  126.338 1.00 20.00 ? 161  ASN C CB  1 
ATOM   8488  C CG  . ASN C 1 161 ? -4.718  66.785  126.649 1.00 20.00 ? 161  ASN C CG  1 
ATOM   8489  O OD1 . ASN C 1 161 ? -3.539  66.917  126.978 1.00 20.00 ? 161  ASN C OD1 1 
ATOM   8490  N ND2 . ASN C 1 161 ? -5.306  65.597  126.547 1.00 20.00 ? 161  ASN C ND2 1 
ATOM   8491  N N   . LYS C 1 162 ? -6.801  70.036  124.289 1.00 20.00 ? 162  LYS C N   1 
ATOM   8492  C CA  . LYS C 1 162 ? -7.541  71.260  124.053 1.00 20.00 ? 162  LYS C CA  1 
ATOM   8493  C C   . LYS C 1 162 ? -8.661  70.985  123.062 1.00 20.00 ? 162  LYS C C   1 
ATOM   8494  O O   . LYS C 1 162 ? -9.750  71.536  123.174 1.00 20.00 ? 162  LYS C O   1 
ATOM   8495  C CB  . LYS C 1 162 ? -6.618  72.335  123.481 1.00 20.00 ? 162  LYS C CB  1 
ATOM   8496  C CG  . LYS C 1 162 ? -5.774  73.069  124.508 1.00 20.00 ? 162  LYS C CG  1 
ATOM   8497  C CD  . LYS C 1 162 ? -5.077  74.261  123.872 1.00 20.00 ? 162  LYS C CD  1 
ATOM   8498  C CE  . LYS C 1 162 ? -3.836  74.678  124.630 1.00 20.00 ? 162  LYS C CE  1 
ATOM   8499  N NZ  . LYS C 1 162 ? -3.504  76.097  124.325 1.00 20.00 ? 162  LYS C NZ  1 
ATOM   8500  N N   . LEU C 1 163 ? -8.384  70.128  122.088 1.00 20.00 ? 163  LEU C N   1 
ATOM   8501  C CA  . LEU C 1 163 ? -9.364  69.783  121.075 1.00 20.00 ? 163  LEU C CA  1 
ATOM   8502  C C   . LEU C 1 163 ? -10.471 68.940  121.684 1.00 20.00 ? 163  LEU C C   1 
ATOM   8503  O O   . LEU C 1 163 ? -11.653 69.205  121.471 1.00 20.00 ? 163  LEU C O   1 
ATOM   8504  C CB  . LEU C 1 163 ? -8.690  69.012  119.939 1.00 20.00 ? 163  LEU C CB  1 
ATOM   8505  C CG  . LEU C 1 163 ? -9.623  68.324  118.938 1.00 20.00 ? 163  LEU C CG  1 
ATOM   8506  C CD1 . LEU C 1 163 ? -10.535 69.352  118.295 1.00 20.00 ? 163  LEU C CD1 1 
ATOM   8507  C CD2 . LEU C 1 163 ? -8.804  67.607  117.888 1.00 20.00 ? 163  LEU C CD2 1 
ATOM   8508  N N   . ALA C 1 164 ? -10.081 67.919  122.443 1.00 20.00 ? 164  ALA C N   1 
ATOM   8509  C CA  . ALA C 1 164 ? -11.043 67.033  123.084 1.00 20.00 ? 164  ALA C CA  1 
ATOM   8510  C C   . ALA C 1 164 ? -11.932 67.812  124.050 1.00 20.00 ? 164  ALA C C   1 
ATOM   8511  O O   . ALA C 1 164 ? -13.116 67.527  124.173 1.00 20.00 ? 164  ALA C O   1 
ATOM   8512  C CB  . ALA C 1 164 ? -10.316 65.916  123.815 1.00 20.00 ? 164  ALA C CB  1 
ATOM   8513  N N   . THR C 1 165 ? -11.356 68.797  124.728 1.00 20.00 ? 165  THR C N   1 
ATOM   8514  C CA  . THR C 1 165 ? -12.111 69.609  125.675 1.00 20.00 ? 165  THR C CA  1 
ATOM   8515  C C   . THR C 1 165 ? -13.094 70.496  124.925 1.00 20.00 ? 165  THR C C   1 
ATOM   8516  O O   . THR C 1 165 ? -14.182 70.778  125.411 1.00 20.00 ? 165  THR C O   1 
ATOM   8517  C CB  . THR C 1 165 ? -11.189 70.511  126.491 1.00 20.00 ? 165  THR C CB  1 
ATOM   8518  O OG1 . THR C 1 165 ? -10.456 69.721  127.434 1.00 20.00 ? 165  THR C OG1 1 
ATOM   8519  C CG2 . THR C 1 165 ? -11.996 71.552  127.230 1.00 20.00 ? 165  THR C CG2 1 
ATOM   8520  N N   . LEU C 1 166 ? -12.696 70.941  123.738 1.00 20.00 ? 166  LEU C N   1 
ATOM   8521  C CA  . LEU C 1 166 ? -13.541 71.795  122.913 1.00 20.00 ? 166  LEU C CA  1 
ATOM   8522  C C   . LEU C 1 166 ? -14.754 70.995  122.498 1.00 20.00 ? 166  LEU C C   1 
ATOM   8523  O O   . LEU C 1 166 ? -15.884 71.451  122.618 1.00 20.00 ? 166  LEU C O   1 
ATOM   8524  C CB  . LEU C 1 166 ? -12.792 72.240  121.650 1.00 20.00 ? 166  LEU C CB  1 
ATOM   8525  C CG  . LEU C 1 166 ? -13.148 73.560  120.950 1.00 20.00 ? 166  LEU C CG  1 
ATOM   8526  C CD1 . LEU C 1 166 ? -12.950 73.396  119.459 1.00 20.00 ? 166  LEU C CD1 1 
ATOM   8527  C CD2 . LEU C 1 166 ? -14.567 73.964  121.245 1.00 20.00 ? 166  LEU C CD2 1 
ATOM   8528  N N   . ILE C 1 167 ? -14.499 69.796  121.991 1.00 20.00 ? 167  ILE C N   1 
ATOM   8529  C CA  . ILE C 1 167 ? -15.556 68.913  121.549 1.00 20.00 ? 167  ILE C CA  1 
ATOM   8530  C C   . ILE C 1 167 ? -16.489 68.590  122.708 1.00 20.00 ? 167  ILE C C   1 
ATOM   8531  O O   . ILE C 1 167 ? -17.688 68.414  122.520 1.00 20.00 ? 167  ILE C O   1 
ATOM   8532  C CB  . ILE C 1 167 ? -14.970 67.603  121.004 1.00 20.00 ? 167  ILE C CB  1 
ATOM   8533  C CG1 . ILE C 1 167 ? -14.182 67.887  119.722 1.00 20.00 ? 167  ILE C CG1 1 
ATOM   8534  C CG2 . ILE C 1 167 ? -16.082 66.596  120.736 1.00 20.00 ? 167  ILE C CG2 1 
ATOM   8535  C CD1 . ILE C 1 167 ? -13.498 66.665  119.144 1.00 20.00 ? 167  ILE C CD1 1 
ATOM   8536  N N   . LYS C 1 168 ? -15.928 68.529  123.909 1.00 20.00 ? 168  LYS C N   1 
ATOM   8537  C CA  . LYS C 1 168 ? -16.697 68.223  125.107 1.00 20.00 ? 168  LYS C CA  1 
ATOM   8538  C C   . LYS C 1 168 ? -17.558 69.380  125.596 1.00 20.00 ? 168  LYS C C   1 
ATOM   8539  O O   . LYS C 1 168 ? -18.748 69.213  125.837 1.00 20.00 ? 168  LYS C O   1 
ATOM   8540  C CB  . LYS C 1 168 ? -15.745 67.773  126.220 1.00 20.00 ? 168  LYS C CB  1 
ATOM   8541  C CG  . LYS C 1 168 ? -16.306 67.873  127.630 1.00 20.00 ? 168  LYS C CG  1 
ATOM   8542  C CD  . LYS C 1 168 ? -15.239 68.330  128.626 1.00 20.00 ? 168  LYS C CD  1 
ATOM   8543  C CE  . LYS C 1 168 ? -14.569 67.145  129.325 1.00 20.00 ? 168  LYS C CE  1 
ATOM   8544  N NZ  . LYS C 1 168 ? -13.399 66.602  128.565 1.00 20.00 ? 168  LYS C NZ  1 
ATOM   8545  N N   . GLU C 1 169 ? -16.963 70.556  125.733 1.00 20.00 ? 169  GLU C N   1 
ATOM   8546  C CA  . GLU C 1 169 ? -17.707 71.707  126.201 1.00 20.00 ? 169  GLU C CA  1 
ATOM   8547  C C   . GLU C 1 169 ? -18.672 72.322  125.183 1.00 20.00 ? 169  GLU C C   1 
ATOM   8548  O O   . GLU C 1 169 ? -19.620 72.998  125.575 1.00 20.00 ? 169  GLU C O   1 
ATOM   8549  C CB  . GLU C 1 169 ? -16.739 72.787  126.709 1.00 20.00 ? 169  GLU C CB  1 
ATOM   8550  C CG  . GLU C 1 169 ? -15.446 72.250  127.346 1.00 20.00 ? 169  GLU C CG  1 
ATOM   8551  C CD  . GLU C 1 169 ? -15.446 72.287  128.875 1.00 20.00 ? 169  GLU C CD  1 
ATOM   8552  O OE1 . GLU C 1 169 ? -16.139 73.147  129.455 1.00 20.00 ? 169  GLU C OE1 1 
ATOM   8553  O OE2 . GLU C 1 169 ? -14.750 71.455  129.501 1.00 20.00 ? 169  GLU C OE2 1 
ATOM   8554  N N   . LYS C 1 170 ? -18.471 72.072  123.891 1.00 20.00 ? 170  LYS C N   1 
ATOM   8555  C CA  . LYS C 1 170 ? -19.362 72.653  122.883 1.00 20.00 ? 170  LYS C CA  1 
ATOM   8556  C C   . LYS C 1 170 ? -20.208 71.723  122.020 1.00 20.00 ? 170  LYS C C   1 
ATOM   8557  O O   . LYS C 1 170 ? -21.199 72.156  121.446 1.00 20.00 ? 170  LYS C O   1 
ATOM   8558  C CB  . LYS C 1 170 ? -18.558 73.573  121.953 1.00 20.00 ? 170  LYS C CB  1 
ATOM   8559  C CG  . LYS C 1 170 ? -17.622 74.536  122.674 1.00 20.00 ? 170  LYS C CG  1 
ATOM   8560  C CD  . LYS C 1 170 ? -18.370 75.749  123.193 1.00 20.00 ? 170  LYS C CD  1 
ATOM   8561  C CE  . LYS C 1 170 ? -17.435 76.722  123.885 1.00 20.00 ? 170  LYS C CE  1 
ATOM   8562  N NZ  . LYS C 1 170 ? -18.203 77.831  124.507 1.00 20.00 ? 170  LYS C NZ  1 
ATOM   8563  N N   . GLY C 1 171 ? -19.826 70.460  121.911 1.00 20.00 ? 171  GLY C N   1 
ATOM   8564  C CA  . GLY C 1 171 ? -20.603 69.547  121.096 1.00 20.00 ? 171  GLY C CA  1 
ATOM   8565  C C   . GLY C 1 171 ? -20.053 69.496  119.684 1.00 20.00 ? 171  GLY C C   1 
ATOM   8566  O O   . GLY C 1 171 ? -19.950 70.515  119.008 1.00 20.00 ? 171  GLY C O   1 
ATOM   8567  N N   . ALA C 1 172 ? -19.695 68.297  119.244 1.00 20.00 ? 172  ALA C N   1 
ATOM   8568  C CA  . ALA C 1 172 ? -19.147 68.088  117.913 1.00 20.00 ? 172  ALA C CA  1 
ATOM   8569  C C   . ALA C 1 172 ? -19.983 68.741  116.837 1.00 20.00 ? 172  ALA C C   1 
ATOM   8570  O O   . ALA C 1 172 ? -19.456 69.211  115.836 1.00 20.00 ? 172  ALA C O   1 
ATOM   8571  C CB  . ALA C 1 172 ? -19.039 66.604  117.629 1.00 20.00 ? 172  ALA C CB  1 
ATOM   8572  N N   . GLU C 1 173 ? -21.291 68.765  117.043 1.00 20.00 ? 173  GLU C N   1 
ATOM   8573  C CA  . GLU C 1 173 ? -22.195 69.361  116.071 1.00 20.00 ? 173  GLU C CA  1 
ATOM   8574  C C   . GLU C 1 173 ? -22.008 70.866  115.932 1.00 20.00 ? 173  GLU C C   1 
ATOM   8575  O O   . GLU C 1 173 ? -22.404 71.451  114.931 1.00 20.00 ? 173  GLU C O   1 
ATOM   8576  C CB  . GLU C 1 173 ? -23.651 69.039  116.447 1.00 20.00 ? 173  GLU C CB  1 
ATOM   8577  C CG  . GLU C 1 173 ? -24.206 69.842  117.626 1.00 20.00 ? 173  GLU C CG  1 
ATOM   8578  C CD  . GLU C 1 173 ? -23.992 69.172  118.980 1.00 20.00 ? 173  GLU C CD  1 
ATOM   8579  O OE1 . GLU C 1 173 ? -23.448 68.047  119.020 1.00 20.00 ? 173  GLU C OE1 1 
ATOM   8580  O OE2 . GLU C 1 173 ? -24.370 69.778  120.007 1.00 20.00 ? 173  GLU C OE2 1 
ATOM   8581  N N   . ASN C 1 174 ? -21.383 71.484  116.925 1.00 20.00 ? 174  ASN C N   1 
ATOM   8582  C CA  . ASN C 1 174 ? -21.158 72.920  116.899 1.00 20.00 ? 174  ASN C CA  1 
ATOM   8583  C C   . ASN C 1 174 ? -19.794 73.329  116.374 1.00 20.00 ? 174  ASN C C   1 
ATOM   8584  O O   . ASN C 1 174 ? -19.424 74.500  116.440 1.00 20.00 ? 174  ASN C O   1 
ATOM   8585  C CB  . ASN C 1 174 ? -21.363 73.486  118.298 1.00 20.00 ? 174  ASN C CB  1 
ATOM   8586  C CG  . ASN C 1 174 ? -22.739 73.200  118.823 1.00 20.00 ? 174  ASN C CG  1 
ATOM   8587  O OD1 . ASN C 1 174 ? -23.667 73.001  118.047 1.00 20.00 ? 174  ASN C OD1 1 
ATOM   8588  N ND2 . ASN C 1 174 ? -22.885 73.171  120.141 1.00 20.00 ? 174  ASN C ND2 1 
ATOM   8589  N N   . ILE C 1 175 ? -19.051 72.360  115.855 1.00 20.00 ? 175  ILE C N   1 
ATOM   8590  C CA  . ILE C 1 175 ? -17.729 72.626  115.318 1.00 20.00 ? 175  ILE C CA  1 
ATOM   8591  C C   . ILE C 1 175 ? -17.794 72.497  113.805 1.00 20.00 ? 175  ILE C C   1 
ATOM   8592  O O   . ILE C 1 175 ? -17.930 71.399  113.269 1.00 20.00 ? 175  ILE C O   1 
ATOM   8593  C CB  . ILE C 1 175 ? -16.695 71.643  115.893 1.00 20.00 ? 175  ILE C CB  1 
ATOM   8594  C CG1 . ILE C 1 175 ? -16.555 71.886  117.401 1.00 20.00 ? 175  ILE C CG1 1 
ATOM   8595  C CG2 . ILE C 1 175 ? -15.343 71.830  115.196 1.00 20.00 ? 175  ILE C CG2 1 
ATOM   8596  C CD1 . ILE C 1 175 ? -15.884 70.770  118.149 1.00 20.00 ? 175  ILE C CD1 1 
ATOM   8597  N N   . ALA C 1 176 ? -17.720 73.632  113.121 1.00 20.00 ? 176  ALA C N   1 
ATOM   8598  C CA  . ALA C 1 176 ? -17.773 73.651  111.666 1.00 20.00 ? 176  ALA C CA  1 
ATOM   8599  C C   . ALA C 1 176 ? -16.744 72.692  111.097 1.00 20.00 ? 176  ALA C C   1 
ATOM   8600  O O   . ALA C 1 176 ? -17.075 71.777  110.348 1.00 20.00 ? 176  ALA C O   1 
ATOM   8601  C CB  . ALA C 1 176 ? -17.517 75.065  111.151 1.00 20.00 ? 176  ALA C CB  1 
ATOM   8602  N N   . TYR C 1 177 ? -15.487 72.918  111.458 1.00 20.00 ? 177  TYR C N   1 
ATOM   8603  C CA  . TYR C 1 177 ? -14.390 72.085  110.999 1.00 20.00 ? 177  TYR C CA  1 
ATOM   8604  C C   . TYR C 1 177 ? -13.124 72.477  111.725 1.00 20.00 ? 177  TYR C C   1 
ATOM   8605  O O   . TYR C 1 177 ? -13.078 73.514  112.390 1.00 20.00 ? 177  TYR C O   1 
ATOM   8606  C CB  . TYR C 1 177 ? -14.188 72.240  109.483 1.00 20.00 ? 177  TYR C CB  1 
ATOM   8607  C CG  . TYR C 1 177 ? -13.849 73.638  108.995 1.00 20.00 ? 177  TYR C CG  1 
ATOM   8608  C CD1 . TYR C 1 177 ? -12.527 74.092  108.973 1.00 20.00 ? 177  TYR C CD1 1 
ATOM   8609  C CD2 . TYR C 1 177 ? -14.844 74.493  108.521 1.00 20.00 ? 177  TYR C CD2 1 
ATOM   8610  C CE1 . TYR C 1 177 ? -12.204 75.362  108.489 1.00 20.00 ? 177  TYR C CE1 1 
ATOM   8611  C CE2 . TYR C 1 177 ? -14.534 75.764  108.037 1.00 20.00 ? 177  TYR C CE2 1 
ATOM   8612  C CZ  . TYR C 1 177 ? -13.210 76.188  108.025 1.00 20.00 ? 177  TYR C CZ  1 
ATOM   8613  O OH  . TYR C 1 177 ? -12.889 77.433  107.549 1.00 20.00 ? 177  TYR C OH  1 
ATOM   8614  N N   . ILE C 1 178 ? -12.103 71.637  111.621 1.00 20.00 ? 178  ILE C N   1 
ATOM   8615  C CA  . ILE C 1 178 ? -10.833 71.924  112.270 1.00 20.00 ? 178  ILE C CA  1 
ATOM   8616  C C   . ILE C 1 178 ? -9.940  72.498  111.170 1.00 20.00 ? 178  ILE C C   1 
ATOM   8617  O O   . ILE C 1 178 ? -9.881  71.959  110.067 1.00 20.00 ? 178  ILE C O   1 
ATOM   8618  C CB  . ILE C 1 178 ? -10.211 70.641  112.866 1.00 20.00 ? 178  ILE C CB  1 
ATOM   8619  C CG1 . ILE C 1 178 ? -10.998 70.221  114.108 1.00 20.00 ? 178  ILE C CG1 1 
ATOM   8620  C CG2 . ILE C 1 178 ? -8.765  70.884  113.250 1.00 20.00 ? 178  ILE C CG2 1 
ATOM   8621  C CD1 . ILE C 1 178 ? -10.905 68.734  114.419 1.00 20.00 ? 178  ILE C CD1 1 
ATOM   8622  N N   . CYS C 1 179 ? -9.283  73.618  111.445 1.00 20.00 ? 179  CYS C N   1 
ATOM   8623  C CA  . CYS C 1 179 ? -8.412  74.224  110.446 1.00 20.00 ? 179  CYS C CA  1 
ATOM   8624  C C   . CYS C 1 179 ? -6.943  74.061  110.816 1.00 20.00 ? 179  CYS C C   1 
ATOM   8625  O O   . CYS C 1 179 ? -6.379  74.892  111.534 1.00 20.00 ? 179  CYS C O   1 
ATOM   8626  C CB  . CYS C 1 179 ? -8.723  75.703  110.280 1.00 20.00 ? 179  CYS C CB  1 
ATOM   8627  S SG  . CYS C 1 179 ? -7.756  76.456  108.972 1.00 20.00 ? 179  CYS C SG  1 
ATOM   8628  N N   . LEU C 1 180 ? -6.338  72.987  110.306 1.00 20.00 ? 180  LEU C N   1 
ATOM   8629  C CA  . LEU C 1 180 ? -4.944  72.659  110.546 1.00 20.00 ? 180  LEU C CA  1 
ATOM   8630  C C   . LEU C 1 180 ? -4.072  73.292  109.468 1.00 20.00 ? 180  LEU C C   1 
ATOM   8631  O O   . LEU C 1 180 ? -4.224  73.003  108.282 1.00 20.00 ? 180  LEU C O   1 
ATOM   8632  C CB  . LEU C 1 180 ? -4.778  71.142  110.536 1.00 20.00 ? 180  LEU C CB  1 
ATOM   8633  C CG  . LEU C 1 180 ? -3.605  70.515  111.280 1.00 20.00 ? 180  LEU C CG  1 
ATOM   8634  C CD1 . LEU C 1 180 ? -4.047  69.174  111.846 1.00 20.00 ? 180  LEU C CD1 1 
ATOM   8635  C CD2 . LEU C 1 180 ? -2.435  70.326  110.329 1.00 20.00 ? 180  LEU C CD2 1 
ATOM   8636  N N   . ALA C 1 181 ? -3.161  74.159  109.895 1.00 20.00 ? 181  ALA C N   1 
ATOM   8637  C CA  . ALA C 1 181 ? -2.258  74.846  108.984 1.00 20.00 ? 181  ALA C CA  1 
ATOM   8638  C C   . ALA C 1 181 ? -0.869  74.236  108.987 1.00 20.00 ? 181  ALA C C   1 
ATOM   8639  O O   . ALA C 1 181 ? -0.335  73.883  110.033 1.00 20.00 ? 181  ALA C O   1 
ATOM   8640  C CB  . ALA C 1 181 ? -2.172  76.321  109.360 1.00 20.00 ? 181  ALA C CB  1 
ATOM   8641  N N   . VAL C 1 182 ? -0.286  74.110  107.803 1.00 20.00 ? 182  VAL C N   1 
ATOM   8642  C CA  . VAL C 1 182 ? 1.048   73.547  107.670 1.00 20.00 ? 182  VAL C CA  1 
ATOM   8643  C C   . VAL C 1 182 ? 1.791   74.423  106.668 1.00 20.00 ? 182  VAL C C   1 
ATOM   8644  O O   . VAL C 1 182 ? 1.386   74.501  105.517 1.00 20.00 ? 182  VAL C O   1 
ATOM   8645  C CB  . VAL C 1 182 ? 1.007   72.098  107.135 1.00 20.00 ? 182  VAL C CB  1 
ATOM   8646  C CG1 . VAL C 1 182 ? 0.531   71.160  108.221 1.00 20.00 ? 182  VAL C CG1 1 
ATOM   8647  C CG2 . VAL C 1 182 ? 0.106   72.011  105.916 1.00 20.00 ? 182  VAL C CG2 1 
ATOM   8648  N N   . THR C 1 183 ? 2.841   75.120  107.098 1.00 20.00 ? 183  THR C N   1 
ATOM   8649  C CA  . THR C 1 183 ? 3.326   75.105  108.471 1.00 20.00 ? 183  THR C CA  1 
ATOM   8650  C C   . THR C 1 183 ? 2.531   76.155  109.242 1.00 20.00 ? 183  THR C C   1 
ATOM   8651  O O   . THR C 1 183 ? 1.577   76.718  108.712 1.00 20.00 ? 183  THR C O   1 
ATOM   8652  C CB  . THR C 1 183 ? 4.806   75.485  108.527 1.00 20.00 ? 183  THR C CB  1 
ATOM   8653  O OG1 . THR C 1 183 ? 4.989   76.739  107.863 1.00 20.00 ? 183  THR C OG1 1 
ATOM   8654  C CG2 . THR C 1 183 ? 5.658   74.426  107.845 1.00 20.00 ? 183  THR C CG2 1 
ATOM   8655  N N   . VAL C 1 184 ? 2.917   76.425  110.484 1.00 20.00 ? 184  VAL C N   1 
ATOM   8656  C CA  . VAL C 1 184 ? 2.205   77.421  111.282 1.00 20.00 ? 184  VAL C CA  1 
ATOM   8657  C C   . VAL C 1 184 ? 2.904   78.781  111.202 1.00 20.00 ? 184  VAL C C   1 
ATOM   8658  O O   . VAL C 1 184 ? 3.902   79.030  111.872 1.00 20.00 ? 184  VAL C O   1 
ATOM   8659  C CB  . VAL C 1 184 ? 2.099   76.987  112.758 1.00 20.00 ? 184  VAL C CB  1 
ATOM   8660  C CG1 . VAL C 1 184 ? 1.389   78.057  113.555 1.00 20.00 ? 184  VAL C CG1 1 
ATOM   8661  C CG2 . VAL C 1 184 ? 1.340   75.674  112.864 1.00 20.00 ? 184  VAL C CG2 1 
ATOM   8662  N N   . ASN C 1 185 ? 2.351   79.658  110.380 1.00 20.00 ? 185  ASN C N   1 
ATOM   8663  C CA  . ASN C 1 185 ? 2.888   80.992  110.176 1.00 20.00 ? 185  ASN C CA  1 
ATOM   8664  C C   . ASN C 1 185 ? 3.180   81.801  111.435 1.00 20.00 ? 185  ASN C C   1 
ATOM   8665  O O   . ASN C 1 185 ? 4.335   82.106  111.727 1.00 20.00 ? 185  ASN C O   1 
ATOM   8666  C CB  . ASN C 1 185 ? 1.936   81.783  109.272 1.00 20.00 ? 185  ASN C CB  1 
ATOM   8667  C CG  . ASN C 1 185 ? 2.506   83.124  108.849 1.00 20.00 ? 185  ASN C CG  1 
ATOM   8668  O OD1 . ASN C 1 185 ? 3.534   83.190  108.173 1.00 20.00 ? 185  ASN C OD1 1 
ATOM   8669  N ND2 . ASN C 1 185 ? 1.838   84.203  109.248 1.00 20.00 ? 185  ASN C ND2 1 
ATOM   8670  N N   . LEU C 1 186 ? 2.128   82.156  112.165 1.00 20.00 ? 186  LEU C N   1 
ATOM   8671  C CA  . LEU C 1 186 ? 2.244   82.940  113.392 1.00 20.00 ? 186  LEU C CA  1 
ATOM   8672  C C   . LEU C 1 186 ? 3.370   82.560  114.351 1.00 20.00 ? 186  LEU C C   1 
ATOM   8673  O O   . LEU C 1 186 ? 3.934   83.427  115.014 1.00 20.00 ? 186  LEU C O   1 
ATOM   8674  C CB  . LEU C 1 186 ? 0.913   82.919  114.149 1.00 20.00 ? 186  LEU C CB  1 
ATOM   8675  C CG  . LEU C 1 186 ? 0.179   84.260  114.294 1.00 20.00 ? 186  LEU C CG  1 
ATOM   8676  C CD1 . LEU C 1 186 ? 0.804   85.057  115.424 1.00 20.00 ? 186  LEU C CD1 1 
ATOM   8677  C CD2 . LEU C 1 186 ? 0.236   85.048  112.983 1.00 20.00 ? 186  LEU C CD2 1 
ATOM   8678  N N   . ALA C 1 187 ? 3.704   81.278  114.429 1.00 20.00 ? 187  ALA C N   1 
ATOM   8679  C CA  . ALA C 1 187 ? 4.767   80.834  115.324 1.00 20.00 ? 187  ALA C CA  1 
ATOM   8680  C C   . ALA C 1 187 ? 6.162   80.988  114.719 1.00 20.00 ? 187  ALA C C   1 
ATOM   8681  O O   . ALA C 1 187 ? 7.167   80.710  115.373 1.00 20.00 ? 187  ALA C O   1 
ATOM   8682  C CB  . ALA C 1 187 ? 4.526   79.381  115.732 1.00 20.00 ? 187  ALA C CB  1 
ATOM   8683  N N   . GLY C 1 188 ? 6.226   81.438  113.474 1.00 20.00 ? 188  GLY C N   1 
ATOM   8684  C CA  . GLY C 1 188 ? 7.516   81.607  112.835 1.00 20.00 ? 188  GLY C CA  1 
ATOM   8685  C C   . GLY C 1 188 ? 7.751   80.612  111.716 1.00 20.00 ? 188  GLY C C   1 
ATOM   8686  O O   . GLY C 1 188 ? 8.882   80.467  111.253 1.00 20.00 ? 188  GLY C O   1 
ATOM   8687  N N   . GLY C 1 189 ? 6.691   79.934  111.275 1.00 20.00 ? 189  GLY C N   1 
ATOM   8688  C CA  . GLY C 1 189 ? 6.818   78.954  110.202 1.00 20.00 ? 189  GLY C CA  1 
ATOM   8689  C C   . GLY C 1 189 ? 7.175   77.578  110.736 1.00 20.00 ? 189  GLY C C   1 
ATOM   8690  O O   . GLY C 1 189 ? 7.955   76.847  110.128 1.00 20.00 ? 189  GLY C O   1 
ATOM   8691  N N   . GLN C 1 190 ? 6.597   77.227  111.882 1.00 20.00 ? 190  GLN C N   1 
ATOM   8692  C CA  . GLN C 1 190 ? 6.845   75.941  112.526 1.00 20.00 ? 190  GLN C CA  1 
ATOM   8693  C C   . GLN C 1 190 ? 5.999   74.787  111.996 1.00 20.00 ? 190  GLN C C   1 
ATOM   8694  O O   . GLN C 1 190 ? 4.809   74.940  111.727 1.00 20.00 ? 190  GLN C O   1 
ATOM   8695  C CB  . GLN C 1 190 ? 6.625   76.066  114.035 1.00 20.00 ? 190  GLN C CB  1 
ATOM   8696  C CG  . GLN C 1 190 ? 7.282   77.281  114.679 1.00 20.00 ? 190  GLN C CG  1 
ATOM   8697  C CD  . GLN C 1 190 ? 8.799   77.251  114.610 1.00 20.00 ? 190  GLN C CD  1 
ATOM   8698  O OE1 . GLN C 1 190 ? 9.404   76.186  114.518 1.00 20.00 ? 190  GLN C OE1 1 
ATOM   8699  N NE2 . GLN C 1 190 ? 9.420   78.429  114.655 1.00 20.00 ? 190  GLN C NE2 1 
ATOM   8700  N N   . PRO C 1 191 ? 6.611   73.602  111.856 1.00 20.00 ? 191  PRO C N   1 
ATOM   8701  C CA  . PRO C 1 191 ? 5.961   72.414  111.297 1.00 20.00 ? 191  PRO C CA  1 
ATOM   8702  C C   . PRO C 1 191 ? 5.005   71.676  112.231 1.00 20.00 ? 191  PRO C C   1 
ATOM   8703  O O   . PRO C 1 191 ? 5.003   71.881  113.445 1.00 20.00 ? 191  PRO C O   1 
ATOM   8704  C CB  . PRO C 1 191 ? 7.135   71.526  110.914 1.00 20.00 ? 191  PRO C CB  1 
ATOM   8705  C CG  . PRO C 1 191 ? 8.163   71.863  111.947 1.00 20.00 ? 191  PRO C CG  1 
ATOM   8706  C CD  . PRO C 1 191 ? 8.023   73.339  112.191 1.00 20.00 ? 191  PRO C CD  1 
ATOM   8707  N N   . VAL C 1 192 ? 4.195   70.812  111.627 1.00 20.00 ? 192  VAL C N   1 
ATOM   8708  C CA  . VAL C 1 192 ? 3.216   69.991  112.328 1.00 20.00 ? 192  VAL C CA  1 
ATOM   8709  C C   . VAL C 1 192 ? 3.667   68.566  111.993 1.00 20.00 ? 192  VAL C C   1 
ATOM   8710  O O   . VAL C 1 192 ? 3.917   68.258  110.829 1.00 20.00 ? 192  VAL C O   1 
ATOM   8711  C CB  . VAL C 1 192 ? 1.776   70.214  111.779 1.00 20.00 ? 192  VAL C CB  1 
ATOM   8712  C CG1 . VAL C 1 192 ? 0.823   69.244  112.418 1.00 20.00 ? 192  VAL C CG1 1 
ATOM   8713  C CG2 . VAL C 1 192 ? 1.320   71.644  112.048 1.00 20.00 ? 192  VAL C CG2 1 
ATOM   8714  N N   . SER C 1 193 ? 3.796   67.712  113.003 1.00 20.00 ? 193  SER C N   1 
ATOM   8715  C CA  . SER C 1 193 ? 4.221   66.338  112.781 1.00 20.00 ? 193  SER C CA  1 
ATOM   8716  C C   . SER C 1 193 ? 3.107   65.471  112.200 1.00 20.00 ? 193  SER C C   1 
ATOM   8717  O O   . SER C 1 193 ? 1.924   65.756  112.377 1.00 20.00 ? 193  SER C O   1 
ATOM   8718  C CB  . SER C 1 193 ? 4.704   65.721  114.087 1.00 20.00 ? 193  SER C CB  1 
ATOM   8719  O OG  . SER C 1 193 ? 3.617   65.503  114.966 1.00 20.00 ? 193  SER C OG  1 
ATOM   8720  N N   . MET C 1 194 ? 3.501   64.406  111.509 1.00 20.00 ? 194  MET C N   1 
ATOM   8721  C CA  . MET C 1 194 ? 2.559   63.490  110.899 1.00 20.00 ? 194  MET C CA  1 
ATOM   8722  C C   . MET C 1 194 ? 1.752   62.759  111.962 1.00 20.00 ? 194  MET C C   1 
ATOM   8723  O O   . MET C 1 194 ? 0.595   62.425  111.748 1.00 20.00 ? 194  MET C O   1 
ATOM   8724  C CB  . MET C 1 194 ? 3.302   62.475  110.038 1.00 20.00 ? 194  MET C CB  1 
ATOM   8725  C CG  . MET C 1 194 ? 2.393   61.644  109.172 1.00 20.00 ? 194  MET C CG  1 
ATOM   8726  S SD  . MET C 1 194 ? 1.878   62.548  107.719 1.00 20.00 ? 194  MET C SD  1 
ATOM   8727  C CE  . MET C 1 194 ? 3.385   62.477  106.773 1.00 20.00 ? 194  MET C CE  1 
ATOM   8728  N N   . ALA C 1 195 ? 2.370   62.502  113.105 1.00 20.00 ? 195  ALA C N   1 
ATOM   8729  C CA  . ALA C 1 195 ? 1.692   61.807  114.193 1.00 20.00 ? 195  ALA C CA  1 
ATOM   8730  C C   . ALA C 1 195 ? 0.514   62.635  114.687 1.00 20.00 ? 195  ALA C C   1 
ATOM   8731  O O   . ALA C 1 195 ? -0.541  62.095  115.018 1.00 20.00 ? 195  ALA C O   1 
ATOM   8732  C CB  . ALA C 1 195 ? 2.665   61.545  115.339 1.00 20.00 ? 195  ALA C CB  1 
ATOM   8733  N N   . ASN C 1 196 ? 0.705   63.949  114.747 1.00 20.00 ? 196  ASN C N   1 
ATOM   8734  C CA  . ASN C 1 196 ? -0.343  64.851  115.200 1.00 20.00 ? 196  ASN C CA  1 
ATOM   8735  C C   . ASN C 1 196 ? -1.472  64.888  114.179 1.00 20.00 ? 196  ASN C C   1 
ATOM   8736  O O   . ASN C 1 196 ? -2.641  64.805  114.538 1.00 20.00 ? 196  ASN C O   1 
ATOM   8737  C CB  . ASN C 1 196 ? 0.223   66.261  115.405 1.00 20.00 ? 196  ASN C CB  1 
ATOM   8738  C CG  . ASN C 1 196 ? -0.701  67.148  116.217 1.00 20.00 ? 196  ASN C CG  1 
ATOM   8739  O OD1 . ASN C 1 196 ? -1.161  68.186  115.739 1.00 20.00 ? 196  ASN C OD1 1 
ATOM   8740  N ND2 . ASN C 1 196 ? -0.971  66.748  117.455 1.00 20.00 ? 196  ASN C ND2 1 
ATOM   8741  N N   . MET C 1 197 ? -1.124  65.003  112.903 1.00 20.00 ? 197  MET C N   1 
ATOM   8742  C CA  . MET C 1 197 ? -2.133  65.045  111.845 1.00 20.00 ? 197  MET C CA  1 
ATOM   8743  C C   . MET C 1 197 ? -2.979  63.777  111.826 1.00 20.00 ? 197  MET C C   1 
ATOM   8744  O O   . MET C 1 197 ? -4.171  63.817  111.520 1.00 20.00 ? 197  MET C O   1 
ATOM   8745  C CB  . MET C 1 197 ? -1.470  65.225  110.485 1.00 20.00 ? 197  MET C CB  1 
ATOM   8746  C CG  . MET C 1 197 ? -0.979  66.628  110.254 1.00 20.00 ? 197  MET C CG  1 
ATOM   8747  S SD  . MET C 1 197 ? -0.179  66.802  108.670 1.00 20.00 ? 197  MET C SD  1 
ATOM   8748  C CE  . MET C 1 197 ? 1.530   66.993  109.138 1.00 20.00 ? 197  MET C CE  1 
ATOM   8749  N N   . ARG C 1 198 ? -2.346  62.657  112.155 1.00 20.00 ? 198  ARG C N   1 
ATOM   8750  C CA  . ARG C 1 198 ? -2.997  61.354  112.193 1.00 20.00 ? 198  ARG C CA  1 
ATOM   8751  C C   . ARG C 1 198 ? -3.910  61.243  113.426 1.00 20.00 ? 198  ARG C C   1 
ATOM   8752  O O   . ARG C 1 198 ? -5.029  60.725  113.338 1.00 20.00 ? 198  ARG C O   1 
ATOM   8753  C CB  . ARG C 1 198 ? -1.912  60.270  112.233 1.00 20.00 ? 198  ARG C CB  1 
ATOM   8754  C CG  . ARG C 1 198 ? -2.351  58.835  111.971 1.00 20.00 ? 198  ARG C CG  1 
ATOM   8755  C CD  . ARG C 1 198 ? -1.209  57.883  112.326 1.00 20.00 ? 198  ARG C CD  1 
ATOM   8756  N NE  . ARG C 1 198 ? -0.205  57.714  111.260 1.00 20.00 ? 198  ARG C NE  1 
ATOM   8757  C CZ  . ARG C 1 198 ? 1.124   57.769  111.434 1.00 20.00 ? 198  ARG C CZ  1 
ATOM   8758  N NH1 . ARG C 1 198 ? 1.635   57.986  112.637 1.00 20.00 ? 198  ARG C NH1 1 
ATOM   8759  N NH2 . ARG C 1 198 ? 1.953   57.600  110.411 1.00 20.00 ? 198  ARG C NH2 1 
ATOM   8760  N N   . ALA C 1 199 ? -3.424  61.738  114.565 1.00 20.00 ? 199  ALA C N   1 
ATOM   8761  C CA  . ALA C 1 199 ? -4.173  61.702  115.820 1.00 20.00 ? 199  ALA C CA  1 
ATOM   8762  C C   . ALA C 1 199 ? -5.389  62.608  115.751 1.00 20.00 ? 199  ALA C C   1 
ATOM   8763  O O   . ALA C 1 199 ? -6.468  62.250  116.205 1.00 20.00 ? 199  ALA C O   1 
ATOM   8764  C CB  . ALA C 1 199 ? -3.274  62.122  116.984 1.00 20.00 ? 199  ALA C CB  1 
ATOM   8765  N N   . VAL C 1 200 ? -5.199  63.793  115.186 1.00 20.00 ? 200  VAL C N   1 
ATOM   8766  C CA  . VAL C 1 200 ? -6.275  64.762  115.048 1.00 20.00 ? 200  VAL C CA  1 
ATOM   8767  C C   . VAL C 1 200 ? -7.358  64.164  114.164 1.00 20.00 ? 200  VAL C C   1 
ATOM   8768  O O   . VAL C 1 200 ? -8.551  64.299  114.432 1.00 20.00 ? 200  VAL C O   1 
ATOM   8769  C CB  . VAL C 1 200 ? -5.759  66.062  114.413 1.00 20.00 ? 200  VAL C CB  1 
ATOM   8770  C CG1 . VAL C 1 200 ? -6.920  66.908  113.911 1.00 20.00 ? 200  VAL C CG1 1 
ATOM   8771  C CG2 . VAL C 1 200 ? -4.949  66.829  115.425 1.00 20.00 ? 200  VAL C CG2 1 
ATOM   8772  N N   . HIS C 1 201 ? -6.926  63.499  113.103 1.00 20.00 ? 201  HIS C N   1 
ATOM   8773  C CA  . HIS C 1 201 ? -7.844  62.873  112.173 1.00 20.00 ? 201  HIS C CA  1 
ATOM   8774  C C   . HIS C 1 201 ? -8.625  61.728  112.810 1.00 20.00 ? 201  HIS C C   1 
ATOM   8775  O O   . HIS C 1 201 ? -9.788  61.516  112.488 1.00 20.00 ? 201  HIS C O   1 
ATOM   8776  C CB  . HIS C 1 201 ? -7.088  62.337  110.974 1.00 20.00 ? 201  HIS C CB  1 
ATOM   8777  C CG  . HIS C 1 201 ? -7.898  61.405  110.140 1.00 20.00 ? 201  HIS C CG  1 
ATOM   8778  N ND1 . HIS C 1 201 ? -8.900  61.841  109.301 1.00 20.00 ? 201  HIS C ND1 1 
ATOM   8779  C CD2 . HIS C 1 201 ? -7.872  60.057  110.030 1.00 20.00 ? 201  HIS C CD2 1 
ATOM   8780  C CE1 . HIS C 1 201 ? -9.456  60.802  108.709 1.00 20.00 ? 201  HIS C CE1 1 
ATOM   8781  N NE2 . HIS C 1 201 ? -8.850  59.708  109.134 1.00 20.00 ? 201  HIS C NE2 1 
ATOM   8782  N N   . GLU C 1 202 ? -7.971  60.976  113.690 1.00 20.00 ? 202  GLU C N   1 
ATOM   8783  C CA  . GLU C 1 202 ? -8.603  59.851  114.375 1.00 20.00 ? 202  GLU C CA  1 
ATOM   8784  C C   . GLU C 1 202 ? -9.738  60.358  115.266 1.00 20.00 ? 202  GLU C C   1 
ATOM   8785  O O   . GLU C 1 202 ? -10.855 59.845  115.227 1.00 20.00 ? 202  GLU C O   1 
ATOM   8786  C CB  . GLU C 1 202 ? -7.578  59.134  115.252 1.00 20.00 ? 202  GLU C CB  1 
ATOM   8787  C CG  . GLU C 1 202 ? -7.116  57.785  114.747 1.00 20.00 ? 202  GLU C CG  1 
ATOM   8788  C CD  . GLU C 1 202 ? -6.050  57.174  115.644 1.00 20.00 ? 202  GLU C CD  1 
ATOM   8789  O OE1 . GLU C 1 202 ? -6.346  56.941  116.837 1.00 20.00 ? 202  GLU C OE1 1 
ATOM   8790  O OE2 . GLU C 1 202 ? -4.921  56.933  115.156 1.00 20.00 ? 202  GLU C OE2 1 
ATOM   8791  N N   . MET C 1 203 ? -9.432  61.359  116.082 1.00 20.00 ? 203  MET C N   1 
ATOM   8792  C CA  . MET C 1 203 ? -10.418 61.937  116.984 1.00 20.00 ? 203  MET C CA  1 
ATOM   8793  C C   . MET C 1 203 ? -11.566 62.570  116.205 1.00 20.00 ? 203  MET C C   1 
ATOM   8794  O O   . MET C 1 203 ? -12.731 62.275  116.458 1.00 20.00 ? 203  MET C O   1 
ATOM   8795  C CB  . MET C 1 203 ? -9.758  62.987  117.882 1.00 20.00 ? 203  MET C CB  1 
ATOM   8796  C CG  . MET C 1 203 ? -10.653 63.513  118.996 1.00 20.00 ? 203  MET C CG  1 
ATOM   8797  S SD  . MET C 1 203 ? -9.745  64.509  120.194 1.00 20.00 ? 203  MET C SD  1 
ATOM   8798  C CE  . MET C 1 203 ? -8.265  63.489  120.434 1.00 20.00 ? 203  MET C CE  1 
ATOM   8799  N N   . ALA C 1 204 ? -11.233 63.433  115.250 1.00 20.00 ? 204  ALA C N   1 
ATOM   8800  C CA  . ALA C 1 204 ? -12.249 64.102  114.438 1.00 20.00 ? 204  ALA C CA  1 
ATOM   8801  C C   . ALA C 1 204 ? -13.132 63.112  113.686 1.00 20.00 ? 204  ALA C C   1 
ATOM   8802  O O   . ALA C 1 204 ? -14.331 63.324  113.531 1.00 20.00 ? 204  ALA C O   1 
ATOM   8803  C CB  . ALA C 1 204 ? -11.583 65.072  113.449 1.00 20.00 ? 204  ALA C CB  1 
ATOM   8804  N N   . SER C 1 205 ? -12.537 62.024  113.215 1.00 20.00 ? 205  SER C N   1 
ATOM   8805  C CA  . SER C 1 205 ? -13.293 61.012  112.483 1.00 20.00 ? 205  SER C CA  1 
ATOM   8806  C C   . SER C 1 205 ? -14.294 60.326  113.417 1.00 20.00 ? 205  SER C C   1 
ATOM   8807  O O   . SER C 1 205 ? -15.354 59.875  112.993 1.00 20.00 ? 205  SER C O   1 
ATOM   8808  C CB  . SER C 1 205 ? -12.340 59.970  111.891 1.00 20.00 ? 205  SER C CB  1 
ATOM   8809  O OG  . SER C 1 205 ? -12.840 58.657  112.081 1.00 20.00 ? 205  SER C OG  1 
ATOM   8810  N N   . THR C 1 206 ? -13.945 60.250  114.693 1.00 20.00 ? 206  THR C N   1 
ATOM   8811  C CA  . THR C 1 206 ? -14.809 59.626  115.680 1.00 20.00 ? 206  THR C CA  1 
ATOM   8812  C C   . THR C 1 206 ? -16.087 60.447  115.852 1.00 20.00 ? 206  THR C C   1 
ATOM   8813  O O   . THR C 1 206 ? -17.188 59.902  115.864 1.00 20.00 ? 206  THR C O   1 
ATOM   8814  C CB  . THR C 1 206 ? -14.091 59.526  117.051 1.00 20.00 ? 206  THR C CB  1 
ATOM   8815  O OG1 . THR C 1 206 ? -13.114 58.478  117.009 1.00 20.00 ? 206  THR C OG1 1 
ATOM   8816  C CG2 . THR C 1 206 ? -15.090 59.233  118.160 1.00 20.00 ? 206  THR C CG2 1 
ATOM   8817  N N   . TYR C 1 207 ? -15.927 61.762  115.975 1.00 20.00 ? 207  TYR C N   1 
ATOM   8818  C CA  . TYR C 1 207 ? -17.049 62.666  116.154 1.00 20.00 ? 207  TYR C CA  1 
ATOM   8819  C C   . TYR C 1 207 ? -17.627 63.196  114.865 1.00 20.00 ? 207  TYR C C   1 
ATOM   8820  O O   . TYR C 1 207 ? -18.557 63.995  114.886 1.00 20.00 ? 207  TYR C O   1 
ATOM   8821  C CB  . TYR C 1 207 ? -16.624 63.832  117.036 1.00 20.00 ? 207  TYR C CB  1 
ATOM   8822  C CG  . TYR C 1 207 ? -16.169 63.383  118.391 1.00 20.00 ? 207  TYR C CG  1 
ATOM   8823  C CD1 . TYR C 1 207 ? -17.076 63.234  119.436 1.00 20.00 ? 207  TYR C CD1 1 
ATOM   8824  C CD2 . TYR C 1 207 ? -14.837 63.077  118.626 1.00 20.00 ? 207  TYR C CD2 1 
ATOM   8825  C CE1 . TYR C 1 207 ? -16.666 62.789  120.681 1.00 20.00 ? 207  TYR C CE1 1 
ATOM   8826  C CE2 . TYR C 1 207 ? -14.412 62.631  119.866 1.00 20.00 ? 207  TYR C CE2 1 
ATOM   8827  C CZ  . TYR C 1 207 ? -15.330 62.488  120.891 1.00 20.00 ? 207  TYR C CZ  1 
ATOM   8828  O OH  . TYR C 1 207 ? -14.910 62.038  122.124 1.00 20.00 ? 207  TYR C OH  1 
ATOM   8829  N N   . GLY C 1 208 ? -17.074 62.759  113.744 1.00 20.00 ? 208  GLY C N   1 
ATOM   8830  C CA  . GLY C 1 208 ? -17.568 63.216  112.460 1.00 20.00 ? 208  GLY C CA  1 
ATOM   8831  C C   . GLY C 1 208 ? -17.288 64.679  112.180 1.00 20.00 ? 208  GLY C C   1 
ATOM   8832  O O   . GLY C 1 208 ? -18.055 65.341  111.476 1.00 20.00 ? 208  GLY C O   1 
ATOM   8833  N N   . ILE C 1 209 ? -16.195 65.196  112.730 1.00 20.00 ? 209  ILE C N   1 
ATOM   8834  C CA  . ILE C 1 209 ? -15.834 66.596  112.519 1.00 20.00 ? 209  ILE C CA  1 
ATOM   8835  C C   . ILE C 1 209 ? -15.003 66.724  111.241 1.00 20.00 ? 209  ILE C C   1 
ATOM   8836  O O   . ILE C 1 209 ? -14.211 65.839  110.910 1.00 20.00 ? 209  ILE C O   1 
ATOM   8837  C CB  . ILE C 1 209 ? -15.029 67.146  113.706 1.00 20.00 ? 209  ILE C CB  1 
ATOM   8838  C CG1 . ILE C 1 209 ? -15.845 66.995  114.990 1.00 20.00 ? 209  ILE C CG1 1 
ATOM   8839  C CG2 . ILE C 1 209 ? -14.676 68.600  113.467 1.00 20.00 ? 209  ILE C CG2 1 
ATOM   8840  C CD1 . ILE C 1 209 ? -15.258 67.725  116.162 1.00 20.00 ? 209  ILE C CD1 1 
ATOM   8841  N N   . LYS C 1 210 ? -15.186 67.828  110.526 1.00 20.00 ? 210  LYS C N   1 
ATOM   8842  C CA  . LYS C 1 210 ? -14.461 68.066  109.284 1.00 20.00 ? 210  LYS C CA  1 
ATOM   8843  C C   . LYS C 1 210 ? -13.091 68.665  109.514 1.00 20.00 ? 210  LYS C C   1 
ATOM   8844  O O   . LYS C 1 210 ? -12.905 69.467  110.432 1.00 20.00 ? 210  LYS C O   1 
ATOM   8845  C CB  . LYS C 1 210 ? -15.266 69.001  108.384 1.00 20.00 ? 210  LYS C CB  1 
ATOM   8846  C CG  . LYS C 1 210 ? -15.684 68.392  107.069 1.00 20.00 ? 210  LYS C CG  1 
ATOM   8847  C CD  . LYS C 1 210 ? -16.597 67.212  107.282 1.00 20.00 ? 210  LYS C CD  1 
ATOM   8848  C CE  . LYS C 1 210 ? -17.418 66.941  106.036 1.00 20.00 ? 210  LYS C CE  1 
ATOM   8849  N NZ  . LYS C 1 210 ? -18.279 68.102  105.695 1.00 20.00 ? 210  LYS C NZ  1 
ATOM   8850  N N   . ILE C 1 211 ? -12.138 68.274  108.668 1.00 20.00 ? 211  ILE C N   1 
ATOM   8851  C CA  . ILE C 1 211 ? -10.764 68.769  108.762 1.00 20.00 ? 211  ILE C CA  1 
ATOM   8852  C C   . ILE C 1 211 ? -10.287 69.342  107.434 1.00 20.00 ? 211  ILE C C   1 
ATOM   8853  O O   . ILE C 1 211 ? -10.162 68.612  106.452 1.00 20.00 ? 211  ILE C O   1 
ATOM   8854  C CB  . ILE C 1 211 ? -9.763  67.651  109.152 1.00 20.00 ? 211  ILE C CB  1 
ATOM   8855  C CG1 . ILE C 1 211 ? -9.992  67.198  110.596 1.00 20.00 ? 211  ILE C CG1 1 
ATOM   8856  C CG2 . ILE C 1 211 ? -8.341  68.175  109.023 1.00 20.00 ? 211  ILE C CG2 1 
ATOM   8857  C CD1 . ILE C 1 211 ? -9.324  65.883  110.942 1.00 20.00 ? 211  ILE C CD1 1 
ATOM   8858  N N   . PHE C 1 212 ? -10.018 70.643  107.406 1.00 20.00 ? 212  PHE C N   1 
ATOM   8859  C CA  . PHE C 1 212 ? -9.547  71.299  106.191 1.00 20.00 ? 212  PHE C CA  1 
ATOM   8860  C C   . PHE C 1 212 ? -8.193  71.937  106.475 1.00 20.00 ? 212  PHE C C   1 
ATOM   8861  O O   . PHE C 1 212 ? -8.054  72.731  107.398 1.00 20.00 ? 212  PHE C O   1 
ATOM   8862  C CB  . PHE C 1 212 ? -10.532 72.379  105.739 1.00 20.00 ? 212  PHE C CB  1 
ATOM   8863  C CG  . PHE C 1 212 ? -11.813 71.831  105.194 1.00 20.00 ? 212  PHE C CG  1 
ATOM   8864  C CD1 . PHE C 1 212 ? -11.847 71.218  103.948 1.00 20.00 ? 212  PHE C CD1 1 
ATOM   8865  C CD2 . PHE C 1 212 ? -12.985 71.902  105.940 1.00 20.00 ? 212  PHE C CD2 1 
ATOM   8866  C CE1 . PHE C 1 212 ? -13.031 70.678  103.449 1.00 20.00 ? 212  PHE C CE1 1 
ATOM   8867  C CE2 . PHE C 1 212 ? -14.178 71.365  105.452 1.00 20.00 ? 212  PHE C CE2 1 
ATOM   8868  C CZ  . PHE C 1 212 ? -14.202 70.751  104.207 1.00 20.00 ? 212  PHE C CZ  1 
ATOM   8869  N N   . TYR C 1 213 ? -7.196  71.594  105.674 1.00 20.00 ? 213  TYR C N   1 
ATOM   8870  C CA  . TYR C 1 213 ? -5.862  72.141  105.857 1.00 20.00 ? 213  TYR C CA  1 
ATOM   8871  C C   . TYR C 1 213 ? -5.645  73.471  105.149 1.00 20.00 ? 213  TYR C C   1 
ATOM   8872  O O   . TYR C 1 213 ? -6.238  73.742  104.116 1.00 20.00 ? 213  TYR C O   1 
ATOM   8873  C CB  . TYR C 1 213 ? -4.804  71.196  105.297 1.00 20.00 ? 213  TYR C CB  1 
ATOM   8874  C CG  . TYR C 1 213 ? -4.529  69.940  106.074 1.00 20.00 ? 213  TYR C CG  1 
ATOM   8875  C CD1 . TYR C 1 213 ? -5.391  69.487  107.069 1.00 20.00 ? 213  TYR C CD1 1 
ATOM   8876  C CD2 . TYR C 1 213 ? -3.409  69.173  105.775 1.00 20.00 ? 213  TYR C CD2 1 
ATOM   8877  C CE1 . TYR C 1 213 ? -5.136  68.291  107.741 1.00 20.00 ? 213  TYR C CE1 1 
ATOM   8878  C CE2 . TYR C 1 213 ? -3.149  67.988  106.436 1.00 20.00 ? 213  TYR C CE2 1 
ATOM   8879  C CZ  . TYR C 1 213 ? -4.008  67.548  107.414 1.00 20.00 ? 213  TYR C CZ  1 
ATOM   8880  O OH  . TYR C 1 213 ? -3.725  66.365  108.057 1.00 20.00 ? 213  TYR C OH  1 
ATOM   8881  N N   . ASP C 1 214 ? -4.791  74.300  105.730 1.00 20.00 ? 214  ASP C N   1 
ATOM   8882  C CA  . ASP C 1 214 ? -4.465  75.584  105.149 1.00 20.00 ? 214  ASP C CA  1 
ATOM   8883  C C   . ASP C 1 214 ? -3.063  75.135  104.754 1.00 20.00 ? 214  ASP C C   1 
ATOM   8884  O O   . ASP C 1 214 ? -2.117  75.299  105.508 1.00 20.00 ? 214  ASP C O   1 
ATOM   8885  C CB  . ASP C 1 214 ? -4.413  76.673  106.211 1.00 20.00 ? 214  ASP C CB  1 
ATOM   8886  C CG  . ASP C 1 214 ? -3.855  77.971  105.672 1.00 20.00 ? 214  ASP C CG  1 
ATOM   8887  O OD1 . ASP C 1 214 ? -3.287  77.943  104.560 1.00 20.00 ? 214  ASP C OD1 1 
ATOM   8888  O OD2 . ASP C 1 214 ? -3.985  79.012  106.352 1.00 20.00 ? 214  ASP C OD2 1 
ATOM   8889  N N   . ALA C 1 215 ? -2.950  74.525  103.583 1.00 20.00 ? 215  ALA C N   1 
ATOM   8890  C CA  . ALA C 1 215 ? -1.675  74.024  103.102 1.00 20.00 ? 215  ALA C CA  1 
ATOM   8891  C C   . ALA C 1 215 ? -0.714  74.940  102.373 1.00 20.00 ? 215  ALA C C   1 
ATOM   8892  O O   . ALA C 1 215 ? 0.196   74.446  101.720 1.00 20.00 ? 215  ALA C O   1 
ATOM   8893  C CB  . ALA C 1 215 ? -1.935  72.792  102.236 1.00 20.00 ? 215  ALA C CB  1 
ATOM   8894  N N   . THR C 1 216 ? -0.846  76.254  102.504 1.00 20.00 ? 216  THR C N   1 
ATOM   8895  C CA  . THR C 1 216 ? 0.068   77.136  101.787 1.00 20.00 ? 216  THR C CA  1 
ATOM   8896  C C   . THR C 1 216 ? 1.548   76.769  101.791 1.00 20.00 ? 216  THR C C   1 
ATOM   8897  O O   . THR C 1 216 ? 2.234   76.987  100.796 1.00 20.00 ? 216  THR C O   1 
ATOM   8898  C CB  . THR C 1 216 ? -0.116  78.588  102.213 1.00 20.00 ? 216  THR C CB  1 
ATOM   8899  O OG1 . THR C 1 216 ? 0.404   78.794  103.527 1.00 20.00 ? 216  THR C OG1 1 
ATOM   8900  C CG2 . THR C 1 216 ? -1.579  78.923  102.191 1.00 20.00 ? 216  THR C CG2 1 
ATOM   8901  N N   . ARG C 1 217 ? 2.039   76.193  102.883 1.00 20.00 ? 217  ARG C N   1 
ATOM   8902  C CA  . ARG C 1 217 ? 3.441   75.812  102.958 1.00 20.00 ? 217  ARG C CA  1 
ATOM   8903  C C   . ARG C 1 217 ? 3.631   74.348  103.352 1.00 20.00 ? 217  ARG C C   1 
ATOM   8904  O O   . ARG C 1 217 ? 4.540   74.018  104.102 1.00 20.00 ? 217  ARG C O   1 
ATOM   8905  C CB  . ARG C 1 217 ? 4.160   76.726  103.944 1.00 20.00 ? 217  ARG C CB  1 
ATOM   8906  C CG  . ARG C 1 217 ? 4.427   78.098  103.372 1.00 20.00 ? 217  ARG C CG  1 
ATOM   8907  C CD  . ARG C 1 217 ? 5.109   78.997  104.376 1.00 20.00 ? 217  ARG C CD  1 
ATOM   8908  N NE  . ARG C 1 217 ? 5.043   80.403  103.982 1.00 20.00 ? 217  ARG C NE  1 
ATOM   8909  C CZ  . ARG C 1 217 ? 4.120   81.254  104.413 1.00 20.00 ? 217  ARG C CZ  1 
ATOM   8910  N NH1 . ARG C 1 217 ? 3.187   80.844  105.252 1.00 20.00 ? 217  ARG C NH1 1 
ATOM   8911  N NH2 . ARG C 1 217 ? 4.129   82.517  104.007 1.00 20.00 ? 217  ARG C NH2 1 
ATOM   8912  N N   . CYS C 1 218 ? 2.784   73.471  102.820 1.00 20.00 ? 218  CYS C N   1 
ATOM   8913  C CA  . CYS C 1 218 ? 2.841   72.037  103.111 1.00 20.00 ? 218  CYS C CA  1 
ATOM   8914  C C   . CYS C 1 218 ? 4.119   71.310  102.701 1.00 20.00 ? 218  CYS C C   1 
ATOM   8915  O O   . CYS C 1 218 ? 4.460   70.294  103.309 1.00 20.00 ? 218  CYS C O   1 
ATOM   8916  C CB  . CYS C 1 218 ? 1.645   71.324  102.473 1.00 20.00 ? 218  CYS C CB  1 
ATOM   8917  S SG  . CYS C 1 218 ? 1.574   71.463  100.673 1.00 20.00 ? 218  CYS C SG  1 
ATOM   8918  N N   . VAL C 1 219 ? 4.819   71.795  101.671 1.00 20.00 ? 219  VAL C N   1 
ATOM   8919  C CA  . VAL C 1 219 ? 6.055   71.127  101.242 1.00 20.00 ? 219  VAL C CA  1 
ATOM   8920  C C   . VAL C 1 219 ? 7.200   71.402  102.216 1.00 20.00 ? 219  VAL C C   1 
ATOM   8921  O O   . VAL C 1 219 ? 8.015   70.517  102.489 1.00 20.00 ? 219  VAL C O   1 
ATOM   8922  C CB  . VAL C 1 219 ? 6.473   71.528  99.814  1.00 20.00 ? 219  VAL C CB  1 
ATOM   8923  C CG1 . VAL C 1 219 ? 7.644   70.657  99.359  1.00 20.00 ? 219  VAL C CG1 1 
ATOM   8924  C CG2 . VAL C 1 219 ? 5.294   71.341  98.858  1.00 20.00 ? 219  VAL C CG2 1 
ATOM   8925  N N   . GLU C 1 220 ? 7.274   72.626  102.736 1.00 20.00 ? 220  GLU C N   1 
ATOM   8926  C CA  . GLU C 1 220 ? 8.325   72.959  103.685 1.00 20.00 ? 220  GLU C CA  1 
ATOM   8927  C C   . GLU C 1 220 ? 8.048   72.089  104.910 1.00 20.00 ? 220  GLU C C   1 
ATOM   8928  O O   . GLU C 1 220 ? 8.961   71.581  105.561 1.00 20.00 ? 220  GLU C O   1 
ATOM   8929  C CB  . GLU C 1 220 ? 8.244   74.427  104.097 1.00 20.00 ? 220  GLU C CB  1 
ATOM   8930  C CG  . GLU C 1 220 ? 8.693   75.399  103.029 1.00 20.00 ? 220  GLU C CG  1 
ATOM   8931  C CD  . GLU C 1 220 ? 8.372   76.831  103.384 1.00 20.00 ? 220  GLU C CD  1 
ATOM   8932  O OE1 . GLU C 1 220 ? 8.012   77.098  104.555 1.00 20.00 ? 220  GLU C OE1 1 
ATOM   8933  O OE2 . GLU C 1 220 ? 8.476   77.692  102.495 1.00 20.00 ? 220  GLU C OE2 1 
ATOM   8934  N N   . ASN C 1 221 ? 6.770   71.930  105.230 1.00 20.00 ? 221  ASN C N   1 
ATOM   8935  C CA  . ASN C 1 221 ? 6.381   71.122  106.372 1.00 20.00 ? 221  ASN C CA  1 
ATOM   8936  C C   . ASN C 1 221 ? 6.855   69.694  106.161 1.00 20.00 ? 221  ASN C C   1 
ATOM   8937  O O   . ASN C 1 221 ? 7.423   69.076  107.059 1.00 20.00 ? 221  ASN C O   1 
ATOM   8938  C CB  . ASN C 1 221 ? 4.856   71.131  106.546 1.00 20.00 ? 221  ASN C CB  1 
ATOM   8939  C CG  . ASN C 1 221 ? 4.432   70.698  107.928 1.00 20.00 ? 221  ASN C CG  1 
ATOM   8940  O OD1 . ASN C 1 221 ? 4.240   71.529  108.814 1.00 20.00 ? 221  ASN C OD1 1 
ATOM   8941  N ND2 . ASN C 1 221 ? 4.289   69.392  108.127 1.00 20.00 ? 221  ASN C ND2 1 
ATOM   8942  N N   . ALA C 1 222 ? 6.609   69.178  104.961 1.00 20.00 ? 222  ALA C N   1 
ATOM   8943  C CA  . ALA C 1 222 ? 6.997   67.815  104.607 1.00 20.00 ? 222  ALA C CA  1 
ATOM   8944  C C   . ALA C 1 222 ? 8.477   67.568  104.808 1.00 20.00 ? 222  ALA C C   1 
ATOM   8945  O O   . ALA C 1 222 ? 8.875   66.477  105.202 1.00 20.00 ? 222  ALA C O   1 
ATOM   8946  C CB  . ALA C 1 222 ? 6.616   67.521  103.164 1.00 20.00 ? 222  ALA C CB  1 
ATOM   8947  N N   . TYR C 1 223 ? 9.294   68.578  104.531 1.00 20.00 ? 223  TYR C N   1 
ATOM   8948  C CA  . TYR C 1 223 ? 10.733  68.438  104.693 1.00 20.00 ? 223  TYR C CA  1 
ATOM   8949  C C   . TYR C 1 223 ? 11.095  68.212  106.174 1.00 20.00 ? 223  TYR C C   1 
ATOM   8950  O O   . TYR C 1 223 ? 11.896  67.335  106.506 1.00 20.00 ? 223  TYR C O   1 
ATOM   8951  C CB  . TYR C 1 223 ? 11.462  69.681  104.149 1.00 20.00 ? 223  TYR C CB  1 
ATOM   8952  C CG  . TYR C 1 223 ? 12.939  69.639  104.455 1.00 20.00 ? 223  TYR C CG  1 
ATOM   8953  C CD1 . TYR C 1 223 ? 13.796  68.805  103.726 1.00 20.00 ? 223  TYR C CD1 1 
ATOM   8954  C CD2 . TYR C 1 223 ? 13.450  70.295  105.575 1.00 20.00 ? 223  TYR C CD2 1 
ATOM   8955  C CE1 . TYR C 1 223 ? 15.111  68.610  104.119 1.00 20.00 ? 223  TYR C CE1 1 
ATOM   8956  C CE2 . TYR C 1 223 ? 14.760  70.110  105.979 1.00 20.00 ? 223  TYR C CE2 1 
ATOM   8957  C CZ  . TYR C 1 223 ? 15.583  69.260  105.256 1.00 20.00 ? 223  TYR C CZ  1 
ATOM   8958  O OH  . TYR C 1 223 ? 16.851  69.008  105.712 1.00 20.00 ? 223  TYR C OH  1 
ATOM   8959  N N   . PHE C 1 224 ? 10.497  69.000  107.060 1.00 20.00 ? 224  PHE C N   1 
ATOM   8960  C CA  . PHE C 1 224 ? 10.752  68.888  108.492 1.00 20.00 ? 224  PHE C CA  1 
ATOM   8961  C C   . PHE C 1 224 ? 10.397  67.512  109.032 1.00 20.00 ? 224  PHE C C   1 
ATOM   8962  O O   . PHE C 1 224 ? 11.061  66.999  109.934 1.00 20.00 ? 224  PHE C O   1 
ATOM   8963  C CB  . PHE C 1 224 ? 9.958   69.946  109.244 1.00 20.00 ? 224  PHE C CB  1 
ATOM   8964  C CG  . PHE C 1 224 ? 10.569  71.305  109.186 1.00 20.00 ? 224  PHE C CG  1 
ATOM   8965  C CD1 . PHE C 1 224 ? 11.590  71.660  110.059 1.00 20.00 ? 224  PHE C CD1 1 
ATOM   8966  C CD2 . PHE C 1 224 ? 10.120  72.240  108.266 1.00 20.00 ? 224  PHE C CD2 1 
ATOM   8967  C CE1 . PHE C 1 224 ? 12.154  72.933  110.012 1.00 20.00 ? 224  PHE C CE1 1 
ATOM   8968  C CE2 . PHE C 1 224 ? 10.672  73.504  108.211 1.00 20.00 ? 224  PHE C CE2 1 
ATOM   8969  C CZ  . PHE C 1 224 ? 11.694  73.854  109.089 1.00 20.00 ? 224  PHE C CZ  1 
ATOM   8970  N N   . ILE C 1 225 ? 9.332   66.929  108.487 1.00 20.00 ? 225  ILE C N   1 
ATOM   8971  C CA  . ILE C 1 225 ? 8.883   65.611  108.900 1.00 20.00 ? 225  ILE C CA  1 
ATOM   8972  C C   . ILE C 1 225 ? 9.960   64.621  108.456 1.00 20.00 ? 225  ILE C C   1 
ATOM   8973  O O   . ILE C 1 225 ? 10.376  63.749  109.220 1.00 20.00 ? 225  ILE C O   1 
ATOM   8974  C CB  . ILE C 1 225 ? 7.532   65.249  108.228 1.00 20.00 ? 225  ILE C CB  1 
ATOM   8975  C CG1 . ILE C 1 225 ? 6.385   65.964  108.947 1.00 20.00 ? 225  ILE C CG1 1 
ATOM   8976  C CG2 . ILE C 1 225 ? 7.309   63.736  108.248 1.00 20.00 ? 225  ILE C CG2 1 
ATOM   8977  C CD1 . ILE C 1 225 ? 5.035   65.841  108.234 1.00 20.00 ? 225  ILE C CD1 1 
ATOM   8978  N N   . LYS C 1 226 ? 10.417  64.772  107.213 1.00 20.00 ? 226  LYS C N   1 
ATOM   8979  C CA  . LYS C 1 226 ? 11.445  63.900  106.654 1.00 20.00 ? 226  LYS C CA  1 
ATOM   8980  C C   . LYS C 1 226 ? 12.754  64.050  107.408 1.00 20.00 ? 226  LYS C C   1 
ATOM   8981  O O   . LYS C 1 226 ? 13.502  63.086  107.585 1.00 20.00 ? 226  LYS C O   1 
ATOM   8982  C CB  . LYS C 1 226 ? 11.692  64.233  105.182 1.00 20.00 ? 226  LYS C CB  1 
ATOM   8983  C CG  . LYS C 1 226 ? 12.795  63.400  104.551 1.00 20.00 ? 226  LYS C CG  1 
ATOM   8984  C CD  . LYS C 1 226 ? 12.703  63.400  103.035 1.00 20.00 ? 226  LYS C CD  1 
ATOM   8985  C CE  . LYS C 1 226 ? 13.810  62.552  102.420 1.00 20.00 ? 226  LYS C CE  1 
ATOM   8986  N NZ  . LYS C 1 226 ? 13.607  61.088  102.646 1.00 20.00 ? 226  LYS C NZ  1 
ATOM   8987  N N   . GLU C 1 227 ? 13.024  65.267  107.852 1.00 20.00 ? 227  GLU C N   1 
ATOM   8988  C CA  . GLU C 1 227 ? 14.243  65.551  108.580 1.00 20.00 ? 227  GLU C CA  1 
ATOM   8989  C C   . GLU C 1 227 ? 14.212  65.225  110.066 1.00 20.00 ? 227  GLU C C   1 
ATOM   8990  O O   . GLU C 1 227 ? 15.201  64.734  110.616 1.00 20.00 ? 227  GLU C O   1 
ATOM   8991  C CB  . GLU C 1 227 ? 14.619  67.028  108.413 1.00 20.00 ? 227  GLU C CB  1 
ATOM   8992  C CG  . GLU C 1 227 ? 15.918  67.401  109.100 1.00 20.00 ? 227  GLU C CG  1 
ATOM   8993  C CD  . GLU C 1 227 ? 16.215  68.875  109.051 1.00 20.00 ? 227  GLU C CD  1 
ATOM   8994  O OE1 . GLU C 1 227 ? 15.612  69.634  109.837 1.00 20.00 ? 227  GLU C OE1 1 
ATOM   8995  O OE2 . GLU C 1 227 ? 17.061  69.274  108.227 1.00 20.00 ? 227  GLU C OE2 1 
ATOM   8996  N N   . GLN C 1 228 ? 13.082  65.466  110.720 1.00 20.00 ? 228  GLN C N   1 
ATOM   8997  C CA  . GLN C 1 228 ? 13.022  65.194  112.143 1.00 20.00 ? 228  GLN C CA  1 
ATOM   8998  C C   . GLN C 1 228 ? 12.056  64.174  112.728 1.00 20.00 ? 228  GLN C C   1 
ATOM   8999  O O   . GLN C 1 228 ? 12.140  63.894  113.919 1.00 20.00 ? 228  GLN C O   1 
ATOM   9000  C CB  . GLN C 1 228 ? 12.845  66.521  112.877 1.00 20.00 ? 228  GLN C CB  1 
ATOM   9001  C CG  . GLN C 1 228 ? 13.858  67.574  112.467 1.00 20.00 ? 228  GLN C CG  1 
ATOM   9002  C CD  . GLN C 1 228 ? 13.452  68.967  112.891 1.00 20.00 ? 228  GLN C CD  1 
ATOM   9003  O OE1 . GLN C 1 228 ? 12.851  69.149  113.944 1.00 20.00 ? 228  GLN C OE1 1 
ATOM   9004  N NE2 . GLN C 1 228 ? 13.777  69.960  112.068 1.00 20.00 ? 228  GLN C NE2 1 
ATOM   9005  N N   . GLU C 1 229 ? 11.156  63.609  111.932 1.00 20.00 ? 229  GLU C N   1 
ATOM   9006  C CA  . GLU C 1 229 ? 10.224  62.635  112.487 1.00 20.00 ? 229  GLU C CA  1 
ATOM   9007  C C   . GLU C 1 229 ? 10.675  61.205  112.297 1.00 20.00 ? 229  GLU C C   1 
ATOM   9008  O O   . GLU C 1 229 ? 10.955  60.770  111.186 1.00 20.00 ? 229  GLU C O   1 
ATOM   9009  C CB  . GLU C 1 229 ? 8.823   62.812  111.897 1.00 20.00 ? 229  GLU C CB  1 
ATOM   9010  C CG  . GLU C 1 229 ? 7.752   62.177  112.756 1.00 20.00 ? 229  GLU C CG  1 
ATOM   9011  C CD  . GLU C 1 229 ? 6.362   62.644  112.417 1.00 20.00 ? 229  GLU C CD  1 
ATOM   9012  O OE1 . GLU C 1 229 ? 6.224   63.586  111.614 1.00 20.00 ? 229  GLU C OE1 1 
ATOM   9013  O OE2 . GLU C 1 229 ? 5.405   62.061  112.960 1.00 20.00 ? 229  GLU C OE2 1 
ATOM   9014  N N   . ALA C 1 230 ? 10.726  60.470  113.400 1.00 20.00 ? 230  ALA C N   1 
ATOM   9015  C CA  . ALA C 1 230 ? 11.148  59.076  113.380 1.00 20.00 ? 230  ALA C CA  1 
ATOM   9016  C C   . ALA C 1 230 ? 10.345  58.223  112.413 1.00 20.00 ? 230  ALA C C   1 
ATOM   9017  O O   . ALA C 1 230 ? 9.120   58.243  112.422 1.00 20.00 ? 230  ALA C O   1 
ATOM   9018  C CB  . ALA C 1 230 ? 11.065  58.494  114.779 1.00 20.00 ? 230  ALA C CB  1 
ATOM   9019  N N   . GLY C 1 231 ? 11.052  57.472  111.578 1.00 20.00 ? 231  GLY C N   1 
ATOM   9020  C CA  . GLY C 1 231 ? 10.389  56.616  110.617 1.00 20.00 ? 231  GLY C CA  1 
ATOM   9021  C C   . GLY C 1 231 ? 10.230  57.222  109.240 1.00 20.00 ? 231  GLY C C   1 
ATOM   9022  O O   . GLY C 1 231 ? 9.879   56.522  108.294 1.00 20.00 ? 231  GLY C O   1 
ATOM   9023  N N   . TYR C 1 232 ? 10.496  58.513  109.106 1.00 20.00 ? 232  TYR C N   1 
ATOM   9024  C CA  . TYR C 1 232 ? 10.359  59.159  107.813 1.00 20.00 ? 232  TYR C CA  1 
ATOM   9025  C C   . TYR C 1 232 ? 11.678  59.495  107.142 1.00 20.00 ? 232  TYR C C   1 
ATOM   9026  O O   . TYR C 1 232 ? 11.703  60.136  106.092 1.00 20.00 ? 232  TYR C O   1 
ATOM   9027  C CB  . TYR C 1 232 ? 9.515   60.418  107.963 1.00 20.00 ? 232  TYR C CB  1 
ATOM   9028  C CG  . TYR C 1 232 ? 8.057   60.095  108.106 1.00 20.00 ? 232  TYR C CG  1 
ATOM   9029  C CD1 . TYR C 1 232 ? 7.255   59.873  106.984 1.00 20.00 ? 232  TYR C CD1 1 
ATOM   9030  C CD2 . TYR C 1 232 ? 7.485   59.954  109.365 1.00 20.00 ? 232  TYR C CD2 1 
ATOM   9031  C CE1 . TYR C 1 232 ? 5.924   59.514  107.118 1.00 20.00 ? 232  TYR C CE1 1 
ATOM   9032  C CE2 . TYR C 1 232 ? 6.154   59.595  109.511 1.00 20.00 ? 232  TYR C CE2 1 
ATOM   9033  C CZ  . TYR C 1 232 ? 5.381   59.373  108.386 1.00 20.00 ? 232  TYR C CZ  1 
ATOM   9034  O OH  . TYR C 1 232 ? 4.080   58.963  108.542 1.00 20.00 ? 232  TYR C OH  1 
ATOM   9035  N N   . GLU C 1 233 ? 12.774  59.046  107.740 1.00 20.00 ? 233  GLU C N   1 
ATOM   9036  C CA  . GLU C 1 233 ? 14.099  59.311  107.190 1.00 20.00 ? 233  GLU C CA  1 
ATOM   9037  C C   . GLU C 1 233 ? 14.231  58.893  105.732 1.00 20.00 ? 233  GLU C C   1 
ATOM   9038  O O   . GLU C 1 233 ? 14.849  59.599  104.936 1.00 20.00 ? 233  GLU C O   1 
ATOM   9039  C CB  . GLU C 1 233 ? 15.175  58.583  108.006 1.00 20.00 ? 233  GLU C CB  1 
ATOM   9040  C CG  . GLU C 1 233 ? 15.042  58.741  109.515 1.00 20.00 ? 233  GLU C CG  1 
ATOM   9041  C CD  . GLU C 1 233 ? 14.146  57.686  110.142 1.00 20.00 ? 233  GLU C CD  1 
ATOM   9042  O OE1 . GLU C 1 233 ? 13.594  56.849  109.393 1.00 20.00 ? 233  GLU C OE1 1 
ATOM   9043  O OE2 . GLU C 1 233 ? 13.998  57.696  111.384 1.00 20.00 ? 233  GLU C OE2 1 
ATOM   9044  N N   . ASN C 1 234 ? 13.638  57.753  105.384 1.00 20.00 ? 234  ASN C N   1 
ATOM   9045  C CA  . ASN C 1 234 ? 13.714  57.252  104.018 1.00 20.00 ? 234  ASN C CA  1 
ATOM   9046  C C   . ASN C 1 234 ? 12.475  57.363  103.144 1.00 20.00 ? 234  ASN C C   1 
ATOM   9047  O O   . ASN C 1 234 ? 12.405  56.741  102.092 1.00 20.00 ? 234  ASN C O   1 
ATOM   9048  C CB  . ASN C 1 234 ? 14.195  55.801  104.049 1.00 20.00 ? 234  ASN C CB  1 
ATOM   9049  C CG  . ASN C 1 234 ? 15.523  55.651  104.777 1.00 20.00 ? 234  ASN C CG  1 
ATOM   9050  O OD1 . ASN C 1 234 ? 16.503  56.324  104.446 1.00 20.00 ? 234  ASN C OD1 1 
ATOM   9051  N ND2 . ASN C 1 234 ? 15.560  54.774  105.776 1.00 20.00 ? 234  ASN C ND2 1 
ATOM   9052  N N   . VAL C 1 235 ? 11.510  58.164  103.572 1.00 20.00 ? 235  VAL C N   1 
ATOM   9053  C CA  . VAL C 1 235 ? 10.281  58.348  102.818 1.00 20.00 ? 235  VAL C CA  1 
ATOM   9054  C C   . VAL C 1 235 ? 10.459  59.556  101.905 1.00 20.00 ? 235  VAL C C   1 
ATOM   9055  O O   . VAL C 1 235 ? 11.068  60.544  102.297 1.00 20.00 ? 235  VAL C O   1 
ATOM   9056  C CB  . VAL C 1 235 ? 9.094   58.574  103.771 1.00 20.00 ? 235  VAL C CB  1 
ATOM   9057  C CG1 . VAL C 1 235 ? 7.822   58.762  102.976 1.00 20.00 ? 235  VAL C CG1 1 
ATOM   9058  C CG2 . VAL C 1 235 ? 8.956   57.383  104.710 1.00 20.00 ? 235  VAL C CG2 1 
ATOM   9059  N N   . SER C 1 236 ? 9.936   59.475  100.687 1.00 20.00 ? 236  SER C N   1 
ATOM   9060  C CA  . SER C 1 236 ? 10.058  60.573  99.741  1.00 20.00 ? 236  SER C CA  1 
ATOM   9061  C C   . SER C 1 236 ? 9.154   61.753  100.080 1.00 20.00 ? 236  SER C C   1 
ATOM   9062  O O   . SER C 1 236 ? 8.095   61.582  100.680 1.00 20.00 ? 236  SER C O   1 
ATOM   9063  C CB  . SER C 1 236 ? 9.750   60.080  98.331  1.00 20.00 ? 236  SER C CB  1 
ATOM   9064  O OG  . SER C 1 236 ? 8.370   59.828  98.182  1.00 20.00 ? 236  SER C OG  1 
ATOM   9065  N N   . ILE C 1 237 ? 9.584   62.955  99.698  1.00 20.00 ? 237  ILE C N   1 
ATOM   9066  C CA  . ILE C 1 237 ? 8.807   64.164  99.961  1.00 20.00 ? 237  ILE C CA  1 
ATOM   9067  C C   . ILE C 1 237 ? 7.432   63.947  99.373  1.00 20.00 ? 237  ILE C C   1 
ATOM   9068  O O   . ILE C 1 237 ? 6.426   64.278  99.984  1.00 20.00 ? 237  ILE C O   1 
ATOM   9069  C CB  . ILE C 1 237 ? 9.435   65.416  99.294  1.00 20.00 ? 237  ILE C CB  1 
ATOM   9070  C CG1 . ILE C 1 237 ? 10.715  65.819  100.035 1.00 20.00 ? 237  ILE C CG1 1 
ATOM   9071  C CG2 . ILE C 1 237 ? 8.438   66.573  99.292  1.00 20.00 ? 237  ILE C CG2 1 
ATOM   9072  C CD1 . ILE C 1 237 ? 10.511  66.184  101.492 1.00 20.00 ? 237  ILE C CD1 1 
ATOM   9073  N N   . LYS C 1 238 ? 7.402   63.372  98.182  1.00 20.00 ? 238  LYS C N   1 
ATOM   9074  C CA  . LYS C 1 238 ? 6.147   63.105  97.503  1.00 20.00 ? 238  LYS C CA  1 
ATOM   9075  C C   . LYS C 1 238 ? 5.218   62.206  98.318  1.00 20.00 ? 238  LYS C C   1 
ATOM   9076  O O   . LYS C 1 238 ? 4.014   62.445  98.381  1.00 20.00 ? 238  LYS C O   1 
ATOM   9077  C CB  . LYS C 1 238 ? 6.421   62.456  96.149  1.00 20.00 ? 238  LYS C CB  1 
ATOM   9078  C CG  . LYS C 1 238 ? 5.173   62.208  95.333  1.00 20.00 ? 238  LYS C CG  1 
ATOM   9079  C CD  . LYS C 1 238 ? 5.510   62.027  93.867  1.00 20.00 ? 238  LYS C CD  1 
ATOM   9080  C CE  . LYS C 1 238 ? 5.797   60.571  93.539  1.00 20.00 ? 238  LYS C CE  1 
ATOM   9081  N NZ  . LYS C 1 238 ? 5.471   60.262  92.113  1.00 20.00 ? 238  LYS C NZ  1 
ATOM   9082  N N   . ASP C 1 239 ? 5.784   61.178  98.944  1.00 20.00 ? 239  ASP C N   1 
ATOM   9083  C CA  . ASP C 1 239 ? 5.000   60.251  99.747  1.00 20.00 ? 239  ASP C CA  1 
ATOM   9084  C C   . ASP C 1 239 ? 4.535   60.848  101.078 1.00 20.00 ? 239  ASP C C   1 
ATOM   9085  O O   . ASP C 1 239 ? 3.457   60.520  101.564 1.00 20.00 ? 239  ASP C O   1 
ATOM   9086  C CB  . ASP C 1 239 ? 5.799   58.965  99.993  1.00 20.00 ? 239  ASP C CB  1 
ATOM   9087  C CG  . ASP C 1 239 ? 5.758   58.020  98.804  1.00 20.00 ? 239  ASP C CG  1 
ATOM   9088  O OD1 . ASP C 1 239 ? 4.888   58.201  97.923  1.00 20.00 ? 239  ASP C OD1 1 
ATOM   9089  O OD2 . ASP C 1 239 ? 6.593   57.097  98.745  1.00 20.00 ? 239  ASP C OD2 1 
ATOM   9090  N N   . ILE C 1 240 ? 5.347   61.719  101.663 1.00 20.00 ? 240  ILE C N   1 
ATOM   9091  C CA  . ILE C 1 240 ? 5.004   62.353  102.932 1.00 20.00 ? 240  ILE C CA  1 
ATOM   9092  C C   . ILE C 1 240 ? 3.838   63.317  102.701 1.00 20.00 ? 240  ILE C C   1 
ATOM   9093  O O   . ILE C 1 240 ? 2.931   63.410  103.519 1.00 20.00 ? 240  ILE C O   1 
ATOM   9094  C CB  . ILE C 1 240 ? 6.216   63.150  103.493 1.00 20.00 ? 240  ILE C CB  1 
ATOM   9095  C CG1 . ILE C 1 240 ? 7.336   62.184  103.900 1.00 20.00 ? 240  ILE C CG1 1 
ATOM   9096  C CG2 . ILE C 1 240 ? 5.782   64.038  104.650 1.00 20.00 ? 240  ILE C CG2 1 
ATOM   9097  C CD1 . ILE C 1 240 ? 8.600   62.872  104.362 1.00 20.00 ? 240  ILE C CD1 1 
ATOM   9098  N N   . VAL C 1 241 ? 3.879   64.037  101.581 1.00 20.00 ? 241  VAL C N   1 
ATOM   9099  C CA  . VAL C 1 241 ? 2.831   64.995  101.232 1.00 20.00 ? 241  VAL C CA  1 
ATOM   9100  C C   . VAL C 1 241 ? 1.519   64.264  101.005 1.00 20.00 ? 241  VAL C C   1 
ATOM   9101  O O   . VAL C 1 241 ? 0.466   64.731  101.428 1.00 20.00 ? 241  VAL C O   1 
ATOM   9102  C CB  . VAL C 1 241 ? 3.189   65.792  99.956  1.00 20.00 ? 241  VAL C CB  1 
ATOM   9103  C CG1 . VAL C 1 241 ? 1.954   66.479  99.390  1.00 20.00 ? 241  VAL C CG1 1 
ATOM   9104  C CG2 . VAL C 1 241 ? 4.237   66.843  100.287 1.00 20.00 ? 241  VAL C CG2 1 
ATOM   9105  N N   . HIS C 1 242 ? 1.581   63.108  100.347 1.00 20.00 ? 242  HIS C N   1 
ATOM   9106  C CA  . HIS C 1 242 ? 0.374   62.346  100.088 1.00 20.00 ? 242  HIS C CA  1 
ATOM   9107  C C   . HIS C 1 242 ? -0.255  61.855  101.384 1.00 20.00 ? 242  HIS C C   1 
ATOM   9108  O O   . HIS C 1 242 ? -1.478  61.863  101.525 1.00 20.00 ? 242  HIS C O   1 
ATOM   9109  C CB  . HIS C 1 242 ? 0.668   61.160  99.173  1.00 20.00 ? 242  HIS C CB  1 
ATOM   9110  C CG  . HIS C 1 242 ? -0.557  60.559  98.558  1.00 20.00 ? 242  HIS C CG  1 
ATOM   9111  N ND1 . HIS C 1 242 ? -1.065  60.978  97.347  1.00 20.00 ? 242  HIS C ND1 1 
ATOM   9112  C CD2 . HIS C 1 242 ? -1.382  59.579  98.992  1.00 20.00 ? 242  HIS C CD2 1 
ATOM   9113  C CE1 . HIS C 1 242 ? -2.149  60.282  97.061  1.00 20.00 ? 242  HIS C CE1 1 
ATOM   9114  N NE2 . HIS C 1 242 ? -2.363  59.426  98.044  1.00 20.00 ? 242  HIS C NE2 1 
ATOM   9115  N N   . GLU C 1 243 ? 0.568   61.435  102.340 1.00 20.00 ? 243  GLU C N   1 
ATOM   9116  C CA  . GLU C 1 243 ? 0.023   60.955  103.599 1.00 20.00 ? 243  GLU C CA  1 
ATOM   9117  C C   . GLU C 1 243 ? -0.584  62.082  104.404 1.00 20.00 ? 243  GLU C C   1 
ATOM   9118  O O   . GLU C 1 243 ? -1.655  61.923  104.989 1.00 20.00 ? 243  GLU C O   1 
ATOM   9119  C CB  . GLU C 1 243 ? 1.091   60.253  104.434 1.00 20.00 ? 243  GLU C CB  1 
ATOM   9120  C CG  . GLU C 1 243 ? 0.488   59.363  105.507 1.00 20.00 ? 243  GLU C CG  1 
ATOM   9121  C CD  . GLU C 1 243 ? 1.490   58.948  106.558 1.00 20.00 ? 243  GLU C CD  1 
ATOM   9122  O OE1 . GLU C 1 243 ? 2.687   58.839  106.223 1.00 20.00 ? 243  GLU C OE1 1 
ATOM   9123  O OE2 . GLU C 1 243 ? 1.084   58.729  107.716 1.00 20.00 ? 243  GLU C OE2 1 
ATOM   9124  N N   . MET C 1 244 ? 0.104   63.217  104.442 1.00 20.00 ? 244  MET C N   1 
ATOM   9125  C CA  . MET C 1 244 ? -0.374  64.378  105.179 1.00 20.00 ? 244  MET C CA  1 
ATOM   9126  C C   . MET C 1 244 ? -1.826  64.649  104.821 1.00 20.00 ? 244  MET C C   1 
ATOM   9127  O O   . MET C 1 244 ? -2.700  64.723  105.682 1.00 20.00 ? 244  MET C O   1 
ATOM   9128  C CB  . MET C 1 244 ? 0.430   65.623  104.803 1.00 20.00 ? 244  MET C CB  1 
ATOM   9129  C CG  . MET C 1 244 ? 1.778   65.755  105.452 1.00 20.00 ? 244  MET C CG  1 
ATOM   9130  S SD  . MET C 1 244 ? 2.683   67.163  104.767 1.00 20.00 ? 244  MET C SD  1 
ATOM   9131  C CE  . MET C 1 244 ? 1.484   68.459  104.974 1.00 20.00 ? 244  MET C CE  1 
ATOM   9132  N N   . PHE C 1 245 ? -2.074  64.802  103.531 1.00 20.00 ? 245  PHE C N   1 
ATOM   9133  C CA  . PHE C 1 245 ? -3.414  65.072  103.053 1.00 20.00 ? 245  PHE C CA  1 
ATOM   9134  C C   . PHE C 1 245 ? -4.379  63.913  103.186 1.00 20.00 ? 245  PHE C C   1 
ATOM   9135  O O   . PHE C 1 245 ? -5.577  64.111  103.110 1.00 20.00 ? 245  PHE C O   1 
ATOM   9136  C CB  . PHE C 1 245 ? -3.357  65.548  101.606 1.00 20.00 ? 245  PHE C CB  1 
ATOM   9137  C CG  . PHE C 1 245 ? -2.770  66.907  101.460 1.00 20.00 ? 245  PHE C CG  1 
ATOM   9138  C CD1 . PHE C 1 245 ? -3.414  68.010  102.004 1.00 20.00 ? 245  PHE C CD1 1 
ATOM   9139  C CD2 . PHE C 1 245 ? -1.555  67.087  100.822 1.00 20.00 ? 245  PHE C CD2 1 
ATOM   9140  C CE1 . PHE C 1 245 ? -2.860  69.277  101.920 1.00 20.00 ? 245  PHE C CE1 1 
ATOM   9141  C CE2 . PHE C 1 245 ? -0.987  68.357  100.731 1.00 20.00 ? 245  PHE C CE2 1 
ATOM   9142  C CZ  . PHE C 1 245 ? -1.646  69.456  101.286 1.00 20.00 ? 245  PHE C CZ  1 
ATOM   9143  N N   . SER C 1 246 ? -3.882  62.698  103.382 1.00 20.00 ? 246  SER C N   1 
ATOM   9144  C CA  . SER C 1 246 ? -4.807  61.583  103.516 1.00 20.00 ? 246  SER C CA  1 
ATOM   9145  C C   . SER C 1 246 ? -5.611  61.756  104.807 1.00 20.00 ? 246  SER C C   1 
ATOM   9146  O O   . SER C 1 246 ? -6.618  61.078  105.014 1.00 20.00 ? 246  SER C O   1 
ATOM   9147  C CB  . SER C 1 246 ? -4.054  60.254  103.533 1.00 20.00 ? 246  SER C CB  1 
ATOM   9148  O OG  . SER C 1 246 ? -3.522  59.985  104.816 1.00 20.00 ? 246  SER C OG  1 
ATOM   9149  N N   . TYR C 1 247 ? -5.178  62.681  105.664 1.00 20.00 ? 247  TYR C N   1 
ATOM   9150  C CA  . TYR C 1 247 ? -5.866  62.930  106.932 1.00 20.00 ? 247  TYR C CA  1 
ATOM   9151  C C   . TYR C 1 247 ? -6.743  64.170  106.910 1.00 20.00 ? 247  TYR C C   1 
ATOM   9152  O O   . TYR C 1 247 ? -7.138  64.663  107.959 1.00 20.00 ? 247  TYR C O   1 
ATOM   9153  C CB  . TYR C 1 247 ? -4.856  63.086  108.076 1.00 20.00 ? 247  TYR C CB  1 
ATOM   9154  C CG  . TYR C 1 247 ? -3.916  61.922  108.238 1.00 20.00 ? 247  TYR C CG  1 
ATOM   9155  C CD1 . TYR C 1 247 ? -4.399  60.643  108.521 1.00 20.00 ? 247  TYR C CD1 1 
ATOM   9156  C CD2 . TYR C 1 247 ? -2.542  62.093  108.102 1.00 20.00 ? 247  TYR C CD2 1 
ATOM   9157  C CE1 . TYR C 1 247 ? -3.537  59.567  108.662 1.00 20.00 ? 247  TYR C CE1 1 
ATOM   9158  C CE2 . TYR C 1 247 ? -1.671  61.024  108.241 1.00 20.00 ? 247  TYR C CE2 1 
ATOM   9159  C CZ  . TYR C 1 247 ? -2.172  59.764  108.521 1.00 20.00 ? 247  TYR C CZ  1 
ATOM   9160  O OH  . TYR C 1 247 ? -1.304  58.705  108.664 1.00 20.00 ? 247  TYR C OH  1 
ATOM   9161  N N   . ALA C 1 248 ? -7.047  64.688  105.727 1.00 20.00 ? 248  ALA C N   1 
ATOM   9162  C CA  . ALA C 1 248 ? -7.881  65.883  105.632 1.00 20.00 ? 248  ALA C CA  1 
ATOM   9163  C C   . ALA C 1 248 ? -9.065  65.633  104.723 1.00 20.00 ? 248  ALA C C   1 
ATOM   9164  O O   . ALA C 1 248 ? -9.069  64.670  103.958 1.00 20.00 ? 248  ALA C O   1 
ATOM   9165  C CB  . ALA C 1 248 ? -7.055  67.059  105.107 1.00 20.00 ? 248  ALA C CB  1 
ATOM   9166  N N   . ASP C 1 249 ? -10.066 66.502  104.808 1.00 20.00 ? 249  ASP C N   1 
ATOM   9167  C CA  . ASP C 1 249 ? -11.265 66.375  103.988 1.00 20.00 ? 249  ASP C CA  1 
ATOM   9168  C C   . ASP C 1 249 ? -11.181 67.314  102.806 1.00 20.00 ? 249  ASP C C   1 
ATOM   9169  O O   . ASP C 1 249 ? -11.985 67.244  101.884 1.00 20.00 ? 249  ASP C O   1 
ATOM   9170  C CB  . ASP C 1 249 ? -12.505 66.696  104.814 1.00 20.00 ? 249  ASP C CB  1 
ATOM   9171  C CG  . ASP C 1 249 ? -12.730 65.696  105.924 1.00 20.00 ? 249  ASP C CG  1 
ATOM   9172  O OD1 . ASP C 1 249 ? -13.025 64.518  105.615 1.00 20.00 ? 249  ASP C OD1 1 
ATOM   9173  O OD2 . ASP C 1 249 ? -12.603 66.079  107.105 1.00 20.00 ? 249  ASP C OD2 1 
ATOM   9174  N N   . GLY C 1 250 ? -10.186 68.189  102.845 1.00 20.00 ? 250  GLY C N   1 
ATOM   9175  C CA  . GLY C 1 250 ? -9.982  69.149  101.780 1.00 20.00 ? 250  GLY C CA  1 
ATOM   9176  C C   . GLY C 1 250 ? -8.912  70.121  102.213 1.00 20.00 ? 250  GLY C C   1 
ATOM   9177  O O   . GLY C 1 250 ? -8.266  69.903  103.234 1.00 20.00 ? 250  GLY C O   1 
ATOM   9178  N N   . CYS C 1 251 ? -8.720  71.191  101.449 1.00 20.00 ? 251  CYS C N   1 
ATOM   9179  C CA  . CYS C 1 251 ? -7.714  72.186  101.786 1.00 20.00 ? 251  CYS C CA  1 
ATOM   9180  C C   . CYS C 1 251 ? -7.832  73.435  100.942 1.00 20.00 ? 251  CYS C C   1 
ATOM   9181  O O   . CYS C 1 251 ? -8.514  73.447  99.926  1.00 20.00 ? 251  CYS C O   1 
ATOM   9182  C CB  . CYS C 1 251 ? -6.308  71.605  101.602 1.00 20.00 ? 251  CYS C CB  1 
ATOM   9183  S SG  . CYS C 1 251 ? -5.716  71.455  99.874  1.00 20.00 ? 251  CYS C SG  1 
ATOM   9184  N N   . THR C 1 252 ? -7.196  74.505  101.406 1.00 20.00 ? 252  THR C N   1 
ATOM   9185  C CA  . THR C 1 252 ? -7.191  75.773  100.693 1.00 20.00 ? 252  THR C CA  1 
ATOM   9186  C C   . THR C 1 252 ? -5.704  75.848  100.434 1.00 20.00 ? 252  THR C C   1 
ATOM   9187  O O   . THR C 1 252 ? -4.905  75.526  101.314 1.00 20.00 ? 252  THR C O   1 
ATOM   9188  C CB  . THR C 1 252 ? -7.614  76.961  101.560 1.00 20.00 ? 252  THR C CB  1 
ATOM   9189  O OG1 . THR C 1 252 ? -6.958  76.890  102.832 1.00 20.00 ? 252  THR C OG1 1 
ATOM   9190  C CG2 . THR C 1 252 ? -9.115  76.954  101.743 1.00 20.00 ? 252  THR C CG2 1 
ATOM   9191  N N   . MET C 1 253 ? -5.324  76.248  99.232  1.00 20.00 ? 253  MET C N   1 
ATOM   9192  C CA  . MET C 1 253 ? -3.919  76.331  98.907  1.00 20.00 ? 253  MET C CA  1 
ATOM   9193  C C   . MET C 1 253 ? -3.534  77.626  98.230  1.00 20.00 ? 253  MET C C   1 
ATOM   9194  O O   . MET C 1 253 ? -4.252  78.123  97.372  1.00 20.00 ? 253  MET C O   1 
ATOM   9195  C CB  . MET C 1 253 ? -3.560  75.160  97.994  1.00 20.00 ? 253  MET C CB  1 
ATOM   9196  C CG  . MET C 1 253 ? -2.150  75.180  97.484  1.00 20.00 ? 253  MET C CG  1 
ATOM   9197  S SD  . MET C 1 253 ? -1.056  74.858  98.838  1.00 20.00 ? 253  MET C SD  1 
ATOM   9198  C CE  . MET C 1 253 ? 0.412   74.450  97.963  1.00 20.00 ? 253  MET C CE  1 
ATOM   9199  N N   . SER C 1 254 ? -2.397  78.182  98.631  1.00 20.00 ? 254  SER C N   1 
ATOM   9200  C CA  . SER C 1 254 ? -1.915  79.421  98.037  1.00 20.00 ? 254  SER C CA  1 
ATOM   9201  C C   . SER C 1 254 ? -0.724  78.994  97.191  1.00 20.00 ? 254  SER C C   1 
ATOM   9202  O O   . SER C 1 254 ? 0.340   78.684  97.725  1.00 20.00 ? 254  SER C O   1 
ATOM   9203  C CB  . SER C 1 254 ? -1.457  80.396  99.104  1.00 20.00 ? 254  SER C CB  1 
ATOM   9204  O OG  . SER C 1 254 ? -0.831  81.505  98.495  1.00 20.00 ? 254  SER C OG  1 
ATOM   9205  N N   . GLY C 1 255 ? -0.912  78.948  95.877  1.00 20.00 ? 255  GLY C N   1 
ATOM   9206  C CA  . GLY C 1 255 ? 0.171   78.546  94.997  1.00 20.00 ? 255  GLY C CA  1 
ATOM   9207  C C   . GLY C 1 255 ? 1.340   79.497  95.061  1.00 20.00 ? 255  GLY C C   1 
ATOM   9208  O O   . GLY C 1 255 ? 2.469   79.128  94.743  1.00 20.00 ? 255  GLY C O   1 
ATOM   9209  N N   . LYS C 1 256 ? 1.060   80.725  95.491  1.00 20.00 ? 256  LYS C N   1 
ATOM   9210  C CA  . LYS C 1 256 ? 2.066   81.778  95.615  1.00 20.00 ? 256  LYS C CA  1 
ATOM   9211  C C   . LYS C 1 256 ? 3.177   81.427  96.606  1.00 20.00 ? 256  LYS C C   1 
ATOM   9212  O O   . LYS C 1 256 ? 4.225   82.075  96.642  1.00 20.00 ? 256  LYS C O   1 
ATOM   9213  C CB  . LYS C 1 256 ? 1.386   83.073  96.048  1.00 20.00 ? 256  LYS C CB  1 
ATOM   9214  C CG  . LYS C 1 256 ? 0.456   83.662  95.005  1.00 20.00 ? 256  LYS C CG  1 
ATOM   9215  C CD  . LYS C 1 256 ? -0.330  84.841  95.566  1.00 20.00 ? 256  LYS C CD  1 
ATOM   9216  C CE  . LYS C 1 256 ? 0.481   86.099  95.543  1.00 20.00 ? 256  LYS C CE  1 
ATOM   9217  N NZ  . LYS C 1 256 ? -0.338  87.281  95.941  1.00 20.00 ? 256  LYS C NZ  1 
ATOM   9218  N N   . LYS C 1 257 ? 2.941   80.410  97.424  1.00 20.00 ? 257  LYS C N   1 
ATOM   9219  C CA  . LYS C 1 257 ? 3.933   79.997  98.401  1.00 20.00 ? 257  LYS C CA  1 
ATOM   9220  C C   . LYS C 1 257 ? 4.682   78.773  97.871  1.00 20.00 ? 257  LYS C C   1 
ATOM   9221  O O   . LYS C 1 257 ? 5.525   78.913  97.000  1.00 20.00 ? 257  LYS C O   1 
ATOM   9222  C CB  . LYS C 1 257 ? 3.278   79.744  99.766  1.00 20.00 ? 257  LYS C CB  1 
ATOM   9223  C CG  . LYS C 1 257 ? 3.149   80.993  100.660 1.00 20.00 ? 257  LYS C CG  1 
ATOM   9224  C CD  . LYS C 1 257 ? 2.043   81.935  100.218 1.00 20.00 ? 257  LYS C CD  1 
ATOM   9225  C CE  . LYS C 1 257 ? 1.905   83.180  101.093 1.00 20.00 ? 257  LYS C CE  1 
ATOM   9226  N NZ  . LYS C 1 257 ? 0.976   82.892  102.187 1.00 20.00 ? 257  LYS C NZ  1 
ATOM   9227  N N   . ASP C 1 258 ? 4.346   77.582  98.360  1.00 20.00 ? 258  ASP C N   1 
ATOM   9228  C CA  . ASP C 1 258 ? 5.018   76.359  97.926  1.00 20.00 ? 258  ASP C CA  1 
ATOM   9229  C C   . ASP C 1 258 ? 4.796   75.805  96.522  1.00 20.00 ? 258  ASP C C   1 
ATOM   9230  O O   . ASP C 1 258 ? 5.341   74.756  96.194  1.00 20.00 ? 258  ASP C O   1 
ATOM   9231  C CB  . ASP C 1 258 ? 4.746   75.240  98.932  1.00 20.00 ? 258  ASP C CB  1 
ATOM   9232  C CG  . ASP C 1 258 ? 5.739   75.234  100.089 1.00 20.00 ? 258  ASP C CG  1 
ATOM   9233  O OD1 . ASP C 1 258 ? 6.807   75.883  99.996  1.00 20.00 ? 258  ASP C OD1 1 
ATOM   9234  O OD2 . ASP C 1 258 ? 5.448   74.564  101.096 1.00 20.00 ? 258  ASP C OD2 1 
ATOM   9235  N N   . CYS C 1 259 ? 4.005   76.465  95.687  1.00 20.00 ? 259  CYS C N   1 
ATOM   9236  C CA  . CYS C 1 259 ? 3.801   75.932  94.344  1.00 20.00 ? 259  CYS C CA  1 
ATOM   9237  C C   . CYS C 1 259 ? 4.744   76.603  93.346  1.00 20.00 ? 259  CYS C C   1 
ATOM   9238  O O   . CYS C 1 259 ? 4.648   76.388  92.138  1.00 20.00 ? 259  CYS C O   1 
ATOM   9239  C CB  . CYS C 1 259 ? 2.349   76.099  93.915  1.00 20.00 ? 259  CYS C CB  1 
ATOM   9240  S SG  . CYS C 1 259 ? 1.263   74.889  94.710  1.00 20.00 ? 259  CYS C SG  1 
ATOM   9241  N N   . LEU C 1 260 ? 5.647   77.424  93.877  1.00 20.00 ? 260  LEU C N   1 
ATOM   9242  C CA  . LEU C 1 260 ? 6.647   78.150  93.100  1.00 20.00 ? 260  LEU C CA  1 
ATOM   9243  C C   . LEU C 1 260 ? 6.140   79.065  91.992  1.00 20.00 ? 260  LEU C C   1 
ATOM   9244  O O   . LEU C 1 260 ? 6.767   79.175  90.932  1.00 20.00 ? 260  LEU C O   1 
ATOM   9245  C CB  . LEU C 1 260 ? 7.662   77.154  92.524  1.00 20.00 ? 260  LEU C CB  1 
ATOM   9246  C CG  . LEU C 1 260 ? 8.449   76.373  93.583  1.00 20.00 ? 260  LEU C CG  1 
ATOM   9247  C CD1 . LEU C 1 260 ? 9.038   75.119  92.979  1.00 20.00 ? 260  LEU C CD1 1 
ATOM   9248  C CD2 . LEU C 1 260 ? 9.543   77.268  94.163  1.00 20.00 ? 260  LEU C CD2 1 
ATOM   9249  N N   . VAL C 1 261 ? 5.025   79.743  92.243  1.00 20.00 ? 261  VAL C N   1 
ATOM   9250  C CA  . VAL C 1 261 ? 4.459   80.650  91.247  1.00 20.00 ? 261  VAL C CA  1 
ATOM   9251  C C   . VAL C 1 261 ? 4.339   82.063  91.800  1.00 20.00 ? 261  VAL C C   1 
ATOM   9252  O O   . VAL C 1 261 ? 4.631   82.309  92.974  1.00 20.00 ? 261  VAL C O   1 
ATOM   9253  C CB  . VAL C 1 261 ? 3.071   80.181  90.754  1.00 20.00 ? 261  VAL C CB  1 
ATOM   9254  C CG1 . VAL C 1 261 ? 3.238   79.004  89.810  1.00 20.00 ? 261  VAL C CG1 1 
ATOM   9255  C CG2 . VAL C 1 261 ? 2.193   79.813  91.931  1.00 20.00 ? 261  VAL C CG2 1 
ATOM   9256  N N   . ASN C 1 262 ? 3.910   82.990  90.949  1.00 20.00 ? 262  ASN C N   1 
ATOM   9257  C CA  . ASN C 1 262 ? 3.757   84.383  91.345  1.00 20.00 ? 262  ASN C CA  1 
ATOM   9258  C C   . ASN C 1 262 ? 2.297   84.747  91.589  1.00 20.00 ? 262  ASN C C   1 
ATOM   9259  O O   . ASN C 1 262 ? 1.986   85.840  92.059  1.00 20.00 ? 262  ASN C O   1 
ATOM   9260  C CB  . ASN C 1 262 ? 4.359   85.290  90.267  1.00 20.00 ? 262  ASN C CB  1 
ATOM   9261  C CG  . ASN C 1 262 ? 5.788   84.893  89.901  1.00 20.00 ? 262  ASN C CG  1 
ATOM   9262  O OD1 . ASN C 1 262 ? 6.072   84.566  88.756  1.00 20.00 ? 262  ASN C OD1 1 
ATOM   9263  N ND2 . ASN C 1 262 ? 6.689   84.921  90.879  1.00 20.00 ? 262  ASN C ND2 1 
ATOM   9264  N N   . ILE C 1 263 ? 1.403   83.822  91.262  1.00 20.00 ? 263  ILE C N   1 
ATOM   9265  C CA  . ILE C 1 263 ? -0.025  84.034  91.444  1.00 20.00 ? 263  ILE C CA  1 
ATOM   9266  C C   . ILE C 1 263 ? -0.739  82.693  91.337  1.00 20.00 ? 263  ILE C C   1 
ATOM   9267  O O   . ILE C 1 263 ? -0.209  81.761  90.730  1.00 20.00 ? 263  ILE C O   1 
ATOM   9268  C CB  . ILE C 1 263 ? -0.585  85.024  90.388  1.00 20.00 ? 263  ILE C CB  1 
ATOM   9269  C CG1 . ILE C 1 263 ? -1.979  85.499  90.807  1.00 20.00 ? 263  ILE C CG1 1 
ATOM   9270  C CG2 . ILE C 1 263 ? -0.649  84.376  89.028  1.00 20.00 ? 263  ILE C CG2 1 
ATOM   9271  C CD1 . ILE C 1 263 ? -1.955  86.542  91.895  1.00 20.00 ? 263  ILE C CD1 1 
ATOM   9272  N N   . GLY C 1 264 ? -1.916  82.586  91.960  1.00 20.00 ? 264  GLY C N   1 
ATOM   9273  C CA  . GLY C 1 264 ? -2.667  81.346  91.907  1.00 20.00 ? 264  GLY C CA  1 
ATOM   9274  C C   . GLY C 1 264 ? -2.857  80.603  93.215  1.00 20.00 ? 264  GLY C C   1 
ATOM   9275  O O   . GLY C 1 264 ? -2.105  80.779  94.175  1.00 20.00 ? 264  GLY C O   1 
ATOM   9276  N N   . GLY C 1 265 ? -3.886  79.761  93.233  1.00 20.00 ? 265  GLY C N   1 
ATOM   9277  C CA  . GLY C 1 265 ? -4.222  78.959  94.395  1.00 20.00 ? 265  GLY C CA  1 
ATOM   9278  C C   . GLY C 1 265 ? -5.360  78.024  94.026  1.00 20.00 ? 265  GLY C C   1 
ATOM   9279  O O   . GLY C 1 265 ? -5.733  77.929  92.861  1.00 20.00 ? 265  GLY C O   1 
ATOM   9280  N N   . PHE C 1 266 ? -5.906  77.313  95.001  1.00 20.00 ? 266  PHE C N   1 
ATOM   9281  C CA  . PHE C 1 266 ? -7.007  76.405  94.720  1.00 20.00 ? 266  PHE C CA  1 
ATOM   9282  C C   . PHE C 1 266 ? -7.661  75.836  95.968  1.00 20.00 ? 266  PHE C C   1 
ATOM   9283  O O   . PHE C 1 266 ? -7.115  75.917  97.072  1.00 20.00 ? 266  PHE C O   1 
ATOM   9284  C CB  . PHE C 1 266 ? -6.564  75.266  93.777  1.00 20.00 ? 266  PHE C CB  1 
ATOM   9285  C CG  . PHE C 1 266 ? -5.349  74.490  94.247  1.00 20.00 ? 266  PHE C CG  1 
ATOM   9286  C CD1 . PHE C 1 266 ? -5.479  73.440  95.152  1.00 20.00 ? 266  PHE C CD1 1 
ATOM   9287  C CD2 . PHE C 1 266 ? -4.076  74.797  93.760  1.00 20.00 ? 266  PHE C CD2 1 
ATOM   9288  C CE1 . PHE C 1 266 ? -4.358  72.704  95.566  1.00 20.00 ? 266  PHE C CE1 1 
ATOM   9289  C CE2 . PHE C 1 266 ? -2.949  74.069  94.168  1.00 20.00 ? 266  PHE C CE2 1 
ATOM   9290  C CZ  . PHE C 1 266 ? -3.090  73.025  95.069  1.00 20.00 ? 266  PHE C CZ  1 
ATOM   9291  N N   . LEU C 1 267 ? -8.851  75.279  95.775  1.00 20.00 ? 267  LEU C N   1 
ATOM   9292  C CA  . LEU C 1 267 ? -9.634  74.676  96.844  1.00 20.00 ? 267  LEU C CA  1 
ATOM   9293  C C   . LEU C 1 267 ? -9.841  73.203  96.507  1.00 20.00 ? 267  LEU C C   1 
ATOM   9294  O O   . LEU C 1 267 ? -10.212 72.867  95.390  1.00 20.00 ? 267  LEU C O   1 
ATOM   9295  C CB  . LEU C 1 267 ? -10.985 75.386  96.960  1.00 20.00 ? 267  LEU C CB  1 
ATOM   9296  C CG  . LEU C 1 267 ? -12.027 74.776  97.897  1.00 20.00 ? 267  LEU C CG  1 
ATOM   9297  C CD1 . LEU C 1 267 ? -11.644 75.055  99.332  1.00 20.00 ? 267  LEU C CD1 1 
ATOM   9298  C CD2 . LEU C 1 267 ? -13.387 75.351  97.587  1.00 20.00 ? 267  LEU C CD2 1 
ATOM   9299  N N   . CYS C 1 268 ? -9.576  72.322  97.463  1.00 20.00 ? 268  CYS C N   1 
ATOM   9300  C CA  . CYS C 1 268 ? -9.744  70.888  97.243  1.00 20.00 ? 268  CYS C CA  1 
ATOM   9301  C C   . CYS C 1 268 ? -10.718 70.316  98.258  1.00 20.00 ? 268  CYS C C   1 
ATOM   9302  O O   . CYS C 1 268 ? -10.796 70.787  99.394  1.00 20.00 ? 268  CYS C O   1 
ATOM   9303  C CB  . CYS C 1 268 ? -8.418  70.134  97.415  1.00 20.00 ? 268  CYS C CB  1 
ATOM   9304  S SG  . CYS C 1 268 ? -7.165  70.401  96.170  1.00 20.00 ? 268  CYS C SG  1 
ATOM   9305  N N   . MET C 1 269 ? -11.450 69.289  97.846  1.00 20.00 ? 269  MET C N   1 
ATOM   9306  C CA  . MET C 1 269 ? -12.416 68.633  98.720  1.00 20.00 ? 269  MET C CA  1 
ATOM   9307  C C   . MET C 1 269 ? -12.786 67.299  98.097  1.00 20.00 ? 269  MET C C   1 
ATOM   9308  O O   . MET C 1 269 ? -12.657 67.118  96.888  1.00 20.00 ? 269  MET C O   1 
ATOM   9309  C CB  . MET C 1 269 ? -13.661 69.494  98.924  1.00 20.00 ? 269  MET C CB  1 
ATOM   9310  C CG  . MET C 1 269 ? -14.653 69.415  97.799  1.00 20.00 ? 269  MET C CG  1 
ATOM   9311  S SD  . MET C 1 269 ? -14.544 70.877  96.801  1.00 20.00 ? 269  MET C SD  1 
ATOM   9312  C CE  . MET C 1 269 ? -15.001 72.100  97.965  1.00 20.00 ? 269  MET C CE  1 
ATOM   9313  N N   . ASN C 1 270 ? -13.226 66.363  98.927  1.00 20.00 ? 270  ASN C N   1 
ATOM   9314  C CA  . ASN C 1 270 ? -13.611 65.045  98.450  1.00 20.00 ? 270  ASN C CA  1 
ATOM   9315  C C   . ASN C 1 270 ? -15.128 64.947  98.289  1.00 20.00 ? 270  ASN C C   1 
ATOM   9316  O O   . ASN C 1 270 ? -15.624 64.247  97.410  1.00 20.00 ? 270  ASN C O   1 
ATOM   9317  C CB  . ASN C 1 270 ? -13.125 63.983  99.434  1.00 20.00 ? 270  ASN C CB  1 
ATOM   9318  C CG  . ASN C 1 270 ? -11.623 63.790  99.390  1.00 20.00 ? 270  ASN C CG  1 
ATOM   9319  O OD1 . ASN C 1 270 ? -11.022 63.770  98.323  1.00 20.00 ? 270  ASN C OD1 1 
ATOM   9320  N ND2 . ASN C 1 270 ? -11.012 63.643  100.553 1.00 20.00 ? 270  ASN C ND2 1 
ATOM   9321  N N   . ASP C 1 271 ? -15.849 65.671  99.139  1.00 20.00 ? 271  ASP C N   1 
ATOM   9322  C CA  . ASP C 1 271 ? -17.311 65.696  99.137  1.00 20.00 ? 271  ASP C CA  1 
ATOM   9323  C C   . ASP C 1 271 ? -17.937 66.269  97.861  1.00 20.00 ? 271  ASP C C   1 
ATOM   9324  O O   . ASP C 1 271 ? -17.640 67.397  97.463  1.00 20.00 ? 271  ASP C O   1 
ATOM   9325  C CB  . ASP C 1 271 ? -17.794 66.489  100.353 1.00 20.00 ? 271  ASP C CB  1 
ATOM   9326  C CG  . ASP C 1 271 ? -19.272 66.313  100.615 1.00 20.00 ? 271  ASP C CG  1 
ATOM   9327  O OD1 . ASP C 1 271 ? -19.705 65.168  100.842 1.00 20.00 ? 271  ASP C OD1 1 
ATOM   9328  O OD2 . ASP C 1 271 ? -20.003 67.323  100.599 1.00 20.00 ? 271  ASP C OD2 1 
ATOM   9329  N N   . GLU C 1 272 ? -18.821 65.495  97.235  1.00 20.00 ? 272  GLU C N   1 
ATOM   9330  C CA  . GLU C 1 272 ? -19.485 65.930  96.009  1.00 20.00 ? 272  GLU C CA  1 
ATOM   9331  C C   . GLU C 1 272 ? -20.490 67.041  96.242  1.00 20.00 ? 272  GLU C C   1 
ATOM   9332  O O   . GLU C 1 272 ? -20.660 67.911  95.390  1.00 20.00 ? 272  GLU C O   1 
ATOM   9333  C CB  . GLU C 1 272 ? -20.189 64.760  95.328  1.00 20.00 ? 272  GLU C CB  1 
ATOM   9334  C CG  . GLU C 1 272 ? -19.398 64.160  94.181  1.00 20.00 ? 272  GLU C CG  1 
ATOM   9335  C CD  . GLU C 1 272 ? -18.537 62.994  94.631  1.00 20.00 ? 272  GLU C CD  1 
ATOM   9336  O OE1 . GLU C 1 272 ? -19.095 61.899  94.861  1.00 20.00 ? 272  GLU C OE1 1 
ATOM   9337  O OE2 . GLU C 1 272 ? -17.305 63.167  94.760  1.00 20.00 ? 272  GLU C OE2 1 
ATOM   9338  N N   . GLU C 1 273 ? -21.167 67.017  97.384  1.00 20.00 ? 273  GLU C N   1 
ATOM   9339  C CA  . GLU C 1 273 ? -22.147 68.059  97.671  1.00 20.00 ? 273  GLU C CA  1 
ATOM   9340  C C   . GLU C 1 273 ? -21.433 69.398  97.754  1.00 20.00 ? 273  GLU C C   1 
ATOM   9341  O O   . GLU C 1 273 ? -21.844 70.369  97.131  1.00 20.00 ? 273  GLU C O   1 
ATOM   9342  C CB  . GLU C 1 273 ? -22.866 67.781  98.995  1.00 20.00 ? 273  GLU C CB  1 
ATOM   9343  C CG  . GLU C 1 273 ? -24.317 67.363  98.840  1.00 20.00 ? 273  GLU C CG  1 
ATOM   9344  C CD  . GLU C 1 273 ? -24.489 65.856  98.838  1.00 20.00 ? 273  GLU C CD  1 
ATOM   9345  O OE1 . GLU C 1 273 ? -23.661 65.154  99.461  1.00 20.00 ? 273  GLU C OE1 1 
ATOM   9346  O OE2 . GLU C 1 273 ? -25.455 65.375  98.210  1.00 20.00 ? 273  GLU C OE2 1 
ATOM   9347  N N   . MET C 1 274 ? -20.358 69.441  98.533  1.00 20.00 ? 274  MET C N   1 
ATOM   9348  C CA  . MET C 1 274 ? -19.584 70.663  98.694  1.00 20.00 ? 274  MET C CA  1 
ATOM   9349  C C   . MET C 1 274 ? -18.970 71.086  97.365  1.00 20.00 ? 274  MET C C   1 
ATOM   9350  O O   . MET C 1 274 ? -18.869 72.272  97.071  1.00 20.00 ? 274  MET C O   1 
ATOM   9351  C CB  . MET C 1 274 ? -18.473 70.458  99.723  1.00 20.00 ? 274  MET C CB  1 
ATOM   9352  C CG  . MET C 1 274 ? -18.626 71.309  100.964 1.00 20.00 ? 274  MET C CG  1 
ATOM   9353  S SD  . MET C 1 274 ? -17.240 71.128  102.096 1.00 20.00 ? 274  MET C SD  1 
ATOM   9354  C CE  . MET C 1 274 ? -15.937 71.984  101.180 1.00 20.00 ? 274  MET C CE  1 
ATOM   9355  N N   . PHE C 1 275 ? -18.556 70.113  96.561  1.00 20.00 ? 275  PHE C N   1 
ATOM   9356  C CA  . PHE C 1 275 ? -17.957 70.425  95.274  1.00 20.00 ? 275  PHE C CA  1 
ATOM   9357  C C   . PHE C 1 275 ? -18.954 71.120  94.365  1.00 20.00 ? 275  PHE C C   1 
ATOM   9358  O O   . PHE C 1 275 ? -18.609 72.082  93.685  1.00 20.00 ? 275  PHE C O   1 
ATOM   9359  C CB  . PHE C 1 275 ? -17.445 69.161  94.593  1.00 20.00 ? 275  PHE C CB  1 
ATOM   9360  C CG  . PHE C 1 275 ? -16.861 69.409  93.237  1.00 20.00 ? 275  PHE C CG  1 
ATOM   9361  C CD1 . PHE C 1 275 ? -15.990 70.473  93.028  1.00 20.00 ? 275  PHE C CD1 1 
ATOM   9362  C CD2 . PHE C 1 275 ? -17.189 68.596  92.167  1.00 20.00 ? 275  PHE C CD2 1 
ATOM   9363  C CE1 . PHE C 1 275 ? -15.456 70.721  91.768  1.00 20.00 ? 275  PHE C CE1 1 
ATOM   9364  C CE2 . PHE C 1 275 ? -16.662 68.833  90.903  1.00 20.00 ? 275  PHE C CE2 1 
ATOM   9365  C CZ  . PHE C 1 275 ? -15.791 69.900  90.703  1.00 20.00 ? 275  PHE C CZ  1 
ATOM   9366  N N   . SER C 1 276 ? -20.187 70.630  94.349  1.00 20.00 ? 276  SER C N   1 
ATOM   9367  C CA  . SER C 1 276 ? -21.231 71.219  93.516  1.00 20.00 ? 276  SER C CA  1 
ATOM   9368  C C   . SER C 1 276 ? -21.570 72.617  93.995  1.00 20.00 ? 276  SER C C   1 
ATOM   9369  O O   . SER C 1 276 ? -21.761 73.528  93.191  1.00 20.00 ? 276  SER C O   1 
ATOM   9370  C CB  . SER C 1 276 ? -22.500 70.371  93.552  1.00 20.00 ? 276  SER C CB  1 
ATOM   9371  O OG  . SER C 1 276 ? -22.203 69.004  93.353  1.00 20.00 ? 276  SER C OG  1 
ATOM   9372  N N   . ALA C 1 277 ? -21.650 72.786  95.309  1.00 20.00 ? 277  ALA C N   1 
ATOM   9373  C CA  . ALA C 1 277 ? -21.968 74.088  95.879  1.00 20.00 ? 277  ALA C CA  1 
ATOM   9374  C C   . ALA C 1 277 ? -20.836 75.093  95.650  1.00 20.00 ? 277  ALA C C   1 
ATOM   9375  O O   . ALA C 1 277 ? -21.079 76.276  95.425  1.00 20.00 ? 277  ALA C O   1 
ATOM   9376  C CB  . ALA C 1 277 ? -22.252 73.944  97.367  1.00 20.00 ? 277  ALA C CB  1 
ATOM   9377  N N   . ALA C 1 278 ? -19.597 74.614  95.706  1.00 20.00 ? 278  ALA C N   1 
ATOM   9378  C CA  . ALA C 1 278 ? -18.433 75.469  95.506  1.00 20.00 ? 278  ALA C CA  1 
ATOM   9379  C C   . ALA C 1 278 ? -18.357 75.949  94.061  1.00 20.00 ? 278  ALA C C   1 
ATOM   9380  O O   . ALA C 1 278 ? -17.929 77.075  93.786  1.00 20.00 ? 278  ALA C O   1 
ATOM   9381  C CB  . ALA C 1 278 ? -17.159 74.707  95.874  1.00 20.00 ? 278  ALA C CB  1 
ATOM   9382  N N   . LYS C 1 279 ? -18.781 75.089  93.142  1.00 20.00 ? 279  LYS C N   1 
ATOM   9383  C CA  . LYS C 1 279 ? -18.767 75.405  91.719  1.00 20.00 ? 279  LYS C CA  1 
ATOM   9384  C C   . LYS C 1 279 ? -19.694 76.561  91.399  1.00 20.00 ? 279  LYS C C   1 
ATOM   9385  O O   . LYS C 1 279 ? -19.384 77.407  90.565  1.00 20.00 ? 279  LYS C O   1 
ATOM   9386  C CB  . LYS C 1 279 ? -19.185 74.185  90.902  1.00 20.00 ? 279  LYS C CB  1 
ATOM   9387  C CG  . LYS C 1 279 ? -18.059 73.580  90.090  1.00 20.00 ? 279  LYS C CG  1 
ATOM   9388  C CD  . LYS C 1 279 ? -18.167 72.068  90.053  1.00 20.00 ? 279  LYS C CD  1 
ATOM   9389  C CE  . LYS C 1 279 ? -18.985 71.592  88.860  1.00 20.00 ? 279  LYS C CE  1 
ATOM   9390  N NZ  . LYS C 1 279 ? -19.643 70.282  89.121  1.00 20.00 ? 279  LYS C NZ  1 
ATOM   9391  N N   . GLU C 1 280 ? -20.840 76.589  92.062  1.00 20.00 ? 280  GLU C N   1 
ATOM   9392  C CA  . GLU C 1 280 ? -21.811 77.648  91.842  1.00 20.00 ? 280  GLU C CA  1 
ATOM   9393  C C   . GLU C 1 280 ? -21.363 78.961  92.482  1.00 20.00 ? 280  GLU C C   1 
ATOM   9394  O O   . GLU C 1 280 ? -21.628 80.035  91.950  1.00 20.00 ? 280  GLU C O   1 
ATOM   9395  C CB  . GLU C 1 280 ? -23.163 77.218  92.403  1.00 20.00 ? 280  GLU C CB  1 
ATOM   9396  C CG  . GLU C 1 280 ? -24.217 78.298  92.382  1.00 20.00 ? 280  GLU C CG  1 
ATOM   9397  C CD  . GLU C 1 280 ? -25.568 77.787  92.837  1.00 20.00 ? 280  GLU C CD  1 
ATOM   9398  O OE1 . GLU C 1 280 ? -25.602 76.888  93.708  1.00 20.00 ? 280  GLU C OE1 1 
ATOM   9399  O OE2 . GLU C 1 280 ? -26.594 78.283  92.321  1.00 20.00 ? 280  GLU C OE2 1 
ATOM   9400  N N   . LEU C 1 281 ? -20.674 78.868  93.617  1.00 20.00 ? 281  LEU C N   1 
ATOM   9401  C CA  . LEU C 1 281 ? -20.189 80.046  94.333  1.00 20.00 ? 281  LEU C CA  1 
ATOM   9402  C C   . LEU C 1 281 ? -18.940 80.704  93.735  1.00 20.00 ? 281  LEU C C   1 
ATOM   9403  O O   . LEU C 1 281 ? -18.789 81.926  93.799  1.00 20.00 ? 281  LEU C O   1 
ATOM   9404  C CB  . LEU C 1 281 ? -19.908 79.684  95.794  1.00 20.00 ? 281  LEU C CB  1 
ATOM   9405  C CG  . LEU C 1 281 ? -20.071 80.808  96.820  1.00 20.00 ? 281  LEU C CG  1 
ATOM   9406  C CD1 . LEU C 1 281 ? -21.510 81.298  96.810  1.00 20.00 ? 281  LEU C CD1 1 
ATOM   9407  C CD2 . LEU C 1 281 ? -19.678 80.306  98.202  1.00 20.00 ? 281  LEU C CD2 1 
ATOM   9408  N N   . VAL C 1 282 ? -18.053 79.901  93.153  1.00 20.00 ? 282  VAL C N   1 
ATOM   9409  C CA  . VAL C 1 282 ? -16.831 80.433  92.560  1.00 20.00 ? 282  VAL C CA  1 
ATOM   9410  C C   . VAL C 1 282 ? -17.110 81.348  91.383  1.00 20.00 ? 282  VAL C C   1 
ATOM   9411  O O   . VAL C 1 282 ? -16.365 82.293  91.134  1.00 20.00 ? 282  VAL C O   1 
ATOM   9412  C CB  . VAL C 1 282 ? -15.886 79.297  92.088  1.00 20.00 ? 282  VAL C CB  1 
ATOM   9413  C CG1 . VAL C 1 282 ? -16.483 78.573  90.901  1.00 20.00 ? 282  VAL C CG1 1 
ATOM   9414  C CG2 . VAL C 1 282 ? -14.529 79.870  91.730  1.00 20.00 ? 282  VAL C CG2 1 
ATOM   9415  N N   . VAL C 1 283 ? -18.188 81.067  90.668  1.00 20.00 ? 283  VAL C N   1 
ATOM   9416  C CA  . VAL C 1 283 ? -18.567 81.861  89.509  1.00 20.00 ? 283  VAL C CA  1 
ATOM   9417  C C   . VAL C 1 283 ? -18.652 83.362  89.773  1.00 20.00 ? 283  VAL C C   1 
ATOM   9418  O O   . VAL C 1 283 ? -18.069 84.161  89.038  1.00 20.00 ? 283  VAL C O   1 
ATOM   9419  C CB  . VAL C 1 283 ? -19.940 81.398  88.932  1.00 20.00 ? 283  VAL C CB  1 
ATOM   9420  C CG1 . VAL C 1 283 ? -20.369 82.319  87.802  1.00 20.00 ? 283  VAL C CG1 1 
ATOM   9421  C CG2 . VAL C 1 283 ? -19.847 79.968  88.428  1.00 20.00 ? 283  VAL C CG2 1 
ATOM   9422  N N   . VAL C 1 284 ? -19.364 83.744  90.828  1.00 20.00 ? 284  VAL C N   1 
ATOM   9423  C CA  . VAL C 1 284 ? -19.523 85.155  91.162  1.00 20.00 ? 284  VAL C CA  1 
ATOM   9424  C C   . VAL C 1 284 ? -18.342 85.862  91.816  1.00 20.00 ? 284  VAL C C   1 
ATOM   9425  O O   . VAL C 1 284 ? -18.283 87.098  91.828  1.00 20.00 ? 284  VAL C O   1 
ATOM   9426  C CB  . VAL C 1 284 ? -20.781 85.368  92.052  1.00 20.00 ? 284  VAL C CB  1 
ATOM   9427  C CG1 . VAL C 1 284 ? -22.028 84.912  91.303  1.00 20.00 ? 284  VAL C CG1 1 
ATOM   9428  C CG2 . VAL C 1 284 ? -20.639 84.610  93.366  1.00 20.00 ? 284  VAL C CG2 1 
ATOM   9429  N N   . TYR C 1 285 ? -17.397 85.093  92.345  1.00 20.00 ? 285  TYR C N   1 
ATOM   9430  C CA  . TYR C 1 285 ? -16.235 85.684  92.999  1.00 20.00 ? 285  TYR C CA  1 
ATOM   9431  C C   . TYR C 1 285 ? -14.921 85.621  92.222  1.00 20.00 ? 285  TYR C C   1 
ATOM   9432  O O   . TYR C 1 285 ? -14.203 86.620  92.141  1.00 20.00 ? 285  TYR C O   1 
ATOM   9433  C CB  . TYR C 1 285 ? -16.028 85.029  94.365  1.00 20.00 ? 285  TYR C CB  1 
ATOM   9434  C CG  . TYR C 1 285 ? -17.030 85.456  95.411  1.00 20.00 ? 285  TYR C CG  1 
ATOM   9435  C CD1 . TYR C 1 285 ? -16.937 86.703  96.018  1.00 20.00 ? 285  TYR C CD1 1 
ATOM   9436  C CD2 . TYR C 1 285 ? -18.073 84.616  95.792  1.00 20.00 ? 285  TYR C CD2 1 
ATOM   9437  C CE1 . TYR C 1 285 ? -17.857 87.107  96.974  1.00 20.00 ? 285  TYR C CE1 1 
ATOM   9438  C CE2 . TYR C 1 285 ? -18.999 85.013  96.748  1.00 20.00 ? 285  TYR C CE2 1 
ATOM   9439  C CZ  . TYR C 1 285 ? -18.882 86.262  97.331  1.00 20.00 ? 285  TYR C CZ  1 
ATOM   9440  O OH  . TYR C 1 285 ? -19.803 86.681  98.258  1.00 20.00 ? 285  TYR C OH  1 
ATOM   9441  N N   . GLU C 1 286 ? -14.612 84.453  91.658  1.00 20.00 ? 286  GLU C N   1 
ATOM   9442  C CA  . GLU C 1 286 ? -13.378 84.244  90.896  1.00 20.00 ? 286  GLU C CA  1 
ATOM   9443  C C   . GLU C 1 286 ? -13.539 84.065  89.389  1.00 20.00 ? 286  GLU C C   1 
ATOM   9444  O O   . GLU C 1 286 ? -12.800 84.669  88.601  1.00 20.00 ? 286  GLU C O   1 
ATOM   9445  C CB  . GLU C 1 286 ? -12.645 83.018  91.449  1.00 20.00 ? 286  GLU C CB  1 
ATOM   9446  C CG  . GLU C 1 286 ? -12.509 83.000  92.961  1.00 20.00 ? 286  GLU C CG  1 
ATOM   9447  C CD  . GLU C 1 286 ? -11.337 83.828  93.447  1.00 20.00 ? 286  GLU C CD  1 
ATOM   9448  O OE1 . GLU C 1 286 ? -10.259 83.754  92.830  1.00 20.00 ? 286  GLU C OE1 1 
ATOM   9449  O OE2 . GLU C 1 286 ? -11.492 84.557  94.447  1.00 20.00 ? 286  GLU C OE2 1 
ATOM   9450  N N   . GLY C 1 287 ? -14.486 83.215  89.001  1.00 20.00 ? 287  GLY C N   1 
ATOM   9451  C CA  . GLY C 1 287 ? -14.735 82.954  87.596  1.00 20.00 ? 287  GLY C CA  1 
ATOM   9452  C C   . GLY C 1 287 ? -15.225 81.528  87.441  1.00 20.00 ? 287  GLY C C   1 
ATOM   9453  O O   . GLY C 1 287 ? -15.456 80.854  88.436  1.00 20.00 ? 287  GLY C O   1 
ATOM   9454  N N   . MET C 1 288 ? -15.379 81.060  86.208  1.00 20.00 ? 288  MET C N   1 
ATOM   9455  C CA  . MET C 1 288 ? -15.849 79.698  85.969  1.00 20.00 ? 288  MET C CA  1 
ATOM   9456  C C   . MET C 1 288 ? -14.987 78.706  86.746  1.00 20.00 ? 288  MET C C   1 
ATOM   9457  O O   . MET C 1 288 ? -13.815 78.974  87.010  1.00 20.00 ? 288  MET C O   1 
ATOM   9458  C CB  . MET C 1 288 ? -15.792 79.367  84.472  1.00 20.00 ? 288  MET C CB  1 
ATOM   9459  C CG  . MET C 1 288 ? -16.945 79.926  83.632  1.00 20.00 ? 288  MET C CG  1 
ATOM   9460  S SD  . MET C 1 288 ? -18.604 79.781  84.346  1.00 20.00 ? 288  MET C SD  1 
ATOM   9461  C CE  . MET C 1 288 ? -19.166 78.308  83.634  1.00 20.00 ? 288  MET C CE  1 
ATOM   9462  N N   . PRO C 1 289 ? -15.555 77.546  87.121  1.00 20.00 ? 289  PRO C N   1 
ATOM   9463  C CA  . PRO C 1 289 ? -14.757 76.549  87.840  1.00 20.00 ? 289  PRO C CA  1 
ATOM   9464  C C   . PRO C 1 289 ? -13.587 76.043  87.000  1.00 20.00 ? 289  PRO C C   1 
ATOM   9465  O O   . PRO C 1 289 ? -12.635 75.474  87.527  1.00 20.00 ? 289  PRO C O   1 
ATOM   9466  C CB  . PRO C 1 289 ? -15.760 75.432  88.159  1.00 20.00 ? 289  PRO C CB  1 
ATOM   9467  C CG  . PRO C 1 289 ? -17.111 76.044  87.956  1.00 20.00 ? 289  PRO C CG  1 
ATOM   9468  C CD  . PRO C 1 289 ? -16.940 77.090  86.908  1.00 20.00 ? 289  PRO C CD  1 
ATOM   9469  N N   . SER C 1 290 ? -13.667 76.269  85.693  1.00 20.00 ? 290  SER C N   1 
ATOM   9470  C CA  . SER C 1 290 ? -12.636 75.843  84.746  1.00 20.00 ? 290  SER C CA  1 
ATOM   9471  C C   . SER C 1 290 ? -11.386 76.715  84.669  1.00 20.00 ? 290  SER C C   1 
ATOM   9472  O O   . SER C 1 290 ? -10.448 76.378  83.954  1.00 20.00 ? 290  SER C O   1 
ATOM   9473  C CB  . SER C 1 290 ? -13.245 75.721  83.345  1.00 20.00 ? 290  SER C CB  1 
ATOM   9474  O OG  . SER C 1 290 ? -14.172 76.771  83.105  1.00 20.00 ? 290  SER C OG  1 
ATOM   9475  N N   . TYR C 1 291 ? -11.373 77.841  85.375  1.00 20.00 ? 291  TYR C N   1 
ATOM   9476  C CA  . TYR C 1 291 ? -10.205 78.725  85.359  1.00 20.00 ? 291  TYR C CA  1 
ATOM   9477  C C   . TYR C 1 291 ? -10.089 79.526  86.660  1.00 20.00 ? 291  TYR C C   1 
ATOM   9478  O O   . TYR C 1 291 ? -9.006  79.972  87.041  1.00 20.00 ? 291  TYR C O   1 
ATOM   9479  C CB  . TYR C 1 291 ? -10.246 79.656  84.138  1.00 20.00 ? 291  TYR C CB  1 
ATOM   9480  C CG  . TYR C 1 291 ? -11.241 80.790  84.230  1.00 20.00 ? 291  TYR C CG  1 
ATOM   9481  C CD1 . TYR C 1 291 ? -10.965 81.917  84.994  1.00 20.00 ? 291  TYR C CD1 1 
ATOM   9482  C CD2 . TYR C 1 291 ? -12.449 80.744  83.538  1.00 20.00 ? 291  TYR C CD2 1 
ATOM   9483  C CE1 . TYR C 1 291 ? -11.851 82.971  85.072  1.00 20.00 ? 291  TYR C CE1 1 
ATOM   9484  C CE2 . TYR C 1 291 ? -13.356 81.803  83.609  1.00 20.00 ? 291  TYR C CE2 1 
ATOM   9485  C CZ  . TYR C 1 291 ? -13.045 82.914  84.378  1.00 20.00 ? 291  TYR C CZ  1 
ATOM   9486  O OH  . TYR C 1 291 ? -13.902 83.987  84.439  1.00 20.00 ? 291  TYR C OH  1 
ATOM   9487  N N   . GLY C 1 292 ? -11.221 79.697  87.332  1.00 20.00 ? 292  GLY C N   1 
ATOM   9488  C CA  . GLY C 1 292 ? -11.273 80.425  88.588  1.00 20.00 ? 292  GLY C CA  1 
ATOM   9489  C C   . GLY C 1 292 ? -10.437 81.677  88.790  1.00 20.00 ? 292  GLY C C   1 
ATOM   9490  O O   . GLY C 1 292 ? -9.679  81.748  89.765  1.00 20.00 ? 292  GLY C O   1 
ATOM   9491  N N   . GLY C 1 293 ? -10.580 82.658  87.895  1.00 20.00 ? 293  GLY C N   1 
ATOM   9492  C CA  . GLY C 1 293 ? -9.837  83.907  87.992  1.00 20.00 ? 293  GLY C CA  1 
ATOM   9493  C C   . GLY C 1 293 ? -8.354  83.829  87.689  1.00 20.00 ? 293  GLY C C   1 
ATOM   9494  O O   . GLY C 1 293 ? -7.587  84.723  88.056  1.00 20.00 ? 293  GLY C O   1 
ATOM   9495  N N   . LEU C 1 294 ? -7.962  82.765  86.999  1.00 20.00 ? 294  LEU C N   1 
ATOM   9496  C CA  . LEU C 1 294 ? -6.577  82.515  86.621  1.00 20.00 ? 294  LEU C CA  1 
ATOM   9497  C C   . LEU C 1 294 ? -6.454  82.284  85.113  1.00 20.00 ? 294  LEU C C   1 
ATOM   9498  O O   . LEU C 1 294 ? -7.268  81.571  84.537  1.00 20.00 ? 294  LEU C O   1 
ATOM   9499  C CB  . LEU C 1 294 ? -6.105  81.251  87.325  1.00 20.00 ? 294  LEU C CB  1 
ATOM   9500  C CG  . LEU C 1 294 ? -4.943  81.202  88.299  1.00 20.00 ? 294  LEU C CG  1 
ATOM   9501  C CD1 . LEU C 1 294 ? -4.898  82.411  89.174  1.00 20.00 ? 294  LEU C CD1 1 
ATOM   9502  C CD2 . LEU C 1 294 ? -5.105  79.926  89.109  1.00 20.00 ? 294  LEU C CD2 1 
ATOM   9503  N N   . ALA C 1 295 ? -5.432  82.862  84.484  1.00 20.00 ? 295  ALA C N   1 
ATOM   9504  C CA  . ALA C 1 295 ? -5.233  82.683  83.049  1.00 20.00 ? 295  ALA C CA  1 
ATOM   9505  C C   . ALA C 1 295 ? -4.799  81.242  82.840  1.00 20.00 ? 295  ALA C C   1 
ATOM   9506  O O   . ALA C 1 295 ? -4.239  80.627  83.745  1.00 20.00 ? 295  ALA C O   1 
ATOM   9507  C CB  . ALA C 1 295 ? -4.148  83.617  82.540  1.00 20.00 ? 295  ALA C CB  1 
ATOM   9508  N N   . GLY C 1 296 ? -5.047  80.697  81.652  1.00 20.00 ? 296  GLY C N   1 
ATOM   9509  C CA  . GLY C 1 296 ? -4.649  79.323  81.400  1.00 20.00 ? 296  GLY C CA  1 
ATOM   9510  C C   . GLY C 1 296 ? -3.164  79.070  81.631  1.00 20.00 ? 296  GLY C C   1 
ATOM   9511  O O   . GLY C 1 296 ? -2.782  78.031  82.170  1.00 20.00 ? 296  GLY C O   1 
ATOM   9512  N N   . ARG C 1 297 ? -2.326  80.020  81.226  1.00 20.00 ? 297  ARG C N   1 
ATOM   9513  C CA  . ARG C 1 297 ? -0.882  79.897  81.383  1.00 20.00 ? 297  ARG C CA  1 
ATOM   9514  C C   . ARG C 1 297 ? -0.462  79.730  82.831  1.00 20.00 ? 297  ARG C C   1 
ATOM   9515  O O   . ARG C 1 297 ? 0.473   78.999  83.125  1.00 20.00 ? 297  ARG C O   1 
ATOM   9516  C CB  . ARG C 1 297 ? -0.176  81.123  80.807  1.00 20.00 ? 297  ARG C CB  1 
ATOM   9517  C CG  . ARG C 1 297 ? -0.716  82.441  81.311  1.00 20.00 ? 297  ARG C CG  1 
ATOM   9518  C CD  . ARG C 1 297 ? 0.159   83.587  80.849  1.00 20.00 ? 297  ARG C CD  1 
ATOM   9519  N NE  . ARG C 1 297 ? -0.310  84.875  81.349  1.00 20.00 ? 297  ARG C NE  1 
ATOM   9520  C CZ  . ARG C 1 297 ? -1.033  85.734  80.641  1.00 20.00 ? 297  ARG C CZ  1 
ATOM   9521  N NH1 . ARG C 1 297 ? -1.383  85.458  79.391  1.00 20.00 ? 297  ARG C NH1 1 
ATOM   9522  N NH2 . ARG C 1 297 ? -1.412  86.872  81.186  1.00 20.00 ? 297  ARG C NH2 1 
ATOM   9523  N N   . ASP C 1 298 ? -1.163  80.405  83.734  1.00 20.00 ? 298  ASP C N   1 
ATOM   9524  C CA  . ASP C 1 298 ? -0.853  80.331  85.152  1.00 20.00 ? 298  ASP C CA  1 
ATOM   9525  C C   . ASP C 1 298 ? -1.245  79.013  85.797  1.00 20.00 ? 298  ASP C C   1 
ATOM   9526  O O   . ASP C 1 298 ? -0.664  78.614  86.811  1.00 20.00 ? 298  ASP C O   1 
ATOM   9527  C CB  . ASP C 1 298 ? -1.495  81.506  85.869  1.00 20.00 ? 298  ASP C CB  1 
ATOM   9528  C CG  . ASP C 1 298 ? -0.727  82.792  85.647  1.00 20.00 ? 298  ASP C CG  1 
ATOM   9529  O OD1 . ASP C 1 298 ? 0.431   82.868  86.076  1.00 20.00 ? 298  ASP C OD1 1 
ATOM   9530  O OD2 . ASP C 1 298 ? -1.250  83.732  85.037  1.00 20.00 ? 298  ASP C OD2 1 
ATOM   9531  N N   . MET C 1 299 ? -2.233  78.337  85.220  1.00 20.00 ? 299  MET C N   1 
ATOM   9532  C CA  . MET C 1 299 ? -2.671  77.056  85.760  1.00 20.00 ? 299  MET C CA  1 
ATOM   9533  C C   . MET C 1 299 ? -1.609  76.041  85.328  1.00 20.00 ? 299  MET C C   1 
ATOM   9534  O O   . MET C 1 299 ? -1.350  75.053  86.012  1.00 20.00 ? 299  MET C O   1 
ATOM   9535  C CB  . MET C 1 299 ? -4.039  76.665  85.190  1.00 20.00 ? 299  MET C CB  1 
ATOM   9536  C CG  . MET C 1 299 ? -5.209  77.477  85.749  1.00 20.00 ? 299  MET C CG  1 
ATOM   9537  S SD  . MET C 1 299 ? -6.826  76.765  85.411  1.00 20.00 ? 299  MET C SD  1 
ATOM   9538  C CE  . MET C 1 299 ? -7.172  77.445  83.818  1.00 20.00 ? 299  MET C CE  1 
ATOM   9539  N N   . GLU C 1 300 ? -0.994  76.300  84.180  1.00 20.00 ? 300  GLU C N   1 
ATOM   9540  C CA  . GLU C 1 300 ? 0.032   75.416  83.666  1.00 20.00 ? 300  GLU C CA  1 
ATOM   9541  C C   . GLU C 1 300 ? 1.302   75.575  84.508  1.00 20.00 ? 300  GLU C C   1 
ATOM   9542  O O   . GLU C 1 300 ? 1.912   74.598  84.913  1.00 20.00 ? 300  GLU C O   1 
ATOM   9543  C CB  . GLU C 1 300 ? 0.321   75.739  82.197  1.00 20.00 ? 300  GLU C CB  1 
ATOM   9544  C CG  . GLU C 1 300 ? 1.259   74.749  81.535  1.00 20.00 ? 300  GLU C CG  1 
ATOM   9545  C CD  . GLU C 1 300 ? 0.613   73.388  81.310  1.00 20.00 ? 300  GLU C CD  1 
ATOM   9546  O OE1 . GLU C 1 300 ? -0.605  73.344  81.072  1.00 20.00 ? 300  GLU C OE1 1 
ATOM   9547  O OE2 . GLU C 1 300 ? 1.325   72.366  81.369  1.00 20.00 ? 300  GLU C OE2 1 
ATOM   9548  N N   . ALA C 1 301 ? 1.693   76.811  84.771  1.00 20.00 ? 301  ALA C N   1 
ATOM   9549  C CA  . ALA C 1 301 ? 2.886   77.081  85.564  1.00 20.00 ? 301  ALA C CA  1 
ATOM   9550  C C   . ALA C 1 301 ? 2.734   76.573  86.999  1.00 20.00 ? 301  ALA C C   1 
ATOM   9551  O O   . ALA C 1 301 ? 3.706   76.117  87.605  1.00 20.00 ? 301  ALA C O   1 
ATOM   9552  C CB  . ALA C 1 301 ? 3.168   78.573  85.581  1.00 20.00 ? 301  ALA C CB  1 
ATOM   9553  N N   . MET C 1 302 ? 1.525   76.670  87.551  1.00 20.00 ? 302  MET C N   1 
ATOM   9554  C CA  . MET C 1 302 ? 1.290   76.210  88.914  1.00 20.00 ? 302  MET C CA  1 
ATOM   9555  C C   . MET C 1 302 ? 1.345   74.692  88.972  1.00 20.00 ? 302  MET C C   1 
ATOM   9556  O O   . MET C 1 302 ? 1.841   74.132  89.938  1.00 20.00 ? 302  MET C O   1 
ATOM   9557  C CB  . MET C 1 302 ? -0.057  76.703  89.438  1.00 20.00 ? 302  MET C CB  1 
ATOM   9558  C CG  . MET C 1 302 ? -0.343  76.255  90.858  1.00 20.00 ? 302  MET C CG  1 
ATOM   9559  S SD  . MET C 1 302 ? -1.616  77.250  91.680  1.00 20.00 ? 302  MET C SD  1 
ATOM   9560  C CE  . MET C 1 302 ? -2.961  77.214  90.465  1.00 20.00 ? 302  MET C CE  1 
ATOM   9561  N N   . ALA C 1 303 ? 0.836   74.024  87.943  1.00 20.00 ? 303  ALA C N   1 
ATOM   9562  C CA  . ALA C 1 303 ? 0.852   72.560  87.899  1.00 20.00 ? 303  ALA C CA  1 
ATOM   9563  C C   . ALA C 1 303 ? 2.304   72.066  87.852  1.00 20.00 ? 303  ALA C C   1 
ATOM   9564  O O   . ALA C 1 303 ? 2.676   71.098  88.528  1.00 20.00 ? 303  ALA C O   1 
ATOM   9565  C CB  . ALA C 1 303 ? 0.110   72.074  86.668  1.00 20.00 ? 303  ALA C CB  1 
ATOM   9566  N N   . ILE C 1 304 ? 3.120   72.732  87.040  1.00 20.00 ? 304  ILE C N   1 
ATOM   9567  C CA  . ILE C 1 304 ? 4.527   72.375  86.891  1.00 20.00 ? 304  ILE C CA  1 
ATOM   9568  C C   . ILE C 1 304 ? 5.301   72.669  88.173  1.00 20.00 ? 304  ILE C C   1 
ATOM   9569  O O   . ILE C 1 304 ? 6.096   71.851  88.623  1.00 20.00 ? 304  ILE C O   1 
ATOM   9570  C CB  . ILE C 1 304 ? 5.176   73.148  85.720  1.00 20.00 ? 304  ILE C CB  1 
ATOM   9571  C CG1 . ILE C 1 304 ? 4.605   72.660  84.389  1.00 20.00 ? 304  ILE C CG1 1 
ATOM   9572  C CG2 . ILE C 1 304 ? 6.681   72.949  85.727  1.00 20.00 ? 304  ILE C CG2 1 
ATOM   9573  C CD1 . ILE C 1 304 ? 4.720   73.674  83.271  1.00 20.00 ? 304  ILE C CD1 1 
ATOM   9574  N N   . GLY C 1 305 ? 5.054   73.837  88.761  1.00 20.00 ? 305  GLY C N   1 
ATOM   9575  C CA  . GLY C 1 305 ? 5.734   74.220  89.984  1.00 20.00 ? 305  GLY C CA  1 
ATOM   9576  C C   . GLY C 1 305 ? 5.479   73.294  91.152  1.00 20.00 ? 305  GLY C C   1 
ATOM   9577  O O   . GLY C 1 305 ? 6.384   73.013  91.943  1.00 20.00 ? 305  GLY C O   1 
ATOM   9578  N N   . LEU C 1 306 ? 4.246   72.816  91.273  1.00 20.00 ? 306  LEU C N   1 
ATOM   9579  C CA  . LEU C 1 306 ? 3.888   71.913  92.359  1.00 20.00 ? 306  LEU C CA  1 
ATOM   9580  C C   . LEU C 1 306 ? 4.678   70.614  92.246  1.00 20.00 ? 306  LEU C C   1 
ATOM   9581  O O   . LEU C 1 306 ? 5.056   70.013  93.247  1.00 20.00 ? 306  LEU C O   1 
ATOM   9582  C CB  . LEU C 1 306 ? 2.391   71.613  92.330  1.00 20.00 ? 306  LEU C CB  1 
ATOM   9583  C CG  . LEU C 1 306 ? 1.869   70.716  93.451  1.00 20.00 ? 306  LEU C CG  1 
ATOM   9584  C CD1 . LEU C 1 306 ? 2.308   71.265  94.808  1.00 20.00 ? 306  LEU C CD1 1 
ATOM   9585  C CD2 . LEU C 1 306 ? 0.354   70.637  93.360  1.00 20.00 ? 306  LEU C CD2 1 
ATOM   9586  N N   . ARG C 1 307 ? 4.916   70.177  91.017  1.00 20.00 ? 307  ARG C N   1 
ATOM   9587  C CA  . ARG C 1 307 ? 5.667   68.955  90.798  1.00 20.00 ? 307  ARG C CA  1 
ATOM   9588  C C   . ARG C 1 307 ? 7.162   69.209  91.081  1.00 20.00 ? 307  ARG C C   1 
ATOM   9589  O O   . ARG C 1 307 ? 7.850   68.348  91.617  1.00 20.00 ? 307  ARG C O   1 
ATOM   9590  C CB  . ARG C 1 307 ? 5.477   68.468  89.360  1.00 20.00 ? 307  ARG C CB  1 
ATOM   9591  C CG  . ARG C 1 307 ? 5.384   66.956  89.247  1.00 20.00 ? 307  ARG C CG  1 
ATOM   9592  C CD  . ARG C 1 307 ? 4.938   66.509  87.860  1.00 20.00 ? 307  ARG C CD  1 
ATOM   9593  N NE  . ARG C 1 307 ? 3.482   66.431  87.719  1.00 20.00 ? 307  ARG C NE  1 
ATOM   9594  C CZ  . ARG C 1 307 ? 2.743   65.358  88.000  1.00 20.00 ? 307  ARG C CZ  1 
ATOM   9595  N NH1 . ARG C 1 307 ? 3.313   64.245  88.450  1.00 20.00 ? 307  ARG C NH1 1 
ATOM   9596  N NH2 . ARG C 1 307 ? 1.428   65.399  87.814  1.00 20.00 ? 307  ARG C NH2 1 
ATOM   9597  N N   . GLU C 1 308 ? 7.651   70.396  90.729  1.00 20.00 ? 308  GLU C N   1 
ATOM   9598  C CA  . GLU C 1 308 ? 9.054   70.743  90.951  1.00 20.00 ? 308  GLU C CA  1 
ATOM   9599  C C   . GLU C 1 308 ? 9.355   70.803  92.437  1.00 20.00 ? 308  GLU C C   1 
ATOM   9600  O O   . GLU C 1 308 ? 10.433  70.411  92.876  1.00 20.00 ? 308  GLU C O   1 
ATOM   9601  C CB  . GLU C 1 308 ? 9.383   72.091  90.313  1.00 20.00 ? 308  GLU C CB  1 
ATOM   9602  C CG  . GLU C 1 308 ? 9.452   72.039  88.794  1.00 20.00 ? 308  GLU C CG  1 
ATOM   9603  C CD  . GLU C 1 308 ? 9.998   73.306  88.179  1.00 20.00 ? 308  GLU C CD  1 
ATOM   9604  O OE1 . GLU C 1 308 ? 10.378  74.220  88.936  1.00 20.00 ? 308  GLU C OE1 1 
ATOM   9605  O OE2 . GLU C 1 308 ? 10.047  73.387  86.937  1.00 20.00 ? 308  GLU C OE2 1 
ATOM   9606  N N   . ALA C 1 309 ? 8.385   71.285  93.205  1.00 20.00 ? 309  ALA C N   1 
ATOM   9607  C CA  . ALA C 1 309 ? 8.518   71.409  94.647  1.00 20.00 ? 309  ALA C CA  1 
ATOM   9608  C C   . ALA C 1 309 ? 8.698   70.073  95.364  1.00 20.00 ? 309  ALA C C   1 
ATOM   9609  O O   . ALA C 1 309 ? 9.119   70.044  96.517  1.00 20.00 ? 309  ALA C O   1 
ATOM   9610  C CB  . ALA C 1 309 ? 7.305   72.136  95.210  1.00 20.00 ? 309  ALA C CB  1 
ATOM   9611  N N   . MET C 1 310 ? 8.376   68.969  94.697  1.00 20.00 ? 310  MET C N   1 
ATOM   9612  C CA  . MET C 1 310 ? 8.517   67.656  95.319  1.00 20.00 ? 310  MET C CA  1 
ATOM   9613  C C   . MET C 1 310 ? 9.953   67.129  95.306  1.00 20.00 ? 310  MET C C   1 
ATOM   9614  O O   . MET C 1 310 ? 10.253  66.132  95.964  1.00 20.00 ? 310  MET C O   1 
ATOM   9615  C CB  . MET C 1 310 ? 7.596   66.641  94.637  1.00 20.00 ? 310  MET C CB  1 
ATOM   9616  C CG  . MET C 1 310 ? 6.111   66.984  94.711  1.00 20.00 ? 310  MET C CG  1 
ATOM   9617  S SD  . MET C 1 310 ? 5.447   67.009  96.393  1.00 20.00 ? 310  MET C SD  1 
ATOM   9618  C CE  . MET C 1 310 ? 4.792   68.614  96.468  1.00 20.00 ? 310  MET C CE  1 
ATOM   9619  N N   . GLN C 1 311 ? 10.843  67.787  94.564  1.00 20.00 ? 311  GLN C N   1 
ATOM   9620  C CA  . GLN C 1 311 ? 12.230  67.337  94.508  1.00 20.00 ? 311  GLN C CA  1 
ATOM   9621  C C   . GLN C 1 311 ? 12.882  67.589  95.856  1.00 20.00 ? 311  GLN C C   1 
ATOM   9622  O O   . GLN C 1 311 ? 12.929  68.724  96.324  1.00 20.00 ? 311  GLN C O   1 
ATOM   9623  C CB  . GLN C 1 311 ? 12.998  68.068  93.411  1.00 20.00 ? 311  GLN C CB  1 
ATOM   9624  C CG  . GLN C 1 311 ? 14.425  67.558  93.248  1.00 20.00 ? 311  GLN C CG  1 
ATOM   9625  C CD  . GLN C 1 311 ? 15.315  68.509  92.472  1.00 20.00 ? 311  GLN C CD  1 
ATOM   9626  O OE1 . GLN C 1 311 ? 14.936  69.639  92.184  1.00 20.00 ? 311  GLN C OE1 1 
ATOM   9627  N NE2 . GLN C 1 311 ? 16.509  68.047  92.126  1.00 20.00 ? 311  GLN C NE2 1 
ATOM   9628  N N   . TYR C 1 312 ? 13.380  66.521  96.474  1.00 20.00 ? 312  TYR C N   1 
ATOM   9629  C CA  . TYR C 1 312 ? 14.029  66.603  97.778  1.00 20.00 ? 312  TYR C CA  1 
ATOM   9630  C C   . TYR C 1 312 ? 15.122  67.670  97.901  1.00 20.00 ? 312  TYR C C   1 
ATOM   9631  O O   . TYR C 1 312 ? 15.087  68.501  98.811  1.00 20.00 ? 312  TYR C O   1 
ATOM   9632  C CB  . TYR C 1 312 ? 14.619  65.244  98.162  1.00 20.00 ? 312  TYR C CB  1 
ATOM   9633  C CG  . TYR C 1 312 ? 15.342  65.300  99.481  1.00 20.00 ? 312  TYR C CG  1 
ATOM   9634  C CD1 . TYR C 1 312 ? 14.640  65.518  100.664 1.00 20.00 ? 312  TYR C CD1 1 
ATOM   9635  C CD2 . TYR C 1 312 ? 16.739  65.250  99.541  1.00 20.00 ? 312  TYR C CD2 1 
ATOM   9636  C CE1 . TYR C 1 312 ? 15.300  65.702  101.872 1.00 20.00 ? 312  TYR C CE1 1 
ATOM   9637  C CE2 . TYR C 1 312 ? 17.414  65.431  100.752 1.00 20.00 ? 312  TYR C CE2 1 
ATOM   9638  C CZ  . TYR C 1 312 ? 16.680  65.663  101.910 1.00 20.00 ? 312  TYR C CZ  1 
ATOM   9639  O OH  . TYR C 1 312 ? 17.312  65.892  103.108 1.00 20.00 ? 312  TYR C OH  1 
ATOM   9640  N N   . GLU C 1 313 ? 16.091  67.636  96.990  1.00 20.00 ? 313  GLU C N   1 
ATOM   9641  C CA  . GLU C 1 313 ? 17.196  68.587  96.991  1.00 20.00 ? 313  GLU C CA  1 
ATOM   9642  C C   . GLU C 1 313 ? 16.762  70.032  96.920  1.00 20.00 ? 313  GLU C C   1 
ATOM   9643  O O   . GLU C 1 313 ? 17.442  70.908  97.458  1.00 20.00 ? 313  GLU C O   1 
ATOM   9644  C CB  . GLU C 1 313 ? 18.145  68.299  95.833  1.00 20.00 ? 313  GLU C CB  1 
ATOM   9645  C CG  . GLU C 1 313 ? 18.970  67.053  96.031  1.00 20.00 ? 313  GLU C CG  1 
ATOM   9646  C CD  . GLU C 1 313 ? 18.263  65.814  95.551  1.00 20.00 ? 313  GLU C CD  1 
ATOM   9647  O OE1 . GLU C 1 313 ? 17.159  65.934  94.987  1.00 20.00 ? 313  GLU C OE1 1 
ATOM   9648  O OE2 . GLU C 1 313 ? 18.816  64.711  95.735  1.00 20.00 ? 313  GLU C OE2 1 
ATOM   9649  N N   . TYR C 1 314 ? 15.649  70.298  96.244  1.00 20.00 ? 314  TYR C N   1 
ATOM   9650  C CA  . TYR C 1 314 ? 15.171  71.666  96.137  1.00 20.00 ? 314  TYR C CA  1 
ATOM   9651  C C   . TYR C 1 314 ? 14.656  72.150  97.483  1.00 20.00 ? 314  TYR C C   1 
ATOM   9652  O O   . TYR C 1 314 ? 15.048  73.212  97.965  1.00 20.00 ? 314  TYR C O   1 
ATOM   9653  C CB  . TYR C 1 314 ? 14.029  71.789  95.124  1.00 20.00 ? 314  TYR C CB  1 
ATOM   9654  C CG  . TYR C 1 314 ? 13.030  72.870  95.516  1.00 20.00 ? 314  TYR C CG  1 
ATOM   9655  C CD1 . TYR C 1 314 ? 13.360  74.224  95.407  1.00 20.00 ? 314  TYR C CD1 1 
ATOM   9656  C CD2 . TYR C 1 314 ? 11.798  72.540  96.079  1.00 20.00 ? 314  TYR C CD2 1 
ATOM   9657  C CE1 . TYR C 1 314 ? 12.497  75.217  95.855  1.00 20.00 ? 314  TYR C CE1 1 
ATOM   9658  C CE2 . TYR C 1 314 ? 10.925  73.529  96.531  1.00 20.00 ? 314  TYR C CE2 1 
ATOM   9659  C CZ  . TYR C 1 314 ? 11.283  74.863  96.417  1.00 20.00 ? 314  TYR C CZ  1 
ATOM   9660  O OH  . TYR C 1 314 ? 10.426  75.843  96.859  1.00 20.00 ? 314  TYR C OH  1 
ATOM   9661  N N   . ILE C 1 315 ? 13.764  71.373  98.086  1.00 20.00 ? 315  ILE C N   1 
ATOM   9662  C CA  . ILE C 1 315 ? 13.192  71.744  99.373  1.00 20.00 ? 315  ILE C CA  1 
ATOM   9663  C C   . ILE C 1 315 ? 14.207  71.699  100.503 1.00 20.00 ? 315  ILE C C   1 
ATOM   9664  O O   . ILE C 1 315 ? 14.127  72.481  101.444 1.00 20.00 ? 315  ILE C O   1 
ATOM   9665  C CB  . ILE C 1 315 ? 11.943  70.870  99.699  1.00 20.00 ? 315  ILE C CB  1 
ATOM   9666  C CG1 . ILE C 1 315 ? 11.094  71.555  100.767 1.00 20.00 ? 315  ILE C CG1 1 
ATOM   9667  C CG2 . ILE C 1 315 ? 12.361  69.474  100.111 1.00 20.00 ? 315  ILE C CG2 1 
ATOM   9668  C CD1 . ILE C 1 315 ? 10.643  72.956  100.414 1.00 20.00 ? 315  ILE C CD1 1 
ATOM   9669  N N   . GLU C 1 316 ? 15.174  70.797  100.413 1.00 20.00 ? 316  GLU C N   1 
ATOM   9670  C CA  . GLU C 1 316 ? 16.177  70.721  101.461 1.00 20.00 ? 316  GLU C CA  1 
ATOM   9671  C C   . GLU C 1 316 ? 16.989  72.018  101.456 1.00 20.00 ? 316  GLU C C   1 
ATOM   9672  O O   . GLU C 1 316 ? 17.209  72.618  102.506 1.00 20.00 ? 316  GLU C O   1 
ATOM   9673  C CB  . GLU C 1 316 ? 17.114  69.537  101.241 1.00 20.00 ? 316  GLU C CB  1 
ATOM   9674  C CG  . GLU C 1 316 ? 18.262  69.514  102.235 1.00 20.00 ? 316  GLU C CG  1 
ATOM   9675  C CD  . GLU C 1 316 ? 19.421  68.683  101.757 1.00 20.00 ? 316  GLU C CD  1 
ATOM   9676  O OE1 . GLU C 1 316 ? 19.528  68.454  100.532 1.00 20.00 ? 316  GLU C OE1 1 
ATOM   9677  O OE2 . GLU C 1 316 ? 20.225  68.253  102.610 1.00 20.00 ? 316  GLU C OE2 1 
ATOM   9678  N N   . HIS C 1 317 ? 17.426  72.451  100.272 1.00 20.00 ? 317  HIS C N   1 
ATOM   9679  C CA  . HIS C 1 317 ? 18.209  73.683  100.140 1.00 20.00 ? 317  HIS C CA  1 
ATOM   9680  C C   . HIS C 1 317 ? 17.384  74.901  100.517 1.00 20.00 ? 317  HIS C C   1 
ATOM   9681  O O   . HIS C 1 317 ? 17.895  75.840  101.116 1.00 20.00 ? 317  HIS C O   1 
ATOM   9682  C CB  . HIS C 1 317 ? 18.716  73.867  98.703  1.00 20.00 ? 317  HIS C CB  1 
ATOM   9683  C CG  . HIS C 1 317 ? 19.198  75.256  98.409  1.00 20.00 ? 317  HIS C CG  1 
ATOM   9684  N ND1 . HIS C 1 317 ? 18.414  76.200  97.781  1.00 20.00 ? 317  HIS C ND1 1 
ATOM   9685  C CD2 . HIS C 1 317 ? 20.366  75.875  98.703  1.00 20.00 ? 317  HIS C CD2 1 
ATOM   9686  C CE1 . HIS C 1 317 ? 19.075  77.340  97.704  1.00 20.00 ? 317  HIS C CE1 1 
ATOM   9687  N NE2 . HIS C 1 317 ? 20.262  77.170  98.257  1.00 20.00 ? 317  HIS C NE2 1 
ATOM   9688  N N   . ARG C 1 318 ? 16.111  74.889  100.139 1.00 20.00 ? 318  ARG C N   1 
ATOM   9689  C CA  . ARG C 1 318 ? 15.219  75.995  100.440 1.00 20.00 ? 318  ARG C CA  1 
ATOM   9690  C C   . ARG C 1 318 ? 15.164  76.252  101.939 1.00 20.00 ? 318  ARG C C   1 
ATOM   9691  O O   . ARG C 1 318 ? 15.412  77.369  102.397 1.00 20.00 ? 318  ARG C O   1 
ATOM   9692  C CB  . ARG C 1 318 ? 13.808  75.693  99.939  1.00 20.00 ? 318  ARG C CB  1 
ATOM   9693  C CG  . ARG C 1 318 ? 12.844  76.877  100.065 1.00 20.00 ? 318  ARG C CG  1 
ATOM   9694  C CD  . ARG C 1 318 ? 12.317  77.061  101.486 1.00 20.00 ? 318  ARG C CD  1 
ATOM   9695  N NE  . ARG C 1 318 ? 11.206  78.004  101.551 1.00 20.00 ? 318  ARG C NE  1 
ATOM   9696  C CZ  . ARG C 1 318 ? 11.322  79.318  101.410 1.00 20.00 ? 318  ARG C CZ  1 
ATOM   9697  N NH1 . ARG C 1 318 ? 12.491  79.872  101.195 1.00 20.00 ? 318  ARG C NH1 1 
ATOM   9698  N NH2 . ARG C 1 318 ? 10.264  80.097  101.484 1.00 20.00 ? 318  ARG C NH2 1 
ATOM   9699  N N   . VAL C 1 319 ? 14.822  75.211  102.692 1.00 20.00 ? 319  VAL C N   1 
ATOM   9700  C CA  . VAL C 1 319 ? 14.725  75.306  104.145 1.00 20.00 ? 319  VAL C CA  1 
ATOM   9701  C C   . VAL C 1 319 ? 16.077  75.589  104.787 1.00 20.00 ? 319  VAL C C   1 
ATOM   9702  O O   . VAL C 1 319 ? 16.180  76.416  105.690 1.00 20.00 ? 319  VAL C O   1 
ATOM   9703  C CB  . VAL C 1 319 ? 14.168  74.000  104.746 1.00 20.00 ? 319  VAL C CB  1 
ATOM   9704  C CG1 . VAL C 1 319 ? 14.121  74.103  106.287 1.00 20.00 ? 319  VAL C CG1 1 
ATOM   9705  C CG2 . VAL C 1 319 ? 12.789  73.708  104.154 1.00 20.00 ? 319  VAL C CG2 1 
ATOM   9706  N N   . LYS C 1 320 ? 17.113  74.905  104.315 1.00 20.00 ? 320  LYS C N   1 
ATOM   9707  C CA  . LYS C 1 320 ? 18.452  75.091  104.855 1.00 20.00 ? 320  LYS C CA  1 
ATOM   9708  C C   . LYS C 1 320 ? 19.038  76.461  104.570 1.00 20.00 ? 320  LYS C C   1 
ATOM   9709  O O   . LYS C 1 320 ? 19.888  76.927  105.315 1.00 20.00 ? 320  LYS C O   1 
ATOM   9710  C CB  . LYS C 1 320 ? 19.389  74.000  104.345 1.00 20.00 ? 320  LYS C CB  1 
ATOM   9711  C CG  . LYS C 1 320 ? 19.481  72.846  105.316 1.00 20.00 ? 320  LYS C CG  1 
ATOM   9712  C CD  . LYS C 1 320 ? 19.941  71.576  104.654 1.00 20.00 ? 320  LYS C CD  1 
ATOM   9713  C CE  . LYS C 1 320 ? 20.081  70.468  105.685 1.00 20.00 ? 320  LYS C CE  1 
ATOM   9714  N NZ  . LYS C 1 320 ? 20.701  69.256  105.080 1.00 20.00 ? 320  LYS C NZ  1 
ATOM   9715  N N   . GLN C 1 321 ? 18.585  77.112  103.504 1.00 20.00 ? 321  GLN C N   1 
ATOM   9716  C CA  . GLN C 1 321 ? 19.099  78.436  103.177 1.00 20.00 ? 321  GLN C CA  1 
ATOM   9717  C C   . GLN C 1 321 ? 18.561  79.408  104.223 1.00 20.00 ? 321  GLN C C   1 
ATOM   9718  O O   . GLN C 1 321 ? 19.228  80.375  104.579 1.00 20.00 ? 321  GLN C O   1 
ATOM   9719  C CB  . GLN C 1 321 ? 18.649  78.873  101.777 1.00 20.00 ? 321  GLN C CB  1 
ATOM   9720  C CG  . GLN C 1 321 ? 19.075  80.297  101.431 1.00 20.00 ? 321  GLN C CG  1 
ATOM   9721  C CD  . GLN C 1 321 ? 18.568  80.764  100.076 1.00 20.00 ? 321  GLN C CD  1 
ATOM   9722  O OE1 . GLN C 1 321 ? 17.369  80.974  99.887  1.00 20.00 ? 321  GLN C OE1 1 
ATOM   9723  N NE2 . GLN C 1 321 ? 19.483  80.937  99.126  1.00 20.00 ? 321  GLN C NE2 1 
ATOM   9724  N N   . VAL C 1 322 ? 17.344  79.151  104.706 1.00 20.00 ? 322  VAL C N   1 
ATOM   9725  C CA  . VAL C 1 322 ? 16.715  79.998  105.718 1.00 20.00 ? 322  VAL C CA  1 
ATOM   9726  C C   . VAL C 1 322 ? 17.415  79.724  107.061 1.00 20.00 ? 322  VAL C C   1 
ATOM   9727  O O   . VAL C 1 322 ? 17.680  80.635  107.840 1.00 20.00 ? 322  VAL C O   1 
ATOM   9728  C CB  . VAL C 1 322 ? 15.208  79.681  105.854 1.00 20.00 ? 322  VAL C CB  1 
ATOM   9729  C CG1 . VAL C 1 322 ? 14.632  80.388  107.069 1.00 20.00 ? 322  VAL C CG1 1 
ATOM   9730  C CG2 . VAL C 1 322 ? 14.464  80.135  104.599 1.00 20.00 ? 322  VAL C CG2 1 
ATOM   9731  N N   . ARG C 1 323 ? 17.715  78.452  107.303 1.00 20.00 ? 323  ARG C N   1 
ATOM   9732  C CA  . ARG C 1 323 ? 18.385  77.991  108.519 1.00 20.00 ? 323  ARG C CA  1 
ATOM   9733  C C   . ARG C 1 323 ? 19.768  78.625  108.620 1.00 20.00 ? 323  ARG C C   1 
ATOM   9734  O O   . ARG C 1 323 ? 20.269  78.897  109.713 1.00 20.00 ? 323  ARG C O   1 
ATOM   9735  C CB  . ARG C 1 323 ? 18.529  76.472  108.455 1.00 20.00 ? 323  ARG C CB  1 
ATOM   9736  C CG  . ARG C 1 323 ? 19.014  75.816  109.717 1.00 20.00 ? 323  ARG C CG  1 
ATOM   9737  C CD  . ARG C 1 323 ? 18.918  74.310  109.576 1.00 20.00 ? 323  ARG C CD  1 
ATOM   9738  N NE  . ARG C 1 323 ? 17.542  73.826  109.717 1.00 20.00 ? 323  ARG C NE  1 
ATOM   9739  C CZ  . ARG C 1 323 ? 17.140  72.596  109.406 1.00 20.00 ? 323  ARG C CZ  1 
ATOM   9740  N NH1 . ARG C 1 323 ? 18.003  71.712  108.931 1.00 20.00 ? 323  ARG C NH1 1 
ATOM   9741  N NH2 . ARG C 1 323 ? 15.878  72.241  109.587 1.00 20.00 ? 323  ARG C NH2 1 
ATOM   9742  N N   . TYR C 1 324 ? 20.374  78.848  107.457 1.00 20.00 ? 324  TYR C N   1 
ATOM   9743  C CA  . TYR C 1 324 ? 21.696  79.442  107.332 1.00 20.00 ? 324  TYR C CA  1 
ATOM   9744  C C   . TYR C 1 324 ? 21.686  80.872  107.835 1.00 20.00 ? 324  TYR C C   1 
ATOM   9745  O O   . TYR C 1 324 ? 22.596  81.297  108.530 1.00 20.00 ? 324  TYR C O   1 
ATOM   9746  C CB  . TYR C 1 324 ? 22.138  79.409  105.863 1.00 20.00 ? 324  TYR C CB  1 
ATOM   9747  C CG  . TYR C 1 324 ? 23.433  80.143  105.575 1.00 20.00 ? 324  TYR C CG  1 
ATOM   9748  C CD1 . TYR C 1 324 ? 23.437  81.504  105.285 1.00 20.00 ? 324  TYR C CD1 1 
ATOM   9749  C CD2 . TYR C 1 324 ? 24.648  79.466  105.566 1.00 20.00 ? 324  TYR C CD2 1 
ATOM   9750  C CE1 . TYR C 1 324 ? 24.619  82.171  104.991 1.00 20.00 ? 324  TYR C CE1 1 
ATOM   9751  C CE2 . TYR C 1 324 ? 25.831  80.119  105.274 1.00 20.00 ? 324  TYR C CE2 1 
ATOM   9752  C CZ  . TYR C 1 324 ? 25.809  81.471  104.986 1.00 20.00 ? 324  TYR C CZ  1 
ATOM   9753  O OH  . TYR C 1 324 ? 26.982  82.113  104.689 1.00 20.00 ? 324  TYR C OH  1 
ATOM   9754  N N   . LEU C 1 325 ? 20.652  81.615  107.470 1.00 20.00 ? 325  LEU C N   1 
ATOM   9755  C CA  . LEU C 1 325 ? 20.524  82.997  107.893 1.00 20.00 ? 325  LEU C CA  1 
ATOM   9756  C C   . LEU C 1 325 ? 20.349  83.033  109.413 1.00 20.00 ? 325  LEU C C   1 
ATOM   9757  O O   . LEU C 1 325 ? 20.974  83.847  110.103 1.00 20.00 ? 325  LEU C O   1 
ATOM   9758  C CB  . LEU C 1 325 ? 19.316  83.632  107.210 1.00 20.00 ? 325  LEU C CB  1 
ATOM   9759  C CG  . LEU C 1 325 ? 19.375  85.128  106.899 1.00 20.00 ? 325  LEU C CG  1 
ATOM   9760  C CD1 . LEU C 1 325 ? 18.006  85.731  107.103 1.00 20.00 ? 325  LEU C CD1 1 
ATOM   9761  C CD2 . LEU C 1 325 ? 20.392  85.817  107.782 1.00 20.00 ? 325  LEU C CD2 1 
ATOM   9762  N N   . GLY C 1 326 ? 19.502  82.142  109.930 1.00 20.00 ? 326  GLY C N   1 
ATOM   9763  C CA  . GLY C 1 326 ? 19.256  82.084  111.365 1.00 20.00 ? 326  GLY C CA  1 
ATOM   9764  C C   . GLY C 1 326 ? 20.474  81.668  112.176 1.00 20.00 ? 326  GLY C C   1 
ATOM   9765  O O   . GLY C 1 326 ? 20.705  82.196  113.261 1.00 20.00 ? 326  GLY C O   1 
ATOM   9766  N N   . ASP C 1 327 ? 21.251  80.722  111.642 1.00 20.00 ? 327  ASP C N   1 
ATOM   9767  C CA  . ASP C 1 327 ? 22.456  80.217  112.294 1.00 20.00 ? 327  ASP C CA  1 
ATOM   9768  C C   . ASP C 1 327 ? 23.528  81.288  112.443 1.00 20.00 ? 327  ASP C C   1 
ATOM   9769  O O   . ASP C 1 327 ? 24.205  81.359  113.467 1.00 20.00 ? 327  ASP C O   1 
ATOM   9770  C CB  . ASP C 1 327 ? 23.046  79.065  111.485 1.00 20.00 ? 327  ASP C CB  1 
ATOM   9771  C CG  . ASP C 1 327 ? 22.275  77.779  111.651 1.00 20.00 ? 327  ASP C CG  1 
ATOM   9772  O OD1 . ASP C 1 327 ? 21.391  77.711  112.535 1.00 20.00 ? 327  ASP C OD1 1 
ATOM   9773  O OD2 . ASP C 1 327 ? 22.558  76.831  110.888 1.00 20.00 ? 327  ASP C OD2 1 
ATOM   9774  N N   . LYS C 1 328 ? 23.696  82.093  111.398 1.00 20.00 ? 328  LYS C N   1 
ATOM   9775  C CA  . LYS C 1 328 ? 24.677  83.168  111.377 1.00 20.00 ? 328  LYS C CA  1 
ATOM   9776  C C   . LYS C 1 328 ? 24.304  84.263  112.362 1.00 20.00 ? 328  LYS C C   1 
ATOM   9777  O O   . LYS C 1 328 ? 25.169  84.847  113.010 1.00 20.00 ? 328  LYS C O   1 
ATOM   9778  C CB  . LYS C 1 328 ? 24.775  83.774  109.976 1.00 20.00 ? 328  LYS C CB  1 
ATOM   9779  C CG  . LYS C 1 328 ? 25.581  82.953  108.983 1.00 20.00 ? 328  LYS C CG  1 
ATOM   9780  C CD  . LYS C 1 328 ? 26.937  83.598  108.678 1.00 20.00 ? 328  LYS C CD  1 
ATOM   9781  C CE  . LYS C 1 328 ? 26.800  84.983  108.036 1.00 20.00 ? 328  LYS C CE  1 
ATOM   9782  N NZ  . LYS C 1 328 ? 28.128  85.557  107.627 1.00 20.00 ? 328  LYS C NZ  1 
ATOM   9783  N N   . LEU C 1 329 ? 23.015  84.556  112.463 1.00 20.00 ? 329  LEU C N   1 
ATOM   9784  C CA  . LEU C 1 329 ? 22.546  85.589  113.376 1.00 20.00 ? 329  LEU C CA  1 
ATOM   9785  C C   . LEU C 1 329 ? 22.668  85.113  114.817 1.00 20.00 ? 329  LEU C C   1 
ATOM   9786  O O   . LEU C 1 329 ? 23.119  85.858  115.686 1.00 20.00 ? 329  LEU C O   1 
ATOM   9787  C CB  . LEU C 1 329 ? 21.090  85.939  113.071 1.00 20.00 ? 329  LEU C CB  1 
ATOM   9788  C CG  . LEU C 1 329 ? 20.810  86.672  111.758 1.00 20.00 ? 329  LEU C CG  1 
ATOM   9789  C CD1 . LEU C 1 329 ? 19.314  86.865  111.598 1.00 20.00 ? 329  LEU C CD1 1 
ATOM   9790  C CD2 . LEU C 1 329 ? 21.523  88.013  111.752 1.00 20.00 ? 329  LEU C CD2 1 
ATOM   9791  N N   . ARG C 1 330 ? 22.265  83.868  115.059 1.00 20.00 ? 330  ARG C N   1 
ATOM   9792  C CA  . ARG C 1 330 ? 22.321  83.275  116.394 1.00 20.00 ? 330  ARG C CA  1 
ATOM   9793  C C   . ARG C 1 330 ? 23.754  83.151  116.906 1.00 20.00 ? 330  ARG C C   1 
ATOM   9794  O O   . ARG C 1 330 ? 24.021  83.315  118.099 1.00 20.00 ? 330  ARG C O   1 
ATOM   9795  C CB  . ARG C 1 330 ? 21.665  81.888  116.389 1.00 20.00 ? 330  ARG C CB  1 
ATOM   9796  C CG  . ARG C 1 330 ? 21.703  81.199  117.738 1.00 20.00 ? 330  ARG C CG  1 
ATOM   9797  C CD  . ARG C 1 330 ? 21.310  79.750  117.634 1.00 20.00 ? 330  ARG C CD  1 
ATOM   9798  N NE  . ARG C 1 330 ? 20.001  79.599  117.014 1.00 20.00 ? 330  ARG C NE  1 
ATOM   9799  C CZ  . ARG C 1 330 ? 19.798  79.067  115.816 1.00 20.00 ? 330  ARG C CZ  1 
ATOM   9800  N NH1 . ARG C 1 330 ? 20.823  78.632  115.094 1.00 20.00 ? 330  ARG C NH1 1 
ATOM   9801  N NH2 . ARG C 1 330 ? 18.566  78.973  115.337 1.00 20.00 ? 330  ARG C NH2 1 
ATOM   9802  N N   . GLU C 1 331 ? 24.670  82.848  115.998 1.00 20.00 ? 331  GLU C N   1 
ATOM   9803  C CA  . GLU C 1 331 ? 26.070  82.700  116.349 1.00 20.00 ? 331  GLU C CA  1 
ATOM   9804  C C   . GLU C 1 331 ? 26.631  84.018  116.850 1.00 20.00 ? 331  GLU C C   1 
ATOM   9805  O O   . GLU C 1 331 ? 27.606  84.038  117.584 1.00 20.00 ? 331  GLU C O   1 
ATOM   9806  C CB  . GLU C 1 331 ? 26.869  82.242  115.130 1.00 20.00 ? 331  GLU C CB  1 
ATOM   9807  C CG  . GLU C 1 331 ? 28.029  81.324  115.450 1.00 20.00 ? 331  GLU C CG  1 
ATOM   9808  C CD  . GLU C 1 331 ? 28.963  81.142  114.268 1.00 20.00 ? 331  GLU C CD  1 
ATOM   9809  O OE1 . GLU C 1 331 ? 28.474  81.159  113.113 1.00 20.00 ? 331  GLU C OE1 1 
ATOM   9810  O OE2 . GLU C 1 331 ? 30.186  80.983  114.493 1.00 20.00 ? 331  GLU C OE2 1 
ATOM   9811  N N   . ALA C 1 332 ? 26.006  85.122  116.463 1.00 20.00 ? 332  ALA C N   1 
ATOM   9812  C CA  . ALA C 1 332 ? 26.481  86.425  116.892 1.00 20.00 ? 332  ALA C CA  1 
ATOM   9813  C C   . ALA C 1 332 ? 25.690  86.984  118.060 1.00 20.00 ? 332  ALA C C   1 
ATOM   9814  O O   . ALA C 1 332 ? 25.888  88.127  118.453 1.00 20.00 ? 332  ALA C O   1 
ATOM   9815  C CB  . ALA C 1 332 ? 26.450  87.395  115.728 1.00 20.00 ? 332  ALA C CB  1 
ATOM   9816  N N   . GLY C 1 333 ? 24.783  86.182  118.605 1.00 20.00 ? 333  GLY C N   1 
ATOM   9817  C CA  . GLY C 1 333 ? 23.983  86.631  119.728 1.00 20.00 ? 333  GLY C CA  1 
ATOM   9818  C C   . GLY C 1 333 ? 22.844  87.564  119.388 1.00 20.00 ? 333  GLY C C   1 
ATOM   9819  O O   . GLY C 1 333 ? 22.351  88.283  120.257 1.00 20.00 ? 333  GLY C O   1 
ATOM   9820  N N   . VAL C 1 334 ? 22.426  87.577  118.128 1.00 20.00 ? 334  VAL C N   1 
ATOM   9821  C CA  . VAL C 1 334 ? 21.328  88.441  117.717 1.00 20.00 ? 334  VAL C CA  1 
ATOM   9822  C C   . VAL C 1 334 ? 20.041  87.728  118.112 1.00 20.00 ? 334  VAL C C   1 
ATOM   9823  O O   . VAL C 1 334 ? 19.900  86.532  117.874 1.00 20.00 ? 334  VAL C O   1 
ATOM   9824  C CB  . VAL C 1 334 ? 21.336  88.674  116.186 1.00 20.00 ? 334  VAL C CB  1 
ATOM   9825  C CG1 . VAL C 1 334 ? 20.101  89.471  115.767 1.00 20.00 ? 334  VAL C CG1 1 
ATOM   9826  C CG2 . VAL C 1 334 ? 22.617  89.407  115.776 1.00 20.00 ? 334  VAL C CG2 1 
ATOM   9827  N N   . PRO C 1 335 ? 19.095  88.443  118.747 1.00 20.00 ? 335  PRO C N   1 
ATOM   9828  C CA  . PRO C 1 335 ? 17.868  87.799  119.233 1.00 20.00 ? 335  PRO C CA  1 
ATOM   9829  C C   . PRO C 1 335 ? 16.852  87.461  118.131 1.00 20.00 ? 335  PRO C C   1 
ATOM   9830  O O   . PRO C 1 335 ? 16.363  88.345  117.422 1.00 20.00 ? 335  PRO C O   1 
ATOM   9831  C CB  . PRO C 1 335 ? 17.311  88.799  120.244 1.00 20.00 ? 335  PRO C CB  1 
ATOM   9832  C CG  . PRO C 1 335 ? 17.861  90.115  119.828 1.00 20.00 ? 335  PRO C CG  1 
ATOM   9833  C CD  . PRO C 1 335 ? 19.134  89.883  119.066 1.00 20.00 ? 335  PRO C CD  1 
ATOM   9834  N N   . ILE C 1 336 ? 16.544  86.175  117.991 1.00 20.00 ? 336  ILE C N   1 
ATOM   9835  C CA  . ILE C 1 336 ? 15.595  85.723  116.986 1.00 20.00 ? 336  ILE C CA  1 
ATOM   9836  C C   . ILE C 1 336 ? 14.628  84.713  117.597 1.00 20.00 ? 336  ILE C C   1 
ATOM   9837  O O   . ILE C 1 336 ? 14.845  84.226  118.709 1.00 20.00 ? 336  ILE C O   1 
ATOM   9838  C CB  . ILE C 1 336 ? 16.313  85.056  115.784 1.00 20.00 ? 336  ILE C CB  1 
ATOM   9839  C CG1 . ILE C 1 336 ? 17.056  83.798  116.242 1.00 20.00 ? 336  ILE C CG1 1 
ATOM   9840  C CG2 . ILE C 1 336 ? 17.271  86.034  115.146 1.00 20.00 ? 336  ILE C CG2 1 
ATOM   9841  C CD1 . ILE C 1 336 ? 17.454  82.864  115.117 1.00 20.00 ? 336  ILE C CD1 1 
ATOM   9842  N N   . VAL C 1 337 ? 13.561  84.415  116.858 1.00 20.00 ? 337  VAL C N   1 
ATOM   9843  C CA  . VAL C 1 337 ? 12.530  83.464  117.276 1.00 20.00 ? 337  VAL C CA  1 
ATOM   9844  C C   . VAL C 1 337 ? 13.067  82.050  117.023 1.00 20.00 ? 337  VAL C C   1 
ATOM   9845  O O   . VAL C 1 337 ? 13.693  81.801  115.986 1.00 20.00 ? 337  VAL C O   1 
ATOM   9846  C CB  . VAL C 1 337 ? 11.220  83.683  116.457 1.00 20.00 ? 337  VAL C CB  1 
ATOM   9847  C CG1 . VAL C 1 337 ? 10.293  82.481  116.596 1.00 20.00 ? 337  VAL C CG1 1 
ATOM   9848  C CG2 . VAL C 1 337 ? 10.521  84.956  116.931 1.00 20.00 ? 337  VAL C CG2 1 
ATOM   9849  N N   . GLU C 1 338 ? 12.827  81.134  117.961 1.00 20.00 ? 338  GLU C N   1 
ATOM   9850  C CA  . GLU C 1 338 ? 13.299  79.755  117.825 1.00 20.00 ? 338  GLU C CA  1 
ATOM   9851  C C   . GLU C 1 338 ? 12.188  78.715  117.721 1.00 20.00 ? 338  GLU C C   1 
ATOM   9852  O O   . GLU C 1 338 ? 11.061  78.947  118.153 1.00 20.00 ? 338  GLU C O   1 
ATOM   9853  C CB  . GLU C 1 338 ? 14.204  79.392  119.000 1.00 20.00 ? 338  GLU C CB  1 
ATOM   9854  C CG  . GLU C 1 338 ? 15.355  80.353  119.195 1.00 20.00 ? 338  GLU C CG  1 
ATOM   9855  C CD  . GLU C 1 338 ? 16.588  79.943  118.426 1.00 20.00 ? 338  GLU C CD  1 
ATOM   9856  O OE1 . GLU C 1 338 ? 16.458  79.165  117.455 1.00 20.00 ? 338  GLU C OE1 1 
ATOM   9857  O OE2 . GLU C 1 338 ? 17.690  80.401  118.796 1.00 20.00 ? 338  GLU C OE2 1 
ATOM   9858  N N   . PRO C 1 339 ? 12.499  77.547  117.127 1.00 20.00 ? 339  PRO C N   1 
ATOM   9859  C CA  . PRO C 1 339 ? 13.582  77.420  116.138 1.00 20.00 ? 339  PRO C CA  1 
ATOM   9860  C C   . PRO C 1 339 ? 13.205  78.113  114.823 1.00 20.00 ? 339  PRO C C   1 
ATOM   9861  O O   . PRO C 1 339 ? 12.082  78.607  114.675 1.00 20.00 ? 339  PRO C O   1 
ATOM   9862  C CB  . PRO C 1 339 ? 13.764  75.909  115.979 1.00 20.00 ? 339  PRO C CB  1 
ATOM   9863  C CG  . PRO C 1 339 ? 12.463  75.308  116.405 1.00 20.00 ? 339  PRO C CG  1 
ATOM   9864  C CD  . PRO C 1 339 ? 11.801  76.271  117.368 1.00 20.00 ? 339  PRO C CD  1 
ATOM   9865  N N   . THR C 1 340 ? 14.138  78.154  113.877 1.00 20.00 ? 340  THR C N   1 
ATOM   9866  C CA  . THR C 1 340 ? 13.885  78.796  112.591 1.00 20.00 ? 340  THR C CA  1 
ATOM   9867  C C   . THR C 1 340 ? 12.865  78.018  111.762 1.00 20.00 ? 340  THR C C   1 
ATOM   9868  O O   . THR C 1 340 ? 12.979  76.806  111.593 1.00 20.00 ? 340  THR C O   1 
ATOM   9869  C CB  . THR C 1 340 ? 15.200  78.968  111.788 1.00 20.00 ? 340  THR C CB  1 
ATOM   9870  O OG1 . THR C 1 340 ? 16.049  79.904  112.460 1.00 20.00 ? 340  THR C OG1 1 
ATOM   9871  C CG2 . THR C 1 340 ? 14.911  79.516  110.415 1.00 20.00 ? 340  THR C CG2 1 
ATOM   9872  N N   . GLY C 1 341 ? 11.860  78.727  111.259 1.00 20.00 ? 341  GLY C N   1 
ATOM   9873  C CA  . GLY C 1 341 ? 10.833  78.087  110.458 1.00 20.00 ? 341  GLY C CA  1 
ATOM   9874  C C   . GLY C 1 341 ? 11.344  77.701  109.091 1.00 20.00 ? 341  GLY C C   1 
ATOM   9875  O O   . GLY C 1 341 ? 12.547  77.658  108.867 1.00 20.00 ? 341  GLY C O   1 
ATOM   9876  N N   . GLY C 1 342 ? 10.440  77.433  108.159 1.00 20.00 ? 342  GLY C N   1 
ATOM   9877  C CA  . GLY C 1 342 ? 10.890  77.055  106.834 1.00 20.00 ? 342  GLY C CA  1 
ATOM   9878  C C   . GLY C 1 342 ? 10.901  78.149  105.783 1.00 20.00 ? 342  GLY C C   1 
ATOM   9879  O O   . GLY C 1 342 ? 11.446  77.953  104.701 1.00 20.00 ? 342  GLY C O   1 
ATOM   9880  N N   . HIS C 1 343 ? 10.334  79.311  106.088 1.00 20.00 ? 343  HIS C N   1 
ATOM   9881  C CA  . HIS C 1 343 ? 10.302  80.391  105.108 1.00 20.00 ? 343  HIS C CA  1 
ATOM   9882  C C   . HIS C 1 343 ? 10.782  81.743  105.582 1.00 20.00 ? 343  HIS C C   1 
ATOM   9883  O O   . HIS C 1 343 ? 10.874  82.671  104.785 1.00 20.00 ? 343  HIS C O   1 
ATOM   9884  C CB  . HIS C 1 343 ? 8.873   80.572  104.610 1.00 20.00 ? 343  HIS C CB  1 
ATOM   9885  C CG  . HIS C 1 343 ? 7.957   81.146  105.644 1.00 20.00 ? 343  HIS C CG  1 
ATOM   9886  N ND1 . HIS C 1 343 ? 7.483   80.408  106.708 1.00 20.00 ? 343  HIS C ND1 1 
ATOM   9887  C CD2 . HIS C 1 343 ? 7.463   82.395  105.804 1.00 20.00 ? 343  HIS C CD2 1 
ATOM   9888  C CE1 . HIS C 1 343 ? 6.737   81.180  107.478 1.00 20.00 ? 343  HIS C CE1 1 
ATOM   9889  N NE2 . HIS C 1 343 ? 6.709   82.390  106.951 1.00 20.00 ? 343  HIS C NE2 1 
ATOM   9890  N N   . ALA C 1 344 ? 11.081  81.876  106.867 1.00 20.00 ? 344  ALA C N   1 
ATOM   9891  C CA  . ALA C 1 344 ? 11.531  83.165  107.353 1.00 20.00 ? 344  ALA C CA  1 
ATOM   9892  C C   . ALA C 1 344 ? 12.236  83.114  108.698 1.00 20.00 ? 344  ALA C C   1 
ATOM   9893  O O   . ALA C 1 344 ? 12.172  82.120  109.412 1.00 20.00 ? 344  ALA C O   1 
ATOM   9894  C CB  . ALA C 1 344 ? 10.337  84.104  107.440 1.00 20.00 ? 344  ALA C CB  1 
ATOM   9895  N N   . VAL C 1 345 ? 12.907  84.216  109.020 1.00 20.00 ? 345  VAL C N   1 
ATOM   9896  C CA  . VAL C 1 345 ? 13.640  84.375  110.267 1.00 20.00 ? 345  VAL C CA  1 
ATOM   9897  C C   . VAL C 1 345 ? 12.997  85.593  110.922 1.00 20.00 ? 345  VAL C C   1 
ATOM   9898  O O   . VAL C 1 345 ? 12.792  86.613  110.265 1.00 20.00 ? 345  VAL C O   1 
ATOM   9899  C CB  . VAL C 1 345 ? 15.142  84.661  110.013 1.00 20.00 ? 345  VAL C CB  1 
ATOM   9900  C CG1 . VAL C 1 345 ? 15.813  85.118  111.306 1.00 20.00 ? 345  VAL C CG1 1 
ATOM   9901  C CG2 . VAL C 1 345 ? 15.833  83.413  109.483 1.00 20.00 ? 345  VAL C CG2 1 
ATOM   9902  N N   . PHE C 1 346 ? 12.651  85.490  112.199 1.00 20.00 ? 346  PHE C N   1 
ATOM   9903  C CA  . PHE C 1 346 ? 12.031  86.613  112.888 1.00 20.00 ? 346  PHE C CA  1 
ATOM   9904  C C   . PHE C 1 346 ? 12.982  87.191  113.910 1.00 20.00 ? 346  PHE C C   1 
ATOM   9905  O O   . PHE C 1 346 ? 13.456  86.476  114.791 1.00 20.00 ? 346  PHE C O   1 
ATOM   9906  C CB  . PHE C 1 346 ? 10.769  86.163  113.617 1.00 20.00 ? 346  PHE C CB  1 
ATOM   9907  C CG  . PHE C 1 346 ? 9.610   85.879  112.710 1.00 20.00 ? 346  PHE C CG  1 
ATOM   9908  C CD1 . PHE C 1 346 ? 9.562   84.701  111.969 1.00 20.00 ? 346  PHE C CD1 1 
ATOM   9909  C CD2 . PHE C 1 346 ? 8.552   86.778  112.609 1.00 20.00 ? 346  PHE C CD2 1 
ATOM   9910  C CE1 . PHE C 1 346 ? 8.476   84.423  111.143 1.00 20.00 ? 346  PHE C CE1 1 
ATOM   9911  C CE2 . PHE C 1 346 ? 7.459   86.506  111.783 1.00 20.00 ? 346  PHE C CE2 1 
ATOM   9912  C CZ  . PHE C 1 346 ? 7.421   85.331  111.053 1.00 20.00 ? 346  PHE C CZ  1 
ATOM   9913  N N   . LEU C 1 347 ? 13.260  88.486  113.797 1.00 20.00 ? 347  LEU C N   1 
ATOM   9914  C CA  . LEU C 1 347 ? 14.159  89.153  114.729 1.00 20.00 ? 347  LEU C CA  1 
ATOM   9915  C C   . LEU C 1 347 ? 13.319  89.690  115.887 1.00 20.00 ? 347  LEU C C   1 
ATOM   9916  O O   . LEU C 1 347 ? 12.226  90.209  115.666 1.00 20.00 ? 347  LEU C O   1 
ATOM   9917  C CB  . LEU C 1 347 ? 14.857  90.333  114.058 1.00 20.00 ? 347  LEU C CB  1 
ATOM   9918  C CG  . LEU C 1 347 ? 15.888  90.168  112.944 1.00 20.00 ? 347  LEU C CG  1 
ATOM   9919  C CD1 . LEU C 1 347 ? 16.410  91.558  112.582 1.00 20.00 ? 347  LEU C CD1 1 
ATOM   9920  C CD2 . LEU C 1 347 ? 17.024  89.268  113.381 1.00 20.00 ? 347  LEU C CD2 1 
ATOM   9921  N N   . ASP C 1 348 ? 13.826  89.575  117.111 1.00 20.00 ? 348  ASP C N   1 
ATOM   9922  C CA  . ASP C 1 348 ? 13.103  90.062  118.280 1.00 20.00 ? 348  ASP C CA  1 
ATOM   9923  C C   . ASP C 1 348 ? 13.480  91.525  118.500 1.00 20.00 ? 348  ASP C C   1 
ATOM   9924  O O   . ASP C 1 348 ? 14.473  91.825  119.170 1.00 20.00 ? 348  ASP C O   1 
ATOM   9925  C CB  . ASP C 1 348 ? 13.477  89.231  119.509 1.00 20.00 ? 348  ASP C CB  1 
ATOM   9926  C CG  . ASP C 1 348 ? 12.583  89.514  120.698 1.00 20.00 ? 348  ASP C CG  1 
ATOM   9927  O OD1 . ASP C 1 348 ? 11.943  90.584  120.715 1.00 20.00 ? 348  ASP C OD1 1 
ATOM   9928  O OD2 . ASP C 1 348 ? 12.523  88.671  121.615 1.00 20.00 ? 348  ASP C OD2 1 
ATOM   9929  N N   . ALA C 1 349 ? 12.684  92.430  117.932 1.00 20.00 ? 349  ALA C N   1 
ATOM   9930  C CA  . ALA C 1 349 ? 12.925  93.866  118.052 1.00 20.00 ? 349  ALA C CA  1 
ATOM   9931  C C   . ALA C 1 349 ? 13.000  94.356  119.495 1.00 20.00 ? 349  ALA C C   1 
ATOM   9932  O O   . ALA C 1 349 ? 13.701  95.317  119.803 1.00 20.00 ? 349  ALA C O   1 
ATOM   9933  C CB  . ALA C 1 349 ? 11.853  94.634  117.297 1.00 20.00 ? 349  ALA C CB  1 
ATOM   9934  N N   . ARG C 1 350 ? 12.273  93.697  120.381 1.00 20.00 ? 350  ARG C N   1 
ATOM   9935  C CA  . ARG C 1 350 ? 12.280  94.088  121.781 1.00 20.00 ? 350  ARG C CA  1 
ATOM   9936  C C   . ARG C 1 350 ? 13.671  93.924  122.377 1.00 20.00 ? 350  ARG C C   1 
ATOM   9937  O O   . ARG C 1 350 ? 14.211  94.849  122.978 1.00 20.00 ? 350  ARG C O   1 
ATOM   9938  C CB  . ARG C 1 350 ? 11.297  93.228  122.569 1.00 20.00 ? 350  ARG C CB  1 
ATOM   9939  C CG  . ARG C 1 350 ? 10.010  93.923  122.939 1.00 20.00 ? 350  ARG C CG  1 
ATOM   9940  C CD  . ARG C 1 350 ? 8.996   92.909  123.455 1.00 20.00 ? 350  ARG C CD  1 
ATOM   9941  N NE  . ARG C 1 350 ? 7.917   93.564  124.181 1.00 20.00 ? 350  ARG C NE  1 
ATOM   9942  C CZ  . ARG C 1 350 ? 6.627   93.463  123.882 1.00 20.00 ? 350  ARG C CZ  1 
ATOM   9943  N NH1 . ARG C 1 350 ? 6.221   92.724  122.858 1.00 20.00 ? 350  ARG C NH1 1 
ATOM   9944  N NH2 . ARG C 1 350 ? 5.739   94.120  124.612 1.00 20.00 ? 350  ARG C NH2 1 
ATOM   9945  N N   . ARG C 1 351 ? 14.244  92.737  122.212 1.00 20.00 ? 351  ARG C N   1 
ATOM   9946  C CA  . ARG C 1 351 ? 15.572  92.450  122.741 1.00 20.00 ? 351  ARG C CA  1 
ATOM   9947  C C   . ARG C 1 351 ? 16.660  93.108  121.913 1.00 20.00 ? 351  ARG C C   1 
ATOM   9948  O O   . ARG C 1 351 ? 17.758  93.350  122.401 1.00 20.00 ? 351  ARG C O   1 
ATOM   9949  C CB  . ARG C 1 351 ? 15.807  90.937  122.802 1.00 20.00 ? 351  ARG C CB  1 
ATOM   9950  C CG  . ARG C 1 351 ? 14.579  90.142  123.215 1.00 20.00 ? 351  ARG C CG  1 
ATOM   9951  C CD  . ARG C 1 351 ? 14.851  89.273  124.430 1.00 20.00 ? 351  ARG C CD  1 
ATOM   9952  N NE  . ARG C 1 351 ? 15.924  88.312  124.190 1.00 20.00 ? 351  ARG C NE  1 
ATOM   9953  C CZ  . ARG C 1 351 ? 15.825  87.249  123.394 1.00 20.00 ? 351  ARG C CZ  1 
ATOM   9954  N NH1 . ARG C 1 351 ? 14.695  86.988  122.743 1.00 20.00 ? 351  ARG C NH1 1 
ATOM   9955  N NH2 . ARG C 1 351 ? 16.864  86.440  123.253 1.00 20.00 ? 351  ARG C NH2 1 
ATOM   9956  N N   . PHE C 1 352 ? 16.354  93.396  120.657 1.00 20.00 ? 352  PHE C N   1 
ATOM   9957  C CA  . PHE C 1 352 ? 17.320  94.027  119.785 1.00 20.00 ? 352  PHE C CA  1 
ATOM   9958  C C   . PHE C 1 352 ? 17.523  95.460  120.265 1.00 20.00 ? 352  PHE C C   1 
ATOM   9959  O O   . PHE C 1 352 ? 18.651  95.936  120.373 1.00 20.00 ? 352  PHE C O   1 
ATOM   9960  C CB  . PHE C 1 352 ? 16.797  94.033  118.347 1.00 20.00 ? 352  PHE C CB  1 
ATOM   9961  C CG  . PHE C 1 352 ? 17.879  94.078  117.305 1.00 20.00 ? 352  PHE C CG  1 
ATOM   9962  C CD1 . PHE C 1 352 ? 18.567  95.261  117.048 1.00 20.00 ? 352  PHE C CD1 1 
ATOM   9963  C CD2 . PHE C 1 352 ? 18.221  92.935  116.589 1.00 20.00 ? 352  PHE C CD2 1 
ATOM   9964  C CE1 . PHE C 1 352 ? 19.582  95.308  116.097 1.00 20.00 ? 352  PHE C CE1 1 
ATOM   9965  C CE2 . PHE C 1 352 ? 19.238  92.968  115.633 1.00 20.00 ? 352  PHE C CE2 1 
ATOM   9966  C CZ  . PHE C 1 352 ? 19.920  94.157  115.387 1.00 20.00 ? 352  PHE C CZ  1 
ATOM   9967  N N   . CYS C 1 353 ? 16.424  96.141  120.570 1.00 20.00 ? 353  CYS C N   1 
ATOM   9968  C CA  . CYS C 1 353 ? 16.487  97.527  121.030 1.00 20.00 ? 353  CYS C CA  1 
ATOM   9969  C C   . CYS C 1 353 ? 15.980  97.745  122.448 1.00 20.00 ? 353  CYS C C   1 
ATOM   9970  O O   . CYS C 1 353 ? 14.891  98.276  122.646 1.00 20.00 ? 353  CYS C O   1 
ATOM   9971  C CB  . CYS C 1 353 ? 15.687  98.418  120.085 1.00 20.00 ? 353  CYS C CB  1 
ATOM   9972  S SG  . CYS C 1 353 ? 15.981  98.077  118.352 1.00 20.00 ? 353  CYS C SG  1 
ATOM   9973  N N   . PRO C 1 354 ? 16.772  97.353  123.452 1.00 20.00 ? 354  PRO C N   1 
ATOM   9974  C CA  . PRO C 1 354 ? 16.315  97.424  124.841 1.00 20.00 ? 354  PRO C CA  1 
ATOM   9975  C C   . PRO C 1 354 ? 16.225  98.859  125.343 1.00 20.00 ? 354  PRO C C   1 
ATOM   9976  O O   . PRO C 1 354 ? 15.696  99.112  126.420 1.00 20.00 ? 354  PRO C O   1 
ATOM   9977  C CB  . PRO C 1 354 ? 17.357  96.612  125.602 1.00 20.00 ? 354  PRO C CB  1 
ATOM   9978  C CG  . PRO C 1 354 ? 18.598  96.750  124.783 1.00 20.00 ? 354  PRO C CG  1 
ATOM   9979  C CD  . PRO C 1 354 ? 18.143  96.821  123.349 1.00 20.00 ? 354  PRO C CD  1 
ATOM   9980  N N   . HIS C 1 355 ? 16.736  99.791  124.545 1.00 20.00 ? 355  HIS C N   1 
ATOM   9981  C CA  . HIS C 1 355 ? 16.722  101.211 124.894 1.00 20.00 ? 355  HIS C CA  1 
ATOM   9982  C C   . HIS C 1 355 ? 15.460  101.912 124.409 1.00 20.00 ? 355  HIS C C   1 
ATOM   9983  O O   . HIS C 1 355 ? 15.270  103.103 124.647 1.00 20.00 ? 355  HIS C O   1 
ATOM   9984  C CB  . HIS C 1 355 ? 17.926  101.907 124.272 1.00 20.00 ? 355  HIS C CB  1 
ATOM   9985  C CG  . HIS C 1 355 ? 17.970  101.810 122.775 1.00 20.00 ? 355  HIS C CG  1 
ATOM   9986  N ND1 . HIS C 1 355 ? 17.946  100.605 122.106 1.00 20.00 ? 355  HIS C ND1 1 
ATOM   9987  C CD2 . HIS C 1 355 ? 18.042  102.768 121.820 1.00 20.00 ? 355  HIS C CD2 1 
ATOM   9988  C CE1 . HIS C 1 355 ? 18.001  100.824 120.805 1.00 20.00 ? 355  HIS C CE1 1 
ATOM   9989  N NE2 . HIS C 1 355 ? 18.059  102.128 120.605 1.00 20.00 ? 355  HIS C NE2 1 
ATOM   9990  N N   . LEU C 1 356 ? 14.600  101.162 123.732 1.00 20.00 ? 356  LEU C N   1 
ATOM   9991  C CA  . LEU C 1 356 ? 13.357  101.703 123.203 1.00 20.00 ? 356  LEU C CA  1 
ATOM   9992  C C   . LEU C 1 356 ? 12.134  101.022 123.810 1.00 20.00 ? 356  LEU C C   1 
ATOM   9993  O O   . LEU C 1 356 ? 12.170  99.835  124.128 1.00 20.00 ? 356  LEU C O   1 
ATOM   9994  C CB  . LEU C 1 356 ? 13.335  101.499 121.686 1.00 20.00 ? 356  LEU C CB  1 
ATOM   9995  C CG  . LEU C 1 356 ? 13.700  102.636 120.732 1.00 20.00 ? 356  LEU C CG  1 
ATOM   9996  C CD1 . LEU C 1 356 ? 14.861  103.425 121.270 1.00 20.00 ? 356  LEU C CD1 1 
ATOM   9997  C CD2 . LEU C 1 356 ? 14.034  102.044 119.372 1.00 20.00 ? 356  LEU C CD2 1 
ATOM   9998  N N   . THR C 1 357 ? 11.051  101.769 123.974 1.00 20.00 ? 357  THR C N   1 
ATOM   9999  C CA  . THR C 1 357 ? 9.837   101.193 124.533 1.00 20.00 ? 357  THR C CA  1 
ATOM   10000 C C   . THR C 1 357 ? 8.990   100.830 123.313 1.00 20.00 ? 357  THR C C   1 
ATOM   10001 O O   . THR C 1 357 ? 9.085   101.500 122.290 1.00 20.00 ? 357  THR C O   1 
ATOM   10002 C CB  . THR C 1 357 ? 9.096   102.207 125.430 1.00 20.00 ? 357  THR C CB  1 
ATOM   10003 O OG1 . THR C 1 357 ? 8.571   103.274 124.633 1.00 20.00 ? 357  THR C OG1 1 
ATOM   10004 C CG2 . THR C 1 357 ? 10.045  102.785 126.455 1.00 20.00 ? 357  THR C CG2 1 
ATOM   10005 N N   . GLN C 1 358 ? 8.182   99.775  123.398 1.00 20.00 ? 358  GLN C N   1 
ATOM   10006 C CA  . GLN C 1 358 ? 7.354   99.376  122.258 1.00 20.00 ? 358  GLN C CA  1 
ATOM   10007 C C   . GLN C 1 358 ? 6.598   100.542 121.636 1.00 20.00 ? 358  GLN C C   1 
ATOM   10008 O O   . GLN C 1 358 ? 6.309   100.538 120.442 1.00 20.00 ? 358  GLN C O   1 
ATOM   10009 C CB  . GLN C 1 358 ? 6.357   98.290  122.659 1.00 20.00 ? 358  GLN C CB  1 
ATOM   10010 C CG  . GLN C 1 358 ? 5.721   97.592  121.465 1.00 20.00 ? 358  GLN C CG  1 
ATOM   10011 C CD  . GLN C 1 358 ? 4.928   96.364  121.859 1.00 20.00 ? 358  GLN C CD  1 
ATOM   10012 O OE1 . GLN C 1 358 ? 4.449   96.259  122.986 1.00 20.00 ? 358  GLN C OE1 1 
ATOM   10013 N NE2 . GLN C 1 358 ? 4.785   95.427  120.931 1.00 20.00 ? 358  GLN C NE2 1 
ATOM   10014 N N   . ASP C 1 359 ? 6.290   101.545 122.446 1.00 20.00 ? 359  ASP C N   1 
ATOM   10015 C CA  . ASP C 1 359 ? 5.567   102.717 121.970 1.00 20.00 ? 359  ASP C CA  1 
ATOM   10016 C C   . ASP C 1 359 ? 6.389   103.572 121.009 1.00 20.00 ? 359  ASP C C   1 
ATOM   10017 O O   . ASP C 1 359 ? 5.862   104.459 120.343 1.00 20.00 ? 359  ASP C O   1 
ATOM   10018 C CB  . ASP C 1 359 ? 5.107   103.549 123.168 1.00 20.00 ? 359  ASP C CB  1 
ATOM   10019 C CG  . ASP C 1 359 ? 4.241   102.747 124.120 1.00 20.00 ? 359  ASP C CG  1 
ATOM   10020 O OD1 . ASP C 1 359 ? 3.105   102.394 123.733 1.00 20.00 ? 359  ASP C OD1 1 
ATOM   10021 O OD2 . ASP C 1 359 ? 4.700   102.461 125.246 1.00 20.00 ? 359  ASP C OD2 1 
ATOM   10022 N N   . GLN C 1 360 ? 7.686   103.300 120.943 1.00 20.00 ? 360  GLN C N   1 
ATOM   10023 C CA  . GLN C 1 360 ? 8.567   104.044 120.063 1.00 20.00 ? 360  GLN C CA  1 
ATOM   10024 C C   . GLN C 1 360 ? 8.817   103.232 118.806 1.00 20.00 ? 360  GLN C C   1 
ATOM   10025 O O   . GLN C 1 360 ? 9.712   103.532 118.024 1.00 20.00 ? 360  GLN C O   1 
ATOM   10026 C CB  . GLN C 1 360 ? 9.879   104.349 120.767 1.00 20.00 ? 360  GLN C CB  1 
ATOM   10027 C CG  . GLN C 1 360 ? 9.746   105.433 121.810 1.00 20.00 ? 360  GLN C CG  1 
ATOM   10028 C CD  . GLN C 1 360 ? 10.897  105.443 122.786 1.00 20.00 ? 360  GLN C CD  1 
ATOM   10029 O OE1 . GLN C 1 360 ? 11.344  104.395 123.258 1.00 20.00 ? 360  GLN C OE1 1 
ATOM   10030 N NE2 . GLN C 1 360 ? 11.384  106.631 123.101 1.00 20.00 ? 360  GLN C NE2 1 
ATOM   10031 N N   . PHE C 1 361 ? 8.022   102.181 118.637 1.00 20.00 ? 361  PHE C N   1 
ATOM   10032 C CA  . PHE C 1 361 ? 8.113   101.296 117.481 1.00 20.00 ? 361  PHE C CA  1 
ATOM   10033 C C   . PHE C 1 361 ? 9.501   100.774 117.175 1.00 20.00 ? 361  PHE C C   1 
ATOM   10034 O O   . PHE C 1 361 ? 10.087  101.117 116.151 1.00 20.00 ? 361  PHE C O   1 
ATOM   10035 C CB  . PHE C 1 361 ? 7.562   102.023 116.259 1.00 20.00 ? 361  PHE C CB  1 
ATOM   10036 C CG  . PHE C 1 361 ? 6.341   102.844 116.550 1.00 20.00 ? 361  PHE C CG  1 
ATOM   10037 C CD1 . PHE C 1 361 ? 5.272   102.296 117.251 1.00 20.00 ? 361  PHE C CD1 1 
ATOM   10038 C CD2 . PHE C 1 361 ? 6.259   104.164 116.126 1.00 20.00 ? 361  PHE C CD2 1 
ATOM   10039 C CE1 . PHE C 1 361 ? 4.144   103.048 117.521 1.00 20.00 ? 361  PHE C CE1 1 
ATOM   10040 C CE2 . PHE C 1 361 ? 5.132   104.930 116.391 1.00 20.00 ? 361  PHE C CE2 1 
ATOM   10041 C CZ  . PHE C 1 361 ? 4.072   104.372 117.089 1.00 20.00 ? 361  PHE C CZ  1 
ATOM   10042 N N   . PRO C 1 362 ? 10.039  99.917  118.050 1.00 20.00 ? 362  PRO C N   1 
ATOM   10043 C CA  . PRO C 1 362 ? 11.352  99.329  117.778 1.00 20.00 ? 362  PRO C CA  1 
ATOM   10044 C C   . PRO C 1 362 ? 11.427  98.506  116.479 1.00 20.00 ? 362  PRO C C   1 
ATOM   10045 O O   . PRO C 1 362 ? 12.357  98.680  115.700 1.00 20.00 ? 362  PRO C O   1 
ATOM   10046 C CB  . PRO C 1 362 ? 11.642  98.490  119.029 1.00 20.00 ? 362  PRO C CB  1 
ATOM   10047 C CG  . PRO C 1 362 ? 10.306  98.244  119.644 1.00 20.00 ? 362  PRO C CG  1 
ATOM   10048 C CD  . PRO C 1 362 ? 9.471   99.447  119.324 1.00 20.00 ? 362  PRO C CD  1 
ATOM   10049 N N   . ALA C 1 363 ? 10.458  97.625  116.236 1.00 20.00 ? 363  ALA C N   1 
ATOM   10050 C CA  . ALA C 1 363 ? 10.475  96.812  115.023 1.00 20.00 ? 363  ALA C CA  1 
ATOM   10051 C C   . ALA C 1 363 ? 10.436  97.653  113.735 1.00 20.00 ? 363  ALA C C   1 
ATOM   10052 O O   . ALA C 1 363 ? 11.127  97.354  112.759 1.00 20.00 ? 363  ALA C O   1 
ATOM   10053 C CB  . ALA C 1 363 ? 9.315   95.808  115.043 1.00 20.00 ? 363  ALA C CB  1 
ATOM   10054 N N   . GLN C 1 364 ? 9.626   98.701  113.731 1.00 20.00 ? 364  GLN C N   1 
ATOM   10055 C CA  . GLN C 1 364 ? 9.518   99.557  112.563 1.00 20.00 ? 364  GLN C CA  1 
ATOM   10056 C C   . GLN C 1 364 ? 10.846  100.262 112.310 1.00 20.00 ? 364  GLN C C   1 
ATOM   10057 O O   . GLN C 1 364 ? 11.276  100.391 111.168 1.00 20.00 ? 364  GLN C O   1 
ATOM   10058 C CB  . GLN C 1 364 ? 8.402   100.592 112.766 1.00 20.00 ? 364  GLN C CB  1 
ATOM   10059 C CG  . GLN C 1 364 ? 7.997   101.346 111.499 1.00 20.00 ? 364  GLN C CG  1 
ATOM   10060 C CD  . GLN C 1 364 ? 7.141   100.513 110.558 1.00 20.00 ? 364  GLN C CD  1 
ATOM   10061 O OE1 . GLN C 1 364 ? 6.050   100.064 110.915 1.00 20.00 ? 364  GLN C OE1 1 
ATOM   10062 N NE2 . GLN C 1 364 ? 7.635   100.307 109.345 1.00 20.00 ? 364  GLN C NE2 1 
ATOM   10063 N N   . SER C 1 365 ? 11.489  100.713 113.385 1.00 20.00 ? 365  SER C N   1 
ATOM   10064 C CA  . SER C 1 365 ? 12.770  101.408 113.287 1.00 20.00 ? 365  SER C CA  1 
ATOM   10065 C C   . SER C 1 365 ? 13.888  100.471 112.886 1.00 20.00 ? 365  SER C C   1 
ATOM   10066 O O   . SER C 1 365 ? 14.744  100.828 112.093 1.00 20.00 ? 365  SER C O   1 
ATOM   10067 C CB  . SER C 1 365 ? 13.129  102.057 114.614 1.00 20.00 ? 365  SER C CB  1 
ATOM   10068 O OG  . SER C 1 365 ? 14.148  103.013 114.406 1.00 20.00 ? 365  SER C OG  1 
ATOM   10069 N N   . LEU C 1 366 ? 13.889  99.276  113.461 1.00 20.00 ? 366  LEU C N   1 
ATOM   10070 C CA  . LEU C 1 366 ? 14.903  98.285  113.157 1.00 20.00 ? 366  LEU C CA  1 
ATOM   10071 C C   . LEU C 1 366 ? 14.848  98.010  111.655 1.00 20.00 ? 366  LEU C C   1 
ATOM   10072 O O   . LEU C 1 366 ? 15.880  97.956  110.984 1.00 20.00 ? 366  LEU C O   1 
ATOM   10073 C CB  . LEU C 1 366 ? 14.612  96.999  113.927 1.00 20.00 ? 366  LEU C CB  1 
ATOM   10074 C CG  . LEU C 1 366 ? 15.748  96.080  114.368 1.00 20.00 ? 366  LEU C CG  1 
ATOM   10075 C CD1 . LEU C 1 366 ? 15.248  94.662  114.287 1.00 20.00 ? 366  LEU C CD1 1 
ATOM   10076 C CD2 . LEU C 1 366 ? 16.992  96.260  113.515 1.00 20.00 ? 366  LEU C CD2 1 
ATOM   10077 N N   . ALA C 1 367 ? 13.633  97.851  111.136 1.00 20.00 ? 367  ALA C N   1 
ATOM   10078 C CA  . ALA C 1 367 ? 13.413  97.581  109.720 1.00 20.00 ? 367  ALA C CA  1 
ATOM   10079 C C   . ALA C 1 367 ? 13.946  98.695  108.826 1.00 20.00 ? 367  ALA C C   1 
ATOM   10080 O O   . ALA C 1 367 ? 14.530  98.424  107.779 1.00 20.00 ? 367  ALA C O   1 
ATOM   10081 C CB  . ALA C 1 367 ? 11.928  97.367  109.461 1.00 20.00 ? 367  ALA C CB  1 
ATOM   10082 N N   . ALA C 1 368 ? 13.730  99.946  109.225 1.00 20.00 ? 368  ALA C N   1 
ATOM   10083 C CA  . ALA C 1 368 ? 14.206  101.086 108.441 1.00 20.00 ? 368  ALA C CA  1 
ATOM   10084 C C   . ALA C 1 368 ? 15.727  101.086 108.421 1.00 20.00 ? 368  ALA C C   1 
ATOM   10085 O O   . ALA C 1 368 ? 16.350  101.351 107.396 1.00 20.00 ? 368  ALA C O   1 
ATOM   10086 C CB  . ALA C 1 368 ? 13.709  102.379 109.037 1.00 20.00 ? 368  ALA C CB  1 
ATOM   10087 N N   . SER C 1 369 ? 16.315  100.787 109.573 1.00 20.00 ? 369  SER C N   1 
ATOM   10088 C CA  . SER C 1 369 ? 17.760  100.743 109.723 1.00 20.00 ? 369  SER C CA  1 
ATOM   10089 C C   . SER C 1 369 ? 18.397  99.643  108.890 1.00 20.00 ? 369  SER C C   1 
ATOM   10090 O O   . SER C 1 369 ? 19.483  99.816  108.346 1.00 20.00 ? 369  SER C O   1 
ATOM   10091 C CB  . SER C 1 369 ? 18.123  100.534 111.193 1.00 20.00 ? 369  SER C CB  1 
ATOM   10092 O OG  . SER C 1 369 ? 18.211  101.781 111.857 1.00 20.00 ? 369  SER C OG  1 
ATOM   10093 N N   . ILE C 1 370 ? 17.722  98.506  108.795 1.00 20.00 ? 370  ILE C N   1 
ATOM   10094 C CA  . ILE C 1 370 ? 18.248  97.388  108.025 1.00 20.00 ? 370  ILE C CA  1 
ATOM   10095 C C   . ILE C 1 370 ? 18.351  97.770  106.552 1.00 20.00 ? 370  ILE C C   1 
ATOM   10096 O O   . ILE C 1 370 ? 19.302  97.395  105.878 1.00 20.00 ? 370  ILE C O   1 
ATOM   10097 C CB  . ILE C 1 370 ? 17.358  96.128  108.195 1.00 20.00 ? 370  ILE C CB  1 
ATOM   10098 C CG1 . ILE C 1 370 ? 17.619  95.491  109.565 1.00 20.00 ? 370  ILE C CG1 1 
ATOM   10099 C CG2 . ILE C 1 370 ? 17.670  95.104  107.107 1.00 20.00 ? 370  ILE C CG2 1 
ATOM   10100 C CD1 . ILE C 1 370 ? 16.598  94.449  109.968 1.00 20.00 ? 370  ILE C CD1 1 
ATOM   10101 N N   . TYR C 1 371 ? 17.375  98.524  106.054 1.00 20.00 ? 371  TYR C N   1 
ATOM   10102 C CA  . TYR C 1 371 ? 17.401  98.932  104.660 1.00 20.00 ? 371  TYR C CA  1 
ATOM   10103 C C   . TYR C 1 371 ? 18.484  99.974  104.396 1.00 20.00 ? 371  TYR C C   1 
ATOM   10104 O O   . TYR C 1 371 ? 19.274  99.819  103.472 1.00 20.00 ? 371  TYR C O   1 
ATOM   10105 C CB  . TYR C 1 371 ? 16.042  99.502  104.221 1.00 20.00 ? 371  TYR C CB  1 
ATOM   10106 C CG  . TYR C 1 371 ? 16.099  100.172 102.859 1.00 20.00 ? 371  TYR C CG  1 
ATOM   10107 C CD1 . TYR C 1 371 ? 16.108  99.414  101.684 1.00 20.00 ? 371  TYR C CD1 1 
ATOM   10108 C CD2 . TYR C 1 371 ? 16.198  101.560 102.747 1.00 20.00 ? 371  TYR C CD2 1 
ATOM   10109 C CE1 . TYR C 1 371 ? 16.219  100.022 100.432 1.00 20.00 ? 371  TYR C CE1 1 
ATOM   10110 C CE2 . TYR C 1 371 ? 16.311  102.181 101.503 1.00 20.00 ? 371  TYR C CE2 1 
ATOM   10111 C CZ  . TYR C 1 371 ? 16.323  101.408 100.349 1.00 20.00 ? 371  TYR C CZ  1 
ATOM   10112 O OH  . TYR C 1 371 ? 16.443  102.033 99.126  1.00 20.00 ? 371  TYR C OH  1 
ATOM   10113 N N   . MET C 1 372 ? 18.511  101.037 105.199 1.00 20.00 ? 372  MET C N   1 
ATOM   10114 C CA  . MET C 1 372 ? 19.501  102.107 105.041 1.00 20.00 ? 372  MET C CA  1 
ATOM   10115 C C   . MET C 1 372 ? 20.930  101.579 105.095 1.00 20.00 ? 372  MET C C   1 
ATOM   10116 O O   . MET C 1 372 ? 21.822  102.088 104.414 1.00 20.00 ? 372  MET C O   1 
ATOM   10117 C CB  . MET C 1 372 ? 19.320  103.177 106.127 1.00 20.00 ? 372  MET C CB  1 
ATOM   10118 C CG  . MET C 1 372 ? 18.042  104.004 106.001 1.00 20.00 ? 372  MET C CG  1 
ATOM   10119 S SD  . MET C 1 372 ? 17.928  105.376 107.183 1.00 20.00 ? 372  MET C SD  1 
ATOM   10120 C CE  . MET C 1 372 ? 17.137  104.583 108.542 1.00 20.00 ? 372  MET C CE  1 
ATOM   10121 N N   . GLU C 1 373 ? 21.136  100.544 105.897 1.00 20.00 ? 373  GLU C N   1 
ATOM   10122 C CA  . GLU C 1 373 ? 22.453  99.946  106.048 1.00 20.00 ? 373  GLU C CA  1 
ATOM   10123 C C   . GLU C 1 373 ? 22.817  98.863  105.028 1.00 20.00 ? 373  GLU C C   1 
ATOM   10124 O O   . GLU C 1 373 ? 23.969  98.764  104.611 1.00 20.00 ? 373  GLU C O   1 
ATOM   10125 C CB  . GLU C 1 373 ? 22.590  99.371  107.464 1.00 20.00 ? 373  GLU C CB  1 
ATOM   10126 C CG  . GLU C 1 373 ? 23.746  99.953  108.276 1.00 20.00 ? 373  GLU C CG  1 
ATOM   10127 C CD  . GLU C 1 373 ? 23.738  101.475 108.317 1.00 20.00 ? 373  GLU C CD  1 
ATOM   10128 O OE1 . GLU C 1 373 ? 22.758  102.056 108.833 1.00 20.00 ? 373  GLU C OE1 1 
ATOM   10129 O OE2 . GLU C 1 373 ? 24.713  102.093 107.833 1.00 20.00 ? 373  GLU C OE2 1 
ATOM   10130 N N   . THR C 1 374 ? 21.845  98.066  104.601 1.00 20.00 ? 374  THR C N   1 
ATOM   10131 C CA  . THR C 1 374 ? 22.138  97.007  103.646 1.00 20.00 ? 374  THR C CA  1 
ATOM   10132 C C   . THR C 1 374 ? 21.411  97.027  102.319 1.00 20.00 ? 374  THR C C   1 
ATOM   10133 O O   . THR C 1 374 ? 21.873  96.420  101.355 1.00 20.00 ? 374  THR C O   1 
ATOM   10134 C CB  . THR C 1 374 ? 21.863  95.655  104.275 1.00 20.00 ? 374  THR C CB  1 
ATOM   10135 O OG1 . THR C 1 374 ? 20.477  95.587  104.629 1.00 20.00 ? 374  THR C OG1 1 
ATOM   10136 C CG2 . THR C 1 374 ? 22.693  95.475  105.530 1.00 20.00 ? 374  THR C CG2 1 
ATOM   10137 N N   . GLY C 1 375 ? 20.270  97.695  102.259 1.00 20.00 ? 375  GLY C N   1 
ATOM   10138 C CA  . GLY C 1 375 ? 19.545  97.730  101.007 1.00 20.00 ? 375  GLY C CA  1 
ATOM   10139 C C   . GLY C 1 375 ? 18.551  96.588  100.918 1.00 20.00 ? 375  GLY C C   1 
ATOM   10140 O O   . GLY C 1 375 ? 18.023  96.307  99.843  1.00 20.00 ? 375  GLY C O   1 
ATOM   10141 N N   . VAL C 1 376 ? 18.313  95.906  102.037 1.00 20.00 ? 376  VAL C N   1 
ATOM   10142 C CA  . VAL C 1 376 ? 17.361  94.800  102.048 1.00 20.00 ? 376  VAL C CA  1 
ATOM   10143 C C   . VAL C 1 376 ? 16.112  95.266  102.790 1.00 20.00 ? 376  VAL C C   1 
ATOM   10144 O O   . VAL C 1 376 ? 16.202  95.944  103.817 1.00 20.00 ? 376  VAL C O   1 
ATOM   10145 C CB  . VAL C 1 376 ? 17.915  93.499  102.735 1.00 20.00 ? 376  VAL C CB  1 
ATOM   10146 C CG1 . VAL C 1 376 ? 19.409  93.584  102.938 1.00 20.00 ? 376  VAL C CG1 1 
ATOM   10147 C CG2 . VAL C 1 376 ? 17.196  93.239  104.041 1.00 20.00 ? 376  VAL C CG2 1 
ATOM   10148 N N   . ARG C 1 377 ? 14.946  94.923  102.259 1.00 20.00 ? 377  ARG C N   1 
ATOM   10149 C CA  . ARG C 1 377 ? 13.704  95.319  102.893 1.00 20.00 ? 377  ARG C CA  1 
ATOM   10150 C C   . ARG C 1 377 ? 13.151  94.169  103.706 1.00 20.00 ? 377  ARG C C   1 
ATOM   10151 O O   . ARG C 1 377 ? 13.172  93.016  103.269 1.00 20.00 ? 377  ARG C O   1 
ATOM   10152 C CB  . ARG C 1 377 ? 12.671  95.746  101.849 1.00 20.00 ? 377  ARG C CB  1 
ATOM   10153 C CG  . ARG C 1 377 ? 11.238  95.705  102.371 1.00 20.00 ? 377  ARG C CG  1 
ATOM   10154 C CD  . ARG C 1 377 ? 10.311  96.585  101.549 1.00 20.00 ? 377  ARG C CD  1 
ATOM   10155 N NE  . ARG C 1 377 ? 9.921   95.957  100.290 1.00 20.00 ? 377  ARG C NE  1 
ATOM   10156 C CZ  . ARG C 1 377 ? 9.150   96.544  99.386  1.00 20.00 ? 377  ARG C CZ  1 
ATOM   10157 N NH1 . ARG C 1 377 ? 8.695   97.764  99.610  1.00 20.00 ? 377  ARG C NH1 1 
ATOM   10158 N NH2 . ARG C 1 377 ? 8.847   95.924  98.256  1.00 20.00 ? 377  ARG C NH2 1 
ATOM   10159 N N   . SER C 1 378 ? 12.662  94.496  104.896 1.00 20.00 ? 378  SER C N   1 
ATOM   10160 C CA  . SER C 1 378 ? 12.089  93.514  105.797 1.00 20.00 ? 378  SER C CA  1 
ATOM   10161 C C   . SER C 1 378 ? 10.717  94.040  106.198 1.00 20.00 ? 378  SER C C   1 
ATOM   10162 O O   . SER C 1 378 ? 10.408  95.205  105.971 1.00 20.00 ? 378  SER C O   1 
ATOM   10163 C CB  . SER C 1 378 ? 12.971  93.347  107.036 1.00 20.00 ? 378  SER C CB  1 
ATOM   10164 O OG  . SER C 1 378 ? 13.304  94.608  107.593 1.00 20.00 ? 378  SER C OG  1 
ATOM   10165 N N   . MET C 1 379 ? 9.889   93.189  106.787 1.00 20.00 ? 379  MET C N   1 
ATOM   10166 C CA  . MET C 1 379 ? 8.569   93.634  107.187 1.00 20.00 ? 379  MET C CA  1 
ATOM   10167 C C   . MET C 1 379 ? 8.414   93.746  108.697 1.00 20.00 ? 379  MET C C   1 
ATOM   10168 O O   . MET C 1 379 ? 8.920   92.908  109.443 1.00 20.00 ? 379  MET C O   1 
ATOM   10169 C CB  . MET C 1 379 ? 7.516   92.677  106.643 1.00 20.00 ? 379  MET C CB  1 
ATOM   10170 C CG  . MET C 1 379 ? 6.140   93.308  106.519 1.00 20.00 ? 379  MET C CG  1 
ATOM   10171 S SD  . MET C 1 379 ? 4.862   92.084  106.275 1.00 20.00 ? 379  MET C SD  1 
ATOM   10172 C CE  . MET C 1 379 ? 5.372   90.906  107.477 1.00 20.00 ? 379  MET C CE  1 
ATOM   10173 N N   . GLU C 1 380 ? 7.731   94.789  109.160 1.00 20.00 ? 380  GLU C N   1 
ATOM   10174 C CA  . GLU C 1 380 ? 7.542   94.936  110.596 1.00 20.00 ? 380  GLU C CA  1 
ATOM   10175 C C   . GLU C 1 380 ? 6.311   94.132  110.989 1.00 20.00 ? 380  GLU C C   1 
ATOM   10176 O O   . GLU C 1 380 ? 5.267   94.190  110.337 1.00 20.00 ? 380  GLU C O   1 
ATOM   10177 C CB  . GLU C 1 380 ? 7.405   96.416  111.007 1.00 20.00 ? 380  GLU C CB  1 
ATOM   10178 C CG  . GLU C 1 380 ? 5.998   96.942  111.236 1.00 20.00 ? 380  GLU C CG  1 
ATOM   10179 C CD  . GLU C 1 380 ? 5.416   96.574  112.587 1.00 20.00 ? 380  GLU C CD  1 
ATOM   10180 O OE1 . GLU C 1 380 ? 5.822   97.148  113.620 1.00 20.00 ? 380  GLU C OE1 1 
ATOM   10181 O OE2 . GLU C 1 380 ? 4.531   95.702  112.605 1.00 20.00 ? 380  GLU C OE2 1 
ATOM   10182 N N   . ARG C 1 381 ? 6.466   93.336  112.037 1.00 20.00 ? 381  ARG C N   1 
ATOM   10183 C CA  . ARG C 1 381 ? 5.391   92.502  112.544 1.00 20.00 ? 381  ARG C CA  1 
ATOM   10184 C C   . ARG C 1 381 ? 5.346   92.776  114.034 1.00 20.00 ? 381  ARG C C   1 
ATOM   10185 O O   . ARG C 1 381 ? 5.716   91.926  114.838 1.00 20.00 ? 381  ARG C O   1 
ATOM   10186 C CB  . ARG C 1 381 ? 5.702   91.028  112.292 1.00 20.00 ? 381  ARG C CB  1 
ATOM   10187 C CG  . ARG C 1 381 ? 5.570   90.592  110.841 1.00 20.00 ? 381  ARG C CG  1 
ATOM   10188 C CD  . ARG C 1 381 ? 4.114   90.601  110.390 1.00 20.00 ? 381  ARG C CD  1 
ATOM   10189 N NE  . ARG C 1 381 ? 3.652   91.939  110.017 1.00 20.00 ? 381  ARG C NE  1 
ATOM   10190 C CZ  . ARG C 1 381 ? 2.614   92.183  109.221 1.00 20.00 ? 381  ARG C CZ  1 
ATOM   10191 N NH1 . ARG C 1 381 ? 1.917   91.181  108.703 1.00 20.00 ? 381  ARG C NH1 1 
ATOM   10192 N NH2 . ARG C 1 381 ? 2.269   93.434  108.944 1.00 20.00 ? 381  ARG C NH2 1 
ATOM   10193 N N   . GLY C 1 382 ? 4.913   93.985  114.385 1.00 20.00 ? 382  GLY C N   1 
ATOM   10194 C CA  . GLY C 1 382 ? 4.822   94.383  115.777 1.00 20.00 ? 382  GLY C CA  1 
ATOM   10195 C C   . GLY C 1 382 ? 3.646   95.297  116.065 1.00 20.00 ? 382  GLY C C   1 
ATOM   10196 O O   . GLY C 1 382 ? 2.579   95.145  115.475 1.00 20.00 ? 382  GLY C O   1 
ATOM   10197 N N   . ILE C 1 383 ? 3.848   96.256  116.962 1.00 20.00 ? 383  ILE C N   1 
ATOM   10198 C CA  . ILE C 1 383 ? 2.803   97.200  117.340 1.00 20.00 ? 383  ILE C CA  1 
ATOM   10199 C C   . ILE C 1 383 ? 2.180   97.996  116.190 1.00 20.00 ? 383  ILE C C   1 
ATOM   10200 O O   . ILE C 1 383 ? 0.969   98.231  116.183 1.00 20.00 ? 383  ILE C O   1 
ATOM   10201 C CB  . ILE C 1 383 ? 3.317   98.187  118.422 1.00 20.00 ? 383  ILE C CB  1 
ATOM   10202 C CG1 . ILE C 1 383 ? 2.191   99.129  118.851 1.00 20.00 ? 383  ILE C CG1 1 
ATOM   10203 C CG2 . ILE C 1 383 ? 4.491   98.985  117.890 1.00 20.00 ? 383  ILE C CG2 1 
ATOM   10204 C CD1 . ILE C 1 383 ? 2.557   100.043 120.001 1.00 20.00 ? 383  ILE C CD1 1 
ATOM   10205 N N   . VAL C 1 384 ? 2.986   98.415  115.219 1.00 20.00 ? 384  VAL C N   1 
ATOM   10206 C CA  . VAL C 1 384 ? 2.457   99.182  114.093 1.00 20.00 ? 384  VAL C CA  1 
ATOM   10207 C C   . VAL C 1 384 ? 1.458   98.348  113.287 1.00 20.00 ? 384  VAL C C   1 
ATOM   10208 O O   . VAL C 1 384 ? 0.364   98.818  112.960 1.00 20.00 ? 384  VAL C O   1 
ATOM   10209 C CB  . VAL C 1 384 ? 3.589   99.685  113.151 1.00 20.00 ? 384  VAL C CB  1 
ATOM   10210 C CG1 . VAL C 1 384 ? 2.995   100.466 111.990 1.00 20.00 ? 384  VAL C CG1 1 
ATOM   10211 C CG2 . VAL C 1 384 ? 4.548   100.567 113.914 1.00 20.00 ? 384  VAL C CG2 1 
ATOM   10212 N N   . SER C 1 385 ? 1.825   97.106  112.987 1.00 20.00 ? 385  SER C N   1 
ATOM   10213 C CA  . SER C 1 385 ? 0.961   96.217  112.224 1.00 20.00 ? 385  SER C CA  1 
ATOM   10214 C C   . SER C 1 385 ? -0.233  95.739  113.043 1.00 20.00 ? 385  SER C C   1 
ATOM   10215 O O   . SER C 1 385 ? -1.289  95.447  112.487 1.00 20.00 ? 385  SER C O   1 
ATOM   10216 C CB  . SER C 1 385 ? 1.755   95.014  111.727 1.00 20.00 ? 385  SER C CB  1 
ATOM   10217 O OG  . SER C 1 385 ? 2.674   95.400  110.721 1.00 20.00 ? 385  SER C OG  1 
ATOM   10218 N N   . ALA C 1 386 ? -0.059  95.661  114.360 1.00 20.00 ? 386  ALA C N   1 
ATOM   10219 C CA  . ALA C 1 386 ? -1.122  95.219  115.259 1.00 20.00 ? 386  ALA C CA  1 
ATOM   10220 C C   . ALA C 1 386 ? -2.273  96.224  115.247 1.00 20.00 ? 386  ALA C C   1 
ATOM   10221 O O   . ALA C 1 386 ? -3.431  95.864  115.461 1.00 20.00 ? 386  ALA C O   1 
ATOM   10222 C CB  . ALA C 1 386 ? -0.579  95.063  116.675 1.00 20.00 ? 386  ALA C CB  1 
ATOM   10223 N N   . GLY C 1 387 ? -1.944  97.487  115.000 1.00 20.00 ? 387  GLY C N   1 
ATOM   10224 C CA  . GLY C 1 387 ? -2.957  98.524  114.962 1.00 20.00 ? 387  GLY C CA  1 
ATOM   10225 C C   . GLY C 1 387 ? -3.384  99.010  116.332 1.00 20.00 ? 387  GLY C C   1 
ATOM   10226 O O   . GLY C 1 387 ? -2.752  98.697  117.340 1.00 20.00 ? 387  GLY C O   1 
ATOM   10227 N N   . ARG C 1 388 ? -4.457  99.793  116.365 1.00 20.00 ? 388  ARG C N   1 
ATOM   10228 C CA  . ARG C 1 388 ? -4.966  100.317 117.622 1.00 20.00 ? 388  ARG C CA  1 
ATOM   10229 C C   . ARG C 1 388 ? -6.419  99.901  117.797 1.00 20.00 ? 388  ARG C C   1 
ATOM   10230 O O   . ARG C 1 388 ? -7.162  99.805  116.823 1.00 20.00 ? 388  ARG C O   1 
ATOM   10231 C CB  . ARG C 1 388 ? -4.830  101.840 117.665 1.00 20.00 ? 388  ARG C CB  1 
ATOM   10232 C CG  . ARG C 1 388 ? -5.566  102.590 116.579 1.00 20.00 ? 388  ARG C CG  1 
ATOM   10233 C CD  . ARG C 1 388 ? -5.277  104.086 116.692 1.00 20.00 ? 388  ARG C CD  1 
ATOM   10234 N NE  . ARG C 1 388 ? -4.592  104.427 117.940 1.00 20.00 ? 388  ARG C NE  1 
ATOM   10235 C CZ  . ARG C 1 388 ? -3.469  105.139 118.021 1.00 20.00 ? 388  ARG C CZ  1 
ATOM   10236 N NH1 . ARG C 1 388 ? -2.886  105.599 116.925 1.00 20.00 ? 388  ARG C NH1 1 
ATOM   10237 N NH2 . ARG C 1 388 ? -2.927  105.397 119.204 1.00 20.00 ? 388  ARG C NH2 1 
ATOM   10238 N N   . SER C 1 389 ? -6.809  99.636  119.041 1.00 20.00 ? 389  SER C N   1 
ATOM   10239 C CA  . SER C 1 389 ? -8.170  99.221  119.359 1.00 20.00 ? 389  SER C CA  1 
ATOM   10240 C C   . SER C 1 389 ? -9.229  100.152 118.795 1.00 20.00 ? 389  SER C C   1 
ATOM   10241 O O   . SER C 1 389 ? -9.054  101.372 118.784 1.00 20.00 ? 389  SER C O   1 
ATOM   10242 C CB  . SER C 1 389 ? -8.357  99.129  120.871 1.00 20.00 ? 389  SER C CB  1 
ATOM   10243 O OG  . SER C 1 389 ? -9.574  99.747  121.264 1.00 20.00 ? 389  SER C OG  1 
ATOM   10244 N N   . LYS C 1 390 ? -10.333 99.568  118.338 1.00 20.00 ? 390  LYS C N   1 
ATOM   10245 C CA  . LYS C 1 390 ? -11.429 100.346 117.771 1.00 20.00 ? 390  LYS C CA  1 
ATOM   10246 C C   . LYS C 1 390 ? -12.151 101.111 118.874 1.00 20.00 ? 390  LYS C C   1 
ATOM   10247 O O   . LYS C 1 390 ? -12.435 102.304 118.730 1.00 20.00 ? 390  LYS C O   1 
ATOM   10248 C CB  . LYS C 1 390 ? -12.412 99.430  117.042 1.00 20.00 ? 390  LYS C CB  1 
ATOM   10249 C CG  . LYS C 1 390 ? -12.638 99.815  115.586 1.00 20.00 ? 390  LYS C CG  1 
ATOM   10250 C CD  . LYS C 1 390 ? -13.827 99.065  114.991 1.00 20.00 ? 390  LYS C CD  1 
ATOM   10251 C CE  . LYS C 1 390 ? -14.057 99.438  113.527 1.00 20.00 ? 390  LYS C CE  1 
ATOM   10252 N NZ  . LYS C 1 390 ? -15.452 99.137  113.073 1.00 20.00 ? 390  LYS C NZ  1 
ATOM   10253 N N   . GLU C 1 391 ? -12.443 100.421 119.975 1.00 20.00 ? 391  GLU C N   1 
ATOM   10254 C CA  . GLU C 1 391 ? -13.130 101.044 121.101 1.00 20.00 ? 391  GLU C CA  1 
ATOM   10255 C C   . GLU C 1 391 ? -12.193 101.986 121.856 1.00 20.00 ? 391  GLU C C   1 
ATOM   10256 O O   . GLU C 1 391 ? -12.326 103.208 121.759 1.00 20.00 ? 391  GLU C O   1 
ATOM   10257 C CB  . GLU C 1 391 ? -13.666 99.980  122.063 1.00 20.00 ? 391  GLU C CB  1 
ATOM   10258 C CG  . GLU C 1 391 ? -12.778 98.751  122.199 1.00 20.00 ? 391  GLU C CG  1 
ATOM   10259 C CD  . GLU C 1 391 ? -13.577 97.478  122.441 1.00 20.00 ? 391  GLU C CD  1 
ATOM   10260 O OE1 . GLU C 1 391 ? -14.680 97.563  123.029 1.00 20.00 ? 391  GLU C OE1 1 
ATOM   10261 O OE2 . GLU C 1 391 ? -13.101 96.393  122.042 1.00 20.00 ? 391  GLU C OE2 1 
ATOM   10262 N N   . THR C 1 392 ? -11.242 101.420 122.597 1.00 20.00 ? 392  THR C N   1 
ATOM   10263 C CA  . THR C 1 392 ? -10.296 102.230 123.359 1.00 20.00 ? 392  THR C CA  1 
ATOM   10264 C C   . THR C 1 392 ? -9.516  103.214 122.480 1.00 20.00 ? 392  THR C C   1 
ATOM   10265 O O   . THR C 1 392 ? -8.978  104.210 122.975 1.00 20.00 ? 392  THR C O   1 
ATOM   10266 C CB  . THR C 1 392 ? -9.303  101.334 124.145 1.00 20.00 ? 392  THR C CB  1 
ATOM   10267 O OG1 . THR C 1 392 ? -8.966  101.970 125.383 1.00 20.00 ? 392  THR C OG1 1 
ATOM   10268 C CG2 . THR C 1 392 ? -8.034  101.094 123.353 1.00 20.00 ? 392  THR C CG2 1 
ATOM   10269 N N   . GLY C 1 393 ? -9.470  102.936 121.178 1.00 20.00 ? 393  GLY C N   1 
ATOM   10270 C CA  . GLY C 1 393 ? -8.756  103.805 120.259 1.00 20.00 ? 393  GLY C CA  1 
ATOM   10271 C C   . GLY C 1 393 ? -7.285  103.920 120.618 1.00 20.00 ? 393  GLY C C   1 
ATOM   10272 O O   . GLY C 1 393 ? -6.665  104.970 120.432 1.00 20.00 ? 393  GLY C O   1 
ATOM   10273 N N   . GLU C 1 394 ? -6.723  102.834 121.137 1.00 20.00 ? 394  GLU C N   1 
ATOM   10274 C CA  . GLU C 1 394 ? -5.319  102.821 121.523 1.00 20.00 ? 394  GLU C CA  1 
ATOM   10275 C C   . GLU C 1 394 ? -4.568  101.674 120.872 1.00 20.00 ? 394  GLU C C   1 
ATOM   10276 O O   . GLU C 1 394 ? -5.155  100.653 120.517 1.00 20.00 ? 394  GLU C O   1 
ATOM   10277 C CB  . GLU C 1 394 ? -5.191  102.726 123.039 1.00 20.00 ? 394  GLU C CB  1 
ATOM   10278 C CG  . GLU C 1 394 ? -5.961  103.802 123.771 1.00 20.00 ? 394  GLU C CG  1 
ATOM   10279 C CD  . GLU C 1 394 ? -5.856  103.661 125.274 1.00 20.00 ? 394  GLU C CD  1 
ATOM   10280 O OE1 . GLU C 1 394 ? -5.951  102.513 125.767 1.00 20.00 ? 394  GLU C OE1 1 
ATOM   10281 O OE2 . GLU C 1 394 ? -5.678  104.695 125.961 1.00 20.00 ? 394  GLU C OE2 1 
ATOM   10282 N N   . ASN C 1 395 ? -3.262  101.860 120.723 1.00 20.00 ? 395  ASN C N   1 
ATOM   10283 C CA  . ASN C 1 395 ? -2.386  100.866 120.114 1.00 20.00 ? 395  ASN C CA  1 
ATOM   10284 C C   . ASN C 1 395 ? -2.432  99.521  120.820 1.00 20.00 ? 395  ASN C C   1 
ATOM   10285 O O   . ASN C 1 395 ? -2.476  99.452  122.052 1.00 20.00 ? 395  ASN C O   1 
ATOM   10286 C CB  . ASN C 1 395 ? -0.935  101.353 120.129 1.00 20.00 ? 395  ASN C CB  1 
ATOM   10287 C CG  . ASN C 1 395 ? -0.651  102.383 119.065 1.00 20.00 ? 395  ASN C CG  1 
ATOM   10288 O OD1 . ASN C 1 395 ? -1.192  102.320 117.963 1.00 20.00 ? 395  ASN C OD1 1 
ATOM   10289 N ND2 . ASN C 1 395 ? 0.209   103.340 119.387 1.00 20.00 ? 395  ASN C ND2 1 
ATOM   10290 N N   . HIS C 1 396 ? -2.432  98.452  120.033 1.00 20.00 ? 396  HIS C N   1 
ATOM   10291 C CA  . HIS C 1 396 ? -2.456  97.120  120.599 1.00 20.00 ? 396  HIS C CA  1 
ATOM   10292 C C   . HIS C 1 396 ? -0.983  96.891  120.919 1.00 20.00 ? 396  HIS C C   1 
ATOM   10293 O O   . HIS C 1 396 ? -0.112  97.345  120.175 1.00 20.00 ? 396  HIS C O   1 
ATOM   10294 C CB  . HIS C 1 396 ? -2.946  96.103  119.570 1.00 20.00 ? 396  HIS C CB  1 
ATOM   10295 C CG  . HIS C 1 396 ? -4.400  96.234  119.240 1.00 20.00 ? 396  HIS C CG  1 
ATOM   10296 N ND1 . HIS C 1 396 ? -4.899  96.011  117.975 1.00 20.00 ? 396  HIS C ND1 1 
ATOM   10297 C CD2 . HIS C 1 396 ? -5.462  96.580  120.007 1.00 20.00 ? 396  HIS C CD2 1 
ATOM   10298 C CE1 . HIS C 1 396 ? -6.205  96.214  117.976 1.00 20.00 ? 396  HIS C CE1 1 
ATOM   10299 N NE2 . HIS C 1 396 ? -6.571  96.561  119.197 1.00 20.00 ? 396  HIS C NE2 1 
ATOM   10300 N N   . ARG C 1 397 ? -0.699  96.217  122.027 1.00 20.00 ? 397  ARG C N   1 
ATOM   10301 C CA  . ARG C 1 397 ? 0.681   95.957  122.407 1.00 20.00 ? 397  ARG C CA  1 
ATOM   10302 C C   . ARG C 1 397 ? 1.024   94.481  122.244 1.00 20.00 ? 397  ARG C C   1 
ATOM   10303 O O   . ARG C 1 397 ? 1.115   93.744  123.224 1.00 20.00 ? 397  ARG C O   1 
ATOM   10304 C CB  . ARG C 1 397 ? 0.911   96.383  123.857 1.00 20.00 ? 397  ARG C CB  1 
ATOM   10305 C CG  . ARG C 1 397 ? 0.701   97.865  124.122 1.00 20.00 ? 397  ARG C CG  1 
ATOM   10306 C CD  . ARG C 1 397 ? 2.030   98.575  124.319 1.00 20.00 ? 397  ARG C CD  1 
ATOM   10307 N NE  . ARG C 1 397 ? 1.970   99.638  125.321 1.00 20.00 ? 397  ARG C NE  1 
ATOM   10308 C CZ  . ARG C 1 397 ? 1.164   100.697 125.261 1.00 20.00 ? 397  ARG C CZ  1 
ATOM   10309 N NH1 . ARG C 1 397 ? 0.327   100.856 124.242 1.00 20.00 ? 397  ARG C NH1 1 
ATOM   10310 N NH2 . ARG C 1 397 ? 1.204   101.613 126.220 1.00 20.00 ? 397  ARG C NH2 1 
ATOM   10311 N N   . PRO C 1 398 ? 1.222   94.027  120.999 1.00 20.00 ? 398  PRO C N   1 
ATOM   10312 C CA  . PRO C 1 398 ? 1.423   92.596  120.749 1.00 20.00 ? 398  PRO C CA  1 
ATOM   10313 C C   . PRO C 1 398 ? 2.558   91.996  121.579 1.00 20.00 ? 398  PRO C C   1 
ATOM   10314 O O   . PRO C 1 398 ? 3.527   92.677  121.905 1.00 20.00 ? 398  PRO C O   1 
ATOM   10315 C CB  . PRO C 1 398 ? 1.708   92.523  119.245 1.00 20.00 ? 398  PRO C CB  1 
ATOM   10316 C CG  . PRO C 1 398 ? 2.065   93.931  118.846 1.00 20.00 ? 398  PRO C CG  1 
ATOM   10317 C CD  . PRO C 1 398 ? 1.280   94.814  119.757 1.00 20.00 ? 398  PRO C CD  1 
ATOM   10318 N N   . LYS C 1 399 ? 2.425   90.717  121.914 1.00 20.00 ? 399  LYS C N   1 
ATOM   10319 C CA  . LYS C 1 399 ? 3.425   90.011  122.702 1.00 20.00 ? 399  LYS C CA  1 
ATOM   10320 C C   . LYS C 1 399 ? 4.783   90.040  122.017 1.00 20.00 ? 399  LYS C C   1 
ATOM   10321 O O   . LYS C 1 399 ? 5.806   90.264  122.659 1.00 20.00 ? 399  LYS C O   1 
ATOM   10322 C CB  . LYS C 1 399 ? 3.003   88.556  122.908 1.00 20.00 ? 399  LYS C CB  1 
ATOM   10323 C CG  . LYS C 1 399 ? 2.137   88.329  124.126 1.00 20.00 ? 399  LYS C CG  1 
ATOM   10324 C CD  . LYS C 1 399 ? 2.845   87.432  125.130 1.00 20.00 ? 399  LYS C CD  1 
ATOM   10325 C CE  . LYS C 1 399 ? 2.103   87.377  126.464 1.00 20.00 ? 399  LYS C CE  1 
ATOM   10326 N NZ  . LYS C 1 399 ? 2.419   86.127  127.223 1.00 20.00 ? 399  LYS C NZ  1 
ATOM   10327 N N   . LEU C 1 400 ? 4.796   89.804  120.711 1.00 20.00 ? 400  LEU C N   1 
ATOM   10328 C CA  . LEU C 1 400 ? 6.052   89.814  119.988 1.00 20.00 ? 400  LEU C CA  1 
ATOM   10329 C C   . LEU C 1 400 ? 6.209   90.999  119.058 1.00 20.00 ? 400  LEU C C   1 
ATOM   10330 O O   . LEU C 1 400 ? 5.393   91.228  118.165 1.00 20.00 ? 400  LEU C O   1 
ATOM   10331 C CB  . LEU C 1 400 ? 6.226   88.522  119.193 1.00 20.00 ? 400  LEU C CB  1 
ATOM   10332 C CG  . LEU C 1 400 ? 4.964   87.714  118.920 1.00 20.00 ? 400  LEU C CG  1 
ATOM   10333 C CD1 . LEU C 1 400 ? 4.070   88.486  117.973 1.00 20.00 ? 400  LEU C CD1 1 
ATOM   10334 C CD2 . LEU C 1 400 ? 5.342   86.368  118.332 1.00 20.00 ? 400  LEU C CD2 1 
ATOM   10335 N N   . GLU C 1 401 ? 7.271   91.756  119.299 1.00 20.00 ? 401  GLU C N   1 
ATOM   10336 C CA  . GLU C 1 401 ? 7.603   92.932  118.516 1.00 20.00 ? 401  GLU C CA  1 
ATOM   10337 C C   . GLU C 1 401 ? 8.748   92.424  117.643 1.00 20.00 ? 401  GLU C C   1 
ATOM   10338 O O   . GLU C 1 401 ? 9.909   92.419  118.060 1.00 20.00 ? 401  GLU C O   1 
ATOM   10339 C CB  . GLU C 1 401 ? 8.069   94.050  119.449 1.00 20.00 ? 401  GLU C CB  1 
ATOM   10340 C CG  . GLU C 1 401 ? 8.571   95.282  118.746 1.00 20.00 ? 401  GLU C CG  1 
ATOM   10341 C CD  . GLU C 1 401 ? 7.461   96.208  118.292 1.00 20.00 ? 401  GLU C CD  1 
ATOM   10342 O OE1 . GLU C 1 401 ? 6.267   95.857  118.434 1.00 20.00 ? 401  GLU C OE1 1 
ATOM   10343 O OE2 . GLU C 1 401 ? 7.793   97.297  117.786 1.00 20.00 ? 401  GLU C OE2 1 
ATOM   10344 N N   . THR C 1 402 ? 8.414   91.984  116.432 1.00 20.00 ? 402  THR C N   1 
ATOM   10345 C CA  . THR C 1 402 ? 9.421   91.461  115.514 1.00 20.00 ? 402  THR C CA  1 
ATOM   10346 C C   . THR C 1 402 ? 9.548   92.118  114.143 1.00 20.00 ? 402  THR C C   1 
ATOM   10347 O O   . THR C 1 402 ? 8.741   92.956  113.743 1.00 20.00 ? 402  THR C O   1 
ATOM   10348 C CB  . THR C 1 402 ? 9.189   89.959  115.267 1.00 20.00 ? 402  THR C CB  1 
ATOM   10349 O OG1 . THR C 1 402 ? 8.035   89.790  114.438 1.00 20.00 ? 402  THR C OG1 1 
ATOM   10350 C CG2 . THR C 1 402 ? 8.956   89.224  116.583 1.00 20.00 ? 402  THR C CG2 1 
ATOM   10351 N N   . VAL C 1 403 ? 10.599  91.716  113.441 1.00 20.00 ? 403  VAL C N   1 
ATOM   10352 C CA  . VAL C 1 403 ? 10.901  92.199  112.110 1.00 20.00 ? 403  VAL C CA  1 
ATOM   10353 C C   . VAL C 1 403 ? 11.045  90.874  111.384 1.00 20.00 ? 403  VAL C C   1 
ATOM   10354 O O   . VAL C 1 403 ? 11.818  90.021  111.795 1.00 20.00 ? 403  VAL C O   1 
ATOM   10355 C CB  . VAL C 1 403 ? 12.232  92.976  112.059 1.00 20.00 ? 403  VAL C CB  1 
ATOM   10356 C CG1 . VAL C 1 403 ? 12.640  93.221  110.625 1.00 20.00 ? 403  VAL C CG1 1 
ATOM   10357 C CG2 . VAL C 1 403 ? 12.080  94.295  112.758 1.00 20.00 ? 403  VAL C CG2 1 
ATOM   10358 N N   . ARG C 1 404 ? 10.296  90.694  110.311 1.00 20.00 ? 404  ARG C N   1 
ATOM   10359 C CA  . ARG C 1 404 ? 10.357  89.450  109.558 1.00 20.00 ? 404  ARG C CA  1 
ATOM   10360 C C   . ARG C 1 404 ? 11.214  89.505  108.293 1.00 20.00 ? 404  ARG C C   1 
ATOM   10361 O O   . ARG C 1 404 ? 11.096  90.433  107.486 1.00 20.00 ? 404  ARG C O   1 
ATOM   10362 C CB  . ARG C 1 404 ? 8.931   89.017  109.197 1.00 20.00 ? 404  ARG C CB  1 
ATOM   10363 C CG  . ARG C 1 404 ? 8.832   87.654  108.574 1.00 20.00 ? 404  ARG C CG  1 
ATOM   10364 C CD  . ARG C 1 404 ? 7.415   87.388  108.090 1.00 20.00 ? 404  ARG C CD  1 
ATOM   10365 N NE  . ARG C 1 404 ? 7.119   88.060  106.830 1.00 20.00 ? 404  ARG C NE  1 
ATOM   10366 C CZ  . ARG C 1 404 ? 5.895   88.177  106.326 1.00 20.00 ? 404  ARG C CZ  1 
ATOM   10367 N NH1 . ARG C 1 404 ? 4.856   87.668  106.976 1.00 20.00 ? 404  ARG C NH1 1 
ATOM   10368 N NH2 . ARG C 1 404 ? 5.707   88.795  105.171 1.00 20.00 ? 404  ARG C NH2 1 
ATOM   10369 N N   . LEU C 1 405 ? 12.087  88.510  108.147 1.00 20.00 ? 405  LEU C N   1 
ATOM   10370 C CA  . LEU C 1 405 ? 12.972  88.399  106.993 1.00 20.00 ? 405  LEU C CA  1 
ATOM   10371 C C   . LEU C 1 405 ? 12.433  87.169  106.270 1.00 20.00 ? 405  LEU C C   1 
ATOM   10372 O O   . LEU C 1 405 ? 12.796  86.035  106.588 1.00 20.00 ? 405  LEU C O   1 
ATOM   10373 C CB  . LEU C 1 405 ? 14.426  88.182  107.438 1.00 20.00 ? 405  LEU C CB  1 
ATOM   10374 C CG  . LEU C 1 405 ? 15.043  89.269  108.333 1.00 20.00 ? 405  LEU C CG  1 
ATOM   10375 C CD1 . LEU C 1 405 ? 16.169  88.669  109.147 1.00 20.00 ? 405  LEU C CD1 1 
ATOM   10376 C CD2 . LEU C 1 405 ? 15.548  90.422  107.497 1.00 20.00 ? 405  LEU C CD2 1 
ATOM   10377 N N   . THR C 1 406 ? 11.541  87.406  105.312 1.00 20.00 ? 406  THR C N   1 
ATOM   10378 C CA  . THR C 1 406 ? 10.914  86.343  104.531 1.00 20.00 ? 406  THR C CA  1 
ATOM   10379 C C   . THR C 1 406 ? 11.693  86.043  103.256 1.00 20.00 ? 406  THR C C   1 
ATOM   10380 O O   . THR C 1 406 ? 11.954  86.929  102.454 1.00 20.00 ? 406  THR C O   1 
ATOM   10381 C CB  . THR C 1 406 ? 9.458   86.741  104.209 1.00 20.00 ? 406  THR C CB  1 
ATOM   10382 O OG1 . THR C 1 406 ? 9.112   87.895  104.985 1.00 20.00 ? 406  THR C OG1 1 
ATOM   10383 C CG2 . THR C 1 406 ? 8.498   85.625  104.572 1.00 20.00 ? 406  THR C CG2 1 
ATOM   10384 N N   . ILE C 1 407 ? 12.050  84.776  103.073 1.00 20.00 ? 407  ILE C N   1 
ATOM   10385 C CA  . ILE C 1 407 ? 12.813  84.339  101.906 1.00 20.00 ? 407  ILE C CA  1 
ATOM   10386 C C   . ILE C 1 407 ? 12.022  83.731  100.750 1.00 20.00 ? 407  ILE C C   1 
ATOM   10387 O O   . ILE C 1 407 ? 11.465  82.639  100.859 1.00 20.00 ? 407  ILE C O   1 
ATOM   10388 C CB  . ILE C 1 407 ? 13.899  83.325  102.324 1.00 20.00 ? 407  ILE C CB  1 
ATOM   10389 C CG1 . ILE C 1 407 ? 14.468  83.694  103.700 1.00 20.00 ? 407  ILE C CG1 1 
ATOM   10390 C CG2 . ILE C 1 407 ? 14.998  83.284  101.272 1.00 20.00 ? 407  ILE C CG2 1 
ATOM   10391 C CD1 . ILE C 1 407 ? 15.110  85.072  103.756 1.00 20.00 ? 407  ILE C CD1 1 
ATOM   10392 N N   . PRO C 1 408 ? 11.985  84.429  99.609  1.00 20.00 ? 408  PRO C N   1 
ATOM   10393 C CA  . PRO C 1 408 ? 11.359  83.846  98.427  1.00 20.00 ? 408  PRO C CA  1 
ATOM   10394 C C   . PRO C 1 408 ? 12.104  82.582  97.990  1.00 20.00 ? 408  PRO C C   1 
ATOM   10395 O O   . PRO C 1 408 ? 13.276  82.394  98.314  1.00 20.00 ? 408  PRO C O   1 
ATOM   10396 C CB  . PRO C 1 408 ? 11.431  84.973  97.397  1.00 20.00 ? 408  PRO C CB  1 
ATOM   10397 C CG  . PRO C 1 408 ? 11.647  86.232  98.210  1.00 20.00 ? 408  PRO C CG  1 
ATOM   10398 C CD  . PRO C 1 408 ? 12.496  85.784  99.345  1.00 20.00 ? 408  PRO C CD  1 
ATOM   10399 N N   . ARG C 1 409 ? 11.425  81.714  97.256  1.00 20.00 ? 409  ARG C N   1 
ATOM   10400 C CA  . ARG C 1 409 ? 12.049  80.488  96.801  1.00 20.00 ? 409  ARG C CA  1 
ATOM   10401 C C   . ARG C 1 409 ? 12.810  80.665  95.500  1.00 20.00 ? 409  ARG C C   1 
ATOM   10402 O O   . ARG C 1 409 ? 12.306  81.281  94.564  1.00 20.00 ? 409  ARG C O   1 
ATOM   10403 C CB  . ARG C 1 409 ? 10.983  79.409  96.648  1.00 20.00 ? 409  ARG C CB  1 
ATOM   10404 C CG  . ARG C 1 409 ? 10.263  79.106  97.952  1.00 20.00 ? 409  ARG C CG  1 
ATOM   10405 C CD  . ARG C 1 409 ? 8.828   78.662  97.736  1.00 20.00 ? 409  ARG C CD  1 
ATOM   10406 N NE  . ARG C 1 409 ? 8.104   78.589  99.004  1.00 20.00 ? 409  ARG C NE  1 
ATOM   10407 C CZ  . ARG C 1 409 ? 7.491   79.627  99.566  1.00 20.00 ? 409  ARG C CZ  1 
ATOM   10408 N NH1 . ARG C 1 409 ? 7.511   80.811  98.970  1.00 20.00 ? 409  ARG C NH1 1 
ATOM   10409 N NH2 . ARG C 1 409 ? 6.877   79.487  100.734 1.00 20.00 ? 409  ARG C NH2 1 
ATOM   10410 N N   . ARG C 1 410 ? 14.041  80.147  95.489  1.00 20.00 ? 410  ARG C N   1 
ATOM   10411 C CA  . ARG C 1 410 ? 14.961  80.180  94.352  1.00 20.00 ? 410  ARG C CA  1 
ATOM   10412 C C   . ARG C 1 410 ? 15.361  81.550  93.795  1.00 20.00 ? 410  ARG C C   1 
ATOM   10413 O O   . ARG C 1 410 ? 15.744  81.666  92.628  1.00 20.00 ? 410  ARG C O   1 
ATOM   10414 C CB  . ARG C 1 410 ? 14.390  79.315  93.225  1.00 20.00 ? 410  ARG C CB  1 
ATOM   10415 C CG  . ARG C 1 410 ? 13.830  77.977  93.698  1.00 20.00 ? 410  ARG C CG  1 
ATOM   10416 C CD  . ARG C 1 410 ? 13.595  77.002  92.530  1.00 20.00 ? 410  ARG C CD  1 
ATOM   10417 N NE  . ARG C 1 410 ? 12.497  77.416  91.658  1.00 20.00 ? 410  ARG C NE  1 
ATOM   10418 C CZ  . ARG C 1 410 ? 11.826  76.603  90.849  1.00 20.00 ? 410  ARG C CZ  1 
ATOM   10419 N NH1 . ARG C 1 410 ? 12.131  75.315  90.787  1.00 20.00 ? 410  ARG C NH1 1 
ATOM   10420 N NH2 . ARG C 1 410 ? 10.853  77.086  90.092  1.00 20.00 ? 410  ARG C NH2 1 
ATOM   10421 N N   . VAL C 1 411 ? 15.321  82.576  94.633  1.00 20.00 ? 411  VAL C N   1 
ATOM   10422 C CA  . VAL C 1 411 ? 15.671  83.918  94.191  1.00 20.00 ? 411  VAL C CA  1 
ATOM   10423 C C   . VAL C 1 411 ? 17.008  84.456  94.696  1.00 20.00 ? 411  VAL C C   1 
ATOM   10424 O O   . VAL C 1 411 ? 17.657  85.246  94.021  1.00 20.00 ? 411  VAL C O   1 
ATOM   10425 C CB  . VAL C 1 411 ? 14.572  84.914  94.609  1.00 20.00 ? 411  VAL C CB  1 
ATOM   10426 C CG1 . VAL C 1 411 ? 14.889  86.304  94.092  1.00 20.00 ? 411  VAL C CG1 1 
ATOM   10427 C CG2 . VAL C 1 411 ? 13.221  84.438  94.090  1.00 20.00 ? 411  VAL C CG2 1 
ATOM   10428 N N   . TYR C 1 412 ? 17.429  84.023  95.874  1.00 20.00 ? 412  TYR C N   1 
ATOM   10429 C CA  . TYR C 1 412 ? 18.682  84.506  96.421  1.00 20.00 ? 412  TYR C CA  1 
ATOM   10430 C C   . TYR C 1 412 ? 19.723  83.426  96.682  1.00 20.00 ? 412  TYR C C   1 
ATOM   10431 O O   . TYR C 1 412 ? 19.422  82.236  96.621  1.00 20.00 ? 412  TYR C O   1 
ATOM   10432 C CB  . TYR C 1 412 ? 18.376  85.278  97.700  1.00 20.00 ? 412  TYR C CB  1 
ATOM   10433 C CG  . TYR C 1 412 ? 17.483  86.473  97.456  1.00 20.00 ? 412  TYR C CG  1 
ATOM   10434 C CD1 . TYR C 1 412 ? 17.976  87.612  96.827  1.00 20.00 ? 412  TYR C CD1 1 
ATOM   10435 C CD2 . TYR C 1 412 ? 16.136  86.460  97.826  1.00 20.00 ? 412  TYR C CD2 1 
ATOM   10436 C CE1 . TYR C 1 412 ? 17.157  88.706  96.567  1.00 20.00 ? 412  TYR C CE1 1 
ATOM   10437 C CE2 . TYR C 1 412 ? 15.302  87.562  97.566  1.00 20.00 ? 412  TYR C CE2 1 
ATOM   10438 C CZ  . TYR C 1 412 ? 15.827  88.676  96.935  1.00 20.00 ? 412  TYR C CZ  1 
ATOM   10439 O OH  . TYR C 1 412 ? 15.033  89.773  96.663  1.00 20.00 ? 412  TYR C OH  1 
ATOM   10440 N N   . THR C 1 413 ? 20.951  83.862  96.954  1.00 20.00 ? 413  THR C N   1 
ATOM   10441 C CA  . THR C 1 413 ? 22.067  82.958  97.234  1.00 20.00 ? 413  THR C CA  1 
ATOM   10442 C C   . THR C 1 413 ? 22.529  83.128  98.689  1.00 20.00 ? 413  THR C C   1 
ATOM   10443 O O   . THR C 1 413 ? 22.002  83.972  99.420  1.00 20.00 ? 413  THR C O   1 
ATOM   10444 C CB  . THR C 1 413 ? 23.265  83.245  96.295  1.00 20.00 ? 413  THR C CB  1 
ATOM   10445 O OG1 . THR C 1 413 ? 23.843  84.511  96.632  1.00 20.00 ? 413  THR C OG1 1 
ATOM   10446 C CG2 . THR C 1 413 ? 22.804  83.296  94.847  1.00 20.00 ? 413  THR C CG2 1 
ATOM   10447 N N   . TYR C 1 414 ? 23.499  82.318  99.113  1.00 20.00 ? 414  TYR C N   1 
ATOM   10448 C CA  . TYR C 1 414 ? 24.019  82.397  100.482 1.00 20.00 ? 414  TYR C CA  1 
ATOM   10449 C C   . TYR C 1 414 ? 24.777  83.702  100.654 1.00 20.00 ? 414  TYR C C   1 
ATOM   10450 O O   . TYR C 1 414 ? 24.915  84.202  101.764 1.00 20.00 ? 414  TYR C O   1 
ATOM   10451 C CB  . TYR C 1 414 ? 24.984  81.247  100.766 1.00 20.00 ? 414  TYR C CB  1 
ATOM   10452 C CG  . TYR C 1 414 ? 24.338  79.904  100.972 1.00 20.00 ? 414  TYR C CG  1 
ATOM   10453 C CD1 . TYR C 1 414 ? 23.455  79.685  102.023 1.00 20.00 ? 414  TYR C CD1 1 
ATOM   10454 C CD2 . TYR C 1 414 ? 24.626  78.842  100.124 1.00 20.00 ? 414  TYR C CD2 1 
ATOM   10455 C CE1 . TYR C 1 414 ? 22.873  78.434  102.222 1.00 20.00 ? 414  TYR C CE1 1 
ATOM   10456 C CE2 . TYR C 1 414 ? 24.052  77.592  100.314 1.00 20.00 ? 414  TYR C CE2 1 
ATOM   10457 C CZ  . TYR C 1 414 ? 23.176  77.396  101.364 1.00 20.00 ? 414  TYR C CZ  1 
ATOM   10458 O OH  . TYR C 1 414 ? 22.590  76.162  101.538 1.00 20.00 ? 414  TYR C OH  1 
ATOM   10459 N N   . ALA C 1 415 ? 25.294  84.234  99.546  1.00 20.00 ? 415  ALA C N   1 
ATOM   10460 C CA  . ALA C 1 415 ? 26.047  85.488  99.557  1.00 20.00 ? 415  ALA C CA  1 
ATOM   10461 C C   . ALA C 1 415 ? 25.088  86.636  99.848  1.00 20.00 ? 415  ALA C C   1 
ATOM   10462 O O   . ALA C 1 415 ? 25.461  87.631  100.474 1.00 20.00 ? 415  ALA C O   1 
ATOM   10463 C CB  . ALA C 1 415 ? 26.746  85.700  98.209  1.00 20.00 ? 415  ALA C CB  1 
ATOM   10464 N N   . HIS C 1 416 ? 23.853  86.506  99.376  1.00 20.00 ? 416  HIS C N   1 
ATOM   10465 C CA  . HIS C 1 416 ? 22.859  87.536  99.608  1.00 20.00 ? 416  HIS C CA  1 
ATOM   10466 C C   . HIS C 1 416 ? 22.493  87.440  101.082 1.00 20.00 ? 416  HIS C C   1 
ATOM   10467 O O   . HIS C 1 416 ? 22.247  88.451  101.728 1.00 20.00 ? 416  HIS C O   1 
ATOM   10468 C CB  . HIS C 1 416 ? 21.621  87.292  98.745  1.00 20.00 ? 416  HIS C CB  1 
ATOM   10469 C CG  . HIS C 1 416 ? 21.813  87.659  97.307  1.00 20.00 ? 416  HIS C CG  1 
ATOM   10470 N ND1 . HIS C 1 416 ? 21.390  86.859  96.269  1.00 20.00 ? 416  HIS C ND1 1 
ATOM   10471 C CD2 . HIS C 1 416 ? 22.407  88.733  96.735  1.00 20.00 ? 416  HIS C CD2 1 
ATOM   10472 C CE1 . HIS C 1 416 ? 21.714  87.423  95.119  1.00 20.00 ? 416  HIS C CE1 1 
ATOM   10473 N NE2 . HIS C 1 416 ? 22.333  88.562  95.376  1.00 20.00 ? 416  HIS C NE2 1 
ATOM   10474 N N   . MET C 1 417 ? 22.469  86.213  101.607 1.00 20.00 ? 417  MET C N   1 
ATOM   10475 C CA  . MET C 1 417 ? 22.137  85.975  103.015 1.00 20.00 ? 417  MET C CA  1 
ATOM   10476 C C   . MET C 1 417 ? 23.237  86.563  103.888 1.00 20.00 ? 417  MET C C   1 
ATOM   10477 O O   . MET C 1 417 ? 22.968  87.084  104.963 1.00 20.00 ? 417  MET C O   1 
ATOM   10478 C CB  . MET C 1 417 ? 22.002  84.471  103.304 1.00 20.00 ? 417  MET C CB  1 
ATOM   10479 C CG  . MET C 1 417 ? 20.772  83.806  102.675 1.00 20.00 ? 417  MET C CG  1 
ATOM   10480 S SD  . MET C 1 417 ? 19.221  84.619  103.113 1.00 20.00 ? 417  MET C SD  1 
ATOM   10481 C CE  . MET C 1 417 ? 18.775  85.380  101.573 1.00 20.00 ? 417  MET C CE  1 
ATOM   10482 N N   . ASP C 1 418 ? 24.481  86.473  103.424 1.00 20.00 ? 418  ASP C N   1 
ATOM   10483 C CA  . ASP C 1 418 ? 25.608  87.012  104.182 1.00 20.00 ? 418  ASP C CA  1 
ATOM   10484 C C   . ASP C 1 418 ? 25.471  88.524  104.251 1.00 20.00 ? 418  ASP C C   1 
ATOM   10485 O O   . ASP C 1 418 ? 25.816  89.137  105.259 1.00 20.00 ? 418  ASP C O   1 
ATOM   10486 C CB  . ASP C 1 418 ? 26.936  86.620  103.530 1.00 20.00 ? 418  ASP C CB  1 
ATOM   10487 C CG  . ASP C 1 418 ? 27.326  85.185  103.836 1.00 20.00 ? 418  ASP C CG  1 
ATOM   10488 O OD1 . ASP C 1 418 ? 26.844  84.640  104.850 1.00 20.00 ? 418  ASP C OD1 1 
ATOM   10489 O OD2 . ASP C 1 418 ? 28.105  84.589  103.069 1.00 20.00 ? 418  ASP C OD2 1 
ATOM   10490 N N   . VAL C 1 419 ? 24.947  89.125  103.187 1.00 20.00 ? 419  VAL C N   1 
ATOM   10491 C CA  . VAL C 1 419 ? 24.760  90.581  103.145 1.00 20.00 ? 419  VAL C CA  1 
ATOM   10492 C C   . VAL C 1 419 ? 23.788  91.040  104.250 1.00 20.00 ? 419  VAL C C   1 
ATOM   10493 O O   . VAL C 1 419 ? 24.077  91.977  104.996 1.00 20.00 ? 419  VAL C O   1 
ATOM   10494 C CB  . VAL C 1 419 ? 24.197  91.043  101.768 1.00 20.00 ? 419  VAL C CB  1 
ATOM   10495 C CG1 . VAL C 1 419 ? 23.701  92.487  101.850 1.00 20.00 ? 419  VAL C CG1 1 
ATOM   10496 C CG2 . VAL C 1 419 ? 25.261  90.930  100.708 1.00 20.00 ? 419  VAL C CG2 1 
ATOM   10497 N N   . VAL C 1 420 ? 22.634  90.384  104.353 1.00 20.00 ? 420  VAL C N   1 
ATOM   10498 C CA  . VAL C 1 420 ? 21.666  90.765  105.372 1.00 20.00 ? 420  VAL C CA  1 
ATOM   10499 C C   . VAL C 1 420 ? 22.161  90.410  106.766 1.00 20.00 ? 420  VAL C C   1 
ATOM   10500 O O   . VAL C 1 420 ? 21.987  91.193  107.696 1.00 20.00 ? 420  VAL C O   1 
ATOM   10501 C CB  . VAL C 1 420 ? 20.251  90.134  105.111 1.00 20.00 ? 420  VAL C CB  1 
ATOM   10502 C CG1 . VAL C 1 420 ? 20.276  89.241  103.888 1.00 20.00 ? 420  VAL C CG1 1 
ATOM   10503 C CG2 . VAL C 1 420 ? 19.763  89.365  106.324 1.00 20.00 ? 420  VAL C CG2 1 
ATOM   10504 N N   . ALA C 1 421 ? 22.793  89.248  106.905 1.00 20.00 ? 421  ALA C N   1 
ATOM   10505 C CA  . ALA C 1 421 ? 23.314  88.798  108.198 1.00 20.00 ? 421  ALA C CA  1 
ATOM   10506 C C   . ALA C 1 421 ? 24.409  89.702  108.748 1.00 20.00 ? 421  ALA C C   1 
ATOM   10507 O O   . ALA C 1 421 ? 24.376  90.084  109.917 1.00 20.00 ? 421  ALA C O   1 
ATOM   10508 C CB  . ALA C 1 421 ? 23.838  87.369  108.089 1.00 20.00 ? 421  ALA C CB  1 
ATOM   10509 N N   . ASP C 1 422 ? 25.381  90.035  107.905 1.00 20.00 ? 422  ASP C N   1 
ATOM   10510 C CA  . ASP C 1 422 ? 26.485  90.892  108.314 1.00 20.00 ? 422  ASP C CA  1 
ATOM   10511 C C   . ASP C 1 422 ? 25.985  92.284  108.650 1.00 20.00 ? 422  ASP C C   1 
ATOM   10512 O O   . ASP C 1 422 ? 26.476  92.910  109.587 1.00 20.00 ? 422  ASP C O   1 
ATOM   10513 C CB  . ASP C 1 422 ? 27.545  90.975  107.206 1.00 20.00 ? 422  ASP C CB  1 
ATOM   10514 C CG  . ASP C 1 422 ? 28.310  89.667  107.024 1.00 20.00 ? 422  ASP C CG  1 
ATOM   10515 O OD1 . ASP C 1 422 ? 28.265  88.807  107.928 1.00 20.00 ? 422  ASP C OD1 1 
ATOM   10516 O OD2 . ASP C 1 422 ? 28.957  89.496  105.972 1.00 20.00 ? 422  ASP C OD2 1 
ATOM   10517 N N   . GLY C 1 423 ? 25.013  92.774  107.888 1.00 20.00 ? 423  GLY C N   1 
ATOM   10518 C CA  . GLY C 1 423 ? 24.485  94.098  108.157 1.00 20.00 ? 423  GLY C CA  1 
ATOM   10519 C C   . GLY C 1 423 ? 23.726  94.150  109.474 1.00 20.00 ? 423  GLY C C   1 
ATOM   10520 O O   . GLY C 1 423 ? 23.824  95.122  110.218 1.00 20.00 ? 423  GLY C O   1 
ATOM   10521 N N   . ILE C 1 424 ? 22.969  93.096  109.769 1.00 20.00 ? 424  ILE C N   1 
ATOM   10522 C CA  . ILE C 1 424 ? 22.189  93.027  111.003 1.00 20.00 ? 424  ILE C CA  1 
ATOM   10523 C C   . ILE C 1 424 ? 23.093  92.825  112.208 1.00 20.00 ? 424  ILE C C   1 
ATOM   10524 O O   . ILE C 1 424 ? 22.840  93.371  113.276 1.00 20.00 ? 424  ILE C O   1 
ATOM   10525 C CB  . ILE C 1 424 ? 21.144  91.897  110.943 1.00 20.00 ? 424  ILE C CB  1 
ATOM   10526 C CG1 . ILE C 1 424 ? 20.039  92.271  109.941 1.00 20.00 ? 424  ILE C CG1 1 
ATOM   10527 C CG2 . ILE C 1 424 ? 20.527  91.684  112.316 1.00 20.00 ? 424  ILE C CG2 1 
ATOM   10528 C CD1 . ILE C 1 424 ? 19.292  91.085  109.352 1.00 20.00 ? 424  ILE C CD1 1 
ATOM   10529 N N   . ILE C 1 425 ? 24.148  92.041  112.044 1.00 20.00 ? 425  ILE C N   1 
ATOM   10530 C CA  . ILE C 1 425 ? 25.067  91.804  113.143 1.00 20.00 ? 425  ILE C CA  1 
ATOM   10531 C C   . ILE C 1 425 ? 25.747  93.143  113.467 1.00 20.00 ? 425  ILE C C   1 
ATOM   10532 O O   . ILE C 1 425 ? 25.920  93.503  114.633 1.00 20.00 ? 425  ILE C O   1 
ATOM   10533 C CB  . ILE C 1 425 ? 26.129  90.757  112.759 1.00 20.00 ? 425  ILE C CB  1 
ATOM   10534 C CG1 . ILE C 1 425 ? 25.542  89.348  112.914 1.00 20.00 ? 425  ILE C CG1 1 
ATOM   10535 C CG2 . ILE C 1 425 ? 27.366  90.926  113.629 1.00 20.00 ? 425  ILE C CG2 1 
ATOM   10536 C CD1 . ILE C 1 425 ? 26.072  88.335  111.916 1.00 20.00 ? 425  ILE C CD1 1 
ATOM   10537 N N   . LYS C 1 426 ? 26.113  93.883  112.424 1.00 20.00 ? 426  LYS C N   1 
ATOM   10538 C CA  . LYS C 1 426 ? 26.764  95.174  112.589 1.00 20.00 ? 426  LYS C CA  1 
ATOM   10539 C C   . LYS C 1 426 ? 25.858  96.159  113.318 1.00 20.00 ? 426  LYS C C   1 
ATOM   10540 O O   . LYS C 1 426 ? 26.315  96.931  114.161 1.00 20.00 ? 426  LYS C O   1 
ATOM   10541 C CB  . LYS C 1 426 ? 27.147  95.744  111.224 1.00 20.00 ? 426  LYS C CB  1 
ATOM   10542 C CG  . LYS C 1 426 ? 27.980  97.018  111.287 1.00 20.00 ? 426  LYS C CG  1 
ATOM   10543 C CD  . LYS C 1 426 ? 27.588  97.994  110.190 1.00 20.00 ? 426  LYS C CD  1 
ATOM   10544 C CE  . LYS C 1 426 ? 27.494  99.426  110.715 1.00 20.00 ? 426  LYS C CE  1 
ATOM   10545 N NZ  . LYS C 1 426 ? 26.090  99.839  111.028 1.00 20.00 ? 426  LYS C NZ  1 
ATOM   10546 N N   . LEU C 1 427 ? 24.572  96.138  112.982 1.00 20.00 ? 427  LEU C N   1 
ATOM   10547 C CA  . LEU C 1 427 ? 23.607  97.034  113.614 1.00 20.00 ? 427  LEU C CA  1 
ATOM   10548 C C   . LEU C 1 427 ? 23.417  96.642  115.073 1.00 20.00 ? 427  LEU C C   1 
ATOM   10549 O O   . LEU C 1 427 ? 23.229  97.495  115.930 1.00 20.00 ? 427  LEU C O   1 
ATOM   10550 C CB  . LEU C 1 427 ? 22.257  96.958  112.901 1.00 20.00 ? 427  LEU C CB  1 
ATOM   10551 C CG  . LEU C 1 427 ? 22.073  97.798  111.641 1.00 20.00 ? 427  LEU C CG  1 
ATOM   10552 C CD1 . LEU C 1 427 ? 20.779  97.398  110.958 1.00 20.00 ? 427  LEU C CD1 1 
ATOM   10553 C CD2 . LEU C 1 427 ? 22.051  99.270  112.007 1.00 20.00 ? 427  LEU C CD2 1 
ATOM   10554 N N   . TYR C 1 428 ? 23.464  95.343  115.344 1.00 20.00 ? 428  TYR C N   1 
ATOM   10555 C CA  . TYR C 1 428 ? 23.295  94.823  116.695 1.00 20.00 ? 428  TYR C CA  1 
ATOM   10556 C C   . TYR C 1 428 ? 24.441  95.243  117.601 1.00 20.00 ? 428  TYR C C   1 
ATOM   10557 O O   . TYR C 1 428 ? 24.268  95.436  118.807 1.00 20.00 ? 428  TYR C O   1 
ATOM   10558 C CB  . TYR C 1 428 ? 23.220  93.295  116.669 1.00 20.00 ? 428  TYR C CB  1 
ATOM   10559 C CG  . TYR C 1 428 ? 22.923  92.687  118.023 1.00 20.00 ? 428  TYR C CG  1 
ATOM   10560 C CD1 . TYR C 1 428 ? 21.798  93.077  118.752 1.00 20.00 ? 428  TYR C CD1 1 
ATOM   10561 C CD2 . TYR C 1 428 ? 23.771  91.734  118.580 1.00 20.00 ? 428  TYR C CD2 1 
ATOM   10562 C CE1 . TYR C 1 428 ? 21.528  92.532  120.006 1.00 20.00 ? 428  TYR C CE1 1 
ATOM   10563 C CE2 . TYR C 1 428 ? 23.511  91.183  119.834 1.00 20.00 ? 428  TYR C CE2 1 
ATOM   10564 C CZ  . TYR C 1 428 ? 22.391  91.585  120.542 1.00 20.00 ? 428  TYR C CZ  1 
ATOM   10565 O OH  . TYR C 1 428 ? 22.141  91.043  121.783 1.00 20.00 ? 428  TYR C OH  1 
ATOM   10566 N N   . GLN C 1 429 ? 25.622  95.373  117.018 1.00 20.00 ? 429  GLN C N   1 
ATOM   10567 C CA  . GLN C 1 429 ? 26.780  95.763  117.787 1.00 20.00 ? 429  GLN C CA  1 
ATOM   10568 C C   . GLN C 1 429 ? 26.723  97.232  118.198 1.00 20.00 ? 429  GLN C C   1 
ATOM   10569 O O   . GLN C 1 429 ? 27.484  97.668  119.053 1.00 20.00 ? 429  GLN C O   1 
ATOM   10570 C CB  . GLN C 1 429 ? 28.047  95.452  116.992 1.00 20.00 ? 429  GLN C CB  1 
ATOM   10571 C CG  . GLN C 1 429 ? 28.576  94.050  117.268 1.00 20.00 ? 429  GLN C CG  1 
ATOM   10572 C CD  . GLN C 1 429 ? 29.384  93.480  116.120 1.00 20.00 ? 429  GLN C CD  1 
ATOM   10573 O OE1 . GLN C 1 429 ? 29.831  94.210  115.230 1.00 20.00 ? 429  GLN C OE1 1 
ATOM   10574 N NE2 . GLN C 1 429 ? 29.577  92.162  116.133 1.00 20.00 ? 429  GLN C NE2 1 
ATOM   10575 N N   . HIS C 1 430 ? 25.805  97.982  117.595 1.00 20.00 ? 430  HIS C N   1 
ATOM   10576 C CA  . HIS C 1 430 ? 25.622  99.405  117.888 1.00 20.00 ? 430  HIS C CA  1 
ATOM   10577 C C   . HIS C 1 430 ? 24.129  99.649  117.956 1.00 20.00 ? 430  HIS C C   1 
ATOM   10578 O O   . HIS C 1 430 ? 23.647  100.696 117.535 1.00 20.00 ? 430  HIS C O   1 
ATOM   10579 C CB  . HIS C 1 430 ? 26.202  100.271 116.773 1.00 20.00 ? 430  HIS C CB  1 
ATOM   10580 C CG  . HIS C 1 430 ? 27.644  100.008 116.496 1.00 20.00 ? 430  HIS C CG  1 
ATOM   10581 N ND1 . HIS C 1 430 ? 28.069  99.263  115.418 1.00 20.00 ? 430  HIS C ND1 1 
ATOM   10582 C CD2 . HIS C 1 430 ? 28.761  100.374 117.168 1.00 20.00 ? 430  HIS C CD2 1 
ATOM   10583 C CE1 . HIS C 1 430 ? 29.388  99.180  115.438 1.00 20.00 ? 430  HIS C CE1 1 
ATOM   10584 N NE2 . HIS C 1 430 ? 29.832  99.845  116.490 1.00 20.00 ? 430  HIS C NE2 1 
ATOM   10585 N N   . LYS C 1 431 ? 23.401  98.670  118.479 1.00 20.00 ? 431  LYS C N   1 
ATOM   10586 C CA  . LYS C 1 431 ? 21.960  98.758  118.599 1.00 20.00 ? 431  LYS C CA  1 
ATOM   10587 C C   . LYS C 1 431 ? 21.483  100.003 119.300 1.00 20.00 ? 431  LYS C C   1 
ATOM   10588 O O   . LYS C 1 431 ? 20.432  100.535 118.958 1.00 20.00 ? 431  LYS C O   1 
ATOM   10589 C CB  . LYS C 1 431 ? 21.419  97.534  119.328 1.00 20.00 ? 431  LYS C CB  1 
ATOM   10590 C CG  . LYS C 1 431 ? 22.056  97.279  120.677 1.00 20.00 ? 431  LYS C CG  1 
ATOM   10591 C CD  . LYS C 1 431 ? 21.505  96.000  121.284 1.00 20.00 ? 431  LYS C CD  1 
ATOM   10592 C CE  . LYS C 1 431 ? 22.324  95.562  122.480 1.00 20.00 ? 431  LYS C CE  1 
ATOM   10593 N NZ  . LYS C 1 431 ? 22.782  96.741  123.262 1.00 20.00 ? 431  LYS C NZ  1 
ATOM   10594 N N   . GLU C 1 432 ? 22.252  100.464 120.281 1.00 20.00 ? 432  GLU C N   1 
ATOM   10595 C CA  . GLU C 1 432 ? 21.906  101.661 121.049 1.00 20.00 ? 432  GLU C CA  1 
ATOM   10596 C C   . GLU C 1 432 ? 21.798  102.888 120.160 1.00 20.00 ? 432  GLU C C   1 
ATOM   10597 O O   . GLU C 1 432 ? 21.301  103.928 120.584 1.00 20.00 ? 432  GLU C O   1 
ATOM   10598 C CB  . GLU C 1 432 ? 22.953  101.918 122.146 1.00 20.00 ? 432  GLU C CB  1 
ATOM   10599 C CG  . GLU C 1 432 ? 23.948  100.772 122.376 1.00 20.00 ? 432  GLU C CG  1 
ATOM   10600 C CD  . GLU C 1 432 ? 25.211  100.886 121.519 1.00 20.00 ? 432  GLU C CD  1 
ATOM   10601 O OE1 . GLU C 1 432 ? 25.568  102.009 121.099 1.00 20.00 ? 432  GLU C OE1 1 
ATOM   10602 O OE2 . GLU C 1 432 ? 25.851  99.846  121.264 1.00 20.00 ? 432  GLU C OE2 1 
ATOM   10603 N N   . ASP C 1 433 ? 22.264  102.753 118.925 1.00 20.00 ? 433  ASP C N   1 
ATOM   10604 C CA  . ASP C 1 433 ? 22.233  103.839 117.956 1.00 20.00 ? 433  ASP C CA  1 
ATOM   10605 C C   . ASP C 1 433 ? 20.923  103.901 117.183 1.00 20.00 ? 433  ASP C C   1 
ATOM   10606 O O   . ASP C 1 433 ? 20.658  104.877 116.488 1.00 20.00 ? 433  ASP C O   1 
ATOM   10607 C CB  . ASP C 1 433 ? 23.386  103.689 116.967 1.00 20.00 ? 433  ASP C CB  1 
ATOM   10608 C CG  . ASP C 1 433 ? 24.701  104.221 117.512 1.00 20.00 ? 433  ASP C CG  1 
ATOM   10609 O OD1 . ASP C 1 433 ? 24.691  104.925 118.546 1.00 20.00 ? 433  ASP C OD1 1 
ATOM   10610 O OD2 . ASP C 1 433 ? 25.747  103.929 116.899 1.00 20.00 ? 433  ASP C OD2 1 
ATOM   10611 N N   . ILE C 1 434 ? 20.116  102.851 117.279 1.00 20.00 ? 434  ILE C N   1 
ATOM   10612 C CA  . ILE C 1 434 ? 18.838  102.817 116.580 1.00 20.00 ? 434  ILE C CA  1 
ATOM   10613 C C   . ILE C 1 434 ? 17.887  103.777 117.301 1.00 20.00 ? 434  ILE C C   1 
ATOM   10614 O O   . ILE C 1 434 ? 17.660  103.659 118.509 1.00 20.00 ? 434  ILE C O   1 
ATOM   10615 C CB  . ILE C 1 434 ? 18.261  101.389 116.562 1.00 20.00 ? 434  ILE C CB  1 
ATOM   10616 C CG1 . ILE C 1 434 ? 19.118  100.510 115.647 1.00 20.00 ? 434  ILE C CG1 1 
ATOM   10617 C CG2 . ILE C 1 434 ? 16.824  101.401 116.060 1.00 20.00 ? 434  ILE C CG2 1 
ATOM   10618 C CD1 . ILE C 1 434 ? 19.074  99.036  115.977 1.00 20.00 ? 434  ILE C CD1 1 
ATOM   10619 N N   . ARG C 1 435 ? 17.342  104.731 116.557 1.00 20.00 ? 435  ARG C N   1 
ATOM   10620 C CA  . ARG C 1 435 ? 16.430  105.713 117.129 1.00 20.00 ? 435  ARG C CA  1 
ATOM   10621 C C   . ARG C 1 435 ? 14.966  105.299 117.146 1.00 20.00 ? 435  ARG C C   1 
ATOM   10622 O O   . ARG C 1 435 ? 14.535  104.475 116.345 1.00 20.00 ? 435  ARG C O   1 
ATOM   10623 C CB  . ARG C 1 435 ? 16.574  107.038 116.380 1.00 20.00 ? 435  ARG C CB  1 
ATOM   10624 C CG  . ARG C 1 435 ? 17.991  107.591 116.370 1.00 20.00 ? 435  ARG C CG  1 
ATOM   10625 C CD  . ARG C 1 435 ? 18.072  108.898 115.592 1.00 20.00 ? 435  ARG C CD  1 
ATOM   10626 N NE  . ARG C 1 435 ? 17.332  109.978 116.242 1.00 20.00 ? 435  ARG C NE  1 
ATOM   10627 C CZ  . ARG C 1 435 ? 17.087  111.157 115.678 1.00 20.00 ? 435  ARG C CZ  1 
ATOM   10628 N NH1 . ARG C 1 435 ? 17.526  111.405 114.451 1.00 20.00 ? 435  ARG C NH1 1 
ATOM   10629 N NH2 . ARG C 1 435 ? 16.404  112.088 116.337 1.00 20.00 ? 435  ARG C NH2 1 
ATOM   10630 N N   . GLY C 1 436 ? 14.207  105.882 118.072 1.00 20.00 ? 436  GLY C N   1 
ATOM   10631 C CA  . GLY C 1 436 ? 12.797  105.568 118.179 1.00 20.00 ? 436  GLY C CA  1 
ATOM   10632 C C   . GLY C 1 436 ? 12.039  106.372 117.148 1.00 20.00 ? 436  GLY C C   1 
ATOM   10633 O O   . GLY C 1 436 ? 12.523  107.405 116.691 1.00 20.00 ? 436  GLY C O   1 
ATOM   10634 N N   . LEU C 1 437 ? 10.855  105.900 116.777 1.00 20.00 ? 437  LEU C N   1 
ATOM   10635 C CA  . LEU C 1 437 ? 10.037  106.591 115.788 1.00 20.00 ? 437  LEU C CA  1 
ATOM   10636 C C   . LEU C 1 437 ? 8.749   107.143 116.385 1.00 20.00 ? 437  LEU C C   1 
ATOM   10637 O O   . LEU C 1 437 ? 8.378   106.819 117.512 1.00 20.00 ? 437  LEU C O   1 
ATOM   10638 C CB  . LEU C 1 437 ? 9.678   105.645 114.636 1.00 20.00 ? 437  LEU C CB  1 
ATOM   10639 C CG  . LEU C 1 437 ? 10.782  105.174 113.689 1.00 20.00 ? 437  LEU C CG  1 
ATOM   10640 C CD1 . LEU C 1 437 ? 10.216  104.137 112.755 1.00 20.00 ? 437  LEU C CD1 1 
ATOM   10641 C CD2 . LEU C 1 437 ? 11.341  106.354 112.898 1.00 20.00 ? 437  LEU C CD2 1 
ATOM   10642 N N   . THR C 1 438 ? 8.080   107.984 115.605 1.00 20.00 ? 438  THR C N   1 
ATOM   10643 C CA  . THR C 1 438 ? 6.828   108.611 115.995 1.00 20.00 ? 438  THR C CA  1 
ATOM   10644 C C   . THR C 1 438 ? 6.024   108.818 114.722 1.00 20.00 ? 438  THR C C   1 
ATOM   10645 O O   . THR C 1 438 ? 6.592   109.081 113.666 1.00 20.00 ? 438  THR C O   1 
ATOM   10646 C CB  . THR C 1 438 ? 7.051   109.982 116.668 1.00 20.00 ? 438  THR C CB  1 
ATOM   10647 O OG1 . THR C 1 438 ? 5.840   110.397 117.318 1.00 20.00 ? 438  THR C OG1 1 
ATOM   10648 C CG2 . THR C 1 438 ? 7.447   111.035 115.634 1.00 20.00 ? 438  THR C CG2 1 
ATOM   10649 N N   . PHE C 1 439 ? 4.707   108.693 114.827 1.00 20.00 ? 439  PHE C N   1 
ATOM   10650 C CA  . PHE C 1 439 ? 3.819   108.869 113.683 1.00 20.00 ? 439  PHE C CA  1 
ATOM   10651 C C   . PHE C 1 439 ? 3.764   110.325 113.244 1.00 20.00 ? 439  PHE C C   1 
ATOM   10652 O O   . PHE C 1 439 ? 3.634   111.207 114.079 1.00 20.00 ? 439  PHE C O   1 
ATOM   10653 C CB  . PHE C 1 439 ? 2.386   108.467 114.051 1.00 20.00 ? 439  PHE C CB  1 
ATOM   10654 C CG  . PHE C 1 439 ? 2.103   107.003 113.940 1.00 20.00 ? 439  PHE C CG  1 
ATOM   10655 C CD1 . PHE C 1 439 ? 2.221   106.344 112.719 1.00 20.00 ? 439  PHE C CD1 1 
ATOM   10656 C CD2 . PHE C 1 439 ? 1.692   106.282 115.053 1.00 20.00 ? 439  PHE C CD2 1 
ATOM   10657 C CE1 . PHE C 1 439 ? 1.932   104.986 112.606 1.00 20.00 ? 439  PHE C CE1 1 
ATOM   10658 C CE2 . PHE C 1 439 ? 1.400   104.921 114.955 1.00 20.00 ? 439  PHE C CE2 1 
ATOM   10659 C CZ  . PHE C 1 439 ? 1.521   104.271 113.726 1.00 20.00 ? 439  PHE C CZ  1 
ATOM   10660 N N   . VAL C 1 440 ? 3.874   110.581 111.944 1.00 20.00 ? 440  VAL C N   1 
ATOM   10661 C CA  . VAL C 1 440 ? 3.800   111.953 111.449 1.00 20.00 ? 440  VAL C CA  1 
ATOM   10662 C C   . VAL C 1 440 ? 2.504   111.948 110.636 1.00 20.00 ? 440  VAL C C   1 
ATOM   10663 O O   . VAL C 1 440 ? 1.934   112.990 110.308 1.00 20.00 ? 440  VAL C O   1 
ATOM   10664 C CB  . VAL C 1 440 ? 4.978   112.358 110.537 1.00 20.00 ? 440  VAL C CB  1 
ATOM   10665 C CG1 . VAL C 1 440 ? 6.246   112.461 111.361 1.00 20.00 ? 440  VAL C CG1 1 
ATOM   10666 C CG2 . VAL C 1 440 ? 5.118   111.383 109.386 1.00 20.00 ? 440  VAL C CG2 1 
ATOM   10667 N N   . TYR C 1 441 ? 2.039   110.742 110.342 1.00 20.00 ? 441  TYR C N   1 
ATOM   10668 C CA  . TYR C 1 441 ? 0.821   110.551 109.585 1.00 20.00 ? 441  TYR C CA  1 
ATOM   10669 C C   . TYR C 1 441 ? 0.359   109.115 109.803 1.00 20.00 ? 441  TYR C C   1 
ATOM   10670 O O   . TYR C 1 441 ? 1.040   108.174 109.407 1.00 20.00 ? 441  TYR C O   1 
ATOM   10671 C CB  . TYR C 1 441 ? 1.073   110.805 108.104 1.00 20.00 ? 441  TYR C CB  1 
ATOM   10672 C CG  . TYR C 1 441 ? -0.041  110.296 107.238 1.00 20.00 ? 441  TYR C CG  1 
ATOM   10673 C CD1 . TYR C 1 441 ? -1.321  110.838 107.335 1.00 20.00 ? 441  TYR C CD1 1 
ATOM   10674 C CD2 . TYR C 1 441 ? 0.158   109.218 106.378 1.00 20.00 ? 441  TYR C CD2 1 
ATOM   10675 C CE1 . TYR C 1 441 ? -2.380  110.315 106.607 1.00 20.00 ? 441  TYR C CE1 1 
ATOM   10676 C CE2 . TYR C 1 441 ? -0.896  108.685 105.643 1.00 20.00 ? 441  TYR C CE2 1 
ATOM   10677 C CZ  . TYR C 1 441 ? -2.166  109.237 105.769 1.00 20.00 ? 441  TYR C CZ  1 
ATOM   10678 O OH  . TYR C 1 441 ? -3.232  108.688 105.093 1.00 20.00 ? 441  TYR C OH  1 
ATOM   10679 N N   . GLU C 1 442 ? -0.795  108.948 110.442 1.00 20.00 ? 442  GLU C N   1 
ATOM   10680 C CA  . GLU C 1 442 ? -1.334  107.619 110.707 1.00 20.00 ? 442  GLU C CA  1 
ATOM   10681 C C   . GLU C 1 442 ? -2.702  107.398 110.073 1.00 20.00 ? 442  GLU C C   1 
ATOM   10682 O O   . GLU C 1 442 ? -3.717  107.863 110.589 1.00 20.00 ? 442  GLU C O   1 
ATOM   10683 C CB  . GLU C 1 442 ? -1.451  107.374 112.209 1.00 20.00 ? 442  GLU C CB  1 
ATOM   10684 C CG  . GLU C 1 442 ? -2.196  106.091 112.544 1.00 20.00 ? 442  GLU C CG  1 
ATOM   10685 C CD  . GLU C 1 442 ? -2.380  105.883 114.032 1.00 20.00 ? 442  GLU C CD  1 
ATOM   10686 O OE1 . GLU C 1 442 ? -1.923  106.731 114.824 1.00 20.00 ? 442  GLU C OE1 1 
ATOM   10687 O OE2 . GLU C 1 442 ? -2.980  104.864 114.410 1.00 20.00 ? 442  GLU C OE2 1 
ATOM   10688 N N   . PRO C 1 443 ? -2.748  106.668 108.951 1.00 20.00 ? 443  PRO C N   1 
ATOM   10689 C CA  . PRO C 1 443 ? -4.044  106.393 108.335 1.00 20.00 ? 443  PRO C CA  1 
ATOM   10690 C C   . PRO C 1 443 ? -4.908  105.571 109.286 1.00 20.00 ? 443  PRO C C   1 
ATOM   10691 O O   . PRO C 1 443 ? -4.385  104.909 110.185 1.00 20.00 ? 443  PRO C O   1 
ATOM   10692 C CB  . PRO C 1 443 ? -3.681  105.644 107.058 1.00 20.00 ? 443  PRO C CB  1 
ATOM   10693 C CG  . PRO C 1 443 ? -2.337  105.088 107.309 1.00 20.00 ? 443  PRO C CG  1 
ATOM   10694 C CD  . PRO C 1 443 ? -1.640  106.056 108.203 1.00 20.00 ? 443  PRO C CD  1 
ATOM   10695 N N   . LYS C 1 444 ? -6.226  105.637 109.098 1.00 20.00 ? 444  LYS C N   1 
ATOM   10696 C CA  . LYS C 1 444 ? -7.171  104.901 109.937 1.00 20.00 ? 444  LYS C CA  1 
ATOM   10697 C C   . LYS C 1 444 ? -7.215  103.412 109.602 1.00 20.00 ? 444  LYS C C   1 
ATOM   10698 O O   . LYS C 1 444 ? -7.346  102.577 110.495 1.00 20.00 ? 444  LYS C O   1 
ATOM   10699 C CB  . LYS C 1 444 ? -8.577  105.487 109.799 1.00 20.00 ? 444  LYS C CB  1 
ATOM   10700 C CG  . LYS C 1 444 ? -8.627  106.996 109.865 1.00 20.00 ? 444  LYS C CG  1 
ATOM   10701 C CD  . LYS C 1 444 ? -8.672  107.477 111.300 1.00 20.00 ? 444  LYS C CD  1 
ATOM   10702 C CE  . LYS C 1 444 ? -9.349  108.836 111.401 1.00 20.00 ? 444  LYS C CE  1 
ATOM   10703 N NZ  . LYS C 1 444 ? -9.110  109.488 112.722 1.00 20.00 ? 444  LYS C NZ  1 
ATOM   10704 N N   . GLN C 1 445 ? -7.119  103.078 108.318 1.00 20.00 ? 445  GLN C N   1 
ATOM   10705 C CA  . GLN C 1 445 ? -7.150  101.681 107.900 1.00 20.00 ? 445  GLN C CA  1 
ATOM   10706 C C   . GLN C 1 445 ? -5.835  101.310 107.232 1.00 20.00 ? 445  GLN C C   1 
ATOM   10707 O O   . GLN C 1 445 ? -5.231  102.130 106.541 1.00 20.00 ? 445  GLN C O   1 
ATOM   10708 C CB  . GLN C 1 445 ? -8.299  101.435 106.920 1.00 20.00 ? 445  GLN C CB  1 
ATOM   10709 C CG  . GLN C 1 445 ? -9.617  102.070 107.318 1.00 20.00 ? 445  GLN C CG  1 
ATOM   10710 C CD  . GLN C 1 445 ? -9.914  103.320 106.521 1.00 20.00 ? 445  GLN C CD  1 
ATOM   10711 O OE1 . GLN C 1 445 ? -8.996  104.024 106.086 1.00 20.00 ? 445  GLN C OE1 1 
ATOM   10712 N NE2 . GLN C 1 445 ? -11.197 103.607 106.321 1.00 20.00 ? 445  GLN C NE2 1 
ATOM   10713 N N   . LEU C 1 446 ? -5.393  100.074 107.440 1.00 20.00 ? 446  LEU C N   1 
ATOM   10714 C CA  . LEU C 1 446 ? -4.143  99.610  106.845 1.00 20.00 ? 446  LEU C CA  1 
ATOM   10715 C C   . LEU C 1 446 ? -3.006  100.569 107.199 1.00 20.00 ? 446  LEU C C   1 
ATOM   10716 O O   . LEU C 1 446 ? -2.182  100.889 106.346 1.00 20.00 ? 446  LEU C O   1 
ATOM   10717 C CB  . LEU C 1 446 ? -4.288  99.555  105.321 1.00 20.00 ? 446  LEU C CB  1 
ATOM   10718 C CG  . LEU C 1 446 ? -4.754  98.281  104.616 1.00 20.00 ? 446  LEU C CG  1 
ATOM   10719 C CD1 . LEU C 1 446 ? -3.612  97.736  103.783 1.00 20.00 ? 446  LEU C CD1 1 
ATOM   10720 C CD2 . LEU C 1 446 ? -5.220  97.254  105.625 1.00 20.00 ? 446  LEU C CD2 1 
ATOM   10721 N N   . ARG C 1 447 ? -2.953  101.011 108.453 1.00 20.00 ? 447  ARG C N   1 
ATOM   10722 C CA  . ARG C 1 447 ? -1.909  101.940 108.879 1.00 20.00 ? 447  ARG C CA  1 
ATOM   10723 C C   . ARG C 1 447 ? -0.462  101.483 108.648 1.00 20.00 ? 447  ARG C C   1 
ATOM   10724 O O   . ARG C 1 447 ? 0.416   102.307 108.408 1.00 20.00 ? 447  ARG C O   1 
ATOM   10725 C CB  . ARG C 1 447 ? -2.136  102.342 110.347 1.00 20.00 ? 447  ARG C CB  1 
ATOM   10726 C CG  . ARG C 1 447 ? -1.526  101.420 111.386 1.00 20.00 ? 447  ARG C CG  1 
ATOM   10727 C CD  . ARG C 1 447 ? -1.522  102.078 112.757 1.00 20.00 ? 447  ARG C CD  1 
ATOM   10728 N NE  . ARG C 1 447 ? -1.104  101.161 113.814 1.00 20.00 ? 447  ARG C NE  1 
ATOM   10729 C CZ  . ARG C 1 447 ? -0.985  101.503 115.093 1.00 20.00 ? 447  ARG C CZ  1 
ATOM   10730 N NH1 . ARG C 1 447 ? -1.253  102.741 115.472 1.00 20.00 ? 447  ARG C NH1 1 
ATOM   10731 N NH2 . ARG C 1 447 ? -0.598  100.610 115.993 1.00 20.00 ? 447  ARG C NH2 1 
ATOM   10732 N N   . PHE C 1 448 ? -0.209  100.181 108.706 1.00 20.00 ? 448  PHE C N   1 
ATOM   10733 C CA  . PHE C 1 448 ? 1.143   99.667  108.493 1.00 20.00 ? 448  PHE C CA  1 
ATOM   10734 C C   . PHE C 1 448 ? 1.508   99.760  107.010 1.00 20.00 ? 448  PHE C C   1 
ATOM   10735 O O   . PHE C 1 448 ? 2.677   99.707  106.641 1.00 20.00 ? 448  PHE C O   1 
ATOM   10736 C CB  . PHE C 1 448 ? 1.242   98.204  108.950 1.00 20.00 ? 448  PHE C CB  1 
ATOM   10737 C CG  . PHE C 1 448 ? 0.443   97.242  108.100 1.00 20.00 ? 448  PHE C CG  1 
ATOM   10738 C CD1 . PHE C 1 448 ? 0.886   96.872  106.832 1.00 20.00 ? 448  PHE C CD1 1 
ATOM   10739 C CD2 . PHE C 1 448 ? -0.769  96.733  108.557 1.00 20.00 ? 448  PHE C CD2 1 
ATOM   10740 C CE1 . PHE C 1 448 ? 0.137   96.018  106.027 1.00 20.00 ? 448  PHE C CE1 1 
ATOM   10741 C CE2 . PHE C 1 448 ? -1.529  95.875  107.761 1.00 20.00 ? 448  PHE C CE2 1 
ATOM   10742 C CZ  . PHE C 1 448 ? -1.073  95.518  106.491 1.00 20.00 ? 448  PHE C CZ  1 
ATOM   10743 N N   . PHE C 1 449 ? 0.495   99.898  106.163 1.00 20.00 ? 449  PHE C N   1 
ATOM   10744 C CA  . PHE C 1 449 ? 0.708   99.990  104.731 1.00 20.00 ? 449  PHE C CA  1 
ATOM   10745 C C   . PHE C 1 449 ? 1.121   101.375 104.239 1.00 20.00 ? 449  PHE C C   1 
ATOM   10746 O O   . PHE C 1 449 ? 1.864   101.495 103.263 1.00 20.00 ? 449  PHE C O   1 
ATOM   10747 C CB  . PHE C 1 449 ? -0.559  99.546  103.997 1.00 20.00 ? 449  PHE C CB  1 
ATOM   10748 C CG  . PHE C 1 449 ? -0.362  99.344  102.523 1.00 20.00 ? 449  PHE C CG  1 
ATOM   10749 C CD1 . PHE C 1 449 ? 0.493   98.348  102.053 1.00 20.00 ? 449  PHE C CD1 1 
ATOM   10750 C CD2 . PHE C 1 449 ? -1.019  100.159 101.598 1.00 20.00 ? 449  PHE C CD2 1 
ATOM   10751 C CE1 . PHE C 1 449 ? 0.694   98.165  100.683 1.00 20.00 ? 449  PHE C CE1 1 
ATOM   10752 C CE2 . PHE C 1 449 ? -0.827  99.988  100.224 1.00 20.00 ? 449  PHE C CE2 1 
ATOM   10753 C CZ  . PHE C 1 449 ? 0.031   98.989  99.765  1.00 20.00 ? 449  PHE C CZ  1 
ATOM   10754 N N   . THR C 1 450 ? 0.664   102.421 104.919 1.00 20.00 ? 450  THR C N   1 
ATOM   10755 C CA  . THR C 1 450 ? 1.010   103.770 104.499 1.00 20.00 ? 450  THR C CA  1 
ATOM   10756 C C   . THR C 1 450 ? 1.407   104.769 105.587 1.00 20.00 ? 450  THR C C   1 
ATOM   10757 O O   . THR C 1 450 ? 1.660   105.933 105.285 1.00 20.00 ? 450  THR C O   1 
ATOM   10758 C CB  . THR C 1 450 ? -0.145  104.366 103.697 1.00 20.00 ? 450  THR C CB  1 
ATOM   10759 O OG1 . THR C 1 450 ? -1.384  103.986 104.303 1.00 20.00 ? 450  THR C OG1 1 
ATOM   10760 C CG2 . THR C 1 450 ? -0.120  103.846 102.279 1.00 20.00 ? 450  THR C CG2 1 
ATOM   10761 N N   . ALA C 1 451 ? 1.469   104.337 106.843 1.00 20.00 ? 451  ALA C N   1 
ATOM   10762 C CA  . ALA C 1 451 ? 1.845   105.259 107.910 1.00 20.00 ? 451  ALA C CA  1 
ATOM   10763 C C   . ALA C 1 451 ? 3.228   105.841 107.636 1.00 20.00 ? 451  ALA C C   1 
ATOM   10764 O O   . ALA C 1 451 ? 4.066   105.199 107.005 1.00 20.00 ? 451  ALA C O   1 
ATOM   10765 C CB  . ALA C 1 451 ? 1.842   104.553 109.254 1.00 20.00 ? 451  ALA C CB  1 
ATOM   10766 N N   . ARG C 1 452 ? 3.457   107.063 108.097 1.00 20.00 ? 452  ARG C N   1 
ATOM   10767 C CA  . ARG C 1 452 ? 4.740   107.725 107.903 1.00 20.00 ? 452  ARG C CA  1 
ATOM   10768 C C   . ARG C 1 452 ? 5.272   108.127 109.266 1.00 20.00 ? 452  ARG C C   1 
ATOM   10769 O O   . ARG C 1 452 ? 4.529   108.612 110.111 1.00 20.00 ? 452  ARG C O   1 
ATOM   10770 C CB  . ARG C 1 452 ? 4.579   108.961 107.026 1.00 20.00 ? 452  ARG C CB  1 
ATOM   10771 C CG  . ARG C 1 452 ? 3.761   108.718 105.785 1.00 20.00 ? 452  ARG C CG  1 
ATOM   10772 C CD  . ARG C 1 452 ? 3.907   109.868 104.833 1.00 20.00 ? 452  ARG C CD  1 
ATOM   10773 N NE  . ARG C 1 452 ? 4.817   109.524 103.755 1.00 20.00 ? 452  ARG C NE  1 
ATOM   10774 C CZ  . ARG C 1 452 ? 6.020   110.059 103.575 1.00 20.00 ? 452  ARG C CZ  1 
ATOM   10775 N NH1 . ARG C 1 452 ? 6.494   110.987 104.403 1.00 20.00 ? 452  ARG C NH1 1 
ATOM   10776 N NH2 . ARG C 1 452 ? 6.754   109.656 102.552 1.00 20.00 ? 452  ARG C NH2 1 
ATOM   10777 N N   . PHE C 1 453 ? 6.565   107.933 109.476 1.00 20.00 ? 453  PHE C N   1 
ATOM   10778 C CA  . PHE C 1 453 ? 7.168   108.278 110.752 1.00 20.00 ? 453  PHE C CA  1 
ATOM   10779 C C   . PHE C 1 453 ? 8.318   109.262 110.647 1.00 20.00 ? 453  PHE C C   1 
ATOM   10780 O O   . PHE C 1 453 ? 8.696   109.704 109.563 1.00 20.00 ? 453  PHE C O   1 
ATOM   10781 C CB  . PHE C 1 453 ? 7.684   107.013 111.444 1.00 20.00 ? 453  PHE C CB  1 
ATOM   10782 C CG  . PHE C 1 453 ? 6.740   105.842 111.369 1.00 20.00 ? 453  PHE C CG  1 
ATOM   10783 C CD1 . PHE C 1 453 ? 6.662   105.066 110.223 1.00 20.00 ? 453  PHE C CD1 1 
ATOM   10784 C CD2 . PHE C 1 453 ? 5.951   105.503 112.460 1.00 20.00 ? 453  PHE C CD2 1 
ATOM   10785 C CE1 . PHE C 1 453 ? 5.816   103.972 110.164 1.00 20.00 ? 453  PHE C CE1 1 
ATOM   10786 C CE2 . PHE C 1 453 ? 5.108   104.419 112.411 1.00 20.00 ? 453  PHE C CE2 1 
ATOM   10787 C CZ  . PHE C 1 453 ? 5.037   103.649 111.260 1.00 20.00 ? 453  PHE C CZ  1 
ATOM   10788 N N   . ASP C 1 454 ? 8.860   109.602 111.808 1.00 20.00 ? 454  ASP C N   1 
ATOM   10789 C CA  . ASP C 1 454 ? 9.978   110.516 111.920 1.00 20.00 ? 454  ASP C CA  1 
ATOM   10790 C C   . ASP C 1 454 ? 10.650  110.177 113.229 1.00 20.00 ? 454  ASP C C   1 
ATOM   10791 O O   . ASP C 1 454 ? 9.988   109.798 114.192 1.00 20.00 ? 454  ASP C O   1 
ATOM   10792 C CB  . ASP C 1 454 ? 9.535   111.972 111.929 1.00 20.00 ? 454  ASP C CB  1 
ATOM   10793 C CG  . ASP C 1 454 ? 10.651  112.911 111.503 1.00 20.00 ? 454  ASP C CG  1 
ATOM   10794 O OD1 . ASP C 1 454 ? 11.798  112.443 111.325 1.00 20.00 ? 454  ASP C OD1 1 
ATOM   10795 O OD2 . ASP C 1 454 ? 10.383  114.115 111.343 1.00 20.00 ? 454  ASP C OD2 1 
ATOM   10796 N N   . PHE C 1 455 ? 11.968  110.306 113.260 1.00 20.00 ? 455  PHE C N   1 
ATOM   10797 C CA  . PHE C 1 455 ? 12.729  110.005 114.456 1.00 20.00 ? 455  PHE C CA  1 
ATOM   10798 C C   . PHE C 1 455 ? 12.316  110.792 115.681 1.00 20.00 ? 455  PHE C C   1 
ATOM   10799 O O   . PHE C 1 455 ? 11.840  111.921 115.587 1.00 20.00 ? 455  PHE C O   1 
ATOM   10800 C CB  . PHE C 1 455 ? 14.214  110.211 114.178 1.00 20.00 ? 455  PHE C CB  1 
ATOM   10801 C CG  . PHE C 1 455 ? 14.785  109.197 113.250 1.00 20.00 ? 455  PHE C CG  1 
ATOM   10802 C CD1 . PHE C 1 455 ? 14.512  107.850 113.435 1.00 20.00 ? 455  PHE C CD1 1 
ATOM   10803 C CD2 . PHE C 1 455 ? 15.574  109.580 112.176 1.00 20.00 ? 455  PHE C CD2 1 
ATOM   10804 C CE1 . PHE C 1 455 ? 15.010  106.901 112.572 1.00 20.00 ? 455  PHE C CE1 1 
ATOM   10805 C CE2 . PHE C 1 455 ? 16.079  108.634 111.302 1.00 20.00 ? 455  PHE C CE2 1 
ATOM   10806 C CZ  . PHE C 1 455 ? 15.794  107.290 111.503 1.00 20.00 ? 455  PHE C CZ  1 
ATOM   10807 N N   . ILE C 1 456 ? 12.498  110.164 116.837 1.00 20.00 ? 456  ILE C N   1 
ATOM   10808 C CA  . ILE C 1 456 ? 12.166  110.766 118.117 1.00 20.00 ? 456  ILE C CA  1 
ATOM   10809 C C   . ILE C 1 456 ? 13.398  111.496 118.638 1.00 20.00 ? 456  ILE C C   1 
ATOM   10810 O O   . ILE C 1 456 ? 14.492  110.879 118.615 1.00 20.00 ? 456  ILE C O   1 
ATOM   10811 C CB  . ILE C 1 456 ? 11.765  109.694 119.140 1.00 20.00 ? 456  ILE C CB  1 
ATOM   10812 C CG1 . ILE C 1 456 ? 10.298  109.329 118.946 1.00 20.00 ? 456  ILE C CG1 1 
ATOM   10813 C CG2 . ILE C 1 456 ? 11.991  110.202 120.549 1.00 20.00 ? 456  ILE C CG2 1 
ATOM   10814 C CD1 . ILE C 1 456 ? 9.887   108.069 119.663 1.00 20.00 ? 456  ILE C CD1 1 
ATOM   10815 O OXT . ILE C 1 456 ? 13.247  112.666 119.060 1.00 20.00 ? 456  ILE C OXT 1 
ATOM   10816 N N   . MET D 1 1   ? 40.560  89.340  99.753  1.00 20.00 ? 1    MET D N   1 
ATOM   10817 C CA  . MET D 1 1   ? 40.001  88.673  100.968 1.00 20.00 ? 1    MET D CA  1 
ATOM   10818 C C   . MET D 1 1   ? 38.476  88.671  100.930 1.00 20.00 ? 1    MET D C   1 
ATOM   10819 O O   . MET D 1 1   ? 37.831  87.747  101.437 1.00 20.00 ? 1    MET D O   1 
ATOM   10820 C CB  . MET D 1 1   ? 40.479  89.397  102.237 1.00 20.00 ? 1    MET D CB  1 
ATOM   10821 C CG  . MET D 1 1   ? 40.376  88.572  103.522 1.00 20.00 ? 1    MET D CG  1 
ATOM   10822 S SD  . MET D 1 1   ? 38.690  88.491  104.185 1.00 20.00 ? 1    MET D SD  1 
ATOM   10823 C CE  . MET D 1 1   ? 38.678  86.843  104.945 1.00 20.00 ? 1    MET D CE  1 
ATOM   10824 N N   . ASN D 1 2   ? 37.907  89.708  100.319 1.00 20.00 ? 2    ASN D N   1 
ATOM   10825 C CA  . ASN D 1 2   ? 36.459  89.827  100.220 1.00 20.00 ? 2    ASN D CA  1 
ATOM   10826 C C   . ASN D 1 2   ? 35.925  89.659  98.806  1.00 20.00 ? 2    ASN D C   1 
ATOM   10827 O O   . ASN D 1 2   ? 36.489  90.189  97.843  1.00 20.00 ? 2    ASN D O   1 
ATOM   10828 C CB  . ASN D 1 2   ? 36.008  91.171  100.794 1.00 20.00 ? 2    ASN D CB  1 
ATOM   10829 C CG  . ASN D 1 2   ? 35.882  91.138  102.306 1.00 20.00 ? 2    ASN D CG  1 
ATOM   10830 O OD1 . ASN D 1 2   ? 34.802  90.884  102.847 1.00 20.00 ? 2    ASN D OD1 1 
ATOM   10831 N ND2 . ASN D 1 2   ? 36.991  91.386  103.001 1.00 20.00 ? 2    ASN D ND2 1 
ATOM   10832 N N   . TYR D 1 3   ? 34.828  88.911  98.702  1.00 20.00 ? 3    TYR D N   1 
ATOM   10833 C CA  . TYR D 1 3   ? 34.180  88.639  97.427  1.00 20.00 ? 3    TYR D CA  1 
ATOM   10834 C C   . TYR D 1 3   ? 32.737  89.147  97.412  1.00 20.00 ? 3    TYR D C   1 
ATOM   10835 O O   . TYR D 1 3   ? 31.958  88.842  98.307  1.00 20.00 ? 3    TYR D O   1 
ATOM   10836 C CB  . TYR D 1 3   ? 34.202  87.141  97.161  1.00 20.00 ? 3    TYR D CB  1 
ATOM   10837 C CG  . TYR D 1 3   ? 35.558  86.518  97.379  1.00 20.00 ? 3    TYR D CG  1 
ATOM   10838 C CD1 . TYR D 1 3   ? 35.932  86.046  98.629  1.00 20.00 ? 3    TYR D CD1 1 
ATOM   10839 C CD2 . TYR D 1 3   ? 36.457  86.370  96.322  1.00 20.00 ? 3    TYR D CD2 1 
ATOM   10840 C CE1 . TYR D 1 3   ? 37.159  85.436  98.825  1.00 20.00 ? 3    TYR D CE1 1 
ATOM   10841 C CE2 . TYR D 1 3   ? 37.695  85.759  96.508  1.00 20.00 ? 3    TYR D CE2 1 
ATOM   10842 C CZ  . TYR D 1 3   ? 38.034  85.294  97.763  1.00 20.00 ? 3    TYR D CZ  1 
ATOM   10843 O OH  . TYR D 1 3   ? 39.245  84.678  97.965  1.00 20.00 ? 3    TYR D OH  1 
ATOM   10844 N N   . PRO D 1 4   ? 32.373  89.934  96.392  1.00 20.00 ? 4    PRO D N   1 
ATOM   10845 C CA  . PRO D 1 4   ? 31.075  90.606  96.405  1.00 20.00 ? 4    PRO D CA  1 
ATOM   10846 C C   . PRO D 1 4   ? 29.935  89.628  96.173  1.00 20.00 ? 4    PRO D C   1 
ATOM   10847 O O   . PRO D 1 4   ? 30.126  88.565  95.583  1.00 20.00 ? 4    PRO D O   1 
ATOM   10848 C CB  . PRO D 1 4   ? 31.184  91.613  95.270  1.00 20.00 ? 4    PRO D CB  1 
ATOM   10849 C CG  . PRO D 1 4   ? 32.133  90.995  94.336  1.00 20.00 ? 4    PRO D CG  1 
ATOM   10850 C CD  . PRO D 1 4   ? 33.127  90.240  95.166  1.00 20.00 ? 4    PRO D CD  1 
ATOM   10851 N N   . ALA D 1 5   ? 28.757  89.990  96.664  1.00 20.00 ? 5    ALA D N   1 
ATOM   10852 C CA  . ALA D 1 5   ? 27.575  89.163  96.511  1.00 20.00 ? 5    ALA D CA  1 
ATOM   10853 C C   . ALA D 1 5   ? 27.097  89.435  95.095  1.00 20.00 ? 5    ALA D C   1 
ATOM   10854 O O   . ALA D 1 5   ? 27.458  90.452  94.508  1.00 20.00 ? 5    ALA D O   1 
ATOM   10855 C CB  . ALA D 1 5   ? 26.513  89.583  97.512  1.00 20.00 ? 5    ALA D CB  1 
ATOM   10856 N N   . GLU D 1 6   ? 26.299  88.535  94.537  1.00 20.00 ? 6    GLU D N   1 
ATOM   10857 C CA  . GLU D 1 6   ? 25.800  88.728  93.181  1.00 20.00 ? 6    GLU D CA  1 
ATOM   10858 C C   . GLU D 1 6   ? 25.078  90.066  93.098  1.00 20.00 ? 6    GLU D C   1 
ATOM   10859 O O   . GLU D 1 6   ? 24.239  90.383  93.941  1.00 20.00 ? 6    GLU D O   1 
ATOM   10860 C CB  . GLU D 1 6   ? 24.847  87.592  92.808  1.00 20.00 ? 6    GLU D CB  1 
ATOM   10861 C CG  . GLU D 1 6   ? 25.524  86.233  92.712  1.00 20.00 ? 6    GLU D CG  1 
ATOM   10862 C CD  . GLU D 1 6   ? 25.684  85.545  94.065  1.00 20.00 ? 6    GLU D CD  1 
ATOM   10863 O OE1 . GLU D 1 6   ? 25.268  86.121  95.091  1.00 20.00 ? 6    GLU D OE1 1 
ATOM   10864 O OE2 . GLU D 1 6   ? 26.231  84.424  94.104  1.00 20.00 ? 6    GLU D OE2 1 
ATOM   10865 N N   . PRO D 1 7   ? 25.404  90.882  92.088  1.00 20.00 ? 7    PRO D N   1 
ATOM   10866 C CA  . PRO D 1 7   ? 24.725  92.166  91.908  1.00 20.00 ? 7    PRO D CA  1 
ATOM   10867 C C   . PRO D 1 7   ? 23.433  92.040  91.097  1.00 20.00 ? 7    PRO D C   1 
ATOM   10868 O O   . PRO D 1 7   ? 23.117  92.898  90.267  1.00 20.00 ? 7    PRO D O   1 
ATOM   10869 C CB  . PRO D 1 7   ? 25.770  93.013  91.198  1.00 20.00 ? 7    PRO D CB  1 
ATOM   10870 C CG  . PRO D 1 7   ? 26.598  92.031  90.437  1.00 20.00 ? 7    PRO D CG  1 
ATOM   10871 C CD  . PRO D 1 7   ? 26.440  90.669  91.064  1.00 20.00 ? 7    PRO D CD  1 
ATOM   10872 N N   . PHE D 1 8   ? 22.694  90.965  91.344  1.00 20.00 ? 8    PHE D N   1 
ATOM   10873 C CA  . PHE D 1 8   ? 21.439  90.704  90.649  1.00 20.00 ? 8    PHE D CA  1 
ATOM   10874 C C   . PHE D 1 8   ? 20.665  89.650  91.419  1.00 20.00 ? 8    PHE D C   1 
ATOM   10875 O O   . PHE D 1 8   ? 21.194  89.055  92.338  1.00 20.00 ? 8    PHE D O   1 
ATOM   10876 C CB  . PHE D 1 8   ? 21.719  90.188  89.233  1.00 20.00 ? 8    PHE D CB  1 
ATOM   10877 C CG  . PHE D 1 8   ? 22.674  89.021  89.184  1.00 20.00 ? 8    PHE D CG  1 
ATOM   10878 C CD1 . PHE D 1 8   ? 22.267  87.751  89.565  1.00 20.00 ? 8    PHE D CD1 1 
ATOM   10879 C CD2 . PHE D 1 8   ? 23.984  89.197  88.766  1.00 20.00 ? 8    PHE D CD2 1 
ATOM   10880 C CE1 . PHE D 1 8   ? 23.151  86.677  89.532  1.00 20.00 ? 8    PHE D CE1 1 
ATOM   10881 C CE2 . PHE D 1 8   ? 24.876  88.126  88.729  1.00 20.00 ? 8    PHE D CE2 1 
ATOM   10882 C CZ  . PHE D 1 8   ? 24.460  86.867  89.112  1.00 20.00 ? 8    PHE D CZ  1 
ATOM   10883 N N   . ARG D 1 9   ? 19.405  89.442  91.058  1.00 20.00 ? 9    ARG D N   1 
ATOM   10884 C CA  . ARG D 1 9   ? 18.579  88.444  91.726  1.00 20.00 ? 9    ARG D CA  1 
ATOM   10885 C C   . ARG D 1 9   ? 18.324  87.374  90.691  1.00 20.00 ? 9    ARG D C   1 
ATOM   10886 O O   . ARG D 1 9   ? 18.525  87.605  89.509  1.00 20.00 ? 9    ARG D O   1 
ATOM   10887 C CB  . ARG D 1 9   ? 17.230  89.025  92.143  1.00 20.00 ? 9    ARG D CB  1 
ATOM   10888 C CG  . ARG D 1 9   ? 17.309  90.321  92.898  1.00 20.00 ? 9    ARG D CG  1 
ATOM   10889 C CD  . ARG D 1 9   ? 15.974  90.621  93.498  1.00 20.00 ? 9    ARG D CD  1 
ATOM   10890 N NE  . ARG D 1 9   ? 15.887  91.981  93.998  1.00 20.00 ? 9    ARG D NE  1 
ATOM   10891 C CZ  . ARG D 1 9   ? 14.737  92.575  94.286  1.00 20.00 ? 9    ARG D CZ  1 
ATOM   10892 N NH1 . ARG D 1 9   ? 13.606  91.914  94.114  1.00 20.00 ? 9    ARG D NH1 1 
ATOM   10893 N NH2 . ARG D 1 9   ? 14.713  93.818  94.745  1.00 20.00 ? 9    ARG D NH2 1 
ATOM   10894 N N   . ILE D 1 10  ? 17.885  86.201  91.117  1.00 20.00 ? 10   ILE D N   1 
ATOM   10895 C CA  . ILE D 1 10  ? 17.614  85.144  90.157  1.00 20.00 ? 10   ILE D CA  1 
ATOM   10896 C C   . ILE D 1 10  ? 16.174  85.371  89.687  1.00 20.00 ? 10   ILE D C   1 
ATOM   10897 O O   . ILE D 1 10  ? 15.271  85.510  90.508  1.00 20.00 ? 10   ILE D O   1 
ATOM   10898 C CB  . ILE D 1 10  ? 17.753  83.737  90.802  1.00 20.00 ? 10   ILE D CB  1 
ATOM   10899 C CG1 . ILE D 1 10  ? 19.204  83.498  91.220  1.00 20.00 ? 10   ILE D CG1 1 
ATOM   10900 C CG2 . ILE D 1 10  ? 17.318  82.657  89.818  1.00 20.00 ? 10   ILE D CG2 1 
ATOM   10901 C CD1 . ILE D 1 10  ? 19.401  82.296  92.117  1.00 20.00 ? 10   ILE D CD1 1 
ATOM   10902 N N   . LYS D 1 11  ? 15.969  85.454  88.372  1.00 20.00 ? 11   LYS D N   1 
ATOM   10903 C CA  . LYS D 1 11  ? 14.629  85.666  87.826  1.00 20.00 ? 11   LYS D CA  1 
ATOM   10904 C C   . LYS D 1 11  ? 14.035  84.305  87.499  1.00 20.00 ? 11   LYS D C   1 
ATOM   10905 O O   . LYS D 1 11  ? 12.864  84.052  87.772  1.00 20.00 ? 11   LYS D O   1 
ATOM   10906 C CB  . LYS D 1 11  ? 14.666  86.533  86.564  1.00 20.00 ? 11   LYS D CB  1 
ATOM   10907 C CG  . LYS D 1 11  ? 13.354  86.544  85.798  1.00 20.00 ? 11   LYS D CG  1 
ATOM   10908 C CD  . LYS D 1 11  ? 12.267  87.300  86.556  1.00 20.00 ? 11   LYS D CD  1 
ATOM   10909 C CE  . LYS D 1 11  ? 11.005  87.413  85.711  1.00 20.00 ? 11   LYS D CE  1 
ATOM   10910 N NZ  . LYS D 1 11  ? 10.901  88.722  85.012  1.00 20.00 ? 11   LYS D NZ  1 
ATOM   10911 N N   . SER D 1 12  ? 14.847  83.434  86.910  1.00 20.00 ? 12   SER D N   1 
ATOM   10912 C CA  . SER D 1 12  ? 14.391  82.099  86.566  1.00 20.00 ? 12   SER D CA  1 
ATOM   10913 C C   . SER D 1 12  ? 15.557  81.118  86.683  1.00 20.00 ? 12   SER D C   1 
ATOM   10914 O O   . SER D 1 12  ? 16.716  81.479  86.523  1.00 20.00 ? 12   SER D O   1 
ATOM   10915 C CB  . SER D 1 12  ? 13.758  82.070  85.170  1.00 20.00 ? 12   SER D CB  1 
ATOM   10916 O OG  . SER D 1 12  ? 14.718  81.980  84.146  1.00 20.00 ? 12   SER D OG  1 
ATOM   10917 N N   . VAL D 1 13  ? 15.244  79.869  86.981  1.00 20.00 ? 13   VAL D N   1 
ATOM   10918 C CA  . VAL D 1 13  ? 16.278  78.871  87.127  1.00 20.00 ? 13   VAL D CA  1 
ATOM   10919 C C   . VAL D 1 13  ? 16.166  77.732  86.131  1.00 20.00 ? 13   VAL D C   1 
ATOM   10920 O O   . VAL D 1 13  ? 15.128  77.505  85.524  1.00 20.00 ? 13   VAL D O   1 
ATOM   10921 C CB  . VAL D 1 13  ? 16.250  78.260  88.557  1.00 20.00 ? 13   VAL D CB  1 
ATOM   10922 C CG1 . VAL D 1 13  ? 16.082  79.353  89.594  1.00 20.00 ? 13   VAL D CG1 1 
ATOM   10923 C CG2 . VAL D 1 13  ? 15.107  77.266  88.678  1.00 20.00 ? 13   VAL D CG2 1 
ATOM   10924 N N   . GLU D 1 14  ? 17.268  77.015  85.978  1.00 20.00 ? 14   GLU D N   1 
ATOM   10925 C CA  . GLU D 1 14  ? 17.340  75.886  85.082  1.00 20.00 ? 14   GLU D CA  1 
ATOM   10926 C C   . GLU D 1 14  ? 17.458  74.697  86.025  1.00 20.00 ? 14   GLU D C   1 
ATOM   10927 O O   . GLU D 1 14  ? 18.492  74.511  86.668  1.00 20.00 ? 14   GLU D O   1 
ATOM   10928 C CB  . GLU D 1 14  ? 18.583  76.003  84.204  1.00 20.00 ? 14   GLU D CB  1 
ATOM   10929 C CG  . GLU D 1 14  ? 18.687  74.955  83.148  1.00 20.00 ? 14   GLU D CG  1 
ATOM   10930 C CD  . GLU D 1 14  ? 19.678  75.320  82.063  1.00 20.00 ? 14   GLU D CD  1 
ATOM   10931 O OE1 . GLU D 1 14  ? 20.395  76.332  82.209  1.00 20.00 ? 14   GLU D OE1 1 
ATOM   10932 O OE2 . GLU D 1 14  ? 19.738  74.587  81.059  1.00 20.00 ? 14   GLU D OE2 1 
ATOM   10933 N N   . THR D 1 15  ? 16.391  73.914  86.141  1.00 20.00 ? 15   THR D N   1 
ATOM   10934 C CA  . THR D 1 15  ? 16.406  72.750  87.024  1.00 20.00 ? 15   THR D CA  1 
ATOM   10935 C C   . THR D 1 15  ? 17.438  71.722  86.554  1.00 20.00 ? 15   THR D C   1 
ATOM   10936 O O   . THR D 1 15  ? 17.719  71.601  85.359  1.00 20.00 ? 15   THR D O   1 
ATOM   10937 C CB  . THR D 1 15  ? 15.016  72.055  87.083  1.00 20.00 ? 15   THR D CB  1 
ATOM   10938 O OG1 . THR D 1 15  ? 14.469  71.954  85.761  1.00 20.00 ? 15   THR D OG1 1 
ATOM   10939 C CG2 . THR D 1 15  ? 14.057  72.846  87.965  1.00 20.00 ? 15   THR D CG2 1 
ATOM   10940 N N   . VAL D 1 16  ? 18.006  70.984  87.500  1.00 20.00 ? 16   VAL D N   1 
ATOM   10941 C CA  . VAL D 1 16  ? 18.996  69.975  87.174  1.00 20.00 ? 16   VAL D CA  1 
ATOM   10942 C C   . VAL D 1 16  ? 18.665  68.702  87.918  1.00 20.00 ? 16   VAL D C   1 
ATOM   10943 O O   . VAL D 1 16  ? 18.072  68.730  88.994  1.00 20.00 ? 16   VAL D O   1 
ATOM   10944 C CB  . VAL D 1 16  ? 20.443  70.409  87.566  1.00 20.00 ? 16   VAL D CB  1 
ATOM   10945 C CG1 . VAL D 1 16  ? 20.778  71.761  86.956  1.00 20.00 ? 16   VAL D CG1 1 
ATOM   10946 C CG2 . VAL D 1 16  ? 20.585  70.458  89.075  1.00 20.00 ? 16   VAL D CG2 1 
ATOM   10947 N N   . SER D 1 17  ? 19.048  67.580  87.329  1.00 20.00 ? 17   SER D N   1 
ATOM   10948 C CA  . SER D 1 17  ? 18.801  66.283  87.934  1.00 20.00 ? 17   SER D CA  1 
ATOM   10949 C C   . SER D 1 17  ? 20.046  65.917  88.737  1.00 20.00 ? 17   SER D C   1 
ATOM   10950 O O   . SER D 1 17  ? 21.142  65.790  88.175  1.00 20.00 ? 17   SER D O   1 
ATOM   10951 C CB  . SER D 1 17  ? 18.549  65.239  86.843  1.00 20.00 ? 17   SER D CB  1 
ATOM   10952 O OG  . SER D 1 17  ? 17.159  65.056  86.616  1.00 20.00 ? 17   SER D OG  1 
ATOM   10953 N N   . MET D 1 18  ? 19.883  65.760  90.047  1.00 20.00 ? 18   MET D N   1 
ATOM   10954 C CA  . MET D 1 18  ? 21.006  65.414  90.906  1.00 20.00 ? 18   MET D CA  1 
ATOM   10955 C C   . MET D 1 18  ? 21.179  63.902  91.017  1.00 20.00 ? 18   MET D C   1 
ATOM   10956 O O   . MET D 1 18  ? 20.757  63.292  91.996  1.00 20.00 ? 18   MET D O   1 
ATOM   10957 C CB  . MET D 1 18  ? 20.808  66.020  92.296  1.00 20.00 ? 18   MET D CB  1 
ATOM   10958 C CG  . MET D 1 18  ? 20.308  67.461  92.290  1.00 20.00 ? 18   MET D CG  1 
ATOM   10959 S SD  . MET D 1 18  ? 21.617  68.705  92.115  1.00 20.00 ? 18   MET D SD  1 
ATOM   10960 C CE  . MET D 1 18  ? 22.453  68.558  93.672  1.00 20.00 ? 18   MET D CE  1 
ATOM   10961 N N   . ILE D 1 19  ? 21.802  63.300  90.010  1.00 20.00 ? 19   ILE D N   1 
ATOM   10962 C CA  . ILE D 1 19  ? 22.018  61.861  90.017  1.00 20.00 ? 19   ILE D CA  1 
ATOM   10963 C C   . ILE D 1 19  ? 23.115  61.495  91.011  1.00 20.00 ? 19   ILE D C   1 
ATOM   10964 O O   . ILE D 1 19  ? 23.991  62.305  91.309  1.00 20.00 ? 19   ILE D O   1 
ATOM   10965 C CB  . ILE D 1 19  ? 22.392  61.348  88.611  1.00 20.00 ? 19   ILE D CB  1 
ATOM   10966 C CG1 . ILE D 1 19  ? 23.743  61.909  88.174  1.00 20.00 ? 19   ILE D CG1 1 
ATOM   10967 C CG2 . ILE D 1 19  ? 21.323  61.767  87.621  1.00 20.00 ? 19   ILE D CG2 1 
ATOM   10968 C CD1 . ILE D 1 19  ? 24.168  61.445  86.791  1.00 20.00 ? 19   ILE D CD1 1 
ATOM   10969 N N   . SER D 1 20  ? 23.055  60.273  91.528  1.00 20.00 ? 20   SER D N   1 
ATOM   10970 C CA  . SER D 1 20  ? 24.036  59.787  92.494  1.00 20.00 ? 20   SER D CA  1 
ATOM   10971 C C   . SER D 1 20  ? 25.421  59.578  91.890  1.00 20.00 ? 20   SER D C   1 
ATOM   10972 O O   . SER D 1 20  ? 25.597  59.647  90.677  1.00 20.00 ? 20   SER D O   1 
ATOM   10973 C CB  . SER D 1 20  ? 23.551  58.468  93.095  1.00 20.00 ? 20   SER D CB  1 
ATOM   10974 O OG  . SER D 1 20  ? 23.643  57.417  92.142  1.00 20.00 ? 20   SER D OG  1 
ATOM   10975 N N   . ARG D 1 21  ? 26.399  59.314  92.754  1.00 20.00 ? 21   ARG D N   1 
ATOM   10976 C CA  . ARG D 1 21  ? 27.773  59.085  92.319  1.00 20.00 ? 21   ARG D CA  1 
ATOM   10977 C C   . ARG D 1 21  ? 27.848  57.820  91.464  1.00 20.00 ? 21   ARG D C   1 
ATOM   10978 O O   . ARG D 1 21  ? 28.603  57.749  90.489  1.00 20.00 ? 21   ARG D O   1 
ATOM   10979 C CB  . ARG D 1 21  ? 28.698  58.931  93.533  1.00 20.00 ? 21   ARG D CB  1 
ATOM   10980 C CG  . ARG D 1 21  ? 30.175  59.022  93.178  1.00 20.00 ? 21   ARG D CG  1 
ATOM   10981 C CD  . ARG D 1 21  ? 31.069  58.463  94.258  1.00 20.00 ? 21   ARG D CD  1 
ATOM   10982 N NE  . ARG D 1 21  ? 31.649  57.203  93.818  1.00 20.00 ? 21   ARG D NE  1 
ATOM   10983 C CZ  . ARG D 1 21  ? 32.813  57.079  93.190  1.00 20.00 ? 21   ARG D CZ  1 
ATOM   10984 N NH1 . ARG D 1 21  ? 33.551  58.145  92.915  1.00 20.00 ? 21   ARG D NH1 1 
ATOM   10985 N NH2 . ARG D 1 21  ? 33.223  55.877  92.813  1.00 20.00 ? 21   ARG D NH2 1 
ATOM   10986 N N   . ASP D 1 22  ? 27.054  56.822  91.839  1.00 20.00 ? 22   ASP D N   1 
ATOM   10987 C CA  . ASP D 1 22  ? 27.018  55.555  91.121  1.00 20.00 ? 22   ASP D CA  1 
ATOM   10988 C C   . ASP D 1 22  ? 26.567  55.765  89.684  1.00 20.00 ? 22   ASP D C   1 
ATOM   10989 O O   . ASP D 1 22  ? 27.104  55.155  88.760  1.00 20.00 ? 22   ASP D O   1 
ATOM   10990 C CB  . ASP D 1 22  ? 26.075  54.582  91.826  1.00 20.00 ? 22   ASP D CB  1 
ATOM   10991 C CG  . ASP D 1 22  ? 26.776  53.762  92.893  1.00 20.00 ? 22   ASP D CG  1 
ATOM   10992 O OD1 . ASP D 1 22  ? 27.722  54.285  93.521  1.00 20.00 ? 22   ASP D OD1 1 
ATOM   10993 O OD2 . ASP D 1 22  ? 26.382  52.594  93.104  1.00 20.00 ? 22   ASP D OD2 1 
ATOM   10994 N N   . GLU D 1 23  ? 25.573  56.629  89.503  1.00 20.00 ? 23   GLU D N   1 
ATOM   10995 C CA  . GLU D 1 23  ? 25.055  56.918  88.172  1.00 20.00 ? 23   GLU D CA  1 
ATOM   10996 C C   . GLU D 1 23  ? 26.098  57.675  87.367  1.00 20.00 ? 23   GLU D C   1 
ATOM   10997 O O   . GLU D 1 23  ? 26.342  57.363  86.207  1.00 20.00 ? 23   GLU D O   1 
ATOM   10998 C CB  . GLU D 1 23  ? 23.786  57.765  88.261  1.00 20.00 ? 23   GLU D CB  1 
ATOM   10999 C CG  . GLU D 1 23  ? 22.620  57.081  88.938  1.00 20.00 ? 23   GLU D CG  1 
ATOM   11000 C CD  . GLU D 1 23  ? 21.419  57.999  89.056  1.00 20.00 ? 23   GLU D CD  1 
ATOM   11001 O OE1 . GLU D 1 23  ? 20.779  58.270  88.013  1.00 20.00 ? 23   GLU D OE1 1 
ATOM   11002 O OE2 . GLU D 1 23  ? 21.117  58.453  90.187  1.00 20.00 ? 23   GLU D OE2 1 
ATOM   11003 N N   . ARG D 1 24  ? 26.714  58.675  87.989  1.00 20.00 ? 24   ARG D N   1 
ATOM   11004 C CA  . ARG D 1 24  ? 27.728  59.467  87.310  1.00 20.00 ? 24   ARG D CA  1 
ATOM   11005 C C   . ARG D 1 24  ? 28.835  58.561  86.804  1.00 20.00 ? 24   ARG D C   1 
ATOM   11006 O O   . ARG D 1 24  ? 29.296  58.701  85.671  1.00 20.00 ? 24   ARG D O   1 
ATOM   11007 C CB  . ARG D 1 24  ? 28.281  60.533  88.255  1.00 20.00 ? 24   ARG D CB  1 
ATOM   11008 C CG  . ARG D 1 24  ? 27.260  61.594  88.603  1.00 20.00 ? 24   ARG D CG  1 
ATOM   11009 C CD  . ARG D 1 24  ? 27.922  62.845  89.134  1.00 20.00 ? 24   ARG D CD  1 
ATOM   11010 N NE  . ARG D 1 24  ? 28.749  62.565  90.303  1.00 20.00 ? 24   ARG D NE  1 
ATOM   11011 C CZ  . ARG D 1 24  ? 28.362  62.782  91.556  1.00 20.00 ? 24   ARG D CZ  1 
ATOM   11012 N NH1 . ARG D 1 24  ? 27.156  63.282  91.805  1.00 20.00 ? 24   ARG D NH1 1 
ATOM   11013 N NH2 . ARG D 1 24  ? 29.174  62.493  92.563  1.00 20.00 ? 24   ARG D NH2 1 
ATOM   11014 N N   . VAL D 1 25  ? 29.253  57.621  87.642  1.00 20.00 ? 25   VAL D N   1 
ATOM   11015 C CA  . VAL D 1 25  ? 30.305  56.693  87.255  1.00 20.00 ? 25   VAL D CA  1 
ATOM   11016 C C   . VAL D 1 25  ? 29.842  55.892  86.038  1.00 20.00 ? 25   VAL D C   1 
ATOM   11017 O O   . VAL D 1 25  ? 30.603  55.663  85.102  1.00 20.00 ? 25   VAL D O   1 
ATOM   11018 C CB  . VAL D 1 25  ? 30.631  55.721  88.399  1.00 20.00 ? 25   VAL D CB  1 
ATOM   11019 C CG1 . VAL D 1 25  ? 31.658  54.700  87.933  1.00 20.00 ? 25   VAL D CG1 1 
ATOM   11020 C CG2 . VAL D 1 25  ? 31.149  56.495  89.597  1.00 20.00 ? 25   VAL D CG2 1 
ATOM   11021 N N   . LYS D 1 26  ? 28.583  55.472  86.059  1.00 20.00 ? 26   LYS D N   1 
ATOM   11022 C CA  . LYS D 1 26  ? 28.015  54.704  84.961  1.00 20.00 ? 26   LYS D CA  1 
ATOM   11023 C C   . LYS D 1 26  ? 27.954  55.544  83.691  1.00 20.00 ? 26   LYS D C   1 
ATOM   11024 O O   . LYS D 1 26  ? 28.202  55.044  82.595  1.00 20.00 ? 26   LYS D O   1 
ATOM   11025 C CB  . LYS D 1 26  ? 26.617  54.222  85.335  1.00 20.00 ? 26   LYS D CB  1 
ATOM   11026 C CG  . LYS D 1 26  ? 26.614  52.858  86.014  1.00 20.00 ? 26   LYS D CG  1 
ATOM   11027 C CD  . LYS D 1 26  ? 25.502  52.727  87.047  1.00 20.00 ? 26   LYS D CD  1 
ATOM   11028 C CE  . LYS D 1 26  ? 24.116  52.657  86.407  1.00 20.00 ? 26   LYS D CE  1 
ATOM   11029 N NZ  . LYS D 1 26  ? 23.061  52.293  87.407  1.00 20.00 ? 26   LYS D NZ  1 
ATOM   11030 N N   . LYS D 1 27  ? 27.623  56.823  83.848  1.00 20.00 ? 27   LYS D N   1 
ATOM   11031 C CA  . LYS D 1 27  ? 27.534  57.740  82.721  1.00 20.00 ? 27   LYS D CA  1 
ATOM   11032 C C   . LYS D 1 27  ? 28.921  58.026  82.158  1.00 20.00 ? 27   LYS D C   1 
ATOM   11033 O O   . LYS D 1 27  ? 29.116  58.032  80.939  1.00 20.00 ? 27   LYS D O   1 
ATOM   11034 C CB  . LYS D 1 27  ? 26.887  59.053  83.159  1.00 20.00 ? 27   LYS D CB  1 
ATOM   11035 C CG  . LYS D 1 27  ? 25.432  59.185  82.758  1.00 20.00 ? 27   LYS D CG  1 
ATOM   11036 C CD  . LYS D 1 27  ? 24.516  58.917  83.935  1.00 20.00 ? 27   LYS D CD  1 
ATOM   11037 C CE  . LYS D 1 27  ? 23.084  58.716  83.482  1.00 20.00 ? 27   LYS D CE  1 
ATOM   11038 N NZ  . LYS D 1 27  ? 22.992  58.465  82.021  1.00 20.00 ? 27   LYS D NZ  1 
ATOM   11039 N N   . MET D 1 28  ? 29.884  58.268  83.045  1.00 20.00 ? 28   MET D N   1 
ATOM   11040 C CA  . MET D 1 28  ? 31.253  58.554  82.619  1.00 20.00 ? 28   MET D CA  1 
ATOM   11041 C C   . MET D 1 28  ? 31.769  57.358  81.823  1.00 20.00 ? 28   MET D C   1 
ATOM   11042 O O   . MET D 1 28  ? 32.478  57.512  80.821  1.00 20.00 ? 28   MET D O   1 
ATOM   11043 C CB  . MET D 1 28  ? 32.146  58.807  83.841  1.00 20.00 ? 28   MET D CB  1 
ATOM   11044 C CG  . MET D 1 28  ? 33.480  59.539  83.565  1.00 20.00 ? 28   MET D CG  1 
ATOM   11045 S SD  . MET D 1 28  ? 33.435  60.863  82.333  1.00 20.00 ? 28   MET D SD  1 
ATOM   11046 C CE  . MET D 1 28  ? 33.886  62.240  83.264  1.00 20.00 ? 28   MET D CE  1 
ATOM   11047 N N   . GLN D 1 29  ? 31.400  56.162  82.272  1.00 20.00 ? 29   GLN D N   1 
ATOM   11048 C CA  . GLN D 1 29  ? 31.819  54.936  81.608  1.00 20.00 ? 29   GLN D CA  1 
ATOM   11049 C C   . GLN D 1 29  ? 31.315  54.902  80.173  1.00 20.00 ? 29   GLN D C   1 
ATOM   11050 O O   . GLN D 1 29  ? 32.085  54.691  79.237  1.00 20.00 ? 29   GLN D O   1 
ATOM   11051 C CB  . GLN D 1 29  ? 31.276  53.731  82.354  1.00 20.00 ? 29   GLN D CB  1 
ATOM   11052 C CG  . GLN D 1 29  ? 32.118  53.308  83.527  1.00 20.00 ? 29   GLN D CG  1 
ATOM   11053 C CD  . GLN D 1 29  ? 31.759  51.920  84.010  1.00 20.00 ? 29   GLN D CD  1 
ATOM   11054 O OE1 . GLN D 1 29  ? 31.088  51.761  85.033  1.00 20.00 ? 29   GLN D OE1 1 
ATOM   11055 N NE2 . GLN D 1 29  ? 32.202  50.901  83.272  1.00 20.00 ? 29   GLN D NE2 1 
ATOM   11056 N N   . GLU D 1 30  ? 30.012  55.109  80.010  1.00 20.00 ? 30   GLU D N   1 
ATOM   11057 C CA  . GLU D 1 30  ? 29.397  55.103  78.688  1.00 20.00 ? 30   GLU D CA  1 
ATOM   11058 C C   . GLU D 1 30  ? 29.914  56.233  77.817  1.00 20.00 ? 30   GLU D C   1 
ATOM   11059 O O   . GLU D 1 30  ? 29.775  56.190  76.600  1.00 20.00 ? 30   GLU D O   1 
ATOM   11060 C CB  . GLU D 1 30  ? 27.884  55.237  78.803  1.00 20.00 ? 30   GLU D CB  1 
ATOM   11061 C CG  . GLU D 1 30  ? 27.250  54.287  79.775  1.00 20.00 ? 30   GLU D CG  1 
ATOM   11062 C CD  . GLU D 1 30  ? 25.746  54.347  79.704  1.00 20.00 ? 30   GLU D CD  1 
ATOM   11063 O OE1 . GLU D 1 30  ? 25.200  55.470  79.669  1.00 20.00 ? 30   GLU D OE1 1 
ATOM   11064 O OE2 . GLU D 1 30  ? 25.110  53.274  79.679  1.00 20.00 ? 30   GLU D OE2 1 
ATOM   11065 N N   . ALA D 1 31  ? 30.489  57.253  78.442  1.00 20.00 ? 31   ALA D N   1 
ATOM   11066 C CA  . ALA D 1 31  ? 31.020  58.387  77.698  1.00 20.00 ? 31   ALA D CA  1 
ATOM   11067 C C   . ALA D 1 31  ? 32.455  58.096  77.290  1.00 20.00 ? 31   ALA D C   1 
ATOM   11068 O O   . ALA D 1 31  ? 33.118  58.933  76.682  1.00 20.00 ? 31   ALA D O   1 
ATOM   11069 C CB  . ALA D 1 31  ? 30.967  59.648  78.556  1.00 20.00 ? 31   ALA D CB  1 
ATOM   11070 N N   . GLY D 1 32  ? 32.931  56.904  77.633  1.00 20.00 ? 32   GLY D N   1 
ATOM   11071 C CA  . GLY D 1 32  ? 34.292  56.532  77.293  1.00 20.00 ? 32   GLY D CA  1 
ATOM   11072 C C   . GLY D 1 32  ? 35.313  57.330  78.089  1.00 20.00 ? 32   GLY D C   1 
ATOM   11073 O O   . GLY D 1 32  ? 36.463  57.498  77.663  1.00 20.00 ? 32   GLY D O   1 
ATOM   11074 N N   . TYR D 1 33  ? 34.889  57.820  79.252  1.00 20.00 ? 33   TYR D N   1 
ATOM   11075 C CA  . TYR D 1 33  ? 35.750  58.610  80.126  1.00 20.00 ? 33   TYR D CA  1 
ATOM   11076 C C   . TYR D 1 33  ? 36.121  59.944  79.500  1.00 20.00 ? 33   TYR D C   1 
ATOM   11077 O O   . TYR D 1 33  ? 37.062  60.603  79.944  1.00 20.00 ? 33   TYR D O   1 
ATOM   11078 C CB  . TYR D 1 33  ? 37.014  57.825  80.485  1.00 20.00 ? 33   TYR D CB  1 
ATOM   11079 C CG  . TYR D 1 33  ? 36.713  56.693  81.424  1.00 20.00 ? 33   TYR D CG  1 
ATOM   11080 C CD1 . TYR D 1 33  ? 36.259  56.947  82.714  1.00 20.00 ? 33   TYR D CD1 1 
ATOM   11081 C CD2 . TYR D 1 33  ? 36.795  55.373  81.003  1.00 20.00 ? 33   TYR D CD2 1 
ATOM   11082 C CE1 . TYR D 1 33  ? 35.885  55.915  83.559  1.00 20.00 ? 33   TYR D CE1 1 
ATOM   11083 C CE2 . TYR D 1 33  ? 36.424  54.330  81.844  1.00 20.00 ? 33   TYR D CE2 1 
ATOM   11084 C CZ  . TYR D 1 33  ? 35.966  54.615  83.120  1.00 20.00 ? 33   TYR D CZ  1 
ATOM   11085 O OH  . TYR D 1 33  ? 35.565  53.607  83.962  1.00 20.00 ? 33   TYR D OH  1 
ATOM   11086 N N   . ASN D 1 34  ? 35.374  60.334  78.471  1.00 20.00 ? 34   ASN D N   1 
ATOM   11087 C CA  . ASN D 1 34  ? 35.608  61.594  77.774  1.00 20.00 ? 34   ASN D CA  1 
ATOM   11088 C C   . ASN D 1 34  ? 34.454  62.520  78.148  1.00 20.00 ? 34   ASN D C   1 
ATOM   11089 O O   . ASN D 1 34  ? 33.295  62.210  77.873  1.00 20.00 ? 34   ASN D O   1 
ATOM   11090 C CB  . ASN D 1 34  ? 35.642  61.365  76.258  1.00 20.00 ? 34   ASN D CB  1 
ATOM   11091 C CG  . ASN D 1 34  ? 35.931  62.629  75.489  1.00 20.00 ? 34   ASN D CG  1 
ATOM   11092 O OD1 . ASN D 1 34  ? 35.995  63.711  76.066  1.00 20.00 ? 34   ASN D OD1 1 
ATOM   11093 N ND2 . ASN D 1 34  ? 36.109  62.503  74.178  1.00 20.00 ? 34   ASN D ND2 1 
AT