data_1C99
# 
_entry.id   1C99 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1C99         
RCSB  RCSB000981   
WWPDB D_1000000981 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1C99 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-30 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rastogi, V.K.' 1 
'Girvin, M.E.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural changes linked to proton translocation by subunit c of the ATP synthase.'                             Nature 
402 263  268  1999 NATUAS UK 0028-0836 0006 ? 10580496 10.1038/46224           
1       '1H, 13C, and 15N assignments and secondary structure of the high pH form of subunit c of the F1F0 ATP synthase.' 
J.Biomol.Nmr 13  91   92   1999 JBNME9 NE 0925-2738 0800 ? 10070750 10.1023/a:1008379624478 
2       'Solution structure of the transmembrane H+-transporting subunit c of the F1F0 ATP synthase.'                     
Biochemistry 37  8817 8824 1998 BICHAW US 0006-2960 0033 ? 9636021  10.1021/bi980511m       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rastogi, V.K.'    1 ? 
primary 'Girvin, M.E.'     2 ? 
1       'Rastogi, V.K.'    3 ? 
1       'Girvin, M.E.'     4 ? 
2       'Girvin, M.E.'     5 ? 
2       'Rastogi, V.K.'    6 ? 
2       'Abildgaard, F.'   7 ? 
2       'Markley, J.L.'    8 ? 
2       'Fillingame, R.H.' 9 ? 
# 
_cell.entry_id           1C99 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1C99 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PROTEOLIPID F1FO OF ATP SYNTHASE' 
_entity.formula_weight             8259.064 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.6.1.34 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'subunit c' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PROTEOLIPID, DCCD-BINDING PROTEIN' 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.3.6.1.34 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA 
_entity_poly.pdbx_seq_one_letter_code_can   MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLU n 
1 3  ASN n 
1 4  LEU n 
1 5  ASN n 
1 6  MET n 
1 7  ASP n 
1 8  LEU n 
1 9  LEU n 
1 10 TYR n 
1 11 MET n 
1 12 ALA n 
1 13 ALA n 
1 14 ALA n 
1 15 VAL n 
1 16 MET n 
1 17 MET n 
1 18 GLY n 
1 19 LEU n 
1 20 ALA n 
1 21 ALA n 
1 22 ILE n 
1 23 GLY n 
1 24 ALA n 
1 25 ALA n 
1 26 ILE n 
1 27 GLY n 
1 28 ILE n 
1 29 GLY n 
1 30 ILE n 
1 31 LEU n 
1 32 GLY n 
1 33 GLY n 
1 34 LYS n 
1 35 PHE n 
1 36 LEU n 
1 37 GLU n 
1 38 GLY n 
1 39 ALA n 
1 40 ALA n 
1 41 ARG n 
1 42 GLN n 
1 43 PRO n 
1 44 ASP n 
1 45 LEU n 
1 46 ILE n 
1 47 PRO n 
1 48 LEU n 
1 49 LEU n 
1 50 ARG n 
1 51 THR n 
1 52 GLN n 
1 53 PHE n 
1 54 PHE n 
1 55 ILE n 
1 56 VAL n 
1 57 MET n 
1 58 GLY n 
1 59 LEU n 
1 60 VAL n 
1 61 ASP n 
1 62 ALA n 
1 63 ILE n 
1 64 PRO n 
1 65 MET n 
1 66 ILE n 
1 67 ALA n 
1 68 VAL n 
1 69 GLY n 
1 70 LEU n 
1 71 GLY n 
1 72 LEU n 
1 73 TYR n 
1 74 VAL n 
1 75 MET n 
1 76 PHE n 
1 77 ALA n 
1 78 VAL n 
1 79 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 UNCE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ER 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    MEMBRANE 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ER 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ATPL_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P68699 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1C99 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 79 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P68699 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  79 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       79 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1  1 HSQC       1 
2  1 TOCSY-HSQC 1 
3  1 NOESY-HSQC 1 
4  1 HNCO       1 
5  1 HNHA       1 
6  1 'HN(CO)CA' 1 
7  1 HNCACB     1 
8  1 'H(CCO)NH' 1 
9  1 'C(CO)NH'  1 
10 1 HCACO      1 
11 1 HCCH-COSY  1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  8.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DRX600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           1C99 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1C99 
_pdbx_nmr_details.text       
;THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 
15N-LABELED SUBUNIT C
;
# 
_pdbx_nmr_ensemble.entry_id                                      1C99 
_pdbx_nmr_ensemble.conformers_calculated_total_number            20 
_pdbx_nmr_ensemble.conformers_submitted_total_number             9 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'LEAST RESTRAINT VIOLATION' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1C99 
_pdbx_nmr_representative.conformer_id         9 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR  3.854 BRUNGER               1 
refinement           CNS     0.3   'BRUNGER et al.'      2 
'data analysis'      NMRPipe ?     'Delaglio, F. et al.' 3 
'structure solution' DYANA   ?     'Guntert, P. et al.'  4 
# 
_exptl.entry_id          1C99 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1C99 
_struct.title                     'ASP61 DEPROTONATED FORM OF SUBUNIT C OF THE F1FO ATP SYNTHASE OF ESCHERICHIA COLI' 
_struct.pdbx_descriptor           'PROTEOLIPID F1FO ATPASE SUBUNIT C' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1C99 
_struct_keywords.pdbx_keywords   'PROTON TRANSPORT, HYDROLASE' 
_struct_keywords.text            'PROTEOLIPID F1FO, ATP SYNTHASE, PROTON TRANSLOCATION, PROTON TRANSPORT, HYDROLASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 2  ? ALA A 40 ? GLU A 2  ALA A 40 1 ? 39 
HELX_P HELX_P2 2 PRO A 47 ? VAL A 74 ? PRO A 47 VAL A 74 1 ? 28 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1C99 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1C99 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1  ? -4.729  -29.672 1.372   1.00 0.00 ? 1  MET A N    1 
ATOM 2     C CA   . MET A 1 1  ? -5.021  -28.313 1.904   1.00 0.00 ? 1  MET A CA   1 
ATOM 3     C C    . MET A 1 1  ? -4.175  -27.243 1.222   1.00 0.00 ? 1  MET A C    1 
ATOM 4     O O    . MET A 1 1  ? -4.425  -26.048 1.376   1.00 0.00 ? 1  MET A O    1 
ATOM 5     C CB   . MET A 1 1  ? -4.756  -28.317 3.410   1.00 0.00 ? 1  MET A CB   1 
ATOM 6     C CG   . MET A 1 1  ? -3.314  -28.619 3.777   1.00 0.00 ? 1  MET A CG   1 
ATOM 7     S SD   . MET A 1 1  ? -3.050  -28.677 5.561   1.00 0.00 ? 1  MET A SD   1 
ATOM 8     C CE   . MET A 1 1  ? -1.318  -29.128 5.632   1.00 0.00 ? 1  MET A CE   1 
ATOM 9     H H1   . MET A 1 1  ? -4.914  -29.656 0.349   1.00 0.00 ? 1  MET A H1   1 
ATOM 10    H H2   . MET A 1 1  ? -3.732  -29.885 1.570   1.00 0.00 ? 1  MET A H2   1 
ATOM 11    H H3   . MET A 1 1  ? -5.360  -30.342 1.858   1.00 0.00 ? 1  MET A H3   1 
ATOM 12    H HA   . MET A 1 1  ? -6.058  -28.096 1.728   1.00 0.00 ? 1  MET A HA   1 
ATOM 13    H HB2  . MET A 1 1  ? -5.013  -27.349 3.814   1.00 0.00 ? 1  MET A HB2  1 
ATOM 14    H HB3  . MET A 1 1  ? -5.380  -29.065 3.866   1.00 0.00 ? 1  MET A HB3  1 
ATOM 15    H HG2  . MET A 1 1  ? -3.040  -29.575 3.357   1.00 0.00 ? 1  MET A HG2  1 
ATOM 16    H HG3  . MET A 1 1  ? -2.684  -27.850 3.360   1.00 0.00 ? 1  MET A HG3  1 
ATOM 17    H HE1  . MET A 1 1  ? -0.884  -29.050 4.646   1.00 0.00 ? 1  MET A HE1  1 
ATOM 18    H HE2  . MET A 1 1  ? -0.800  -28.461 6.306   1.00 0.00 ? 1  MET A HE2  1 
ATOM 19    H HE3  . MET A 1 1  ? -1.224  -30.143 5.987   1.00 0.00 ? 1  MET A HE3  1 
ATOM 20    N N    . GLU A 1 2  ? -3.180  -27.681 0.469   1.00 0.00 ? 2  GLU A N    1 
ATOM 21    C CA   . GLU A 1 2  ? -2.295  -26.765 -0.240  1.00 0.00 ? 2  GLU A CA   1 
ATOM 22    C C    . GLU A 1 2  ? -3.048  -26.025 -1.339  1.00 0.00 ? 2  GLU A C    1 
ATOM 23    O O    . GLU A 1 2  ? -2.969  -24.800 -1.446  1.00 0.00 ? 2  GLU A O    1 
ATOM 24    C CB   . GLU A 1 2  ? -1.113  -27.529 -0.840  1.00 0.00 ? 2  GLU A CB   1 
ATOM 25    C CG   . GLU A 1 2  ? -0.269  -28.253 0.195   1.00 0.00 ? 2  GLU A CG   1 
ATOM 26    C CD   . GLU A 1 2  ? 0.356   -27.309 1.204   1.00 0.00 ? 2  GLU A CD   1 
ATOM 27    O OE1  . GLU A 1 2  ? 1.142   -26.432 0.788   1.00 0.00 ? 2  GLU A OE1  1 
ATOM 28    O OE2  . GLU A 1 2  ? 0.059   -27.447 2.409   1.00 0.00 ? 2  GLU A OE2  1 
ATOM 29    H H    . GLU A 1 2  ? -3.037  -28.643 0.388   1.00 0.00 ? 2  GLU A H    1 
ATOM 30    H HA   . GLU A 1 2  ? -1.925  -26.045 0.471   1.00 0.00 ? 2  GLU A HA   1 
ATOM 31    H HB2  . GLU A 1 2  ? -1.489  -28.259 -1.541  1.00 0.00 ? 2  GLU A HB2  1 
ATOM 32    H HB3  . GLU A 1 2  ? -0.478  -26.831 -1.366  1.00 0.00 ? 2  GLU A HB3  1 
ATOM 33    H HG2  . GLU A 1 2  ? -0.895  -28.956 0.725   1.00 0.00 ? 2  GLU A HG2  1 
ATOM 34    H HG3  . GLU A 1 2  ? 0.520   -28.789 -0.312  1.00 0.00 ? 2  GLU A HG3  1 
ATOM 35    N N    . ASN A 1 3  ? -3.778  -26.774 -2.158  1.00 0.00 ? 3  ASN A N    1 
ATOM 36    C CA   . ASN A 1 3  ? -4.543  -26.181 -3.246  1.00 0.00 ? 3  ASN A CA   1 
ATOM 37    C C    . ASN A 1 3  ? -5.627  -25.260 -2.698  1.00 0.00 ? 3  ASN A C    1 
ATOM 38    O O    . ASN A 1 3  ? -5.987  -24.271 -3.333  1.00 0.00 ? 3  ASN A O    1 
ATOM 39    C CB   . ASN A 1 3  ? -5.165  -27.270 -4.124  1.00 0.00 ? 3  ASN A CB   1 
ATOM 40    C CG   . ASN A 1 3  ? -6.099  -28.179 -3.350  1.00 0.00 ? 3  ASN A CG   1 
ATOM 41    O OD1  . ASN A 1 3  ? -7.080  -27.724 -2.763  1.00 0.00 ? 3  ASN A OD1  1 
ATOM 42    N ND2  . ASN A 1 3  ? -5.799  -29.472 -3.348  1.00 0.00 ? 3  ASN A ND2  1 
ATOM 43    H H    . ASN A 1 3  ? -3.804  -27.744 -2.026  1.00 0.00 ? 3  ASN A H    1 
ATOM 44    H HA   . ASN A 1 3  ? -3.861  -25.594 -3.844  1.00 0.00 ? 3  ASN A HA   1 
ATOM 45    H HB2  . ASN A 1 3  ? -5.727  -26.803 -4.920  1.00 0.00 ? 3  ASN A HB2  1 
ATOM 46    H HB3  . ASN A 1 3  ? -4.377  -27.872 -4.552  1.00 0.00 ? 3  ASN A HB3  1 
ATOM 47    H HD21 . ASN A 1 3  ? -5.003  -29.763 -3.840  1.00 0.00 ? 3  ASN A HD21 1 
ATOM 48    H HD22 . ASN A 1 3  ? -6.387  -30.083 -2.857  1.00 0.00 ? 3  ASN A HD22 1 
ATOM 49    N N    . LEU A 1 4  ? -6.133  -25.583 -1.511  1.00 0.00 ? 4  LEU A N    1 
ATOM 50    C CA   . LEU A 1 4  ? -7.168  -24.773 -0.877  1.00 0.00 ? 4  LEU A CA   1 
ATOM 51    C C    . LEU A 1 4  ? -6.572  -23.510 -0.276  1.00 0.00 ? 4  LEU A C    1 
ATOM 52    O O    . LEU A 1 4  ? -7.076  -22.415 -0.507  1.00 0.00 ? 4  LEU A O    1 
ATOM 53    C CB   . LEU A 1 4  ? -7.901  -25.580 0.196   1.00 0.00 ? 4  LEU A CB   1 
ATOM 54    C CG   . LEU A 1 4  ? -8.652  -26.807 -0.325  1.00 0.00 ? 4  LEU A CG   1 
ATOM 55    C CD1  . LEU A 1 4  ? -9.394  -27.502 0.806   1.00 0.00 ? 4  LEU A CD1  1 
ATOM 56    C CD2  . LEU A 1 4  ? -9.614  -26.409 -1.434  1.00 0.00 ? 4  LEU A CD2  1 
ATOM 57    H H    . LEU A 1 4  ? -5.797  -26.378 -1.047  1.00 0.00 ? 4  LEU A H    1 
ATOM 58    H HA   . LEU A 1 4  ? -7.874  -24.481 -1.639  1.00 0.00 ? 4  LEU A HA   1 
ATOM 59    H HB2  . LEU A 1 4  ? -7.177  -25.909 0.928   1.00 0.00 ? 4  LEU A HB2  1 
ATOM 60    H HB3  . LEU A 1 4  ? -8.613  -24.931 0.683   1.00 0.00 ? 4  LEU A HB3  1 
ATOM 61    H HG   . LEU A 1 4  ? -7.940  -27.509 -0.735  1.00 0.00 ? 4  LEU A HG   1 
ATOM 62    H HD11 . LEU A 1 4  ? -9.994  -26.779 1.341   1.00 0.00 ? 4  LEU A HD11 1 
ATOM 63    H HD12 . LEU A 1 4  ? -10.035 -28.269 0.398   1.00 0.00 ? 4  LEU A HD12 1 
ATOM 64    H HD13 . LEU A 1 4  ? -8.682  -27.950 1.482   1.00 0.00 ? 4  LEU A HD13 1 
ATOM 65    H HD21 . LEU A 1 4  ? -10.150 -25.517 -1.144  1.00 0.00 ? 4  LEU A HD21 1 
ATOM 66    H HD22 . LEU A 1 4  ? -9.059  -26.217 -2.340  1.00 0.00 ? 4  LEU A HD22 1 
ATOM 67    H HD23 . LEU A 1 4  ? -10.318 -27.211 -1.605  1.00 0.00 ? 4  LEU A HD23 1 
ATOM 68    N N    . ASN A 1 5  ? -5.488  -23.658 0.477   1.00 0.00 ? 5  ASN A N    1 
ATOM 69    C CA   . ASN A 1 5  ? -4.835  -22.502 1.075   1.00 0.00 ? 5  ASN A CA   1 
ATOM 70    C C    . ASN A 1 5  ? -4.123  -21.689 -0.001  1.00 0.00 ? 5  ASN A C    1 
ATOM 71    O O    . ASN A 1 5  ? -3.760  -20.533 0.216   1.00 0.00 ? 5  ASN A O    1 
ATOM 72    C CB   . ASN A 1 5  ? -3.844  -22.930 2.160   1.00 0.00 ? 5  ASN A CB   1 
ATOM 73    C CG   . ASN A 1 5  ? -4.523  -23.633 3.321   1.00 0.00 ? 5  ASN A CG   1 
ATOM 74    O OD1  . ASN A 1 5  ? -5.428  -23.085 3.950   1.00 0.00 ? 5  ASN A OD1  1 
ATOM 75    N ND2  . ASN A 1 5  ? -4.081  -24.849 3.617   1.00 0.00 ? 5  ASN A ND2  1 
ATOM 76    H H    . ASN A 1 5  ? -5.115  -24.553 0.619   1.00 0.00 ? 5  ASN A H    1 
ATOM 77    H HA   . ASN A 1 5  ? -5.604  -21.885 1.516   1.00 0.00 ? 5  ASN A HA   1 
ATOM 78    H HB2  . ASN A 1 5  ? -3.118  -23.604 1.731   1.00 0.00 ? 5  ASN A HB2  1 
ATOM 79    H HB3  . ASN A 1 5  ? -3.336  -22.056 2.541   1.00 0.00 ? 5  ASN A HB3  1 
ATOM 80    H HD21 . ASN A 1 5  ? -3.351  -25.221 3.078   1.00 0.00 ? 5  ASN A HD21 1 
ATOM 81    H HD22 . ASN A 1 5  ? -4.501  -25.327 4.363   1.00 0.00 ? 5  ASN A HD22 1 
ATOM 82    N N    . MET A 1 6  ? -3.937  -22.303 -1.165  1.00 0.00 ? 6  MET A N    1 
ATOM 83    C CA   . MET A 1 6  ? -3.290  -21.642 -2.285  1.00 0.00 ? 6  MET A CA   1 
ATOM 84    C C    . MET A 1 6  ? -4.301  -20.771 -3.024  1.00 0.00 ? 6  MET A C    1 
ATOM 85    O O    . MET A 1 6  ? -4.120  -19.554 -3.154  1.00 0.00 ? 6  MET A O    1 
ATOM 86    C CB   . MET A 1 6  ? -2.683  -22.692 -3.222  1.00 0.00 ? 6  MET A CB   1 
ATOM 87    C CG   . MET A 1 6  ? -2.018  -22.123 -4.465  1.00 0.00 ? 6  MET A CG   1 
ATOM 88    S SD   . MET A 1 6  ? -1.298  -23.408 -5.506  1.00 0.00 ? 6  MET A SD   1 
ATOM 89    C CE   . MET A 1 6  ? -0.701  -22.441 -6.890  1.00 0.00 ? 6  MET A CE   1 
ATOM 90    H H    . MET A 1 6  ? -4.252  -23.224 -1.278  1.00 0.00 ? 6  MET A H    1 
ATOM 91    H HA   . MET A 1 6  ? -2.510  -21.012 -1.891  1.00 0.00 ? 6  MET A HA   1 
ATOM 92    H HB2  . MET A 1 6  ? -1.941  -23.254 -2.675  1.00 0.00 ? 6  MET A HB2  1 
ATOM 93    H HB3  . MET A 1 6  ? -3.467  -23.366 -3.538  1.00 0.00 ? 6  MET A HB3  1 
ATOM 94    H HG2  . MET A 1 6  ? -2.756  -21.588 -5.041  1.00 0.00 ? 6  MET A HG2  1 
ATOM 95    H HG3  . MET A 1 6  ? -1.236  -21.446 -4.160  1.00 0.00 ? 6  MET A HG3  1 
ATOM 96    H HE1  . MET A 1 6  ? -0.049  -21.659 -6.528  1.00 0.00 ? 6  MET A HE1  1 
ATOM 97    H HE2  . MET A 1 6  ? -0.153  -23.080 -7.566  1.00 0.00 ? 6  MET A HE2  1 
ATOM 98    H HE3  . MET A 1 6  ? -1.538  -22.000 -7.409  1.00 0.00 ? 6  MET A HE3  1 
ATOM 99    N N    . ASP A 1 7  ? -5.381  -21.395 -3.488  1.00 0.00 ? 7  ASP A N    1 
ATOM 100   C CA   . ASP A 1 7  ? -6.426  -20.674 -4.193  1.00 0.00 ? 7  ASP A CA   1 
ATOM 101   C C    . ASP A 1 7  ? -7.160  -19.749 -3.231  1.00 0.00 ? 7  ASP A C    1 
ATOM 102   O O    . ASP A 1 7  ? -7.478  -18.610 -3.574  1.00 0.00 ? 7  ASP A O    1 
ATOM 103   C CB   . ASP A 1 7  ? -7.412  -21.647 -4.846  1.00 0.00 ? 7  ASP A CB   1 
ATOM 104   C CG   . ASP A 1 7  ? -8.340  -22.302 -3.840  1.00 0.00 ? 7  ASP A CG   1 
ATOM 105   O OD1  . ASP A 1 7  ? -7.838  -22.825 -2.827  1.00 0.00 ? 7  ASP A OD1  1 
ATOM 106   O OD2  . ASP A 1 7  ? -9.567  -22.289 -4.068  1.00 0.00 ? 7  ASP A OD2  1 
ATOM 107   H H    . ASP A 1 7  ? -5.483  -22.358 -3.341  1.00 0.00 ? 7  ASP A H    1 
ATOM 108   H HA   . ASP A 1 7  ? -5.957  -20.077 -4.961  1.00 0.00 ? 7  ASP A HA   1 
ATOM 109   H HB2  . ASP A 1 7  ? -8.013  -21.109 -5.560  1.00 0.00 ? 7  ASP A HB2  1 
ATOM 110   H HB3  . ASP A 1 7  ? -6.859  -22.422 -5.359  1.00 0.00 ? 7  ASP A HB3  1 
ATOM 111   N N    . LEU A 1 8  ? -7.433  -20.242 -2.020  1.00 0.00 ? 8  LEU A N    1 
ATOM 112   C CA   . LEU A 1 8  ? -8.129  -19.432 -1.029  1.00 0.00 ? 8  LEU A CA   1 
ATOM 113   C C    . LEU A 1 8  ? -7.333  -18.174 -0.711  1.00 0.00 ? 8  LEU A C    1 
ATOM 114   O O    . LEU A 1 8  ? -7.906  -17.096 -0.547  1.00 0.00 ? 8  LEU A O    1 
ATOM 115   C CB   . LEU A 1 8  ? -8.382  -20.218 0.252   1.00 0.00 ? 8  LEU A CB   1 
ATOM 116   C CG   . LEU A 1 8  ? -9.089  -19.434 1.362   1.00 0.00 ? 8  LEU A CG   1 
ATOM 117   C CD1  . LEU A 1 8  ? -10.429 -18.904 0.874   1.00 0.00 ? 8  LEU A CD1  1 
ATOM 118   C CD2  . LEU A 1 8  ? -9.277  -20.305 2.595   1.00 0.00 ? 8  LEU A CD2  1 
ATOM 119   H H    . LEU A 1 8  ? -7.162  -21.166 -1.792  1.00 0.00 ? 8  LEU A H    1 
ATOM 120   H HA   . LEU A 1 8  ? -9.073  -19.144 -1.449  1.00 0.00 ? 8  LEU A HA   1 
ATOM 121   H HB2  . LEU A 1 8  ? -8.980  -21.084 0.009   1.00 0.00 ? 8  LEU A HB2  1 
ATOM 122   H HB3  . LEU A 1 8  ? -7.434  -20.552 0.629   1.00 0.00 ? 8  LEU A HB3  1 
ATOM 123   H HG   . LEU A 1 8  ? -8.478  -18.588 1.639   1.00 0.00 ? 8  LEU A HG   1 
ATOM 124   H HD11 . LEU A 1 8  ? -10.309 -18.467 -0.106  1.00 0.00 ? 8  LEU A HD11 1 
ATOM 125   H HD12 . LEU A 1 8  ? -11.140 -19.716 0.821   1.00 0.00 ? 8  LEU A HD12 1 
ATOM 126   H HD13 . LEU A 1 8  ? -10.791 -18.154 1.561   1.00 0.00 ? 8  LEU A HD13 1 
ATOM 127   H HD21 . LEU A 1 8  ? -8.391  -20.901 2.752   1.00 0.00 ? 8  LEU A HD21 1 
ATOM 128   H HD22 . LEU A 1 8  ? -9.447  -19.676 3.456   1.00 0.00 ? 8  LEU A HD22 1 
ATOM 129   H HD23 . LEU A 1 8  ? -10.128 -20.954 2.450   1.00 0.00 ? 8  LEU A HD23 1 
ATOM 130   N N    . LEU A 1 9  ? -6.010  -18.307 -0.629  1.00 0.00 ? 9  LEU A N    1 
ATOM 131   C CA   . LEU A 1 9  ? -5.161  -17.161 -0.336  1.00 0.00 ? 9  LEU A CA   1 
ATOM 132   C C    . LEU A 1 9  ? -5.193  -16.175 -1.497  1.00 0.00 ? 9  LEU A C    1 
ATOM 133   O O    . LEU A 1 9  ? -5.575  -15.017 -1.324  1.00 0.00 ? 9  LEU A O    1 
ATOM 134   C CB   . LEU A 1 9  ? -3.729  -17.605 -0.042  1.00 0.00 ? 9  LEU A CB   1 
ATOM 135   C CG   . LEU A 1 9  ? -2.776  -16.474 0.349   1.00 0.00 ? 9  LEU A CG   1 
ATOM 136   C CD1  . LEU A 1 9  ? -3.338  -15.685 1.521   1.00 0.00 ? 9  LEU A CD1  1 
ATOM 137   C CD2  . LEU A 1 9  ? -1.407  -17.029 0.697   1.00 0.00 ? 9  LEU A CD2  1 
ATOM 138   H H    . LEU A 1 9  ? -5.599  -19.189 -0.776  1.00 0.00 ? 9  LEU A H    1 
ATOM 139   H HA   . LEU A 1 9  ? -5.563  -16.674 0.541   1.00 0.00 ? 9  LEU A HA   1 
ATOM 140   H HB2  . LEU A 1 9  ? -3.756  -18.321 0.767   1.00 0.00 ? 9  LEU A HB2  1 
ATOM 141   H HB3  . LEU A 1 9  ? -3.334  -18.092 -0.920  1.00 0.00 ? 9  LEU A HB3  1 
ATOM 142   H HG   . LEU A 1 9  ? -2.663  -15.799 -0.488  1.00 0.00 ? 9  LEU A HG   1 
ATOM 143   H HD11 . LEU A 1 9  ? -3.777  -16.366 2.235   1.00 0.00 ? 9  LEU A HD11 1 
ATOM 144   H HD12 . LEU A 1 9  ? -2.543  -15.129 1.994   1.00 0.00 ? 9  LEU A HD12 1 
ATOM 145   H HD13 . LEU A 1 9  ? -4.093  -15.000 1.164   1.00 0.00 ? 9  LEU A HD13 1 
ATOM 146   H HD21 . LEU A 1 9  ? -1.288  -18.003 0.245   1.00 0.00 ? 9  LEU A HD21 1 
ATOM 147   H HD22 . LEU A 1 9  ? -0.644  -16.362 0.324   1.00 0.00 ? 9  LEU A HD22 1 
ATOM 148   H HD23 . LEU A 1 9  ? -1.315  -17.116 1.769   1.00 0.00 ? 9  LEU A HD23 1 
ATOM 149   N N    . TYR A 1 10 ? -4.829  -16.642 -2.692  1.00 0.00 ? 10 TYR A N    1 
ATOM 150   C CA   . TYR A 1 10 ? -4.850  -15.785 -3.880  1.00 0.00 ? 10 TYR A CA   1 
ATOM 151   C C    . TYR A 1 10 ? -6.199  -15.100 -3.994  1.00 0.00 ? 10 TYR A C    1 
ATOM 152   O O    . TYR A 1 10 ? -6.294  -13.881 -4.138  1.00 0.00 ? 10 TYR A O    1 
ATOM 153   C CB   . TYR A 1 10 ? -4.634  -16.615 -5.144  1.00 0.00 ? 10 TYR A CB   1 
ATOM 154   C CG   . TYR A 1 10 ? -3.413  -17.500 -5.128  1.00 0.00 ? 10 TYR A CG   1 
ATOM 155   C CD1  . TYR A 1 10 ? -2.352  -17.274 -4.258  1.00 0.00 ? 10 TYR A CD1  1 
ATOM 156   C CD2  . TYR A 1 10 ? -3.323  -18.563 -6.008  1.00 0.00 ? 10 TYR A CD2  1 
ATOM 157   C CE1  . TYR A 1 10 ? -1.240  -18.089 -4.267  1.00 0.00 ? 10 TYR A CE1  1 
ATOM 158   C CE2  . TYR A 1 10 ? -2.213  -19.382 -6.025  1.00 0.00 ? 10 TYR A CE2  1 
ATOM 159   C CZ   . TYR A 1 10 ? -1.176  -19.141 -5.151  1.00 0.00 ? 10 TYR A CZ   1 
ATOM 160   O OH   . TYR A 1 10 ? -0.064  -19.951 -5.166  1.00 0.00 ? 10 TYR A OH   1 
ATOM 161   H H    . TYR A 1 10 ? -4.560  -17.584 -2.782  1.00 0.00 ? 10 TYR A H    1 
ATOM 162   H HA   . TYR A 1 10 ? -4.070  -15.037 -3.792  1.00 0.00 ? 10 TYR A HA   1 
ATOM 163   H HB2  . TYR A 1 10 ? -5.494  -17.250 -5.294  1.00 0.00 ? 10 TYR A HB2  1 
ATOM 164   H HB3  . TYR A 1 10 ? -4.545  -15.945 -5.988  1.00 0.00 ? 10 TYR A HB3  1 
ATOM 165   H HD1  . TYR A 1 10 ? -2.405  -16.450 -3.566  1.00 0.00 ? 10 TYR A HD1  1 
ATOM 166   H HD2  . TYR A 1 10 ? -4.147  -18.749 -6.685  1.00 0.00 ? 10 TYR A HD2  1 
ATOM 167   H HE1  . TYR A 1 10 ? -0.428  -17.901 -3.582  1.00 0.00 ? 10 TYR A HE1  1 
ATOM 168   H HE2  . TYR A 1 10 ? -2.161  -20.208 -6.720  1.00 0.00 ? 10 TYR A HE2  1 
ATOM 169   H HH   . TYR A 1 10 ? 0.524   -19.674 -5.874  1.00 0.00 ? 10 TYR A HH   1 
ATOM 170   N N    . MET A 1 11 ? -7.242  -15.911 -3.935  1.00 0.00 ? 11 MET A N    1 
ATOM 171   C CA   . MET A 1 11 ? -8.601  -15.423 -4.031  1.00 0.00 ? 11 MET A CA   1 
ATOM 172   C C    . MET A 1 11 ? -8.881  -14.451 -2.896  1.00 0.00 ? 11 MET A C    1 
ATOM 173   O O    . MET A 1 11 ? -9.524  -13.418 -3.087  1.00 0.00 ? 11 MET A O    1 
ATOM 174   C CB   . MET A 1 11 ? -9.563  -16.604 -3.989  1.00 0.00 ? 11 MET A CB   1 
ATOM 175   C CG   . MET A 1 11 ? -10.981 -16.260 -4.418  1.00 0.00 ? 11 MET A CG   1 
ATOM 176   S SD   . MET A 1 11 ? -12.090 -17.682 -4.369  1.00 0.00 ? 11 MET A SD   1 
ATOM 177   C CE   . MET A 1 11 ? -11.315 -18.765 -5.567  1.00 0.00 ? 11 MET A CE   1 
ATOM 178   H H    . MET A 1 11 ? -7.091  -16.873 -3.823  1.00 0.00 ? 11 MET A H    1 
ATOM 179   H HA   . MET A 1 11 ? -8.706  -14.906 -4.974  1.00 0.00 ? 11 MET A HA   1 
ATOM 180   H HB2  . MET A 1 11 ? -9.180  -17.378 -4.643  1.00 0.00 ? 11 MET A HB2  1 
ATOM 181   H HB3  . MET A 1 11 ? -9.598  -16.987 -2.979  1.00 0.00 ? 11 MET A HB3  1 
ATOM 182   H HG2  . MET A 1 11 ? -11.368 -15.498 -3.756  1.00 0.00 ? 11 MET A HG2  1 
ATOM 183   H HG3  . MET A 1 11 ? -10.955 -15.876 -5.428  1.00 0.00 ? 11 MET A HG3  1 
ATOM 184   H HE1  . MET A 1 11 ? -10.242 -18.713 -5.461  1.00 0.00 ? 11 MET A HE1  1 
ATOM 185   H HE2  . MET A 1 11 ? -11.642 -19.781 -5.399  1.00 0.00 ? 11 MET A HE2  1 
ATOM 186   H HE3  . MET A 1 11 ? -11.594 -18.457 -6.564  1.00 0.00 ? 11 MET A HE3  1 
ATOM 187   N N    . ALA A 1 12 ? -8.355  -14.773 -1.718  1.00 0.00 ? 12 ALA A N    1 
ATOM 188   C CA   . ALA A 1 12 ? -8.513  -13.910 -0.559  1.00 0.00 ? 12 ALA A CA   1 
ATOM 189   C C    . ALA A 1 12 ? -7.881  -12.563 -0.844  1.00 0.00 ? 12 ALA A C    1 
ATOM 190   O O    . ALA A 1 12 ? -8.388  -11.540 -0.425  1.00 0.00 ? 12 ALA A O    1 
ATOM 191   C CB   . ALA A 1 12 ? -7.893  -14.543 0.679   1.00 0.00 ? 12 ALA A CB   1 
ATOM 192   H H    . ALA A 1 12 ? -7.828  -15.594 -1.637  1.00 0.00 ? 12 ALA A H    1 
ATOM 193   H HA   . ALA A 1 12 ? -9.572  -13.763 -0.380  1.00 0.00 ? 12 ALA A HA   1 
ATOM 194   H HB1  . ALA A 1 12 ? -7.125  -15.241 0.381   1.00 0.00 ? 12 ALA A HB1  1 
ATOM 195   H HB2  . ALA A 1 12 ? -7.456  -13.771 1.297   1.00 0.00 ? 12 ALA A HB2  1 
ATOM 196   H HB3  . ALA A 1 12 ? -8.656  -15.062 1.240   1.00 0.00 ? 12 ALA A HB3  1 
ATOM 197   N N    . ALA A 1 13 ? -6.781  -12.571 -1.585  1.00 0.00 ? 13 ALA A N    1 
ATOM 198   C CA   . ALA A 1 13 ? -6.110  -11.335 -1.942  1.00 0.00 ? 13 ALA A CA   1 
ATOM 199   C C    . ALA A 1 13 ? -7.017  -10.491 -2.824  1.00 0.00 ? 13 ALA A C    1 
ATOM 200   O O    . ALA A 1 13 ? -7.058  -9.272  -2.701  1.00 0.00 ? 13 ALA A O    1 
ATOM 201   C CB   . ALA A 1 13 ? -4.794  -11.626 -2.649  1.00 0.00 ? 13 ALA A CB   1 
ATOM 202   H H    . ALA A 1 13 ? -6.425  -13.421 -1.910  1.00 0.00 ? 13 ALA A H    1 
ATOM 203   H HA   . ALA A 1 13 ? -5.898  -10.791 -1.028  1.00 0.00 ? 13 ALA A HA   1 
ATOM 204   H HB1  . ALA A 1 13 ? -4.960  -12.351 -3.432  1.00 0.00 ? 13 ALA A HB1  1 
ATOM 205   H HB2  . ALA A 1 13 ? -4.409  -10.714 -3.080  1.00 0.00 ? 13 ALA A HB2  1 
ATOM 206   H HB3  . ALA A 1 13 ? -4.082  -12.019 -1.939  1.00 0.00 ? 13 ALA A HB3  1 
ATOM 207   N N    . ALA A 1 14 ? -7.763  -11.153 -3.703  1.00 0.00 ? 14 ALA A N    1 
ATOM 208   C CA   . ALA A 1 14 ? -8.688  -10.456 -4.587  1.00 0.00 ? 14 ALA A CA   1 
ATOM 209   C C    . ALA A 1 14 ? -9.775  -9.783  -3.760  1.00 0.00 ? 14 ALA A C    1 
ATOM 210   O O    . ALA A 1 14 ? -9.989  -8.574  -3.855  1.00 0.00 ? 14 ALA A O    1 
ATOM 211   C CB   . ALA A 1 14 ? -9.300  -11.421 -5.592  1.00 0.00 ? 14 ALA A CB   1 
ATOM 212   H H    . ALA A 1 14 ? -7.702  -12.131 -3.748  1.00 0.00 ? 14 ALA A H    1 
ATOM 213   H HA   . ALA A 1 14 ? -8.135  -9.702  -5.128  1.00 0.00 ? 14 ALA A HA   1 
ATOM 214   H HB1  . ALA A 1 14 ? -8.722  -12.333 -5.613  1.00 0.00 ? 14 ALA A HB1  1 
ATOM 215   H HB2  . ALA A 1 14 ? -10.317 -11.646 -5.304  1.00 0.00 ? 14 ALA A HB2  1 
ATOM 216   H HB3  . ALA A 1 14 ? -9.295  -10.969 -6.573  1.00 0.00 ? 14 ALA A HB3  1 
ATOM 217   N N    . VAL A 1 15 ? -10.441 -10.578 -2.928  1.00 0.00 ? 15 VAL A N    1 
ATOM 218   C CA   . VAL A 1 15 ? -11.492 -10.070 -2.057  1.00 0.00 ? 15 VAL A CA   1 
ATOM 219   C C    . VAL A 1 15 ? -10.919 -9.030  -1.100  1.00 0.00 ? 15 VAL A C    1 
ATOM 220   O O    . VAL A 1 15 ? -11.453 -7.934  -0.962  1.00 0.00 ? 15 VAL A O    1 
ATOM 221   C CB   . VAL A 1 15 ? -12.138 -11.211 -1.244  1.00 0.00 ? 15 VAL A CB   1 
ATOM 222   C CG1  . VAL A 1 15 ? -13.274 -10.682 -0.375  1.00 0.00 ? 15 VAL A CG1  1 
ATOM 223   C CG2  . VAL A 1 15 ? -12.631 -12.308 -2.173  1.00 0.00 ? 15 VAL A CG2  1 
ATOM 224   H H    . VAL A 1 15 ? -10.207 -11.530 -2.887  1.00 0.00 ? 15 VAL A H    1 
ATOM 225   H HA   . VAL A 1 15 ? -12.254 -9.610  -2.674  1.00 0.00 ? 15 VAL A HA   1 
ATOM 226   H HB   . VAL A 1 15 ? -11.384 -11.634 -0.593  1.00 0.00 ? 15 VAL A HB   1 
ATOM 227   H HG11 . VAL A 1 15 ? -13.388 -9.620  -0.537  1.00 0.00 ? 15 VAL A HG11 1 
ATOM 228   H HG12 . VAL A 1 15 ? -14.192 -11.188 -0.636  1.00 0.00 ? 15 VAL A HG12 1 
ATOM 229   H HG13 . VAL A 1 15 ? -13.045 -10.864 0.665   1.00 0.00 ? 15 VAL A HG13 1 
ATOM 230   H HG21 . VAL A 1 15 ? -12.094 -12.257 -3.109  1.00 0.00 ? 15 VAL A HG21 1 
ATOM 231   H HG22 . VAL A 1 15 ? -12.463 -13.271 -1.713  1.00 0.00 ? 15 VAL A HG22 1 
ATOM 232   H HG23 . VAL A 1 15 ? -13.688 -12.178 -2.357  1.00 0.00 ? 15 VAL A HG23 1 
ATOM 233   N N    . MET A 1 16 ? -9.819  -9.392  -0.453  1.00 0.00 ? 16 MET A N    1 
ATOM 234   C CA   . MET A 1 16 ? -9.140  -8.507  0.493   1.00 0.00 ? 16 MET A CA   1 
ATOM 235   C C    . MET A 1 16 ? -8.741  -7.195  -0.173  1.00 0.00 ? 16 MET A C    1 
ATOM 236   O O    . MET A 1 16 ? -8.949  -6.115  0.380   1.00 0.00 ? 16 MET A O    1 
ATOM 237   C CB   . MET A 1 16 ? -7.895  -9.192  1.072   1.00 0.00 ? 16 MET A CB   1 
ATOM 238   C CG   . MET A 1 16 ? -8.116  -9.885  2.413   1.00 0.00 ? 16 MET A CG   1 
ATOM 239   S SD   . MET A 1 16 ? -9.105  -11.393 2.303   1.00 0.00 ? 16 MET A SD   1 
ATOM 240   C CE   . MET A 1 16 ? -10.768 -10.736 2.193   1.00 0.00 ? 16 MET A CE   1 
ATOM 241   H H    . MET A 1 16 ? -9.451  -10.280 -0.618  1.00 0.00 ? 16 MET A H    1 
ATOM 242   H HA   . MET A 1 16 ? -9.827  -8.291  1.291   1.00 0.00 ? 16 MET A HA   1 
ATOM 243   H HB2  . MET A 1 16 ? -7.550  -9.931  0.369   1.00 0.00 ? 16 MET A HB2  1 
ATOM 244   H HB3  . MET A 1 16 ? -7.117  -8.456  1.196   1.00 0.00 ? 16 MET A HB3  1 
ATOM 245   H HG2  . MET A 1 16 ? -7.153  -10.140 2.829   1.00 0.00 ? 16 MET A HG2  1 
ATOM 246   H HG3  . MET A 1 16 ? -8.615  -9.194  3.078   1.00 0.00 ? 16 MET A HG3  1 
ATOM 247   H HE1  . MET A 1 16 ? -10.964 -10.112 3.051   1.00 0.00 ? 16 MET A HE1  1 
ATOM 248   H HE2  . MET A 1 16 ? -10.869 -10.152 1.293   1.00 0.00 ? 16 MET A HE2  1 
ATOM 249   H HE3  . MET A 1 16 ? -11.474 -11.553 2.173   1.00 0.00 ? 16 MET A HE3  1 
ATOM 250   N N    . MET A 1 17 ? -8.164  -7.301  -1.359  1.00 0.00 ? 17 MET A N    1 
ATOM 251   C CA   . MET A 1 17 ? -7.731  -6.127  -2.108  1.00 0.00 ? 17 MET A CA   1 
ATOM 252   C C    . MET A 1 17 ? -8.927  -5.282  -2.512  1.00 0.00 ? 17 MET A C    1 
ATOM 253   O O    . MET A 1 17 ? -8.887  -4.055  -2.428  1.00 0.00 ? 17 MET A O    1 
ATOM 254   C CB   . MET A 1 17 ? -6.937  -6.534  -3.355  1.00 0.00 ? 17 MET A CB   1 
ATOM 255   C CG   . MET A 1 17 ? -5.530  -7.030  -3.057  1.00 0.00 ? 17 MET A CG   1 
ATOM 256   S SD   . MET A 1 17 ? -4.476  -5.750  -2.349  1.00 0.00 ? 17 MET A SD   1 
ATOM 257   C CE   . MET A 1 17 ? -4.498  -4.524  -3.654  1.00 0.00 ? 17 MET A CE   1 
ATOM 258   H H    . MET A 1 17 ? -8.030  -8.189  -1.738  1.00 0.00 ? 17 MET A H    1 
ATOM 259   H HA   . MET A 1 17 ? -7.091  -5.540  -1.462  1.00 0.00 ? 17 MET A HA   1 
ATOM 260   H HB2  . MET A 1 17 ? -7.472  -7.320  -3.868  1.00 0.00 ? 17 MET A HB2  1 
ATOM 261   H HB3  . MET A 1 17 ? -6.862  -5.679  -4.009  1.00 0.00 ? 17 MET A HB3  1 
ATOM 262   H HG2  . MET A 1 17 ? -5.589  -7.848  -2.356  1.00 0.00 ? 17 MET A HG2  1 
ATOM 263   H HG3  . MET A 1 17 ? -5.083  -7.377  -3.976  1.00 0.00 ? 17 MET A HG3  1 
ATOM 264   H HE1  . MET A 1 17 ? -5.119  -4.873  -4.466  1.00 0.00 ? 17 MET A HE1  1 
ATOM 265   H HE2  . MET A 1 17 ? -4.897  -3.597  -3.269  1.00 0.00 ? 17 MET A HE2  1 
ATOM 266   H HE3  . MET A 1 17 ? -3.494  -4.362  -4.014  1.00 0.00 ? 17 MET A HE3  1 
ATOM 267   N N    . GLY A 1 18 ? -9.997  -5.945  -2.943  1.00 0.00 ? 18 GLY A N    1 
ATOM 268   C CA   . GLY A 1 18 ? -11.193 -5.236  -3.349  1.00 0.00 ? 18 GLY A CA   1 
ATOM 269   C C    . GLY A 1 18 ? -11.865 -4.552  -2.182  1.00 0.00 ? 18 GLY A C    1 
ATOM 270   O O    . GLY A 1 18 ? -12.107 -3.348  -2.216  1.00 0.00 ? 18 GLY A O    1 
ATOM 271   H H    . GLY A 1 18 ? -9.975  -6.924  -2.979  1.00 0.00 ? 18 GLY A H    1 
ATOM 272   H HA2  . GLY A 1 18 ? -10.926 -4.490  -4.086  1.00 0.00 ? 18 GLY A HA2  1 
ATOM 273   H HA3  . GLY A 1 18 ? -11.886 -5.936  -3.792  1.00 0.00 ? 18 GLY A HA3  1 
ATOM 274   N N    . LEU A 1 19 ? -12.160 -5.320  -1.139  1.00 0.00 ? 19 LEU A N    1 
ATOM 275   C CA   . LEU A 1 19 ? -12.800 -4.779  0.050   1.00 0.00 ? 19 LEU A CA   1 
ATOM 276   C C    . LEU A 1 19 ? -11.921 -3.696  0.651   1.00 0.00 ? 19 LEU A C    1 
ATOM 277   O O    . LEU A 1 19 ? -12.401 -2.633  1.048   1.00 0.00 ? 19 LEU A O    1 
ATOM 278   C CB   . LEU A 1 19 ? -13.055 -5.893  1.069   1.00 0.00 ? 19 LEU A CB   1 
ATOM 279   C CG   . LEU A 1 19 ? -11.813 -6.445  1.774   1.00 0.00 ? 19 LEU A CG   1 
ATOM 280   C CD1  . LEU A 1 19 ? -11.425 -5.573  2.962   1.00 0.00 ? 19 LEU A CD1  1 
ATOM 281   C CD2  . LEU A 1 19 ? -12.051 -7.877  2.222   1.00 0.00 ? 19 LEU A CD2  1 
ATOM 282   H H    . LEU A 1 19 ? -11.935 -6.271  -1.167  1.00 0.00 ? 19 LEU A H    1 
ATOM 283   H HA   . LEU A 1 19 ? -13.743 -4.344  -0.246  1.00 0.00 ? 19 LEU A HA   1 
ATOM 284   H HB2  . LEU A 1 19 ? -13.731 -5.517  1.821   1.00 0.00 ? 19 LEU A HB2  1 
ATOM 285   H HB3  . LEU A 1 19 ? -13.537 -6.712  0.554   1.00 0.00 ? 19 LEU A HB3  1 
ATOM 286   H HG   . LEU A 1 19 ? -10.987 -6.443  1.078   1.00 0.00 ? 19 LEU A HG   1 
ATOM 287   H HD11 . LEU A 1 19 ? -11.715 -4.552  2.777   1.00 0.00 ? 19 LEU A HD11 1 
ATOM 288   H HD12 . LEU A 1 19 ? -11.926 -5.934  3.848   1.00 0.00 ? 19 LEU A HD12 1 
ATOM 289   H HD13 . LEU A 1 19 ? -10.356 -5.624  3.111   1.00 0.00 ? 19 LEU A HD13 1 
ATOM 290   H HD21 . LEU A 1 19 ? -12.925 -7.916  2.855   1.00 0.00 ? 19 LEU A HD21 1 
ATOM 291   H HD22 . LEU A 1 19 ? -12.204 -8.505  1.357   1.00 0.00 ? 19 LEU A HD22 1 
ATOM 292   H HD23 . LEU A 1 19 ? -11.192 -8.227  2.773   1.00 0.00 ? 19 LEU A HD23 1 
ATOM 293   N N    . ALA A 1 20 ? -10.621 -3.967  0.694   1.00 0.00 ? 20 ALA A N    1 
ATOM 294   C CA   . ALA A 1 20 ? -9.665  -3.012  1.221   1.00 0.00 ? 20 ALA A CA   1 
ATOM 295   C C    . ALA A 1 20 ? -9.561  -1.822  0.285   1.00 0.00 ? 20 ALA A C    1 
ATOM 296   O O    . ALA A 1 20 ? -9.315  -0.700  0.717   1.00 0.00 ? 20 ALA A O    1 
ATOM 297   C CB   . ALA A 1 20 ? -8.304  -3.661  1.414   1.00 0.00 ? 20 ALA A CB   1 
ATOM 298   H H    . ALA A 1 20 ? -10.298 -4.824  0.346   1.00 0.00 ? 20 ALA A H    1 
ATOM 299   H HA   . ALA A 1 20 ? -10.023 -2.674  2.184   1.00 0.00 ? 20 ALA A HA   1 
ATOM 300   H HB1  . ALA A 1 20 ? -8.405  -4.525  2.053   1.00 0.00 ? 20 ALA A HB1  1 
ATOM 301   H HB2  . ALA A 1 20 ? -7.910  -3.963  0.456   1.00 0.00 ? 20 ALA A HB2  1 
ATOM 302   H HB3  . ALA A 1 20 ? -7.633  -2.949  1.872   1.00 0.00 ? 20 ALA A HB3  1 
ATOM 303   N N    . ALA A 1 21 ? -9.770  -2.074  -1.005  1.00 0.00 ? 21 ALA A N    1 
ATOM 304   C CA   . ALA A 1 21 ? -9.719  -1.013  -2.002  1.00 0.00 ? 21 ALA A CA   1 
ATOM 305   C C    . ALA A 1 21 ? -10.879 -0.061  -1.801  1.00 0.00 ? 21 ALA A C    1 
ATOM 306   O O    . ALA A 1 21 ? -10.722 1.155   -1.872  1.00 0.00 ? 21 ALA A O    1 
ATOM 307   C CB   . ALA A 1 21 ? -9.736  -1.587  -3.413  1.00 0.00 ? 21 ALA A CB   1 
ATOM 308   H H    . ALA A 1 21 ? -9.976  -2.991  -1.288  1.00 0.00 ? 21 ALA A H    1 
ATOM 309   H HA   . ALA A 1 21 ? -8.801  -0.470  -1.865  1.00 0.00 ? 21 ALA A HA   1 
ATOM 310   H HB1  . ALA A 1 21 ? -10.091 -2.605  -3.385  1.00 0.00 ? 21 ALA A HB1  1 
ATOM 311   H HB2  . ALA A 1 21 ? -10.395 -0.997  -4.033  1.00 0.00 ? 21 ALA A HB2  1 
ATOM 312   H HB3  . ALA A 1 21 ? -8.737  -1.564  -3.824  1.00 0.00 ? 21 ALA A HB3  1 
ATOM 313   N N    . ILE A 1 22 ? -12.039 -0.633  -1.528  1.00 0.00 ? 22 ILE A N    1 
ATOM 314   C CA   . ILE A 1 22 ? -13.239 0.151   -1.290  1.00 0.00 ? 22 ILE A CA   1 
ATOM 315   C C    . ILE A 1 22 ? -13.069 0.991   -0.032  1.00 0.00 ? 22 ILE A C    1 
ATOM 316   O O    . ILE A 1 22 ? -13.180 2.212   -0.073  1.00 0.00 ? 22 ILE A O    1 
ATOM 317   C CB   . ILE A 1 22 ? -14.483 -0.745  -1.145  1.00 0.00 ? 22 ILE A CB   1 
ATOM 318   C CG1  . ILE A 1 22 ? -14.648 -1.621  -2.386  1.00 0.00 ? 22 ILE A CG1  1 
ATOM 319   C CG2  . ILE A 1 22 ? -15.728 0.103   -0.924  1.00 0.00 ? 22 ILE A CG2  1 
ATOM 320   C CD1  . ILE A 1 22 ? -15.789 -2.609  -2.282  1.00 0.00 ? 22 ILE A CD1  1 
ATOM 321   H H    . ILE A 1 22 ? -12.081 -1.608  -1.471  1.00 0.00 ? 22 ILE A H    1 
ATOM 322   H HA   . ILE A 1 22 ? -13.388 0.805   -2.134  1.00 0.00 ? 22 ILE A HA   1 
ATOM 323   H HB   . ILE A 1 22 ? -14.346 -1.373  -0.282  1.00 0.00 ? 22 ILE A HB   1 
ATOM 324   H HG12 . ILE A 1 22 ? -14.834 -0.991  -3.241  1.00 0.00 ? 22 ILE A HG12 1 
ATOM 325   H HG13 . ILE A 1 22 ? -13.740 -2.178  -2.547  1.00 0.00 ? 22 ILE A HG13 1 
ATOM 326   H HG21 . ILE A 1 22 ? -15.554 1.101   -1.298  1.00 0.00 ? 22 ILE A HG21 1 
ATOM 327   H HG22 . ILE A 1 22 ? -16.562 -0.339  -1.449  1.00 0.00 ? 22 ILE A HG22 1 
ATOM 328   H HG23 . ILE A 1 22 ? -15.950 0.148   0.132   1.00 0.00 ? 22 ILE A HG23 1 
ATOM 329   H HD11 . ILE A 1 22 ? -16.609 -2.156  -1.744  1.00 0.00 ? 22 ILE A HD11 1 
ATOM 330   H HD12 . ILE A 1 22 ? -16.118 -2.885  -3.273  1.00 0.00 ? 22 ILE A HD12 1 
ATOM 331   H HD13 . ILE A 1 22 ? -15.455 -3.490  -1.754  1.00 0.00 ? 22 ILE A HD13 1 
ATOM 332   N N    . GLY A 1 23 ? -12.778 0.328   1.086   1.00 0.00 ? 23 GLY A N    1 
ATOM 333   C CA   . GLY A 1 23 ? -12.579 1.042   2.334   1.00 0.00 ? 23 GLY A CA   1 
ATOM 334   C C    . GLY A 1 23 ? -11.423 2.016   2.236   1.00 0.00 ? 23 GLY A C    1 
ATOM 335   O O    . GLY A 1 23 ? -11.520 3.163   2.682   1.00 0.00 ? 23 GLY A O    1 
ATOM 336   H H    . GLY A 1 23 ? -12.687 -0.647  1.059   1.00 0.00 ? 23 GLY A H    1 
ATOM 337   H HA2  . GLY A 1 23 ? -13.481 1.586   2.578   1.00 0.00 ? 23 GLY A HA2  1 
ATOM 338   H HA3  . GLY A 1 23 ? -12.372 0.330   3.119   1.00 0.00 ? 23 GLY A HA3  1 
ATOM 339   N N    . ALA A 1 24 ? -10.331 1.558   1.633   1.00 0.00 ? 24 ALA A N    1 
ATOM 340   C CA   . ALA A 1 24 ? -9.150  2.389   1.454   1.00 0.00 ? 24 ALA A CA   1 
ATOM 341   C C    . ALA A 1 24 ? -9.490  3.608   0.616   1.00 0.00 ? 24 ALA A C    1 
ATOM 342   O O    . ALA A 1 24 ? -9.097  4.723   0.949   1.00 0.00 ? 24 ALA A O    1 
ATOM 343   C CB   . ALA A 1 24 ? -8.030  1.598   0.796   1.00 0.00 ? 24 ALA A CB   1 
ATOM 344   H H    . ALA A 1 24 ? -10.325 0.641   1.290   1.00 0.00 ? 24 ALA A H    1 
ATOM 345   H HA   . ALA A 1 24 ? -8.814  2.711   2.428   1.00 0.00 ? 24 ALA A HA   1 
ATOM 346   H HB1  . ALA A 1 24 ? -8.401  1.131   -0.104  1.00 0.00 ? 24 ALA A HB1  1 
ATOM 347   H HB2  . ALA A 1 24 ? -7.218  2.263   0.545   1.00 0.00 ? 24 ALA A HB2  1 
ATOM 348   H HB3  . ALA A 1 24 ? -7.677  0.838   1.477   1.00 0.00 ? 24 ALA A HB3  1 
ATOM 349   N N    . ALA A 1 25 ? -10.223 3.383   -0.474  1.00 0.00 ? 25 ALA A N    1 
ATOM 350   C CA   . ALA A 1 25 ? -10.625 4.465   -1.363  1.00 0.00 ? 25 ALA A CA   1 
ATOM 351   C C    . ALA A 1 25 ? -11.476 5.478   -0.613  1.00 0.00 ? 25 ALA A C    1 
ATOM 352   O O    . ALA A 1 25 ? -11.255 6.687   -0.704  1.00 0.00 ? 25 ALA A O    1 
ATOM 353   C CB   . ALA A 1 25 ? -11.388 3.922   -2.563  1.00 0.00 ? 25 ALA A CB   1 
ATOM 354   H H    . ALA A 1 25 ? -10.499 2.464   -0.681  1.00 0.00 ? 25 ALA A H    1 
ATOM 355   H HA   . ALA A 1 25 ? -9.732  4.951   -1.723  1.00 0.00 ? 25 ALA A HA   1 
ATOM 356   H HB1  . ALA A 1 25 ? -11.757 2.934   -2.339  1.00 0.00 ? 25 ALA A HB1  1 
ATOM 357   H HB2  . ALA A 1 25 ? -12.220 4.573   -2.785  1.00 0.00 ? 25 ALA A HB2  1 
ATOM 358   H HB3  . ALA A 1 25 ? -10.729 3.877   -3.418  1.00 0.00 ? 25 ALA A HB3  1 
ATOM 359   N N    . ILE A 1 26 ? -12.446 4.972   0.138   1.00 0.00 ? 26 ILE A N    1 
ATOM 360   C CA   . ILE A 1 26 ? -13.334 5.821   0.913   1.00 0.00 ? 26 ILE A CA   1 
ATOM 361   C C    . ILE A 1 26 ? -12.553 6.746   1.840   1.00 0.00 ? 26 ILE A C    1 
ATOM 362   O O    . ILE A 1 26 ? -12.723 7.959   1.794   1.00 0.00 ? 26 ILE A O    1 
ATOM 363   C CB   . ILE A 1 26 ? -14.329 4.989   1.733   1.00 0.00 ? 26 ILE A CB   1 
ATOM 364   C CG1  . ILE A 1 26 ? -15.229 4.203   0.788   1.00 0.00 ? 26 ILE A CG1  1 
ATOM 365   C CG2  . ILE A 1 26 ? -15.162 5.877   2.653   1.00 0.00 ? 26 ILE A CG2  1 
ATOM 366   C CD1  . ILE A 1 26 ? -15.985 5.065   -0.199  1.00 0.00 ? 26 ILE A CD1  1 
ATOM 367   H H    . ILE A 1 26 ? -12.565 3.999   0.173   1.00 0.00 ? 26 ILE A H    1 
ATOM 368   H HA   . ILE A 1 26 ? -13.906 6.414   0.223   1.00 0.00 ? 26 ILE A HA   1 
ATOM 369   H HB   . ILE A 1 26 ? -13.770 4.300   2.344   1.00 0.00 ? 26 ILE A HB   1 
ATOM 370   H HG12 . ILE A 1 26 ? -14.631 3.508   0.228   1.00 0.00 ? 26 ILE A HG12 1 
ATOM 371   H HG13 . ILE A 1 26 ? -15.947 3.666   1.370   1.00 0.00 ? 26 ILE A HG13 1 
ATOM 372   H HG21 . ILE A 1 26 ? -14.936 6.914   2.456   1.00 0.00 ? 26 ILE A HG21 1 
ATOM 373   H HG22 . ILE A 1 26 ? -16.212 5.696   2.474   1.00 0.00 ? 26 ILE A HG22 1 
ATOM 374   H HG23 . ILE A 1 26 ? -14.928 5.646   3.682   1.00 0.00 ? 26 ILE A HG23 1 
ATOM 375   H HD11 . ILE A 1 26 ? -15.767 6.107   -0.011  1.00 0.00 ? 26 ILE A HD11 1 
ATOM 376   H HD12 . ILE A 1 26 ? -15.682 4.810   -1.204  1.00 0.00 ? 26 ILE A HD12 1 
ATOM 377   H HD13 . ILE A 1 26 ? -17.045 4.895   -0.088  1.00 0.00 ? 26 ILE A HD13 1 
ATOM 378   N N    . GLY A 1 27 ? -11.707 6.168   2.688   1.00 0.00 ? 27 GLY A N    1 
ATOM 379   C CA   . GLY A 1 27 ? -10.935 6.978   3.618   1.00 0.00 ? 27 GLY A CA   1 
ATOM 380   C C    . GLY A 1 27 ? -9.935  7.882   2.930   1.00 0.00 ? 27 GLY A C    1 
ATOM 381   O O    . GLY A 1 27 ? -9.869  9.072   3.237   1.00 0.00 ? 27 GLY A O    1 
ATOM 382   H H    . GLY A 1 27 ? -11.613 5.191   2.692   1.00 0.00 ? 27 GLY A H    1 
ATOM 383   H HA2  . GLY A 1 27 ? -11.618 7.592   4.185   1.00 0.00 ? 27 GLY A HA2  1 
ATOM 384   H HA3  . GLY A 1 27 ? -10.412 6.336   4.300   1.00 0.00 ? 27 GLY A HA3  1 
ATOM 385   N N    . ILE A 1 28 ? -9.149  7.337   1.998   1.00 0.00 ? 28 ILE A N    1 
ATOM 386   C CA   . ILE A 1 28 ? -8.172  8.154   1.293   1.00 0.00 ? 28 ILE A CA   1 
ATOM 387   C C    . ILE A 1 28 ? -8.846  9.409   0.778   1.00 0.00 ? 28 ILE A C    1 
ATOM 388   O O    . ILE A 1 28 ? -8.359  10.515  0.969   1.00 0.00 ? 28 ILE A O    1 
ATOM 389   C CB   . ILE A 1 28 ? -7.501  7.414   0.124   1.00 0.00 ? 28 ILE A CB   1 
ATOM 390   C CG1  . ILE A 1 28 ? -8.525  6.876   -0.867  1.00 0.00 ? 28 ILE A CG1  1 
ATOM 391   C CG2  . ILE A 1 28 ? -6.625  6.286   0.641   1.00 0.00 ? 28 ILE A CG2  1 
ATOM 392   C CD1  . ILE A 1 28 ? -7.891  6.260   -2.098  1.00 0.00 ? 28 ILE A CD1  1 
ATOM 393   H H    . ILE A 1 28 ? -9.233  6.388   1.780   1.00 0.00 ? 28 ILE A H    1 
ATOM 394   H HA   . ILE A 1 28 ? -7.410  8.438   2.001   1.00 0.00 ? 28 ILE A HA   1 
ATOM 395   H HB   . ILE A 1 28 ? -6.877  8.116   -0.384  1.00 0.00 ? 28 ILE A HB   1 
ATOM 396   H HG12 . ILE A 1 28 ? -9.114  6.119   -0.382  1.00 0.00 ? 28 ILE A HG12 1 
ATOM 397   H HG13 . ILE A 1 28 ? -9.165  7.679   -1.194  1.00 0.00 ? 28 ILE A HG13 1 
ATOM 398   H HG21 . ILE A 1 28 ? -7.048  5.894   1.555   1.00 0.00 ? 28 ILE A HG21 1 
ATOM 399   H HG22 . ILE A 1 28 ? -6.578  5.500   -0.098  1.00 0.00 ? 28 ILE A HG22 1 
ATOM 400   H HG23 . ILE A 1 28 ? -5.631  6.658   0.834   1.00 0.00 ? 28 ILE A HG23 1 
ATOM 401   H HD11 . ILE A 1 28 ? -6.988  6.797   -2.346  1.00 0.00 ? 28 ILE A HD11 1 
ATOM 402   H HD12 . ILE A 1 28 ? -7.651  5.225   -1.900  1.00 0.00 ? 28 ILE A HD12 1 
ATOM 403   H HD13 . ILE A 1 28 ? -8.583  6.316   -2.925  1.00 0.00 ? 28 ILE A HD13 1 
ATOM 404   N N    . GLY A 1 29 ? -9.998  9.216   0.167   1.00 0.00 ? 29 GLY A N    1 
ATOM 405   C CA   . GLY A 1 29 ? -10.769 10.333  -0.332  1.00 0.00 ? 29 GLY A CA   1 
ATOM 406   C C    . GLY A 1 29 ? -11.261 11.208  0.804   1.00 0.00 ? 29 GLY A C    1 
ATOM 407   O O    . GLY A 1 29 ? -11.302 12.432  0.686   1.00 0.00 ? 29 GLY A O    1 
ATOM 408   H H    . GLY A 1 29 ? -10.338 8.304   0.080   1.00 0.00 ? 29 GLY A H    1 
ATOM 409   H HA2  . GLY A 1 29 ? -10.152 10.924  -0.994  1.00 0.00 ? 29 GLY A HA2  1 
ATOM 410   H HA3  . GLY A 1 29 ? -11.621 9.959   -0.882  1.00 0.00 ? 29 GLY A HA3  1 
ATOM 411   N N    . ILE A 1 30 ? -11.622 10.571  1.921   1.00 0.00 ? 30 ILE A N    1 
ATOM 412   C CA   . ILE A 1 30 ? -12.097 11.293  3.098   1.00 0.00 ? 30 ILE A CA   1 
ATOM 413   C C    . ILE A 1 30 ? -11.030 12.263  3.603   1.00 0.00 ? 30 ILE A C    1 
ATOM 414   O O    . ILE A 1 30 ? -11.163 13.478  3.460   1.00 0.00 ? 30 ILE A O    1 
ATOM 415   C CB   . ILE A 1 30 ? -12.498 10.317  4.235   1.00 0.00 ? 30 ILE A CB   1 
ATOM 416   C CG1  . ILE A 1 30 ? -13.755 9.545   3.847   1.00 0.00 ? 30 ILE A CG1  1 
ATOM 417   C CG2  . ILE A 1 30 ? -12.733 11.070  5.539   1.00 0.00 ? 30 ILE A CG2  1 
ATOM 418   C CD1  . ILE A 1 30 ? -14.119 8.454   4.830   1.00 0.00 ? 30 ILE A CD1  1 
ATOM 419   H H    . ILE A 1 30 ? -11.553 9.592   1.957   1.00 0.00 ? 30 ILE A H    1 
ATOM 420   H HA   . ILE A 1 30 ? -12.974 11.856  2.810   1.00 0.00 ? 30 ILE A HA   1 
ATOM 421   H HB   . ILE A 1 30 ? -11.687 9.609   4.391   1.00 0.00 ? 30 ILE A HB   1 
ATOM 422   H HG12 . ILE A 1 30 ? -14.588 10.232  3.792   1.00 0.00 ? 30 ILE A HG12 1 
ATOM 423   H HG13 . ILE A 1 30 ? -13.607 9.092   2.883   1.00 0.00 ? 30 ILE A HG13 1 
ATOM 424   H HG21 . ILE A 1 30 ? -13.381 11.914  5.354   1.00 0.00 ? 30 ILE A HG21 1 
ATOM 425   H HG22 . ILE A 1 30 ? -13.196 10.410  6.257   1.00 0.00 ? 30 ILE A HG22 1 
ATOM 426   H HG23 . ILE A 1 30 ? -11.789 11.420  5.928   1.00 0.00 ? 30 ILE A HG23 1 
ATOM 427   H HD11 . ILE A 1 30 ? -13.228 8.119   5.340   1.00 0.00 ? 30 ILE A HD11 1 
ATOM 428   H HD12 . ILE A 1 30 ? -14.823 8.840   5.553   1.00 0.00 ? 30 ILE A HD12 1 
ATOM 429   H HD13 . ILE A 1 30 ? -14.564 7.625   4.301   1.00 0.00 ? 30 ILE A HD13 1 
ATOM 430   N N    . LEU A 1 31 ? -9.970  11.713  4.185   1.00 0.00 ? 31 LEU A N    1 
ATOM 431   C CA   . LEU A 1 31 ? -8.873  12.517  4.709   1.00 0.00 ? 31 LEU A CA   1 
ATOM 432   C C    . LEU A 1 31 ? -8.115  13.181  3.565   1.00 0.00 ? 31 LEU A C    1 
ATOM 433   O O    . LEU A 1 31 ? -7.579  14.279  3.710   1.00 0.00 ? 31 LEU A O    1 
ATOM 434   C CB   . LEU A 1 31 ? -7.936  11.627  5.534   1.00 0.00 ? 31 LEU A CB   1 
ATOM 435   C CG   . LEU A 1 31 ? -6.876  12.356  6.365   1.00 0.00 ? 31 LEU A CG   1 
ATOM 436   C CD1  . LEU A 1 31 ? -6.193  11.389  7.323   1.00 0.00 ? 31 LEU A CD1  1 
ATOM 437   C CD2  . LEU A 1 31 ? -5.849  13.020  5.464   1.00 0.00 ? 31 LEU A CD2  1 
ATOM 438   H H    . LEU A 1 31 ? -9.922  10.737  4.261   1.00 0.00 ? 31 LEU A H    1 
ATOM 439   H HA   . LEU A 1 31 ? -9.290  13.288  5.349   1.00 0.00 ? 31 LEU A HA   1 
ATOM 440   H HB2  . LEU A 1 31 ? -8.540  11.035  6.204   1.00 0.00 ? 31 LEU A HB2  1 
ATOM 441   H HB3  . LEU A 1 31 ? -7.427  10.958  4.856   1.00 0.00 ? 31 LEU A HB3  1 
ATOM 442   H HG   . LEU A 1 31 ? -7.356  13.125  6.953   1.00 0.00 ? 31 LEU A HG   1 
ATOM 443   H HD11 . LEU A 1 31 ? -6.676  10.425  7.268   1.00 0.00 ? 31 LEU A HD11 1 
ATOM 444   H HD12 . LEU A 1 31 ? -5.153  11.284  7.049   1.00 0.00 ? 31 LEU A HD12 1 
ATOM 445   H HD13 . LEU A 1 31 ? -6.264  11.770  8.330   1.00 0.00 ? 31 LEU A HD13 1 
ATOM 446   H HD21 . LEU A 1 31 ? -5.789  12.484  4.528   1.00 0.00 ? 31 LEU A HD21 1 
ATOM 447   H HD22 . LEU A 1 31 ? -6.146  14.037  5.278   1.00 0.00 ? 31 LEU A HD22 1 
ATOM 448   H HD23 . LEU A 1 31 ? -4.885  13.009  5.949   1.00 0.00 ? 31 LEU A HD23 1 
ATOM 449   N N    . GLY A 1 32 ? -8.086  12.511  2.418   1.00 0.00 ? 32 GLY A N    1 
ATOM 450   C CA   . GLY A 1 32 ? -7.403  13.056  1.261   1.00 0.00 ? 32 GLY A CA   1 
ATOM 451   C C    . GLY A 1 32 ? -7.979  14.387  0.839   1.00 0.00 ? 32 GLY A C    1 
ATOM 452   O O    . GLY A 1 32 ? -7.243  15.335  0.609   1.00 0.00 ? 32 GLY A O    1 
ATOM 453   H H    . GLY A 1 32 ? -8.539  11.644  2.355   1.00 0.00 ? 32 GLY A H    1 
ATOM 454   H HA2  . GLY A 1 32 ? -6.357  13.186  1.502   1.00 0.00 ? 32 GLY A HA2  1 
ATOM 455   H HA3  . GLY A 1 32 ? -7.487  12.363  0.436   1.00 0.00 ? 32 GLY A HA3  1 
ATOM 456   N N    . GLY A 1 33 ? -9.300  14.461  0.736   1.00 0.00 ? 33 GLY A N    1 
ATOM 457   C CA   . GLY A 1 33 ? -9.936  15.702  0.338   1.00 0.00 ? 33 GLY A CA   1 
ATOM 458   C C    . GLY A 1 33 ? -9.627  16.839  1.293   1.00 0.00 ? 33 GLY A C    1 
ATOM 459   O O    . GLY A 1 33 ? -9.210  17.916  0.872   1.00 0.00 ? 33 GLY A O    1 
ATOM 460   H H    . GLY A 1 33 ? -9.845  13.672  0.932   1.00 0.00 ? 33 GLY A H    1 
ATOM 461   H HA2  . GLY A 1 33 ? -9.589  15.971  -0.651  1.00 0.00 ? 33 GLY A HA2  1 
ATOM 462   H HA3  . GLY A 1 33 ? -11.006 15.554  0.306   1.00 0.00 ? 33 GLY A HA3  1 
ATOM 463   N N    . LYS A 1 34 ? -9.835  16.595  2.583   1.00 0.00 ? 34 LYS A N    1 
ATOM 464   C CA   . LYS A 1 34 ? -9.585  17.602  3.609   1.00 0.00 ? 34 LYS A CA   1 
ATOM 465   C C    . LYS A 1 34 ? -8.120  18.041  3.624   1.00 0.00 ? 34 LYS A C    1 
ATOM 466   O O    . LYS A 1 34 ? -7.815  19.234  3.536   1.00 0.00 ? 34 LYS A O    1 
ATOM 467   C CB   . LYS A 1 34 ? -9.998  17.060  4.986   1.00 0.00 ? 34 LYS A CB   1 
ATOM 468   C CG   . LYS A 1 34 ? -9.270  15.796  5.404   1.00 0.00 ? 34 LYS A CG   1 
ATOM 469   C CD   . LYS A 1 34 ? -9.809  15.252  6.718   1.00 0.00 ? 34 LYS A CD   1 
ATOM 470   C CE   . LYS A 1 34 ? -11.265 14.835  6.595   1.00 0.00 ? 34 LYS A CE   1 
ATOM 471   N NZ   . LYS A 1 34 ? -11.793 14.278  7.871   1.00 0.00 ? 34 LYS A NZ   1 
ATOM 472   H H    . LYS A 1 34 ? -10.170 15.714  2.852   1.00 0.00 ? 34 LYS A H    1 
ATOM 473   H HA   . LYS A 1 34 ? -10.196 18.461  3.377   1.00 0.00 ? 34 LYS A HA   1 
ATOM 474   H HB2  . LYS A 1 34 ? -9.803  17.812  5.729   1.00 0.00 ? 34 LYS A HB2  1 
ATOM 475   H HB3  . LYS A 1 34 ? -11.056 16.849  4.971   1.00 0.00 ? 34 LYS A HB3  1 
ATOM 476   H HG2  . LYS A 1 34 ? -9.395  15.050  4.636   1.00 0.00 ? 34 LYS A HG2  1 
ATOM 477   H HG3  . LYS A 1 34 ? -8.221  16.021  5.526   1.00 0.00 ? 34 LYS A HG3  1 
ATOM 478   H HD2  . LYS A 1 34 ? -9.223  14.393  7.008   1.00 0.00 ? 34 LYS A HD2  1 
ATOM 479   H HD3  . LYS A 1 34 ? -9.725  16.018  7.475   1.00 0.00 ? 34 LYS A HD3  1 
ATOM 480   H HE2  . LYS A 1 34 ? -11.853 15.698  6.321   1.00 0.00 ? 34 LYS A HE2  1 
ATOM 481   H HE3  . LYS A 1 34 ? -11.348 14.084  5.823   1.00 0.00 ? 34 LYS A HE3  1 
ATOM 482   H HZ1  . LYS A 1 34 ? -11.039 13.770  8.379   1.00 0.00 ? 34 LYS A HZ1  1 
ATOM 483   H HZ2  . LYS A 1 34 ? -12.146 15.046  8.477   1.00 0.00 ? 34 LYS A HZ2  1 
ATOM 484   H HZ3  . LYS A 1 34 ? -12.571 13.615  7.678   1.00 0.00 ? 34 LYS A HZ3  1 
ATOM 485   N N    . PHE A 1 35 ? -7.215  17.074  3.734   1.00 0.00 ? 35 PHE A N    1 
ATOM 486   C CA   . PHE A 1 35 ? -5.784  17.362  3.769   1.00 0.00 ? 35 PHE A CA   1 
ATOM 487   C C    . PHE A 1 35 ? -5.338  17.978  2.453   1.00 0.00 ? 35 PHE A C    1 
ATOM 488   O O    . PHE A 1 35 ? -4.653  19.001  2.426   1.00 0.00 ? 35 PHE A O    1 
ATOM 489   C CB   . PHE A 1 35 ? -5.008  16.075  4.033   1.00 0.00 ? 35 PHE A CB   1 
ATOM 490   C CG   . PHE A 1 35 ? -3.624  16.305  4.565   1.00 0.00 ? 35 PHE A CG   1 
ATOM 491   C CD1  . PHE A 1 35 ? -3.430  16.941  5.780   1.00 0.00 ? 35 PHE A CD1  1 
ATOM 492   C CD2  . PHE A 1 35 ? -2.518  15.899  3.844   1.00 0.00 ? 35 PHE A CD2  1 
ATOM 493   C CE1  . PHE A 1 35 ? -2.156  17.169  6.259   1.00 0.00 ? 35 PHE A CE1  1 
ATOM 494   C CE2  . PHE A 1 35 ? -1.244  16.121  4.320   1.00 0.00 ? 35 PHE A CE2  1 
ATOM 495   C CZ   . PHE A 1 35 ? -1.063  16.758  5.528   1.00 0.00 ? 35 PHE A CZ   1 
ATOM 496   H H    . PHE A 1 35 ? -7.514  16.145  3.796   1.00 0.00 ? 35 PHE A H    1 
ATOM 497   H HA   . PHE A 1 35 ? -5.596  18.065  4.574   1.00 0.00 ? 35 PHE A HA   1 
ATOM 498   H HB2  . PHE A 1 35 ? -5.548  15.486  4.748   1.00 0.00 ? 35 PHE A HB2  1 
ATOM 499   H HB3  . PHE A 1 35 ? -4.921  15.519  3.110   1.00 0.00 ? 35 PHE A HB3  1 
ATOM 500   H HD1  . PHE A 1 35 ? -4.287  17.263  6.352   1.00 0.00 ? 35 PHE A HD1  1 
ATOM 501   H HD2  . PHE A 1 35 ? -2.660  15.398  2.901   1.00 0.00 ? 35 PHE A HD2  1 
ATOM 502   H HE1  . PHE A 1 35 ? -2.017  17.668  7.207   1.00 0.00 ? 35 PHE A HE1  1 
ATOM 503   H HE2  . PHE A 1 35 ? -0.389  15.798  3.746   1.00 0.00 ? 35 PHE A HE2  1 
ATOM 504   H HZ   . PHE A 1 35 ? -0.064  16.936  5.901   1.00 0.00 ? 35 PHE A HZ   1 
ATOM 505   N N    . LEU A 1 36 ? -5.744  17.345  1.362   1.00 0.00 ? 36 LEU A N    1 
ATOM 506   C CA   . LEU A 1 36 ? -5.407  17.821  0.024   1.00 0.00 ? 36 LEU A CA   1 
ATOM 507   C C    . LEU A 1 36 ? -5.964  19.225  -0.178  1.00 0.00 ? 36 LEU A C    1 
ATOM 508   O O    . LEU A 1 36 ? -5.325  20.076  -0.794  1.00 0.00 ? 36 LEU A O    1 
ATOM 509   C CB   . LEU A 1 36 ? -5.962  16.861  -1.036  1.00 0.00 ? 36 LEU A CB   1 
ATOM 510   C CG   . LEU A 1 36 ? -5.384  17.006  -2.447  1.00 0.00 ? 36 LEU A CG   1 
ATOM 511   C CD1  . LEU A 1 36 ? -5.777  18.336  -3.075  1.00 0.00 ? 36 LEU A CD1  1 
ATOM 512   C CD2  . LEU A 1 36 ? -3.870  16.853  -2.415  1.00 0.00 ? 36 LEU A CD2  1 
ATOM 513   H H    . LEU A 1 36 ? -6.288  16.538  1.462   1.00 0.00 ? 36 LEU A H    1 
ATOM 514   H HA   . LEU A 1 36 ? -4.333  17.855  -0.059  1.00 0.00 ? 36 LEU A HA   1 
ATOM 515   H HB2  . LEU A 1 36 ? -5.773  15.854  -0.703  1.00 0.00 ? 36 LEU A HB2  1 
ATOM 516   H HB3  . LEU A 1 36 ? -7.031  17.007  -1.094  1.00 0.00 ? 36 LEU A HB3  1 
ATOM 517   H HG   . LEU A 1 36 ? -5.783  16.219  -3.070  1.00 0.00 ? 36 LEU A HG   1 
ATOM 518   H HD11 . LEU A 1 36 ? -6.480  18.846  -2.436  1.00 0.00 ? 36 LEU A HD11 1 
ATOM 519   H HD12 . LEU A 1 36 ? -4.898  18.946  -3.205  1.00 0.00 ? 36 LEU A HD12 1 
ATOM 520   H HD13 . LEU A 1 36 ? -6.234  18.156  -4.037  1.00 0.00 ? 36 LEU A HD13 1 
ATOM 521   H HD21 . LEU A 1 36 ? -3.601  16.105  -1.683  1.00 0.00 ? 36 LEU A HD21 1 
ATOM 522   H HD22 . LEU A 1 36 ? -3.519  16.546  -3.388  1.00 0.00 ? 36 LEU A HD22 1 
ATOM 523   H HD23 . LEU A 1 36 ? -3.418  17.797  -2.149  1.00 0.00 ? 36 LEU A HD23 1 
ATOM 524   N N    . GLU A 1 37 ? -7.156  19.463  0.364   1.00 0.00 ? 37 GLU A N    1 
ATOM 525   C CA   . GLU A 1 37 ? -7.798  20.768  0.254   1.00 0.00 ? 37 GLU A CA   1 
ATOM 526   C C    . GLU A 1 37 ? -6.943  21.848  0.909   1.00 0.00 ? 37 GLU A C    1 
ATOM 527   O O    . GLU A 1 37 ? -6.589  22.844  0.275   1.00 0.00 ? 37 GLU A O    1 
ATOM 528   C CB   . GLU A 1 37 ? -9.183  20.733  0.908   1.00 0.00 ? 37 GLU A CB   1 
ATOM 529   C CG   . GLU A 1 37 ? -9.926  22.057  0.836   1.00 0.00 ? 37 GLU A CG   1 
ATOM 530   C CD   . GLU A 1 37 ? -11.300 21.990  1.478   1.00 0.00 ? 37 GLU A CD   1 
ATOM 531   O OE1  . GLU A 1 37 ? -11.674 20.906  1.975   1.00 0.00 ? 37 GLU A OE1  1 
ATOM 532   O OE2  . GLU A 1 37 ? -12.003 23.023  1.484   1.00 0.00 ? 37 GLU A OE2  1 
ATOM 533   H H    . GLU A 1 37 ? -7.611  18.747  0.855   1.00 0.00 ? 37 GLU A H    1 
ATOM 534   H HA   . GLU A 1 37 ? -7.910  20.997  -0.795  1.00 0.00 ? 37 GLU A HA   1 
ATOM 535   H HB2  . GLU A 1 37 ? -9.782  19.984  0.415   1.00 0.00 ? 37 GLU A HB2  1 
ATOM 536   H HB3  . GLU A 1 37 ? -9.071  20.465  1.948   1.00 0.00 ? 37 GLU A HB3  1 
ATOM 537   H HG2  . GLU A 1 37 ? -9.345  22.810  1.345   1.00 0.00 ? 37 GLU A HG2  1 
ATOM 538   H HG3  . GLU A 1 37 ? -10.044 22.333  -0.201  1.00 0.00 ? 37 GLU A HG3  1 
ATOM 539   N N    . GLY A 1 38 ? -6.611  21.643  2.179   1.00 0.00 ? 38 GLY A N    1 
ATOM 540   C CA   . GLY A 1 38 ? -5.796  22.610  2.899   1.00 0.00 ? 38 GLY A CA   1 
ATOM 541   C C    . GLY A 1 38 ? -4.452  22.831  2.233   1.00 0.00 ? 38 GLY A C    1 
ATOM 542   O O    . GLY A 1 38 ? -4.091  23.961  1.889   1.00 0.00 ? 38 GLY A O    1 
ATOM 543   H H    . GLY A 1 38 ? -6.918  20.827  2.630   1.00 0.00 ? 38 GLY A H    1 
ATOM 544   H HA2  . GLY A 1 38 ? -6.326  23.552  2.941   1.00 0.00 ? 38 GLY A HA2  1 
ATOM 545   H HA3  . GLY A 1 38 ? -5.634  22.254  3.906   1.00 0.00 ? 38 GLY A HA3  1 
ATOM 546   N N    . ALA A 1 39 ? -3.711  21.747  2.044   1.00 0.00 ? 39 ALA A N    1 
ATOM 547   C CA   . ALA A 1 39 ? -2.407  21.820  1.407   1.00 0.00 ? 39 ALA A CA   1 
ATOM 548   C C    . ALA A 1 39 ? -2.520  22.476  0.043   1.00 0.00 ? 39 ALA A C    1 
ATOM 549   O O    . ALA A 1 39 ? -1.765  23.387  -0.292  1.00 0.00 ? 39 ALA A O    1 
ATOM 550   C CB   . ALA A 1 39 ? -1.815  20.432  1.268   1.00 0.00 ? 39 ALA A CB   1 
ATOM 551   H H    . ALA A 1 39 ? -4.055  20.876  2.334   1.00 0.00 ? 39 ALA A H    1 
ATOM 552   H HA   . ALA A 1 39 ? -1.757  22.409  2.030   1.00 0.00 ? 39 ALA A HA   1 
ATOM 553   H HB1  . ALA A 1 39 ? -1.783  19.953  2.235   1.00 0.00 ? 39 ALA A HB1  1 
ATOM 554   H HB2  . ALA A 1 39 ? -2.430  19.853  0.600   1.00 0.00 ? 39 ALA A HB2  1 
ATOM 555   H HB3  . ALA A 1 39 ? -0.816  20.503  0.865   1.00 0.00 ? 39 ALA A HB3  1 
ATOM 556   N N    . ALA A 1 40 ? -3.484  22.016  -0.735  1.00 0.00 ? 40 ALA A N    1 
ATOM 557   C CA   . ALA A 1 40 ? -3.704  22.570  -2.058  1.00 0.00 ? 40 ALA A CA   1 
ATOM 558   C C    . ALA A 1 40 ? -4.275  23.973  -1.961  1.00 0.00 ? 40 ALA A C    1 
ATOM 559   O O    . ALA A 1 40 ? -4.236  24.737  -2.928  1.00 0.00 ? 40 ALA A O    1 
ATOM 560   C CB   . ALA A 1 40 ? -4.603  21.654  -2.860  1.00 0.00 ? 40 ALA A CB   1 
ATOM 561   H H    . ALA A 1 40 ? -4.068  21.297  -0.409  1.00 0.00 ? 40 ALA A H    1 
ATOM 562   H HA   . ALA A 1 40 ? -2.748  22.623  -2.557  1.00 0.00 ? 40 ALA A HA   1 
ATOM 563   H HB1  . ALA A 1 40 ? -4.310  20.630  -2.677  1.00 0.00 ? 40 ALA A HB1  1 
ATOM 564   H HB2  . ALA A 1 40 ? -5.628  21.796  -2.557  1.00 0.00 ? 40 ALA A HB2  1 
ATOM 565   H HB3  . ALA A 1 40 ? -4.499  21.876  -3.911  1.00 0.00 ? 40 ALA A HB3  1 
ATOM 566   N N    . ARG A 1 41 ? -4.775  24.326  -0.781  1.00 0.00 ? 41 ARG A N    1 
ATOM 567   C CA   . ARG A 1 41 ? -5.309  25.656  -0.565  1.00 0.00 ? 41 ARG A CA   1 
ATOM 568   C C    . ARG A 1 41 ? -4.165  26.618  -0.279  1.00 0.00 ? 41 ARG A C    1 
ATOM 569   O O    . ARG A 1 41 ? -4.245  27.810  -0.577  1.00 0.00 ? 41 ARG A O    1 
ATOM 570   C CB   . ARG A 1 41 ? -6.307  25.666  0.595   1.00 0.00 ? 41 ARG A CB   1 
ATOM 571   C CG   . ARG A 1 41 ? -6.910  27.035  0.882   1.00 0.00 ? 41 ARG A CG   1 
ATOM 572   C CD   . ARG A 1 41 ? -7.806  27.510  -0.252  1.00 0.00 ? 41 ARG A CD   1 
ATOM 573   N NE   . ARG A 1 41 ? -7.058  27.780  -1.478  1.00 0.00 ? 41 ARG A NE   1 
ATOM 574   C CZ   . ARG A 1 41 ? -7.628  28.024  -2.655  1.00 0.00 ? 41 ARG A CZ   1 
ATOM 575   N NH1  . ARG A 1 41 ? -8.950  28.052  -2.767  1.00 0.00 ? 41 ARG A NH1  1 
ATOM 576   N NH2  . ARG A 1 41 ? -6.873  28.242  -3.723  1.00 0.00 ? 41 ARG A NH2  1 
ATOM 577   H H    . ARG A 1 41 ? -4.762  23.688  -0.039  1.00 0.00 ? 41 ARG A H    1 
ATOM 578   H HA   . ARG A 1 41 ? -5.802  25.958  -1.468  1.00 0.00 ? 41 ARG A HA   1 
ATOM 579   H HB2  . ARG A 1 41 ? -7.113  24.986  0.365   1.00 0.00 ? 41 ARG A HB2  1 
ATOM 580   H HB3  . ARG A 1 41 ? -5.807  25.325  1.490   1.00 0.00 ? 41 ARG A HB3  1 
ATOM 581   H HG2  . ARG A 1 41 ? -7.494  26.977  1.787   1.00 0.00 ? 41 ARG A HG2  1 
ATOM 582   H HG3  . ARG A 1 41 ? -6.108  27.747  1.017   1.00 0.00 ? 41 ARG A HG3  1 
ATOM 583   H HD2  . ARG A 1 41 ? -8.542  26.745  -0.454  1.00 0.00 ? 41 ARG A HD2  1 
ATOM 584   H HD3  . ARG A 1 41 ? -8.307  28.414  0.059   1.00 0.00 ? 41 ARG A HD3  1 
ATOM 585   H HE   . ARG A 1 41 ? -6.080  27.782  -1.421  1.00 0.00 ? 41 ARG A HE   1 
ATOM 586   H HH11 . ARG A 1 41 ? -9.524  27.891  -1.966  1.00 0.00 ? 41 ARG A HH11 1 
ATOM 587   H HH12 . ARG A 1 41 ? -9.371  28.237  -3.655  1.00 0.00 ? 41 ARG A HH12 1 
ATOM 588   H HH21 . ARG A 1 41 ? -5.877  28.224  -3.644  1.00 0.00 ? 41 ARG A HH21 1 
ATOM 589   H HH22 . ARG A 1 41 ? -7.300  28.424  -4.609  1.00 0.00 ? 41 ARG A HH22 1 
ATOM 590   N N    . GLN A 1 42 ? -3.092  26.076  0.290   1.00 0.00 ? 42 GLN A N    1 
ATOM 591   C CA   . GLN A 1 42 ? -1.910  26.855  0.607   1.00 0.00 ? 42 GLN A CA   1 
ATOM 592   C C    . GLN A 1 42 ? -0.810  26.622  -0.431  1.00 0.00 ? 42 GLN A C    1 
ATOM 593   O O    . GLN A 1 42 ? -0.191  25.559  -0.462  1.00 0.00 ? 42 GLN A O    1 
ATOM 594   C CB   . GLN A 1 42 ? -1.388  26.486  1.988   1.00 0.00 ? 42 GLN A CB   1 
ATOM 595   C CG   . GLN A 1 42 ? -2.252  27.000  3.128   1.00 0.00 ? 42 GLN A CG   1 
ATOM 596   C CD   . GLN A 1 42 ? -2.409  28.508  3.101   1.00 0.00 ? 42 GLN A CD   1 
ATOM 597   O OE1  . GLN A 1 42 ? -1.427  29.247  3.157   1.00 0.00 ? 42 GLN A OE1  1 
ATOM 598   N NE2  . GLN A 1 42 ? -3.651  28.972  3.020   1.00 0.00 ? 42 GLN A NE2  1 
ATOM 599   H H    . GLN A 1 42 ? -3.096  25.121  0.496   1.00 0.00 ? 42 GLN A H    1 
ATOM 600   H HA   . GLN A 1 42 ? -2.189  27.895  0.605   1.00 0.00 ? 42 GLN A HA   1 
ATOM 601   H HB2  . GLN A 1 42 ? -1.335  25.409  2.063   1.00 0.00 ? 42 GLN A HB2  1 
ATOM 602   H HB3  . GLN A 1 42 ? -0.401  26.892  2.094   1.00 0.00 ? 42 GLN A HB3  1 
ATOM 603   H HG2  . GLN A 1 42 ? -3.230  26.550  3.053   1.00 0.00 ? 42 GLN A HG2  1 
ATOM 604   H HG3  . GLN A 1 42 ? -1.796  26.717  4.064   1.00 0.00 ? 42 GLN A HG3  1 
ATOM 605   H HE21 . GLN A 1 42 ? -4.386  28.325  2.982   1.00 0.00 ? 42 GLN A HE21 1 
ATOM 606   H HE22 . GLN A 1 42 ? -3.782  29.943  3.000   1.00 0.00 ? 42 GLN A HE22 1 
ATOM 607   N N    . PRO A 1 43 ? -0.559  27.612  -1.304  1.00 0.00 ? 43 PRO A N    1 
ATOM 608   C CA   . PRO A 1 43 ? 0.461   27.509  -2.351  1.00 0.00 ? 43 PRO A CA   1 
ATOM 609   C C    . PRO A 1 43 ? 1.792   26.924  -1.868  1.00 0.00 ? 43 PRO A C    1 
ATOM 610   O O    . PRO A 1 43 ? 2.572   26.417  -2.669  1.00 0.00 ? 43 PRO A O    1 
ATOM 611   C CB   . PRO A 1 43 ? 0.673   28.958  -2.813  1.00 0.00 ? 43 PRO A CB   1 
ATOM 612   C CG   . PRO A 1 43 ? -0.269  29.813  -2.025  1.00 0.00 ? 43 PRO A CG   1 
ATOM 613   C CD   . PRO A 1 43 ? -1.259  28.902  -1.358  1.00 0.00 ? 43 PRO A CD   1 
ATOM 614   H HA   . PRO A 1 43 ? 0.103   26.922  -3.182  1.00 0.00 ? 43 PRO A HA   1 
ATOM 615   H HB2  . PRO A 1 43 ? 1.696   29.241  -2.624  1.00 0.00 ? 43 PRO A HB2  1 
ATOM 616   H HB3  . PRO A 1 43 ? 0.469   29.027  -3.870  1.00 0.00 ? 43 PRO A HB3  1 
ATOM 617   H HG2  . PRO A 1 43 ? 0.281   30.366  -1.279  1.00 0.00 ? 43 PRO A HG2  1 
ATOM 618   H HG3  . PRO A 1 43 ? -0.781  30.495  -2.689  1.00 0.00 ? 43 PRO A HG3  1 
ATOM 619   H HD2  . PRO A 1 43 ? -1.485  29.263  -0.365  1.00 0.00 ? 43 PRO A HD2  1 
ATOM 620   H HD3  . PRO A 1 43 ? -2.161  28.827  -1.949  1.00 0.00 ? 43 PRO A HD3  1 
ATOM 621   N N    . ASP A 1 44 ? 2.064   27.007  -0.571  1.00 0.00 ? 44 ASP A N    1 
ATOM 622   C CA   . ASP A 1 44 ? 3.324   26.498  -0.027  1.00 0.00 ? 44 ASP A CA   1 
ATOM 623   C C    . ASP A 1 44 ? 3.284   24.988  0.231   1.00 0.00 ? 44 ASP A C    1 
ATOM 624   O O    . ASP A 1 44 ? 4.301   24.392  0.583   1.00 0.00 ? 44 ASP A O    1 
ATOM 625   C CB   . ASP A 1 44 ? 3.667   27.230  1.272   1.00 0.00 ? 44 ASP A CB   1 
ATOM 626   C CG   . ASP A 1 44 ? 4.991   26.781  1.859   1.00 0.00 ? 44 ASP A CG   1 
ATOM 627   O OD1  . ASP A 1 44 ? 6.025   26.933  1.174   1.00 0.00 ? 44 ASP A OD1  1 
ATOM 628   O OD2  . ASP A 1 44 ? 4.995   26.276  3.002   1.00 0.00 ? 44 ASP A OD2  1 
ATOM 629   H H    . ASP A 1 44 ? 1.420   27.434  0.030   1.00 0.00 ? 44 ASP A H    1 
ATOM 630   H HA   . ASP A 1 44 ? 4.101   26.702  -0.750  1.00 0.00 ? 44 ASP A HA   1 
ATOM 631   H HB2  . ASP A 1 44 ? 3.722   28.291  1.077   1.00 0.00 ? 44 ASP A HB2  1 
ATOM 632   H HB3  . ASP A 1 44 ? 2.889   27.042  1.999   1.00 0.00 ? 44 ASP A HB3  1 
ATOM 633   N N    . LEU A 1 45 ? 2.114   24.376  0.081   1.00 0.00 ? 45 LEU A N    1 
ATOM 634   C CA   . LEU A 1 45 ? 1.970   22.941  0.328   1.00 0.00 ? 45 LEU A CA   1 
ATOM 635   C C    . LEU A 1 45 ? 1.774   22.148  -0.970  1.00 0.00 ? 45 LEU A C    1 
ATOM 636   O O    . LEU A 1 45 ? 1.311   21.004  -0.948  1.00 0.00 ? 45 LEU A O    1 
ATOM 637   C CB   . LEU A 1 45 ? 0.814   22.699  1.306   1.00 0.00 ? 45 LEU A CB   1 
ATOM 638   C CG   . LEU A 1 45 ? 1.042   23.249  2.725   1.00 0.00 ? 45 LEU A CG   1 
ATOM 639   C CD1  . LEU A 1 45 ? 1.302   24.747  2.690   1.00 0.00 ? 45 LEU A CD1  1 
ATOM 640   C CD2  . LEU A 1 45 ? -0.146  22.947  3.626   1.00 0.00 ? 45 LEU A CD2  1 
ATOM 641   H H    . LEU A 1 45 ? 1.328   24.897  -0.184  1.00 0.00 ? 45 LEU A H    1 
ATOM 642   H HA   . LEU A 1 45 ? 2.881   22.594  0.793   1.00 0.00 ? 45 LEU A HA   1 
ATOM 643   H HB2  . LEU A 1 45 ? -0.073  23.158  0.905   1.00 0.00 ? 45 LEU A HB2  1 
ATOM 644   H HB3  . LEU A 1 45 ? 0.648   21.637  1.380   1.00 0.00 ? 45 LEU A HB3  1 
ATOM 645   H HG   . LEU A 1 45 ? 1.913   22.772  3.150   1.00 0.00 ? 45 LEU A HG   1 
ATOM 646   H HD11 . LEU A 1 45 ? 0.800   25.179  1.836   1.00 0.00 ? 45 LEU A HD11 1 
ATOM 647   H HD12 . LEU A 1 45 ? 0.925   25.199  3.595   1.00 0.00 ? 45 LEU A HD12 1 
ATOM 648   H HD13 . LEU A 1 45 ? 2.363   24.927  2.612   1.00 0.00 ? 45 LEU A HD13 1 
ATOM 649   H HD21 . LEU A 1 45 ? -0.468  21.929  3.473   1.00 0.00 ? 45 LEU A HD21 1 
ATOM 650   H HD22 . LEU A 1 45 ? 0.141   23.081  4.659   1.00 0.00 ? 45 LEU A HD22 1 
ATOM 651   H HD23 . LEU A 1 45 ? -0.957  23.619  3.390   1.00 0.00 ? 45 LEU A HD23 1 
ATOM 652   N N    . ILE A 1 46 ? 2.147   22.740  -2.105  1.00 0.00 ? 46 ILE A N    1 
ATOM 653   C CA   . ILE A 1 46 ? 2.020   22.044  -3.384  1.00 0.00 ? 46 ILE A CA   1 
ATOM 654   C C    . ILE A 1 46 ? 2.742   20.704  -3.326  1.00 0.00 ? 46 ILE A C    1 
ATOM 655   O O    . ILE A 1 46 ? 2.204   19.688  -3.748  1.00 0.00 ? 46 ILE A O    1 
ATOM 656   C CB   . ILE A 1 46 ? 2.586   22.847  -4.564  1.00 0.00 ? 46 ILE A CB   1 
ATOM 657   C CG1  . ILE A 1 46 ? 2.049   24.276  -4.553  1.00 0.00 ? 46 ILE A CG1  1 
ATOM 658   C CG2  . ILE A 1 46 ? 2.244   22.160  -5.878  1.00 0.00 ? 46 ILE A CG2  1 
ATOM 659   C CD1  . ILE A 1 46 ? 2.598   25.140  -5.667  1.00 0.00 ? 46 ILE A CD1  1 
ATOM 660   H H    . ILE A 1 46 ? 2.528   23.641  -2.079  1.00 0.00 ? 46 ILE A H    1 
ATOM 661   H HA   . ILE A 1 46 ? 0.970   21.871  -3.563  1.00 0.00 ? 46 ILE A HA   1 
ATOM 662   H HB   . ILE A 1 46 ? 3.654   22.863  -4.470  1.00 0.00 ? 46 ILE A HB   1 
ATOM 663   H HG12 . ILE A 1 46 ? 0.974   24.250  -4.653  1.00 0.00 ? 46 ILE A HG12 1 
ATOM 664   H HG13 . ILE A 1 46 ? 2.306   24.739  -3.617  1.00 0.00 ? 46 ILE A HG13 1 
ATOM 665   H HG21 . ILE A 1 46 ? 1.337   21.586  -5.758  1.00 0.00 ? 46 ILE A HG21 1 
ATOM 666   H HG22 . ILE A 1 46 ? 2.099   22.905  -6.647  1.00 0.00 ? 46 ILE A HG22 1 
ATOM 667   H HG23 . ILE A 1 46 ? 3.051   21.502  -6.162  1.00 0.00 ? 46 ILE A HG23 1 
ATOM 668   H HD11 . ILE A 1 46 ? 2.848   24.518  -6.514  1.00 0.00 ? 46 ILE A HD11 1 
ATOM 669   H HD12 . ILE A 1 46 ? 1.853   25.865  -5.960  1.00 0.00 ? 46 ILE A HD12 1 
ATOM 670   H HD13 . ILE A 1 46 ? 3.484   25.652  -5.322  1.00 0.00 ? 46 ILE A HD13 1 
ATOM 671   N N    . PRO A 1 47 ? 3.976   20.670  -2.788  1.00 0.00 ? 47 PRO A N    1 
ATOM 672   C CA   . PRO A 1 47 ? 4.731   19.427  -2.674  1.00 0.00 ? 47 PRO A CA   1 
ATOM 673   C C    . PRO A 1 47 ? 4.064   18.496  -1.675  1.00 0.00 ? 47 PRO A C    1 
ATOM 674   O O    . PRO A 1 47 ? 4.259   17.274  -1.705  1.00 0.00 ? 47 PRO A O    1 
ATOM 675   C CB   . PRO A 1 47 ? 6.117   19.867  -2.180  1.00 0.00 ? 47 PRO A CB   1 
ATOM 676   C CG   . PRO A 1 47 ? 6.149   21.350  -2.356  1.00 0.00 ? 47 PRO A CG   1 
ATOM 677   C CD   . PRO A 1 47 ? 4.724   21.811  -2.239  1.00 0.00 ? 47 PRO A CD   1 
ATOM 678   H HA   . PRO A 1 47 ? 4.809   18.928  -3.630  1.00 0.00 ? 47 PRO A HA   1 
ATOM 679   H HB2  . PRO A 1 47 ? 6.234   19.592  -1.142  1.00 0.00 ? 47 PRO A HB2  1 
ATOM 680   H HB3  . PRO A 1 47 ? 6.881   19.385  -2.772  1.00 0.00 ? 47 PRO A HB3  1 
ATOM 681   H HG2  . PRO A 1 47 ? 6.751   21.799  -1.581  1.00 0.00 ? 47 PRO A HG2  1 
ATOM 682   H HG3  . PRO A 1 47 ? 6.544   21.597  -3.330  1.00 0.00 ? 47 PRO A HG3  1 
ATOM 683   H HD2  . PRO A 1 47 ? 4.467   21.985  -1.205  1.00 0.00 ? 47 PRO A HD2  1 
ATOM 684   H HD3  . PRO A 1 47 ? 4.563   22.701  -2.827  1.00 0.00 ? 47 PRO A HD3  1 
ATOM 685   N N    . LEU A 1 48 ? 3.246   19.088  -0.808  1.00 0.00 ? 48 LEU A N    1 
ATOM 686   C CA   . LEU A 1 48 ? 2.506   18.324  0.171   1.00 0.00 ? 48 LEU A CA   1 
ATOM 687   C C    . LEU A 1 48 ? 1.459   17.527  -0.581  1.00 0.00 ? 48 LEU A C    1 
ATOM 688   O O    . LEU A 1 48 ? 1.202   16.366  -0.284  1.00 0.00 ? 48 LEU A O    1 
ATOM 689   C CB   . LEU A 1 48 ? 1.852   19.259  1.193   1.00 0.00 ? 48 LEU A CB   1 
ATOM 690   C CG   . LEU A 1 48 ? 1.240   18.565  2.408   1.00 0.00 ? 48 LEU A CG   1 
ATOM 691   C CD1  . LEU A 1 48 ? 2.292   17.744  3.137   1.00 0.00 ? 48 LEU A CD1  1 
ATOM 692   C CD2  . LEU A 1 48 ? 0.625   19.591  3.342   1.00 0.00 ? 48 LEU A CD2  1 
ATOM 693   H H    . LEU A 1 48 ? 3.114   20.058  -0.853  1.00 0.00 ? 48 LEU A H    1 
ATOM 694   H HA   . LEU A 1 48 ? 3.187   17.650  0.670   1.00 0.00 ? 48 LEU A HA   1 
ATOM 695   H HB2  . LEU A 1 48 ? 2.600   19.956  1.542   1.00 0.00 ? 48 LEU A HB2  1 
ATOM 696   H HB3  . LEU A 1 48 ? 1.068   19.818  0.696   1.00 0.00 ? 48 LEU A HB3  1 
ATOM 697   H HG   . LEU A 1 48 ? 0.459   17.895  2.080   1.00 0.00 ? 48 LEU A HG   1 
ATOM 698   H HD11 . LEU A 1 48 ? 3.244   18.252  3.086   1.00 0.00 ? 48 LEU A HD11 1 
ATOM 699   H HD12 . LEU A 1 48 ? 2.002   17.624  4.170   1.00 0.00 ? 48 LEU A HD12 1 
ATOM 700   H HD13 . LEU A 1 48 ? 2.377   16.774  2.672   1.00 0.00 ? 48 LEU A HD13 1 
ATOM 701   H HD21 . LEU A 1 48 ? 0.125   20.348  2.759   1.00 0.00 ? 48 LEU A HD21 1 
ATOM 702   H HD22 . LEU A 1 48 ? -0.087  19.107  3.992   1.00 0.00 ? 48 LEU A HD22 1 
ATOM 703   H HD23 . LEU A 1 48 ? 1.402   20.049  3.936   1.00 0.00 ? 48 LEU A HD23 1 
ATOM 704   N N    . LEU A 1 49 ? 0.891   18.178  -1.597  1.00 0.00 ? 49 LEU A N    1 
ATOM 705   C CA   . LEU A 1 49 ? -0.114  17.575  -2.468  1.00 0.00 ? 49 LEU A CA   1 
ATOM 706   C C    . LEU A 1 49 ? 0.274   16.161  -2.880  1.00 0.00 ? 49 LEU A C    1 
ATOM 707   O O    . LEU A 1 49 ? -0.424  15.191  -2.577  1.00 0.00 ? 49 LEU A O    1 
ATOM 708   C CB   . LEU A 1 49 ? -0.270  18.440  -3.722  1.00 0.00 ? 49 LEU A CB   1 
ATOM 709   C CG   . LEU A 1 49 ? -0.721  19.872  -3.458  1.00 0.00 ? 49 LEU A CG   1 
ATOM 710   C CD1  . LEU A 1 49 ? -1.005  20.597  -4.766  1.00 0.00 ? 49 LEU A CD1  1 
ATOM 711   C CD2  . LEU A 1 49 ? -1.942  19.882  -2.556  1.00 0.00 ? 49 LEU A CD2  1 
ATOM 712   H H    . LEU A 1 49 ? 1.177   19.101  -1.782  1.00 0.00 ? 49 LEU A H    1 
ATOM 713   H HA   . LEU A 1 49 ? -1.051  17.546  -1.939  1.00 0.00 ? 49 LEU A HA   1 
ATOM 714   H HB2  . LEU A 1 49 ? 0.689   18.475  -4.233  1.00 0.00 ? 49 LEU A HB2  1 
ATOM 715   H HB3  . LEU A 1 49 ? -0.990  17.971  -4.374  1.00 0.00 ? 49 LEU A HB3  1 
ATOM 716   H HG   . LEU A 1 49 ? 0.072   20.399  -2.949  1.00 0.00 ? 49 LEU A HG   1 
ATOM 717   H HD11 . LEU A 1 49 ? -0.599  20.028  -5.589  1.00 0.00 ? 49 LEU A HD11 1 
ATOM 718   H HD12 . LEU A 1 49 ? -2.072  20.704  -4.894  1.00 0.00 ? 49 LEU A HD12 1 
ATOM 719   H HD13 . LEU A 1 49 ? -0.546  21.574  -4.744  1.00 0.00 ? 49 LEU A HD13 1 
ATOM 720   H HD21 . LEU A 1 49 ? -1.743  19.295  -1.673  1.00 0.00 ? 49 LEU A HD21 1 
ATOM 721   H HD22 . LEU A 1 49 ? -2.160  20.893  -2.268  1.00 0.00 ? 49 LEU A HD22 1 
ATOM 722   H HD23 . LEU A 1 49 ? -2.785  19.465  -3.086  1.00 0.00 ? 49 LEU A HD23 1 
ATOM 723   N N    . ARG A 1 50 ? 1.383   16.059  -3.595  1.00 0.00 ? 50 ARG A N    1 
ATOM 724   C CA   . ARG A 1 50 ? 1.873   14.785  -4.074  1.00 0.00 ? 50 ARG A CA   1 
ATOM 725   C C    . ARG A 1 50 ? 2.329   13.912  -2.912  1.00 0.00 ? 50 ARG A C    1 
ATOM 726   O O    . ARG A 1 50 ? 1.986   12.729  -2.833  1.00 0.00 ? 50 ARG A O    1 
ATOM 727   C CB   . ARG A 1 50 ? 3.023   15.030  -5.046  1.00 0.00 ? 50 ARG A CB   1 
ATOM 728   C CG   . ARG A 1 50 ? 2.616   15.824  -6.276  1.00 0.00 ? 50 ARG A CG   1 
ATOM 729   C CD   . ARG A 1 50 ? 1.711   15.014  -7.189  1.00 0.00 ? 50 ARG A CD   1 
ATOM 730   N NE   . ARG A 1 50 ? 2.420   13.892  -7.800  1.00 0.00 ? 50 ARG A NE   1 
ATOM 731   C CZ   . ARG A 1 50 ? 1.857   13.024  -8.639  1.00 0.00 ? 50 ARG A CZ   1 
ATOM 732   N NH1  . ARG A 1 50 ? 0.571   13.127  -8.948  1.00 0.00 ? 50 ARG A NH1  1 
ATOM 733   N NH2  . ARG A 1 50 ? 2.584   12.049  -9.166  1.00 0.00 ? 50 ARG A NH2  1 
ATOM 734   H H    . ARG A 1 50 ? 1.885   16.868  -3.817  1.00 0.00 ? 50 ARG A H    1 
ATOM 735   H HA   . ARG A 1 50 ? 1.068   14.288  -4.597  1.00 0.00 ? 50 ARG A HA   1 
ATOM 736   H HB2  . ARG A 1 50 ? 3.805   15.574  -4.533  1.00 0.00 ? 50 ARG A HB2  1 
ATOM 737   H HB3  . ARG A 1 50 ? 3.411   14.084  -5.367  1.00 0.00 ? 50 ARG A HB3  1 
ATOM 738   H HG2  . ARG A 1 50 ? 2.088   16.712  -5.960  1.00 0.00 ? 50 ARG A HG2  1 
ATOM 739   H HG3  . ARG A 1 50 ? 3.504   16.107  -6.822  1.00 0.00 ? 50 ARG A HG3  1 
ATOM 740   H HD2  . ARG A 1 50 ? 0.884   14.630  -6.610  1.00 0.00 ? 50 ARG A HD2  1 
ATOM 741   H HD3  . ARG A 1 50 ? 1.334   15.658  -7.970  1.00 0.00 ? 50 ARG A HD3  1 
ATOM 742   H HE   . ARG A 1 50 ? 3.369   13.785  -7.582  1.00 0.00 ? 50 ARG A HE   1 
ATOM 743   H HH11 . ARG A 1 50 ? 0.017   13.859  -8.552  1.00 0.00 ? 50 ARG A HH11 1 
ATOM 744   H HH12 . ARG A 1 50 ? 0.155   12.471  -9.579  1.00 0.00 ? 50 ARG A HH12 1 
ATOM 745   H HH21 . ARG A 1 50 ? 3.554   11.966  -8.936  1.00 0.00 ? 50 ARG A HH21 1 
ATOM 746   H HH22 . ARG A 1 50 ? 2.163   11.396  -9.796  1.00 0.00 ? 50 ARG A HH22 1 
ATOM 747   N N    . THR A 1 51 ? 3.095   14.509  -2.003  1.00 0.00 ? 51 THR A N    1 
ATOM 748   C CA   . THR A 1 51 ? 3.598   13.792  -0.838  1.00 0.00 ? 51 THR A CA   1 
ATOM 749   C C    . THR A 1 51 ? 2.454   13.172  -0.051  1.00 0.00 ? 51 THR A C    1 
ATOM 750   O O    . THR A 1 51 ? 2.515   12.009  0.348   1.00 0.00 ? 51 THR A O    1 
ATOM 751   C CB   . THR A 1 51 ? 4.384   14.739  0.066   1.00 0.00 ? 51 THR A CB   1 
ATOM 752   O OG1  . THR A 1 51 ? 5.406   15.389  -0.665  1.00 0.00 ? 51 THR A OG1  1 
ATOM 753   C CG2  . THR A 1 51 ? 5.027   14.039  1.245   1.00 0.00 ? 51 THR A CG2  1 
ATOM 754   H H    . THR A 1 51 ? 3.321   15.458  -2.115  1.00 0.00 ? 51 THR A H    1 
ATOM 755   H HA   . THR A 1 51 ? 4.257   13.008  -1.185  1.00 0.00 ? 51 THR A HA   1 
ATOM 756   H HB   . THR A 1 51 ? 3.712   15.491  0.454   1.00 0.00 ? 51 THR A HB   1 
ATOM 757   H HG1  . THR A 1 51 ? 5.006   15.988  -1.305  1.00 0.00 ? 51 THR A HG1  1 
ATOM 758   H HG21 . THR A 1 51 ? 4.306   13.379  1.707   1.00 0.00 ? 51 THR A HG21 1 
ATOM 759   H HG22 . THR A 1 51 ? 5.875   13.464  0.905   1.00 0.00 ? 51 THR A HG22 1 
ATOM 760   H HG23 . THR A 1 51 ? 5.355   14.774  1.965   1.00 0.00 ? 51 THR A HG23 1 
ATOM 761   N N    . GLN A 1 52 ? 1.410   13.961  0.173   1.00 0.00 ? 52 GLN A N    1 
ATOM 762   C CA   . GLN A 1 52 ? 0.255   13.494  0.921   1.00 0.00 ? 52 GLN A CA   1 
ATOM 763   C C    . GLN A 1 52 ? -0.526  12.465  0.120   1.00 0.00 ? 52 GLN A C    1 
ATOM 764   O O    . GLN A 1 52 ? -1.057  11.503  0.670   1.00 0.00 ? 52 GLN A O    1 
ATOM 765   C CB   . GLN A 1 52 ? -0.666  14.655  1.292   1.00 0.00 ? 52 GLN A CB   1 
ATOM 766   C CG   . GLN A 1 52 ? -1.384  15.276  0.106   1.00 0.00 ? 52 GLN A CG   1 
ATOM 767   C CD   . GLN A 1 52 ? -2.425  16.286  0.531   1.00 0.00 ? 52 GLN A CD   1 
ATOM 768   O OE1  . GLN A 1 52 ? -3.496  15.923  1.015   1.00 0.00 ? 52 GLN A OE1  1 
ATOM 769   N NE2  . GLN A 1 52 ? -2.105  17.561  0.375   1.00 0.00 ? 52 GLN A NE2  1 
ATOM 770   H H    . GLN A 1 52 ? 1.421   14.877  -0.167  1.00 0.00 ? 52 GLN A H    1 
ATOM 771   H HA   . GLN A 1 52 ? 0.619   13.035  1.825   1.00 0.00 ? 52 GLN A HA   1 
ATOM 772   H HB2  . GLN A 1 52 ? -1.411  14.296  1.986   1.00 0.00 ? 52 GLN A HB2  1 
ATOM 773   H HB3  . GLN A 1 52 ? -0.080  15.425  1.774   1.00 0.00 ? 52 GLN A HB3  1 
ATOM 774   H HG2  . GLN A 1 52 ? -0.663  15.771  -0.522  1.00 0.00 ? 52 GLN A HG2  1 
ATOM 775   H HG3  . GLN A 1 52 ? -1.872  14.493  -0.455  1.00 0.00 ? 52 GLN A HG3  1 
ATOM 776   H HE21 . GLN A 1 52 ? -1.228  17.776  -0.005  1.00 0.00 ? 52 GLN A HE21 1 
ATOM 777   H HE22 . GLN A 1 52 ? -2.756  18.234  0.650   1.00 0.00 ? 52 GLN A HE22 1 
ATOM 778   N N    . PHE A 1 53 ? -0.590  12.664  -1.185  1.00 0.00 ? 53 PHE A N    1 
ATOM 779   C CA   . PHE A 1 53 ? -1.308  11.732  -2.042  1.00 0.00 ? 53 PHE A CA   1 
ATOM 780   C C    . PHE A 1 53 ? -0.751  10.324  -1.853  1.00 0.00 ? 53 PHE A C    1 
ATOM 781   O O    . PHE A 1 53 ? -1.474  9.398   -1.479  1.00 0.00 ? 53 PHE A O    1 
ATOM 782   C CB   . PHE A 1 53 ? -1.186  12.159  -3.505  1.00 0.00 ? 53 PHE A CB   1 
ATOM 783   C CG   . PHE A 1 53 ? -2.037  11.347  -4.439  1.00 0.00 ? 53 PHE A CG   1 
ATOM 784   C CD1  . PHE A 1 53 ? -1.751  10.013  -4.679  1.00 0.00 ? 53 PHE A CD1  1 
ATOM 785   C CD2  . PHE A 1 53 ? -3.136  11.915  -5.064  1.00 0.00 ? 53 PHE A CD2  1 
ATOM 786   C CE1  . PHE A 1 53 ? -2.543  9.262   -5.526  1.00 0.00 ? 53 PHE A CE1  1 
ATOM 787   C CE2  . PHE A 1 53 ? -3.931  11.169  -5.912  1.00 0.00 ? 53 PHE A CE2  1 
ATOM 788   C CZ   . PHE A 1 53 ? -3.634  9.841   -6.143  1.00 0.00 ? 53 PHE A CZ   1 
ATOM 789   H H    . PHE A 1 53 ? -0.142  13.446  -1.579  1.00 0.00 ? 53 PHE A H    1 
ATOM 790   H HA   . PHE A 1 53 ? -2.353  11.741  -1.753  1.00 0.00 ? 53 PHE A HA   1 
ATOM 791   H HB2  . PHE A 1 53 ? -1.483  13.193  -3.596  1.00 0.00 ? 53 PHE A HB2  1 
ATOM 792   H HB3  . PHE A 1 53 ? -0.157  12.058  -3.815  1.00 0.00 ? 53 PHE A HB3  1 
ATOM 793   H HD1  . PHE A 1 53 ? -0.898  9.559   -4.198  1.00 0.00 ? 53 PHE A HD1  1 
ATOM 794   H HD2  . PHE A 1 53 ? -3.369  12.954  -4.885  1.00 0.00 ? 53 PHE A HD2  1 
ATOM 795   H HE1  . PHE A 1 53 ? -2.309  8.223   -5.704  1.00 0.00 ? 53 PHE A HE1  1 
ATOM 796   H HE2  . PHE A 1 53 ? -4.783  11.624  -6.395  1.00 0.00 ? 53 PHE A HE2  1 
ATOM 797   H HZ   . PHE A 1 53 ? -4.255  9.254   -6.805  1.00 0.00 ? 53 PHE A HZ   1 
ATOM 798   N N    . PHE A 1 54 ? 0.550   10.187  -2.090  1.00 0.00 ? 54 PHE A N    1 
ATOM 799   C CA   . PHE A 1 54 ? 1.229   8.903   -1.950  1.00 0.00 ? 54 PHE A CA   1 
ATOM 800   C C    . PHE A 1 54 ? 1.194   8.384   -0.510  1.00 0.00 ? 54 PHE A C    1 
ATOM 801   O O    . PHE A 1 54 ? 0.997   7.191   -0.286  1.00 0.00 ? 54 PHE A O    1 
ATOM 802   C CB   . PHE A 1 54 ? 2.683   9.029   -2.418  1.00 0.00 ? 54 PHE A CB   1 
ATOM 803   C CG   . PHE A 1 54 ? 2.809   9.430   -3.860  1.00 0.00 ? 54 PHE A CG   1 
ATOM 804   C CD1  . PHE A 1 54 ? 2.406   8.569   -4.869  1.00 0.00 ? 54 PHE A CD1  1 
ATOM 805   C CD2  . PHE A 1 54 ? 3.308   10.674  -4.205  1.00 0.00 ? 54 PHE A CD2  1 
ATOM 806   C CE1  . PHE A 1 54 ? 2.499   8.944   -6.194  1.00 0.00 ? 54 PHE A CE1  1 
ATOM 807   C CE2  . PHE A 1 54 ? 3.407   11.052  -5.530  1.00 0.00 ? 54 PHE A CE2  1 
ATOM 808   C CZ   . PHE A 1 54 ? 3.002   10.187  -6.525  1.00 0.00 ? 54 PHE A CZ   1 
ATOM 809   H H    . PHE A 1 54 ? 1.070   10.973  -2.366  1.00 0.00 ? 54 PHE A H    1 
ATOM 810   H HA   . PHE A 1 54 ? 0.720   8.191   -2.593  1.00 0.00 ? 54 PHE A HA   1 
ATOM 811   H HB2  . PHE A 1 54 ? 3.184   9.775   -1.820  1.00 0.00 ? 54 PHE A HB2  1 
ATOM 812   H HB3  . PHE A 1 54 ? 3.180   8.078   -2.291  1.00 0.00 ? 54 PHE A HB3  1 
ATOM 813   H HD1  . PHE A 1 54 ? 2.014   7.597   -4.611  1.00 0.00 ? 54 PHE A HD1  1 
ATOM 814   H HD2  . PHE A 1 54 ? 3.627   11.351  -3.427  1.00 0.00 ? 54 PHE A HD2  1 
ATOM 815   H HE1  . PHE A 1 54 ? 2.181   8.266   -6.972  1.00 0.00 ? 54 PHE A HE1  1 
ATOM 816   H HE2  . PHE A 1 54 ? 3.801   12.024  -5.786  1.00 0.00 ? 54 PHE A HE2  1 
ATOM 817   H HZ   . PHE A 1 54 ? 3.075   10.481  -7.560  1.00 0.00 ? 54 PHE A HZ   1 
ATOM 818   N N    . ILE A 1 55 ? 1.403   9.271   0.463   1.00 0.00 ? 55 ILE A N    1 
ATOM 819   C CA   . ILE A 1 55 ? 1.414   8.857   1.868   1.00 0.00 ? 55 ILE A CA   1 
ATOM 820   C C    . ILE A 1 55 ? 0.056   8.307   2.306   1.00 0.00 ? 55 ILE A C    1 
ATOM 821   O O    . ILE A 1 55 ? -0.026  7.230   2.889   1.00 0.00 ? 55 ILE A O    1 
ATOM 822   C CB   . ILE A 1 55 ? 1.830   10.006  2.824   1.00 0.00 ? 55 ILE A CB   1 
ATOM 823   C CG1  . ILE A 1 55 ? 2.171   9.451   4.206   1.00 0.00 ? 55 ILE A CG1  1 
ATOM 824   C CG2  . ILE A 1 55 ? 0.734   11.044  2.945   1.00 0.00 ? 55 ILE A CG2  1 
ATOM 825   C CD1  . ILE A 1 55 ? 3.371   8.530   4.212   1.00 0.00 ? 55 ILE A CD1  1 
ATOM 826   H H    . ILE A 1 55 ? 1.568   10.210  0.234   1.00 0.00 ? 55 ILE A H    1 
ATOM 827   H HA   . ILE A 1 55 ? 2.148   8.066   1.965   1.00 0.00 ? 55 ILE A HA   1 
ATOM 828   H HB   . ILE A 1 55 ? 2.702   10.493  2.414   1.00 0.00 ? 55 ILE A HB   1 
ATOM 829   H HG12 . ILE A 1 55 ? 2.380   10.271  4.875   1.00 0.00 ? 55 ILE A HG12 1 
ATOM 830   H HG13 . ILE A 1 55 ? 1.324   8.894   4.579   1.00 0.00 ? 55 ILE A HG13 1 
ATOM 831   H HG21 . ILE A 1 55 ? 0.359   11.273  1.968   1.00 0.00 ? 55 ILE A HG21 1 
ATOM 832   H HG22 . ILE A 1 55 ? -0.065  10.657  3.557   1.00 0.00 ? 55 ILE A HG22 1 
ATOM 833   H HG23 . ILE A 1 55 ? 1.133   11.940  3.397   1.00 0.00 ? 55 ILE A HG23 1 
ATOM 834   H HD11 . ILE A 1 55 ? 3.800   8.494   3.222   1.00 0.00 ? 55 ILE A HD11 1 
ATOM 835   H HD12 . ILE A 1 55 ? 4.105   8.903   4.911   1.00 0.00 ? 55 ILE A HD12 1 
ATOM 836   H HD13 . ILE A 1 55 ? 3.062   7.539   4.509   1.00 0.00 ? 55 ILE A HD13 1 
ATOM 837   N N    . VAL A 1 56 ? -1.009  9.052   2.028   1.00 0.00 ? 56 VAL A N    1 
ATOM 838   C CA   . VAL A 1 56 ? -2.349  8.633   2.416   1.00 0.00 ? 56 VAL A CA   1 
ATOM 839   C C    . VAL A 1 56 ? -2.784  7.372   1.680   1.00 0.00 ? 56 VAL A C    1 
ATOM 840   O O    . VAL A 1 56 ? -3.364  6.471   2.280   1.00 0.00 ? 56 VAL A O    1 
ATOM 841   C CB   . VAL A 1 56 ? -3.381  9.753   2.167   1.00 0.00 ? 56 VAL A CB   1 
ATOM 842   C CG1  . VAL A 1 56 ? -4.774  9.323   2.611   1.00 0.00 ? 56 VAL A CG1  1 
ATOM 843   C CG2  . VAL A 1 56 ? -2.960  11.025  2.887   1.00 0.00 ? 56 VAL A CG2  1 
ATOM 844   H H    . VAL A 1 56 ? -0.891  9.903   1.561   1.00 0.00 ? 56 VAL A H    1 
ATOM 845   H HA   . VAL A 1 56 ? -2.332  8.421   3.476   1.00 0.00 ? 56 VAL A HA   1 
ATOM 846   H HB   . VAL A 1 56 ? -3.412  9.961   1.108   1.00 0.00 ? 56 VAL A HB   1 
ATOM 847   H HG11 . VAL A 1 56 ? -4.821  8.246   2.662   1.00 0.00 ? 56 VAL A HG11 1 
ATOM 848   H HG12 . VAL A 1 56 ? -4.984  9.738   3.586   1.00 0.00 ? 56 VAL A HG12 1 
ATOM 849   H HG13 . VAL A 1 56 ? -5.504  9.684   1.902   1.00 0.00 ? 56 VAL A HG13 1 
ATOM 850   H HG21 . VAL A 1 56 ? -1.962  11.297  2.583   1.00 0.00 ? 56 VAL A HG21 1 
ATOM 851   H HG22 . VAL A 1 56 ? -3.643  11.823  2.637   1.00 0.00 ? 56 VAL A HG22 1 
ATOM 852   H HG23 . VAL A 1 56 ? -2.978  10.857  3.954   1.00 0.00 ? 56 VAL A HG23 1 
ATOM 853   N N    . MET A 1 57 ? -2.506  7.304   0.384   1.00 0.00 ? 57 MET A N    1 
ATOM 854   C CA   . MET A 1 57 ? -2.884  6.135   -0.398  1.00 0.00 ? 57 MET A CA   1 
ATOM 855   C C    . MET A 1 57 ? -2.007  4.950   -0.033  1.00 0.00 ? 57 MET A C    1 
ATOM 856   O O    . MET A 1 57 ? -2.477  3.819   0.082   1.00 0.00 ? 57 MET A O    1 
ATOM 857   C CB   . MET A 1 57 ? -2.777  6.434   -1.895  1.00 0.00 ? 57 MET A CB   1 
ATOM 858   C CG   . MET A 1 57 ? -3.197  5.273   -2.781  1.00 0.00 ? 57 MET A CG   1 
ATOM 859   S SD   . MET A 1 57 ? -3.170  5.692   -4.534  1.00 0.00 ? 57 MET A SD   1 
ATOM 860   C CE   . MET A 1 57 ? -4.414  6.979   -4.592  1.00 0.00 ? 57 MET A CE   1 
ATOM 861   H H    . MET A 1 57 ? -2.038  8.048   -0.053  1.00 0.00 ? 57 MET A H    1 
ATOM 862   H HA   . MET A 1 57 ? -3.904  5.895   -0.158  1.00 0.00 ? 57 MET A HA   1 
ATOM 863   H HB2  . MET A 1 57 ? -3.404  7.281   -2.126  1.00 0.00 ? 57 MET A HB2  1 
ATOM 864   H HB3  . MET A 1 57 ? -1.751  6.682   -2.130  1.00 0.00 ? 57 MET A HB3  1 
ATOM 865   H HG2  . MET A 1 57 ? -2.522  4.447   -2.615  1.00 0.00 ? 57 MET A HG2  1 
ATOM 866   H HG3  . MET A 1 57 ? -4.201  4.978   -2.512  1.00 0.00 ? 57 MET A HG3  1 
ATOM 867   H HE1  . MET A 1 57 ? -4.134  7.781   -3.925  1.00 0.00 ? 57 MET A HE1  1 
ATOM 868   H HE2  . MET A 1 57 ? -4.492  7.359   -5.600  1.00 0.00 ? 57 MET A HE2  1 
ATOM 869   H HE3  . MET A 1 57 ? -5.367  6.572   -4.286  1.00 0.00 ? 57 MET A HE3  1 
ATOM 870   N N    . GLY A 1 58 ? -0.728  5.229   0.146   1.00 0.00 ? 58 GLY A N    1 
ATOM 871   C CA   . GLY A 1 58 ? 0.229   4.193   0.491   1.00 0.00 ? 58 GLY A CA   1 
ATOM 872   C C    . GLY A 1 58 ? 0.032   3.633   1.887   1.00 0.00 ? 58 GLY A C    1 
ATOM 873   O O    . GLY A 1 58 ? 0.083   2.421   2.081   1.00 0.00 ? 58 GLY A O    1 
ATOM 874   H H    . GLY A 1 58 ? -0.429  6.152   0.039   1.00 0.00 ? 58 GLY A H    1 
ATOM 875   H HA2  . GLY A 1 58 ? 0.134   3.383   -0.221  1.00 0.00 ? 58 GLY A HA2  1 
ATOM 876   H HA3  . GLY A 1 58 ? 1.223   4.601   0.416   1.00 0.00 ? 58 GLY A HA3  1 
ATOM 877   N N    . LEU A 1 59 ? -0.190  4.507   2.867   1.00 0.00 ? 59 LEU A N    1 
ATOM 878   C CA   . LEU A 1 59 ? -0.391  4.057   4.238   1.00 0.00 ? 59 LEU A CA   1 
ATOM 879   C C    . LEU A 1 59 ? -1.653  3.209   4.326   1.00 0.00 ? 59 LEU A C    1 
ATOM 880   O O    . LEU A 1 59 ? -1.678  2.175   4.995   1.00 0.00 ? 59 LEU A O    1 
ATOM 881   C CB   . LEU A 1 59 ? -0.480  5.252   5.192   1.00 0.00 ? 59 LEU A CB   1 
ATOM 882   C CG   . LEU A 1 59 ? 0.815   6.054   5.363   1.00 0.00 ? 59 LEU A CG   1 
ATOM 883   C CD1  . LEU A 1 59 ? 0.588   7.238   6.289   1.00 0.00 ? 59 LEU A CD1  1 
ATOM 884   C CD2  . LEU A 1 59 ? 1.934   5.172   5.898   1.00 0.00 ? 59 LEU A CD2  1 
ATOM 885   H H    . LEU A 1 59 ? -0.223  5.467   2.668   1.00 0.00 ? 59 LEU A H    1 
ATOM 886   H HA   . LEU A 1 59 ? 0.456   3.446   4.512   1.00 0.00 ? 59 LEU A HA   1 
ATOM 887   H HB2  . LEU A 1 59 ? -1.244  5.919   4.823   1.00 0.00 ? 59 LEU A HB2  1 
ATOM 888   H HB3  . LEU A 1 59 ? -0.781  4.889   6.160   1.00 0.00 ? 59 LEU A HB3  1 
ATOM 889   H HG   . LEU A 1 59 ? 1.125   6.438   4.403   1.00 0.00 ? 59 LEU A HG   1 
ATOM 890   H HD11 . LEU A 1 59 ? 0.191   6.888   7.230   1.00 0.00 ? 59 LEU A HD11 1 
ATOM 891   H HD12 . LEU A 1 59 ? 1.525   7.748   6.459   1.00 0.00 ? 59 LEU A HD12 1 
ATOM 892   H HD13 . LEU A 1 59 ? -0.115  7.921   5.834   1.00 0.00 ? 59 LEU A HD13 1 
ATOM 893   H HD21 . LEU A 1 59 ? 1.736   4.142   5.644   1.00 0.00 ? 59 LEU A HD21 1 
ATOM 894   H HD22 . LEU A 1 59 ? 2.872   5.477   5.461   1.00 0.00 ? 59 LEU A HD22 1 
ATOM 895   H HD23 . LEU A 1 59 ? 1.989   5.272   6.972   1.00 0.00 ? 59 LEU A HD23 1 
ATOM 896   N N    . VAL A 1 60 ? -2.688  3.641   3.618   1.00 0.00 ? 60 VAL A N    1 
ATOM 897   C CA   . VAL A 1 60 ? -3.953  2.919   3.586   1.00 0.00 ? 60 VAL A CA   1 
ATOM 898   C C    . VAL A 1 60 ? -3.809  1.626   2.784   1.00 0.00 ? 60 VAL A C    1 
ATOM 899   O O    . VAL A 1 60 ? -4.321  0.580   3.179   1.00 0.00 ? 60 VAL A O    1 
ATOM 900   C CB   . VAL A 1 60 ? -5.070  3.794   2.974   1.00 0.00 ? 60 VAL A CB   1 
ATOM 901   C CG1  . VAL A 1 60 ? -6.394  3.047   2.919   1.00 0.00 ? 60 VAL A CG1  1 
ATOM 902   C CG2  . VAL A 1 60 ? -5.223  5.085   3.764   1.00 0.00 ? 60 VAL A CG2  1 
ATOM 903   H H    . VAL A 1 60 ? -2.595  4.459   3.088   1.00 0.00 ? 60 VAL A H    1 
ATOM 904   H HA   . VAL A 1 60 ? -4.228  2.674   4.606   1.00 0.00 ? 60 VAL A HA   1 
ATOM 905   H HB   . VAL A 1 60 ? -4.785  4.051   1.963   1.00 0.00 ? 60 VAL A HB   1 
ATOM 906   H HG11 . VAL A 1 60 ? -6.222  2.030   2.601   1.00 0.00 ? 60 VAL A HG11 1 
ATOM 907   H HG12 . VAL A 1 60 ? -6.847  3.047   3.900   1.00 0.00 ? 60 VAL A HG12 1 
ATOM 908   H HG13 . VAL A 1 60 ? -7.054  3.540   2.217   1.00 0.00 ? 60 VAL A HG13 1 
ATOM 909   H HG21 . VAL A 1 60 ? -4.247  5.485   3.993   1.00 0.00 ? 60 VAL A HG21 1 
ATOM 910   H HG22 . VAL A 1 60 ? -5.779  5.802   3.177   1.00 0.00 ? 60 VAL A HG22 1 
ATOM 911   H HG23 . VAL A 1 60 ? -5.754  4.883   4.682   1.00 0.00 ? 60 VAL A HG23 1 
ATOM 912   N N    . ASP A 1 61 ? -3.095  1.707   1.663   1.00 0.00 ? 61 ASP A N    1 
ATOM 913   C CA   . ASP A 1 61 ? -2.870  0.550   0.807   1.00 0.00 ? 61 ASP A CA   1 
ATOM 914   C C    . ASP A 1 61 ? -1.735  -0.326  1.332   1.00 0.00 ? 61 ASP A C    1 
ATOM 915   O O    . ASP A 1 61 ? -1.519  -1.441  0.848   1.00 0.00 ? 61 ASP A O    1 
ATOM 916   C CB   . ASP A 1 61 ? -2.563  1.012   -0.616  1.00 0.00 ? 61 ASP A CB   1 
ATOM 917   C CG   . ASP A 1 61 ? -3.788  1.569   -1.314  1.00 0.00 ? 61 ASP A CG   1 
ATOM 918   O OD1  . ASP A 1 61 ? -4.770  0.815   -1.479  1.00 0.00 ? 61 ASP A OD1  1 
ATOM 919   O OD2  . ASP A 1 61 ? -3.769  2.758   -1.691  1.00 0.00 ? 61 ASP A OD2  1 
ATOM 920   H H    . ASP A 1 61 ? -2.704  2.564   1.403   1.00 0.00 ? 61 ASP A H    1 
ATOM 921   H HA   . ASP A 1 61 ? -3.779  -0.035  0.800   1.00 0.00 ? 61 ASP A HA   1 
ATOM 922   H HB2  . ASP A 1 61 ? -1.800  1.782   -0.587  1.00 0.00 ? 61 ASP A HB2  1 
ATOM 923   H HB3  . ASP A 1 61 ? -2.197  0.176   -1.182  1.00 0.00 ? 61 ASP A HB3  1 
ATOM 924   N N    . ALA A 1 62 ? -1.020  0.161   2.334   1.00 0.00 ? 62 ALA A N    1 
ATOM 925   C CA   . ALA A 1 62 ? 0.061   -0.610  2.914   1.00 0.00 ? 62 ALA A CA   1 
ATOM 926   C C    . ALA A 1 62 ? -0.500  -1.848  3.605   1.00 0.00 ? 62 ALA A C    1 
ATOM 927   O O    . ALA A 1 62 ? 0.171   -2.871  3.709   1.00 0.00 ? 62 ALA A O    1 
ATOM 928   C CB   . ALA A 1 62 ? 0.857   0.236   3.895   1.00 0.00 ? 62 ALA A CB   1 
ATOM 929   H H    . ALA A 1 62 ? -1.233  1.045   2.700   1.00 0.00 ? 62 ALA A H    1 
ATOM 930   H HA   . ALA A 1 62 ? 0.720   -0.920  2.116   1.00 0.00 ? 62 ALA A HA   1 
ATOM 931   H HB1  . ALA A 1 62 ? 0.204   0.962   4.356   1.00 0.00 ? 62 ALA A HB1  1 
ATOM 932   H HB2  . ALA A 1 62 ? 1.283   -0.400  4.657   1.00 0.00 ? 62 ALA A HB2  1 
ATOM 933   H HB3  . ALA A 1 62 ? 1.649   0.747   3.368   1.00 0.00 ? 62 ALA A HB3  1 
ATOM 934   N N    . ILE A 1 63 ? -1.745  -1.751  4.064   1.00 0.00 ? 63 ILE A N    1 
ATOM 935   C CA   . ILE A 1 63 ? -2.393  -2.866  4.736   1.00 0.00 ? 63 ILE A CA   1 
ATOM 936   C C    . ILE A 1 63 ? -2.528  -4.064  3.794   1.00 0.00 ? 63 ILE A C    1 
ATOM 937   O O    . ILE A 1 63 ? -1.988  -5.132  4.088   1.00 0.00 ? 63 ILE A O    1 
ATOM 938   C CB   . ILE A 1 63 ? -3.756  -2.456  5.342   1.00 0.00 ? 63 ILE A CB   1 
ATOM 939   C CG1  . ILE A 1 63 ? -3.530  -1.445  6.466   1.00 0.00 ? 63 ILE A CG1  1 
ATOM 940   C CG2  . ILE A 1 63 ? -4.510  -3.672  5.864   1.00 0.00 ? 63 ILE A CG2  1 
ATOM 941   C CD1  . ILE A 1 63 ? -4.812  -0.938  7.091   1.00 0.00 ? 63 ILE A CD1  1 
ATOM 942   H H    . ILE A 1 63 ? -2.237  -0.916  3.939   1.00 0.00 ? 63 ILE A H    1 
ATOM 943   H HA   . ILE A 1 63 ? -1.747  -3.158  5.554   1.00 0.00 ? 63 ILE A HA   1 
ATOM 944   H HB   . ILE A 1 63 ? -4.351  -1.991  4.579   1.00 0.00 ? 63 ILE A HB   1 
ATOM 945   H HG12 . ILE A 1 63 ? -2.940  -1.907  7.242   1.00 0.00 ? 63 ILE A HG12 1 
ATOM 946   H HG13 . ILE A 1 63 ? -2.993  -0.595  6.070   1.00 0.00 ? 63 ILE A HG13 1 
ATOM 947   H HG21 . ILE A 1 63 ? -3.910  -4.176  6.608   1.00 0.00 ? 63 ILE A HG21 1 
ATOM 948   H HG22 . ILE A 1 63 ? -5.443  -3.354  6.309   1.00 0.00 ? 63 ILE A HG22 1 
ATOM 949   H HG23 . ILE A 1 63 ? -4.713  -4.347  5.047   1.00 0.00 ? 63 ILE A HG23 1 
ATOM 950   H HD11 . ILE A 1 63 ? -5.645  -1.513  6.720   1.00 0.00 ? 63 ILE A HD11 1 
ATOM 951   H HD12 . ILE A 1 63 ? -4.753  -1.038  8.165   1.00 0.00 ? 63 ILE A HD12 1 
ATOM 952   H HD13 . ILE A 1 63 ? -4.949  0.103   6.834   1.00 0.00 ? 63 ILE A HD13 1 
ATOM 953   N N    . PRO A 1 64 ? -3.229  -3.938  2.643   1.00 0.00 ? 64 PRO A N    1 
ATOM 954   C CA   . PRO A 1 64 ? -3.355  -5.050  1.708   1.00 0.00 ? 64 PRO A CA   1 
ATOM 955   C C    . PRO A 1 64 ? -2.022  -5.353  1.051   1.00 0.00 ? 64 PRO A C    1 
ATOM 956   O O    . PRO A 1 64 ? -1.755  -6.482  0.653   1.00 0.00 ? 64 PRO A O    1 
ATOM 957   C CB   . PRO A 1 64 ? -4.374  -4.563  0.669   1.00 0.00 ? 64 PRO A CB   1 
ATOM 958   C CG   . PRO A 1 64 ? -4.995  -3.353  1.271   1.00 0.00 ? 64 PRO A CG   1 
ATOM 959   C CD   . PRO A 1 64 ? -3.938  -2.748  2.143   1.00 0.00 ? 64 PRO A CD   1 
ATOM 960   H HA   . PRO A 1 64 ? -3.717  -5.934  2.199   1.00 0.00 ? 64 PRO A HA   1 
ATOM 961   H HB2  . PRO A 1 64 ? -3.863  -4.324  -0.251  1.00 0.00 ? 64 PRO A HB2  1 
ATOM 962   H HB3  . PRO A 1 64 ? -5.108  -5.335  0.490   1.00 0.00 ? 64 PRO A HB3  1 
ATOM 963   H HG2  . PRO A 1 64 ? -5.284  -2.660  0.494   1.00 0.00 ? 64 PRO A HG2  1 
ATOM 964   H HG3  . PRO A 1 64 ? -5.850  -3.636  1.863   1.00 0.00 ? 64 PRO A HG3  1 
ATOM 965   H HD2  . PRO A 1 64 ? -3.294  -2.123  1.560   1.00 0.00 ? 64 PRO A HD2  1 
ATOM 966   H HD3  . PRO A 1 64 ? -4.388  -2.194  2.936   1.00 0.00 ? 64 PRO A HD3  1 
ATOM 967   N N    . MET A 1 65 ? -1.174  -4.338  0.968   1.00 0.00 ? 65 MET A N    1 
ATOM 968   C CA   . MET A 1 65 ? 0.143   -4.508  0.387   1.00 0.00 ? 65 MET A CA   1 
ATOM 969   C C    . MET A 1 65 ? 0.996   -5.370  1.306   1.00 0.00 ? 65 MET A C    1 
ATOM 970   O O    . MET A 1 65 ? 1.849   -6.132  0.853   1.00 0.00 ? 65 MET A O    1 
ATOM 971   C CB   . MET A 1 65 ? 0.798   -3.146  0.179   1.00 0.00 ? 65 MET A CB   1 
ATOM 972   C CG   . MET A 1 65 ? 2.207   -3.226  -0.371  1.00 0.00 ? 65 MET A CG   1 
ATOM 973   S SD   . MET A 1 65 ? 2.291   -4.076  -1.959  1.00 0.00 ? 65 MET A SD   1 
ATOM 974   C CE   . MET A 1 65 ? 4.059   -4.080  -2.248  1.00 0.00 ? 65 MET A CE   1 
ATOM 975   H H    . MET A 1 65 ? -1.430  -3.459  1.327   1.00 0.00 ? 65 MET A H    1 
ATOM 976   H HA   . MET A 1 65 ? 0.033   -5.006  -0.567  1.00 0.00 ? 65 MET A HA   1 
ATOM 977   H HB2  . MET A 1 65 ? 0.198   -2.573  -0.511  1.00 0.00 ? 65 MET A HB2  1 
ATOM 978   H HB3  . MET A 1 65 ? 0.834   -2.629  1.126   1.00 0.00 ? 65 MET A HB3  1 
ATOM 979   H HG2  . MET A 1 65 ? 2.574   -2.222  -0.496  1.00 0.00 ? 65 MET A HG2  1 
ATOM 980   H HG3  . MET A 1 65 ? 2.829   -3.751  0.339   1.00 0.00 ? 65 MET A HG3  1 
ATOM 981   H HE1  . MET A 1 65 ? 4.578   -4.167  -1.305  1.00 0.00 ? 65 MET A HE1  1 
ATOM 982   H HE2  . MET A 1 65 ? 4.318   -4.916  -2.881  1.00 0.00 ? 65 MET A HE2  1 
ATOM 983   H HE3  . MET A 1 65 ? 4.347   -3.159  -2.734  1.00 0.00 ? 65 MET A HE3  1 
ATOM 984   N N    . ILE A 1 66 ? 0.734   -5.254  2.605   1.00 0.00 ? 66 ILE A N    1 
ATOM 985   C CA   . ILE A 1 66 ? 1.452   -6.025  3.609   1.00 0.00 ? 66 ILE A CA   1 
ATOM 986   C C    . ILE A 1 66 ? 0.895   -7.443  3.671   1.00 0.00 ? 66 ILE A C    1 
ATOM 987   O O    . ILE A 1 66 ? 1.649   -8.413  3.702   1.00 0.00 ? 66 ILE A O    1 
ATOM 988   C CB   . ILE A 1 66 ? 1.368   -5.341  5.000   1.00 0.00 ? 66 ILE A CB   1 
ATOM 989   C CG1  . ILE A 1 66 ? 2.271   -4.105  5.033   1.00 0.00 ? 66 ILE A CG1  1 
ATOM 990   C CG2  . ILE A 1 66 ? 1.752   -6.292  6.131   1.00 0.00 ? 66 ILE A CG2  1 
ATOM 991   C CD1  . ILE A 1 66 ? 2.159   -3.309  6.315   1.00 0.00 ? 66 ILE A CD1  1 
ATOM 992   H H    . ILE A 1 66 ? 0.022   -4.643  2.895   1.00 0.00 ? 66 ILE A H    1 
ATOM 993   H HA   . ILE A 1 66 ? 2.494   -6.070  3.315   1.00 0.00 ? 66 ILE A HA   1 
ATOM 994   H HB   . ILE A 1 66 ? 0.348   -5.030  5.162   1.00 0.00 ? 66 ILE A HB   1 
ATOM 995   H HG12 . ILE A 1 66 ? 3.300   -4.418  4.929   1.00 0.00 ? 66 ILE A HG12 1 
ATOM 996   H HG13 . ILE A 1 66 ? 2.018   -3.455  4.212   1.00 0.00 ? 66 ILE A HG13 1 
ATOM 997   H HG21 . ILE A 1 66 ? 1.455   -7.297  5.882   1.00 0.00 ? 66 ILE A HG21 1 
ATOM 998   H HG22 . ILE A 1 66 ? 2.819   -6.257  6.282   1.00 0.00 ? 66 ILE A HG22 1 
ATOM 999   H HG23 . ILE A 1 66 ? 1.249   -5.983  7.037   1.00 0.00 ? 66 ILE A HG23 1 
ATOM 1000  H HD11 . ILE A 1 66 ? 2.127   -3.986  7.156   1.00 0.00 ? 66 ILE A HD11 1 
ATOM 1001  H HD12 . ILE A 1 66 ? 3.014   -2.657  6.409   1.00 0.00 ? 66 ILE A HD12 1 
ATOM 1002  H HD13 . ILE A 1 66 ? 1.255   -2.719  6.294   1.00 0.00 ? 66 ILE A HD13 1 
ATOM 1003  N N    . ALA A 1 67 ? -0.431  -7.556  3.672   1.00 0.00 ? 67 ALA A N    1 
ATOM 1004  C CA   . ALA A 1 67 ? -1.078  -8.857  3.714   1.00 0.00 ? 67 ALA A CA   1 
ATOM 1005  C C    . ALA A 1 67 ? -0.817  -9.617  2.426   1.00 0.00 ? 67 ALA A C    1 
ATOM 1006  O O    . ALA A 1 67 ? -0.329  -10.745 2.440   1.00 0.00 ? 67 ALA A O    1 
ATOM 1007  C CB   . ALA A 1 67 ? -2.571  -8.707  3.959   1.00 0.00 ? 67 ALA A CB   1 
ATOM 1008  H H    . ALA A 1 67 ? -0.982  -6.749  3.632   1.00 0.00 ? 67 ALA A H    1 
ATOM 1009  H HA   . ALA A 1 67 ? -0.650  -9.409  4.532   1.00 0.00 ? 67 ALA A HA   1 
ATOM 1010  H HB1  . ALA A 1 67 ? -2.948  -7.877  3.379   1.00 0.00 ? 67 ALA A HB1  1 
ATOM 1011  H HB2  . ALA A 1 67 ? -3.078  -9.613  3.663   1.00 0.00 ? 67 ALA A HB2  1 
ATOM 1012  H HB3  . ALA A 1 67 ? -2.747  -8.522  5.009   1.00 0.00 ? 67 ALA A HB3  1 
ATOM 1013  N N    . VAL A 1 68 ? -1.118  -8.981  1.306   1.00 0.00 ? 68 VAL A N    1 
ATOM 1014  C CA   . VAL A 1 68 ? -0.883  -9.595  0.015   1.00 0.00 ? 68 VAL A CA   1 
ATOM 1015  C C    . VAL A 1 68 ? 0.612   -9.793  -0.183  1.00 0.00 ? 68 VAL A C    1 
ATOM 1016  O O    . VAL A 1 68 ? 1.056   -10.869 -0.574  1.00 0.00 ? 68 VAL A O    1 
ATOM 1017  C CB   . VAL A 1 68 ? -1.453  -8.739  -1.138  1.00 0.00 ? 68 VAL A CB   1 
ATOM 1018  C CG1  . VAL A 1 68 ? -1.160  -9.380  -2.488  1.00 0.00 ? 68 VAL A CG1  1 
ATOM 1019  C CG2  . VAL A 1 68 ? -2.952  -8.540  -0.960  1.00 0.00 ? 68 VAL A CG2  1 
ATOM 1020  H H    . VAL A 1 68 ? -1.484  -8.076  1.351   1.00 0.00 ? 68 VAL A H    1 
ATOM 1021  H HA   . VAL A 1 68 ? -1.371  -10.561 0.006   1.00 0.00 ? 68 VAL A HA   1 
ATOM 1022  H HB   . VAL A 1 68 ? -0.976  -7.768  -1.114  1.00 0.00 ? 68 VAL A HB   1 
ATOM 1023  H HG11 . VAL A 1 68 ? -0.154  -9.769  -2.489  1.00 0.00 ? 68 VAL A HG11 1 
ATOM 1024  H HG12 . VAL A 1 68 ? -1.858  -10.185 -2.664  1.00 0.00 ? 68 VAL A HG12 1 
ATOM 1025  H HG13 . VAL A 1 68 ? -1.261  -8.639  -3.267  1.00 0.00 ? 68 VAL A HG13 1 
ATOM 1026  H HG21 . VAL A 1 68 ? -3.416  -9.488  -0.734  1.00 0.00 ? 68 VAL A HG21 1 
ATOM 1027  H HG22 . VAL A 1 68 ? -3.131  -7.852  -0.149  1.00 0.00 ? 68 VAL A HG22 1 
ATOM 1028  H HG23 . VAL A 1 68 ? -3.373  -8.140  -1.870  1.00 0.00 ? 68 VAL A HG23 1 
ATOM 1029  N N    . GLY A 1 69 ? 1.383   -8.747  0.108   1.00 0.00 ? 69 GLY A N    1 
ATOM 1030  C CA   . GLY A 1 69 ? 2.824   -8.824  -0.032  1.00 0.00 ? 69 GLY A CA   1 
ATOM 1031  C C    . GLY A 1 69 ? 3.425   -9.986  0.734   1.00 0.00 ? 69 GLY A C    1 
ATOM 1032  O O    . GLY A 1 69 ? 4.198   -10.761 0.176   1.00 0.00 ? 69 GLY A O    1 
ATOM 1033  H H    . GLY A 1 69 ? 0.970   -7.917  0.429   1.00 0.00 ? 69 GLY A H    1 
ATOM 1034  H HA2  . GLY A 1 69 ? 3.066   -8.935  -1.080  1.00 0.00 ? 69 GLY A HA2  1 
ATOM 1035  H HA3  . GLY A 1 69 ? 3.263   -7.905  0.330   1.00 0.00 ? 69 GLY A HA3  1 
ATOM 1036  N N    . LEU A 1 70 ? 3.082   -10.110 2.016   1.00 0.00 ? 70 LEU A N    1 
ATOM 1037  C CA   . LEU A 1 70 ? 3.604   -11.179 2.836   1.00 0.00 ? 70 LEU A CA   1 
ATOM 1038  C C    . LEU A 1 70 ? 3.158   -12.523 2.296   1.00 0.00 ? 70 LEU A C    1 
ATOM 1039  O O    . LEU A 1 70 ? 3.933   -13.477 2.236   1.00 0.00 ? 70 LEU A O    1 
ATOM 1040  C CB   . LEU A 1 70 ? 3.133   -10.993 4.275   1.00 0.00 ? 70 LEU A CB   1 
ATOM 1041  C CG   . LEU A 1 70 ? 1.654   -11.270 4.565   1.00 0.00 ? 70 LEU A CG   1 
ATOM 1042  C CD1  . LEU A 1 70 ? 1.402   -12.757 4.785   1.00 0.00 ? 70 LEU A CD1  1 
ATOM 1043  C CD2  . LEU A 1 70 ? 1.196   -10.479 5.782   1.00 0.00 ? 70 LEU A CD2  1 
ATOM 1044  H H    . LEU A 1 70 ? 2.468   -9.468  2.424   1.00 0.00 ? 70 LEU A H    1 
ATOM 1045  H HA   . LEU A 1 70 ? 4.681   -11.128 2.807   1.00 0.00 ? 70 LEU A HA   1 
ATOM 1046  H HB2  . LEU A 1 70 ? 3.711   -11.641 4.882   1.00 0.00 ? 70 LEU A HB2  1 
ATOM 1047  H HB3  . LEU A 1 70 ? 3.342   -9.978  4.563   1.00 0.00 ? 70 LEU A HB3  1 
ATOM 1048  H HG   . LEU A 1 70 ? 1.066   -10.953 3.723   1.00 0.00 ? 70 LEU A HG   1 
ATOM 1049  H HD11 . LEU A 1 70 ? 2.138   -13.148 5.471   1.00 0.00 ? 70 LEU A HD11 1 
ATOM 1050  H HD12 . LEU A 1 70 ? 0.415   -12.894 5.203   1.00 0.00 ? 70 LEU A HD12 1 
ATOM 1051  H HD13 . LEU A 1 70 ? 1.468   -13.284 3.851   1.00 0.00 ? 70 LEU A HD13 1 
ATOM 1052  H HD21 . LEU A 1 70 ? 1.851   -10.690 6.615   1.00 0.00 ? 70 LEU A HD21 1 
ATOM 1053  H HD22 . LEU A 1 70 ? 1.225   -9.425  5.559   1.00 0.00 ? 70 LEU A HD22 1 
ATOM 1054  H HD23 . LEU A 1 70 ? 0.187   -10.765 6.037   1.00 0.00 ? 70 LEU A HD23 1 
ATOM 1055  N N    . GLY A 1 71 ? 1.898   -12.583 1.906   1.00 0.00 ? 71 GLY A N    1 
ATOM 1056  C CA   . GLY A 1 71 ? 1.342   -13.813 1.374   1.00 0.00 ? 71 GLY A CA   1 
ATOM 1057  C C    . GLY A 1 71 ? 2.086   -14.315 0.150   1.00 0.00 ? 71 GLY A C    1 
ATOM 1058  O O    . GLY A 1 71 ? 2.563   -15.448 0.127   1.00 0.00 ? 71 GLY A O    1 
ATOM 1059  H H    . GLY A 1 71 ? 1.336   -11.780 1.993   1.00 0.00 ? 71 GLY A H    1 
ATOM 1060  H HA2  . GLY A 1 71 ? 1.382   -14.574 2.141   1.00 0.00 ? 71 GLY A HA2  1 
ATOM 1061  H HA3  . GLY A 1 71 ? 0.308   -13.643 1.107   1.00 0.00 ? 71 GLY A HA3  1 
ATOM 1062  N N    . LEU A 1 72 ? 2.181   -13.471 -0.871  1.00 0.00 ? 72 LEU A N    1 
ATOM 1063  C CA   . LEU A 1 72 ? 2.860   -13.841 -2.112  1.00 0.00 ? 72 LEU A CA   1 
ATOM 1064  C C    . LEU A 1 72 ? 4.370   -13.920 -1.928  1.00 0.00 ? 72 LEU A C    1 
ATOM 1065  O O    . LEU A 1 72 ? 5.048   -14.677 -2.621  1.00 0.00 ? 72 LEU A O    1 
ATOM 1066  C CB   . LEU A 1 72 ? 2.522   -12.852 -3.232  1.00 0.00 ? 72 LEU A CB   1 
ATOM 1067  C CG   . LEU A 1 72 ? 2.774   -11.376 -2.926  1.00 0.00 ? 72 LEU A CG   1 
ATOM 1068  C CD1  . LEU A 1 72 ? 4.256   -11.037 -3.010  1.00 0.00 ? 72 LEU A CD1  1 
ATOM 1069  C CD2  . LEU A 1 72 ? 1.969   -10.500 -3.876  1.00 0.00 ? 72 LEU A CD2  1 
ATOM 1070  H H    . LEU A 1 72 ? 1.779   -12.583 -0.793  1.00 0.00 ? 72 LEU A H    1 
ATOM 1071  H HA   . LEU A 1 72 ? 2.499   -14.820 -2.400  1.00 0.00 ? 72 LEU A HA   1 
ATOM 1072  H HB2  . LEU A 1 72 ? 3.115   -13.114 -4.095  1.00 0.00 ? 72 LEU A HB2  1 
ATOM 1073  H HB3  . LEU A 1 72 ? 1.478   -12.972 -3.484  1.00 0.00 ? 72 LEU A HB3  1 
ATOM 1074  H HG   . LEU A 1 72 ? 2.446   -11.169 -1.924  1.00 0.00 ? 72 LEU A HG   1 
ATOM 1075  H HD11 . LEU A 1 72 ? 4.835   -11.945 -3.055  1.00 0.00 ? 72 LEU A HD11 1 
ATOM 1076  H HD12 . LEU A 1 72 ? 4.442   -10.450 -3.896  1.00 0.00 ? 72 LEU A HD12 1 
ATOM 1077  H HD13 . LEU A 1 72 ? 4.544   -10.469 -2.137  1.00 0.00 ? 72 LEU A HD13 1 
ATOM 1078  H HD21 . LEU A 1 72 ? 2.260   -10.715 -4.894  1.00 0.00 ? 72 LEU A HD21 1 
ATOM 1079  H HD22 . LEU A 1 72 ? 0.918   -10.706 -3.751  1.00 0.00 ? 72 LEU A HD22 1 
ATOM 1080  H HD23 . LEU A 1 72 ? 2.162   -9.460  -3.658  1.00 0.00 ? 72 LEU A HD23 1 
ATOM 1081  N N    . TYR A 1 73 ? 4.894   -13.141 -0.990  1.00 0.00 ? 73 TYR A N    1 
ATOM 1082  C CA   . TYR A 1 73 ? 6.328   -13.134 -0.732  1.00 0.00 ? 73 TYR A CA   1 
ATOM 1083  C C    . TYR A 1 73 ? 6.789   -14.535 -0.373  1.00 0.00 ? 73 TYR A C    1 
ATOM 1084  O O    . TYR A 1 73 ? 7.839   -14.991 -0.813  1.00 0.00 ? 73 TYR A O    1 
ATOM 1085  C CB   . TYR A 1 73 ? 6.671   -12.146 0.388   1.00 0.00 ? 73 TYR A CB   1 
ATOM 1086  C CG   . TYR A 1 73 ? 8.155   -11.941 0.572   1.00 0.00 ? 73 TYR A CG   1 
ATOM 1087  C CD1  . TYR A 1 73 ? 8.940   -12.903 1.193   1.00 0.00 ? 73 TYR A CD1  1 
ATOM 1088  C CD2  . TYR A 1 73 ? 8.775   -10.793 0.096   1.00 0.00 ? 73 TYR A CD2  1 
ATOM 1089  C CE1  . TYR A 1 73 ? 10.305  -12.724 1.337   1.00 0.00 ? 73 TYR A CE1  1 
ATOM 1090  C CE2  . TYR A 1 73 ? 10.137  -10.606 0.238   1.00 0.00 ? 73 TYR A CE2  1 
ATOM 1091  C CZ   . TYR A 1 73 ? 10.897  -11.575 0.858   1.00 0.00 ? 73 TYR A CZ   1 
ATOM 1092  O OH   . TYR A 1 73 ? 12.254  -11.394 0.999   1.00 0.00 ? 73 TYR A OH   1 
ATOM 1093  H H    . TYR A 1 73 ? 4.307   -12.564 -0.464  1.00 0.00 ? 73 TYR A H    1 
ATOM 1094  H HA   . TYR A 1 73 ? 6.830   -12.823 -1.643  1.00 0.00 ? 73 TYR A HA   1 
ATOM 1095  H HB2  . TYR A 1 73 ? 6.232   -11.188 0.159   1.00 0.00 ? 73 TYR A HB2  1 
ATOM 1096  H HB3  . TYR A 1 73 ? 6.265   -12.511 1.320   1.00 0.00 ? 73 TYR A HB3  1 
ATOM 1097  H HD1  . TYR A 1 73 ? 8.470   -13.799 1.569   1.00 0.00 ? 73 TYR A HD1  1 
ATOM 1098  H HD2  . TYR A 1 73 ? 8.173   -10.036 -0.389  1.00 0.00 ? 73 TYR A HD2  1 
ATOM 1099  H HE1  . TYR A 1 73 ? 10.902  -13.483 1.823   1.00 0.00 ? 73 TYR A HE1  1 
ATOM 1100  H HE2  . TYR A 1 73 ? 10.603  -9.705  -0.136  1.00 0.00 ? 73 TYR A HE2  1 
ATOM 1101  H HH   . TYR A 1 73 ? 12.423  -10.780 1.718   1.00 0.00 ? 73 TYR A HH   1 
ATOM 1102  N N    . VAL A 1 74 ? 5.974   -15.223 0.414   1.00 0.00 ? 74 VAL A N    1 
ATOM 1103  C CA   . VAL A 1 74 ? 6.270   -16.590 0.822   1.00 0.00 ? 74 VAL A CA   1 
ATOM 1104  C C    . VAL A 1 74 ? 5.606   -17.591 -0.116  1.00 0.00 ? 74 VAL A C    1 
ATOM 1105  O O    . VAL A 1 74 ? 6.118   -18.686 -0.346  1.00 0.00 ? 74 VAL A O    1 
ATOM 1106  C CB   . VAL A 1 74 ? 5.800   -16.860 2.266   1.00 0.00 ? 74 VAL A CB   1 
ATOM 1107  C CG1  . VAL A 1 74 ? 6.189   -18.264 2.710   1.00 0.00 ? 74 VAL A CG1  1 
ATOM 1108  C CG2  . VAL A 1 74 ? 6.363   -15.815 3.218   1.00 0.00 ? 74 VAL A CG2  1 
ATOM 1109  H H    . VAL A 1 74 ? 5.140   -14.807 0.715   1.00 0.00 ? 74 VAL A H    1 
ATOM 1110  H HA   . VAL A 1 74 ? 7.342   -16.730 0.779   1.00 0.00 ? 74 VAL A HA   1 
ATOM 1111  H HB   . VAL A 1 74 ? 4.721   -16.790 2.289   1.00 0.00 ? 74 VAL A HB   1 
ATOM 1112  H HG11 . VAL A 1 74 ? 6.593   -18.809 1.870   1.00 0.00 ? 74 VAL A HG11 1 
ATOM 1113  H HG12 . VAL A 1 74 ? 6.934   -18.202 3.491   1.00 0.00 ? 74 VAL A HG12 1 
ATOM 1114  H HG13 . VAL A 1 74 ? 5.317   -18.778 3.085   1.00 0.00 ? 74 VAL A HG13 1 
ATOM 1115  H HG21 . VAL A 1 74 ? 6.695   -14.956 2.654   1.00 0.00 ? 74 VAL A HG21 1 
ATOM 1116  H HG22 . VAL A 1 74 ? 5.596   -15.512 3.915   1.00 0.00 ? 74 VAL A HG22 1 
ATOM 1117  H HG23 . VAL A 1 74 ? 7.197   -16.234 3.761   1.00 0.00 ? 74 VAL A HG23 1 
ATOM 1118  N N    . MET A 1 75 ? 4.451   -17.215 -0.648  1.00 0.00 ? 75 MET A N    1 
ATOM 1119  C CA   . MET A 1 75 ? 3.713   -18.094 -1.542  1.00 0.00 ? 75 MET A CA   1 
ATOM 1120  C C    . MET A 1 75 ? 4.343   -18.168 -2.928  1.00 0.00 ? 75 MET A C    1 
ATOM 1121  O O    . MET A 1 75 ? 4.985   -19.157 -3.278  1.00 0.00 ? 75 MET A O    1 
ATOM 1122  C CB   . MET A 1 75 ? 2.263   -17.633 -1.655  1.00 0.00 ? 75 MET A CB   1 
ATOM 1123  C CG   . MET A 1 75 ? 1.416   -17.982 -0.444  1.00 0.00 ? 75 MET A CG   1 
ATOM 1124  S SD   . MET A 1 75 ? 1.380   -19.752 -0.095  1.00 0.00 ? 75 MET A SD   1 
ATOM 1125  C CE   . MET A 1 75 ? 0.547   -20.372 -1.552  1.00 0.00 ? 75 MET A CE   1 
ATOM 1126  H H    . MET A 1 75 ? 4.082   -16.335 -0.427  1.00 0.00 ? 75 MET A H    1 
ATOM 1127  H HA   . MET A 1 75 ? 3.725   -19.078 -1.104  1.00 0.00 ? 75 MET A HA   1 
ATOM 1128  H HB2  . MET A 1 75 ? 2.250   -16.561 -1.774  1.00 0.00 ? 75 MET A HB2  1 
ATOM 1129  H HB3  . MET A 1 75 ? 1.817   -18.083 -2.526  1.00 0.00 ? 75 MET A HB3  1 
ATOM 1130  H HG2  . MET A 1 75 ? 1.810   -17.469 0.418   1.00 0.00 ? 75 MET A HG2  1 
ATOM 1131  H HG3  . MET A 1 75 ? 0.410   -17.649 -0.631  1.00 0.00 ? 75 MET A HG3  1 
ATOM 1132  H HE1  . MET A 1 75 ? 0.273   -19.545 -2.190  1.00 0.00 ? 75 MET A HE1  1 
ATOM 1133  H HE2  . MET A 1 75 ? 1.206   -21.038 -2.088  1.00 0.00 ? 75 MET A HE2  1 
ATOM 1134  H HE3  . MET A 1 75 ? -0.343  -20.909 -1.255  1.00 0.00 ? 75 MET A HE3  1 
ATOM 1135  N N    . PHE A 1 76 ? 4.145   -17.125 -3.721  1.00 0.00 ? 76 PHE A N    1 
ATOM 1136  C CA   . PHE A 1 76 ? 4.667   -17.093 -5.082  1.00 0.00 ? 76 PHE A CA   1 
ATOM 1137  C C    . PHE A 1 76 ? 6.195   -17.118 -5.140  1.00 0.00 ? 76 PHE A C    1 
ATOM 1138  O O    . PHE A 1 76 ? 6.767   -17.599 -6.117  1.00 0.00 ? 76 PHE A O    1 
ATOM 1139  C CB   . PHE A 1 76 ? 4.142   -15.861 -5.822  1.00 0.00 ? 76 PHE A CB   1 
ATOM 1140  C CG   . PHE A 1 76 ? 2.664   -15.914 -6.108  1.00 0.00 ? 76 PHE A CG   1 
ATOM 1141  C CD1  . PHE A 1 76 ? 2.098   -17.023 -6.715  1.00 0.00 ? 76 PHE A CD1  1 
ATOM 1142  C CD2  . PHE A 1 76 ? 1.839   -14.858 -5.761  1.00 0.00 ? 76 PHE A CD2  1 
ATOM 1143  C CE1  . PHE A 1 76 ? 0.740   -17.077 -6.962  1.00 0.00 ? 76 PHE A CE1  1 
ATOM 1144  C CE2  . PHE A 1 76 ? 0.483   -14.905 -6.008  1.00 0.00 ? 76 PHE A CE2  1 
ATOM 1145  C CZ   . PHE A 1 76 ? -0.068  -16.017 -6.607  1.00 0.00 ? 76 PHE A CZ   1 
ATOM 1146  H H    . PHE A 1 76 ? 3.611   -16.369 -3.393  1.00 0.00 ? 76 PHE A H    1 
ATOM 1147  H HA   . PHE A 1 76 ? 4.293   -17.976 -5.587  1.00 0.00 ? 76 PHE A HA   1 
ATOM 1148  H HB2  . PHE A 1 76 ? 4.332   -14.983 -5.221  1.00 0.00 ? 76 PHE A HB2  1 
ATOM 1149  H HB3  . PHE A 1 76 ? 4.666   -15.767 -6.758  1.00 0.00 ? 76 PHE A HB3  1 
ATOM 1150  H HD1  . PHE A 1 76 ? 2.729   -17.854 -6.992  1.00 0.00 ? 76 PHE A HD1  1 
ATOM 1151  H HD2  . PHE A 1 76 ? 2.268   -13.988 -5.297  1.00 0.00 ? 76 PHE A HD2  1 
ATOM 1152  H HE1  . PHE A 1 76 ? 0.311   -17.948 -7.437  1.00 0.00 ? 76 PHE A HE1  1 
ATOM 1153  H HE2  . PHE A 1 76 ? -0.147  -14.074 -5.727  1.00 0.00 ? 76 PHE A HE2  1 
ATOM 1154  H HZ   . PHE A 1 76 ? -1.131  -16.057 -6.798  1.00 0.00 ? 76 PHE A HZ   1 
ATOM 1155  N N    . ALA A 1 77 ? 6.861   -16.589 -4.117  1.00 0.00 ? 77 ALA A N    1 
ATOM 1156  C CA   . ALA A 1 77 ? 8.319   -16.555 -4.113  1.00 0.00 ? 77 ALA A CA   1 
ATOM 1157  C C    . ALA A 1 77 ? 8.926   -17.723 -3.347  1.00 0.00 ? 77 ALA A C    1 
ATOM 1158  O O    . ALA A 1 77 ? 9.797   -18.425 -3.860  1.00 0.00 ? 77 ALA A O    1 
ATOM 1159  C CB   . ALA A 1 77 ? 8.822   -15.233 -3.557  1.00 0.00 ? 77 ALA A CB   1 
ATOM 1160  H H    . ALA A 1 77 ? 6.371   -16.205 -3.367  1.00 0.00 ? 77 ALA A H    1 
ATOM 1161  H HA   . ALA A 1 77 ? 8.639   -16.622 -5.131  1.00 0.00 ? 77 ALA A HA   1 
ATOM 1162  H HB1  . ALA A 1 77 ? 8.171   -14.435 -3.881  1.00 0.00 ? 77 ALA A HB1  1 
ATOM 1163  H HB2  . ALA A 1 77 ? 8.833   -15.277 -2.483  1.00 0.00 ? 77 ALA A HB2  1 
ATOM 1164  H HB3  . ALA A 1 77 ? 9.823   -15.050 -3.919  1.00 0.00 ? 77 ALA A HB3  1 
ATOM 1165  N N    . VAL A 1 78 ? 8.477   -17.920 -2.120  1.00 0.00 ? 78 VAL A N    1 
ATOM 1166  C CA   . VAL A 1 78 ? 8.999   -18.999 -1.288  1.00 0.00 ? 78 VAL A CA   1 
ATOM 1167  C C    . VAL A 1 78 ? 8.236   -20.306 -1.503  1.00 0.00 ? 78 VAL A C    1 
ATOM 1168  O O    . VAL A 1 78 ? 8.624   -21.347 -0.973  1.00 0.00 ? 78 VAL A O    1 
ATOM 1169  C CB   . VAL A 1 78 ? 8.979   -18.630 0.212   1.00 0.00 ? 78 VAL A CB   1 
ATOM 1170  C CG1  . VAL A 1 78 ? 9.573   -19.751 1.053   1.00 0.00 ? 78 VAL A CG1  1 
ATOM 1171  C CG2  . VAL A 1 78 ? 9.725   -17.326 0.450   1.00 0.00 ? 78 VAL A CG2  1 
ATOM 1172  H H    . VAL A 1 78 ? 7.795   -17.324 -1.765  1.00 0.00 ? 78 VAL A H    1 
ATOM 1173  H HA   . VAL A 1 78 ? 10.025  -19.151 -1.575  1.00 0.00 ? 78 VAL A HA   1 
ATOM 1174  H HB   . VAL A 1 78 ? 7.956   -18.493 0.518   1.00 0.00 ? 78 VAL A HB   1 
ATOM 1175  H HG11 . VAL A 1 78 ? 10.382  -20.217 0.510   1.00 0.00 ? 78 VAL A HG11 1 
ATOM 1176  H HG12 . VAL A 1 78 ? 9.950   -19.344 1.980   1.00 0.00 ? 78 VAL A HG12 1 
ATOM 1177  H HG13 . VAL A 1 78 ? 8.810   -20.485 1.265   1.00 0.00 ? 78 VAL A HG13 1 
ATOM 1178  H HG21 . VAL A 1 78 ? 9.588   -16.672 -0.399  1.00 0.00 ? 78 VAL A HG21 1 
ATOM 1179  H HG22 . VAL A 1 78 ? 9.339   -16.847 1.338   1.00 0.00 ? 78 VAL A HG22 1 
ATOM 1180  H HG23 . VAL A 1 78 ? 10.777  -17.532 0.580   1.00 0.00 ? 78 VAL A HG23 1 
ATOM 1181  N N    . ALA A 1 79 ? 7.156   -20.258 -2.282  1.00 0.00 ? 79 ALA A N    1 
ATOM 1182  C CA   . ALA A 1 79 ? 6.368   -21.459 -2.558  1.00 0.00 ? 79 ALA A CA   1 
ATOM 1183  C C    . ALA A 1 79 ? 5.993   -21.544 -4.035  1.00 0.00 ? 79 ALA A C    1 
ATOM 1184  O O    . ALA A 1 79 ? 4.857   -21.873 -4.380  1.00 0.00 ? 79 ALA A O    1 
ATOM 1185  C CB   . ALA A 1 79 ? 5.120   -21.491 -1.688  1.00 0.00 ? 79 ALA A CB   1 
ATOM 1186  H H    . ALA A 1 79 ? 6.884   -19.404 -2.683  1.00 0.00 ? 79 ALA A H    1 
ATOM 1187  H HA   . ALA A 1 79 ? 6.972   -22.321 -2.307  1.00 0.00 ? 79 ALA A HA   1 
ATOM 1188  H HB1  . ALA A 1 79 ? 4.762   -20.486 -1.536  1.00 0.00 ? 79 ALA A HB1  1 
ATOM 1189  H HB2  . ALA A 1 79 ? 4.354   -22.075 -2.178  1.00 0.00 ? 79 ALA A HB2  1 
ATOM 1190  H HB3  . ALA A 1 79 ? 5.357   -21.936 -0.735  1.00 0.00 ? 79 ALA A HB3  1 
ATOM 1191  N N    . MET A 1 1  ? -4.926  -29.273 -0.049  1.00 0.00 ? 1  MET A N    2 
ATOM 1192  C CA   . MET A 1 1  ? -5.096  -27.843 0.320   1.00 0.00 ? 1  MET A CA   2 
ATOM 1193  C C    . MET A 1 1  ? -4.176  -26.936 -0.495  1.00 0.00 ? 1  MET A C    2 
ATOM 1194  O O    . MET A 1 1  ? -4.279  -25.712 -0.425  1.00 0.00 ? 1  MET A O    2 
ATOM 1195  C CB   . MET A 1 1  ? -4.804  -27.690 1.816   1.00 0.00 ? 1  MET A CB   2 
ATOM 1196  C CG   . MET A 1 1  ? -4.925  -26.262 2.321   1.00 0.00 ? 1  MET A CG   2 
ATOM 1197  S SD   . MET A 1 1  ? -6.574  -25.575 2.076   1.00 0.00 ? 1  MET A SD   2 
ATOM 1198  C CE   . MET A 1 1  ? -6.358  -23.937 2.766   1.00 0.00 ? 1  MET A CE   2 
ATOM 1199  H H1   . MET A 1 1  ? -3.935  -29.533 0.129   1.00 0.00 ? 1  MET A H1   2 
ATOM 1200  H H2   . MET A 1 1  ? -5.572  -29.833 0.544   1.00 0.00 ? 1  MET A H2   2 
ATOM 1201  H H3   . MET A 1 1  ? -5.166  -29.369 -1.058  1.00 0.00 ? 1  MET A H3   2 
ATOM 1202  H HA   . MET A 1 1  ? -6.115  -27.562 0.127   1.00 0.00 ? 1  MET A HA   2 
ATOM 1203  H HB2  . MET A 1 1  ? -5.499  -28.305 2.369   1.00 0.00 ? 1  MET A HB2  2 
ATOM 1204  H HB3  . MET A 1 1  ? -3.800  -28.035 2.012   1.00 0.00 ? 1  MET A HB3  2 
ATOM 1205  H HG2  . MET A 1 1  ? -4.700  -26.248 3.377   1.00 0.00 ? 1  MET A HG2  2 
ATOM 1206  H HG3  . MET A 1 1  ? -4.212  -25.647 1.795   1.00 0.00 ? 1  MET A HG3  2 
ATOM 1207  H HE1  . MET A 1 1  ? -5.451  -23.499 2.376   1.00 0.00 ? 1  MET A HE1  2 
ATOM 1208  H HE2  . MET A 1 1  ? -7.201  -23.319 2.494   1.00 0.00 ? 1  MET A HE2  2 
ATOM 1209  H HE3  . MET A 1 1  ? -6.293  -24.004 3.841   1.00 0.00 ? 1  MET A HE3  2 
ATOM 1210  N N    . GLU A 1 2  ? -3.284  -27.540 -1.269  1.00 0.00 ? 2  GLU A N    2 
ATOM 1211  C CA   . GLU A 1 2  ? -2.351  -26.785 -2.095  1.00 0.00 ? 2  GLU A CA   2 
ATOM 1212  C C    . GLU A 1 2  ? -3.092  -25.935 -3.119  1.00 0.00 ? 2  GLU A C    2 
ATOM 1213  O O    . GLU A 1 2  ? -2.879  -24.725 -3.210  1.00 0.00 ? 2  GLU A O    2 
ATOM 1214  C CB   . GLU A 1 2  ? -1.384  -27.735 -2.809  1.00 0.00 ? 2  GLU A CB   2 
ATOM 1215  C CG   . GLU A 1 2  ? -0.352  -27.023 -3.669  1.00 0.00 ? 2  GLU A CG   2 
ATOM 1216  C CD   . GLU A 1 2  ? 0.560   -27.991 -4.395  1.00 0.00 ? 2  GLU A CD   2 
ATOM 1217  O OE1  . GLU A 1 2  ? 0.049   -28.797 -5.202  1.00 0.00 ? 2  GLU A OE1  2 
ATOM 1218  O OE2  . GLU A 1 2  ? 1.786   -27.947 -4.157  1.00 0.00 ? 2  GLU A OE2  2 
ATOM 1219  H H    . GLU A 1 2  ? -3.254  -28.517 -1.287  1.00 0.00 ? 2  GLU A H    2 
ATOM 1220  H HA   . GLU A 1 2  ? -1.788  -26.134 -1.447  1.00 0.00 ? 2  GLU A HA   2 
ATOM 1221  H HB2  . GLU A 1 2  ? -0.861  -28.319 -2.069  1.00 0.00 ? 2  GLU A HB2  2 
ATOM 1222  H HB3  . GLU A 1 2  ? -1.953  -28.398 -3.444  1.00 0.00 ? 2  GLU A HB3  2 
ATOM 1223  H HG2  . GLU A 1 2  ? -0.866  -26.418 -4.401  1.00 0.00 ? 2  GLU A HG2  2 
ATOM 1224  H HG3  . GLU A 1 2  ? 0.250   -26.389 -3.036  1.00 0.00 ? 2  GLU A HG3  2 
ATOM 1225  N N    . ASN A 1 3  ? -3.957  -26.574 -3.897  1.00 0.00 ? 3  ASN A N    2 
ATOM 1226  C CA   . ASN A 1 3  ? -4.719  -25.869 -4.918  1.00 0.00 ? 3  ASN A CA   2 
ATOM 1227  C C    . ASN A 1 3  ? -5.685  -24.876 -4.285  1.00 0.00 ? 3  ASN A C    2 
ATOM 1228  O O    . ASN A 1 3  ? -5.952  -23.817 -4.850  1.00 0.00 ? 3  ASN A O    2 
ATOM 1229  C CB   . ASN A 1 3  ? -5.479  -26.861 -5.803  1.00 0.00 ? 3  ASN A CB   2 
ATOM 1230  C CG   . ASN A 1 3  ? -6.445  -27.723 -5.014  1.00 0.00 ? 3  ASN A CG   2 
ATOM 1231  O OD1  . ASN A 1 3  ? -7.376  -27.216 -4.386  1.00 0.00 ? 3  ASN A OD1  2 
ATOM 1232  N ND2  . ASN A 1 3  ? -6.231  -29.033 -5.043  1.00 0.00 ? 3  ASN A ND2  2 
ATOM 1233  H H    . ASN A 1 3  ? -4.081  -27.539 -3.784  1.00 0.00 ? 3  ASN A H    2 
ATOM 1234  H HA   . ASN A 1 3  ? -4.019  -25.323 -5.530  1.00 0.00 ? 3  ASN A HA   2 
ATOM 1235  H HB2  . ASN A 1 3  ? -6.039  -26.314 -6.545  1.00 0.00 ? 3  ASN A HB2  2 
ATOM 1236  H HB3  . ASN A 1 3  ? -4.769  -27.508 -6.298  1.00 0.00 ? 3  ASN A HB3  2 
ATOM 1237  H HD21 . ASN A 1 3  ? -5.471  -29.365 -5.565  1.00 0.00 ? 3  ASN A HD21 2 
ATOM 1238  H HD22 . ASN A 1 3  ? -6.839  -29.613 -4.541  1.00 0.00 ? 3  ASN A HD22 2 
ATOM 1239  N N    . LEU A 1 4  ? -6.196  -25.215 -3.107  1.00 0.00 ? 4  LEU A N    2 
ATOM 1240  C CA   . LEU A 1 4  ? -7.123  -24.336 -2.404  1.00 0.00 ? 4  LEU A CA   2 
ATOM 1241  C C    . LEU A 1 4  ? -6.377  -23.190 -1.739  1.00 0.00 ? 4  LEU A C    2 
ATOM 1242  O O    . LEU A 1 4  ? -6.903  -22.089 -1.613  1.00 0.00 ? 4  LEU A O    2 
ATOM 1243  C CB   . LEU A 1 4  ? -7.927  -25.114 -1.360  1.00 0.00 ? 4  LEU A CB   2 
ATOM 1244  C CG   . LEU A 1 4  ? -8.827  -26.217 -1.918  1.00 0.00 ? 4  LEU A CG   2 
ATOM 1245  C CD1  . LEU A 1 4  ? -9.617  -26.878 -0.800  1.00 0.00 ? 4  LEU A CD1  2 
ATOM 1246  C CD2  . LEU A 1 4  ? -9.765  -25.654 -2.976  1.00 0.00 ? 4  LEU A CD2  2 
ATOM 1247  H H    . LEU A 1 4  ? -5.939  -26.068 -2.699  1.00 0.00 ? 4  LEU A H    2 
ATOM 1248  H HA   . LEU A 1 4  ? -7.802  -23.920 -3.133  1.00 0.00 ? 4  LEU A HA   2 
ATOM 1249  H HB2  . LEU A 1 4  ? -7.232  -25.563 -0.664  1.00 0.00 ? 4  LEU A HB2  2 
ATOM 1250  H HB3  . LEU A 1 4  ? -8.548  -24.414 -0.821  1.00 0.00 ? 4  LEU A HB3  2 
ATOM 1251  H HG   . LEU A 1 4  ? -8.213  -26.974 -2.383  1.00 0.00 ? 4  LEU A HG   2 
ATOM 1252  H HD11 . LEU A 1 4  ? -9.038  -26.856 0.112   1.00 0.00 ? 4  LEU A HD11 2 
ATOM 1253  H HD12 . LEU A 1 4  ? -10.544 -26.344 -0.650  1.00 0.00 ? 4  LEU A HD12 2 
ATOM 1254  H HD13 . LEU A 1 4  ? -9.831  -27.902 -1.066  1.00 0.00 ? 4  LEU A HD13 2 
ATOM 1255  H HD21 . LEU A 1 4  ? -9.187  -25.191 -3.762  1.00 0.00 ? 4  LEU A HD21 2 
ATOM 1256  H HD22 . LEU A 1 4  ? -10.361 -26.454 -3.391  1.00 0.00 ? 4  LEU A HD22 2 
ATOM 1257  H HD23 . LEU A 1 4  ? -10.415 -24.918 -2.525  1.00 0.00 ? 4  LEU A HD23 2 
ATOM 1258  N N    . ASN A 1 5  ? -5.143  -23.445 -1.327  1.00 0.00 ? 5  ASN A N    2 
ATOM 1259  C CA   . ASN A 1 5  ? -4.342  -22.412 -0.688  1.00 0.00 ? 5  ASN A CA   2 
ATOM 1260  C C    . ASN A 1 5  ? -3.791  -21.450 -1.732  1.00 0.00 ? 5  ASN A C    2 
ATOM 1261  O O    . ASN A 1 5  ? -3.581  -20.270 -1.452  1.00 0.00 ? 5  ASN A O    2 
ATOM 1262  C CB   . ASN A 1 5  ? -3.199  -23.038 0.119   1.00 0.00 ? 5  ASN A CB   2 
ATOM 1263  C CG   . ASN A 1 5  ? -2.403  -22.029 0.940   1.00 0.00 ? 5  ASN A CG   2 
ATOM 1264  O OD1  . ASN A 1 5  ? -1.379  -22.376 1.527   1.00 0.00 ? 5  ASN A OD1  2 
ATOM 1265  N ND2  . ASN A 1 5  ? -2.867  -20.781 1.005   1.00 0.00 ? 5  ASN A ND2  2 
ATOM 1266  H H    . ASN A 1 5  ? -4.763  -24.338 -1.462  1.00 0.00 ? 5  ASN A H    2 
ATOM 1267  H HA   . ASN A 1 5  ? -4.991  -21.861 -0.023  1.00 0.00 ? 5  ASN A HA   2 
ATOM 1268  H HB2  . ASN A 1 5  ? -3.611  -23.771 0.798   1.00 0.00 ? 5  ASN A HB2  2 
ATOM 1269  H HB3  . ASN A 1 5  ? -2.520  -23.531 -0.563  1.00 0.00 ? 5  ASN A HB3  2 
ATOM 1270  H HD21 . ASN A 1 5  ? -3.693  -20.563 0.530   1.00 0.00 ? 5  ASN A HD21 2 
ATOM 1271  H HD22 . ASN A 1 5  ? -2.359  -20.129 1.531   1.00 0.00 ? 5  ASN A HD22 2 
ATOM 1272  N N    . MET A 1 6  ? -3.570  -21.955 -2.942  1.00 0.00 ? 6  MET A N    2 
ATOM 1273  C CA   . MET A 1 6  ? -3.061  -21.130 -4.026  1.00 0.00 ? 6  MET A CA   2 
ATOM 1274  C C    . MET A 1 6  ? -4.189  -20.312 -4.653  1.00 0.00 ? 6  MET A C    2 
ATOM 1275  O O    . MET A 1 6  ? -4.064  -19.095 -4.828  1.00 0.00 ? 6  MET A O    2 
ATOM 1276  C CB   . MET A 1 6  ? -2.377  -21.997 -5.083  1.00 0.00 ? 6  MET A CB   2 
ATOM 1277  C CG   . MET A 1 6  ? -1.102  -22.662 -4.592  1.00 0.00 ? 6  MET A CG   2 
ATOM 1278  S SD   . MET A 1 6  ? -0.301  -23.647 -5.872  1.00 0.00 ? 6  MET A SD   2 
ATOM 1279  C CE   . MET A 1 6  ? -1.609  -24.801 -6.278  1.00 0.00 ? 6  MET A CE   2 
ATOM 1280  H H    . MET A 1 6  ? -3.764  -22.903 -3.110  1.00 0.00 ? 6  MET A H    2 
ATOM 1281  H HA   . MET A 1 6  ? -2.334  -20.450 -3.606  1.00 0.00 ? 6  MET A HA   2 
ATOM 1282  H HB2  . MET A 1 6  ? -3.063  -22.770 -5.395  1.00 0.00 ? 6  MET A HB2  2 
ATOM 1283  H HB3  . MET A 1 6  ? -2.131  -21.382 -5.933  1.00 0.00 ? 6  MET A HB3  2 
ATOM 1284  H HG2  . MET A 1 6  ? -0.416  -21.895 -4.266  1.00 0.00 ? 6  MET A HG2  2 
ATOM 1285  H HG3  . MET A 1 6  ? -1.343  -23.305 -3.760  1.00 0.00 ? 6  MET A HG3  2 
ATOM 1286  H HE1  . MET A 1 6  ? -2.074  -25.152 -5.369  1.00 0.00 ? 6  MET A HE1  2 
ATOM 1287  H HE2  . MET A 1 6  ? -2.349  -24.305 -6.892  1.00 0.00 ? 6  MET A HE2  2 
ATOM 1288  H HE3  . MET A 1 6  ? -1.196  -25.639 -6.819  1.00 0.00 ? 6  MET A HE3  2 
ATOM 1289  N N    . ASP A 1 7  ? -5.297  -20.978 -4.981  1.00 0.00 ? 7  ASP A N    2 
ATOM 1290  C CA   . ASP A 1 7  ? -6.432  -20.293 -5.574  1.00 0.00 ? 7  ASP A CA   2 
ATOM 1291  C C    . ASP A 1 7  ? -7.071  -19.351 -4.557  1.00 0.00 ? 7  ASP A C    2 
ATOM 1292  O O    . ASP A 1 7  ? -7.453  -18.232 -4.901  1.00 0.00 ? 7  ASP A O    2 
ATOM 1293  C CB   . ASP A 1 7  ? -7.464  -21.290 -6.114  1.00 0.00 ? 7  ASP A CB   2 
ATOM 1294  C CG   . ASP A 1 7  ? -8.066  -22.168 -5.037  1.00 0.00 ? 7  ASP A CG   2 
ATOM 1295  O OD1  . ASP A 1 7  ? -7.642  -22.052 -3.873  1.00 0.00 ? 7  ASP A OD1  2 
ATOM 1296  O OD2  . ASP A 1 7  ? -8.958  -22.978 -5.361  1.00 0.00 ? 7  ASP A OD2  2 
ATOM 1297  H H    . ASP A 1 7  ? -5.351  -21.941 -4.816  1.00 0.00 ? 7  ASP A H    2 
ATOM 1298  H HA   . ASP A 1 7  ? -6.059  -19.701 -6.397  1.00 0.00 ? 7  ASP A HA   2 
ATOM 1299  H HB2  . ASP A 1 7  ? -8.262  -20.744 -6.587  1.00 0.00 ? 7  ASP A HB2  2 
ATOM 1300  H HB3  . ASP A 1 7  ? -6.990  -21.927 -6.848  1.00 0.00 ? 7  ASP A HB3  2 
ATOM 1301  N N    . LEU A 1 8  ? -7.172  -19.790 -3.298  1.00 0.00 ? 8  LEU A N    2 
ATOM 1302  C CA   . LEU A 1 8  ? -7.748  -18.940 -2.262  1.00 0.00 ? 8  LEU A CA   2 
ATOM 1303  C C    . LEU A 1 8  ? -6.866  -17.716 -2.066  1.00 0.00 ? 8  LEU A C    2 
ATOM 1304  O O    . LEU A 1 8  ? -7.350  -16.639 -1.719  1.00 0.00 ? 8  LEU A O    2 
ATOM 1305  C CB   . LEU A 1 8  ? -7.906  -19.704 -0.946  1.00 0.00 ? 8  LEU A CB   2 
ATOM 1306  C CG   . LEU A 1 8  ? -8.633  -18.955 0.180   1.00 0.00 ? 8  LEU A CG   2 
ATOM 1307  C CD1  . LEU A 1 8  ? -7.791  -17.801 0.704   1.00 0.00 ? 8  LEU A CD1  2 
ATOM 1308  C CD2  . LEU A 1 8  ? -9.986  -18.452 -0.303  1.00 0.00 ? 8  LEU A CD2  2 
ATOM 1309  H H    . LEU A 1 8  ? -6.842  -20.693 -3.062  1.00 0.00 ? 8  LEU A H    2 
ATOM 1310  H HA   . LEU A 1 8  ? -8.717  -18.619 -2.599  1.00 0.00 ? 8  LEU A HA   2 
ATOM 1311  H HB2  . LEU A 1 8  ? -8.451  -20.616 -1.148  1.00 0.00 ? 8  LEU A HB2  2 
ATOM 1312  H HB3  . LEU A 1 8  ? -6.924  -19.963 -0.596  1.00 0.00 ? 8  LEU A HB3  2 
ATOM 1313  H HG   . LEU A 1 8  ? -8.805  -19.638 0.999   1.00 0.00 ? 8  LEU A HG   2 
ATOM 1314  H HD11 . LEU A 1 8  ? -6.774  -17.909 0.358   1.00 0.00 ? 8  LEU A HD11 2 
ATOM 1315  H HD12 . LEU A 1 8  ? -8.196  -16.867 0.344   1.00 0.00 ? 8  LEU A HD12 2 
ATOM 1316  H HD13 . LEU A 1 8  ? -7.806  -17.807 1.785   1.00 0.00 ? 8  LEU A HD13 2 
ATOM 1317  H HD21 . LEU A 1 8  ? -10.234 -18.925 -1.242  1.00 0.00 ? 8  LEU A HD21 2 
ATOM 1318  H HD22 . LEU A 1 8  ? -10.740 -18.690 0.431   1.00 0.00 ? 8  LEU A HD22 2 
ATOM 1319  H HD23 . LEU A 1 8  ? -9.944  -17.381 -0.441  1.00 0.00 ? 8  LEU A HD23 2 
ATOM 1320  N N    . LEU A 1 9  ? -5.565  -17.887 -2.308  1.00 0.00 ? 9  LEU A N    2 
ATOM 1321  C CA   . LEU A 1 9  ? -4.616  -16.791 -2.175  1.00 0.00 ? 9  LEU A CA   2 
ATOM 1322  C C    . LEU A 1 9  ? -4.871  -15.754 -3.259  1.00 0.00 ? 9  LEU A C    2 
ATOM 1323  O O    . LEU A 1 9  ? -5.200  -14.607 -2.960  1.00 0.00 ? 9  LEU A O    2 
ATOM 1324  C CB   . LEU A 1 9  ? -3.174  -17.304 -2.266  1.00 0.00 ? 9  LEU A CB   2 
ATOM 1325  C CG   . LEU A 1 9  ? -2.079  -16.253 -2.031  1.00 0.00 ? 9  LEU A CG   2 
ATOM 1326  C CD1  . LEU A 1 9  ? -2.134  -15.151 -3.079  1.00 0.00 ? 9  LEU A CD1  2 
ATOM 1327  C CD2  . LEU A 1 9  ? -2.195  -15.665 -0.631  1.00 0.00 ? 9  LEU A CD2  2 
ATOM 1328  H H    . LEU A 1 9  ? -5.242  -18.767 -2.592  1.00 0.00 ? 9  LEU A H    2 
ATOM 1329  H HA   . LEU A 1 9  ? -4.768  -16.333 -1.209  1.00 0.00 ? 9  LEU A HA   2 
ATOM 1330  H HB2  . LEU A 1 9  ? -3.050  -18.087 -1.534  1.00 0.00 ? 9  LEU A HB2  2 
ATOM 1331  H HB3  . LEU A 1 9  ? -3.027  -17.730 -3.247  1.00 0.00 ? 9  LEU A HB3  2 
ATOM 1332  H HG   . LEU A 1 9  ? -1.114  -16.731 -2.112  1.00 0.00 ? 9  LEU A HG   2 
ATOM 1333  H HD11 . LEU A 1 9  ? -2.447  -15.569 -4.024  1.00 0.00 ? 9  LEU A HD11 2 
ATOM 1334  H HD12 . LEU A 1 9  ? -2.840  -14.395 -2.768  1.00 0.00 ? 9  LEU A HD12 2 
ATOM 1335  H HD13 . LEU A 1 9  ? -1.155  -14.709 -3.187  1.00 0.00 ? 9  LEU A HD13 2 
ATOM 1336  H HD21 . LEU A 1 9  ? -2.921  -16.227 -0.063  1.00 0.00 ? 9  LEU A HD21 2 
ATOM 1337  H HD22 . LEU A 1 9  ? -1.236  -15.716 -0.140  1.00 0.00 ? 9  LEU A HD22 2 
ATOM 1338  H HD23 . LEU A 1 9  ? -2.512  -14.634 -0.698  1.00 0.00 ? 9  LEU A HD23 2 
ATOM 1339  N N    . TYR A 1 10 ? -4.731  -16.160 -4.524  1.00 0.00 ? 10 TYR A N    2 
ATOM 1340  C CA   . TYR A 1 10 ? -4.955  -15.233 -5.633  1.00 0.00 ? 10 TYR A CA   2 
ATOM 1341  C C    . TYR A 1 10 ? -6.292  -14.534 -5.455  1.00 0.00 ? 10 TYR A C    2 
ATOM 1342  O O    . TYR A 1 10 ? -6.391  -13.310 -5.542  1.00 0.00 ? 10 TYR A O    2 
ATOM 1343  C CB   . TYR A 1 10 ? -4.960  -15.950 -6.987  1.00 0.00 ? 10 TYR A CB   2 
ATOM 1344  C CG   . TYR A 1 10 ? -3.864  -16.974 -7.180  1.00 0.00 ? 10 TYR A CG   2 
ATOM 1345  C CD1  . TYR A 1 10 ? -2.624  -16.831 -6.575  1.00 0.00 ? 10 TYR A CD1  2 
ATOM 1346  C CD2  . TYR A 1 10 ? -4.072  -18.075 -7.999  1.00 0.00 ? 10 TYR A CD2  2 
ATOM 1347  C CE1  . TYR A 1 10 ? -1.621  -17.762 -6.779  1.00 0.00 ? 10 TYR A CE1  2 
ATOM 1348  C CE2  . TYR A 1 10 ? -3.078  -19.009 -8.206  1.00 0.00 ? 10 TYR A CE2  2 
ATOM 1349  C CZ   . TYR A 1 10 ? -1.853  -18.848 -7.596  1.00 0.00 ? 10 TYR A CZ   2 
ATOM 1350  O OH   . TYR A 1 10 ? -0.858  -19.774 -7.802  1.00 0.00 ? 10 TYR A OH   2 
ATOM 1351  H H    . TYR A 1 10 ? -4.474  -17.091 -4.712  1.00 0.00 ? 10 TYR A H    2 
ATOM 1352  H HA   . TYR A 1 10 ? -4.161  -14.492 -5.620  1.00 0.00 ? 10 TYR A HA   2 
ATOM 1353  H HB2  . TYR A 1 10 ? -5.904  -16.460 -7.105  1.00 0.00 ? 10 TYR A HB2  2 
ATOM 1354  H HB3  . TYR A 1 10 ? -4.862  -15.213 -7.770  1.00 0.00 ? 10 TYR A HB3  2 
ATOM 1355  H HD1  . TYR A 1 10 ? -2.448  -15.982 -5.932  1.00 0.00 ? 10 TYR A HD1  2 
ATOM 1356  H HD2  . TYR A 1 10 ? -5.033  -18.197 -8.477  1.00 0.00 ? 10 TYR A HD2  2 
ATOM 1357  H HE1  . TYR A 1 10 ? -0.660  -17.636 -6.301  1.00 0.00 ? 10 TYR A HE1  2 
ATOM 1358  H HE2  . TYR A 1 10 ? -3.262  -19.857 -8.849  1.00 0.00 ? 10 TYR A HE2  2 
ATOM 1359  H HH   . TYR A 1 10 ? -0.463  -19.632 -8.665  1.00 0.00 ? 10 TYR A HH   2 
ATOM 1360  N N    . MET A 1 11 ? -7.319  -15.336 -5.202  1.00 0.00 ? 11 MET A N    2 
ATOM 1361  C CA   . MET A 1 11 ? -8.664  -14.827 -5.007  1.00 0.00 ? 11 MET A CA   2 
ATOM 1362  C C    . MET A 1 11 ? -8.715  -13.922 -3.786  1.00 0.00 ? 11 MET A C    2 
ATOM 1363  O O    . MET A 1 11 ? -9.317  -12.850 -3.819  1.00 0.00 ? 11 MET A O    2 
ATOM 1364  C CB   . MET A 1 11 ? -9.639  -15.992 -4.841  1.00 0.00 ? 11 MET A CB   2 
ATOM 1365  C CG   . MET A 1 11 ? -11.100 -15.578 -4.890  1.00 0.00 ? 11 MET A CG   2 
ATOM 1366  S SD   . MET A 1 11 ? -11.548 -14.801 -6.454  1.00 0.00 ? 11 MET A SD   2 
ATOM 1367  C CE   . MET A 1 11 ? -11.122 -16.102 -7.610  1.00 0.00 ? 11 MET A CE   2 
ATOM 1368  H H    . MET A 1 11 ? -7.164  -16.302 -5.145  1.00 0.00 ? 11 MET A H    2 
ATOM 1369  H HA   . MET A 1 11 ? -8.935  -14.255 -5.881  1.00 0.00 ? 11 MET A HA   2 
ATOM 1370  H HB2  . MET A 1 11 ? -9.458  -16.710 -5.629  1.00 0.00 ? 11 MET A HB2  2 
ATOM 1371  H HB3  . MET A 1 11 ? -9.453  -16.465 -3.888  1.00 0.00 ? 11 MET A HB3  2 
ATOM 1372  H HG2  . MET A 1 11 ? -11.713 -16.456 -4.752  1.00 0.00 ? 11 MET A HG2  2 
ATOM 1373  H HG3  . MET A 1 11 ? -11.289 -14.879 -4.088  1.00 0.00 ? 11 MET A HG3  2 
ATOM 1374  H HE1  . MET A 1 11 ? -10.822 -16.983 -7.065  1.00 0.00 ? 11 MET A HE1  2 
ATOM 1375  H HE2  . MET A 1 11 ? -11.981 -16.333 -8.224  1.00 0.00 ? 11 MET A HE2  2 
ATOM 1376  H HE3  . MET A 1 11 ? -10.308 -15.771 -8.239  1.00 0.00 ? 11 MET A HE3  2 
ATOM 1377  N N    . ALA A 1 12 ? -8.058  -14.352 -2.714  1.00 0.00 ? 12 ALA A N    2 
ATOM 1378  C CA   . ALA A 1 12 ? -8.011  -13.571 -1.485  1.00 0.00 ? 12 ALA A CA   2 
ATOM 1379  C C    . ALA A 1 12 ? -7.480  -12.181 -1.778  1.00 0.00 ? 12 ALA A C    2 
ATOM 1380  O O    . ALA A 1 12 ? -8.008  -11.191 -1.290  1.00 0.00 ? 12 ALA A O    2 
ATOM 1381  C CB   . ALA A 1 12 ? -7.142  -14.260 -0.443  1.00 0.00 ? 12 ALA A CB   2 
ATOM 1382  H H    . ALA A 1 12 ? -7.585  -15.208 -2.756  1.00 0.00 ? 12 ALA A H    2 
ATOM 1383  H HA   . ALA A 1 12 ? -9.018  -13.485 -1.095  1.00 0.00 ? 12 ALA A HA   2 
ATOM 1384  H HB1  . ALA A 1 12 ? -6.322  -14.764 -0.936  1.00 0.00 ? 12 ALA A HB1  2 
ATOM 1385  H HB2  . ALA A 1 12 ? -6.751  -13.525 0.243   1.00 0.00 ? 12 ALA A HB2  2 
ATOM 1386  H HB3  . ALA A 1 12 ? -7.734  -14.981 0.100   1.00 0.00 ? 12 ALA A HB3  2 
ATOM 1387  N N    . ALA A 1 13 ? -6.441  -12.114 -2.597  1.00 0.00 ? 13 ALA A N    2 
ATOM 1388  C CA   . ALA A 1 13 ? -5.855  -10.838 -2.972  1.00 0.00 ? 13 ALA A CA   2 
ATOM 1389  C C    . ALA A 1 13 ? -6.915  -9.943  -3.598  1.00 0.00 ? 13 ALA A C    2 
ATOM 1390  O O    . ALA A 1 13 ? -7.012  -8.761  -3.276  1.00 0.00 ? 13 ALA A O    2 
ATOM 1391  C CB   . ALA A 1 13 ? -4.703  -11.055 -3.939  1.00 0.00 ? 13 ALA A CB   2 
ATOM 1392  H H    . ALA A 1 13 ? -6.067  -12.939 -2.969  1.00 0.00 ? 13 ALA A H    2 
ATOM 1393  H HA   . ALA A 1 13 ? -5.472  -10.363 -2.075  1.00 0.00 ? 13 ALA A HA   2 
ATOM 1394  H HB1  . ALA A 1 13 ? -5.016  -11.737 -4.720  1.00 0.00 ? 13 ALA A HB1  2 
ATOM 1395  H HB2  . ALA A 1 13 ? -4.417  -10.112 -4.378  1.00 0.00 ? 13 ALA A HB2  2 
ATOM 1396  H HB3  . ALA A 1 13 ? -3.862  -11.477 -3.408  1.00 0.00 ? 13 ALA A HB3  2 
ATOM 1397  N N    . ALA A 1 14 ? -7.719  -10.521 -4.485  1.00 0.00 ? 14 ALA A N    2 
ATOM 1398  C CA   . ALA A 1 14 ? -8.785  -9.776  -5.142  1.00 0.00 ? 14 ALA A CA   2 
ATOM 1399  C C    . ALA A 1 14 ? -9.756  -9.227  -4.106  1.00 0.00 ? 14 ALA A C    2 
ATOM 1400  O O    . ALA A 1 14 ? -10.010 -8.024  -4.051  1.00 0.00 ? 14 ALA A O    2 
ATOM 1401  C CB   . ALA A 1 14 ? -9.513  -10.658 -6.145  1.00 0.00 ? 14 ALA A CB   2 
ATOM 1402  H H    . ALA A 1 14 ? -7.600  -11.471 -4.693  1.00 0.00 ? 14 ALA A H    2 
ATOM 1403  H HA   . ALA A 1 14 ? -8.337  -8.949  -5.678  1.00 0.00 ? 14 ALA A HA   2 
ATOM 1404  H HB1  . ALA A 1 14 ? -8.805  -11.312 -6.630  1.00 0.00 ? 14 ALA A HB1  2 
ATOM 1405  H HB2  . ALA A 1 14 ? -10.257 -11.251 -5.631  1.00 0.00 ? 14 ALA A HB2  2 
ATOM 1406  H HB3  . ALA A 1 14 ? -9.997  -10.038 -6.885  1.00 0.00 ? 14 ALA A HB3  2 
ATOM 1407  N N    . VAL A 1 15 ? -10.281 -10.119 -3.268  1.00 0.00 ? 15 VAL A N    2 
ATOM 1408  C CA   . VAL A 1 15 ? -11.209 -9.723  -2.216  1.00 0.00 ? 15 VAL A CA   2 
ATOM 1409  C C    . VAL A 1 15 ? -10.552 -8.699  -1.296  1.00 0.00 ? 15 VAL A C    2 
ATOM 1410  O O    . VAL A 1 15 ? -10.993 -7.559  -1.203  1.00 0.00 ? 15 VAL A O    2 
ATOM 1411  C CB   . VAL A 1 15 ? -11.665 -10.939 -1.382  1.00 0.00 ? 15 VAL A CB   2 
ATOM 1412  C CG1  . VAL A 1 15 ? -12.682 -10.519 -0.329  1.00 0.00 ? 15 VAL A CG1  2 
ATOM 1413  C CG2  . VAL A 1 15 ? -12.235 -12.020 -2.287  1.00 0.00 ? 15 VAL A CG2  2 
ATOM 1414  H H    . VAL A 1 15 ? -10.028 -11.062 -3.351  1.00 0.00 ? 15 VAL A H    2 
ATOM 1415  H HA   . VAL A 1 15 ? -12.080 -9.278  -2.681  1.00 0.00 ? 15 VAL A HA   2 
ATOM 1416  H HB   . VAL A 1 15 ? -10.802 -11.345 -0.873  1.00 0.00 ? 15 VAL A HB   2 
ATOM 1417  H HG11 . VAL A 1 15 ? -12.321 -9.646  0.194   1.00 0.00 ? 15 VAL A HG11 2 
ATOM 1418  H HG12 . VAL A 1 15 ? -13.622 -10.287 -0.810  1.00 0.00 ? 15 VAL A HG12 2 
ATOM 1419  H HG13 . VAL A 1 15 ? -12.827 -11.326 0.373   1.00 0.00 ? 15 VAL A HG13 2 
ATOM 1420  H HG21 . VAL A 1 15 ? -12.484 -11.593 -3.246  1.00 0.00 ? 15 VAL A HG21 2 
ATOM 1421  H HG22 . VAL A 1 15 ? -11.499 -12.800 -2.421  1.00 0.00 ? 15 VAL A HG22 2 
ATOM 1422  H HG23 . VAL A 1 15 ? -13.124 -12.437 -1.837  1.00 0.00 ? 15 VAL A HG23 2 
ATOM 1423  N N    . MET A 1 16 ? -9.484  -9.123  -0.626  1.00 0.00 ? 16 MET A N    2 
ATOM 1424  C CA   . MET A 1 16 ? -8.742  -8.261  0.282   1.00 0.00 ? 16 MET A CA   2 
ATOM 1425  C C    . MET A 1 16 ? -8.439  -6.906  -0.348  1.00 0.00 ? 16 MET A C    2 
ATOM 1426  O O    . MET A 1 16 ? -8.645  -5.861  0.268   1.00 0.00 ? 16 MET A O    2 
ATOM 1427  C CB   . MET A 1 16 ? -7.443  -8.956  0.691   1.00 0.00 ? 16 MET A CB   2 
ATOM 1428  C CG   . MET A 1 16 ? -7.385  -9.310  2.164   1.00 0.00 ? 16 MET A CG   2 
ATOM 1429  S SD   . MET A 1 16 ? -8.673  -10.472 2.656   1.00 0.00 ? 16 MET A SD   2 
ATOM 1430  C CE   . MET A 1 16 ? -8.204  -11.924 1.717   1.00 0.00 ? 16 MET A CE   2 
ATOM 1431  H H    . MET A 1 16 ? -9.183  -10.045 -0.745  1.00 0.00 ? 16 MET A H    2 
ATOM 1432  H HA   . MET A 1 16 ? -9.347  -8.103  1.156   1.00 0.00 ? 16 MET A HA   2 
ATOM 1433  H HB2  . MET A 1 16 ? -7.348  -9.867  0.124   1.00 0.00 ? 16 MET A HB2  2 
ATOM 1434  H HB3  . MET A 1 16 ? -6.605  -8.316  0.457   1.00 0.00 ? 16 MET A HB3  2 
ATOM 1435  H HG2  . MET A 1 16 ? -6.425  -9.751  2.374   1.00 0.00 ? 16 MET A HG2  2 
ATOM 1436  H HG3  . MET A 1 16 ? -7.501  -8.405  2.736   1.00 0.00 ? 16 MET A HG3  2 
ATOM 1437  H HE1  . MET A 1 16 ? -7.601  -11.627 0.871   1.00 0.00 ? 16 MET A HE1  2 
ATOM 1438  H HE2  . MET A 1 16 ? -7.636  -12.592 2.347   1.00 0.00 ? 16 MET A HE2  2 
ATOM 1439  H HE3  . MET A 1 16 ? -9.091  -12.428 1.365   1.00 0.00 ? 16 MET A HE3  2 
ATOM 1440  N N    . MET A 1 17 ? -7.952  -6.933  -1.574  1.00 0.00 ? 17 MET A N    2 
ATOM 1441  C CA   . MET A 1 17 ? -7.623  -5.706  -2.289  1.00 0.00 ? 17 MET A CA   2 
ATOM 1442  C C    . MET A 1 17 ? -8.864  -4.850  -2.500  1.00 0.00 ? 17 MET A C    2 
ATOM 1443  O O    . MET A 1 17 ? -8.831  -3.641  -2.291  1.00 0.00 ? 17 MET A O    2 
ATOM 1444  C CB   . MET A 1 17 ? -6.974  -6.021  -3.640  1.00 0.00 ? 17 MET A CB   2 
ATOM 1445  C CG   . MET A 1 17 ? -5.543  -6.531  -3.541  1.00 0.00 ? 17 MET A CG   2 
ATOM 1446  S SD   . MET A 1 17 ? -4.318  -5.204  -3.565  1.00 0.00 ? 17 MET A SD   2 
ATOM 1447  C CE   . MET A 1 17 ? -4.795  -4.251  -2.126  1.00 0.00 ? 17 MET A CE   2 
ATOM 1448  H H    . MET A 1 17 ? -7.813  -7.796  -2.009  1.00 0.00 ? 17 MET A H    2 
ATOM 1449  H HA   . MET A 1 17 ? -6.921  -5.154  -1.683  1.00 0.00 ? 17 MET A HA   2 
ATOM 1450  H HB2  . MET A 1 17 ? -7.565  -6.772  -4.144  1.00 0.00 ? 17 MET A HB2  2 
ATOM 1451  H HB3  . MET A 1 17 ? -6.970  -5.122  -4.240  1.00 0.00 ? 17 MET A HB3  2 
ATOM 1452  H HG2  . MET A 1 17 ? -5.436  -7.081  -2.619  1.00 0.00 ? 17 MET A HG2  2 
ATOM 1453  H HG3  . MET A 1 17 ? -5.353  -7.189  -4.375  1.00 0.00 ? 17 MET A HG3  2 
ATOM 1454  H HE1  . MET A 1 17 ? -4.981  -4.921  -1.299  1.00 0.00 ? 17 MET A HE1  2 
ATOM 1455  H HE2  . MET A 1 17 ? -4.000  -3.568  -1.866  1.00 0.00 ? 17 MET A HE2  2 
ATOM 1456  H HE3  . MET A 1 17 ? -5.693  -3.693  -2.345  1.00 0.00 ? 17 MET A HE3  2 
ATOM 1457  N N    . GLY A 1 18 ? -9.954  -5.484  -2.919  1.00 0.00 ? 18 GLY A N    2 
ATOM 1458  C CA   . GLY A 1 18 ? -11.189 -4.759  -3.164  1.00 0.00 ? 18 GLY A CA   2 
ATOM 1459  C C    . GLY A 1 18 ? -11.800 -4.186  -1.902  1.00 0.00 ? 18 GLY A C    2 
ATOM 1460  O O    . GLY A 1 18 ? -12.149 -3.009  -1.858  1.00 0.00 ? 18 GLY A O    2 
ATOM 1461  H H    . GLY A 1 18 ? -9.922  -6.452  -3.068  1.00 0.00 ? 18 GLY A H    2 
ATOM 1462  H HA2  . GLY A 1 18 ? -10.984 -3.946  -3.848  1.00 0.00 ? 18 GLY A HA2  2 
ATOM 1463  H HA3  . GLY A 1 18 ? -11.902 -5.428  -3.623  1.00 0.00 ? 18 GLY A HA3  2 
ATOM 1464  N N    . LEU A 1 19 ? -11.940 -5.018  -0.877  1.00 0.00 ? 19 LEU A N    2 
ATOM 1465  C CA   . LEU A 1 19 ? -12.526 -4.577  0.381   1.00 0.00 ? 19 LEU A CA   2 
ATOM 1466  C C    . LEU A 1 19 ? -11.691 -3.454  0.982   1.00 0.00 ? 19 LEU A C    2 
ATOM 1467  O O    . LEU A 1 19 ? -12.229 -2.459  1.474   1.00 0.00 ? 19 LEU A O    2 
ATOM 1468  C CB   . LEU A 1 19 ? -12.643 -5.758  1.351   1.00 0.00 ? 19 LEU A CB   2 
ATOM 1469  C CG   . LEU A 1 19 ? -11.333 -6.252  1.965   1.00 0.00 ? 19 LEU A CG   2 
ATOM 1470  C CD1  . LEU A 1 19 ? -11.000 -5.475  3.233   1.00 0.00 ? 19 LEU A CD1  2 
ATOM 1471  C CD2  . LEU A 1 19 ? -11.419 -7.742  2.261   1.00 0.00 ? 19 LEU A CD2  2 
ATOM 1472  H H    . LEU A 1 19 ? -11.652 -5.948  -0.970  1.00 0.00 ? 19 LEU A H    2 
ATOM 1473  H HA   . LEU A 1 19 ? -13.514 -4.197  0.168   1.00 0.00 ? 19 LEU A HA   2 
ATOM 1474  H HB2  . LEU A 1 19 ? -13.302 -5.473  2.154   1.00 0.00 ? 19 LEU A HB2  2 
ATOM 1475  H HB3  . LEU A 1 19 ? -13.091 -6.584  0.817   1.00 0.00 ? 19 LEU A HB3  2 
ATOM 1476  H HG   . LEU A 1 19 ? -10.533 -6.093  1.257   1.00 0.00 ? 19 LEU A HG   2 
ATOM 1477  H HD11 . LEU A 1 19 ? -11.858 -5.475  3.891   1.00 0.00 ? 19 LEU A HD11 2 
ATOM 1478  H HD12 . LEU A 1 19 ? -10.166 -5.945  3.732   1.00 0.00 ? 19 LEU A HD12 2 
ATOM 1479  H HD13 . LEU A 1 19 ? -10.741 -4.460  2.981   1.00 0.00 ? 19 LEU A HD13 2 
ATOM 1480  H HD21 . LEU A 1 19 ? -12.345 -7.955  2.774   1.00 0.00 ? 19 LEU A HD21 2 
ATOM 1481  H HD22 . LEU A 1 19 ? -11.383 -8.295  1.335   1.00 0.00 ? 19 LEU A HD22 2 
ATOM 1482  H HD23 . LEU A 1 19 ? -10.587 -8.032  2.886   1.00 0.00 ? 19 LEU A HD23 2 
ATOM 1483  N N    . ALA A 1 20 ? -10.370 -3.602  0.914   1.00 0.00 ? 20 ALA A N    2 
ATOM 1484  C CA   . ALA A 1 20 ? -9.471  -2.583  1.429   1.00 0.00 ? 20 ALA A CA   2 
ATOM 1485  C C    . ALA A 1 20 ? -9.527  -1.352  0.537   1.00 0.00 ? 20 ALA A C    2 
ATOM 1486  O O    . ALA A 1 20 ? -9.389  -0.224  1.006   1.00 0.00 ? 20 ALA A O    2 
ATOM 1487  C CB   . ALA A 1 20 ? -8.047  -3.113  1.528   1.00 0.00 ? 20 ALA A CB   2 
ATOM 1488  H H    . ALA A 1 20 ? -9.997  -4.404  0.491   1.00 0.00 ? 20 ALA A H    2 
ATOM 1489  H HA   . ALA A 1 20 ? -9.804  -2.314  2.423   1.00 0.00 ? 20 ALA A HA   2 
ATOM 1490  H HB1  . ALA A 1 20 ? -8.068  -4.190  1.611   1.00 0.00 ? 20 ALA A HB1  2 
ATOM 1491  H HB2  . ALA A 1 20 ? -7.493  -2.831  0.645   1.00 0.00 ? 20 ALA A HB2  2 
ATOM 1492  H HB3  . ALA A 1 20 ? -7.567  -2.696  2.402   1.00 0.00 ? 20 ALA A HB3  2 
ATOM 1493  N N    . ALA A 1 21 ? -9.756  -1.583  -0.755  1.00 0.00 ? 21 ALA A N    2 
ATOM 1494  C CA   . ALA A 1 21 ? -9.853  -0.490  -1.716  1.00 0.00 ? 21 ALA A CA   2 
ATOM 1495  C C    . ALA A 1 21 ? -11.089 0.344   -1.439  1.00 0.00 ? 21 ALA A C    2 
ATOM 1496  O O    . ALA A 1 21 ? -11.041 1.571   -1.442  1.00 0.00 ? 21 ALA A O    2 
ATOM 1497  C CB   . ALA A 1 21 ? -9.881  -1.014  -3.144  1.00 0.00 ? 21 ALA A CB   2 
ATOM 1498  H H    . ALA A 1 21 ? -9.874  -2.508  -1.063  1.00 0.00 ? 21 ALA A H    2 
ATOM 1499  H HA   . ALA A 1 21 ? -8.987  0.131   -1.600  1.00 0.00 ? 21 ALA A HA   2 
ATOM 1500  H HB1  . ALA A 1 21 ? -9.465  -2.007  -3.173  1.00 0.00 ? 21 ALA A HB1  2 
ATOM 1501  H HB2  . ALA A 1 21 ? -10.900 -1.040  -3.499  1.00 0.00 ? 21 ALA A HB2  2 
ATOM 1502  H HB3  . ALA A 1 21 ? -9.297  -0.363  -3.778  1.00 0.00 ? 21 ALA A HB3  2 
ATOM 1503  N N    . ILE A 1 22 ? -12.190 -0.341  -1.185  1.00 0.00 ? 22 ILE A N    2 
ATOM 1504  C CA   . ILE A 1 22 ? -13.450 0.323   -0.889  1.00 0.00 ? 22 ILE A CA   2 
ATOM 1505  C C    . ILE A 1 22 ? -13.337 1.126   0.399   1.00 0.00 ? 22 ILE A C    2 
ATOM 1506  O O    . ILE A 1 22 ? -13.549 2.336   0.403   1.00 0.00 ? 22 ILE A O    2 
ATOM 1507  C CB   . ILE A 1 22 ? -14.608 -0.687  -0.771  1.00 0.00 ? 22 ILE A CB   2 
ATOM 1508  C CG1  . ILE A 1 22 ? -14.796 -1.430  -2.093  1.00 0.00 ? 22 ILE A CG1  2 
ATOM 1509  C CG2  . ILE A 1 22 ? -15.897 0.016   -0.369  1.00 0.00 ? 22 ILE A CG2  2 
ATOM 1510  C CD1  . ILE A 1 22 ? -15.845 -2.518  -2.031  1.00 0.00 ? 22 ILE A CD1  2 
ATOM 1511  H H    . ILE A 1 22 ? -12.149 -1.317  -1.188  1.00 0.00 ? 22 ILE A H    2 
ATOM 1512  H HA   . ILE A 1 22 ? -13.671 0.996   -1.703  1.00 0.00 ? 22 ILE A HA   2 
ATOM 1513  H HB   . ILE A 1 22 ? -14.356 -1.394  0.000   1.00 0.00 ? 22 ILE A HB   2 
ATOM 1514  H HG12 . ILE A 1 22 ? -15.098 -0.724  -2.853  1.00 0.00 ? 22 ILE A HG12 2 
ATOM 1515  H HG13 . ILE A 1 22 ? -13.861 -1.883  -2.381  1.00 0.00 ? 22 ILE A HG13 2 
ATOM 1516  H HG21 . ILE A 1 22 ? -15.906 1.014   -0.782  1.00 0.00 ? 22 ILE A HG21 2 
ATOM 1517  H HG22 . ILE A 1 22 ? -16.742 -0.539  -0.749  1.00 0.00 ? 22 ILE A HG22 2 
ATOM 1518  H HG23 . ILE A 1 22 ? -15.957 0.072   0.707   1.00 0.00 ? 22 ILE A HG23 2 
ATOM 1519  H HD11 . ILE A 1 22 ? -16.011 -2.799  -1.002  1.00 0.00 ? 22 ILE A HD11 2 
ATOM 1520  H HD12 . ILE A 1 22 ? -16.767 -2.155  -2.460  1.00 0.00 ? 22 ILE A HD12 2 
ATOM 1521  H HD13 . ILE A 1 22 ? -15.504 -3.379  -2.588  1.00 0.00 ? 22 ILE A HD13 2 
ATOM 1522  N N    . GLY A 1 23 ? -12.985 0.453   1.492   1.00 0.00 ? 23 GLY A N    2 
ATOM 1523  C CA   . GLY A 1 23 ? -12.840 1.141   2.763   1.00 0.00 ? 23 GLY A CA   2 
ATOM 1524  C C    . GLY A 1 23 ? -11.815 2.254   2.685   1.00 0.00 ? 23 GLY A C    2 
ATOM 1525  O O    . GLY A 1 23 ? -12.090 3.400   3.058   1.00 0.00 ? 23 GLY A O    2 
ATOM 1526  H H    . GLY A 1 23 ? -12.815 -0.513  1.433   1.00 0.00 ? 23 GLY A H    2 
ATOM 1527  H HA2  . GLY A 1 23 ? -13.796 1.559   3.048   1.00 0.00 ? 23 GLY A HA2  2 
ATOM 1528  H HA3  . GLY A 1 23 ? -12.530 0.430   3.516   1.00 0.00 ? 23 GLY A HA3  2 
ATOM 1529  N N    . ALA A 1 24 ? -10.630 1.915   2.185   1.00 0.00 ? 24 ALA A N    2 
ATOM 1530  C CA   . ALA A 1 24 ? -9.557  2.885   2.042   1.00 0.00 ? 24 ALA A CA   2 
ATOM 1531  C C    . ALA A 1 24 ? -9.989  4.028   1.135   1.00 0.00 ? 24 ALA A C    2 
ATOM 1532  O O    . ALA A 1 24 ? -9.708  5.189   1.411   1.00 0.00 ? 24 ALA A O    2 
ATOM 1533  C CB   . ALA A 1 24 ? -8.303  2.219   1.494   1.00 0.00 ? 24 ALA A CB   2 
ATOM 1534  H H    . ALA A 1 24 ? -10.480 0.989   1.898   1.00 0.00 ? 24 ALA A H    2 
ATOM 1535  H HA   . ALA A 1 24 ? -9.330  3.281   3.022   1.00 0.00 ? 24 ALA A HA   2 
ATOM 1536  H HB1  . ALA A 1 24 ? -7.995  1.427   2.161   1.00 0.00 ? 24 ALA A HB1  2 
ATOM 1537  H HB2  . ALA A 1 24 ? -8.511  1.808   0.518   1.00 0.00 ? 24 ALA A HB2  2 
ATOM 1538  H HB3  . ALA A 1 24 ? -7.512  2.951   1.415   1.00 0.00 ? 24 ALA A HB3  2 
ATOM 1539  N N    . ALA A 1 25 ? -10.684 3.694   0.054   1.00 0.00 ? 25 ALA A N    2 
ATOM 1540  C CA   . ALA A 1 25 ? -11.157 4.707   -0.878  1.00 0.00 ? 25 ALA A CA   2 
ATOM 1541  C C    . ALA A 1 25 ? -12.124 5.662   -0.187  1.00 0.00 ? 25 ALA A C    2 
ATOM 1542  O O    . ALA A 1 25 ? -12.003 6.880   -0.306  1.00 0.00 ? 25 ALA A O    2 
ATOM 1543  C CB   . ALA A 1 25 ? -11.823 4.057   -2.081  1.00 0.00 ? 25 ALA A CB   2 
ATOM 1544  H H    . ALA A 1 25 ? -10.888 2.750   -0.114  1.00 0.00 ? 25 ALA A H    2 
ATOM 1545  H HA   . ALA A 1 25 ? -10.299 5.266   -1.226  1.00 0.00 ? 25 ALA A HA   2 
ATOM 1546  H HB1  . ALA A 1 25 ? -12.525 3.309   -1.743  1.00 0.00 ? 25 ALA A HB1  2 
ATOM 1547  H HB2  . ALA A 1 25 ? -12.346 4.810   -2.652  1.00 0.00 ? 25 ALA A HB2  2 
ATOM 1548  H HB3  . ALA A 1 25 ? -11.072 3.592   -2.701  1.00 0.00 ? 25 ALA A HB3  2 
ATOM 1549  N N    . ILE A 1 26 ? -13.074 5.103   0.551   1.00 0.00 ? 26 ILE A N    2 
ATOM 1550  C CA   . ILE A 1 26 ? -14.047 5.913   1.266   1.00 0.00 ? 26 ILE A CA   2 
ATOM 1551  C C    . ILE A 1 26 ? -13.361 6.899   2.211   1.00 0.00 ? 26 ILE A C    2 
ATOM 1552  O O    . ILE A 1 26 ? -13.529 8.109   2.080   1.00 0.00 ? 26 ILE A O    2 
ATOM 1553  C CB   . ILE A 1 26 ? -15.040 5.047   2.053   1.00 0.00 ? 26 ILE A CB   2 
ATOM 1554  C CG1  . ILE A 1 26 ? -15.869 4.214   1.081   1.00 0.00 ? 26 ILE A CG1  2 
ATOM 1555  C CG2  . ILE A 1 26 ? -15.946 5.910   2.923   1.00 0.00 ? 26 ILE A CG2  2 
ATOM 1556  C CD1  . ILE A 1 26 ? -16.608 5.040   0.049   1.00 0.00 ? 26 ILE A CD1  2 
ATOM 1557  H H    . ILE A 1 26 ? -13.118 4.126   0.622   1.00 0.00 ? 26 ILE A H    2 
ATOM 1558  H HA   . ILE A 1 26 ? -14.615 6.464   0.535   1.00 0.00 ? 26 ILE A HA   2 
ATOM 1559  H HB   . ILE A 1 26 ? -14.481 4.388   2.696   1.00 0.00 ? 26 ILE A HB   2 
ATOM 1560  H HG12 . ILE A 1 26 ? -15.224 3.532   0.556   1.00 0.00 ? 26 ILE A HG12 2 
ATOM 1561  H HG13 . ILE A 1 26 ? -16.596 3.660   1.637   1.00 0.00 ? 26 ILE A HG13 2 
ATOM 1562  H HG21 . ILE A 1 26 ? -15.909 6.933   2.576   1.00 0.00 ? 26 ILE A HG21 2 
ATOM 1563  H HG22 . ILE A 1 26 ? -16.961 5.546   2.860   1.00 0.00 ? 26 ILE A HG22 2 
ATOM 1564  H HG23 . ILE A 1 26 ? -15.611 5.865   3.948   1.00 0.00 ? 26 ILE A HG23 2 
ATOM 1565  H HD11 . ILE A 1 26 ? -17.177 5.812   0.545   1.00 0.00 ? 26 ILE A HD11 2 
ATOM 1566  H HD12 . ILE A 1 26 ? -15.896 5.494   -0.624  1.00 0.00 ? 26 ILE A HD12 2 
ATOM 1567  H HD13 . ILE A 1 26 ? -17.277 4.402   -0.510  1.00 0.00 ? 26 ILE A HD13 2 
ATOM 1568  N N    . GLY A 1 27 ? -12.589 6.380   3.168   1.00 0.00 ? 27 GLY A N    2 
ATOM 1569  C CA   . GLY A 1 27 ? -11.909 7.253   4.118   1.00 0.00 ? 27 GLY A CA   2 
ATOM 1570  C C    . GLY A 1 27 ? -10.827 8.101   3.480   1.00 0.00 ? 27 GLY A C    2 
ATOM 1571  O O    . GLY A 1 27 ? -10.749 9.302   3.736   1.00 0.00 ? 27 GLY A O    2 
ATOM 1572  H H    . GLY A 1 27 ? -12.486 5.403   3.233   1.00 0.00 ? 27 GLY A H    2 
ATOM 1573  H HA2  . GLY A 1 27 ? -12.642 7.910   4.566   1.00 0.00 ? 27 GLY A HA2  2 
ATOM 1574  H HA3  . GLY A 1 27 ? -11.469 6.659   4.896   1.00 0.00 ? 27 GLY A HA3  2 
ATOM 1575  N N    . ILE A 1 28 ? -9.986  7.492   2.644   1.00 0.00 ? 28 ILE A N    2 
ATOM 1576  C CA   . ILE A 1 28 ? -8.921  8.242   1.984   1.00 0.00 ? 28 ILE A CA   2 
ATOM 1577  C C    . ILE A 1 28 ? -9.533  9.459   1.326   1.00 0.00 ? 28 ILE A C    2 
ATOM 1578  O O    . ILE A 1 28 ? -9.070  10.581  1.489   1.00 0.00 ? 28 ILE A O    2 
ATOM 1579  C CB   . ILE A 1 28 ? -8.168  7.392   0.934   1.00 0.00 ? 28 ILE A CB   2 
ATOM 1580  C CG1  . ILE A 1 28 ? -6.814  8.024   0.613   1.00 0.00 ? 28 ILE A CG1  2 
ATOM 1581  C CG2  . ILE A 1 28 ? -8.979  7.208   -0.341  1.00 0.00 ? 28 ILE A CG2  2 
ATOM 1582  C CD1  . ILE A 1 28 ? -5.919  8.169   1.820   1.00 0.00 ? 28 ILE A CD1  2 
ATOM 1583  H H    . ILE A 1 28 ? -10.086 6.537   2.470   1.00 0.00 ? 28 ILE A H    2 
ATOM 1584  H HA   . ILE A 1 28 ? -8.221  8.567   2.740   1.00 0.00 ? 28 ILE A HA   2 
ATOM 1585  H HB   . ILE A 1 28 ? -8.011  6.423   1.355   1.00 0.00 ? 28 ILE A HB   2 
ATOM 1586  H HG12 . ILE A 1 28 ? -6.299  7.407   -0.109  1.00 0.00 ? 28 ILE A HG12 2 
ATOM 1587  H HG13 . ILE A 1 28 ? -6.973  9.007   0.194   1.00 0.00 ? 28 ILE A HG13 2 
ATOM 1588  H HG21 . ILE A 1 28 ? -9.927  6.762   -0.097  1.00 0.00 ? 28 ILE A HG21 2 
ATOM 1589  H HG22 . ILE A 1 28 ? -9.141  8.167   -0.808  1.00 0.00 ? 28 ILE A HG22 2 
ATOM 1590  H HG23 . ILE A 1 28 ? -8.442  6.563   -1.020  1.00 0.00 ? 28 ILE A HG23 2 
ATOM 1591  H HD11 . ILE A 1 28 ? -6.290  7.545   2.619   1.00 0.00 ? 28 ILE A HD11 2 
ATOM 1592  H HD12 . ILE A 1 28 ? -4.915  7.866   1.563   1.00 0.00 ? 28 ILE A HD12 2 
ATOM 1593  H HD13 . ILE A 1 28 ? -5.913  9.199   2.142   1.00 0.00 ? 28 ILE A HD13 2 
ATOM 1594  N N    . GLY A 1 29 ? -10.624 9.212   0.633   1.00 0.00 ? 29 GLY A N    2 
ATOM 1595  C CA   . GLY A 1 29 ? -11.354 10.287  -0.004  1.00 0.00 ? 29 GLY A CA   2 
ATOM 1596  C C    . GLY A 1 29 ? -11.874 11.268  1.028   1.00 0.00 ? 29 GLY A C    2 
ATOM 1597  O O    . GLY A 1 29 ? -11.846 12.479  0.820   1.00 0.00 ? 29 GLY A O    2 
ATOM 1598  H H    . GLY A 1 29 ? -10.953 8.289   0.588   1.00 0.00 ? 29 GLY A H    2 
ATOM 1599  H HA2  . GLY A 1 29 ? -10.696 10.805  -0.689  1.00 0.00 ? 29 GLY A HA2  2 
ATOM 1600  H HA3  . GLY A 1 29 ? -12.188 9.877   -0.553  1.00 0.00 ? 29 GLY A HA3  2 
ATOM 1601  N N    . ILE A 1 30 ? -12.338 10.733  2.159   1.00 0.00 ? 30 ILE A N    2 
ATOM 1602  C CA   . ILE A 1 30 ? -12.853 11.564  3.244   1.00 0.00 ? 30 ILE A CA   2 
ATOM 1603  C C    . ILE A 1 30 ? -11.792 12.557  3.729   1.00 0.00 ? 30 ILE A C    2 
ATOM 1604  O O    . ILE A 1 30 ? -11.917 13.762  3.514   1.00 0.00 ? 30 ILE A O    2 
ATOM 1605  C CB   . ILE A 1 30 ? -13.350 10.697  4.431   1.00 0.00 ? 30 ILE A CB   2 
ATOM 1606  C CG1  . ILE A 1 30 ? -14.602 9.923   4.021   1.00 0.00 ? 30 ILE A CG1  2 
ATOM 1607  C CG2  . ILE A 1 30 ? -13.640 11.561  5.654   1.00 0.00 ? 30 ILE A CG2  2 
ATOM 1608  C CD1  . ILE A 1 30 ? -15.770 10.810  3.651   1.00 0.00 ? 30 ILE A CD1  2 
ATOM 1609  H H    . ILE A 1 30 ? -12.324 9.756   2.269   1.00 0.00 ? 30 ILE A H    2 
ATOM 1610  H HA   . ILE A 1 30 ? -13.697 12.120  2.859   1.00 0.00 ? 30 ILE A HA   2 
ATOM 1611  H HB   . ILE A 1 30 ? -12.572 9.986   4.695   1.00 0.00 ? 30 ILE A HB   2 
ATOM 1612  H HG12 . ILE A 1 30 ? -14.371 9.316   3.165   1.00 0.00 ? 30 ILE A HG12 2 
ATOM 1613  H HG13 . ILE A 1 30 ? -14.910 9.288   4.837   1.00 0.00 ? 30 ILE A HG13 2 
ATOM 1614  H HG21 . ILE A 1 30 ? -13.634 12.603  5.369   1.00 0.00 ? 30 ILE A HG21 2 
ATOM 1615  H HG22 . ILE A 1 30 ? -14.609 11.304  6.056   1.00 0.00 ? 30 ILE A HG22 2 
ATOM 1616  H HG23 . ILE A 1 30 ? -12.883 11.388  6.404   1.00 0.00 ? 30 ILE A HG23 2 
ATOM 1617  H HD11 . ILE A 1 30 ? -15.903 11.566  4.412   1.00 0.00 ? 30 ILE A HD11 2 
ATOM 1618  H HD12 . ILE A 1 30 ? -15.575 11.285  2.702   1.00 0.00 ? 30 ILE A HD12 2 
ATOM 1619  H HD13 . ILE A 1 30 ? -16.666 10.212  3.577   1.00 0.00 ? 30 ILE A HD13 2 
ATOM 1620  N N    . LEU A 1 31 ? -10.751 12.043  4.383   1.00 0.00 ? 31 LEU A N    2 
ATOM 1621  C CA   . LEU A 1 31 ? -9.672  12.885  4.904   1.00 0.00 ? 31 LEU A CA   2 
ATOM 1622  C C    . LEU A 1 31 ? -8.742  13.336  3.782   1.00 0.00 ? 31 LEU A C    2 
ATOM 1623  O O    . LEU A 1 31 ? -8.354  14.502  3.715   1.00 0.00 ? 31 LEU A O    2 
ATOM 1624  C CB   . LEU A 1 31 ? -8.880  12.113  5.968   1.00 0.00 ? 31 LEU A CB   2 
ATOM 1625  C CG   . LEU A 1 31 ? -7.817  12.915  6.733   1.00 0.00 ? 31 LEU A CG   2 
ATOM 1626  C CD1  . LEU A 1 31 ? -6.708  13.385  5.804   1.00 0.00 ? 31 LEU A CD1  2 
ATOM 1627  C CD2  . LEU A 1 31 ? -8.453  14.098  7.445   1.00 0.00 ? 31 LEU A CD2  2 
ATOM 1628  H H    . LEU A 1 31 ? -10.708 11.075  4.524   1.00 0.00 ? 31 LEU A H    2 
ATOM 1629  H HA   . LEU A 1 31 ? -10.120 13.763  5.359   1.00 0.00 ? 31 LEU A HA   2 
ATOM 1630  H HB2  . LEU A 1 31 ? -9.582  11.717  6.686   1.00 0.00 ? 31 LEU A HB2  2 
ATOM 1631  H HB3  . LEU A 1 31 ? -8.387  11.282  5.480   1.00 0.00 ? 31 LEU A HB3  2 
ATOM 1632  H HG   . LEU A 1 31 ? -7.371  12.278  7.483   1.00 0.00 ? 31 LEU A HG   2 
ATOM 1633  H HD11 . LEU A 1 31 ? -6.606  12.690  4.984   1.00 0.00 ? 31 LEU A HD11 2 
ATOM 1634  H HD12 . LEU A 1 31 ? -6.953  14.364  5.417   1.00 0.00 ? 31 LEU A HD12 2 
ATOM 1635  H HD13 . LEU A 1 31 ? -5.778  13.437  6.350   1.00 0.00 ? 31 LEU A HD13 2 
ATOM 1636  H HD21 . LEU A 1 31 ? -9.473  13.856  7.706   1.00 0.00 ? 31 LEU A HD21 2 
ATOM 1637  H HD22 . LEU A 1 31 ? -7.895  14.322  8.342   1.00 0.00 ? 31 LEU A HD22 2 
ATOM 1638  H HD23 . LEU A 1 31 ? -8.443  14.959  6.791   1.00 0.00 ? 31 LEU A HD23 2 
ATOM 1639  N N    . GLY A 1 32 ? -8.382  12.407  2.906   1.00 0.00 ? 32 GLY A N    2 
ATOM 1640  C CA   . GLY A 1 32 ? -7.500  12.741  1.803   1.00 0.00 ? 32 GLY A CA   2 
ATOM 1641  C C    . GLY A 1 32 ? -8.118  13.781  0.896   1.00 0.00 ? 32 GLY A C    2 
ATOM 1642  O O    . GLY A 1 32 ? -7.431  14.679  0.409   1.00 0.00 ? 32 GLY A O    2 
ATOM 1643  H H    . GLY A 1 32 ? -8.716  11.491  3.007   1.00 0.00 ? 32 GLY A H    2 
ATOM 1644  H HA2  . GLY A 1 32 ? -6.571  13.127  2.200   1.00 0.00 ? 32 GLY A HA2  2 
ATOM 1645  H HA3  . GLY A 1 32 ? -7.295  11.851  1.229   1.00 0.00 ? 32 GLY A HA3  2 
ATOM 1646  N N    . GLY A 1 33 ? -9.425  13.668  0.681   1.00 0.00 ? 33 GLY A N    2 
ATOM 1647  C CA   . GLY A 1 33 ? -10.124 14.621  -0.159  1.00 0.00 ? 33 GLY A CA   2 
ATOM 1648  C C    . GLY A 1 33 ? -10.118 16.008  0.448   1.00 0.00 ? 33 GLY A C    2 
ATOM 1649  O O    . GLY A 1 33 ? -9.733  16.974  -0.205  1.00 0.00 ? 33 GLY A O    2 
ATOM 1650  H H    . GLY A 1 33 ? -9.922  12.939  1.108   1.00 0.00 ? 33 GLY A H    2 
ATOM 1651  H HA2  . GLY A 1 33 ? -9.640  14.658  -1.126  1.00 0.00 ? 33 GLY A HA2  2 
ATOM 1652  H HA3  . GLY A 1 33 ? -11.146 14.300  -0.290  1.00 0.00 ? 33 GLY A HA3  2 
ATOM 1653  N N    . LYS A 1 34 ? -10.536 16.103  1.708   1.00 0.00 ? 34 LYS A N    2 
ATOM 1654  C CA   . LYS A 1 34 ? -10.563 17.382  2.409   1.00 0.00 ? 34 LYS A CA   2 
ATOM 1655  C C    . LYS A 1 34 ? -9.166  17.997  2.436   1.00 0.00 ? 34 LYS A C    2 
ATOM 1656  O O    . LYS A 1 34 ? -8.969  19.165  2.075   1.00 0.00 ? 34 LYS A O    2 
ATOM 1657  C CB   . LYS A 1 34 ? -11.092 17.192  3.838   1.00 0.00 ? 34 LYS A CB   2 
ATOM 1658  C CG   . LYS A 1 34 ? -10.316 16.180  4.660   1.00 0.00 ? 34 LYS A CG   2 
ATOM 1659  C CD   . LYS A 1 34 ? -10.928 15.988  6.044   1.00 0.00 ? 34 LYS A CD   2 
ATOM 1660  C CE   . LYS A 1 34 ? -10.806 17.240  6.900   1.00 0.00 ? 34 LYS A CE   2 
ATOM 1661  N NZ   . LYS A 1 34 ? -11.760 18.307  6.486   1.00 0.00 ? 34 LYS A NZ   2 
ATOM 1662  H H    . LYS A 1 34 ? -10.824 15.293  2.179   1.00 0.00 ? 34 LYS A H    2 
ATOM 1663  H HA   . LYS A 1 34 ? -11.224 18.044  1.871   1.00 0.00 ? 34 LYS A HA   2 
ATOM 1664  H HB2  . LYS A 1 34 ? -11.048 18.134  4.351   1.00 0.00 ? 34 LYS A HB2  2 
ATOM 1665  H HB3  . LYS A 1 34 ? -12.119 16.867  3.788   1.00 0.00 ? 34 LYS A HB3  2 
ATOM 1666  H HG2  . LYS A 1 34 ? -10.321 15.234  4.142   1.00 0.00 ? 34 LYS A HG2  2 
ATOM 1667  H HG3  . LYS A 1 34 ? -9.301  16.527  4.774   1.00 0.00 ? 34 LYS A HG3  2 
ATOM 1668  H HD2  . LYS A 1 34 ? -11.974 15.745  5.932   1.00 0.00 ? 34 LYS A HD2  2 
ATOM 1669  H HD3  . LYS A 1 34 ? -10.423 15.175  6.541   1.00 0.00 ? 34 LYS A HD3  2 
ATOM 1670  H HE2  . LYS A 1 34 ? -11.002 16.976  7.928   1.00 0.00 ? 34 LYS A HE2  2 
ATOM 1671  H HE3  . LYS A 1 34 ? -9.798  17.619  6.814   1.00 0.00 ? 34 LYS A HE3  2 
ATOM 1672  H HZ1  . LYS A 1 34 ? -12.435 17.933  5.787   1.00 0.00 ? 34 LYS A HZ1  2 
ATOM 1673  H HZ2  . LYS A 1 34 ? -12.290 18.651  7.313   1.00 0.00 ? 34 LYS A HZ2  2 
ATOM 1674  H HZ3  . LYS A 1 34 ? -11.242 19.104  6.063   1.00 0.00 ? 34 LYS A HZ3  2 
ATOM 1675  N N    . PHE A 1 35 ? -8.197  17.191  2.850   1.00 0.00 ? 35 PHE A N    2 
ATOM 1676  C CA   . PHE A 1 35 ? -6.808  17.625  2.923   1.00 0.00 ? 35 PHE A CA   2 
ATOM 1677  C C    . PHE A 1 35 ? -6.317  18.012  1.537   1.00 0.00 ? 35 PHE A C    2 
ATOM 1678  O O    . PHE A 1 35 ? -5.623  19.013  1.362   1.00 0.00 ? 35 PHE A O    2 
ATOM 1679  C CB   . PHE A 1 35 ? -5.948  16.495  3.484   1.00 0.00 ? 35 PHE A CB   2 
ATOM 1680  C CG   . PHE A 1 35 ? -4.711  16.973  4.185   1.00 0.00 ? 35 PHE A CG   2 
ATOM 1681  C CD1  . PHE A 1 35 ? -4.807  17.761  5.321   1.00 0.00 ? 35 PHE A CD1  2 
ATOM 1682  C CD2  . PHE A 1 35 ? -3.456  16.649  3.705   1.00 0.00 ? 35 PHE A CD2  2 
ATOM 1683  C CE1  . PHE A 1 35 ? -3.673  18.217  5.962   1.00 0.00 ? 35 PHE A CE1  2 
ATOM 1684  C CE2  . PHE A 1 35 ? -2.318  17.099  4.344   1.00 0.00 ? 35 PHE A CE2  2 
ATOM 1685  C CZ   . PHE A 1 35 ? -2.426  17.885  5.473   1.00 0.00 ? 35 PHE A CZ   2 
ATOM 1686  H H    . PHE A 1 35 ? -8.420  16.272  3.106   1.00 0.00 ? 35 PHE A H    2 
ATOM 1687  H HA   . PHE A 1 35 ? -6.749  18.485  3.581   1.00 0.00 ? 35 PHE A HA   2 
ATOM 1688  H HB2  . PHE A 1 35 ? -6.534  15.923  4.183   1.00 0.00 ? 35 PHE A HB2  2 
ATOM 1689  H HB3  . PHE A 1 35 ? -5.643  15.851  2.672   1.00 0.00 ? 35 PHE A HB3  2 
ATOM 1690  H HD1  . PHE A 1 35 ? -5.783  18.021  5.704   1.00 0.00 ? 35 PHE A HD1  2 
ATOM 1691  H HD2  . PHE A 1 35 ? -3.369  16.033  2.821   1.00 0.00 ? 35 PHE A HD2  2 
ATOM 1692  H HE1  . PHE A 1 35 ? -3.761  18.831  6.846   1.00 0.00 ? 35 PHE A HE1  2 
ATOM 1693  H HE2  . PHE A 1 35 ? -1.344  16.836  3.963   1.00 0.00 ? 35 PHE A HE2  2 
ATOM 1694  H HZ   . PHE A 1 35 ? -1.537  18.239  5.973   1.00 0.00 ? 35 PHE A HZ   2 
ATOM 1695  N N    . LEU A 1 36 ? -6.700  17.205  0.556   1.00 0.00 ? 36 LEU A N    2 
ATOM 1696  C CA   . LEU A 1 36 ? -6.321  17.447  -0.831  1.00 0.00 ? 36 LEU A CA   2 
ATOM 1697  C C    . LEU A 1 36 ? -6.925  18.757  -1.327  1.00 0.00 ? 36 LEU A C    2 
ATOM 1698  O O    . LEU A 1 36 ? -6.266  19.533  -2.016  1.00 0.00 ? 36 LEU A O    2 
ATOM 1699  C CB   . LEU A 1 36 ? -6.786  16.290  -1.719  1.00 0.00 ? 36 LEU A CB   2 
ATOM 1700  C CG   . LEU A 1 36 ? -6.432  16.422  -3.203  1.00 0.00 ? 36 LEU A CG   2 
ATOM 1701  C CD1  . LEU A 1 36 ? -4.923  16.398  -3.394  1.00 0.00 ? 36 LEU A CD1  2 
ATOM 1702  C CD2  . LEU A 1 36 ? -7.094  15.315  -4.010  1.00 0.00 ? 36 LEU A CD2  2 
ATOM 1703  H H    . LEU A 1 36 ? -7.258  16.429  0.773   1.00 0.00 ? 36 LEU A H    2 
ATOM 1704  H HA   . LEU A 1 36 ? -5.244  17.517  -0.875  1.00 0.00 ? 36 LEU A HA   2 
ATOM 1705  H HB2  . LEU A 1 36 ? -6.343  15.379  -1.346  1.00 0.00 ? 36 LEU A HB2  2 
ATOM 1706  H HB3  . LEU A 1 36 ? -7.859  16.207  -1.636  1.00 0.00 ? 36 LEU A HB3  2 
ATOM 1707  H HG   . LEU A 1 36 ? -6.798  17.370  -3.569  1.00 0.00 ? 36 LEU A HG   2 
ATOM 1708  H HD11 . LEU A 1 36 ? -4.440  16.712  -2.480  1.00 0.00 ? 36 LEU A HD11 2 
ATOM 1709  H HD12 . LEU A 1 36 ? -4.606  15.397  -3.642  1.00 0.00 ? 36 LEU A HD12 2 
ATOM 1710  H HD13 . LEU A 1 36 ? -4.651  17.071  -4.193  1.00 0.00 ? 36 LEU A HD13 2 
ATOM 1711  H HD21 . LEU A 1 36 ? -7.351  14.495  -3.355  1.00 0.00 ? 36 LEU A HD21 2 
ATOM 1712  H HD22 . LEU A 1 36 ? -7.991  15.696  -4.476  1.00 0.00 ? 36 LEU A HD22 2 
ATOM 1713  H HD23 . LEU A 1 36 ? -6.414  14.966  -4.773  1.00 0.00 ? 36 LEU A HD23 2 
ATOM 1714  N N    . GLU A 1 37 ? -8.181  19.001  -0.960  1.00 0.00 ? 37 GLU A N    2 
ATOM 1715  C CA   . GLU A 1 37 ? -8.870  20.223  -1.361  1.00 0.00 ? 37 GLU A CA   2 
ATOM 1716  C C    . GLU A 1 37 ? -8.127  21.449  -0.850  1.00 0.00 ? 37 GLU A C    2 
ATOM 1717  O O    . GLU A 1 37 ? -7.789  22.341  -1.625  1.00 0.00 ? 37 GLU A O    2 
ATOM 1718  C CB   . GLU A 1 37 ? -10.313 20.230  -0.847  1.00 0.00 ? 37 GLU A CB   2 
ATOM 1719  C CG   . GLU A 1 37 ? -11.221 19.248  -1.572  1.00 0.00 ? 37 GLU A CG   2 
ATOM 1720  C CD   . GLU A 1 37 ? -12.626 19.220  -0.998  1.00 0.00 ? 37 GLU A CD   2 
ATOM 1721  O OE1  . GLU A 1 37 ? -13.290 20.278  -1.000  1.00 0.00 ? 37 GLU A OE1  2 
ATOM 1722  O OE2  . GLU A 1 37 ? -13.062 18.138  -0.551  1.00 0.00 ? 37 GLU A OE2  2 
ATOM 1723  H H    . GLU A 1 37 ? -8.651  18.350  -0.401  1.00 0.00 ? 37 GLU A H    2 
ATOM 1724  H HA   . GLU A 1 37 ? -8.883  20.252  -2.441  1.00 0.00 ? 37 GLU A HA   2 
ATOM 1725  H HB2  . GLU A 1 37 ? -10.311 19.979  0.203   1.00 0.00 ? 37 GLU A HB2  2 
ATOM 1726  H HB3  . GLU A 1 37 ? -10.720 21.222  -0.970  1.00 0.00 ? 37 GLU A HB3  2 
ATOM 1727  H HG2  . GLU A 1 37 ? -11.282 19.534  -2.610  1.00 0.00 ? 37 GLU A HG2  2 
ATOM 1728  H HG3  . GLU A 1 37 ? -10.797 18.260  -1.496  1.00 0.00 ? 37 GLU A HG3  2 
ATOM 1729  N N    . GLY A 1 38 ? -7.862  21.486  0.453   1.00 0.00 ? 38 GLY A N    2 
ATOM 1730  C CA   . GLY A 1 38 ? -7.145  22.618  1.019   1.00 0.00 ? 38 GLY A CA   2 
ATOM 1731  C C    . GLY A 1 38 ? -5.758  22.769  0.419   1.00 0.00 ? 38 GLY A C    2 
ATOM 1732  O O    . GLY A 1 38 ? -5.436  23.789  -0.206  1.00 0.00 ? 38 GLY A O    2 
ATOM 1733  H H    . GLY A 1 38 ? -8.148  20.741  1.030   1.00 0.00 ? 38 GLY A H    2 
ATOM 1734  H HA2  . GLY A 1 38 ? -7.711  23.520  0.832   1.00 0.00 ? 38 GLY A HA2  2 
ATOM 1735  H HA3  . GLY A 1 38 ? -7.052  22.478  2.087   1.00 0.00 ? 38 GLY A HA3  2 
ATOM 1736  N N    . ALA A 1 39 ? -4.929  21.747  0.605   1.00 0.00 ? 39 ALA A N    2 
ATOM 1737  C CA   . ALA A 1 39 ? -3.574  21.761  0.075   1.00 0.00 ? 39 ALA A CA   2 
ATOM 1738  C C    . ALA A 1 39 ? -3.580  22.142  -1.399  1.00 0.00 ? 39 ALA A C    2 
ATOM 1739  O O    . ALA A 1 39 ? -2.799  22.983  -1.839  1.00 0.00 ? 39 ALA A O    2 
ATOM 1740  C CB   . ALA A 1 39 ? -2.916  20.404  0.275   1.00 0.00 ? 39 ALA A CB   2 
ATOM 1741  H H    . ALA A 1 39 ? -5.240  20.963  1.105   1.00 0.00 ? 39 ALA A H    2 
ATOM 1742  H HA   . ALA A 1 39 ? -3.007  22.497  0.625   1.00 0.00 ? 39 ALA A HA   2 
ATOM 1743  H HB1  . ALA A 1 39 ? -3.670  19.674  0.532   1.00 0.00 ? 39 ALA A HB1  2 
ATOM 1744  H HB2  . ALA A 1 39 ? -2.421  20.103  -0.636  1.00 0.00 ? 39 ALA A HB2  2 
ATOM 1745  H HB3  . ALA A 1 39 ? -2.192  20.469  1.074   1.00 0.00 ? 39 ALA A HB3  2 
ATOM 1746  N N    . ALA A 1 40 ? -4.478  21.531  -2.160  1.00 0.00 ? 40 ALA A N    2 
ATOM 1747  C CA   . ALA A 1 40 ? -4.581  21.825  -3.577  1.00 0.00 ? 40 ALA A CA   2 
ATOM 1748  C C    . ALA A 1 40 ? -5.195  23.200  -3.796  1.00 0.00 ? 40 ALA A C    2 
ATOM 1749  O O    . ALA A 1 40 ? -4.931  23.852  -4.807  1.00 0.00 ? 40 ALA A O    2 
ATOM 1750  C CB   . ALA A 1 40 ? -5.382  20.748  -4.285  1.00 0.00 ? 40 ALA A CB   2 
ATOM 1751  H H    . ALA A 1 40 ? -5.087  20.876  -1.757  1.00 0.00 ? 40 ALA A H    2 
ATOM 1752  H HA   . ALA A 1 40 ? -3.583  21.824  -3.986  1.00 0.00 ? 40 ALA A HA   2 
ATOM 1753  H HB1  . ALA A 1 40 ? -4.899  19.794  -4.134  1.00 0.00 ? 40 ALA A HB1  2 
ATOM 1754  H HB2  . ALA A 1 40 ? -6.380  20.717  -3.879  1.00 0.00 ? 40 ALA A HB2  2 
ATOM 1755  H HB3  . ALA A 1 40 ? -5.425  20.969  -5.340  1.00 0.00 ? 40 ALA A HB3  2 
ATOM 1756  N N    . ARG A 1 41 ? -5.989  23.654  -2.829  1.00 0.00 ? 41 ARG A N    2 
ATOM 1757  C CA   . ARG A 1 41 ? -6.595  24.973  -2.917  1.00 0.00 ? 41 ARG A CA   2 
ATOM 1758  C C    . ARG A 1 41 ? -5.507  26.028  -2.808  1.00 0.00 ? 41 ARG A C    2 
ATOM 1759  O O    . ARG A 1 41 ? -5.653  27.147  -3.297  1.00 0.00 ? 41 ARG A O    2 
ATOM 1760  C CB   . ARG A 1 41 ? -7.636  25.179  -1.816  1.00 0.00 ? 41 ARG A CB   2 
ATOM 1761  C CG   . ARG A 1 41 ? -8.260  26.564  -1.828  1.00 0.00 ? 41 ARG A CG   2 
ATOM 1762  C CD   . ARG A 1 41 ? -9.184  26.768  -0.641  1.00 0.00 ? 41 ARG A CD   2 
ATOM 1763  N NE   . ARG A 1 41 ? -8.489  26.581  0.630   1.00 0.00 ? 41 ARG A NE   2 
ATOM 1764  C CZ   . ARG A 1 41 ? -9.081  26.675  1.819   1.00 0.00 ? 41 ARG A CZ   2 
ATOM 1765  N NH1  . ARG A 1 41 ? -10.378 26.947  1.905   1.00 0.00 ? 41 ARG A NH1  2 
ATOM 1766  N NH2  . ARG A 1 41 ? -8.375  26.496  2.927   1.00 0.00 ? 41 ARG A NH2  2 
ATOM 1767  H H    . ARG A 1 41 ? -6.147  23.105  -2.034  1.00 0.00 ? 41 ARG A H    2 
ATOM 1768  H HA   . ARG A 1 41 ? -7.068  25.059  -3.879  1.00 0.00 ? 41 ARG A HA   2 
ATOM 1769  H HB2  . ARG A 1 41 ? -8.423  24.451  -1.939  1.00 0.00 ? 41 ARG A HB2  2 
ATOM 1770  H HB3  . ARG A 1 41 ? -7.165  25.031  -0.855  1.00 0.00 ? 41 ARG A HB3  2 
ATOM 1771  H HG2  . ARG A 1 41 ? -7.474  27.303  -1.791  1.00 0.00 ? 41 ARG A HG2  2 
ATOM 1772  H HG3  . ARG A 1 41 ? -8.827  26.683  -2.740  1.00 0.00 ? 41 ARG A HG3  2 
ATOM 1773  H HD2  . ARG A 1 41 ? -9.578  27.773  -0.680  1.00 0.00 ? 41 ARG A HD2  2 
ATOM 1774  H HD3  . ARG A 1 41 ? -9.995  26.061  -0.707  1.00 0.00 ? 41 ARG A HD3  2 
ATOM 1775  H HE   . ARG A 1 41 ? -7.532  26.377  0.597   1.00 0.00 ? 41 ARG A HE   2 
ATOM 1776  H HH11 . ARG A 1 41 ? -10.917 27.083  1.074   1.00 0.00 ? 41 ARG A HH11 2 
ATOM 1777  H HH12 . ARG A 1 41 ? -10.815 27.015  2.801   1.00 0.00 ? 41 ARG A HH12 2 
ATOM 1778  H HH21 . ARG A 1 41 ? -7.399  26.289  2.869   1.00 0.00 ? 41 ARG A HH21 2 
ATOM 1779  H HH22 . ARG A 1 41 ? -8.820  26.567  3.820   1.00 0.00 ? 41 ARG A HH22 2 
ATOM 1780  N N    . GLN A 1 42 ? -4.411  25.644  -2.161  1.00 0.00 ? 42 GLN A N    2 
ATOM 1781  C CA   . GLN A 1 42 ? -3.268  26.514  -1.982  1.00 0.00 ? 42 GLN A CA   2 
ATOM 1782  C C    . GLN A 1 42 ? -2.213  26.227  -3.059  1.00 0.00 ? 42 GLN A C    2 
ATOM 1783  O O    . GLN A 1 42 ? -1.405  25.309  -2.914  1.00 0.00 ? 42 GLN A O    2 
ATOM 1784  C CB   . GLN A 1 42 ? -2.669  26.295  -0.596  1.00 0.00 ? 42 GLN A CB   2 
ATOM 1785  C CG   . GLN A 1 42 ? -3.584  26.721  0.539   1.00 0.00 ? 42 GLN A CG   2 
ATOM 1786  C CD   . GLN A 1 42 ? -2.953  26.526  1.903   1.00 0.00 ? 42 GLN A CD   2 
ATOM 1787  O OE1  . GLN A 1 42 ? -1.930  27.134  2.220   1.00 0.00 ? 42 GLN A OE1  2 
ATOM 1788  N NE2  . GLN A 1 42 ? -3.561  25.672  2.719   1.00 0.00 ? 42 GLN A NE2  2 
ATOM 1789  H H    . GLN A 1 42 ? -4.372  24.739  -1.793  1.00 0.00 ? 42 GLN A H    2 
ATOM 1790  H HA   . GLN A 1 42 ? -3.604  27.537  -2.070  1.00 0.00 ? 42 GLN A HA   2 
ATOM 1791  H HB2  . GLN A 1 42 ? -2.449  25.244  -0.476  1.00 0.00 ? 42 GLN A HB2  2 
ATOM 1792  H HB3  . GLN A 1 42 ? -1.756  26.851  -0.525  1.00 0.00 ? 42 GLN A HB3  2 
ATOM 1793  H HG2  . GLN A 1 42 ? -3.823  27.767  0.418   1.00 0.00 ? 42 GLN A HG2  2 
ATOM 1794  H HG3  . GLN A 1 42 ? -4.491  26.137  0.491   1.00 0.00 ? 42 GLN A HG3  2 
ATOM 1795  H HE21 . GLN A 1 42 ? -4.371  25.223  2.399   1.00 0.00 ? 42 GLN A HE21 2 
ATOM 1796  H HE22 . GLN A 1 42 ? -3.175  25.527  3.608   1.00 0.00 ? 42 GLN A HE22 2 
ATOM 1797  N N    . PRO A 1 43 ? -2.222  27.001  -4.160  1.00 0.00 ? 43 PRO A N    2 
ATOM 1798  C CA   . PRO A 1 43 ? -1.282  26.832  -5.277  1.00 0.00 ? 43 PRO A CA   2 
ATOM 1799  C C    . PRO A 1 43 ? 0.144   26.471  -4.853  1.00 0.00 ? 43 PRO A C    2 
ATOM 1800  O O    . PRO A 1 43 ? 0.894   25.881  -5.629  1.00 0.00 ? 43 PRO A O    2 
ATOM 1801  C CB   . PRO A 1 43 ? -1.295  28.210  -5.932  1.00 0.00 ? 43 PRO A CB   2 
ATOM 1802  C CG   . PRO A 1 43 ? -2.664  28.746  -5.684  1.00 0.00 ? 43 PRO A CG   2 
ATOM 1803  C CD   . PRO A 1 43 ? -3.170  28.102  -4.416  1.00 0.00 ? 43 PRO A CD   2 
ATOM 1804  H HA   . PRO A 1 43 ? -1.639  26.099  -5.982  1.00 0.00 ? 43 PRO A HA   2 
ATOM 1805  H HB2  . PRO A 1 43 ? -0.539  28.832  -5.477  1.00 0.00 ? 43 PRO A HB2  2 
ATOM 1806  H HB3  . PRO A 1 43 ? -1.096  28.111  -6.988  1.00 0.00 ? 43 PRO A HB3  2 
ATOM 1807  H HG2  . PRO A 1 43 ? -2.618  29.818  -5.563  1.00 0.00 ? 43 PRO A HG2  2 
ATOM 1808  H HG3  . PRO A 1 43 ? -3.309  28.493  -6.513  1.00 0.00 ? 43 PRO A HG3  2 
ATOM 1809  H HD2  . PRO A 1 43 ? -3.161  28.811  -3.601  1.00 0.00 ? 43 PRO A HD2  2 
ATOM 1810  H HD3  . PRO A 1 43 ? -4.166  27.719  -4.570  1.00 0.00 ? 43 PRO A HD3  2 
ATOM 1811  N N    . ASP A 1 44 ? 0.530   26.847  -3.639  1.00 0.00 ? 44 ASP A N    2 
ATOM 1812  C CA   . ASP A 1 44 ? 1.881   26.574  -3.151  1.00 0.00 ? 44 ASP A CA   2 
ATOM 1813  C C    . ASP A 1 44 ? 2.047   25.136  -2.656  1.00 0.00 ? 44 ASP A C    2 
ATOM 1814  O O    . ASP A 1 44 ? 3.133   24.754  -2.221  1.00 0.00 ? 44 ASP A O    2 
ATOM 1815  C CB   . ASP A 1 44 ? 2.240   27.550  -2.028  1.00 0.00 ? 44 ASP A CB   2 
ATOM 1816  C CG   . ASP A 1 44 ? 2.231   28.994  -2.490  1.00 0.00 ? 44 ASP A CG   2 
ATOM 1817  O OD1  . ASP A 1 44 ? 3.006   29.329  -3.409  1.00 0.00 ? 44 ASP A OD1  2 
ATOM 1818  O OD2  . ASP A 1 44 ? 1.447   29.792  -1.930  1.00 0.00 ? 44 ASP A OD2  2 
ATOM 1819  H H    . ASP A 1 44 ? -0.096  27.334  -3.065  1.00 0.00 ? 44 ASP A H    2 
ATOM 1820  H HA   . ASP A 1 44 ? 2.562   26.732  -3.975  1.00 0.00 ? 44 ASP A HA   2 
ATOM 1821  H HB2  . ASP A 1 44 ? 1.526   27.443  -1.224  1.00 0.00 ? 44 ASP A HB2  2 
ATOM 1822  H HB3  . ASP A 1 44 ? 3.229   27.315  -1.658  1.00 0.00 ? 44 ASP A HB3  2 
ATOM 1823  N N    . LEU A 1 45 ? 0.977   24.343  -2.698  1.00 0.00 ? 45 LEU A N    2 
ATOM 1824  C CA   . LEU A 1 45 ? 1.045   22.963  -2.225  1.00 0.00 ? 45 LEU A CA   2 
ATOM 1825  C C    . LEU A 1 45 ? 0.685   21.941  -3.308  1.00 0.00 ? 45 LEU A C    2 
ATOM 1826  O O    . LEU A 1 45 ? 0.440   20.774  -3.000  1.00 0.00 ? 45 LEU A O    2 
ATOM 1827  C CB   . LEU A 1 45 ? 0.124   22.781  -1.021  1.00 0.00 ? 45 LEU A CB   2 
ATOM 1828  C CG   . LEU A 1 45 ? 0.517   23.567  0.231   1.00 0.00 ? 45 LEU A CG   2 
ATOM 1829  C CD1  . LEU A 1 45 ? 0.384   25.064  -0.012  1.00 0.00 ? 45 LEU A CD1  2 
ATOM 1830  C CD2  . LEU A 1 45 ? -0.333  23.134  1.420   1.00 0.00 ? 45 LEU A CD2  2 
ATOM 1831  H H    . LEU A 1 45 ? 0.128   24.691  -3.035  1.00 0.00 ? 45 LEU A H    2 
ATOM 1832  H HA   . LEU A 1 45 ? 2.060   22.775  -1.906  1.00 0.00 ? 45 LEU A HA   2 
ATOM 1833  H HB2  . LEU A 1 45 ? -0.868  23.085  -1.309  1.00 0.00 ? 45 LEU A HB2  2 
ATOM 1834  H HB3  . LEU A 1 45 ? 0.101   21.735  -0.769  1.00 0.00 ? 45 LEU A HB3  2 
ATOM 1835  H HG   . LEU A 1 45 ? 1.550   23.360  0.467   1.00 0.00 ? 45 LEU A HG   2 
ATOM 1836  H HD11 . LEU A 1 45 ? -0.222  25.233  -0.891  1.00 0.00 ? 45 LEU A HD11 2 
ATOM 1837  H HD12 . LEU A 1 45 ? -0.086  25.528  0.843   1.00 0.00 ? 45 LEU A HD12 2 
ATOM 1838  H HD13 . LEU A 1 45 ? 1.363   25.493  -0.161  1.00 0.00 ? 45 LEU A HD13 2 
ATOM 1839  H HD21 . LEU A 1 45 ? -0.952  22.295  1.135   1.00 0.00 ? 45 LEU A HD21 2 
ATOM 1840  H HD22 . LEU A 1 45 ? 0.310   22.844  2.237   1.00 0.00 ? 45 LEU A HD22 2 
ATOM 1841  H HD23 . LEU A 1 45 ? -0.963  23.955  1.732   1.00 0.00 ? 45 LEU A HD23 2 
ATOM 1842  N N    . ILE A 1 46 ? 0.658   22.355  -4.574  1.00 0.00 ? 46 ILE A N    2 
ATOM 1843  C CA   . ILE A 1 46 ? 0.332   21.410  -5.643  1.00 0.00 ? 46 ILE A CA   2 
ATOM 1844  C C    . ILE A 1 46 ? 1.223   20.175  -5.548  1.00 0.00 ? 46 ILE A C    2 
ATOM 1845  O O    . ILE A 1 46 ? 0.743   19.053  -5.656  1.00 0.00 ? 46 ILE A O    2 
ATOM 1846  C CB   . ILE A 1 46 ? 0.491   22.007  -7.049  1.00 0.00 ? 46 ILE A CB   2 
ATOM 1847  C CG1  . ILE A 1 46 ? -0.190  23.371  -7.142  1.00 0.00 ? 46 ILE A CG1  2 
ATOM 1848  C CG2  . ILE A 1 46 ? -0.085  21.057  -8.089  1.00 0.00 ? 46 ILE A CG2  2 
ATOM 1849  C CD1  . ILE A 1 46 ? -1.673  23.325  -6.846  1.00 0.00 ? 46 ILE A CD1  2 
ATOM 1850  H H    . ILE A 1 46 ? 0.865   23.290  -4.788  1.00 0.00 ? 46 ILE A H    2 
ATOM 1851  H HA   . ILE A 1 46 ? -0.698  21.108  -5.516  1.00 0.00 ? 46 ILE A HA   2 
ATOM 1852  H HB   . ILE A 1 46 ? 1.538   22.110  -7.243  1.00 0.00 ? 46 ILE A HB   2 
ATOM 1853  H HG12 . ILE A 1 46 ? 0.266   24.042  -6.435  1.00 0.00 ? 46 ILE A HG12 2 
ATOM 1854  H HG13 . ILE A 1 46 ? -0.062  23.763  -8.140  1.00 0.00 ? 46 ILE A HG13 2 
ATOM 1855  H HG21 . ILE A 1 46 ? -0.184  20.070  -7.662  1.00 0.00 ? 46 ILE A HG21 2 
ATOM 1856  H HG22 . ILE A 1 46 ? -1.056  21.412  -8.403  1.00 0.00 ? 46 ILE A HG22 2 
ATOM 1857  H HG23 . ILE A 1 46 ? 0.576   21.015  -8.943  1.00 0.00 ? 46 ILE A HG23 2 
ATOM 1858  H HD11 . ILE A 1 46 ? -2.008  22.299  -6.846  1.00 0.00 ? 46 ILE A HD11 2 
ATOM 1859  H HD12 . ILE A 1 46 ? -1.861  23.766  -5.879  1.00 0.00 ? 46 ILE A HD12 2 
ATOM 1860  H HD13 . ILE A 1 46 ? -2.208  23.878  -7.605  1.00 0.00 ? 46 ILE A HD13 2 
ATOM 1861  N N    . PRO A 1 47 ? 2.542   20.356  -5.337  1.00 0.00 ? 47 PRO A N    2 
ATOM 1862  C CA   . PRO A 1 47 ? 3.464   19.230  -5.217  1.00 0.00 ? 47 PRO A CA   2 
ATOM 1863  C C    . PRO A 1 47 ? 3.231   18.481  -3.916  1.00 0.00 ? 47 PRO A C    2 
ATOM 1864  O O    . PRO A 1 47 ? 3.581   17.306  -3.784  1.00 0.00 ? 47 PRO A O    2 
ATOM 1865  C CB   . PRO A 1 47 ? 4.859   19.873  -5.241  1.00 0.00 ? 47 PRO A CB   2 
ATOM 1866  C CG   . PRO A 1 47 ? 4.637   21.302  -5.620  1.00 0.00 ? 47 PRO A CG   2 
ATOM 1867  C CD   . PRO A 1 47 ? 3.239   21.639  -5.189  1.00 0.00 ? 47 PRO A CD   2 
ATOM 1868  H HA   . PRO A 1 47 ? 3.352   18.544  -6.046  1.00 0.00 ? 47 PRO A HA   2 
ATOM 1869  H HB2  . PRO A 1 47 ? 5.310   19.792  -4.263  1.00 0.00 ? 47 PRO A HB2  2 
ATOM 1870  H HB3  . PRO A 1 47 ? 5.476   19.366  -5.968  1.00 0.00 ? 47 PRO A HB3  2 
ATOM 1871  H HG2  . PRO A 1 47 ? 5.349   21.932  -5.105  1.00 0.00 ? 47 PRO A HG2  2 
ATOM 1872  H HG3  . PRO A 1 47 ? 4.738   21.418  -6.689  1.00 0.00 ? 47 PRO A HG3  2 
ATOM 1873  H HD2  . PRO A 1 47 ? 3.230   21.970  -4.162  1.00 0.00 ? 47 PRO A HD2  2 
ATOM 1874  H HD3  . PRO A 1 47 ? 2.811   22.391  -5.836  1.00 0.00 ? 47 PRO A HD3  2 
ATOM 1875  N N    . LEU A 1 48 ? 2.608   19.167  -2.966  1.00 0.00 ? 48 LEU A N    2 
ATOM 1876  C CA   . LEU A 1 48 ? 2.278   18.567  -1.690  1.00 0.00 ? 48 LEU A CA   2 
ATOM 1877  C C    . LEU A 1 48 ? 1.225   17.504  -1.941  1.00 0.00 ? 48 LEU A C    2 
ATOM 1878  O O    . LEU A 1 48 ? 1.239   16.420  -1.359  1.00 0.00 ? 48 LEU A O    2 
ATOM 1879  C CB   . LEU A 1 48 ? 1.719   19.627  -0.743  1.00 0.00 ? 48 LEU A CB   2 
ATOM 1880  C CG   . LEU A 1 48 ? 1.492   19.152  0.686   1.00 0.00 ? 48 LEU A CG   2 
ATOM 1881  C CD1  . LEU A 1 48 ? 2.816   18.896  1.386   1.00 0.00 ? 48 LEU A CD1  2 
ATOM 1882  C CD2  . LEU A 1 48 ? 0.654   20.162  1.456   1.00 0.00 ? 48 LEU A CD2  2 
ATOM 1883  H H    . LEU A 1 48 ? 2.335   20.093  -3.140  1.00 0.00 ? 48 LEU A H    2 
ATOM 1884  H HA   . LEU A 1 48 ? 3.165   18.118  -1.269  1.00 0.00 ? 48 LEU A HA   2 
ATOM 1885  H HB2  . LEU A 1 48 ? 2.402   20.463  -0.723  1.00 0.00 ? 48 LEU A HB2  2 
ATOM 1886  H HB3  . LEU A 1 48 ? 0.768   19.963  -1.138  1.00 0.00 ? 48 LEU A HB3  2 
ATOM 1887  H HG   . LEU A 1 48 ? 0.951   18.222  0.652   1.00 0.00 ? 48 LEU A HG   2 
ATOM 1888  H HD11 . LEU A 1 48 ? 3.414   18.220  0.792   1.00 0.00 ? 48 LEU A HD11 2 
ATOM 1889  H HD12 . LEU A 1 48 ? 3.345   19.829  1.511   1.00 0.00 ? 48 LEU A HD12 2 
ATOM 1890  H HD13 . LEU A 1 48 ? 2.631   18.455  2.356   1.00 0.00 ? 48 LEU A HD13 2 
ATOM 1891  H HD21 . LEU A 1 48 ? -0.216  20.428  0.871   1.00 0.00 ? 48 LEU A HD21 2 
ATOM 1892  H HD22 . LEU A 1 48 ? 0.338   19.728  2.394   1.00 0.00 ? 48 LEU A HD22 2 
ATOM 1893  H HD23 . LEU A 1 48 ? 1.241   21.046  1.647   1.00 0.00 ? 48 LEU A HD23 2 
ATOM 1894  N N    . LEU A 1 49 ? 0.323   17.852  -2.850  1.00 0.00 ? 49 LEU A N    2 
ATOM 1895  C CA   . LEU A 1 49 ? -0.765  16.990  -3.265  1.00 0.00 ? 49 LEU A CA   2 
ATOM 1896  C C    . LEU A 1 49 ? -0.285  15.576  -3.563  1.00 0.00 ? 49 LEU A C    2 
ATOM 1897  O O    . LEU A 1 49 ? -0.665  14.622  -2.885  1.00 0.00 ? 49 LEU A O    2 
ATOM 1898  C CB   . LEU A 1 49 ? -1.416  17.600  -4.507  1.00 0.00 ? 49 LEU A CB   2 
ATOM 1899  C CG   . LEU A 1 49 ? -1.986  19.003  -4.300  1.00 0.00 ? 49 LEU A CG   2 
ATOM 1900  C CD1  . LEU A 1 49 ? -2.802  19.438  -5.507  1.00 0.00 ? 49 LEU A CD1  2 
ATOM 1901  C CD2  . LEU A 1 49 ? -2.829  19.059  -3.036  1.00 0.00 ? 49 LEU A CD2  2 
ATOM 1902  H H    . LEU A 1 49 ? 0.401   18.737  -3.271  1.00 0.00 ? 49 LEU A H    2 
ATOM 1903  H HA   . LEU A 1 49 ? -1.491  16.954  -2.469  1.00 0.00 ? 49 LEU A HA   2 
ATOM 1904  H HB2  . LEU A 1 49 ? -0.663  17.657  -5.292  1.00 0.00 ? 49 LEU A HB2  2 
ATOM 1905  H HB3  . LEU A 1 49 ? -2.213  16.952  -4.837  1.00 0.00 ? 49 LEU A HB3  2 
ATOM 1906  H HG   . LEU A 1 49 ? -1.168  19.699  -4.186  1.00 0.00 ? 49 LEU A HG   2 
ATOM 1907  H HD11 . LEU A 1 49 ? -2.200  19.354  -6.400  1.00 0.00 ? 49 LEU A HD11 2 
ATOM 1908  H HD12 . LEU A 1 49 ? -3.673  18.806  -5.600  1.00 0.00 ? 49 LEU A HD12 2 
ATOM 1909  H HD13 . LEU A 1 49 ? -3.114  20.464  -5.378  1.00 0.00 ? 49 LEU A HD13 2 
ATOM 1910  H HD21 . LEU A 1 49 ? -2.297  18.588  -2.224  1.00 0.00 ? 49 LEU A HD21 2 
ATOM 1911  H HD22 . LEU A 1 49 ? -3.024  20.087  -2.785  1.00 0.00 ? 49 LEU A HD22 2 
ATOM 1912  H HD23 . LEU A 1 49 ? -3.763  18.544  -3.203  1.00 0.00 ? 49 LEU A HD23 2 
ATOM 1913  N N    . ARG A 1 50 ? 0.547   15.451  -4.582  1.00 0.00 ? 50 ARG A N    2 
ATOM 1914  C CA   . ARG A 1 50 ? 1.075   14.166  -4.990  1.00 0.00 ? 50 ARG A CA   2 
ATOM 1915  C C    . ARG A 1 50 ? 2.003   13.596  -3.929  1.00 0.00 ? 50 ARG A C    2 
ATOM 1916  O O    . ARG A 1 50 ? 1.991   12.392  -3.656  1.00 0.00 ? 50 ARG A O    2 
ATOM 1917  C CB   . ARG A 1 50 ? 1.825   14.321  -6.310  1.00 0.00 ? 50 ARG A CB   2 
ATOM 1918  C CG   . ARG A 1 50 ? 0.939   14.747  -7.470  1.00 0.00 ? 50 ARG A CG   2 
ATOM 1919  C CD   . ARG A 1 50 ? 1.730   14.843  -8.767  1.00 0.00 ? 50 ARG A CD   2 
ATOM 1920  N NE   . ARG A 1 50 ? 0.886   15.234  -9.895  1.00 0.00 ? 50 ARG A NE   2 
ATOM 1921  C CZ   . ARG A 1 50 ? -0.104  14.487  -10.379 1.00 0.00 ? 50 ARG A CZ   2 
ATOM 1922  N NH1  . ARG A 1 50 ? -0.351  13.284  -9.872  1.00 0.00 ? 50 ARG A NH1  2 
ATOM 1923  N NH2  . ARG A 1 50 ? -0.844  14.940  -11.381 1.00 0.00 ? 50 ARG A NH2  2 
ATOM 1924  H H    . ARG A 1 50 ? 0.813   16.245  -5.080  1.00 0.00 ? 50 ARG A H    2 
ATOM 1925  H HA   . ARG A 1 50 ? 0.243   13.491  -5.136  1.00 0.00 ? 50 ARG A HA   2 
ATOM 1926  H HB2  . ARG A 1 50 ? 2.600   15.063  -6.185  1.00 0.00 ? 50 ARG A HB2  2 
ATOM 1927  H HB3  . ARG A 1 50 ? 2.278   13.383  -6.559  1.00 0.00 ? 50 ARG A HB3  2 
ATOM 1928  H HG2  . ARG A 1 50 ? 0.150   14.022  -7.593  1.00 0.00 ? 50 ARG A HG2  2 
ATOM 1929  H HG3  . ARG A 1 50 ? 0.512   15.714  -7.249  1.00 0.00 ? 50 ARG A HG3  2 
ATOM 1930  H HD2  . ARG A 1 50 ? 2.512   15.577  -8.644  1.00 0.00 ? 50 ARG A HD2  2 
ATOM 1931  H HD3  . ARG A 1 50 ? 2.171   13.880  -8.977  1.00 0.00 ? 50 ARG A HD3  2 
ATOM 1932  H HE   . ARG A 1 50 ? 1.058   16.107  -10.305 1.00 0.00 ? 50 ARG A HE   2 
ATOM 1933  H HH11 . ARG A 1 50 ? 0.209   12.931  -9.123  1.00 0.00 ? 50 ARG A HH11 2 
ATOM 1934  H HH12 . ARG A 1 50 ? -1.098  12.731  -10.242 1.00 0.00 ? 50 ARG A HH12 2 
ATOM 1935  H HH21 . ARG A 1 50 ? -0.658  15.841  -11.772 1.00 0.00 ? 50 ARG A HH21 2 
ATOM 1936  H HH22 . ARG A 1 50 ? -1.588  14.381  -11.746 1.00 0.00 ? 50 ARG A HH22 2 
ATOM 1937  N N    . THR A 1 51 ? 2.823   14.465  -3.349  1.00 0.00 ? 51 THR A N    2 
ATOM 1938  C CA   . THR A 1 51 ? 3.775   14.046  -2.335  1.00 0.00 ? 51 THR A CA   2 
ATOM 1939  C C    . THR A 1 51 ? 3.083   13.395  -1.150  1.00 0.00 ? 51 THR A C    2 
ATOM 1940  O O    . THR A 1 51 ? 3.539   12.372  -0.640  1.00 0.00 ? 51 THR A O    2 
ATOM 1941  C CB   . THR A 1 51 ? 4.611   15.234  -1.866  1.00 0.00 ? 51 THR A CB   2 
ATOM 1942  O OG1  . THR A 1 51 ? 5.233   15.864  -2.968  1.00 0.00 ? 51 THR A OG1  2 
ATOM 1943  C CG2  . THR A 1 51 ? 5.693   14.850  -0.878  1.00 0.00 ? 51 THR A CG2  2 
ATOM 1944  H H    . THR A 1 51 ? 2.796   15.409  -3.621  1.00 0.00 ? 51 THR A H    2 
ATOM 1945  H HA   . THR A 1 51 ? 4.424   13.321  -2.788  1.00 0.00 ? 51 THR A HA   2 
ATOM 1946  H HB   . THR A 1 51 ? 3.961   15.951  -1.385  1.00 0.00 ? 51 THR A HB   2 
ATOM 1947  H HG1  . THR A 1 51 ? 4.558   16.260  -3.529  1.00 0.00 ? 51 THR A HG1  2 
ATOM 1948  H HG21 . THR A 1 51 ? 6.117   13.898  -1.161  1.00 0.00 ? 51 THR A HG21 2 
ATOM 1949  H HG22 . THR A 1 51 ? 6.467   15.604  -0.881  1.00 0.00 ? 51 THR A HG22 2 
ATOM 1950  H HG23 . THR A 1 51 ? 5.267   14.775  0.112   1.00 0.00 ? 51 THR A HG23 2 
ATOM 1951  N N    . GLN A 1 52 ? 1.978   13.982  -0.711  1.00 0.00 ? 52 GLN A N    2 
ATOM 1952  C CA   . GLN A 1 52 ? 1.241   13.433  0.418   1.00 0.00 ? 52 GLN A CA   2 
ATOM 1953  C C    . GLN A 1 52 ? 0.288   12.351  -0.050  1.00 0.00 ? 52 GLN A C    2 
ATOM 1954  O O    . GLN A 1 52 ? 0.065   11.360  0.645   1.00 0.00 ? 52 GLN A O    2 
ATOM 1955  C CB   . GLN A 1 52 ? 0.476   14.526  1.151   1.00 0.00 ? 52 GLN A CB   2 
ATOM 1956  C CG   . GLN A 1 52 ? 1.374   15.628  1.670   1.00 0.00 ? 52 GLN A CG   2 
ATOM 1957  C CD   . GLN A 1 52 ? 0.617   16.644  2.501   1.00 0.00 ? 52 GLN A CD   2 
ATOM 1958  O OE1  . GLN A 1 52 ? -0.385  17.205  2.057   1.00 0.00 ? 52 GLN A OE1  2 
ATOM 1959  N NE2  . GLN A 1 52 ? 1.096   16.894  3.714   1.00 0.00 ? 52 GLN A NE2  2 
ATOM 1960  H H    . GLN A 1 52 ? 1.652   14.796  -1.157  1.00 0.00 ? 52 GLN A H    2 
ATOM 1961  H HA   . GLN A 1 52 ? 1.957   12.991  1.095   1.00 0.00 ? 52 GLN A HA   2 
ATOM 1962  H HB2  . GLN A 1 52 ? -0.245  14.962  0.476   1.00 0.00 ? 52 GLN A HB2  2 
ATOM 1963  H HB3  . GLN A 1 52 ? -0.045  14.088  1.989   1.00 0.00 ? 52 GLN A HB3  2 
ATOM 1964  H HG2  . GLN A 1 52 ? 2.145   15.185  2.284   1.00 0.00 ? 52 GLN A HG2  2 
ATOM 1965  H HG3  . GLN A 1 52 ? 1.829   16.125  0.825   1.00 0.00 ? 52 GLN A HG3  2 
ATOM 1966  H HE21 . GLN A 1 52 ? 1.901   16.415  4.001   1.00 0.00 ? 52 GLN A HE21 2 
ATOM 1967  H HE22 . GLN A 1 52 ? 0.623   17.546  4.273   1.00 0.00 ? 52 GLN A HE22 2 
ATOM 1968  N N    . PHE A 1 53 ? -0.264  12.536  -1.241  1.00 0.00 ? 53 PHE A N    2 
ATOM 1969  C CA   . PHE A 1 53 ? -1.188  11.565  -1.802  1.00 0.00 ? 53 PHE A CA   2 
ATOM 1970  C C    . PHE A 1 53 ? -0.566  10.176  -1.765  1.00 0.00 ? 53 PHE A C    2 
ATOM 1971  O O    . PHE A 1 53 ? -1.180  9.223   -1.282  1.00 0.00 ? 53 PHE A O    2 
ATOM 1972  C CB   . PHE A 1 53 ? -1.550  11.927  -3.247  1.00 0.00 ? 53 PHE A CB   2 
ATOM 1973  C CG   . PHE A 1 53 ? -2.582  11.025  -3.877  1.00 0.00 ? 53 PHE A CG   2 
ATOM 1974  C CD1  . PHE A 1 53 ? -3.327  10.138  -3.109  1.00 0.00 ? 53 PHE A CD1  2 
ATOM 1975  C CD2  . PHE A 1 53 ? -2.816  11.074  -5.241  1.00 0.00 ? 53 PHE A CD2  2 
ATOM 1976  C CE1  . PHE A 1 53 ? -4.277  9.322   -3.693  1.00 0.00 ? 53 PHE A CE1  2 
ATOM 1977  C CE2  . PHE A 1 53 ? -3.763  10.261  -5.829  1.00 0.00 ? 53 PHE A CE2  2 
ATOM 1978  C CZ   . PHE A 1 53 ? -4.495  9.384   -5.054  1.00 0.00 ? 53 PHE A CZ   2 
ATOM 1979  H H    . PHE A 1 53 ? -0.039  13.339  -1.755  1.00 0.00 ? 53 PHE A H    2 
ATOM 1980  H HA   . PHE A 1 53 ? -2.089  11.573  -1.194  1.00 0.00 ? 53 PHE A HA   2 
ATOM 1981  H HB2  . PHE A 1 53 ? -1.940  12.933  -3.269  1.00 0.00 ? 53 PHE A HB2  2 
ATOM 1982  H HB3  . PHE A 1 53 ? -0.656  11.882  -3.851  1.00 0.00 ? 53 PHE A HB3  2 
ATOM 1983  H HD1  . PHE A 1 53 ? -3.158  10.089  -2.043  1.00 0.00 ? 53 PHE A HD1  2 
ATOM 1984  H HD2  . PHE A 1 53 ? -2.244  11.758  -5.851  1.00 0.00 ? 53 PHE A HD2  2 
ATOM 1985  H HE1  . PHE A 1 53 ? -4.848  8.637   -3.084  1.00 0.00 ? 53 PHE A HE1  2 
ATOM 1986  H HE2  . PHE A 1 53 ? -3.935  10.312  -6.894  1.00 0.00 ? 53 PHE A HE2  2 
ATOM 1987  H HZ   . PHE A 1 53 ? -5.237  8.747   -5.513  1.00 0.00 ? 53 PHE A HZ   2 
ATOM 1988  N N    . PHE A 1 54 ? 0.667   10.063  -2.272  1.00 0.00 ? 54 PHE A N    2 
ATOM 1989  C CA   . PHE A 1 54 ? 1.347   8.776   -2.291  1.00 0.00 ? 54 PHE A CA   2 
ATOM 1990  C C    . PHE A 1 54 ? 1.589   8.268   -0.870  1.00 0.00 ? 54 PHE A C    2 
ATOM 1991  O O    . PHE A 1 54 ? 1.507   7.068   -0.614  1.00 0.00 ? 54 PHE A O    2 
ATOM 1992  C CB   . PHE A 1 54 ? 2.659   8.841   -3.101  1.00 0.00 ? 54 PHE A CB   2 
ATOM 1993  C CG   . PHE A 1 54 ? 3.808   9.590   -2.465  1.00 0.00 ? 54 PHE A CG   2 
ATOM 1994  C CD1  . PHE A 1 54 ? 4.340   9.193   -1.250  1.00 0.00 ? 54 PHE A CD1  2 
ATOM 1995  C CD2  . PHE A 1 54 ? 4.382   10.676  -3.111  1.00 0.00 ? 54 PHE A CD2  2 
ATOM 1996  C CE1  . PHE A 1 54 ? 5.412   9.860   -0.692  1.00 0.00 ? 54 PHE A CE1  2 
ATOM 1997  C CE2  . PHE A 1 54 ? 5.455   11.345  -2.553  1.00 0.00 ? 54 PHE A CE2  2 
ATOM 1998  C CZ   . PHE A 1 54 ? 5.970   10.936  -1.345  1.00 0.00 ? 54 PHE A CZ   2 
ATOM 1999  H H    . PHE A 1 54 ? 1.119   10.858  -2.641  1.00 0.00 ? 54 PHE A H    2 
ATOM 2000  H HA   . PHE A 1 54 ? 0.679   8.077   -2.786  1.00 0.00 ? 54 PHE A HA   2 
ATOM 2001  H HB2  . PHE A 1 54 ? 2.998   7.835   -3.287  1.00 0.00 ? 54 PHE A HB2  2 
ATOM 2002  H HB3  . PHE A 1 54 ? 2.449   9.315   -4.050  1.00 0.00 ? 54 PHE A HB3  2 
ATOM 2003  H HD1  . PHE A 1 54 ? 3.909   8.352   -0.733  1.00 0.00 ? 54 PHE A HD1  2 
ATOM 2004  H HD2  . PHE A 1 54 ? 3.978   11.006  -4.053  1.00 0.00 ? 54 PHE A HD2  2 
ATOM 2005  H HE1  . PHE A 1 54 ? 5.816   9.535   0.254   1.00 0.00 ? 54 PHE A HE1  2 
ATOM 2006  H HE2  . PHE A 1 54 ? 5.892   12.188  -3.068  1.00 0.00 ? 54 PHE A HE2  2 
ATOM 2007  H HZ   . PHE A 1 54 ? 6.809   11.458  -0.909  1.00 0.00 ? 54 PHE A HZ   2 
ATOM 2008  N N    . ILE A 1 55 ? 1.869   9.186   0.057   1.00 0.00 ? 55 ILE A N    2 
ATOM 2009  C CA   . ILE A 1 55 ? 2.111   8.811   1.452   1.00 0.00 ? 55 ILE A CA   2 
ATOM 2010  C C    . ILE A 1 55 ? 0.851   8.248   2.099   1.00 0.00 ? 55 ILE A C    2 
ATOM 2011  O O    . ILE A 1 55 ? 0.815   7.090   2.509   1.00 0.00 ? 55 ILE A O    2 
ATOM 2012  C CB   . ILE A 1 55 ? 2.601   10.006  2.304   1.00 0.00 ? 55 ILE A CB   2 
ATOM 2013  C CG1  . ILE A 1 55 ? 3.890   10.584  1.726   1.00 0.00 ? 55 ILE A CG1  2 
ATOM 2014  C CG2  . ILE A 1 55 ? 2.816   9.581   3.754   1.00 0.00 ? 55 ILE A CG2  2 
ATOM 2015  C CD1  . ILE A 1 55 ? 4.454   11.735  2.530   1.00 0.00 ? 55 ILE A CD1  2 
ATOM 2016  H H    . ILE A 1 55 ? 1.907   10.131  -0.201  1.00 0.00 ? 55 ILE A H    2 
ATOM 2017  H HA   . ILE A 1 55 ? 2.881   8.050   1.464   1.00 0.00 ? 55 ILE A HA   2 
ATOM 2018  H HB   . ILE A 1 55 ? 1.836   10.768  2.289   1.00 0.00 ? 55 ILE A HB   2 
ATOM 2019  H HG12 . ILE A 1 55 ? 4.640   9.808   1.686   1.00 0.00 ? 55 ILE A HG12 2 
ATOM 2020  H HG13 . ILE A 1 55 ? 3.695   10.941  0.729   1.00 0.00 ? 55 ILE A HG13 2 
ATOM 2021  H HG21 . ILE A 1 55 ? 2.494   8.559   3.884   1.00 0.00 ? 55 ILE A HG21 2 
ATOM 2022  H HG22 . ILE A 1 55 ? 3.865   9.661   4.002   1.00 0.00 ? 55 ILE A HG22 2 
ATOM 2023  H HG23 . ILE A 1 55 ? 2.243   10.225  4.405   1.00 0.00 ? 55 ILE A HG23 2 
ATOM 2024  H HD11 . ILE A 1 55 ? 4.539   11.443  3.567   1.00 0.00 ? 55 ILE A HD11 2 
ATOM 2025  H HD12 . ILE A 1 55 ? 5.430   11.996  2.149   1.00 0.00 ? 55 ILE A HD12 2 
ATOM 2026  H HD13 . ILE A 1 55 ? 3.796   12.587  2.448   1.00 0.00 ? 55 ILE A HD13 2 
ATOM 2027  N N    . VAL A 1 56 ? -0.174  9.086   2.208   1.00 0.00 ? 56 VAL A N    2 
ATOM 2028  C CA   . VAL A 1 56 ? -1.430  8.684   2.829   1.00 0.00 ? 56 VAL A CA   2 
ATOM 2029  C C    . VAL A 1 56 ? -2.003  7.430   2.178   1.00 0.00 ? 56 VAL A C    2 
ATOM 2030  O O    . VAL A 1 56 ? -2.513  6.545   2.866   1.00 0.00 ? 56 VAL A O    2 
ATOM 2031  C CB   . VAL A 1 56 ? -2.474  9.814   2.755   1.00 0.00 ? 56 VAL A CB   2 
ATOM 2032  C CG1  . VAL A 1 56 ? -3.712  9.453   3.561   1.00 0.00 ? 56 VAL A CG1  2 
ATOM 2033  C CG2  . VAL A 1 56 ? -1.872  11.123  3.241   1.00 0.00 ? 56 VAL A CG2  2 
ATOM 2034  H H    . VAL A 1 56 ? -0.078  10.004  1.877   1.00 0.00 ? 56 VAL A H    2 
ATOM 2035  H HA   . VAL A 1 56 ? -1.232  8.477   3.873   1.00 0.00 ? 56 VAL A HA   2 
ATOM 2036  H HB   . VAL A 1 56 ? -2.767  9.939   1.723   1.00 0.00 ? 56 VAL A HB   2 
ATOM 2037  H HG11 . VAL A 1 56 ? -3.987  8.428   3.358   1.00 0.00 ? 56 VAL A HG11 2 
ATOM 2038  H HG12 . VAL A 1 56 ? -3.502  9.567   4.614   1.00 0.00 ? 56 VAL A HG12 2 
ATOM 2039  H HG13 . VAL A 1 56 ? -4.526  10.106  3.283   1.00 0.00 ? 56 VAL A HG13 2 
ATOM 2040  H HG21 . VAL A 1 56 ? -1.249  10.936  4.103   1.00 0.00 ? 56 VAL A HG21 2 
ATOM 2041  H HG22 . VAL A 1 56 ? -1.275  11.558  2.454   1.00 0.00 ? 56 VAL A HG22 2 
ATOM 2042  H HG23 . VAL A 1 56 ? -2.665  11.805  3.512   1.00 0.00 ? 56 VAL A HG23 2 
ATOM 2043  N N    . MET A 1 57 ? -1.912  7.351   0.855   1.00 0.00 ? 57 MET A N    2 
ATOM 2044  C CA   . MET A 1 57 ? -2.424  6.196   0.129   1.00 0.00 ? 57 MET A CA   2 
ATOM 2045  C C    . MET A 1 57 ? -1.549  4.979   0.377   1.00 0.00 ? 57 MET A C    2 
ATOM 2046  O O    . MET A 1 57 ? -2.041  3.860   0.523   1.00 0.00 ? 57 MET A O    2 
ATOM 2047  C CB   . MET A 1 57 ? -2.499  6.495   -1.371  1.00 0.00 ? 57 MET A CB   2 
ATOM 2048  C CG   . MET A 1 57 ? -3.019  5.331   -2.196  1.00 0.00 ? 57 MET A CG   2 
ATOM 2049  S SD   . MET A 1 57 ? -3.203  5.738   -3.941  1.00 0.00 ? 57 MET A SD   2 
ATOM 2050  C CE   . MET A 1 57 ? -3.854  4.194   -4.577  1.00 0.00 ? 57 MET A CE   2 
ATOM 2051  H H    . MET A 1 57 ? -1.486  8.081   0.357   1.00 0.00 ? 57 MET A H    2 
ATOM 2052  H HA   . MET A 1 57 ? -3.414  5.988   0.496   1.00 0.00 ? 57 MET A HA   2 
ATOM 2053  H HB2  . MET A 1 57 ? -3.154  7.340   -1.527  1.00 0.00 ? 57 MET A HB2  2 
ATOM 2054  H HB3  . MET A 1 57 ? -1.510  6.746   -1.729  1.00 0.00 ? 57 MET A HB3  2 
ATOM 2055  H HG2  . MET A 1 57 ? -2.325  4.509   -2.107  1.00 0.00 ? 57 MET A HG2  2 
ATOM 2056  H HG3  . MET A 1 57 ? -3.981  5.031   -1.806  1.00 0.00 ? 57 MET A HG3  2 
ATOM 2057  H HE1  . MET A 1 57 ? -4.450  3.714   -3.816  1.00 0.00 ? 57 MET A HE1  2 
ATOM 2058  H HE2  . MET A 1 57 ? -4.467  4.392   -5.444  1.00 0.00 ? 57 MET A HE2  2 
ATOM 2059  H HE3  . MET A 1 57 ? -3.035  3.546   -4.855  1.00 0.00 ? 57 MET A HE3  2 
ATOM 2060  N N    . GLY A 1 58 ? -0.250  5.215   0.428   1.00 0.00 ? 58 GLY A N    2 
ATOM 2061  C CA   . GLY A 1 58 ? 0.695   4.141   0.661   1.00 0.00 ? 58 GLY A CA   2 
ATOM 2062  C C    . GLY A 1 58 ? 0.558   3.544   2.046   1.00 0.00 ? 58 GLY A C    2 
ATOM 2063  O O    . GLY A 1 58 ? 0.533   2.324   2.200   1.00 0.00 ? 58 GLY A O    2 
ATOM 2064  H H    . GLY A 1 58 ? 0.070   6.131   0.306   1.00 0.00 ? 58 GLY A H    2 
ATOM 2065  H HA2  . GLY A 1 58 ? 0.530   3.362   -0.072  1.00 0.00 ? 58 GLY A HA2  2 
ATOM 2066  H HA3  . GLY A 1 58 ? 1.695   4.522   0.541   1.00 0.00 ? 58 GLY A HA3  2 
ATOM 2067  N N    . LEU A 1 59 ? 0.457   4.403   3.060   1.00 0.00 ? 59 LEU A N    2 
ATOM 2068  C CA   . LEU A 1 59 ? 0.304   3.939   4.431   1.00 0.00 ? 59 LEU A CA   2 
ATOM 2069  C C    . LEU A 1 59 ? -0.926  3.049   4.540   1.00 0.00 ? 59 LEU A C    2 
ATOM 2070  O O    . LEU A 1 59 ? -0.890  1.987   5.159   1.00 0.00 ? 59 LEU A O    2 
ATOM 2071  C CB   . LEU A 1 59 ? 0.183   5.130   5.383   1.00 0.00 ? 59 LEU A CB   2 
ATOM 2072  C CG   . LEU A 1 59 ? 1.408   6.044   5.435   1.00 0.00 ? 59 LEU A CG   2 
ATOM 2073  C CD1  . LEU A 1 59 ? 1.154   7.228   6.359   1.00 0.00 ? 59 LEU A CD1  2 
ATOM 2074  C CD2  . LEU A 1 59 ? 2.634   5.266   5.887   1.00 0.00 ? 59 LEU A CD2  2 
ATOM 2075  H H    . LEU A 1 59 ? 0.473   5.365   2.880   1.00 0.00 ? 59 LEU A H    2 
ATOM 2076  H HA   . LEU A 1 59 ? 1.180   3.364   4.691   1.00 0.00 ? 59 LEU A HA   2 
ATOM 2077  H HB2  . LEU A 1 59 ? -0.669  5.720   5.077   1.00 0.00 ? 59 LEU A HB2  2 
ATOM 2078  H HB3  . LEU A 1 59 ? 0.000   4.753   6.376   1.00 0.00 ? 59 LEU A HB3  2 
ATOM 2079  H HG   . LEU A 1 59 ? 1.601   6.428   4.445   1.00 0.00 ? 59 LEU A HG   2 
ATOM 2080  H HD11 . LEU A 1 59 ? 0.129   7.207   6.700   1.00 0.00 ? 59 LEU A HD11 2 
ATOM 2081  H HD12 . LEU A 1 59 ? 1.817   7.171   7.209   1.00 0.00 ? 59 LEU A HD12 2 
ATOM 2082  H HD13 . LEU A 1 59 ? 1.334   8.147   5.821   1.00 0.00 ? 59 LEU A HD13 2 
ATOM 2083  H HD21 . LEU A 1 59 ? 2.805   4.440   5.213   1.00 0.00 ? 59 LEU A HD21 2 
ATOM 2084  H HD22 . LEU A 1 59 ? 3.494   5.919   5.884   1.00 0.00 ? 59 LEU A HD22 2 
ATOM 2085  H HD23 . LEU A 1 59 ? 2.472   4.889   6.886   1.00 0.00 ? 59 LEU A HD23 2 
ATOM 2086  N N    . VAL A 1 60 ? -2.007  3.483   3.903   1.00 0.00 ? 60 VAL A N    2 
ATOM 2087  C CA   . VAL A 1 60 ? -3.248  2.725   3.898   1.00 0.00 ? 60 VAL A CA   2 
ATOM 2088  C C    . VAL A 1 60 ? -3.069  1.415   3.137   1.00 0.00 ? 60 VAL A C    2 
ATOM 2089  O O    . VAL A 1 60 ? -3.393  0.341   3.642   1.00 0.00 ? 60 VAL A O    2 
ATOM 2090  C CB   . VAL A 1 60 ? -4.394  3.532   3.255   1.00 0.00 ? 60 VAL A CB   2 
ATOM 2091  C CG1  . VAL A 1 60 ? -5.698  2.752   3.309   1.00 0.00 ? 60 VAL A CG1  2 
ATOM 2092  C CG2  . VAL A 1 60 ? -4.544  4.885   3.936   1.00 0.00 ? 60 VAL A CG2  2 
ATOM 2093  H H    . VAL A 1 60 ? -1.963  4.328   3.408   1.00 0.00 ? 60 VAL A H    2 
ATOM 2094  H HA   . VAL A 1 60 ? -3.515  2.504   4.925   1.00 0.00 ? 60 VAL A HA   2 
ATOM 2095  H HB   . VAL A 1 60 ? -4.146  3.704   2.216   1.00 0.00 ? 60 VAL A HB   2 
ATOM 2096  H HG11 . VAL A 1 60 ? -5.743  2.189   4.229   1.00 0.00 ? 60 VAL A HG11 2 
ATOM 2097  H HG12 . VAL A 1 60 ? -6.531  3.439   3.267   1.00 0.00 ? 60 VAL A HG12 2 
ATOM 2098  H HG13 . VAL A 1 60 ? -5.748  2.074   2.469   1.00 0.00 ? 60 VAL A HG13 2 
ATOM 2099  H HG21 . VAL A 1 60 ? -3.600  5.176   4.370   1.00 0.00 ? 60 VAL A HG21 2 
ATOM 2100  H HG22 . VAL A 1 60 ? -4.849  5.622   3.206   1.00 0.00 ? 60 VAL A HG22 2 
ATOM 2101  H HG23 . VAL A 1 60 ? -5.291  4.815   4.712   1.00 0.00 ? 60 VAL A HG23 2 
ATOM 2102  N N    . ASP A 1 61 ? -2.545  1.514   1.917   1.00 0.00 ? 61 ASP A N    2 
ATOM 2103  C CA   . ASP A 1 61 ? -2.318  0.344   1.086   1.00 0.00 ? 61 ASP A CA   2 
ATOM 2104  C C    . ASP A 1 61 ? -1.198  -0.527  1.639   1.00 0.00 ? 61 ASP A C    2 
ATOM 2105  O O    . ASP A 1 61 ? -1.036  -1.680  1.230   1.00 0.00 ? 61 ASP A O    2 
ATOM 2106  C CB   . ASP A 1 61 ? -1.987  0.774   -0.341  1.00 0.00 ? 61 ASP A CB   2 
ATOM 2107  C CG   . ASP A 1 61 ? -3.186  1.359   -1.062  1.00 0.00 ? 61 ASP A CG   2 
ATOM 2108  O OD1  . ASP A 1 61 ? -4.243  0.695   -1.090  1.00 0.00 ? 61 ASP A OD1  2 
ATOM 2109  O OD2  . ASP A 1 61 ? -3.064  2.473   -1.613  1.00 0.00 ? 61 ASP A OD2  2 
ATOM 2110  H H    . ASP A 1 61 ? -2.303  2.393   1.567   1.00 0.00 ? 61 ASP A H    2 
ATOM 2111  H HA   . ASP A 1 61 ? -3.231  -0.235  1.076   1.00 0.00 ? 61 ASP A HA   2 
ATOM 2112  H HB2  . ASP A 1 61 ? -1.203  1.524   -0.314  1.00 0.00 ? 61 ASP A HB2  2 
ATOM 2113  H HB3  . ASP A 1 61 ? -1.638  -0.079  -0.893  1.00 0.00 ? 61 ASP A HB3  2 
ATOM 2114  N N    . ALA A 1 62 ? -0.430  0.011   2.578   1.00 0.00 ? 62 ALA A N    2 
ATOM 2115  C CA   . ALA A 1 62 ? 0.649   -0.750  3.180   1.00 0.00 ? 62 ALA A CA   2 
ATOM 2116  C C    . ALA A 1 62 ? 0.085   -2.007  3.825   1.00 0.00 ? 62 ALA A C    2 
ATOM 2117  O O    . ALA A 1 62 ? 0.719   -3.059  3.826   1.00 0.00 ? 62 ALA A O    2 
ATOM 2118  C CB   . ALA A 1 62 ? 1.395   0.091   4.205   1.00 0.00 ? 62 ALA A CB   2 
ATOM 2119  H H    . ALA A 1 62 ? -0.600  0.928   2.880   1.00 0.00 ? 62 ALA A H    2 
ATOM 2120  H HA   . ALA A 1 62 ? 1.340   -1.033  2.399   1.00 0.00 ? 62 ALA A HA   2 
ATOM 2121  H HB1  . ALA A 1 62 ? 0.691   0.521   4.900   1.00 0.00 ? 62 ALA A HB1  2 
ATOM 2122  H HB2  . ALA A 1 62 ? 2.095   -0.532  4.742   1.00 0.00 ? 62 ALA A HB2  2 
ATOM 2123  H HB3  . ALA A 1 62 ? 1.931   0.883   3.701   1.00 0.00 ? 62 ALA A HB3  2 
ATOM 2124  N N    . ILE A 1 63 ? -1.131  -1.888  4.352   1.00 0.00 ? 63 ILE A N    2 
ATOM 2125  C CA   . ILE A 1 63 ? -1.795  -3.012  4.986   1.00 0.00 ? 63 ILE A CA   2 
ATOM 2126  C C    . ILE A 1 63 ? -1.993  -4.156  3.985   1.00 0.00 ? 63 ILE A C    2 
ATOM 2127  O O    . ILE A 1 63 ? -1.382  -5.213  4.145   1.00 0.00 ? 63 ILE A O    2 
ATOM 2128  C CB   . ILE A 1 63 ? -3.124  -2.584  5.651   1.00 0.00 ? 63 ILE A CB   2 
ATOM 2129  C CG1  . ILE A 1 63 ? -2.833  -1.617  6.799   1.00 0.00 ? 63 ILE A CG1  2 
ATOM 2130  C CG2  . ILE A 1 63 ? -3.903  -3.794  6.155   1.00 0.00 ? 63 ILE A CG2  2 
ATOM 2131  C CD1  . ILE A 1 63 ? -4.070  -1.177  7.553   1.00 0.00 ? 63 ILE A CD1  2 
ATOM 2132  H H    . ILE A 1 63 ? -1.592  -1.030  4.299   1.00 0.00 ? 63 ILE A H    2 
ATOM 2133  H HA   . ILE A 1 63 ? -1.136  -3.366  5.769   1.00 0.00 ? 63 ILE A HA   2 
ATOM 2134  H HB   . ILE A 1 63 ? -3.723  -2.072  4.924   1.00 0.00 ? 63 ILE A HB   2 
ATOM 2135  H HG12 . ILE A 1 63 ? -2.166  -2.092  7.501   1.00 0.00 ? 63 ILE A HG12 2 
ATOM 2136  H HG13 . ILE A 1 63 ? -2.358  -0.734  6.398   1.00 0.00 ? 63 ILE A HG13 2 
ATOM 2137  H HG21 . ILE A 1 63 ? -3.967  -4.534  5.373   1.00 0.00 ? 63 ILE A HG21 2 
ATOM 2138  H HG22 . ILE A 1 63 ? -3.396  -4.217  7.010   1.00 0.00 ? 63 ILE A HG22 2 
ATOM 2139  H HG23 . ILE A 1 63 ? -4.897  -3.487  6.443   1.00 0.00 ? 63 ILE A HG23 2 
ATOM 2140  H HD11 . ILE A 1 63 ? -4.951  -1.537  7.042   1.00 0.00 ? 63 ILE A HD11 2 
ATOM 2141  H HD12 . ILE A 1 63 ? -4.043  -1.582  8.554   1.00 0.00 ? 63 ILE A HD12 2 
ATOM 2142  H HD13 . ILE A 1 63 ? -4.097  -0.098  7.601   1.00 0.00 ? 63 ILE A HD13 2 
ATOM 2143  N N    . PRO A 1 64 ? -2.827  -3.997  2.929   1.00 0.00 ? 64 PRO A N    2 
ATOM 2144  C CA   . PRO A 1 64 ? -3.004  -5.068  1.957   1.00 0.00 ? 64 PRO A CA   2 
ATOM 2145  C C    . PRO A 1 64 ? -1.676  -5.474  1.345   1.00 0.00 ? 64 PRO A C    2 
ATOM 2146  O O    . PRO A 1 64 ? -1.504  -6.605  0.896   1.00 0.00 ? 64 PRO A O    2 
ATOM 2147  C CB   . PRO A 1 64 ? -3.918  -4.481  0.880   1.00 0.00 ? 64 PRO A CB   2 
ATOM 2148  C CG   . PRO A 1 64 ? -4.529  -3.261  1.473   1.00 0.00 ? 64 PRO A CG   2 
ATOM 2149  C CD   . PRO A 1 64 ? -3.638  -2.807  2.599   1.00 0.00 ? 64 PRO A CD   2 
ATOM 2150  H HA   . PRO A 1 64 ? -3.460  -5.930  2.406   1.00 0.00 ? 64 PRO A HA   2 
ATOM 2151  H HB2  . PRO A 1 64 ? -3.333  -4.238  0.005   1.00 0.00 ? 64 PRO A HB2  2 
ATOM 2152  H HB3  . PRO A 1 64 ? -4.673  -5.208  0.618   1.00 0.00 ? 64 PRO A HB3  2 
ATOM 2153  H HG2  . PRO A 1 64 ? -4.597  -2.489  0.723   1.00 0.00 ? 64 PRO A HG2  2 
ATOM 2154  H HG3  . PRO A 1 64 ? -5.512  -3.497  1.851   1.00 0.00 ? 64 PRO A HG3  2 
ATOM 2155  H HD2  . PRO A 1 64 ? -3.017  -1.987  2.282   1.00 0.00 ? 64 PRO A HD2  2 
ATOM 2156  H HD3  . PRO A 1 64 ? -4.250  -2.517  3.428   1.00 0.00 ? 64 PRO A HD3  2 
ATOM 2157  N N    . MET A 1 65 ? -0.733  -4.544  1.347   1.00 0.00 ? 65 MET A N    2 
ATOM 2158  C CA   . MET A 1 65 ? 0.587   -4.812  0.806   1.00 0.00 ? 65 MET A CA   2 
ATOM 2159  C C    . MET A 1 65 ? 1.319   -5.774  1.733   1.00 0.00 ? 65 MET A C    2 
ATOM 2160  O O    . MET A 1 65 ? 2.092   -6.623  1.289   1.00 0.00 ? 65 MET A O    2 
ATOM 2161  C CB   . MET A 1 65 ? 1.371   -3.501  0.655   1.00 0.00 ? 65 MET A CB   2 
ATOM 2162  C CG   . MET A 1 65 ? 2.613   -3.604  -0.208  1.00 0.00 ? 65 MET A CG   2 
ATOM 2163  S SD   . MET A 1 65 ? 3.930   -4.587  0.535   1.00 0.00 ? 65 MET A SD   2 
ATOM 2164  C CE   . MET A 1 65 ? 5.171   -4.516  -0.755  1.00 0.00 ? 65 MET A CE   2 
ATOM 2165  H H    . MET A 1 65 ? -0.929  -3.660  1.733   1.00 0.00 ? 65 MET A H    2 
ATOM 2166  H HA   . MET A 1 65 ? 0.468   -5.275  -0.165  1.00 0.00 ? 65 MET A HA   2 
ATOM 2167  H HB2  . MET A 1 65 ? 0.724   -2.764  0.212   1.00 0.00 ? 65 MET A HB2  2 
ATOM 2168  H HB3  . MET A 1 65 ? 1.670   -3.163  1.630   1.00 0.00 ? 65 MET A HB3  2 
ATOM 2169  H HG2  . MET A 1 65 ? 2.332   -4.052  -1.139  1.00 0.00 ? 65 MET A HG2  2 
ATOM 2170  H HG3  . MET A 1 65 ? 2.987   -2.606  -0.392  1.00 0.00 ? 65 MET A HG3  2 
ATOM 2171  H HE1  . MET A 1 65 ? 4.714   -4.743  -1.707  1.00 0.00 ? 65 MET A HE1  2 
ATOM 2172  H HE2  . MET A 1 65 ? 5.600   -3.526  -0.789  1.00 0.00 ? 65 MET A HE2  2 
ATOM 2173  H HE3  . MET A 1 65 ? 5.947   -5.238  -0.549  1.00 0.00 ? 65 MET A HE3  2 
ATOM 2174  N N    . ILE A 1 66 ? 1.036   -5.652  3.028   1.00 0.00 ? 66 ILE A N    2 
ATOM 2175  C CA   . ILE A 1 66 ? 1.646   -6.518  4.031   1.00 0.00 ? 66 ILE A CA   2 
ATOM 2176  C C    . ILE A 1 66 ? 0.974   -7.884  4.027   1.00 0.00 ? 66 ILE A C    2 
ATOM 2177  O O    . ILE A 1 66 ? 1.643   -8.914  4.082   1.00 0.00 ? 66 ILE A O    2 
ATOM 2178  C CB   . ILE A 1 66 ? 1.571   -5.884  5.444   1.00 0.00 ? 66 ILE A CB   2 
ATOM 2179  C CG1  . ILE A 1 66 ? 2.528   -4.691  5.533   1.00 0.00 ? 66 ILE A CG1  2 
ATOM 2180  C CG2  . ILE A 1 66 ? 1.898   -6.900  6.531   1.00 0.00 ? 66 ILE A CG2  2 
ATOM 2181  C CD1  . ILE A 1 66 ? 2.414   -3.918  6.829   1.00 0.00 ? 66 ILE A CD1  2 
ATOM 2182  H H    . ILE A 1 66 ? 0.382   -4.974  3.313   1.00 0.00 ? 66 ILE A H    2 
ATOM 2183  H HA   . ILE A 1 66 ? 2.691   -6.641  3.772   1.00 0.00 ? 66 ILE A HA   2 
ATOM 2184  H HB   . ILE A 1 66 ? 0.563   -5.535  5.607   1.00 0.00 ? 66 ILE A HB   2 
ATOM 2185  H HG12 . ILE A 1 66 ? 3.544   -5.048  5.452   1.00 0.00 ? 66 ILE A HG12 2 
ATOM 2186  H HG13 . ILE A 1 66 ? 2.327   -4.012  4.721   1.00 0.00 ? 66 ILE A HG13 2 
ATOM 2187  H HG21 . ILE A 1 66 ? 1.284   -7.779  6.402   1.00 0.00 ? 66 ILE A HG21 2 
ATOM 2188  H HG22 . ILE A 1 66 ? 2.940   -7.175  6.467   1.00 0.00 ? 66 ILE A HG22 2 
ATOM 2189  H HG23 . ILE A 1 66 ? 1.698   -6.464  7.498   1.00 0.00 ? 66 ILE A HG23 2 
ATOM 2190  H HD11 . ILE A 1 66 ? 1.848   -4.496  7.544   1.00 0.00 ? 66 ILE A HD11 2 
ATOM 2191  H HD12 . ILE A 1 66 ? 3.402   -3.726  7.222   1.00 0.00 ? 66 ILE A HD12 2 
ATOM 2192  H HD13 . ILE A 1 66 ? 1.911   -2.980  6.645   1.00 0.00 ? 66 ILE A HD13 2 
ATOM 2193  N N    . ALA A 1 67 ? -0.352  -7.888  3.950   1.00 0.00 ? 67 ALA A N    2 
ATOM 2194  C CA   . ALA A 1 67 ? -1.101  -9.130  3.923   1.00 0.00 ? 67 ALA A CA   2 
ATOM 2195  C C    . ALA A 1 67 ? -0.825  -9.881  2.629   1.00 0.00 ? 67 ALA A C    2 
ATOM 2196  O O    . ALA A 1 67 ? -0.467  -11.058 2.637   1.00 0.00 ? 67 ALA A O    2 
ATOM 2197  C CB   . ALA A 1 67 ? -2.590  -8.858  4.078   1.00 0.00 ? 67 ALA A CB   2 
ATOM 2198  H H    . ALA A 1 67 ? -0.832  -7.039  3.899   1.00 0.00 ? 67 ALA A H    2 
ATOM 2199  H HA   . ALA A 1 67 ? -0.774  -9.728  4.755   1.00 0.00 ? 67 ALA A HA   2 
ATOM 2200  H HB1  . ALA A 1 67 ? -2.733  -7.973  4.678   1.00 0.00 ? 67 ALA A HB1  2 
ATOM 2201  H HB2  . ALA A 1 67 ? -3.030  -8.708  3.104   1.00 0.00 ? 67 ALA A HB2  2 
ATOM 2202  H HB3  . ALA A 1 67 ? -3.061  -9.701  4.560   1.00 0.00 ? 67 ALA A HB3  2 
ATOM 2203  N N    . VAL A 1 68 ? -0.973  -9.179  1.513   1.00 0.00 ? 68 VAL A N    2 
ATOM 2204  C CA   . VAL A 1 68 ? -0.720  -9.768  0.208   1.00 0.00 ? 68 VAL A CA   2 
ATOM 2205  C C    . VAL A 1 68 ? 0.767   -10.026 0.026   1.00 0.00 ? 68 VAL A C    2 
ATOM 2206  O O    . VAL A 1 68 ? 1.160   -10.965 -0.663  1.00 0.00 ? 68 VAL A O    2 
ATOM 2207  C CB   . VAL A 1 68 ? -1.236  -8.864  -0.932  1.00 0.00 ? 68 VAL A CB   2 
ATOM 2208  C CG1  . VAL A 1 68 ? -0.989  -9.505  -2.292  1.00 0.00 ? 68 VAL A CG1  2 
ATOM 2209  C CG2  . VAL A 1 68 ? -2.715  -8.564  -0.739  1.00 0.00 ? 68 VAL A CG2  2 
ATOM 2210  H H    . VAL A 1 68 ? -1.243  -8.239  1.570   1.00 0.00 ? 68 VAL A H    2 
ATOM 2211  H HA   . VAL A 1 68 ? -1.243  -10.713 0.164   1.00 0.00 ? 68 VAL A HA   2 
ATOM 2212  H HB   . VAL A 1 68 ? -0.694  -7.928  -0.896  1.00 0.00 ? 68 VAL A HB   2 
ATOM 2213  H HG11 . VAL A 1 68 ? -0.326  -10.348 -2.179  1.00 0.00 ? 68 VAL A HG11 2 
ATOM 2214  H HG12 . VAL A 1 68 ? -1.927  -9.838  -2.710  1.00 0.00 ? 68 VAL A HG12 2 
ATOM 2215  H HG13 . VAL A 1 68 ? -0.538  -8.780  -2.953  1.00 0.00 ? 68 VAL A HG13 2 
ATOM 2216  H HG21 . VAL A 1 68 ? -2.872  -8.146  0.244   1.00 0.00 ? 68 VAL A HG21 2 
ATOM 2217  H HG22 . VAL A 1 68 ? -3.041  -7.857  -1.487  1.00 0.00 ? 68 VAL A HG22 2 
ATOM 2218  H HG23 . VAL A 1 68 ? -3.283  -9.478  -0.836  1.00 0.00 ? 68 VAL A HG23 2 
ATOM 2219  N N    . GLY A 1 69 ? 1.592   -9.192  0.657   1.00 0.00 ? 69 GLY A N    2 
ATOM 2220  C CA   . GLY A 1 69 ? 3.028   -9.362  0.560   1.00 0.00 ? 69 GLY A CA   2 
ATOM 2221  C C    . GLY A 1 69 ? 3.498   -10.602 1.293   1.00 0.00 ? 69 GLY A C    2 
ATOM 2222  O O    . GLY A 1 69 ? 4.218   -11.431 0.734   1.00 0.00 ? 69 GLY A O    2 
ATOM 2223  H H    . GLY A 1 69 ? 1.221   -8.463  1.199   1.00 0.00 ? 69 GLY A H    2 
ATOM 2224  H HA2  . GLY A 1 69 ? 3.304   -9.442  -0.483  1.00 0.00 ? 69 GLY A HA2  2 
ATOM 2225  H HA3  . GLY A 1 69 ? 3.516   -8.497  0.987   1.00 0.00 ? 69 GLY A HA3  2 
ATOM 2226  N N    . LEU A 1 70 ? 3.082   -10.739 2.551   1.00 0.00 ? 70 LEU A N    2 
ATOM 2227  C CA   . LEU A 1 70 ? 3.448   -11.881 3.351   1.00 0.00 ? 70 LEU A CA   2 
ATOM 2228  C C    . LEU A 1 70 ? 2.901   -13.148 2.726   1.00 0.00 ? 70 LEU A C    2 
ATOM 2229  O O    . LEU A 1 70 ? 3.580   -14.173 2.658   1.00 0.00 ? 70 LEU A O    2 
ATOM 2230  C CB   . LEU A 1 70 ? 2.901   -11.697 4.762   1.00 0.00 ? 70 LEU A CB   2 
ATOM 2231  C CG   . LEU A 1 70 ? 1.380   -11.764 4.916   1.00 0.00 ? 70 LEU A CG   2 
ATOM 2232  C CD1  . LEU A 1 70 ? 0.887   -13.207 4.891   1.00 0.00 ? 70 LEU A CD1  2 
ATOM 2233  C CD2  . LEU A 1 70 ? 0.948   -11.073 6.201   1.00 0.00 ? 70 LEU A CD2  2 
ATOM 2234  H H    . LEU A 1 70 ? 2.504   -10.059 2.949   1.00 0.00 ? 70 LEU A H    2 
ATOM 2235  H HA   . LEU A 1 70 ? 4.525   -11.938 3.390   1.00 0.00 ? 70 LEU A HA   2 
ATOM 2236  H HB2  . LEU A 1 70 ? 3.329   -12.452 5.374   1.00 0.00 ? 70 LEU A HB2  2 
ATOM 2237  H HB3  . LEU A 1 70 ? 3.228   -10.739 5.121   1.00 0.00 ? 70 LEU A HB3  2 
ATOM 2238  H HG   . LEU A 1 70 ? 0.924   -11.243 4.091   1.00 0.00 ? 70 LEU A HG   2 
ATOM 2239  H HD11 . LEU A 1 70 ? 1.722   -13.872 4.732   1.00 0.00 ? 70 LEU A HD11 2 
ATOM 2240  H HD12 . LEU A 1 70 ? 0.413   -13.443 5.832   1.00 0.00 ? 70 LEU A HD12 2 
ATOM 2241  H HD13 . LEU A 1 70 ? 0.172   -13.327 4.089   1.00 0.00 ? 70 LEU A HD13 2 
ATOM 2242  H HD21 . LEU A 1 70 ? 1.472   -11.511 7.039   1.00 0.00 ? 70 LEU A HD21 2 
ATOM 2243  H HD22 . LEU A 1 70 ? 1.182   -10.021 6.140   1.00 0.00 ? 70 LEU A HD22 2 
ATOM 2244  H HD23 . LEU A 1 70 ? -0.116  -11.198 6.339   1.00 0.00 ? 70 LEU A HD23 2 
ATOM 2245  N N    . GLY A 1 71 ? 1.661   -13.061 2.271   1.00 0.00 ? 71 GLY A N    2 
ATOM 2246  C CA   . GLY A 1 71 ? 1.019   -14.200 1.650   1.00 0.00 ? 71 GLY A CA   2 
ATOM 2247  C C    . GLY A 1 71 ? 1.741   -14.663 0.399   1.00 0.00 ? 71 GLY A C    2 
ATOM 2248  O O    . GLY A 1 71 ? 2.070   -15.838 0.269   1.00 0.00 ? 71 GLY A O    2 
ATOM 2249  H H    . GLY A 1 71 ? 1.177   -12.208 2.365   1.00 0.00 ? 71 GLY A H    2 
ATOM 2250  H HA2  . GLY A 1 71 ? 0.991   -15.015 2.359   1.00 0.00 ? 71 GLY A HA2  2 
ATOM 2251  H HA3  . GLY A 1 71 ? 0.006   -13.930 1.388   1.00 0.00 ? 71 GLY A HA3  2 
ATOM 2252  N N    . LEU A 1 72 ? 1.983   -13.735 -0.521  1.00 0.00 ? 72 LEU A N    2 
ATOM 2253  C CA   . LEU A 1 72 ? 2.664   -14.051 -1.772  1.00 0.00 ? 72 LEU A CA   2 
ATOM 2254  C C    . LEU A 1 72 ? 4.088   -14.512 -1.519  1.00 0.00 ? 72 LEU A C    2 
ATOM 2255  O O    . LEU A 1 72 ? 4.631   -15.326 -2.265  1.00 0.00 ? 72 LEU A O    2 
ATOM 2256  C CB   . LEU A 1 72 ? 2.663   -12.835 -2.700  1.00 0.00 ? 72 LEU A CB   2 
ATOM 2257  C CG   . LEU A 1 72 ? 3.361   -11.592 -2.155  1.00 0.00 ? 72 LEU A CG   2 
ATOM 2258  C CD1  . LEU A 1 72 ? 4.875   -11.751 -2.209  1.00 0.00 ? 72 LEU A CD1  2 
ATOM 2259  C CD2  . LEU A 1 72 ? 2.912   -10.353 -2.921  1.00 0.00 ? 72 LEU A CD2  2 
ATOM 2260  H H    . LEU A 1 72 ? 1.699   -12.818 -0.354  1.00 0.00 ? 72 LEU A H    2 
ATOM 2261  H HA   . LEU A 1 72 ? 2.118   -14.848 -2.246  1.00 0.00 ? 72 LEU A HA   2 
ATOM 2262  H HB2  . LEU A 1 72 ? 3.153   -13.116 -3.620  1.00 0.00 ? 72 LEU A HB2  2 
ATOM 2263  H HB3  . LEU A 1 72 ? 1.639   -12.576 -2.915  1.00 0.00 ? 72 LEU A HB3  2 
ATOM 2264  H HG   . LEU A 1 72 ? 3.082   -11.466 -1.123  1.00 0.00 ? 72 LEU A HG   2 
ATOM 2265  H HD11 . LEU A 1 72 ? 5.126   -12.618 -2.802  1.00 0.00 ? 72 LEU A HD11 2 
ATOM 2266  H HD12 . LEU A 1 72 ? 5.315   -10.871 -2.655  1.00 0.00 ? 72 LEU A HD12 2 
ATOM 2267  H HD13 . LEU A 1 72 ? 5.259   -11.877 -1.206  1.00 0.00 ? 72 LEU A HD13 2 
ATOM 2268  H HD21 . LEU A 1 72 ? 2.180   -10.635 -3.665  1.00 0.00 ? 72 LEU A HD21 2 
ATOM 2269  H HD22 . LEU A 1 72 ? 2.471   -9.646  -2.235  1.00 0.00 ? 72 LEU A HD22 2 
ATOM 2270  H HD23 . LEU A 1 72 ? 3.762   -9.899  -3.408  1.00 0.00 ? 72 LEU A HD23 2 
ATOM 2271  N N    . TYR A 1 73 ? 4.685   -13.998 -0.453  1.00 0.00 ? 73 TYR A N    2 
ATOM 2272  C CA   . TYR A 1 73 ? 6.048   -14.358 -0.098  1.00 0.00 ? 73 TYR A CA   2 
ATOM 2273  C C    . TYR A 1 73 ? 6.189   -15.871 -0.015  1.00 0.00 ? 73 TYR A C    2 
ATOM 2274  O O    . TYR A 1 73 ? 7.106   -16.457 -0.587  1.00 0.00 ? 73 TYR A O    2 
ATOM 2275  C CB   . TYR A 1 73 ? 6.429   -13.716 1.239   1.00 0.00 ? 73 TYR A CB   2 
ATOM 2276  C CG   . TYR A 1 73 ? 7.817   -14.075 1.713   1.00 0.00 ? 73 TYR A CG   2 
ATOM 2277  C CD1  . TYR A 1 73 ? 8.947   -13.526 1.117   1.00 0.00 ? 73 TYR A CD1  2 
ATOM 2278  C CD2  . TYR A 1 73 ? 7.996   -14.987 2.745   1.00 0.00 ? 73 TYR A CD2  2 
ATOM 2279  C CE1  . TYR A 1 73 ? 10.217  -13.874 1.541   1.00 0.00 ? 73 TYR A CE1  2 
ATOM 2280  C CE2  . TYR A 1 73 ? 9.262   -15.339 3.177   1.00 0.00 ? 73 TYR A CE2  2 
ATOM 2281  C CZ   . TYR A 1 73 ? 10.369  -14.782 2.571   1.00 0.00 ? 73 TYR A CZ   2 
ATOM 2282  O OH   . TYR A 1 73 ? 11.630  -15.132 2.997   1.00 0.00 ? 73 TYR A OH   2 
ATOM 2283  H H    . TYR A 1 73 ? 4.195   -13.365 0.109   1.00 0.00 ? 73 TYR A H    2 
ATOM 2284  H HA   . TYR A 1 73 ? 6.703   -13.987 -0.876  1.00 0.00 ? 73 TYR A HA   2 
ATOM 2285  H HB2  . TYR A 1 73 ? 6.379   -12.643 1.141   1.00 0.00 ? 73 TYR A HB2  2 
ATOM 2286  H HB3  . TYR A 1 73 ? 5.727   -14.036 1.995   1.00 0.00 ? 73 TYR A HB3  2 
ATOM 2287  H HD1  . TYR A 1 73 ? 8.826   -12.811 0.315   1.00 0.00 ? 73 TYR A HD1  2 
ATOM 2288  H HD2  . TYR A 1 73 ? 7.123   -15.419 3.215   1.00 0.00 ? 73 TYR A HD2  2 
ATOM 2289  H HE1  . TYR A 1 73 ? 11.086  -13.439 1.069   1.00 0.00 ? 73 TYR A HE1  2 
ATOM 2290  H HE2  . TYR A 1 73 ? 9.381   -16.048 3.983   1.00 0.00 ? 73 TYR A HE2  2 
ATOM 2291  H HH   . TYR A 1 73 ? 12.290  -14.706 2.444   1.00 0.00 ? 73 TYR A HH   2 
ATOM 2292  N N    . VAL A 1 74 ? 5.260   -16.497 0.694   1.00 0.00 ? 74 VAL A N    2 
ATOM 2293  C CA   . VAL A 1 74 ? 5.257   -17.943 0.847   1.00 0.00 ? 74 VAL A CA   2 
ATOM 2294  C C    . VAL A 1 74 ? 4.450   -18.594 -0.271  1.00 0.00 ? 74 VAL A C    2 
ATOM 2295  O O    . VAL A 1 74 ? 4.728   -19.721 -0.678  1.00 0.00 ? 74 VAL A O    2 
ATOM 2296  C CB   . VAL A 1 74 ? 4.659   -18.365 2.205   1.00 0.00 ? 74 VAL A CB   2 
ATOM 2297  C CG1  . VAL A 1 74 ? 4.721   -19.877 2.373   1.00 0.00 ? 74 VAL A CG1  2 
ATOM 2298  C CG2  . VAL A 1 74 ? 5.374   -17.661 3.351   1.00 0.00 ? 74 VAL A CG2  2 
ATOM 2299  H H    . VAL A 1 74 ? 4.549   -15.971 1.118   1.00 0.00 ? 74 VAL A H    2 
ATOM 2300  H HA   . VAL A 1 74 ? 6.282   -18.293 0.801   1.00 0.00 ? 74 VAL A HA   2 
ATOM 2301  H HB   . VAL A 1 74 ? 3.621   -18.068 2.223   1.00 0.00 ? 74 VAL A HB   2 
ATOM 2302  H HG11 . VAL A 1 74 ? 4.326   -20.354 1.489   1.00 0.00 ? 74 VAL A HG11 2 
ATOM 2303  H HG12 . VAL A 1 74 ? 5.747   -20.181 2.519   1.00 0.00 ? 74 VAL A HG12 2 
ATOM 2304  H HG13 . VAL A 1 74 ? 4.134   -20.166 3.233   1.00 0.00 ? 74 VAL A HG13 2 
ATOM 2305  H HG21 . VAL A 1 74 ? 6.221   -17.115 2.966   1.00 0.00 ? 74 VAL A HG21 2 
ATOM 2306  H HG22 . VAL A 1 74 ? 4.693   -16.977 3.833   1.00 0.00 ? 74 VAL A HG22 2 
ATOM 2307  H HG23 . VAL A 1 74 ? 5.715   -18.393 4.068   1.00 0.00 ? 74 VAL A HG23 2 
ATOM 2308  N N    . MET A 1 75 ? 3.431   -17.880 -0.748  1.00 0.00 ? 75 MET A N    2 
ATOM 2309  C CA   . MET A 1 75 ? 2.556   -18.395 -1.796  1.00 0.00 ? 75 MET A CA   2 
ATOM 2310  C C    . MET A 1 75 ? 3.164   -18.252 -3.190  1.00 0.00 ? 75 MET A C    2 
ATOM 2311  O O    . MET A 1 75 ? 3.503   -19.239 -3.827  1.00 0.00 ? 75 MET A O    2 
ATOM 2312  C CB   . MET A 1 75 ? 1.199   -17.689 -1.739  1.00 0.00 ? 75 MET A CB   2 
ATOM 2313  C CG   . MET A 1 75 ? 0.256   -18.232 -0.666  1.00 0.00 ? 75 MET A CG   2 
ATOM 2314  S SD   . MET A 1 75 ? 1.035   -18.444 0.950   1.00 0.00 ? 75 MET A SD   2 
ATOM 2315  C CE   . MET A 1 75 ? 1.717   -20.093 0.788   1.00 0.00 ? 75 MET A CE   2 
ATOM 2316  H H    . MET A 1 75 ? 3.252   -16.992 -0.377  1.00 0.00 ? 75 MET A H    2 
ATOM 2317  H HA   . MET A 1 75 ? 2.400   -19.440 -1.595  1.00 0.00 ? 75 MET A HA   2 
ATOM 2318  H HB2  . MET A 1 75 ? 1.362   -16.640 -1.546  1.00 0.00 ? 75 MET A HB2  2 
ATOM 2319  H HB3  . MET A 1 75 ? 0.713   -17.793 -2.697  1.00 0.00 ? 75 MET A HB3  2 
ATOM 2320  H HG2  . MET A 1 75 ? -0.569  -17.548 -0.553  1.00 0.00 ? 75 MET A HG2  2 
ATOM 2321  H HG3  . MET A 1 75 ? -0.121  -19.191 -0.993  1.00 0.00 ? 75 MET A HG3  2 
ATOM 2322  H HE1  . MET A 1 75 ? 0.982   -20.743 0.337   1.00 0.00 ? 75 MET A HE1  2 
ATOM 2323  H HE2  . MET A 1 75 ? 2.597   -20.062 0.167   1.00 0.00 ? 75 MET A HE2  2 
ATOM 2324  H HE3  . MET A 1 75 ? 1.979   -20.471 1.766   1.00 0.00 ? 75 MET A HE3  2 
ATOM 2325  N N    . PHE A 1 76 ? 3.284   -17.029 -3.675  1.00 0.00 ? 76 PHE A N    2 
ATOM 2326  C CA   . PHE A 1 76 ? 3.832   -16.799 -5.012  1.00 0.00 ? 76 PHE A CA   2 
ATOM 2327  C C    . PHE A 1 76 ? 5.252   -17.339 -5.173  1.00 0.00 ? 76 PHE A C    2 
ATOM 2328  O O    . PHE A 1 76 ? 5.697   -17.595 -6.292  1.00 0.00 ? 76 PHE A O    2 
ATOM 2329  C CB   . PHE A 1 76 ? 3.833   -15.303 -5.336  1.00 0.00 ? 76 PHE A CB   2 
ATOM 2330  C CG   . PHE A 1 76 ? 2.488   -14.730 -5.707  1.00 0.00 ? 76 PHE A CG   2 
ATOM 2331  C CD1  . PHE A 1 76 ? 1.323   -15.457 -5.528  1.00 0.00 ? 76 PHE A CD1  2 
ATOM 2332  C CD2  . PHE A 1 76 ? 2.398   -13.458 -6.247  1.00 0.00 ? 76 PHE A CD2  2 
ATOM 2333  C CE1  . PHE A 1 76 ? 0.102   -14.924 -5.879  1.00 0.00 ? 76 PHE A CE1  2 
ATOM 2334  C CE2  . PHE A 1 76 ? 1.178   -12.925 -6.603  1.00 0.00 ? 76 PHE A CE2  2 
ATOM 2335  C CZ   . PHE A 1 76 ? 0.028   -13.658 -6.418  1.00 0.00 ? 76 PHE A CZ   2 
ATOM 2336  H H    . PHE A 1 76 ? 2.981   -16.266 -3.142  1.00 0.00 ? 76 PHE A H    2 
ATOM 2337  H HA   . PHE A 1 76 ? 3.192   -17.312 -5.718  1.00 0.00 ? 76 PHE A HA   2 
ATOM 2338  H HB2  . PHE A 1 76 ? 4.188   -14.762 -4.472  1.00 0.00 ? 76 PHE A HB2  2 
ATOM 2339  H HB3  . PHE A 1 76 ? 4.508   -15.129 -6.158  1.00 0.00 ? 76 PHE A HB3  2 
ATOM 2340  H HD1  . PHE A 1 76 ? 1.377   -16.449 -5.104  1.00 0.00 ? 76 PHE A HD1  2 
ATOM 2341  H HD2  . PHE A 1 76 ? 3.299   -12.881 -6.392  1.00 0.00 ? 76 PHE A HD2  2 
ATOM 2342  H HE1  . PHE A 1 76 ? -0.795  -15.496 -5.729  1.00 0.00 ? 76 PHE A HE1  2 
ATOM 2343  H HE2  . PHE A 1 76 ? 1.123   -11.931 -7.021  1.00 0.00 ? 76 PHE A HE2  2 
ATOM 2344  H HZ   . PHE A 1 76 ? -0.929  -13.243 -6.695  1.00 0.00 ? 76 PHE A HZ   2 
ATOM 2345  N N    . ALA A 1 77 ? 5.968   -17.494 -4.071  1.00 0.00 ? 77 ALA A N    2 
ATOM 2346  C CA   . ALA A 1 77 ? 7.342   -17.975 -4.128  1.00 0.00 ? 77 ALA A CA   2 
ATOM 2347  C C    . ALA A 1 77 ? 7.424   -19.483 -4.307  1.00 0.00 ? 77 ALA A C    2 
ATOM 2348  O O    . ALA A 1 77 ? 8.091   -19.976 -5.217  1.00 0.00 ? 77 ALA A O    2 
ATOM 2349  C CB   . ALA A 1 77 ? 8.102   -17.550 -2.882  1.00 0.00 ? 77 ALA A CB   2 
ATOM 2350  H H    . ALA A 1 77 ? 5.575   -17.263 -3.209  1.00 0.00 ? 77 ALA A H    2 
ATOM 2351  H HA   . ALA A 1 77 ? 7.811   -17.510 -4.970  1.00 0.00 ? 77 ALA A HA   2 
ATOM 2352  H HB1  . ALA A 1 77 ? 7.874   -16.519 -2.657  1.00 0.00 ? 77 ALA A HB1  2 
ATOM 2353  H HB2  . ALA A 1 77 ? 7.811   -18.176 -2.051  1.00 0.00 ? 77 ALA A HB2  2 
ATOM 2354  H HB3  . ALA A 1 77 ? 9.163   -17.654 -3.057  1.00 0.00 ? 77 ALA A HB3  2 
ATOM 2355  N N    . VAL A 1 78 ? 6.768   -20.207 -3.422  1.00 0.00 ? 78 VAL A N    2 
ATOM 2356  C CA   . VAL A 1 78 ? 6.787   -21.661 -3.461  1.00 0.00 ? 78 VAL A CA   2 
ATOM 2357  C C    . VAL A 1 78 ? 5.409   -22.253 -3.738  1.00 0.00 ? 78 VAL A C    2 
ATOM 2358  O O    . VAL A 1 78 ? 5.292   -23.420 -4.113  1.00 0.00 ? 78 VAL A O    2 
ATOM 2359  C CB   . VAL A 1 78 ? 7.330   -22.238 -2.141  1.00 0.00 ? 78 VAL A CB   2 
ATOM 2360  C CG1  . VAL A 1 78 ? 6.400   -21.911 -0.981  1.00 0.00 ? 78 VAL A CG1  2 
ATOM 2361  C CG2  . VAL A 1 78 ? 7.555   -23.739 -2.254  1.00 0.00 ? 78 VAL A CG2  2 
ATOM 2362  H H    . VAL A 1 78 ? 6.278   -19.756 -2.716  1.00 0.00 ? 78 VAL A H    2 
ATOM 2363  H HA   . VAL A 1 78 ? 7.455   -21.954 -4.251  1.00 0.00 ? 78 VAL A HA   2 
ATOM 2364  H HB   . VAL A 1 78 ? 8.278   -21.769 -1.943  1.00 0.00 ? 78 VAL A HB   2 
ATOM 2365  H HG11 . VAL A 1 78 ? 5.376   -21.920 -1.325  1.00 0.00 ? 78 VAL A HG11 2 
ATOM 2366  H HG12 . VAL A 1 78 ? 6.524   -22.650 -0.203  1.00 0.00 ? 78 VAL A HG12 2 
ATOM 2367  H HG13 . VAL A 1 78 ? 6.642   -20.933 -0.591  1.00 0.00 ? 78 VAL A HG13 2 
ATOM 2368  H HG21 . VAL A 1 78 ? 7.139   -24.099 -3.182  1.00 0.00 ? 78 VAL A HG21 2 
ATOM 2369  H HG22 . VAL A 1 78 ? 8.616   -23.945 -2.233  1.00 0.00 ? 78 VAL A HG22 2 
ATOM 2370  H HG23 . VAL A 1 78 ? 7.076   -24.240 -1.426  1.00 0.00 ? 78 VAL A HG23 2 
ATOM 2371  N N    . ALA A 1 79 ? 4.367   -21.455 -3.550  1.00 0.00 ? 79 ALA A N    2 
ATOM 2372  C CA   . ALA A 1 79 ? 3.002   -21.932 -3.783  1.00 0.00 ? 79 ALA A CA   2 
ATOM 2373  C C    . ALA A 1 79 ? 2.399   -21.315 -5.041  1.00 0.00 ? 79 ALA A C    2 
ATOM 2374  O O    . ALA A 1 79 ? 2.884   -21.544 -6.149  1.00 0.00 ? 79 ALA A O    2 
ATOM 2375  C CB   . ALA A 1 79 ? 2.123   -21.642 -2.575  1.00 0.00 ? 79 ALA A CB   2 
ATOM 2376  H H    . ALA A 1 79 ? 4.513   -20.526 -3.248  1.00 0.00 ? 79 ALA A H    2 
ATOM 2377  H HA   . ALA A 1 79 ? 3.042   -23.006 -3.912  1.00 0.00 ? 79 ALA A HA   2 
ATOM 2378  H HB1  . ALA A 1 79 ? 2.745   -21.506 -1.701  1.00 0.00 ? 79 ALA A HB1  2 
ATOM 2379  H HB2  . ALA A 1 79 ? 1.552   -20.742 -2.753  1.00 0.00 ? 79 ALA A HB2  2 
ATOM 2380  H HB3  . ALA A 1 79 ? 1.450   -22.471 -2.413  1.00 0.00 ? 79 ALA A HB3  2 
ATOM 2381  N N    . MET A 1 1  ? -6.142  -29.173 1.572   1.00 0.00 ? 1  MET A N    3 
ATOM 2382  C CA   . MET A 1 1  ? -6.537  -27.734 1.728   1.00 0.00 ? 1  MET A CA   3 
ATOM 2383  C C    . MET A 1 1  ? -5.471  -26.759 1.209   1.00 0.00 ? 1  MET A C    3 
ATOM 2384  O O    . MET A 1 1  ? -5.661  -25.544 1.266   1.00 0.00 ? 1  MET A O    3 
ATOM 2385  C CB   . MET A 1 1  ? -6.823  -27.446 3.209   1.00 0.00 ? 1  MET A CB   3 
ATOM 2386  C CG   . MET A 1 1  ? -8.160  -27.985 3.708   1.00 0.00 ? 1  MET A CG   3 
ATOM 2387  S SD   . MET A 1 1  ? -8.228  -29.787 3.791   1.00 0.00 ? 1  MET A SD   3 
ATOM 2388  C CE   . MET A 1 1  ? -6.969  -30.123 5.022   1.00 0.00 ? 1  MET A CE   3 
ATOM 2389  H H1   . MET A 1 1  ? -5.207  -29.210 1.128   1.00 0.00 ? 1  MET A H1   3 
ATOM 2390  H H2   . MET A 1 1  ? -6.119  -29.605 2.517   1.00 0.00 ? 1  MET A H2   3 
ATOM 2391  H H3   . MET A 1 1  ? -6.856  -29.631 0.969   1.00 0.00 ? 1  MET A H3   3 
ATOM 2392  H HA   . MET A 1 1  ? -7.442  -27.575 1.166   1.00 0.00 ? 1  MET A HA   3 
ATOM 2393  H HB2  . MET A 1 1  ? -6.038  -27.889 3.803   1.00 0.00 ? 1  MET A HB2  3 
ATOM 2394  H HB3  . MET A 1 1  ? -6.813  -26.377 3.362   1.00 0.00 ? 1  MET A HB3  3 
ATOM 2395  H HG2  . MET A 1 1  ? -8.343  -27.591 4.695   1.00 0.00 ? 1  MET A HG2  3 
ATOM 2396  H HG3  . MET A 1 1  ? -8.938  -27.643 3.039   1.00 0.00 ? 1  MET A HG3  3 
ATOM 2397  H HE1  . MET A 1 1  ? -6.256  -29.312 5.041   1.00 0.00 ? 1  MET A HE1  3 
ATOM 2398  H HE2  . MET A 1 1  ? -7.431  -30.217 5.995   1.00 0.00 ? 1  MET A HE2  3 
ATOM 2399  H HE3  . MET A 1 1  ? -6.460  -31.044 4.777   1.00 0.00 ? 1  MET A HE3  3 
ATOM 2400  N N    . GLU A 1 2  ? -4.360  -27.283 0.704   1.00 0.00 ? 2  GLU A N    3 
ATOM 2401  C CA   . GLU A 1 2  ? -3.288  -26.446 0.184   1.00 0.00 ? 2  GLU A CA   3 
ATOM 2402  C C    . GLU A 1 2  ? -3.744  -25.693 -1.061  1.00 0.00 ? 2  GLU A C    3 
ATOM 2403  O O    . GLU A 1 2  ? -3.507  -24.493 -1.191  1.00 0.00 ? 2  GLU A O    3 
ATOM 2404  C CB   . GLU A 1 2  ? -2.062  -27.300 -0.138  1.00 0.00 ? 2  GLU A CB   3 
ATOM 2405  C CG   . GLU A 1 2  ? -1.526  -28.066 1.061   1.00 0.00 ? 2  GLU A CG   3 
ATOM 2406  C CD   . GLU A 1 2  ? -0.319  -28.918 0.719   1.00 0.00 ? 2  GLU A CD   3 
ATOM 2407  O OE1  . GLU A 1 2  ? 0.699   -28.351 0.270   1.00 0.00 ? 2  GLU A OE1  3 
ATOM 2408  O OE2  . GLU A 1 2  ? -0.392  -30.151 0.900   1.00 0.00 ? 2  GLU A OE2  3 
ATOM 2409  H H    . GLU A 1 2  ? -4.257  -28.252 0.680   1.00 0.00 ? 2  GLU A H    3 
ATOM 2410  H HA   . GLU A 1 2  ? -3.027  -25.729 0.947   1.00 0.00 ? 2  GLU A HA   3 
ATOM 2411  H HB2  . GLU A 1 2  ? -2.325  -28.012 -0.906  1.00 0.00 ? 2  GLU A HB2  3 
ATOM 2412  H HB3  . GLU A 1 2  ? -1.277  -26.657 -0.508  1.00 0.00 ? 2  GLU A HB3  3 
ATOM 2413  H HG2  . GLU A 1 2  ? -1.240  -27.358 1.825   1.00 0.00 ? 2  GLU A HG2  3 
ATOM 2414  H HG3  . GLU A 1 2  ? -2.307  -28.708 1.441   1.00 0.00 ? 2  GLU A HG3  3 
ATOM 2415  N N    . ASN A 1 3  ? -4.399  -26.403 -1.973  1.00 0.00 ? 3  ASN A N    3 
ATOM 2416  C CA   . ASN A 1 3  ? -4.883  -25.793 -3.204  1.00 0.00 ? 3  ASN A CA   3 
ATOM 2417  C C    . ASN A 1 3  ? -5.913  -24.710 -2.904  1.00 0.00 ? 3  ASN A C    3 
ATOM 2418  O O    . ASN A 1 3  ? -5.858  -23.615 -3.462  1.00 0.00 ? 3  ASN A O    3 
ATOM 2419  C CB   . ASN A 1 3  ? -5.485  -26.854 -4.131  1.00 0.00 ? 3  ASN A CB   3 
ATOM 2420  C CG   . ASN A 1 3  ? -5.973  -26.267 -5.442  1.00 0.00 ? 3  ASN A CG   3 
ATOM 2421  O OD1  . ASN A 1 3  ? -6.893  -25.449 -5.465  1.00 0.00 ? 3  ASN A OD1  3 
ATOM 2422  N ND2  . ASN A 1 3  ? -5.355  -26.681 -6.543  1.00 0.00 ? 3  ASN A ND2  3 
ATOM 2423  H H    . ASN A 1 3  ? -4.560  -27.356 -1.815  1.00 0.00 ? 3  ASN A H    3 
ATOM 2424  H HA   . ASN A 1 3  ? -4.042  -25.337 -3.697  1.00 0.00 ? 3  ASN A HA   3 
ATOM 2425  H HB2  . ASN A 1 3  ? -4.735  -27.600 -4.349  1.00 0.00 ? 3  ASN A HB2  3 
ATOM 2426  H HB3  . ASN A 1 3  ? -6.323  -27.324 -3.636  1.00 0.00 ? 3  ASN A HB3  3 
ATOM 2427  H HD21 . ASN A 1 3  ? -4.630  -27.334 -6.450  1.00 0.00 ? 3  ASN A HD21 3 
ATOM 2428  H HD22 . ASN A 1 3  ? -5.648  -26.317 -7.403  1.00 0.00 ? 3  ASN A HD22 3 
ATOM 2429  N N    . LEU A 1 4  ? -6.850  -25.026 -2.019  1.00 0.00 ? 4  LEU A N    3 
ATOM 2430  C CA   . LEU A 1 4  ? -7.893  -24.079 -1.640  1.00 0.00 ? 4  LEU A CA   3 
ATOM 2431  C C    . LEU A 1 4  ? -7.297  -22.896 -0.900  1.00 0.00 ? 4  LEU A C    3 
ATOM 2432  O O    . LEU A 1 4  ? -7.632  -21.755 -1.193  1.00 0.00 ? 4  LEU A O    3 
ATOM 2433  C CB   . LEU A 1 4  ? -8.960  -24.762 -0.782  1.00 0.00 ? 4  LEU A CB   3 
ATOM 2434  C CG   . LEU A 1 4  ? -9.720  -25.897 -1.472  1.00 0.00 ? 4  LEU A CG   3 
ATOM 2435  C CD1  . LEU A 1 4  ? -10.719 -26.526 -0.513  1.00 0.00 ? 4  LEU A CD1  3 
ATOM 2436  C CD2  . LEU A 1 4  ? -10.427 -25.389 -2.722  1.00 0.00 ? 4  LEU A CD2  3 
ATOM 2437  H H    . LEU A 1 4  ? -6.838  -25.915 -1.612  1.00 0.00 ? 4  LEU A H    3 
ATOM 2438  H HA   . LEU A 1 4  ? -8.349  -23.708 -2.544  1.00 0.00 ? 4  LEU A HA   3 
ATOM 2439  H HB2  . LEU A 1 4  ? -8.481  -25.161 0.100   1.00 0.00 ? 4  LEU A HB2  3 
ATOM 2440  H HB3  . LEU A 1 4  ? -9.676  -24.014 -0.475  1.00 0.00 ? 4  LEU A HB3  3 
ATOM 2441  H HG   . LEU A 1 4  ? -9.018  -26.662 -1.770  1.00 0.00 ? 4  LEU A HG   3 
ATOM 2442  H HD11 . LEU A 1 4  ? -10.330 -26.481 0.492   1.00 0.00 ? 4  LEU A HD11 3 
ATOM 2443  H HD12 . LEU A 1 4  ? -11.654 -25.987 -0.561  1.00 0.00 ? 4  LEU A HD12 3 
ATOM 2444  H HD13 . LEU A 1 4  ? -10.882 -27.558 -0.790  1.00 0.00 ? 4  LEU A HD13 3 
ATOM 2445  H HD21 . LEU A 1 4  ? -10.188 -24.347 -2.876  1.00 0.00 ? 4  LEU A HD21 3 
ATOM 2446  H HD22 . LEU A 1 4  ? -10.101 -25.961 -3.577  1.00 0.00 ? 4  LEU A HD22 3 
ATOM 2447  H HD23 . LEU A 1 4  ? -11.496 -25.498 -2.603  1.00 0.00 ? 4  LEU A HD23 3 
ATOM 2448  N N    . ASN A 1 5  ? -6.395  -23.157 0.039   1.00 0.00 ? 5  ASN A N    3 
ATOM 2449  C CA   . ASN A 1 5  ? -5.756  -22.073 0.772   1.00 0.00 ? 5  ASN A CA   3 
ATOM 2450  C C    . ASN A 1 5  ? -4.952  -21.226 -0.198  1.00 0.00 ? 5  ASN A C    3 
ATOM 2451  O O    . ASN A 1 5  ? -4.894  -20.003 -0.080  1.00 0.00 ? 5  ASN A O    3 
ATOM 2452  C CB   . ASN A 1 5  ? -4.848  -22.610 1.884   1.00 0.00 ? 5  ASN A CB   3 
ATOM 2453  C CG   . ASN A 1 5  ? -5.592  -23.411 2.946   1.00 0.00 ? 5  ASN A CG   3 
ATOM 2454  O OD1  . ASN A 1 5  ? -4.969  -23.975 3.848   1.00 0.00 ? 5  ASN A OD1  3 
ATOM 2455  N ND2  . ASN A 1 5  ? -6.922  -23.465 2.864   1.00 0.00 ? 5  ASN A ND2  3 
ATOM 2456  H H    . ASN A 1 5  ? -6.143  -24.087 0.227   1.00 0.00 ? 5  ASN A H    3 
ATOM 2457  H HA   . ASN A 1 5  ? -6.532  -21.461 1.204   1.00 0.00 ? 5  ASN A HA   3 
ATOM 2458  H HB2  . ASN A 1 5  ? -4.094  -23.248 1.443   1.00 0.00 ? 5  ASN A HB2  3 
ATOM 2459  H HB3  . ASN A 1 5  ? -4.361  -21.776 2.369   1.00 0.00 ? 5  ASN A HB3  3 
ATOM 2460  H HD21 . ASN A 1 5  ? -7.364  -22.992 2.132   1.00 0.00 ? 5  ASN A HD21 3 
ATOM 2461  H HD22 . ASN A 1 5  ? -7.404  -23.982 3.543   1.00 0.00 ? 5  ASN A HD22 3 
ATOM 2462  N N    . MET A 1 6  ? -4.355  -21.895 -1.176  1.00 0.00 ? 6  MET A N    3 
ATOM 2463  C CA   . MET A 1 6  ? -3.570  -21.225 -2.201  1.00 0.00 ? 6  MET A CA   3 
ATOM 2464  C C    . MET A 1 6  ? -4.472  -20.312 -3.029  1.00 0.00 ? 6  MET A C    3 
ATOM 2465  O O    . MET A 1 6  ? -4.391  -19.077 -2.941  1.00 0.00 ? 6  MET A O    3 
ATOM 2466  C CB   . MET A 1 6  ? -2.891  -22.272 -3.095  1.00 0.00 ? 6  MET A CB   3 
ATOM 2467  C CG   . MET A 1 6  ? -2.034  -21.679 -4.200  1.00 0.00 ? 6  MET A CG   3 
ATOM 2468  S SD   . MET A 1 6  ? -1.245  -22.938 -5.221  1.00 0.00 ? 6  MET A SD   3 
ATOM 2469  C CE   . MET A 1 6  ? -0.156  -23.708 -4.026  1.00 0.00 ? 6  MET A CE   3 
ATOM 2470  H H    . MET A 1 6  ? -4.460  -22.868 -1.221  1.00 0.00 ? 6  MET A H    3 
ATOM 2471  H HA   . MET A 1 6  ? -2.813  -20.630 -1.710  1.00 0.00 ? 6  MET A HA   3 
ATOM 2472  H HB2  . MET A 1 6  ? -2.261  -22.898 -2.481  1.00 0.00 ? 6  MET A HB2  3 
ATOM 2473  H HB3  . MET A 1 6  ? -3.654  -22.886 -3.553  1.00 0.00 ? 6  MET A HB3  3 
ATOM 2474  H HG2  . MET A 1 6  ? -2.657  -21.064 -4.830  1.00 0.00 ? 6  MET A HG2  3 
ATOM 2475  H HG3  . MET A 1 6  ? -1.265  -21.072 -3.747  1.00 0.00 ? 6  MET A HG3  3 
ATOM 2476  H HE1  . MET A 1 6  ? -0.136  -23.116 -3.122  1.00 0.00 ? 6  MET A HE1  3 
ATOM 2477  H HE2  . MET A 1 6  ? -0.516  -24.701 -3.798  1.00 0.00 ? 6  MET A HE2  3 
ATOM 2478  H HE3  . MET A 1 6  ? 0.841   -23.772 -4.435  1.00 0.00 ? 6  MET A HE3  3 
ATOM 2479  N N    . ASP A 1 7  ? -5.347  -20.929 -3.825  1.00 0.00 ? 7  ASP A N    3 
ATOM 2480  C CA   . ASP A 1 7  ? -6.278  -20.185 -4.661  1.00 0.00 ? 7  ASP A CA   3 
ATOM 2481  C C    . ASP A 1 7  ? -7.061  -19.180 -3.825  1.00 0.00 ? 7  ASP A C    3 
ATOM 2482  O O    . ASP A 1 7  ? -7.274  -18.043 -4.246  1.00 0.00 ? 7  ASP A O    3 
ATOM 2483  C CB   . ASP A 1 7  ? -7.220  -21.139 -5.396  1.00 0.00 ? 7  ASP A CB   3 
ATOM 2484  C CG   . ASP A 1 7  ? -8.006  -22.049 -4.470  1.00 0.00 ? 7  ASP A CG   3 
ATOM 2485  O OD1  . ASP A 1 7  ? -8.725  -21.530 -3.591  1.00 0.00 ? 7  ASP A OD1  3 
ATOM 2486  O OD2  . ASP A 1 7  ? -7.920  -23.284 -4.641  1.00 0.00 ? 7  ASP A OD2  3 
ATOM 2487  H H    . ASP A 1 7  ? -5.373  -21.909 -3.840  1.00 0.00 ? 7  ASP A H    3 
ATOM 2488  H HA   . ASP A 1 7  ? -5.702  -19.647 -5.396  1.00 0.00 ? 7  ASP A HA   3 
ATOM 2489  H HB2  . ASP A 1 7  ? -7.919  -20.562 -5.977  1.00 0.00 ? 7  ASP A HB2  3 
ATOM 2490  H HB3  . ASP A 1 7  ? -6.627  -21.754 -6.062  1.00 0.00 ? 7  ASP A HB3  3 
ATOM 2491  N N    . LEU A 1 8  ? -7.469  -19.594 -2.627  1.00 0.00 ? 8  LEU A N    3 
ATOM 2492  C CA   . LEU A 1 8  ? -8.209  -18.708 -1.739  1.00 0.00 ? 8  LEU A CA   3 
ATOM 2493  C C    . LEU A 1 8  ? -7.335  -17.539 -1.289  1.00 0.00 ? 8  LEU A C    3 
ATOM 2494  O O    . LEU A 1 8  ? -7.837  -16.441 -1.049  1.00 0.00 ? 8  LEU A O    3 
ATOM 2495  C CB   . LEU A 1 8  ? -8.729  -19.466 -0.523  1.00 0.00 ? 8  LEU A CB   3 
ATOM 2496  C CG   . LEU A 1 8  ? -9.550  -18.627 0.459   1.00 0.00 ? 8  LEU A CG   3 
ATOM 2497  C CD1  . LEU A 1 8  ? -10.769 -18.030 -0.232  1.00 0.00 ? 8  LEU A CD1  3 
ATOM 2498  C CD2  . LEU A 1 8  ? -9.968  -19.467 1.658   1.00 0.00 ? 8  LEU A CD2  3 
ATOM 2499  H H    . LEU A 1 8  ? -7.261  -20.511 -2.334  1.00 0.00 ? 8  LEU A H    3 
ATOM 2500  H HA   . LEU A 1 8  ? -9.048  -18.320 -2.287  1.00 0.00 ? 8  LEU A HA   3 
ATOM 2501  H HB2  . LEU A 1 8  ? -9.344  -20.284 -0.870  1.00 0.00 ? 8  LEU A HB2  3 
ATOM 2502  H HB3  . LEU A 1 8  ? -7.886  -19.870 0.004   1.00 0.00 ? 8  LEU A HB3  3 
ATOM 2503  H HG   . LEU A 1 8  ? -8.940  -17.811 0.819   1.00 0.00 ? 8  LEU A HG   3 
ATOM 2504  H HD11 . LEU A 1 8  ? -10.760 -18.299 -1.277  1.00 0.00 ? 8  LEU A HD11 3 
ATOM 2505  H HD12 . LEU A 1 8  ? -11.668 -18.412 0.229   1.00 0.00 ? 8  LEU A HD12 3 
ATOM 2506  H HD13 . LEU A 1 8  ? -10.744 -16.955 -0.137  1.00 0.00 ? 8  LEU A HD13 3 
ATOM 2507  H HD21 . LEU A 1 8  ? -9.389  -20.379 1.679   1.00 0.00 ? 8  LEU A HD21 3 
ATOM 2508  H HD22 . LEU A 1 8  ? -9.792  -18.909 2.566   1.00 0.00 ? 8  LEU A HD22 3 
ATOM 2509  H HD23 . LEU A 1 8  ? -11.017 -19.708 1.581   1.00 0.00 ? 8  LEU A HD23 3 
ATOM 2510  N N    . LEU A 1 9  ? -6.025  -17.775 -1.180  1.00 0.00 ? 9  LEU A N    3 
ATOM 2511  C CA   . LEU A 1 9  ? -5.104  -16.722 -0.758  1.00 0.00 ? 9  LEU A CA   3 
ATOM 2512  C C    . LEU A 1 9  ? -4.999  -15.647 -1.835  1.00 0.00 ? 9  LEU A C    3 
ATOM 2513  O O    . LEU A 1 9  ? -5.209  -14.468 -1.551  1.00 0.00 ? 9  LEU A O    3 
ATOM 2514  C CB   . LEU A 1 9  ? -3.715  -17.287 -0.417  1.00 0.00 ? 9  LEU A CB   3 
ATOM 2515  C CG   . LEU A 1 9  ? -2.743  -16.305 0.254   1.00 0.00 ? 9  LEU A CG   3 
ATOM 2516  C CD1  . LEU A 1 9  ? -2.396  -15.155 -0.679  1.00 0.00 ? 9  LEU A CD1  3 
ATOM 2517  C CD2  . LEU A 1 9  ? -3.322  -15.776 1.559   1.00 0.00 ? 9  LEU A CD2  3 
ATOM 2518  H H    . LEU A 1 9  ? -5.675  -18.668 -1.387  1.00 0.00 ? 9  LEU A H    3 
ATOM 2519  H HA   . LEU A 1 9  ? -5.523  -16.270 0.131   1.00 0.00 ? 9  LEU A HA   3 
ATOM 2520  H HB2  . LEU A 1 9  ? -3.846  -18.127 0.247   1.00 0.00 ? 9  LEU A HB2  3 
ATOM 2521  H HB3  . LEU A 1 9  ? -3.257  -17.639 -1.328  1.00 0.00 ? 9  LEU A HB3  3 
ATOM 2522  H HG   . LEU A 1 9  ? -1.826  -16.826 0.486   1.00 0.00 ? 9  LEU A HG   3 
ATOM 2523  H HD11 . LEU A 1 9  ? -2.333  -15.522 -1.690  1.00 0.00 ? 9  LEU A HD11 3 
ATOM 2524  H HD12 . LEU A 1 9  ? -3.162  -14.395 -0.616  1.00 0.00 ? 9  LEU A HD12 3 
ATOM 2525  H HD13 . LEU A 1 9  ? -1.445  -14.733 -0.388  1.00 0.00 ? 9  LEU A HD13 3 
ATOM 2526  H HD21 . LEU A 1 9  ? -4.400  -15.849 1.535   1.00 0.00 ? 9  LEU A HD21 3 
ATOM 2527  H HD22 . LEU A 1 9  ? -2.943  -16.360 2.382   1.00 0.00 ? 9  LEU A HD22 3 
ATOM 2528  H HD23 . LEU A 1 9  ? -3.035  -14.742 1.689   1.00 0.00 ? 9  LEU A HD23 3 
ATOM 2529  N N    . TYR A 1 10 ? -4.700  -16.042 -3.080  1.00 0.00 ? 10 TYR A N    3 
ATOM 2530  C CA   . TYR A 1 10 ? -4.606  -15.046 -4.158  1.00 0.00 ? 10 TYR A CA   3 
ATOM 2531  C C    . TYR A 1 10 ? -5.940  -14.334 -4.291  1.00 0.00 ? 10 TYR A C    3 
ATOM 2532  O O    . TYR A 1 10 ? -6.004  -13.114 -4.440  1.00 0.00 ? 10 TYR A O    3 
ATOM 2533  C CB   . TYR A 1 10 ? -4.242  -15.664 -5.514  1.00 0.00 ? 10 TYR A CB   3 
ATOM 2534  C CG   . TYR A 1 10 ? -2.949  -16.444 -5.514  1.00 0.00 ? 10 TYR A CG   3 
ATOM 2535  C CD1  . TYR A 1 10 ? -2.900  -17.690 -4.931  1.00 0.00 ? 10 TYR A CD1  3 
ATOM 2536  C CD2  . TYR A 1 10 ? -1.784  -15.939 -6.084  1.00 0.00 ? 10 TYR A CD2  3 
ATOM 2537  C CE1  . TYR A 1 10 ? -1.740  -18.425 -4.909  1.00 0.00 ? 10 TYR A CE1  3 
ATOM 2538  C CE2  . TYR A 1 10 ? -0.612  -16.670 -6.068  1.00 0.00 ? 10 TYR A CE2  3 
ATOM 2539  C CZ   . TYR A 1 10 ? -0.595  -17.914 -5.477  1.00 0.00 ? 10 TYR A CZ   3 
ATOM 2540  O OH   . TYR A 1 10 ? 0.571   -18.650 -5.454  1.00 0.00 ? 10 TYR A OH   3 
ATOM 2541  H H    . TYR A 1 10 ? -4.558  -16.998 -3.269  1.00 0.00 ? 10 TYR A H    3 
ATOM 2542  H HA   . TYR A 1 10 ? -3.844  -14.325 -3.878  1.00 0.00 ? 10 TYR A HA   3 
ATOM 2543  H HB2  . TYR A 1 10 ? -5.031  -16.333 -5.818  1.00 0.00 ? 10 TYR A HB2  3 
ATOM 2544  H HB3  . TYR A 1 10 ? -4.155  -14.872 -6.243  1.00 0.00 ? 10 TYR A HB3  3 
ATOM 2545  H HD1  . TYR A 1 10 ? -3.794  -18.085 -4.488  1.00 0.00 ? 10 TYR A HD1  3 
ATOM 2546  H HD2  . TYR A 1 10 ? -1.798  -14.963 -6.543  1.00 0.00 ? 10 TYR A HD2  3 
ATOM 2547  H HE1  . TYR A 1 10 ? -1.737  -19.398 -4.450  1.00 0.00 ? 10 TYR A HE1  3 
ATOM 2548  H HE2  . TYR A 1 10 ? 0.284   -16.265 -6.513  1.00 0.00 ? 10 TYR A HE2  3 
ATOM 2549  H HH   . TYR A 1 10 ? 1.127   -18.396 -6.194  1.00 0.00 ? 10 TYR A HH   3 
ATOM 2550  N N    . MET A 1 11 ? -7.008  -15.118 -4.219  1.00 0.00 ? 11 MET A N    3 
ATOM 2551  C CA   . MET A 1 11 ? -8.355  -14.589 -4.312  1.00 0.00 ? 11 MET A CA   3 
ATOM 2552  C C    . MET A 1 11 ? -8.610  -13.658 -3.141  1.00 0.00 ? 11 MET A C    3 
ATOM 2553  O O    . MET A 1 11 ? -9.246  -12.611 -3.279  1.00 0.00 ? 11 MET A O    3 
ATOM 2554  C CB   . MET A 1 11 ? -9.359  -15.740 -4.305  1.00 0.00 ? 11 MET A CB   3 
ATOM 2555  C CG   . MET A 1 11 ? -10.776 -15.325 -4.678  1.00 0.00 ? 11 MET A CG   3 
ATOM 2556  S SD   . MET A 1 11 ? -11.929 -16.713 -4.655  1.00 0.00 ? 11 MET A SD   3 
ATOM 2557  C CE   . MET A 1 11 ? -13.474 -15.889 -5.038  1.00 0.00 ? 11 MET A CE   3 
ATOM 2558  H H    . MET A 1 11 ? -6.883  -16.082 -4.087  1.00 0.00 ? 11 MET A H    3 
ATOM 2559  H HA   . MET A 1 11 ? -8.442  -14.037 -5.237  1.00 0.00 ? 11 MET A HA   3 
ATOM 2560  H HB2  . MET A 1 11 ? -9.020  -16.494 -5.003  1.00 0.00 ? 11 MET A HB2  3 
ATOM 2561  H HB3  . MET A 1 11 ? -9.384  -16.169 -3.314  1.00 0.00 ? 11 MET A HB3  3 
ATOM 2562  H HG2  . MET A 1 11 ? -11.117 -14.581 -3.974  1.00 0.00 ? 11 MET A HG2  3 
ATOM 2563  H HG3  . MET A 1 11 ? -10.764 -14.902 -5.672  1.00 0.00 ? 11 MET A HG3  3 
ATOM 2564  H HE1  . MET A 1 11 ? -13.290 -15.079 -5.728  1.00 0.00 ? 11 MET A HE1  3 
ATOM 2565  H HE2  . MET A 1 11 ? -14.156 -16.596 -5.486  1.00 0.00 ? 11 MET A HE2  3 
ATOM 2566  H HE3  . MET A 1 11 ? -13.908 -15.498 -4.129  1.00 0.00 ? 11 MET A HE3  3 
ATOM 2567  N N    . ALA A 1 12 ? -8.076  -14.041 -1.986  1.00 0.00 ? 12 ALA A N    3 
ATOM 2568  C CA   . ALA A 1 12 ? -8.207  -13.240 -0.784  1.00 0.00 ? 12 ALA A CA   3 
ATOM 2569  C C    . ALA A 1 12 ? -7.540  -11.897 -0.997  1.00 0.00 ? 12 ALA A C    3 
ATOM 2570  O O    . ALA A 1 12 ? -8.032  -10.876 -0.549  1.00 0.00 ? 12 ALA A O    3 
ATOM 2571  C CB   . ALA A 1 12 ? -7.590  -13.961 0.407   1.00 0.00 ? 12 ALA A CB   3 
ATOM 2572  H H    . ALA A 1 12 ? -7.565  -14.877 -1.952  1.00 0.00 ? 12 ALA A H    3 
ATOM 2573  H HA   . ALA A 1 12 ? -9.259  -13.084 -0.587  1.00 0.00 ? 12 ALA A HA   3 
ATOM 2574  H HB1  . ALA A 1 12 ? -6.881  -14.696 0.054   1.00 0.00 ? 12 ALA A HB1  3 
ATOM 2575  H HB2  . ALA A 1 12 ? -7.084  -13.246 1.038   1.00 0.00 ? 12 ALA A HB2  3 
ATOM 2576  H HB3  . ALA A 1 12 ? -8.368  -14.454 0.972   1.00 0.00 ? 12 ALA A HB3  3 
ATOM 2577  N N    . ALA A 1 13 ? -6.422  -11.904 -1.709  1.00 0.00 ? 13 ALA A N    3 
ATOM 2578  C CA   . ALA A 1 13 ? -5.706  -10.673 -2.000  1.00 0.00 ? 13 ALA A CA   3 
ATOM 2579  C C    . ALA A 1 13 ? -6.599  -9.721  -2.786  1.00 0.00 ? 13 ALA A C    3 
ATOM 2580  O O    . ALA A 1 13 ? -6.696  -8.542  -2.470  1.00 0.00 ? 13 ALA A O    3 
ATOM 2581  C CB   . ALA A 1 13 ? -4.432  -10.976 -2.778  1.00 0.00 ? 13 ALA A CB   3 
ATOM 2582  H H    . ALA A 1 13 ? -6.080  -12.750 -2.058  1.00 0.00 ? 13 ALA A H    3 
ATOM 2583  H HA   . ALA A 1 13 ? -5.433  -10.210 -1.061  1.00 0.00 ? 13 ALA A HA   3 
ATOM 2584  H HB1  . ALA A 1 13 ? -4.667  -11.608 -3.622  1.00 0.00 ? 13 ALA A HB1  3 
ATOM 2585  H HB2  . ALA A 1 13 ? -3.999  -10.052 -3.131  1.00 0.00 ? 13 ALA A HB2  3 
ATOM 2586  H HB3  . ALA A 1 13 ? -3.728  -11.480 -2.134  1.00 0.00 ? 13 ALA A HB3  3 
ATOM 2587  N N    . ALA A 1 14 ? -7.266  -10.246 -3.804  1.00 0.00 ? 14 ALA A N    3 
ATOM 2588  C CA   . ALA A 1 14 ? -8.160  -9.436  -4.620  1.00 0.00 ? 14 ALA A CA   3 
ATOM 2589  C C    . ALA A 1 14 ? -9.285  -8.851  -3.773  1.00 0.00 ? 14 ALA A C    3 
ATOM 2590  O O    . ALA A 1 14 ? -9.544  -7.649  -3.811  1.00 0.00 ? 14 ALA A O    3 
ATOM 2591  C CB   . ALA A 1 14 ? -8.731  -10.264 -5.760  1.00 0.00 ? 14 ALA A CB   3 
ATOM 2592  H H    . ALA A 1 14 ? -7.161  -11.200 -4.007  1.00 0.00 ? 14 ALA A H    3 
ATOM 2593  H HA   . ALA A 1 14 ? -7.583  -8.626  -5.045  1.00 0.00 ? 14 ALA A HA   3 
ATOM 2594  H HB1  . ALA A 1 14 ? -8.062  -11.082 -5.981  1.00 0.00 ? 14 ALA A HB1  3 
ATOM 2595  H HB2  . ALA A 1 14 ? -9.696  -10.654 -5.473  1.00 0.00 ? 14 ALA A HB2  3 
ATOM 2596  H HB3  . ALA A 1 14 ? -8.841  -9.641  -6.636  1.00 0.00 ? 14 ALA A HB3  3 
ATOM 2597  N N    . VAL A 1 15 ? -9.948  -9.711  -3.006  1.00 0.00 ? 15 VAL A N    3 
ATOM 2598  C CA   . VAL A 1 15 ? -11.049 -9.287  -2.147  1.00 0.00 ? 15 VAL A CA   3 
ATOM 2599  C C    . VAL A 1 15 ? -10.565 -8.343  -1.050  1.00 0.00 ? 15 VAL A C    3 
ATOM 2600  O O    . VAL A 1 15 ? -11.117 -7.267  -0.861  1.00 0.00 ? 15 VAL A O    3 
ATOM 2601  C CB   . VAL A 1 15 ? -11.741 -10.498 -1.498  1.00 0.00 ? 15 VAL A CB   3 
ATOM 2602  C CG1  . VAL A 1 15 ? -12.968 -10.061 -0.708  1.00 0.00 ? 15 VAL A CG1  3 
ATOM 2603  C CG2  . VAL A 1 15 ? -12.109 -11.525 -2.557  1.00 0.00 ? 15 VAL A CG2  3 
ATOM 2604  H H    . VAL A 1 15 ? -9.691  -10.659 -3.019  1.00 0.00 ? 15 VAL A H    3 
ATOM 2605  H HA   . VAL A 1 15 ? -11.775 -8.772  -2.763  1.00 0.00 ? 15 VAL A HA   3 
ATOM 2606  H HB   . VAL A 1 15 ? -11.044 -10.957 -0.811  1.00 0.00 ? 15 VAL A HB   3 
ATOM 2607  H HG11 . VAL A 1 15 ? -12.863 -9.025  -0.422  1.00 0.00 ? 15 VAL A HG11 3 
ATOM 2608  H HG12 . VAL A 1 15 ? -13.849 -10.177 -1.322  1.00 0.00 ? 15 VAL A HG12 3 
ATOM 2609  H HG13 . VAL A 1 15 ? -13.062 -10.672 0.177   1.00 0.00 ? 15 VAL A HG13 3 
ATOM 2610  H HG21 . VAL A 1 15 ? -12.161 -11.044 -3.522  1.00 0.00 ? 15 VAL A HG21 3 
ATOM 2611  H HG22 . VAL A 1 15 ? -11.355 -12.299 -2.583  1.00 0.00 ? 15 VAL A HG22 3 
ATOM 2612  H HG23 . VAL A 1 15 ? -13.067 -11.961 -2.319  1.00 0.00 ? 15 VAL A HG23 3 
ATOM 2613  N N    . MET A 1 16 ? -9.532  -8.761  -0.329  1.00 0.00 ? 16 MET A N    3 
ATOM 2614  C CA   . MET A 1 16 ? -8.967  -7.964  0.758   1.00 0.00 ? 16 MET A CA   3 
ATOM 2615  C C    . MET A 1 16 ? -8.413  -6.644  0.236   1.00 0.00 ? 16 MET A C    3 
ATOM 2616  O O    . MET A 1 16 ? -8.741  -5.576  0.747   1.00 0.00 ? 16 MET A O    3 
ATOM 2617  C CB   . MET A 1 16 ? -7.869  -8.764  1.473   1.00 0.00 ? 16 MET A CB   3 
ATOM 2618  C CG   . MET A 1 16 ? -8.079  -8.922  2.965   1.00 0.00 ? 16 MET A CG   3 
ATOM 2619  S SD   . MET A 1 16 ? -7.597  -7.472  3.925   1.00 0.00 ? 16 MET A SD   3 
ATOM 2620  C CE   . MET A 1 16 ? -8.909  -6.327  3.518   1.00 0.00 ? 16 MET A CE   3 
ATOM 2621  H H    . MET A 1 16 ? -9.145  -9.631  -0.527  1.00 0.00 ? 16 MET A H    3 
ATOM 2622  H HA   . MET A 1 16 ? -9.755  -7.752  1.452   1.00 0.00 ? 16 MET A HA   3 
ATOM 2623  H HB2  . MET A 1 16 ? -7.821  -9.749  1.043   1.00 0.00 ? 16 MET A HB2  3 
ATOM 2624  H HB3  . MET A 1 16 ? -6.927  -8.275  1.321   1.00 0.00 ? 16 MET A HB3  3 
ATOM 2625  H HG2  . MET A 1 16 ? -9.119  -9.107  3.134   1.00 0.00 ? 16 MET A HG2  3 
ATOM 2626  H HG3  . MET A 1 16 ? -7.506  -9.770  3.305   1.00 0.00 ? 16 MET A HG3  3 
ATOM 2627  H HE1  . MET A 1 16 ? -9.753  -6.871  3.122   1.00 0.00 ? 16 MET A HE1  3 
ATOM 2628  H HE2  . MET A 1 16 ? -9.210  -5.795  4.408   1.00 0.00 ? 16 MET A HE2  3 
ATOM 2629  H HE3  . MET A 1 16 ? -8.555  -5.624  2.783   1.00 0.00 ? 16 MET A HE3  3 
ATOM 2630  N N    . MET A 1 17 ? -7.576  -6.725  -0.783  1.00 0.00 ? 17 MET A N    3 
ATOM 2631  C CA   . MET A 1 17 ? -6.981  -5.531  -1.375  1.00 0.00 ? 17 MET A CA   3 
ATOM 2632  C C    . MET A 1 17 ? -8.065  -4.633  -1.965  1.00 0.00 ? 17 MET A C    3 
ATOM 2633  O O    . MET A 1 17 ? -8.030  -3.410  -1.809  1.00 0.00 ? 17 MET A O    3 
ATOM 2634  C CB   . MET A 1 17 ? -5.963  -5.906  -2.461  1.00 0.00 ? 17 MET A CB   3 
ATOM 2635  C CG   . MET A 1 17 ? -4.768  -6.700  -1.944  1.00 0.00 ? 17 MET A CG   3 
ATOM 2636  S SD   . MET A 1 17 ? -3.511  -6.968  -3.209  1.00 0.00 ? 17 MET A SD   3 
ATOM 2637  C CE   . MET A 1 17 ? -2.962  -5.289  -3.503  1.00 0.00 ? 17 MET A CE   3 
ATOM 2638  H H    . MET A 1 17 ? -7.357  -7.604  -1.145  1.00 0.00 ? 17 MET A H    3 
ATOM 2639  H HA   . MET A 1 17 ? -6.473  -4.992  -0.589  1.00 0.00 ? 17 MET A HA   3 
ATOM 2640  H HB2  . MET A 1 17 ? -6.460  -6.498  -3.215  1.00 0.00 ? 17 MET A HB2  3 
ATOM 2641  H HB3  . MET A 1 17 ? -5.593  -4.999  -2.918  1.00 0.00 ? 17 MET A HB3  3 
ATOM 2642  H HG2  . MET A 1 17 ? -4.321  -6.159  -1.129  1.00 0.00 ? 17 MET A HG2  3 
ATOM 2643  H HG3  . MET A 1 17 ? -5.109  -7.658  -1.587  1.00 0.00 ? 17 MET A HG3  3 
ATOM 2644  H HE1  . MET A 1 17 ? -3.801  -4.687  -3.815  1.00 0.00 ? 17 MET A HE1  3 
ATOM 2645  H HE2  . MET A 1 17 ? -2.545  -4.883  -2.593  1.00 0.00 ? 17 MET A HE2  3 
ATOM 2646  H HE3  . MET A 1 17 ? -2.208  -5.287  -4.276  1.00 0.00 ? 17 MET A HE3  3 
ATOM 2647  N N    . GLY A 1 18 ? -9.036  -5.251  -2.633  1.00 0.00 ? 18 GLY A N    3 
ATOM 2648  C CA   . GLY A 1 18 ? -10.124 -4.499  -3.236  1.00 0.00 ? 18 GLY A CA   3 
ATOM 2649  C C    . GLY A 1 18 ? -11.041 -3.876  -2.205  1.00 0.00 ? 18 GLY A C    3 
ATOM 2650  O O    . GLY A 1 18 ? -11.287 -2.675  -2.234  1.00 0.00 ? 18 GLY A O    3 
ATOM 2651  H H    . GLY A 1 18 ? -9.018  -6.227  -2.715  1.00 0.00 ? 18 GLY A H    3 
ATOM 2652  H HA2  . GLY A 1 18 ? -9.707  -3.715  -3.854  1.00 0.00 ? 18 GLY A HA2  3 
ATOM 2653  H HA3  . GLY A 1 18 ? -10.703 -5.163  -3.861  1.00 0.00 ? 18 GLY A HA3  3 
ATOM 2654  N N    . LEU A 1 19 ? -11.552 -4.697  -1.293  1.00 0.00 ? 19 LEU A N    3 
ATOM 2655  C CA   . LEU A 1 19 ? -12.450 -4.221  -0.247  1.00 0.00 ? 19 LEU A CA   3 
ATOM 2656  C C    . LEU A 1 19 ? -11.763 -3.139  0.572   1.00 0.00 ? 19 LEU A C    3 
ATOM 2657  O O    . LEU A 1 19 ? -12.340 -2.082  0.850   1.00 0.00 ? 19 LEU A O    3 
ATOM 2658  C CB   . LEU A 1 19 ? -12.884 -5.387  0.653   1.00 0.00 ? 19 LEU A CB   3 
ATOM 2659  C CG   . LEU A 1 19 ? -11.801 -5.948  1.583   1.00 0.00 ? 19 LEU A CG   3 
ATOM 2660  C CD1  . LEU A 1 19 ? -11.643 -5.071  2.820   1.00 0.00 ? 19 LEU A CD1  3 
ATOM 2661  C CD2  . LEU A 1 19 ? -12.125 -7.382  1.981   1.00 0.00 ? 19 LEU A CD2  3 
ATOM 2662  H H    . LEU A 1 19 ? -11.318 -5.642  -1.325  1.00 0.00 ? 19 LEU A H    3 
ATOM 2663  H HA   . LEU A 1 19 ? -13.323 -3.800  -0.724  1.00 0.00 ? 19 LEU A HA   3 
ATOM 2664  H HB2  . LEU A 1 19 ? -13.711 -5.053  1.262   1.00 0.00 ? 19 LEU A HB2  3 
ATOM 2665  H HB3  . LEU A 1 19 ? -13.228 -6.191  0.019   1.00 0.00 ? 19 LEU A HB3  3 
ATOM 2666  H HG   . LEU A 1 19 ? -10.856 -5.952  1.059   1.00 0.00 ? 19 LEU A HG   3 
ATOM 2667  H HD11 . LEU A 1 19 ? -12.299 -4.216  2.742   1.00 0.00 ? 19 LEU A HD11 3 
ATOM 2668  H HD12 . LEU A 1 19 ? -11.898 -5.640  3.702   1.00 0.00 ? 19 LEU A HD12 3 
ATOM 2669  H HD13 . LEU A 1 19 ? -10.620 -4.732  2.892   1.00 0.00 ? 19 LEU A HD13 3 
ATOM 2670  H HD21 . LEU A 1 19 ? -13.180 -7.468  2.194   1.00 0.00 ? 19 LEU A HD21 3 
ATOM 2671  H HD22 . LEU A 1 19 ? -11.864 -8.048  1.171   1.00 0.00 ? 19 LEU A HD22 3 
ATOM 2672  H HD23 . LEU A 1 19 ? -11.557 -7.648  2.861   1.00 0.00 ? 19 LEU A HD23 3 
ATOM 2673  N N    . ALA A 1 20 ? -10.512 -3.401  0.934   1.00 0.00 ? 20 ALA A N    3 
ATOM 2674  C CA   . ALA A 1 20 ? -9.730  -2.446  1.694   1.00 0.00 ? 20 ALA A CA   3 
ATOM 2675  C C    . ALA A 1 20 ? -9.468  -1.219  0.842   1.00 0.00 ? 20 ALA A C    3 
ATOM 2676  O O    . ALA A 1 20 ? -9.393  -0.099  1.346   1.00 0.00 ? 20 ALA A O    3 
ATOM 2677  C CB   . ALA A 1 20 ? -8.420  -3.073  2.154   1.00 0.00 ? 20 ALA A CB   3 
ATOM 2678  H H    . ALA A 1 20 ? -10.104 -4.249  0.666   1.00 0.00 ? 20 ALA A H    3 
ATOM 2679  H HA   . ALA A 1 20 ? -10.299 -2.160  2.567   1.00 0.00 ? 20 ALA A HA   3 
ATOM 2680  H HB1  . ALA A 1 20 ? -7.984  -3.633  1.341   1.00 0.00 ? 20 ALA A HB1  3 
ATOM 2681  H HB2  . ALA A 1 20 ? -7.738  -2.295  2.462   1.00 0.00 ? 20 ALA A HB2  3 
ATOM 2682  H HB3  . ALA A 1 20 ? -8.611  -3.734  2.986   1.00 0.00 ? 20 ALA A HB3  3 
ATOM 2683  N N    . ALA A 1 21 ? -9.350  -1.444  -0.466  1.00 0.00 ? 21 ALA A N    3 
ATOM 2684  C CA   . ALA A 1 21 ? -9.115  -0.363  -1.409  1.00 0.00 ? 21 ALA A CA   3 
ATOM 2685  C C    . ALA A 1 21 ? -10.339 0.527   -1.513  1.00 0.00 ? 21 ALA A C    3 
ATOM 2686  O O    . ALA A 1 21 ? -10.229 1.749   -1.550  1.00 0.00 ? 21 ALA A O    3 
ATOM 2687  C CB   . ALA A 1 21 ? -8.733  -0.920  -2.773  1.00 0.00 ? 21 ALA A CB   3 
ATOM 2688  H H    . ALA A 1 21 ? -9.433  -2.363  -0.803  1.00 0.00 ? 21 ALA A H    3 
ATOM 2689  H HA   . ALA A 1 21 ? -8.297  0.225   -1.041  1.00 0.00 ? 21 ALA A HA   3 
ATOM 2690  H HB1  . ALA A 1 21 ? -9.383  -1.746  -3.019  1.00 0.00 ? 21 ALA A HB1  3 
ATOM 2691  H HB2  . ALA A 1 21 ? -8.835  -0.147  -3.520  1.00 0.00 ? 21 ALA A HB2  3 
ATOM 2692  H HB3  . ALA A 1 21 ? -7.708  -1.263  -2.746  1.00 0.00 ? 21 ALA A HB3  3 
ATOM 2693  N N    . ILE A 1 22 ? -11.507 -0.099  -1.534  1.00 0.00 ? 22 ILE A N    3 
ATOM 2694  C CA   . ILE A 1 22 ? -12.764 0.633   -1.610  1.00 0.00 ? 22 ILE A CA   3 
ATOM 2695  C C    . ILE A 1 22 ? -12.921 1.515   -0.381  1.00 0.00 ? 22 ILE A C    3 
ATOM 2696  O O    . ILE A 1 22 ? -13.045 2.733   -0.493  1.00 0.00 ? 22 ILE A O    3 
ATOM 2697  C CB   . ILE A 1 22 ? -13.977 -0.314  -1.717  1.00 0.00 ? 22 ILE A CB   3 
ATOM 2698  C CG1  . ILE A 1 22 ? -13.880 -1.164  -2.982  1.00 0.00 ? 22 ILE A CG1  3 
ATOM 2699  C CG2  . ILE A 1 22 ? -15.281 0.474   -1.711  1.00 0.00 ? 22 ILE A CG2  3 
ATOM 2700  C CD1  . ILE A 1 22 ? -14.941 -2.241  -3.067  1.00 0.00 ? 22 ILE A CD1  3 
ATOM 2701  H H    . ILE A 1 22 ? -11.518 -1.074  -1.480  1.00 0.00 ? 22 ILE A H    3 
ATOM 2702  H HA   . ILE A 1 22 ? -12.737 1.257   -2.489  1.00 0.00 ? 22 ILE A HA   3 
ATOM 2703  H HB   . ILE A 1 22 ? -13.974 -0.960  -0.857  1.00 0.00 ? 22 ILE A HB   3 
ATOM 2704  H HG12 . ILE A 1 22 ? -13.987 -0.526  -3.847  1.00 0.00 ? 22 ILE A HG12 3 
ATOM 2705  H HG13 . ILE A 1 22 ? -12.916 -1.643  -3.012  1.00 0.00 ? 22 ILE A HG13 3 
ATOM 2706  H HG21 . ILE A 1 22 ? -15.357 1.035   -0.792  1.00 0.00 ? 22 ILE A HG21 3 
ATOM 2707  H HG22 . ILE A 1 22 ? -15.295 1.153   -2.551  1.00 0.00 ? 22 ILE A HG22 3 
ATOM 2708  H HG23 . ILE A 1 22 ? -16.113 -0.210  -1.787  1.00 0.00 ? 22 ILE A HG23 3 
ATOM 2709  H HD11 . ILE A 1 22 ? -15.009 -2.754  -2.120  1.00 0.00 ? 22 ILE A HD11 3 
ATOM 2710  H HD12 . ILE A 1 22 ? -15.895 -1.790  -3.301  1.00 0.00 ? 22 ILE A HD12 3 
ATOM 2711  H HD13 . ILE A 1 22 ? -14.677 -2.947  -3.841  1.00 0.00 ? 22 ILE A HD13 3 
ATOM 2712  N N    . GLY A 1 23 ? -12.890 0.894   0.795   1.00 0.00 ? 23 GLY A N    3 
ATOM 2713  C CA   . GLY A 1 23 ? -13.013 1.651   2.026   1.00 0.00 ? 23 GLY A CA   3 
ATOM 2714  C C    . GLY A 1 23 ? -11.888 2.654   2.174   1.00 0.00 ? 23 GLY A C    3 
ATOM 2715  O O    . GLY A 1 23 ? -12.121 3.832   2.468   1.00 0.00 ? 23 GLY A O    3 
ATOM 2716  H H    . GLY A 1 23 ? -12.771 -0.083  0.827   1.00 0.00 ? 23 GLY A H    3 
ATOM 2717  H HA2  . GLY A 1 23 ? -13.957 2.178   2.022   1.00 0.00 ? 23 GLY A HA2  3 
ATOM 2718  H HA3  . GLY A 1 23 ? -12.992 0.972   2.864   1.00 0.00 ? 23 GLY A HA3  3 
ATOM 2719  N N    . ALA A 1 24 ? -10.661 2.187   1.950   1.00 0.00 ? 24 ALA A N    3 
ATOM 2720  C CA   . ALA A 1 24 ? -9.493  3.049   2.041   1.00 0.00 ? 24 ALA A CA   3 
ATOM 2721  C C    . ALA A 1 24 ? -9.644  4.240   1.106   1.00 0.00 ? 24 ALA A C    3 
ATOM 2722  O O    . ALA A 1 24 ? -9.340  5.371   1.478   1.00 0.00 ? 24 ALA A O    3 
ATOM 2723  C CB   . ALA A 1 24 ? -8.225  2.271   1.715   1.00 0.00 ? 24 ALA A CB   3 
ATOM 2724  H H    . ALA A 1 24 ? -10.542 1.244   1.706   1.00 0.00 ? 24 ALA A H    3 
ATOM 2725  H HA   . ALA A 1 24 ? -9.419  3.407   3.058   1.00 0.00 ? 24 ALA A HA   3 
ATOM 2726  H HB1  . ALA A 1 24 ? -8.339  1.784   0.757   1.00 0.00 ? 24 ALA A HB1  3 
ATOM 2727  H HB2  . ALA A 1 24 ? -7.386  2.950   1.674   1.00 0.00 ? 24 ALA A HB2  3 
ATOM 2728  H HB3  . ALA A 1 24 ? -8.052  1.528   2.478   1.00 0.00 ? 24 ALA A HB3  3 
ATOM 2729  N N    . ALA A 1 25 ? -10.130 3.979   -0.107  1.00 0.00 ? 25 ALA A N    3 
ATOM 2730  C CA   . ALA A 1 25 ? -10.338 5.038   -1.087  1.00 0.00 ? 25 ALA A CA   3 
ATOM 2731  C C    . ALA A 1 25 ? -11.349 6.046   -0.564  1.00 0.00 ? 25 ALA A C    3 
ATOM 2732  O O    . ALA A 1 25 ? -11.050 7.228   -0.438  1.00 0.00 ? 25 ALA A O    3 
ATOM 2733  C CB   . ALA A 1 25 ? -10.809 4.460   -2.415  1.00 0.00 ? 25 ALA A CB   3 
ATOM 2734  H H    . ALA A 1 25 ? -10.363 3.054   -0.341  1.00 0.00 ? 25 ALA A H    3 
ATOM 2735  H HA   . ALA A 1 25 ? -9.393  5.537   -1.249  1.00 0.00 ? 25 ALA A HA   3 
ATOM 2736  H HB1  . ALA A 1 25 ? -11.063 3.420   -2.287  1.00 0.00 ? 25 ALA A HB1  3 
ATOM 2737  H HB2  . ALA A 1 25 ? -11.681 5.001   -2.755  1.00 0.00 ? 25 ALA A HB2  3 
ATOM 2738  H HB3  . ALA A 1 25 ? -10.021 4.551   -3.147  1.00 0.00 ? 25 ALA A HB3  3 
ATOM 2739  N N    . ILE A 1 26 ? -12.546 5.567   -0.250  1.00 0.00 ? 26 ILE A N    3 
ATOM 2740  C CA   . ILE A 1 26 ? -13.598 6.428   0.268   1.00 0.00 ? 26 ILE A CA   3 
ATOM 2741  C C    . ILE A 1 26 ? -13.064 7.383   1.335   1.00 0.00 ? 26 ILE A C    3 
ATOM 2742  O O    . ILE A 1 26 ? -13.190 8.598   1.204   1.00 0.00 ? 26 ILE A O    3 
ATOM 2743  C CB   . ILE A 1 26 ? -14.757 5.607   0.847   1.00 0.00 ? 26 ILE A CB   3 
ATOM 2744  C CG1  . ILE A 1 26 ? -15.393 4.772   -0.258  1.00 0.00 ? 26 ILE A CG1  3 
ATOM 2745  C CG2  . ILE A 1 26 ? -15.796 6.511   1.494   1.00 0.00 ? 26 ILE A CG2  3 
ATOM 2746  C CD1  . ILE A 1 26 ? -15.814 5.578   -1.468  1.00 0.00 ? 26 ILE A CD1  3 
ATOM 2747  H H    . ILE A 1 26 ? -12.723 4.610   -0.366  1.00 0.00 ? 26 ILE A H    3 
ATOM 2748  H HA   . ILE A 1 26 ? -13.990 7.000   -0.555  1.00 0.00 ? 26 ILE A HA   3 
ATOM 2749  H HB   . ILE A 1 26 ? -14.362 4.951   1.602   1.00 0.00 ? 26 ILE A HB   3 
ATOM 2750  H HG12 . ILE A 1 26 ? -14.693 4.023   -0.586  1.00 0.00 ? 26 ILE A HG12 3 
ATOM 2751  H HG13 . ILE A 1 26 ? -16.266 4.295   0.134   1.00 0.00 ? 26 ILE A HG13 3 
ATOM 2752  H HG21 . ILE A 1 26 ? -15.877 7.429   0.929   1.00 0.00 ? 26 ILE A HG21 3 
ATOM 2753  H HG22 . ILE A 1 26 ? -16.753 6.010   1.504   1.00 0.00 ? 26 ILE A HG22 3 
ATOM 2754  H HG23 . ILE A 1 26 ? -15.497 6.736   2.507   1.00 0.00 ? 26 ILE A HG23 3 
ATOM 2755  H HD11 . ILE A 1 26 ? -16.037 6.590   -1.166  1.00 0.00 ? 26 ILE A HD11 3 
ATOM 2756  H HD12 . ILE A 1 26 ? -15.011 5.587   -2.191  1.00 0.00 ? 26 ILE A HD12 3 
ATOM 2757  H HD13 . ILE A 1 26 ? -16.692 5.130   -1.910  1.00 0.00 ? 26 ILE A HD13 3 
ATOM 2758  N N    . GLY A 1 27 ? -12.462 6.830   2.386   1.00 0.00 ? 27 GLY A N    3 
ATOM 2759  C CA   . GLY A 1 27 ? -11.925 7.666   3.448   1.00 0.00 ? 27 GLY A CA   3 
ATOM 2760  C C    . GLY A 1 27 ? -10.728 8.483   3.003   1.00 0.00 ? 27 GLY A C    3 
ATOM 2761  O O    . GLY A 1 27 ? -10.582 9.639   3.398   1.00 0.00 ? 27 GLY A O    3 
ATOM 2762  H H    . GLY A 1 27 ? -12.383 5.853   2.442   1.00 0.00 ? 27 GLY A H    3 
ATOM 2763  H HA2  . GLY A 1 27 ? -12.701 8.342   3.783   1.00 0.00 ? 27 GLY A HA2  3 
ATOM 2764  H HA3  . GLY A 1 27 ? -11.635 7.045   4.277   1.00 0.00 ? 27 GLY A HA3  3 
ATOM 2765  N N    . ILE A 1 28 ? -9.862  7.894   2.175   1.00 0.00 ? 28 ILE A N    3 
ATOM 2766  C CA   . ILE A 1 28 ? -8.689  8.614   1.692   1.00 0.00 ? 28 ILE A CA   3 
ATOM 2767  C C    . ILE A 1 28 ? -9.150  9.888   1.018   1.00 0.00 ? 28 ILE A C    3 
ATOM 2768  O O    . ILE A 1 28 ? -8.622  10.969  1.255   1.00 0.00 ? 28 ILE A O    3 
ATOM 2769  C CB   . ILE A 1 28 ? -7.841  7.769   0.714   1.00 0.00 ? 28 ILE A CB   3 
ATOM 2770  C CG1  . ILE A 1 28 ? -6.390  8.249   0.729   1.00 0.00 ? 28 ILE A CG1  3 
ATOM 2771  C CG2  . ILE A 1 28 ? -8.397  7.812   -0.701  1.00 0.00 ? 28 ILE A CG2  3 
ATOM 2772  C CD1  . ILE A 1 28 ? -6.223  9.689   0.299   1.00 0.00 ? 28 ILE A CD1  3 
ATOM 2773  H H    . ILE A 1 28 ? -10.021 6.973   1.882   1.00 0.00 ? 28 ILE A H    3 
ATOM 2774  H HA   . ILE A 1 28 ? -8.079  8.870   2.546   1.00 0.00 ? 28 ILE A HA   3 
ATOM 2775  H HB   . ILE A 1 28 ? -7.878  6.753   1.045   1.00 0.00 ? 28 ILE A HB   3 
ATOM 2776  H HG12 . ILE A 1 28 ? -6.002  8.158   1.731   1.00 0.00 ? 28 ILE A HG12 3 
ATOM 2777  H HG13 . ILE A 1 28 ? -5.805  7.631   0.064   1.00 0.00 ? 28 ILE A HG13 3 
ATOM 2778  H HG21 . ILE A 1 28 ? -9.447  7.587   -0.678  1.00 0.00 ? 28 ILE A HG21 3 
ATOM 2779  H HG22 . ILE A 1 28 ? -8.247  8.796   -1.119  1.00 0.00 ? 28 ILE A HG22 3 
ATOM 2780  H HG23 . ILE A 1 28 ? -7.886  7.081   -1.309  1.00 0.00 ? 28 ILE A HG23 3 
ATOM 2781  H HD11 . ILE A 1 28 ? -6.982  9.938   -0.427  1.00 0.00 ? 28 ILE A HD11 3 
ATOM 2782  H HD12 . ILE A 1 28 ? -6.322  10.335  1.159   1.00 0.00 ? 28 ILE A HD12 3 
ATOM 2783  H HD13 . ILE A 1 28 ? -5.245  9.822   -0.140  1.00 0.00 ? 28 ILE A HD13 3 
ATOM 2784  N N    . GLY A 1 29 ? -10.187 9.739   0.220   1.00 0.00 ? 29 GLY A N    3 
ATOM 2785  C CA   . GLY A 1 29 ? -10.773 10.876  -0.449  1.00 0.00 ? 29 GLY A CA   3 
ATOM 2786  C C    . GLY A 1 29 ? -11.425 11.805  0.554   1.00 0.00 ? 29 GLY A C    3 
ATOM 2787  O O    . GLY A 1 29 ? -11.380 13.023  0.411   1.00 0.00 ? 29 GLY A O    3 
ATOM 2788  H H    . GLY A 1 29 ? -10.578 8.845   0.116   1.00 0.00 ? 29 GLY A H    3 
ATOM 2789  H HA2  . GLY A 1 29 ? -10.001 11.412  -0.983  1.00 0.00 ? 29 GLY A HA2  3 
ATOM 2790  H HA3  . GLY A 1 29 ? -11.520 10.534  -1.151  1.00 0.00 ? 29 GLY A HA3  3 
ATOM 2791  N N    . ILE A 1 30 ? -12.025 11.217  1.588   1.00 0.00 ? 30 ILE A N    3 
ATOM 2792  C CA   . ILE A 1 30 ? -12.676 11.993  2.636   1.00 0.00 ? 30 ILE A CA   3 
ATOM 2793  C C    . ILE A 1 30 ? -11.678 12.926  3.320   1.00 0.00 ? 30 ILE A C    3 
ATOM 2794  O O    . ILE A 1 30 ? -11.756 14.143  3.165   1.00 0.00 ? 30 ILE A O    3 
ATOM 2795  C CB   . ILE A 1 30 ? -13.338 11.071  3.688   1.00 0.00 ? 30 ILE A CB   3 
ATOM 2796  C CG1  . ILE A 1 30 ? -14.454 10.262  3.035   1.00 0.00 ? 30 ILE A CG1  3 
ATOM 2797  C CG2  . ILE A 1 30 ? -13.881 11.875  4.861   1.00 0.00 ? 30 ILE A CG2  3 
ATOM 2798  C CD1  . ILE A 1 30 ? -15.583 11.108  2.486   1.00 0.00 ? 30 ILE A CD1  3 
ATOM 2799  H H    . ILE A 1 30 ? -12.021 10.235  1.650   1.00 0.00 ? 30 ILE A H    3 
ATOM 2800  H HA   . ILE A 1 30 ? -13.452 12.589  2.173   1.00 0.00 ? 30 ILE A HA   3 
ATOM 2801  H HB   . ILE A 1 30 ? -12.587 10.385  4.066   1.00 0.00 ? 30 ILE A HB   3 
ATOM 2802  H HG12 . ILE A 1 30 ? -14.040 9.702   2.218   1.00 0.00 ? 30 ILE A HG12 3 
ATOM 2803  H HG13 . ILE A 1 30 ? -14.871 9.581   3.762   1.00 0.00 ? 30 ILE A HG13 3 
ATOM 2804  H HG21 . ILE A 1 30 ? -13.078 12.432  5.321   1.00 0.00 ? 30 ILE A HG21 3 
ATOM 2805  H HG22 . ILE A 1 30 ? -14.639 12.560  4.510   1.00 0.00 ? 30 ILE A HG22 3 
ATOM 2806  H HG23 . ILE A 1 30 ? -14.313 11.202  5.589   1.00 0.00 ? 30 ILE A HG23 3 
ATOM 2807  H HD11 . ILE A 1 30 ? -15.311 12.151  2.535   1.00 0.00 ? 30 ILE A HD11 3 
ATOM 2808  H HD12 . ILE A 1 30 ? -15.768 10.832  1.457   1.00 0.00 ? 30 ILE A HD12 3 
ATOM 2809  H HD13 . ILE A 1 30 ? -16.477 10.939  3.069   1.00 0.00 ? 30 ILE A HD13 3 
ATOM 2810  N N    . LEU A 1 31 ? -10.743 12.344  4.072   1.00 0.00 ? 31 LEU A N    3 
ATOM 2811  C CA   . LEU A 1 31 ? -9.727  13.120  4.785   1.00 0.00 ? 31 LEU A CA   3 
ATOM 2812  C C    . LEU A 1 31 ? -8.675  13.644  3.818   1.00 0.00 ? 31 LEU A C    3 
ATOM 2813  O O    . LEU A 1 31 ? -8.288  14.811  3.878   1.00 0.00 ? 31 LEU A O    3 
ATOM 2814  C CB   . LEU A 1 31 ? -9.063  12.251  5.864   1.00 0.00 ? 31 LEU A CB   3 
ATOM 2815  C CG   . LEU A 1 31 ? -8.035  12.955  6.765   1.00 0.00 ? 31 LEU A CG   3 
ATOM 2816  C CD1  . LEU A 1 31 ? -6.780  13.326  5.990   1.00 0.00 ? 31 LEU A CD1  3 
ATOM 2817  C CD2  . LEU A 1 31 ? -8.646  14.187  7.411   1.00 0.00 ? 31 LEU A CD2  3 
ATOM 2818  H H    . LEU A 1 31 ? -10.739 11.368  4.151   1.00 0.00 ? 31 LEU A H    3 
ATOM 2819  H HA   . LEU A 1 31 ? -10.219 13.962  5.254   1.00 0.00 ? 31 LEU A HA   3 
ATOM 2820  H HB2  . LEU A 1 31 ? -9.841  11.848  6.495   1.00 0.00 ? 31 LEU A HB2  3 
ATOM 2821  H HB3  . LEU A 1 31 ? -8.565  11.428  5.370   1.00 0.00 ? 31 LEU A HB3  3 
ATOM 2822  H HG   . LEU A 1 31 ? -7.745  12.277  7.555   1.00 0.00 ? 31 LEU A HG   3 
ATOM 2823  H HD11 . LEU A 1 31 ? -6.777  12.812  5.037   1.00 0.00 ? 31 LEU A HD11 3 
ATOM 2824  H HD12 . LEU A 1 31 ? -6.758  14.397  5.824   1.00 0.00 ? 31 LEU A HD12 3 
ATOM 2825  H HD13 . LEU A 1 31 ? -5.908  13.032  6.560   1.00 0.00 ? 31 LEU A HD13 3 
ATOM 2826  H HD21 . LEU A 1 31 ? -9.215  14.734  6.676   1.00 0.00 ? 31 LEU A HD21 3 
ATOM 2827  H HD22 . LEU A 1 31 ? -9.295  13.885  8.220   1.00 0.00 ? 31 LEU A HD22 3 
ATOM 2828  H HD23 . LEU A 1 31 ? -7.859  14.817  7.798   1.00 0.00 ? 31 LEU A HD23 3 
ATOM 2829  N N    . GLY A 1 32 ? -8.212  12.774  2.928   1.00 0.00 ? 32 GLY A N    3 
ATOM 2830  C CA   . GLY A 1 32 ? -7.214  13.180  1.960   1.00 0.00 ? 32 GLY A CA   3 
ATOM 2831  C C    . GLY A 1 32 ? -7.751  14.261  1.055   1.00 0.00 ? 32 GLY A C    3 
ATOM 2832  O O    . GLY A 1 32 ? -7.080  15.254  0.793   1.00 0.00 ? 32 GLY A O    3 
ATOM 2833  H H    . GLY A 1 32 ? -8.554  11.857  2.924   1.00 0.00 ? 32 GLY A H    3 
ATOM 2834  H HA2  . GLY A 1 32 ? -6.345  13.554  2.486   1.00 0.00 ? 32 GLY A HA2  3 
ATOM 2835  H HA3  . GLY A 1 32 ? -6.926  12.329  1.362   1.00 0.00 ? 32 GLY A HA3  3 
ATOM 2836  N N    . GLY A 1 33 ? -8.983  14.076  0.595   1.00 0.00 ? 33 GLY A N    3 
ATOM 2837  C CA   . GLY A 1 33 ? -9.602  15.061  -0.267  1.00 0.00 ? 33 GLY A CA   3 
ATOM 2838  C C    . GLY A 1 33 ? -9.730  16.405  0.415   1.00 0.00 ? 33 GLY A C    3 
ATOM 2839  O O    . GLY A 1 33 ? -9.345  17.426  -0.144  1.00 0.00 ? 33 GLY A O    3 
ATOM 2840  H H    . GLY A 1 33 ? -9.478  13.273  0.855   1.00 0.00 ? 33 GLY A H    3 
ATOM 2841  H HA2  . GLY A 1 33 ? -9.001  15.176  -1.158  1.00 0.00 ? 33 GLY A HA2  3 
ATOM 2842  H HA3  . GLY A 1 33 ? -10.586 14.720  -0.552  1.00 0.00 ? 33 GLY A HA3  3 
ATOM 2843  N N    . LYS A 1 34 ? -10.261 16.403  1.637   1.00 0.00 ? 34 LYS A N    3 
ATOM 2844  C CA   . LYS A 1 34 ? -10.423 17.639  2.392   1.00 0.00 ? 34 LYS A CA   3 
ATOM 2845  C C    . LYS A 1 34 ? -9.068  18.293  2.648   1.00 0.00 ? 34 LYS A C    3 
ATOM 2846  O O    . LYS A 1 34 ? -8.852  19.466  2.316   1.00 0.00 ? 34 LYS A O    3 
ATOM 2847  C CB   . LYS A 1 34 ? -11.153 17.377  3.718   1.00 0.00 ? 34 LYS A CB   3 
ATOM 2848  C CG   . LYS A 1 34 ? -10.469 16.377  4.633   1.00 0.00 ? 34 LYS A CG   3 
ATOM 2849  C CD   . LYS A 1 34 ? -11.303 16.077  5.876   1.00 0.00 ? 34 LYS A CD   3 
ATOM 2850  C CE   . LYS A 1 34 ? -11.381 17.269  6.821   1.00 0.00 ? 34 LYS A CE   3 
ATOM 2851  N NZ   . LYS A 1 34 ? -12.369 18.290  6.376   1.00 0.00 ? 34 LYS A NZ   3 
ATOM 2852  H H    . LYS A 1 34 ? -10.541 15.554  2.039   1.00 0.00 ? 34 LYS A H    3 
ATOM 2853  H HA   . LYS A 1 34 ? -11.019 18.309  1.791   1.00 0.00 ? 34 LYS A HA   3 
ATOM 2854  H HB2  . LYS A 1 34 ? -11.230 18.304  4.251   1.00 0.00 ? 34 LYS A HB2  3 
ATOM 2855  H HB3  . LYS A 1 34 ? -12.146 17.012  3.504   1.00 0.00 ? 34 LYS A HB3  3 
ATOM 2856  H HG2  . LYS A 1 34 ? -10.310 15.462  4.089   1.00 0.00 ? 34 LYS A HG2  3 
ATOM 2857  H HG3  . LYS A 1 34 ? -9.518  16.783  4.943   1.00 0.00 ? 34 LYS A HG3  3 
ATOM 2858  H HD2  . LYS A 1 34 ? -12.303 15.813  5.568   1.00 0.00 ? 34 LYS A HD2  3 
ATOM 2859  H HD3  . LYS A 1 34 ? -10.862 15.245  6.401   1.00 0.00 ? 34 LYS A HD3  3 
ATOM 2860  H HE2  . LYS A 1 34 ? -11.667 16.912  7.799   1.00 0.00 ? 34 LYS A HE2  3 
ATOM 2861  H HE3  . LYS A 1 34 ? -10.404 17.727  6.881   1.00 0.00 ? 34 LYS A HE3  3 
ATOM 2862  H HZ1  . LYS A 1 34 ? -13.277 17.834  6.146   1.00 0.00 ? 34 LYS A HZ1  3 
ATOM 2863  H HZ2  . LYS A 1 34 ? -12.527 18.985  7.132   1.00 0.00 ? 34 LYS A HZ2  3 
ATOM 2864  H HZ3  . LYS A 1 34 ? -12.021 18.788  5.535   1.00 0.00 ? 34 LYS A HZ3  3 
ATOM 2865  N N    . PHE A 1 35 ? -8.149  17.526  3.228   1.00 0.00 ? 35 PHE A N    3 
ATOM 2866  C CA   . PHE A 1 35 ? -6.812  18.024  3.520   1.00 0.00 ? 35 PHE A CA   3 
ATOM 2867  C C    . PHE A 1 35 ? -6.160  18.516  2.237   1.00 0.00 ? 35 PHE A C    3 
ATOM 2868  O O    . PHE A 1 35 ? -5.864  19.702  2.089   1.00 0.00 ? 35 PHE A O    3 
ATOM 2869  C CB   . PHE A 1 35 ? -5.965  16.920  4.157   1.00 0.00 ? 35 PHE A CB   3 
ATOM 2870  C CG   . PHE A 1 35 ? -4.674  17.421  4.740   1.00 0.00 ? 35 PHE A CG   3 
ATOM 2871  C CD1  . PHE A 1 35 ? -3.688  17.951  3.926   1.00 0.00 ? 35 PHE A CD1  3 
ATOM 2872  C CD2  . PHE A 1 35 ? -4.455  17.377  6.108   1.00 0.00 ? 35 PHE A CD2  3 
ATOM 2873  C CE1  . PHE A 1 35 ? -2.508  18.428  4.463   1.00 0.00 ? 35 PHE A CE1  3 
ATOM 2874  C CE2  . PHE A 1 35 ? -3.277  17.850  6.651   1.00 0.00 ? 35 PHE A CE2  3 
ATOM 2875  C CZ   . PHE A 1 35 ? -2.303  18.378  5.827   1.00 0.00 ? 35 PHE A CZ   3 
ATOM 2876  H H    . PHE A 1 35 ? -8.373  16.601  3.457   1.00 0.00 ? 35 PHE A H    3 
ATOM 2877  H HA   . PHE A 1 35 ? -6.903  18.852  4.213   1.00 0.00 ? 35 PHE A HA   3 
ATOM 2878  H HB2  . PHE A 1 35 ? -6.530  16.455  4.947   1.00 0.00 ? 35 PHE A HB2  3 
ATOM 2879  H HB3  . PHE A 1 35 ? -5.727  16.179  3.407   1.00 0.00 ? 35 PHE A HB3  3 
ATOM 2880  H HD1  . PHE A 1 35 ? -3.847  17.989  2.859   1.00 0.00 ? 35 PHE A HD1  3 
ATOM 2881  H HD2  . PHE A 1 35 ? -5.217  16.964  6.753   1.00 0.00 ? 35 PHE A HD2  3 
ATOM 2882  H HE1  . PHE A 1 35 ? -1.747  18.839  3.816   1.00 0.00 ? 35 PHE A HE1  3 
ATOM 2883  H HE2  . PHE A 1 35 ? -3.118  17.808  7.719   1.00 0.00 ? 35 PHE A HE2  3 
ATOM 2884  H HZ   . PHE A 1 35 ? -1.381  18.750  6.248   1.00 0.00 ? 35 PHE A HZ   3 
ATOM 2885  N N    . LEU A 1 36 ? -5.967  17.595  1.300   1.00 0.00 ? 36 LEU A N    3 
ATOM 2886  C CA   . LEU A 1 36 ? -5.376  17.921  0.015   1.00 0.00 ? 36 LEU A CA   3 
ATOM 2887  C C    . LEU A 1 36 ? -6.123  19.071  -0.652  1.00 0.00 ? 36 LEU A C    3 
ATOM 2888  O O    . LEU A 1 36 ? -5.517  19.899  -1.322  1.00 0.00 ? 36 LEU A O    3 
ATOM 2889  C CB   . LEU A 1 36 ? -5.382  16.693  -0.896  1.00 0.00 ? 36 LEU A CB   3 
ATOM 2890  C CG   . LEU A 1 36 ? -4.273  15.669  -0.629  1.00 0.00 ? 36 LEU A CG   3 
ATOM 2891  C CD1  . LEU A 1 36 ? -4.201  15.318  0.850   1.00 0.00 ? 36 LEU A CD1  3 
ATOM 2892  C CD2  . LEU A 1 36 ? -4.499  14.416  -1.464  1.00 0.00 ? 36 LEU A CD2  3 
ATOM 2893  H H    . LEU A 1 36 ? -6.245  16.674  1.474   1.00 0.00 ? 36 LEU A H    3 
ATOM 2894  H HA   . LEU A 1 36 ? -4.353  18.224  0.189   1.00 0.00 ? 36 LEU A HA   3 
ATOM 2895  H HB2  . LEU A 1 36 ? -6.334  16.198  -0.791  1.00 0.00 ? 36 LEU A HB2  3 
ATOM 2896  H HB3  . LEU A 1 36 ? -5.290  17.030  -1.910  1.00 0.00 ? 36 LEU A HB3  3 
ATOM 2897  H HG   . LEU A 1 36 ? -3.324  16.094  -0.916  1.00 0.00 ? 36 LEU A HG   3 
ATOM 2898  H HD11 . LEU A 1 36 ? -4.142  16.224  1.433   1.00 0.00 ? 36 LEU A HD11 3 
ATOM 2899  H HD12 . LEU A 1 36 ? -5.081  14.763  1.134   1.00 0.00 ? 36 LEU A HD12 3 
ATOM 2900  H HD13 . LEU A 1 36 ? -3.324  14.716  1.033   1.00 0.00 ? 36 LEU A HD13 3 
ATOM 2901  H HD21 . LEU A 1 36 ? -5.503  14.051  -1.301  1.00 0.00 ? 36 LEU A HD21 3 
ATOM 2902  H HD22 . LEU A 1 36 ? -4.368  14.651  -2.511  1.00 0.00 ? 36 LEU A HD22 3 
ATOM 2903  H HD23 . LEU A 1 36 ? -3.789  13.656  -1.174  1.00 0.00 ? 36 LEU A HD23 3 
ATOM 2904  N N    . GLU A 1 37 ? -7.440  19.131  -0.455  1.00 0.00 ? 37 GLU A N    3 
ATOM 2905  C CA   . GLU A 1 37 ? -8.239  20.205  -1.042  1.00 0.00 ? 37 GLU A CA   3 
ATOM 2906  C C    . GLU A 1 37 ? -7.700  21.556  -0.596  1.00 0.00 ? 37 GLU A C    3 
ATOM 2907  O O    . GLU A 1 37 ? -7.250  22.364  -1.415  1.00 0.00 ? 37 GLU A O    3 
ATOM 2908  C CB   . GLU A 1 37 ? -9.716  20.071  -0.652  1.00 0.00 ? 37 GLU A CB   3 
ATOM 2909  C CG   . GLU A 1 37 ? -10.590 21.202  -1.169  1.00 0.00 ? 37 GLU A CG   3 
ATOM 2910  C CD   . GLU A 1 37 ? -10.616 21.270  -2.683  1.00 0.00 ? 37 GLU A CD   3 
ATOM 2911  O OE1  . GLU A 1 37 ? -11.059 20.287  -3.314  1.00 0.00 ? 37 GLU A OE1  3 
ATOM 2912  O OE2  . GLU A 1 37 ? -10.191 22.305  -3.238  1.00 0.00 ? 37 GLU A OE2  3 
ATOM 2913  H H    . GLU A 1 37 ? -7.878  18.451  0.098   1.00 0.00 ? 37 GLU A H    3 
ATOM 2914  H HA   . GLU A 1 37 ? -8.151  20.134  -2.117  1.00 0.00 ? 37 GLU A HA   3 
ATOM 2915  H HB2  . GLU A 1 37 ? -10.100 19.146  -1.053  1.00 0.00 ? 37 GLU A HB2  3 
ATOM 2916  H HB3  . GLU A 1 37 ? -9.796  20.049  0.425   1.00 0.00 ? 37 GLU A HB3  3 
ATOM 2917  H HG2  . GLU A 1 37 ? -11.599 21.054  -0.814  1.00 0.00 ? 37 GLU A HG2  3 
ATOM 2918  H HG3  . GLU A 1 37 ? -10.209 22.138  -0.787  1.00 0.00 ? 37 GLU A HG3  3 
ATOM 2919  N N    . GLY A 1 38 ? -7.722  21.793  0.713   1.00 0.00 ? 38 GLY A N    3 
ATOM 2920  C CA   . GLY A 1 38 ? -7.205  23.046  1.231   1.00 0.00 ? 38 GLY A CA   3 
ATOM 2921  C C    . GLY A 1 38 ? -5.786  23.287  0.764   1.00 0.00 ? 38 GLY A C    3 
ATOM 2922  O O    . GLY A 1 38 ? -5.456  24.368  0.279   1.00 0.00 ? 38 GLY A O    3 
ATOM 2923  H H    . GLY A 1 38 ? -8.072  21.108  1.327   1.00 0.00 ? 38 GLY A H    3 
ATOM 2924  H HA2  . GLY A 1 38 ? -7.834  23.856  0.884   1.00 0.00 ? 38 GLY A HA2  3 
ATOM 2925  H HA3  . GLY A 1 38 ? -7.220  23.022  2.311   1.00 0.00 ? 38 GLY A HA3  3 
ATOM 2926  N N    . ALA A 1 39 ? -4.953  22.258  0.888   1.00 0.00 ? 39 ALA A N    3 
ATOM 2927  C CA   . ALA A 1 39 ? -3.567  22.346  0.456   1.00 0.00 ? 39 ALA A CA   3 
ATOM 2928  C C    . ALA A 1 39 ? -3.504  22.598  -1.042  1.00 0.00 ? 39 ALA A C    3 
ATOM 2929  O O    . ALA A 1 39 ? -2.629  23.305  -1.530  1.00 0.00 ? 39 ALA A O    3 
ATOM 2930  C CB   . ALA A 1 39 ? -2.815  21.072  0.816   1.00 0.00 ? 39 ALA A CB   3 
ATOM 2931  H H    . ALA A 1 39 ? -5.284  21.416  1.263   1.00 0.00 ? 39 ALA A H    3 
ATOM 2932  H HA   . ALA A 1 39 ? -3.105  23.175  0.975   1.00 0.00 ? 39 ALA A HA   3 
ATOM 2933  H HB1  . ALA A 1 39 ? -3.074  20.774  1.822   1.00 0.00 ? 39 ALA A HB1  3 
ATOM 2934  H HB2  . ALA A 1 39 ? -3.085  20.286  0.126   1.00 0.00 ? 39 ALA A HB2  3 
ATOM 2935  H HB3  . ALA A 1 39 ? -1.752  21.253  0.757   1.00 0.00 ? 39 ALA A HB3  3 
ATOM 2936  N N    . ALA A 1 40 ? -4.443  22.021  -1.773  1.00 0.00 ? 40 ALA A N    3 
ATOM 2937  C CA   . ALA A 1 40 ? -4.490  22.203  -3.212  1.00 0.00 ? 40 ALA A CA   3 
ATOM 2938  C C    . ALA A 1 40 ? -4.922  23.623  -3.544  1.00 0.00 ? 40 ALA A C    3 
ATOM 2939  O O    . ALA A 1 40 ? -4.622  24.141  -4.619  1.00 0.00 ? 40 ALA A O    3 
ATOM 2940  C CB   . ALA A 1 40 ? -5.421  21.191  -3.853  1.00 0.00 ? 40 ALA A CB   3 
ATOM 2941  H H    . ALA A 1 40 ? -5.122  21.470  -1.336  1.00 0.00 ? 40 ALA A H    3 
ATOM 2942  H HA   . ALA A 1 40 ? -3.493  22.040  -3.598  1.00 0.00 ? 40 ALA A HA   3 
ATOM 2943  H HB1  . ALA A 1 40 ? -5.266  20.226  -3.400  1.00 0.00 ? 40 ALA A HB1  3 
ATOM 2944  H HB2  . ALA A 1 40 ? -6.445  21.498  -3.703  1.00 0.00 ? 40 ALA A HB2  3 
ATOM 2945  H HB3  . ALA A 1 40 ? -5.213  21.129  -4.909  1.00 0.00 ? 40 ALA A HB3  3 
ATOM 2946  N N    . ARG A 1 41 ? -5.609  24.260  -2.597  1.00 0.00 ? 41 ARG A N    3 
ATOM 2947  C CA   . ARG A 1 41 ? -6.057  25.634  -2.779  1.00 0.00 ? 41 ARG A CA   3 
ATOM 2948  C C    . ARG A 1 41 ? -5.011  26.597  -2.219  1.00 0.00 ? 41 ARG A C    3 
ATOM 2949  O O    . ARG A 1 41 ? -4.972  27.774  -2.583  1.00 0.00 ? 41 ARG A O    3 
ATOM 2950  C CB   . ARG A 1 41 ? -7.417  25.840  -2.096  1.00 0.00 ? 41 ARG A CB   3 
ATOM 2951  C CG   . ARG A 1 41 ? -8.010  27.231  -2.276  1.00 0.00 ? 41 ARG A CG   3 
ATOM 2952  C CD   . ARG A 1 41 ? -7.463  28.222  -1.256  1.00 0.00 ? 41 ARG A CD   3 
ATOM 2953  N NE   . ARG A 1 41 ? -7.599  27.727  0.111   1.00 0.00 ? 41 ARG A NE   3 
ATOM 2954  C CZ   . ARG A 1 41 ? -8.766  27.474  0.696   1.00 0.00 ? 41 ARG A CZ   3 
ATOM 2955  N NH1  . ARG A 1 41 ? -9.905  27.742  0.070   1.00 0.00 ? 41 ARG A NH1  3 
ATOM 2956  N NH2  . ARG A 1 41 ? -8.796  26.969  1.920   1.00 0.00 ? 41 ARG A NH2  3 
ATOM 2957  H H    . ARG A 1 41 ? -5.807  23.800  -1.752  1.00 0.00 ? 41 ARG A H    3 
ATOM 2958  H HA   . ARG A 1 41 ? -6.161  25.809  -3.835  1.00 0.00 ? 41 ARG A HA   3 
ATOM 2959  H HB2  . ARG A 1 41 ? -8.118  25.124  -2.499  1.00 0.00 ? 41 ARG A HB2  3 
ATOM 2960  H HB3  . ARG A 1 41 ? -7.306  25.657  -1.036  1.00 0.00 ? 41 ARG A HB3  3 
ATOM 2961  H HG2  . ARG A 1 41 ? -7.772  27.585  -3.268  1.00 0.00 ? 41 ARG A HG2  3 
ATOM 2962  H HG3  . ARG A 1 41 ? -9.082  27.167  -2.165  1.00 0.00 ? 41 ARG A HG3  3 
ATOM 2963  H HD2  . ARG A 1 41 ? -6.421  28.400  -1.461  1.00 0.00 ? 41 ARG A HD2  3 
ATOM 2964  H HD3  . ARG A 1 41 ? -8.008  29.149  -1.348  1.00 0.00 ? 41 ARG A HD3  3 
ATOM 2965  H HE   . ARG A 1 41 ? -6.774  27.556  0.613   1.00 0.00 ? 41 ARG A HE   3 
ATOM 2966  H HH11 . ARG A 1 41 ? -9.892  28.141  -0.846  1.00 0.00 ? 41 ARG A HH11 3 
ATOM 2967  H HH12 . ARG A 1 41 ? -10.779 27.542  0.516   1.00 0.00 ? 41 ARG A HH12 3 
ATOM 2968  H HH21 . ARG A 1 41 ? -7.942  26.780  2.405   1.00 0.00 ? 41 ARG A HH21 3 
ATOM 2969  H HH22 . ARG A 1 41 ? -9.673  26.775  2.360   1.00 0.00 ? 41 ARG A HH22 3 
ATOM 2970  N N    . GLN A 1 42 ? -4.146  26.072  -1.352  1.00 0.00 ? 42 GLN A N    3 
ATOM 2971  C CA   . GLN A 1 42 ? -3.080  26.832  -0.751  1.00 0.00 ? 42 GLN A CA   3 
ATOM 2972  C C    . GLN A 1 42 ? -2.122  27.363  -1.821  1.00 0.00 ? 42 GLN A C    3 
ATOM 2973  O O    . GLN A 1 42 ? -2.351  27.187  -3.018  1.00 0.00 ? 42 GLN A O    3 
ATOM 2974  C CB   . GLN A 1 42 ? -2.351  25.932  0.258   1.00 0.00 ? 42 GLN A CB   3 
ATOM 2975  C CG   . GLN A 1 42 ? -3.096  25.774  1.574   1.00 0.00 ? 42 GLN A CG   3 
ATOM 2976  C CD   . GLN A 1 42 ? -2.254  25.115  2.649   1.00 0.00 ? 42 GLN A CD   3 
ATOM 2977  O OE1  . GLN A 1 42 ? -1.709  24.032  2.449   1.00 0.00 ? 42 GLN A OE1  3 
ATOM 2978  N NE2  . GLN A 1 42 ? -2.150  25.765  3.802   1.00 0.00 ? 42 GLN A NE2  3 
ATOM 2979  H H    . GLN A 1 42 ? -4.217  25.138  -1.121  1.00 0.00 ? 42 GLN A H    3 
ATOM 2980  H HA   . GLN A 1 42 ? -3.518  27.665  -0.229  1.00 0.00 ? 42 GLN A HA   3 
ATOM 2981  H HB2  . GLN A 1 42 ? -2.238  24.952  -0.178  1.00 0.00 ? 42 GLN A HB2  3 
ATOM 2982  H HB3  . GLN A 1 42 ? -1.376  26.329  0.463   1.00 0.00 ? 42 GLN A HB3  3 
ATOM 2983  H HG2  . GLN A 1 42 ? -3.397  26.749  1.923   1.00 0.00 ? 42 GLN A HG2  3 
ATOM 2984  H HG3  . GLN A 1 42 ? -3.970  25.168  1.405   1.00 0.00 ? 42 GLN A HG3  3 
ATOM 2985  H HE21 . GLN A 1 42 ? -2.617  26.621  3.894   1.00 0.00 ? 42 GLN A HE21 3 
ATOM 2986  H HE22 . GLN A 1 42 ? -1.615  25.359  4.516   1.00 0.00 ? 42 GLN A HE22 3 
ATOM 2987  N N    . PRO A 1 43 ? -1.048  28.037  -1.395  1.00 0.00 ? 43 PRO A N    3 
ATOM 2988  C CA   . PRO A 1 43 ? -0.055  28.618  -2.302  1.00 0.00 ? 43 PRO A CA   3 
ATOM 2989  C C    . PRO A 1 43 ? 0.431   27.644  -3.372  1.00 0.00 ? 43 PRO A C    3 
ATOM 2990  O O    . PRO A 1 43 ? 0.106   27.803  -4.548  1.00 0.00 ? 43 PRO A O    3 
ATOM 2991  C CB   . PRO A 1 43 ? 1.086   29.022  -1.365  1.00 0.00 ? 43 PRO A CB   3 
ATOM 2992  C CG   . PRO A 1 43 ? 0.419   29.270  -0.054  1.00 0.00 ? 43 PRO A CG   3 
ATOM 2993  C CD   . PRO A 1 43 ? -0.727  28.297  0.013   1.00 0.00 ? 43 PRO A CD   3 
ATOM 2994  H HA   . PRO A 1 43 ? -0.444  29.497  -2.790  1.00 0.00 ? 43 PRO A HA   3 
ATOM 2995  H HB2  . PRO A 1 43 ? 1.807   28.222  -1.299  1.00 0.00 ? 43 PRO A HB2  3 
ATOM 2996  H HB3  . PRO A 1 43 ? 1.565   29.915  -1.739  1.00 0.00 ? 43 PRO A HB3  3 
ATOM 2997  H HG2  . PRO A 1 43 ? 1.115   29.085  0.752   1.00 0.00 ? 43 PRO A HG2  3 
ATOM 2998  H HG3  . PRO A 1 43 ? 0.055   30.285  -0.013  1.00 0.00 ? 43 PRO A HG3  3 
ATOM 2999  H HD2  . PRO A 1 43 ? -0.421  27.387  0.502   1.00 0.00 ? 43 PRO A HD2  3 
ATOM 3000  H HD3  . PRO A 1 43 ? -1.579  28.727  0.522   1.00 0.00 ? 43 PRO A HD3  3 
ATOM 3001  N N    . ASP A 1 44 ? 1.223   26.651  -2.978  1.00 0.00 ? 44 ASP A N    3 
ATOM 3002  C CA   . ASP A 1 44 ? 1.744   25.691  -3.945  1.00 0.00 ? 44 ASP A CA   3 
ATOM 3003  C C    . ASP A 1 44 ? 1.880   24.292  -3.343  1.00 0.00 ? 44 ASP A C    3 
ATOM 3004  O O    . ASP A 1 44 ? 2.900   23.630  -3.520  1.00 0.00 ? 44 ASP A O    3 
ATOM 3005  C CB   . ASP A 1 44 ? 3.101   26.175  -4.471  1.00 0.00 ? 44 ASP A CB   3 
ATOM 3006  C CG   . ASP A 1 44 ? 3.520   25.462  -5.743  1.00 0.00 ? 44 ASP A CG   3 
ATOM 3007  O OD1  . ASP A 1 44 ? 3.679   24.226  -5.711  1.00 0.00 ? 44 ASP A OD1  3 
ATOM 3008  O OD2  . ASP A 1 44 ? 3.684   26.145  -6.778  1.00 0.00 ? 44 ASP A OD2  3 
ATOM 3009  H H    . ASP A 1 44 ? 1.469   26.569  -2.034  1.00 0.00 ? 44 ASP A H    3 
ATOM 3010  H HA   . ASP A 1 44 ? 1.049   25.643  -4.771  1.00 0.00 ? 44 ASP A HA   3 
ATOM 3011  H HB2  . ASP A 1 44 ? 3.043   27.233  -4.677  1.00 0.00 ? 44 ASP A HB2  3 
ATOM 3012  H HB3  . ASP A 1 44 ? 3.857   26.001  -3.717  1.00 0.00 ? 44 ASP A HB3  3 
ATOM 3013  N N    . LEU A 1 45 ? 0.840   23.834  -2.650  1.00 0.00 ? 45 LEU A N    3 
ATOM 3014  C CA   . LEU A 1 45 ? 0.858   22.499  -2.054  1.00 0.00 ? 45 LEU A CA   3 
ATOM 3015  C C    . LEU A 1 45 ? 0.432   21.433  -3.072  1.00 0.00 ? 45 LEU A C    3 
ATOM 3016  O O    . LEU A 1 45 ? 0.164   20.285  -2.713  1.00 0.00 ? 45 LEU A O    3 
ATOM 3017  C CB   . LEU A 1 45 ? -0.045  22.451  -0.823  1.00 0.00 ? 45 LEU A CB   3 
ATOM 3018  C CG   . LEU A 1 45 ? 0.474   23.211  0.395   1.00 0.00 ? 45 LEU A CG   3 
ATOM 3019  C CD1  . LEU A 1 45 ? 1.820   22.663  0.832   1.00 0.00 ? 45 LEU A CD1  3 
ATOM 3020  C CD2  . LEU A 1 45 ? 0.568   24.698  0.093   1.00 0.00 ? 45 LEU A CD2  3 
ATOM 3021  H H    . LEU A 1 45 ? 0.042   24.396  -2.547  1.00 0.00 ? 45 LEU A H    3 
ATOM 3022  H HA   . LEU A 1 45 ? 1.873   22.291  -1.748  1.00 0.00 ? 45 LEU A HA   3 
ATOM 3023  H HB2  . LEU A 1 45 ? -0.995  22.871  -1.092  1.00 0.00 ? 45 LEU A HB2  3 
ATOM 3024  H HB3  . LEU A 1 45 ? -0.188  21.419  -0.542  1.00 0.00 ? 45 LEU A HB3  3 
ATOM 3025  H HG   . LEU A 1 45 ? -0.219  23.080  1.214   1.00 0.00 ? 45 LEU A HG   3 
ATOM 3026  H HD11 . LEU A 1 45 ? 1.772   21.585  0.872   1.00 0.00 ? 45 LEU A HD11 3 
ATOM 3027  H HD12 . LEU A 1 45 ? 2.579   22.965  0.125   1.00 0.00 ? 45 LEU A HD12 3 
ATOM 3028  H HD13 . LEU A 1 45 ? 2.064   23.049  1.810   1.00 0.00 ? 45 LEU A HD13 3 
ATOM 3029  H HD21 . LEU A 1 45 ? -0.193  24.966  -0.624  1.00 0.00 ? 45 LEU A HD21 3 
ATOM 3030  H HD22 . LEU A 1 45 ? 0.420   25.260  1.003   1.00 0.00 ? 45 LEU A HD22 3 
ATOM 3031  H HD23 . LEU A 1 45 ? 1.543   24.922  -0.315  1.00 0.00 ? 45 LEU A HD23 3 
ATOM 3032  N N    . ILE A 1 46 ? 0.386   21.810  -4.347  1.00 0.00 ? 46 ILE A N    3 
ATOM 3033  C CA   . ILE A 1 46 ? 0.013   20.877  -5.399  1.00 0.00 ? 46 ILE A CA   3 
ATOM 3034  C C    . ILE A 1 46 ? 0.862   19.613  -5.322  1.00 0.00 ? 46 ILE A C    3 
ATOM 3035  O O    . ILE A 1 46 ? 0.339   18.510  -5.420  1.00 0.00 ? 46 ILE A O    3 
ATOM 3036  C CB   . ILE A 1 46 ? 0.166   21.494  -6.796  1.00 0.00 ? 46 ILE A CB   3 
ATOM 3037  C CG1  . ILE A 1 46 ? -0.500  22.871  -6.851  1.00 0.00 ? 46 ILE A CG1  3 
ATOM 3038  C CG2  . ILE A 1 46 ? -0.434  20.576  -7.850  1.00 0.00 ? 46 ILE A CG2  3 
ATOM 3039  C CD1  . ILE A 1 46 ? -1.980  22.832  -6.540  1.00 0.00 ? 46 ILE A CD1  3 
ATOM 3040  H H    . ILE A 1 46 ? 0.622   22.727  -4.586  1.00 0.00 ? 46 ILE A H    3 
ATOM 3041  H HA   . ILE A 1 46 ? -1.025  20.610  -5.254  1.00 0.00 ? 46 ILE A HA   3 
ATOM 3042  H HB   . ILE A 1 46 ? 1.216   21.594  -6.998  1.00 0.00 ? 46 ILE A HB   3 
ATOM 3043  H HG12 . ILE A 1 46 ? -0.027  23.528  -6.134  1.00 0.00 ? 46 ILE A HG12 3 
ATOM 3044  H HG13 . ILE A 1 46 ? -0.379  23.281  -7.841  1.00 0.00 ? 46 ILE A HG13 3 
ATOM 3045  H HG21 . ILE A 1 46 ? -0.116  19.560  -7.668  1.00 0.00 ? 46 ILE A HG21 3 
ATOM 3046  H HG22 . ILE A 1 46 ? -1.513  20.629  -7.802  1.00 0.00 ? 46 ILE A HG22 3 
ATOM 3047  H HG23 . ILE A 1 46 ? -0.103  20.888  -8.830  1.00 0.00 ? 46 ILE A HG23 3 
ATOM 3048  H HD11 . ILE A 1 46 ? -2.457  22.090  -7.162  1.00 0.00 ? 46 ILE A HD11 3 
ATOM 3049  H HD12 . ILE A 1 46 ? -2.123  22.576  -5.500  1.00 0.00 ? 46 ILE A HD12 3 
ATOM 3050  H HD13 . ILE A 1 46 ? -2.415  23.801  -6.735  1.00 0.00 ? 46 ILE A HD13 3 
ATOM 3051  N N    . PRO A 1 47 ? 2.192   19.734  -5.147  1.00 0.00 ? 47 PRO A N    3 
ATOM 3052  C CA   . PRO A 1 47 ? 3.044   18.556  -5.054  1.00 0.00 ? 47 PRO A CA   3 
ATOM 3053  C C    . PRO A 1 47 ? 2.764   17.790  -3.770  1.00 0.00 ? 47 PRO A C    3 
ATOM 3054  O O    . PRO A 1 47 ? 2.996   16.581  -3.682  1.00 0.00 ? 47 PRO A O    3 
ATOM 3055  C CB   . PRO A 1 47 ? 4.467   19.117  -5.065  1.00 0.00 ? 47 PRO A CB   3 
ATOM 3056  C CG   . PRO A 1 47 ? 4.334   20.532  -4.612  1.00 0.00 ? 47 PRO A CG   3 
ATOM 3057  C CD   . PRO A 1 47 ? 2.961   20.990  -5.027  1.00 0.00 ? 47 PRO A CD   3 
ATOM 3058  H HA   . PRO A 1 47 ? 2.891   17.900  -5.899  1.00 0.00 ? 47 PRO A HA   3 
ATOM 3059  H HB2  . PRO A 1 47 ? 5.086   18.544  -4.389  1.00 0.00 ? 47 PRO A HB2  3 
ATOM 3060  H HB3  . PRO A 1 47 ? 4.872   19.061  -6.065  1.00 0.00 ? 47 PRO A HB3  3 
ATOM 3061  H HG2  . PRO A 1 47 ? 4.436   20.585  -3.539  1.00 0.00 ? 47 PRO A HG2  3 
ATOM 3062  H HG3  . PRO A 1 47 ? 5.090   21.141  -5.089  1.00 0.00 ? 47 PRO A HG3  3 
ATOM 3063  H HD2  . PRO A 1 47 ? 2.547   21.630  -4.270  1.00 0.00 ? 47 PRO A HD2  3 
ATOM 3064  H HD3  . PRO A 1 47 ? 3.006   21.504  -5.976  1.00 0.00 ? 47 PRO A HD3  3 
ATOM 3065  N N    . LEU A 1 48 ? 2.225   18.497  -2.780  1.00 0.00 ? 48 LEU A N    3 
ATOM 3066  C CA   . LEU A 1 48 ? 1.864   17.875  -1.521  1.00 0.00 ? 48 LEU A CA   3 
ATOM 3067  C C    . LEU A 1 48 ? 0.705   16.937  -1.790  1.00 0.00 ? 48 LEU A C    3 
ATOM 3068  O O    . LEU A 1 48 ? 0.632   15.834  -1.254  1.00 0.00 ? 48 LEU A O    3 
ATOM 3069  C CB   . LEU A 1 48 ? 1.459   18.940  -0.497  1.00 0.00 ? 48 LEU A CB   3 
ATOM 3070  C CG   . LEU A 1 48 ? 1.161   18.418  0.907   1.00 0.00 ? 48 LEU A CG   3 
ATOM 3071  C CD1  . LEU A 1 48 ? 2.430   17.932  1.587   1.00 0.00 ? 48 LEU A CD1  3 
ATOM 3072  C CD2  . LEU A 1 48 ? 0.476   19.494  1.737   1.00 0.00 ? 48 LEU A CD2  3 
ATOM 3073  H H    . LEU A 1 48 ? 2.032   19.450  -2.914  1.00 0.00 ? 48 LEU A H    3 
ATOM 3074  H HA   . LEU A 1 48 ? 2.708   17.308  -1.154  1.00 0.00 ? 48 LEU A HA   3 
ATOM 3075  H HB2  . LEU A 1 48 ? 2.260   19.662  -0.427  1.00 0.00 ? 48 LEU A HB2  3 
ATOM 3076  H HB3  . LEU A 1 48 ? 0.573   19.442  -0.861  1.00 0.00 ? 48 LEU A HB3  3 
ATOM 3077  H HG   . LEU A 1 48 ? 0.492   17.579  0.831   1.00 0.00 ? 48 LEU A HG   3 
ATOM 3078  H HD11 . LEU A 1 48 ? 3.257   17.992  0.895   1.00 0.00 ? 48 LEU A HD11 3 
ATOM 3079  H HD12 . LEU A 1 48 ? 2.636   18.549  2.449   1.00 0.00 ? 48 LEU A HD12 3 
ATOM 3080  H HD13 . LEU A 1 48 ? 2.297   16.908  1.902   1.00 0.00 ? 48 LEU A HD13 3 
ATOM 3081  H HD21 . LEU A 1 48 ? -0.214  20.044  1.113   1.00 0.00 ? 48 LEU A HD21 3 
ATOM 3082  H HD22 . LEU A 1 48 ? -0.064  19.032  2.550   1.00 0.00 ? 48 LEU A HD22 3 
ATOM 3083  H HD23 . LEU A 1 48 ? 1.218   20.170  2.135   1.00 0.00 ? 48 LEU A HD23 3 
ATOM 3084  N N    . LEU A 1 49 ? -0.190  17.392  -2.662  1.00 0.00 ? 49 LEU A N    3 
ATOM 3085  C CA   . LEU A 1 49 ? -1.350  16.613  -3.066  1.00 0.00 ? 49 LEU A CA   3 
ATOM 3086  C C    . LEU A 1 49 ? -0.959  15.165  -3.341  1.00 0.00 ? 49 LEU A C    3 
ATOM 3087  O O    . LEU A 1 49 ? -1.428  14.235  -2.677  1.00 0.00 ? 49 LEU A O    3 
ATOM 3088  C CB   . LEU A 1 49 ? -1.965  17.225  -4.328  1.00 0.00 ? 49 LEU A CB   3 
ATOM 3089  C CG   . LEU A 1 49 ? -2.621  18.593  -4.139  1.00 0.00 ? 49 LEU A CG   3 
ATOM 3090  C CD1  . LEU A 1 49 ? -3.177  19.105  -5.459  1.00 0.00 ? 49 LEU A CD1  3 
ATOM 3091  C CD2  . LEU A 1 49 ? -3.718  18.514  -3.092  1.00 0.00 ? 49 LEU A CD2  3 
ATOM 3092  H H    . LEU A 1 49 ? -0.053  18.280  -3.062  1.00 0.00 ? 49 LEU A H    3 
ATOM 3093  H HA   . LEU A 1 49 ? -2.071  16.641  -2.265  1.00 0.00 ? 49 LEU A HA   3 
ATOM 3094  H HB2  . LEU A 1 49 ? -1.179  17.330  -5.070  1.00 0.00 ? 49 LEU A HB2  3 
ATOM 3095  H HB3  . LEU A 1 49 ? -2.708  16.542  -4.711  1.00 0.00 ? 49 LEU A HB3  3 
ATOM 3096  H HG   . LEU A 1 49 ? -1.879  19.297  -3.794  1.00 0.00 ? 49 LEU A HG   3 
ATOM 3097  H HD11 . LEU A 1 49 ? -2.384  19.152  -6.191  1.00 0.00 ? 49 LEU A HD11 3 
ATOM 3098  H HD12 . LEU A 1 49 ? -3.949  18.436  -5.808  1.00 0.00 ? 49 LEU A HD12 3 
ATOM 3099  H HD13 . LEU A 1 49 ? -3.594  20.090  -5.315  1.00 0.00 ? 49 LEU A HD13 3 
ATOM 3100  H HD21 . LEU A 1 49 ? -3.508  17.708  -2.406  1.00 0.00 ? 49 LEU A HD21 3 
ATOM 3101  H HD22 . LEU A 1 49 ? -3.762  19.446  -2.549  1.00 0.00 ? 49 LEU A HD22 3 
ATOM 3102  H HD23 . LEU A 1 49 ? -4.666  18.333  -3.579  1.00 0.00 ? 49 LEU A HD23 3 
ATOM 3103  N N    . ARG A 1 50 ? -0.080  14.991  -4.320  1.00 0.00 ? 50 ARG A N    3 
ATOM 3104  C CA   . ARG A 1 50 ? 0.393   13.681  -4.697  1.00 0.00 ? 50 ARG A CA   3 
ATOM 3105  C C    . ARG A 1 50 ? 1.143   13.043  -3.541  1.00 0.00 ? 50 ARG A C    3 
ATOM 3106  O O    . ARG A 1 50 ? 0.876   11.904  -3.169  1.00 0.00 ? 50 ARG A O    3 
ATOM 3107  C CB   . ARG A 1 50 ? 1.290   13.793  -5.933  1.00 0.00 ? 50 ARG A CB   3 
ATOM 3108  C CG   . ARG A 1 50 ? 2.522   14.660  -5.732  1.00 0.00 ? 50 ARG A CG   3 
ATOM 3109  C CD   . ARG A 1 50 ? 3.349   14.759  -7.002  1.00 0.00 ? 50 ARG A CD   3 
ATOM 3110  N NE   . ARG A 1 50 ? 4.566   15.546  -6.806  1.00 0.00 ? 50 ARG A NE   3 
ATOM 3111  C CZ   . ARG A 1 50 ? 5.477   15.745  -7.755  1.00 0.00 ? 50 ARG A CZ   3 
ATOM 3112  N NH1  . ARG A 1 50 ? 5.310   15.218  -8.962  1.00 0.00 ? 50 ARG A NH1  3 
ATOM 3113  N NH2  . ARG A 1 50 ? 6.559   16.469  -7.500  1.00 0.00 ? 50 ARG A NH2  3 
ATOM 3114  H H    . ARG A 1 50 ? 0.266   15.766  -4.795  1.00 0.00 ? 50 ARG A H    3 
ATOM 3115  H HA   . ARG A 1 50 ? -0.468  13.071  -4.941  1.00 0.00 ? 50 ARG A HA   3 
ATOM 3116  H HB2  . ARG A 1 50 ? 1.616   12.811  -6.210  1.00 0.00 ? 50 ARG A HB2  3 
ATOM 3117  H HB3  . ARG A 1 50 ? 0.713   14.211  -6.745  1.00 0.00 ? 50 ARG A HB3  3 
ATOM 3118  H HG2  . ARG A 1 50 ? 2.207   15.651  -5.444  1.00 0.00 ? 50 ARG A HG2  3 
ATOM 3119  H HG3  . ARG A 1 50 ? 3.130   14.229  -4.950  1.00 0.00 ? 50 ARG A HG3  3 
ATOM 3120  H HD2  . ARG A 1 50 ? 3.624   13.763  -7.318  1.00 0.00 ? 50 ARG A HD2  3 
ATOM 3121  H HD3  . ARG A 1 50 ? 2.751   15.227  -7.772  1.00 0.00 ? 50 ARG A HD3  3 
ATOM 3122  H HE   . ARG A 1 50 ? 4.710   15.945  -5.922  1.00 0.00 ? 50 ARG A HE   3 
ATOM 3123  H HH11 . ARG A 1 50 ? 4.497   14.670  -9.161  1.00 0.00 ? 50 ARG A HH11 3 
ATOM 3124  H HH12 . ARG A 1 50 ? 5.996   15.369  -9.673  1.00 0.00 ? 50 ARG A HH12 3 
ATOM 3125  H HH21 . ARG A 1 50 ? 6.692   16.867  -6.593  1.00 0.00 ? 50 ARG A HH21 3 
ATOM 3126  H HH22 . ARG A 1 50 ? 7.243   16.615  -8.216  1.00 0.00 ? 50 ARG A HH22 3 
ATOM 3127  N N    . THR A 1 51 ? 2.079   13.789  -2.959  1.00 0.00 ? 51 THR A N    3 
ATOM 3128  C CA   . THR A 1 51 ? 2.857   13.285  -1.835  1.00 0.00 ? 51 THR A CA   3 
ATOM 3129  C C    . THR A 1 51 ? 1.951   12.629  -0.799  1.00 0.00 ? 51 THR A C    3 
ATOM 3130  O O    . THR A 1 51 ? 2.204   11.510  -0.362  1.00 0.00 ? 51 THR A O    3 
ATOM 3131  C CB   . THR A 1 51 ? 3.659   14.415  -1.190  1.00 0.00 ? 51 THR A CB   3 
ATOM 3132  O OG1  . THR A 1 51 ? 4.562   14.978  -2.122  1.00 0.00 ? 51 THR A OG1  3 
ATOM 3133  C CG2  . THR A 1 51 ? 4.464   13.972  0.011   1.00 0.00 ? 51 THR A CG2  3 
ATOM 3134  H H    . THR A 1 51 ? 2.241   14.699  -3.287  1.00 0.00 ? 51 THR A H    3 
ATOM 3135  H HA   . THR A 1 51 ? 3.543   12.542  -2.216  1.00 0.00 ? 51 THR A HA   3 
ATOM 3136  H HB   . THR A 1 51 ? 2.977   15.189  -0.867  1.00 0.00 ? 51 THR A HB   3 
ATOM 3137  H HG1  . THR A 1 51 ? 5.020   15.716  -1.715  1.00 0.00 ? 51 THR A HG1  3 
ATOM 3138  H HG21 . THR A 1 51 ? 3.823   13.437  0.696   1.00 0.00 ? 51 THR A HG21 3 
ATOM 3139  H HG22 . THR A 1 51 ? 5.266   13.324  -0.313  1.00 0.00 ? 51 THR A HG22 3 
ATOM 3140  H HG23 . THR A 1 51 ? 4.877   14.836  0.508   1.00 0.00 ? 51 THR A HG23 3 
ATOM 3141  N N    . GLN A 1 52 ? 0.883   13.324  -0.426  1.00 0.00 ? 52 GLN A N    3 
ATOM 3142  C CA   . GLN A 1 52 ? -0.054  12.785  0.557   1.00 0.00 ? 52 GLN A CA   3 
ATOM 3143  C C    . GLN A 1 52 ? -0.825  11.610  -0.027  1.00 0.00 ? 52 GLN A C    3 
ATOM 3144  O O    . GLN A 1 52 ? -1.172  10.667  0.680   1.00 0.00 ? 52 GLN A O    3 
ATOM 3145  C CB   . GLN A 1 52 ? -1.033  13.861  1.020   1.00 0.00 ? 52 GLN A CB   3 
ATOM 3146  C CG   . GLN A 1 52 ? -0.362  15.163  1.410   1.00 0.00 ? 52 GLN A CG   3 
ATOM 3147  C CD   . GLN A 1 52 ? -1.348  16.195  1.929   1.00 0.00 ? 52 GLN A CD   3 
ATOM 3148  O OE1  . GLN A 1 52 ? -1.852  16.078  3.047   1.00 0.00 ? 52 GLN A OE1  3 
ATOM 3149  N NE2  . GLN A 1 52 ? -1.649  17.199  1.113   1.00 0.00 ? 52 GLN A NE2  3 
ATOM 3150  H H    . GLN A 1 52 ? 0.721   14.212  -0.824  1.00 0.00 ? 52 GLN A H    3 
ATOM 3151  H HA   . GLN A 1 52 ? 0.517   12.439  1.406   1.00 0.00 ? 52 GLN A HA   3 
ATOM 3152  H HB2  . GLN A 1 52 ? -1.730  14.064  0.223   1.00 0.00 ? 52 GLN A HB2  3 
ATOM 3153  H HB3  . GLN A 1 52 ? -1.577  13.491  1.878   1.00 0.00 ? 52 GLN A HB3  3 
ATOM 3154  H HG2  . GLN A 1 52 ? 0.365   14.961  2.183   1.00 0.00 ? 52 GLN A HG2  3 
ATOM 3155  H HG3  . GLN A 1 52 ? 0.137   15.560  0.542   1.00 0.00 ? 52 GLN A HG3  3 
ATOM 3156  H HE21 . GLN A 1 52 ? -1.226  17.220  0.228   1.00 0.00 ? 52 GLN A HE21 3 
ATOM 3157  H HE22 . GLN A 1 52 ? -2.277  17.882  1.429   1.00 0.00 ? 52 GLN A HE22 3 
ATOM 3158  N N    . PHE A 1 53 ? -1.092  11.675  -1.326  1.00 0.00 ? 53 PHE A N    3 
ATOM 3159  C CA   . PHE A 1 53 ? -1.827  10.613  -2.010  1.00 0.00 ? 53 PHE A CA   3 
ATOM 3160  C C    . PHE A 1 53 ? -1.134  9.267   -1.811  1.00 0.00 ? 53 PHE A C    3 
ATOM 3161  O O    . PHE A 1 53 ? -1.747  8.297   -1.359  1.00 0.00 ? 53 PHE A O    3 
ATOM 3162  C CB   . PHE A 1 53 ? -1.929  10.934  -3.504  1.00 0.00 ? 53 PHE A CB   3 
ATOM 3163  C CG   . PHE A 1 53 ? -2.790  9.977   -4.279  1.00 0.00 ? 53 PHE A CG   3 
ATOM 3164  C CD1  . PHE A 1 53 ? -2.376  8.676   -4.505  1.00 0.00 ? 53 PHE A CD1  3 
ATOM 3165  C CD2  . PHE A 1 53 ? -4.017  10.381  -4.777  1.00 0.00 ? 53 PHE A CD2  3 
ATOM 3166  C CE1  . PHE A 1 53 ? -3.170  7.797   -5.214  1.00 0.00 ? 53 PHE A CE1  3 
ATOM 3167  C CE2  . PHE A 1 53 ? -4.814  9.507   -5.486  1.00 0.00 ? 53 PHE A CE2  3 
ATOM 3168  C CZ   . PHE A 1 53 ? -4.391  8.212   -5.705  1.00 0.00 ? 53 PHE A CZ   3 
ATOM 3169  H H    . PHE A 1 53 ? -0.790  12.461  -1.839  1.00 0.00 ? 53 PHE A H    3 
ATOM 3170  H HA   . PHE A 1 53 ? -2.824  10.565  -1.589  1.00 0.00 ? 53 PHE A HA   3 
ATOM 3171  H HB2  . PHE A 1 53 ? -2.342  11.923  -3.627  1.00 0.00 ? 53 PHE A HB2  3 
ATOM 3172  H HB3  . PHE A 1 53 ? -0.936  10.908  -3.932  1.00 0.00 ? 53 PHE A HB3  3 
ATOM 3173  H HD1  . PHE A 1 53 ? -1.420  8.350   -4.122  1.00 0.00 ? 53 PHE A HD1  3 
ATOM 3174  H HD2  . PHE A 1 53 ? -4.350  11.396  -4.606  1.00 0.00 ? 53 PHE A HD2  3 
ATOM 3175  H HE1  . PHE A 1 53 ? -2.835  6.783   -5.384  1.00 0.00 ? 53 PHE A HE1  3 
ATOM 3176  H HE2  . PHE A 1 53 ? -5.769  9.835   -5.868  1.00 0.00 ? 53 PHE A HE2  3 
ATOM 3177  H HZ   . PHE A 1 53 ? -5.013  7.525   -6.259  1.00 0.00 ? 53 PHE A HZ   3 
ATOM 3178  N N    . PHE A 1 54 ? 0.152   9.227   -2.155  1.00 0.00 ? 54 PHE A N    3 
ATOM 3179  C CA   . PHE A 1 54 ? 0.955   8.012   -2.033  1.00 0.00 ? 54 PHE A CA   3 
ATOM 3180  C C    . PHE A 1 54 ? 1.121   7.591   -0.575  1.00 0.00 ? 54 PHE A C    3 
ATOM 3181  O O    . PHE A 1 54 ? 0.997   6.413   -0.244  1.00 0.00 ? 54 PHE A O    3 
ATOM 3182  C CB   . PHE A 1 54 ? 2.339   8.222   -2.664  1.00 0.00 ? 54 PHE A CB   3 
ATOM 3183  C CG   . PHE A 1 54 ? 2.293   8.484   -4.142  1.00 0.00 ? 54 PHE A CG   3 
ATOM 3184  C CD1  . PHE A 1 54 ? 1.841   9.698   -4.634  1.00 0.00 ? 54 PHE A CD1  3 
ATOM 3185  C CD2  . PHE A 1 54 ? 2.675   7.503   -5.041  1.00 0.00 ? 54 PHE A CD2  3 
ATOM 3186  C CE1  . PHE A 1 54 ? 1.769   9.926   -5.995  1.00 0.00 ? 54 PHE A CE1  3 
ATOM 3187  C CE2  . PHE A 1 54 ? 2.611   7.728   -6.403  1.00 0.00 ? 54 PHE A CE2  3 
ATOM 3188  C CZ   . PHE A 1 54 ? 2.156   8.940   -6.880  1.00 0.00 ? 54 PHE A CZ   3 
ATOM 3189  H H    . PHE A 1 54 ? 0.573   10.039  -2.502  1.00 0.00 ? 54 PHE A H    3 
ATOM 3190  H HA   . PHE A 1 54 ? 0.445   7.222   -2.574  1.00 0.00 ? 54 PHE A HA   3 
ATOM 3191  H HB2  . PHE A 1 54 ? 2.818   9.067   -2.191  1.00 0.00 ? 54 PHE A HB2  3 
ATOM 3192  H HB3  . PHE A 1 54 ? 2.938   7.338   -2.501  1.00 0.00 ? 54 PHE A HB3  3 
ATOM 3193  H HD1  . PHE A 1 54 ? 1.546   10.472  -3.944  1.00 0.00 ? 54 PHE A HD1  3 
ATOM 3194  H HD2  . PHE A 1 54 ? 3.032   6.553   -4.669  1.00 0.00 ? 54 PHE A HD2  3 
ATOM 3195  H HE1  . PHE A 1 54 ? 1.414   10.875  -6.367  1.00 0.00 ? 54 PHE A HE1  3 
ATOM 3196  H HE2  . PHE A 1 54 ? 2.914   6.954   -7.094  1.00 0.00 ? 54 PHE A HE2  3 
ATOM 3197  H HZ   . PHE A 1 54 ? 2.101   9.117   -7.945  1.00 0.00 ? 54 PHE A HZ   3 
ATOM 3198  N N    . ILE A 1 55 ? 1.411   8.558   0.289   1.00 0.00 ? 55 ILE A N    3 
ATOM 3199  C CA   . ILE A 1 55 ? 1.612   8.277   1.711   1.00 0.00 ? 55 ILE A CA   3 
ATOM 3200  C C    . ILE A 1 55 ? 0.341   7.745   2.369   1.00 0.00 ? 55 ILE A C    3 
ATOM 3201  O O    . ILE A 1 55 ? 0.344   6.665   2.956   1.00 0.00 ? 55 ILE A O    3 
ATOM 3202  C CB   . ILE A 1 55 ? 2.100   9.532   2.470   1.00 0.00 ? 55 ILE A CB   3 
ATOM 3203  C CG1  . ILE A 1 55 ? 3.425   10.023  1.881   1.00 0.00 ? 55 ILE A CG1  3 
ATOM 3204  C CG2  . ILE A 1 55 ? 2.261   9.243   3.959   1.00 0.00 ? 55 ILE A CG2  3 
ATOM 3205  C CD1  . ILE A 1 55 ? 4.577   9.064   2.088   1.00 0.00 ? 55 ILE A CD1  3 
ATOM 3206  H H    . ILE A 1 55 ? 1.503   9.480   -0.038  1.00 0.00 ? 55 ILE A H    3 
ATOM 3207  H HA   . ILE A 1 55 ? 2.383   7.521   1.790   1.00 0.00 ? 55 ILE A HA   3 
ATOM 3208  H HB   . ILE A 1 55 ? 1.356   10.307  2.358   1.00 0.00 ? 55 ILE A HB   3 
ATOM 3209  H HG12 . ILE A 1 55 ? 3.307   10.165  0.821   1.00 0.00 ? 55 ILE A HG12 3 
ATOM 3210  H HG13 . ILE A 1 55 ? 3.690   10.964  2.340   1.00 0.00 ? 55 ILE A HG13 3 
ATOM 3211  H HG21 . ILE A 1 55 ? 1.420   8.666   4.309   1.00 0.00 ? 55 ILE A HG21 3 
ATOM 3212  H HG22 . ILE A 1 55 ? 3.172   8.686   4.121   1.00 0.00 ? 55 ILE A HG22 3 
ATOM 3213  H HG23 . ILE A 1 55 ? 2.309   10.175  4.503   1.00 0.00 ? 55 ILE A HG23 3 
ATOM 3214  H HD11 . ILE A 1 55 ? 4.235   8.051   1.938   1.00 0.00 ? 55 ILE A HD11 3 
ATOM 3215  H HD12 . ILE A 1 55 ? 5.361   9.288   1.378   1.00 0.00 ? 55 ILE A HD12 3 
ATOM 3216  H HD13 . ILE A 1 55 ? 4.960   9.171   3.092   1.00 0.00 ? 55 ILE A HD13 3 
ATOM 3217  N N    . VAL A 1 56 ? -0.737  8.510   2.283   1.00 0.00 ? 56 VAL A N    3 
ATOM 3218  C CA   . VAL A 1 56 ? -2.001  8.111   2.893   1.00 0.00 ? 56 VAL A CA   3 
ATOM 3219  C C    . VAL A 1 56 ? -2.524  6.801   2.315   1.00 0.00 ? 56 VAL A C    3 
ATOM 3220  O O    . VAL A 1 56 ? -2.903  5.896   3.058   1.00 0.00 ? 56 VAL A O    3 
ATOM 3221  C CB   . VAL A 1 56 ? -3.072  9.204   2.715   1.00 0.00 ? 56 VAL A CB   3 
ATOM 3222  C CG1  . VAL A 1 56 ? -4.347  8.838   3.463   1.00 0.00 ? 56 VAL A CG1  3 
ATOM 3223  C CG2  . VAL A 1 56 ? -2.539  10.552  3.178   1.00 0.00 ? 56 VAL A CG2  3 
ATOM 3224  H H    . VAL A 1 56 ? -0.681  9.368   1.813   1.00 0.00 ? 56 VAL A H    3 
ATOM 3225  H HA   . VAL A 1 56 ? -1.829  7.978   3.953   1.00 0.00 ? 56 VAL A HA   3 
ATOM 3226  H HB   . VAL A 1 56 ? -3.309  9.279   1.663   1.00 0.00 ? 56 VAL A HB   3 
ATOM 3227  H HG11 . VAL A 1 56 ? -4.620  7.818   3.232   1.00 0.00 ? 56 VAL A HG11 3 
ATOM 3228  H HG12 . VAL A 1 56 ? -4.181  8.934   4.526   1.00 0.00 ? 56 VAL A HG12 3 
ATOM 3229  H HG13 . VAL A 1 56 ? -5.145  9.500   3.161   1.00 0.00 ? 56 VAL A HG13 3 
ATOM 3230  H HG21 . VAL A 1 56 ? -1.517  10.441  3.511   1.00 0.00 ? 56 VAL A HG21 3 
ATOM 3231  H HG22 . VAL A 1 56 ? -2.576  11.253  2.360   1.00 0.00 ? 56 VAL A HG22 3 
ATOM 3232  H HG23 . VAL A 1 56 ? -3.145  10.920  3.994   1.00 0.00 ? 56 VAL A HG23 3 
ATOM 3233  N N    . MET A 1 57 ? -2.540  6.699   0.991   1.00 0.00 ? 57 MET A N    3 
ATOM 3234  C CA   . MET A 1 57 ? -3.020  5.492   0.337   1.00 0.00 ? 57 MET A CA   3 
ATOM 3235  C C    . MET A 1 57 ? -2.066  4.338   0.581   1.00 0.00 ? 57 MET A C    3 
ATOM 3236  O O    . MET A 1 57 ? -2.479  3.189   0.722   1.00 0.00 ? 57 MET A O    3 
ATOM 3237  C CB   . MET A 1 57 ? -3.184  5.728   -1.166  1.00 0.00 ? 57 MET A CB   3 
ATOM 3238  C CG   . MET A 1 57 ? -3.726  4.523   -1.914  1.00 0.00 ? 57 MET A CG   3 
ATOM 3239  S SD   . MET A 1 57 ? -3.844  4.807   -3.692  1.00 0.00 ? 57 MET A SD   3 
ATOM 3240  C CE   . MET A 1 57 ? -4.478  3.226   -4.248  1.00 0.00 ? 57 MET A CE   3 
ATOM 3241  H H    . MET A 1 57 ? -2.218  7.446   0.443   1.00 0.00 ? 57 MET A H    3 
ATOM 3242  H HA   . MET A 1 57 ? -3.976  5.243   0.762   1.00 0.00 ? 57 MET A HA   3 
ATOM 3243  H HB2  . MET A 1 57 ? -3.859  6.556   -1.316  1.00 0.00 ? 57 MET A HB2  3 
ATOM 3244  H HB3  . MET A 1 57 ? -2.220  5.981   -1.586  1.00 0.00 ? 57 MET A HB3  3 
ATOM 3245  H HG2  . MET A 1 57 ? -3.068  3.686   -1.741  1.00 0.00 ? 57 MET A HG2  3 
ATOM 3246  H HG3  . MET A 1 57 ? -4.710  4.294   -1.533  1.00 0.00 ? 57 MET A HG3  3 
ATOM 3247  H HE1  . MET A 1 57 ? -5.016  2.750   -3.442  1.00 0.00 ? 57 MET A HE1  3 
ATOM 3248  H HE2  . MET A 1 57 ? -5.145  3.380   -5.084  1.00 0.00 ? 57 MET A HE2  3 
ATOM 3249  H HE3  . MET A 1 57 ? -3.656  2.596   -4.555  1.00 0.00 ? 57 MET A HE3  3 
ATOM 3250  N N    . GLY A 1 58 ? -0.787  4.658   0.625   1.00 0.00 ? 58 GLY A N    3 
ATOM 3251  C CA   . GLY A 1 58 ? 0.227   3.646   0.843   1.00 0.00 ? 58 GLY A CA   3 
ATOM 3252  C C    . GLY A 1 58 ? 0.206   3.077   2.248   1.00 0.00 ? 58 GLY A C    3 
ATOM 3253  O O    . GLY A 1 58 ? 0.292   1.862   2.427   1.00 0.00 ? 58 GLY A O    3 
ATOM 3254  H H    . GLY A 1 58 ? -0.527  5.593   0.503   1.00 0.00 ? 58 GLY A H    3 
ATOM 3255  H HA2  . GLY A 1 58 ? 0.070   2.842   0.140   1.00 0.00 ? 58 GLY A HA2  3 
ATOM 3256  H HA3  . GLY A 1 58 ? 1.192   4.080   0.657   1.00 0.00 ? 58 GLY A HA3  3 
ATOM 3257  N N    . LEU A 1 59 ? 0.095   3.947   3.250   1.00 0.00 ? 59 LEU A N    3 
ATOM 3258  C CA   . LEU A 1 59 ? 0.061   3.500   4.635   1.00 0.00 ? 59 LEU A CA   3 
ATOM 3259  C C    . LEU A 1 59 ? -1.154  2.610   4.868   1.00 0.00 ? 59 LEU A C    3 
ATOM 3260  O O    . LEU A 1 59 ? -1.060  1.564   5.512   1.00 0.00 ? 59 LEU A O    3 
ATOM 3261  C CB   . LEU A 1 59 ? 0.033   4.699   5.586   1.00 0.00 ? 59 LEU A CB   3 
ATOM 3262  C CG   . LEU A 1 59 ? 1.303   5.556   5.598   1.00 0.00 ? 59 LEU A CG   3 
ATOM 3263  C CD1  . LEU A 1 59 ? 1.159   6.715   6.576   1.00 0.00 ? 59 LEU A CD1  3 
ATOM 3264  C CD2  . LEU A 1 59 ? 2.523   4.711   5.946   1.00 0.00 ? 59 LEU A CD2  3 
ATOM 3265  H H    . LEU A 1 59 ? 0.029   4.905   3.054   1.00 0.00 ? 59 LEU A H    3 
ATOM 3266  H HA   . LEU A 1 59 ? 0.954   2.923   4.819   1.00 0.00 ? 59 LEU A HA   3 
ATOM 3267  H HB2  . LEU A 1 59 ? -0.796  5.331   5.306   1.00 0.00 ? 59 LEU A HB2  3 
ATOM 3268  H HB3  . LEU A 1 59 ? -0.137  4.335   6.586   1.00 0.00 ? 59 LEU A HB3  3 
ATOM 3269  H HG   . LEU A 1 59 ? 1.455   5.971   4.613   1.00 0.00 ? 59 LEU A HG   3 
ATOM 3270  H HD11 . LEU A 1 59 ? 0.162   6.718   6.989   1.00 0.00 ? 59 LEU A HD11 3 
ATOM 3271  H HD12 . LEU A 1 59 ? 1.879   6.606   7.374   1.00 0.00 ? 59 LEU A HD12 3 
ATOM 3272  H HD13 . LEU A 1 59 ? 1.337   7.646   6.057   1.00 0.00 ? 59 LEU A HD13 3 
ATOM 3273  H HD21 . LEU A 1 59 ? 2.235   3.674   6.023   1.00 0.00 ? 59 LEU A HD21 3 
ATOM 3274  H HD22 . LEU A 1 59 ? 3.266   4.821   5.169   1.00 0.00 ? 59 LEU A HD22 3 
ATOM 3275  H HD23 . LEU A 1 59 ? 2.935   5.041   6.887   1.00 0.00 ? 59 LEU A HD23 3 
ATOM 3276  N N    . VAL A 1 60 ? -2.288  3.022   4.311   1.00 0.00 ? 60 VAL A N    3 
ATOM 3277  C CA   . VAL A 1 60 ? -3.525  2.261   4.432   1.00 0.00 ? 60 VAL A CA   3 
ATOM 3278  C C    . VAL A 1 60 ? -3.434  0.968   3.629   1.00 0.00 ? 60 VAL A C    3 
ATOM 3279  O O    . VAL A 1 60 ? -3.709  -0.118  4.138   1.00 0.00 ? 60 VAL A O    3 
ATOM 3280  C CB   . VAL A 1 60 ? -4.730  3.084   3.930   1.00 0.00 ? 60 VAL A CB   3 
ATOM 3281  C CG1  . VAL A 1 60 ? -6.027  2.306   4.093   1.00 0.00 ? 60 VAL A CG1  3 
ATOM 3282  C CG2  . VAL A 1 60 ? -4.805  4.418   4.656   1.00 0.00 ? 60 VAL A CG2  3 
ATOM 3283  H H    . VAL A 1 60 ? -2.289  3.855   3.793   1.00 0.00 ? 60 VAL A H    3 
ATOM 3284  H HA   . VAL A 1 60 ? -3.680  2.023   5.477   1.00 0.00 ? 60 VAL A HA   3 
ATOM 3285  H HB   . VAL A 1 60 ? -4.588  3.283   2.878   1.00 0.00 ? 60 VAL A HB   3 
ATOM 3286  H HG11 . VAL A 1 60 ? -6.159  2.038   5.131   1.00 0.00 ? 60 VAL A HG11 3 
ATOM 3287  H HG12 . VAL A 1 60 ? -6.856  2.921   3.773   1.00 0.00 ? 60 VAL A HG12 3 
ATOM 3288  H HG13 . VAL A 1 60 ? -5.989  1.411   3.491   1.00 0.00 ? 60 VAL A HG13 3 
ATOM 3289  H HG21 . VAL A 1 60 ? -3.806  4.801   4.811   1.00 0.00 ? 60 VAL A HG21 3 
ATOM 3290  H HG22 . VAL A 1 60 ? -5.371  5.119   4.062   1.00 0.00 ? 60 VAL A HG22 3 
ATOM 3291  H HG23 . VAL A 1 60 ? -5.290  4.281   5.611   1.00 0.00 ? 60 VAL A HG23 3 
ATOM 3292  N N    . ASP A 1 61 ? -3.037  1.099   2.368   1.00 0.00 ? 61 ASP A N    3 
ATOM 3293  C CA   . ASP A 1 61 ? -2.899  -0.040  1.478   1.00 0.00 ? 61 ASP A CA   3 
ATOM 3294  C C    . ASP A 1 61 ? -1.732  -0.936  1.887   1.00 0.00 ? 61 ASP A C    3 
ATOM 3295  O O    . ASP A 1 61 ? -1.633  -2.082  1.444   1.00 0.00 ? 61 ASP A O    3 
ATOM 3296  C CB   . ASP A 1 61 ? -2.692  0.458   0.049   1.00 0.00 ? 61 ASP A CB   3 
ATOM 3297  C CG   . ASP A 1 61 ? -3.876  1.256   -0.463  1.00 0.00 ? 61 ASP A CG   3 
ATOM 3298  O OD1  . ASP A 1 61 ? -4.832  1.467   0.313   1.00 0.00 ? 61 ASP A OD1  3 
ATOM 3299  O OD2  . ASP A 1 61 ? -3.847  1.673   -1.641  1.00 0.00 ? 61 ASP A OD2  3 
ATOM 3300  H H    . ASP A 1 61 ? -2.828  1.991   2.022   1.00 0.00 ? 61 ASP A H    3 
ATOM 3301  H HA   . ASP A 1 61 ? -3.813  -0.614  1.523   1.00 0.00 ? 61 ASP A HA   3 
ATOM 3302  H HB2  . ASP A 1 61 ? -1.809  1.093   0.016   1.00 0.00 ? 61 ASP A HB2  3 
ATOM 3303  H HB3  . ASP A 1 61 ? -2.543  -0.387  -0.599  1.00 0.00 ? 61 ASP A HB3  3 
ATOM 3304  N N    . ALA A 1 62 ? -0.848  -0.412  2.728   1.00 0.00 ? 62 ALA A N    3 
ATOM 3305  C CA   . ALA A 1 62 ? 0.302   -1.177  3.186   1.00 0.00 ? 62 ALA A CA   3 
ATOM 3306  C C    . ALA A 1 62 ? -0.149  -2.461  3.868   1.00 0.00 ? 62 ALA A C    3 
ATOM 3307  O O    . ALA A 1 62 ? 0.514   -3.491  3.776   1.00 0.00 ? 62 ALA A O    3 
ATOM 3308  C CB   . ALA A 1 62 ? 1.150   -0.338  4.131   1.00 0.00 ? 62 ALA A CB   3 
ATOM 3309  H H    . ALA A 1 62 ? -0.970  0.505   3.047   1.00 0.00 ? 62 ALA A H    3 
ATOM 3310  H HA   . ALA A 1 62 ? 0.903   -1.428  2.324   1.00 0.00 ? 62 ALA A HA   3 
ATOM 3311  H HB1  . ALA A 1 62 ? 0.686   0.627   4.270   1.00 0.00 ? 62 ALA A HB1  3 
ATOM 3312  H HB2  . ALA A 1 62 ? 1.231   -0.839  5.085   1.00 0.00 ? 62 ALA A HB2  3 
ATOM 3313  H HB3  . ALA A 1 62 ? 2.135   -0.206  3.710   1.00 0.00 ? 62 ALA A HB3  3 
ATOM 3314  N N    . ILE A 1 63 ? -1.290  -2.391  4.543   1.00 0.00 ? 63 ILE A N    3 
ATOM 3315  C CA   . ILE A 1 63 ? -1.841  -3.547  5.235   1.00 0.00 ? 63 ILE A CA   3 
ATOM 3316  C C    . ILE A 1 63 ? -2.058  -4.704  4.260   1.00 0.00 ? 63 ILE A C    3 
ATOM 3317  O O    . ILE A 1 63 ? -1.394  -5.735  4.365   1.00 0.00 ? 63 ILE A O    3 
ATOM 3318  C CB   . ILE A 1 63 ? -3.155  -3.187  5.960   1.00 0.00 ? 63 ILE A CB   3 
ATOM 3319  C CG1  . ILE A 1 63 ? -2.865  -2.195  7.086   1.00 0.00 ? 63 ILE A CG1  3 
ATOM 3320  C CG2  . ILE A 1 63 ? -3.834  -4.437  6.505   1.00 0.00 ? 63 ILE A CG2  3 
ATOM 3321  C CD1  . ILE A 1 63 ? -4.103  -1.745  7.829   1.00 0.00 ? 63 ILE A CD1  3 
ATOM 3322  H H    . ILE A 1 63 ? -1.777  -1.544  4.566   1.00 0.00 ? 63 ILE A H    3 
ATOM 3323  H HA   . ILE A 1 63 ? -1.119  -3.856  5.978   1.00 0.00 ? 63 ILE A HA   3 
ATOM 3324  H HB   . ILE A 1 63 ? -3.818  -2.721  5.249   1.00 0.00 ? 63 ILE A HB   3 
ATOM 3325  H HG12 . ILE A 1 63 ? -2.199  -2.657  7.800   1.00 0.00 ? 63 ILE A HG12 3 
ATOM 3326  H HG13 . ILE A 1 63 ? -2.388  -1.318  6.671   1.00 0.00 ? 63 ILE A HG13 3 
ATOM 3327  H HG21 . ILE A 1 63 ? -3.172  -4.933  7.199   1.00 0.00 ? 63 ILE A HG21 3 
ATOM 3328  H HG22 . ILE A 1 63 ? -4.745  -4.157  7.013   1.00 0.00 ? 63 ILE A HG22 3 
ATOM 3329  H HG23 . ILE A 1 63 ? -4.067  -5.105  5.690   1.00 0.00 ? 63 ILE A HG23 3 
ATOM 3330  H HD11 . ILE A 1 63 ? -4.897  -2.461  7.673   1.00 0.00 ? 63 ILE A HD11 3 
ATOM 3331  H HD12 . ILE A 1 63 ? -3.883  -1.675  8.884   1.00 0.00 ? 63 ILE A HD12 3 
ATOM 3332  H HD13 . ILE A 1 63 ? -4.413  -0.778  7.460   1.00 0.00 ? 63 ILE A HD13 3 
ATOM 3333  N N    . PRO A 1 64 ? -2.982  -4.564  3.291   1.00 0.00 ? 64 PRO A N    3 
ATOM 3334  C CA   . PRO A 1 64 ? -3.223  -5.620  2.319   1.00 0.00 ? 64 PRO A CA   3 
ATOM 3335  C C    . PRO A 1 64 ? -1.964  -5.921  1.525   1.00 0.00 ? 64 PRO A C    3 
ATOM 3336  O O    . PRO A 1 64 ? -1.772  -7.031  1.034   1.00 0.00 ? 64 PRO A O    3 
ATOM 3337  C CB   . PRO A 1 64 ? -4.327  -5.066  1.414   1.00 0.00 ? 64 PRO A CB   3 
ATOM 3338  C CG   . PRO A 1 64 ? -4.345  -3.595  1.663   1.00 0.00 ? 64 PRO A CG   3 
ATOM 3339  C CD   . PRO A 1 64 ? -3.847  -3.396  3.066   1.00 0.00 ? 64 PRO A CD   3 
ATOM 3340  H HA   . PRO A 1 64 ? -3.555  -6.522  2.800   1.00 0.00 ? 64 PRO A HA   3 
ATOM 3341  H HB2  . PRO A 1 64 ? -4.091  -5.284  0.385   1.00 0.00 ? 64 PRO A HB2  3 
ATOM 3342  H HB3  . PRO A 1 64 ? -5.272  -5.520  1.675   1.00 0.00 ? 64 PRO A HB3  3 
ATOM 3343  H HG2  . PRO A 1 64 ? -3.696  -3.097  0.959   1.00 0.00 ? 64 PRO A HG2  3 
ATOM 3344  H HG3  . PRO A 1 64 ? -5.356  -3.224  1.569   1.00 0.00 ? 64 PRO A HG3  3 
ATOM 3345  H HD2  . PRO A 1 64 ? -3.288  -2.476  3.143   1.00 0.00 ? 64 PRO A HD2  3 
ATOM 3346  H HD3  . PRO A 1 64 ? -4.676  -3.396  3.758   1.00 0.00 ? 64 PRO A HD3  3 
ATOM 3347  N N    . MET A 1 65 ? -1.085  -4.931  1.440   1.00 0.00 ? 65 MET A N    3 
ATOM 3348  C CA   . MET A 1 65 ? 0.181   -5.103  0.745   1.00 0.00 ? 65 MET A CA   3 
ATOM 3349  C C    . MET A 1 65 ? 1.091   -6.004  1.564   1.00 0.00 ? 65 MET A C    3 
ATOM 3350  O O    . MET A 1 65 ? 1.890   -6.765  1.023   1.00 0.00 ? 65 MET A O    3 
ATOM 3351  C CB   . MET A 1 65 ? 0.849   -3.756  0.511   1.00 0.00 ? 65 MET A CB   3 
ATOM 3352  C CG   . MET A 1 65 ? 0.281   -2.989  -0.666  1.00 0.00 ? 65 MET A CG   3 
ATOM 3353  S SD   . MET A 1 65 ? 0.401   -3.896  -2.222  1.00 0.00 ? 65 MET A SD   3 
ATOM 3354  C CE   . MET A 1 65 ? 2.176   -4.069  -2.387  1.00 0.00 ? 65 MET A CE   3 
ATOM 3355  H H    . MET A 1 65 ? -1.279  -4.075  1.883   1.00 0.00 ? 65 MET A H    3 
ATOM 3356  H HA   . MET A 1 65 ? -0.019  -5.574  -0.206  1.00 0.00 ? 65 MET A HA   3 
ATOM 3357  H HB2  . MET A 1 65 ? 0.721   -3.154  1.395   1.00 0.00 ? 65 MET A HB2  3 
ATOM 3358  H HB3  . MET A 1 65 ? 1.893   -3.912  0.345   1.00 0.00 ? 65 MET A HB3  3 
ATOM 3359  H HG2  . MET A 1 65 ? -0.754  -2.786  -0.467  1.00 0.00 ? 65 MET A HG2  3 
ATOM 3360  H HG3  . MET A 1 65 ? 0.816   -2.057  -0.765  1.00 0.00 ? 65 MET A HG3  3 
ATOM 3361  H HE1  . MET A 1 65 ? 2.640   -3.960  -1.418  1.00 0.00 ? 65 MET A HE1  3 
ATOM 3362  H HE2  . MET A 1 65 ? 2.406   -5.044  -2.788  1.00 0.00 ? 65 MET A HE2  3 
ATOM 3363  H HE3  . MET A 1 65 ? 2.552   -3.307  -3.053  1.00 0.00 ? 65 MET A HE3  3 
ATOM 3364  N N    . ILE A 1 66 ? 0.934   -5.922  2.878   1.00 0.00 ? 66 ILE A N    3 
ATOM 3365  C CA   . ILE A 1 66 ? 1.713   -6.738  3.801   1.00 0.00 ? 66 ILE A CA   3 
ATOM 3366  C C    . ILE A 1 66 ? 1.181   -8.167  3.791   1.00 0.00 ? 66 ILE A C    3 
ATOM 3367  O O    . ILE A 1 66 ? 1.947   -9.125  3.700   1.00 0.00 ? 66 ILE A O    3 
ATOM 3368  C CB   . ILE A 1 66 ? 1.668   -6.155  5.239   1.00 0.00 ? 66 ILE A CB   3 
ATOM 3369  C CG1  . ILE A 1 66 ? 2.525   -4.892  5.317   1.00 0.00 ? 66 ILE A CG1  3 
ATOM 3370  C CG2  . ILE A 1 66 ? 2.133   -7.168  6.279   1.00 0.00 ? 66 ILE A CG2  3 
ATOM 3371  C CD1  . ILE A 1 66 ? 2.420   -4.172  6.644   1.00 0.00 ? 66 ILE A CD1  3 
ATOM 3372  H H    . ILE A 1 66 ? 0.261   -5.307  3.235   1.00 0.00 ? 66 ILE A H    3 
ATOM 3373  H HA   . ILE A 1 66 ? 2.742   -6.742  3.464   1.00 0.00 ? 66 ILE A HA   3 
ATOM 3374  H HB   . ILE A 1 66 ? 0.648   -5.896  5.467   1.00 0.00 ? 66 ILE A HB   3 
ATOM 3375  H HG12 . ILE A 1 66 ? 3.560   -5.159  5.169   1.00 0.00 ? 66 ILE A HG12 3 
ATOM 3376  H HG13 . ILE A 1 66 ? 2.223   -4.208  4.541   1.00 0.00 ? 66 ILE A HG13 3 
ATOM 3377  H HG21 . ILE A 1 66 ? 1.750   -8.146  6.032   1.00 0.00 ? 66 ILE A HG21 3 
ATOM 3378  H HG22 . ILE A 1 66 ? 3.212   -7.197  6.297   1.00 0.00 ? 66 ILE A HG22 3 
ATOM 3379  H HG23 . ILE A 1 66 ? 1.764   -6.873  7.251   1.00 0.00 ? 66 ILE A HG23 3 
ATOM 3380  H HD11 . ILE A 1 66 ? 1.389   -3.899  6.824   1.00 0.00 ? 66 ILE A HD11 3 
ATOM 3381  H HD12 . ILE A 1 66 ? 2.763   -4.821  7.436   1.00 0.00 ? 66 ILE A HD12 3 
ATOM 3382  H HD13 . ILE A 1 66 ? 3.028   -3.281  6.619   1.00 0.00 ? 66 ILE A HD13 3 
ATOM 3383  N N    . ALA A 1 67 ? -0.138  -8.299  3.872   1.00 0.00 ? 67 ALA A N    3 
ATOM 3384  C CA   . ALA A 1 67 ? -0.771  -9.606  3.861   1.00 0.00 ? 67 ALA A CA   3 
ATOM 3385  C C    . ALA A 1 67 ? -0.601  -10.270 2.502   1.00 0.00 ? 67 ALA A C    3 
ATOM 3386  O O    . ALA A 1 67 ? -0.094  -11.387 2.403   1.00 0.00 ? 67 ALA A O    3 
ATOM 3387  C CB   . ALA A 1 67 ? -2.244  -9.486  4.221   1.00 0.00 ? 67 ALA A CB   3 
ATOM 3388  H H    . ALA A 1 67 ? -0.696  -7.500  3.932   1.00 0.00 ? 67 ALA A H    3 
ATOM 3389  H HA   . ALA A 1 67 ? -0.289  -10.210 4.610   1.00 0.00 ? 67 ALA A HA   3 
ATOM 3390  H HB1  . ALA A 1 67 ? -2.407  -8.571  4.770   1.00 0.00 ? 67 ALA A HB1  3 
ATOM 3391  H HB2  . ALA A 1 67 ? -2.835  -9.474  3.317   1.00 0.00 ? 67 ALA A HB2  3 
ATOM 3392  H HB3  . ALA A 1 67 ? -2.535  -10.329 4.829   1.00 0.00 ? 67 ALA A HB3  3 
ATOM 3393  N N    . VAL A 1 68 ? -1.017  -9.569  1.454   1.00 0.00 ? 68 VAL A N    3 
ATOM 3394  C CA   . VAL A 1 68 ? -0.895  -10.087 0.101   1.00 0.00 ? 68 VAL A CA   3 
ATOM 3395  C C    . VAL A 1 68 ? 0.572   -10.188 -0.297  1.00 0.00 ? 68 VAL A C    3 
ATOM 3396  O O    . VAL A 1 68 ? 0.988   -11.161 -0.921  1.00 0.00 ? 68 VAL A O    3 
ATOM 3397  C CB   . VAL A 1 68 ? -1.640  -9.202  -0.921  1.00 0.00 ? 68 VAL A CB   3 
ATOM 3398  C CG1  . VAL A 1 68 ? -1.505  -9.781  -2.317  1.00 0.00 ? 68 VAL A CG1  3 
ATOM 3399  C CG2  . VAL A 1 68 ? -3.107  -9.055  -0.541  1.00 0.00 ? 68 VAL A CG2  3 
ATOM 3400  H H    . VAL A 1 68 ? -1.404  -8.682  1.594   1.00 0.00 ? 68 VAL A H    3 
ATOM 3401  H HA   . VAL A 1 68 ? -1.334  -11.076 0.081   1.00 0.00 ? 68 VAL A HA   3 
ATOM 3402  H HB   . VAL A 1 68 ? -1.186  -8.220  -0.918  1.00 0.00 ? 68 VAL A HB   3 
ATOM 3403  H HG11 . VAL A 1 68 ? -1.729  -10.838 -2.291  1.00 0.00 ? 68 VAL A HG11 3 
ATOM 3404  H HG12 . VAL A 1 68 ? -2.195  -9.285  -2.984  1.00 0.00 ? 68 VAL A HG12 3 
ATOM 3405  H HG13 . VAL A 1 68 ? -0.495  -9.637  -2.670  1.00 0.00 ? 68 VAL A HG13 3 
ATOM 3406  H HG21 . VAL A 1 68 ? -3.396  -9.872  0.103   1.00 0.00 ? 68 VAL A HG21 3 
ATOM 3407  H HG22 . VAL A 1 68 ? -3.253  -8.121  -0.022  1.00 0.00 ? 68 VAL A HG22 3 
ATOM 3408  H HG23 . VAL A 1 68 ? -3.713  -9.067  -1.434  1.00 0.00 ? 68 VAL A HG23 3 
ATOM 3409  N N    . GLY A 1 69 ? 1.356   -9.180  0.075   1.00 0.00 ? 69 GLY A N    3 
ATOM 3410  C CA   . GLY A 1 69 ? 2.771   -9.187  -0.251  1.00 0.00 ? 69 GLY A CA   3 
ATOM 3411  C C    . GLY A 1 69 ? 3.498   -10.333 0.418   1.00 0.00 ? 69 GLY A C    3 
ATOM 3412  O O    . GLY A 1 69 ? 4.342   -10.980 -0.196  1.00 0.00 ? 69 GLY A O    3 
ATOM 3413  H H    . GLY A 1 69 ? 0.973   -8.430  0.577   1.00 0.00 ? 69 GLY A H    3 
ATOM 3414  H HA2  . GLY A 1 69 ? 2.882   -9.278  -1.324  1.00 0.00 ? 69 GLY A HA2  3 
ATOM 3415  H HA3  . GLY A 1 69 ? 3.217   -8.255  0.067   1.00 0.00 ? 69 GLY A HA3  3 
ATOM 3416  N N    . LEU A 1 70 ? 3.167   -10.590 1.681   1.00 0.00 ? 70 LEU A N    3 
ATOM 3417  C CA   . LEU A 1 70 ? 3.796   -11.675 2.422   1.00 0.00 ? 70 LEU A CA   3 
ATOM 3418  C C    . LEU A 1 70 ? 3.370   -13.012 1.833   1.00 0.00 ? 70 LEU A C    3 
ATOM 3419  O O    . LEU A 1 70 ? 4.195   -13.895 1.604   1.00 0.00 ? 70 LEU A O    3 
ATOM 3420  C CB   . LEU A 1 70 ? 3.419   -11.609 3.908   1.00 0.00 ? 70 LEU A CB   3 
ATOM 3421  C CG   . LEU A 1 70 ? 4.245   -12.508 4.836   1.00 0.00 ? 70 LEU A CG   3 
ATOM 3422  C CD1  . LEU A 1 70 ? 3.899   -12.234 6.291   1.00 0.00 ? 70 LEU A CD1  3 
ATOM 3423  C CD2  . LEU A 1 70 ? 4.020   -13.977 4.509   1.00 0.00 ? 70 LEU A CD2  3 
ATOM 3424  H H    . LEU A 1 70 ? 2.483   -10.043 2.119   1.00 0.00 ? 70 LEU A H    3 
ATOM 3425  H HA   . LEU A 1 70 ? 4.866   -11.571 2.323   1.00 0.00 ? 70 LEU A HA   3 
ATOM 3426  H HB2  . LEU A 1 70 ? 3.531   -10.589 4.239   1.00 0.00 ? 70 LEU A HB2  3 
ATOM 3427  H HB3  . LEU A 1 70 ? 2.381   -11.889 4.007   1.00 0.00 ? 70 LEU A HB3  3 
ATOM 3428  H HG   . LEU A 1 70 ? 5.294   -12.288 4.696   1.00 0.00 ? 70 LEU A HG   3 
ATOM 3429  H HD11 . LEU A 1 70 ? 3.609   -11.201 6.405   1.00 0.00 ? 70 LEU A HD11 3 
ATOM 3430  H HD12 . LEU A 1 70 ? 3.082   -12.873 6.593   1.00 0.00 ? 70 LEU A HD12 3 
ATOM 3431  H HD13 . LEU A 1 70 ? 4.761   -12.436 6.910   1.00 0.00 ? 70 LEU A HD13 3 
ATOM 3432  H HD21 . LEU A 1 70 ? 2.997   -14.125 4.193   1.00 0.00 ? 70 LEU A HD21 3 
ATOM 3433  H HD22 . LEU A 1 70 ? 4.690   -14.276 3.715   1.00 0.00 ? 70 LEU A HD22 3 
ATOM 3434  H HD23 . LEU A 1 70 ? 4.217   -14.576 5.389   1.00 0.00 ? 70 LEU A HD23 3 
ATOM 3435  N N    . GLY A 1 71 ? 2.072   -13.147 1.587   1.00 0.00 ? 71 GLY A N    3 
ATOM 3436  C CA   . GLY A 1 71 ? 1.547   -14.377 1.023   1.00 0.00 ? 71 GLY A CA   3 
ATOM 3437  C C    . GLY A 1 71 ? 2.084   -14.659 -0.366  1.00 0.00 ? 71 GLY A C    3 
ATOM 3438  O O    . GLY A 1 71 ? 2.471   -15.785 -0.672  1.00 0.00 ? 71 GLY A O    3 
ATOM 3439  H H    . GLY A 1 71 ? 1.464   -12.401 1.793   1.00 0.00 ? 71 GLY A H    3 
ATOM 3440  H HA2  . GLY A 1 71 ? 1.813   -15.198 1.674   1.00 0.00 ? 71 GLY A HA2  3 
ATOM 3441  H HA3  . GLY A 1 71 ? 0.470   -14.308 0.974   1.00 0.00 ? 71 GLY A HA3  3 
ATOM 3442  N N    . LEU A 1 72 ? 2.113   -13.635 -1.210  1.00 0.00 ? 72 LEU A N    3 
ATOM 3443  C CA   . LEU A 1 72 ? 2.613   -13.786 -2.569  1.00 0.00 ? 72 LEU A CA   3 
ATOM 3444  C C    . LEU A 1 72 ? 4.131   -13.911 -2.562  1.00 0.00 ? 72 LEU A C    3 
ATOM 3445  O O    . LEU A 1 72 ? 4.714   -14.586 -3.408  1.00 0.00 ? 72 LEU A O    3 
ATOM 3446  C CB   . LEU A 1 72 ? 2.186   -12.602 -3.438  1.00 0.00 ? 72 LEU A CB   3 
ATOM 3447  C CG   . LEU A 1 72 ? 0.674   -12.396 -3.561  1.00 0.00 ? 72 LEU A CG   3 
ATOM 3448  C CD1  . LEU A 1 72 ? 0.369   -11.194 -4.443  1.00 0.00 ? 72 LEU A CD1  3 
ATOM 3449  C CD2  . LEU A 1 72 ? 0.003   -13.643 -4.116  1.00 0.00 ? 72 LEU A CD2  3 
ATOM 3450  H H    . LEU A 1 72 ? 1.797   -12.762 -0.911  1.00 0.00 ? 72 LEU A H    3 
ATOM 3451  H HA   . LEU A 1 72 ? 2.195   -14.693 -2.978  1.00 0.00 ? 72 LEU A HA   3 
ATOM 3452  H HB2  . LEU A 1 72 ? 2.619   -11.704 -3.025  1.00 0.00 ? 72 LEU A HB2  3 
ATOM 3453  H HB3  . LEU A 1 72 ? 2.586   -12.751 -4.429  1.00 0.00 ? 72 LEU A HB3  3 
ATOM 3454  H HG   . LEU A 1 72 ? 0.264   -12.204 -2.581  1.00 0.00 ? 72 LEU A HG   3 
ATOM 3455  H HD11 . LEU A 1 72 ? 1.105   -10.422 -4.271  1.00 0.00 ? 72 LEU A HD11 3 
ATOM 3456  H HD12 . LEU A 1 72 ? 0.397   -11.493 -5.480  1.00 0.00 ? 72 LEU A HD12 3 
ATOM 3457  H HD13 . LEU A 1 72 ? -0.612  -10.815 -4.206  1.00 0.00 ? 72 LEU A HD13 3 
ATOM 3458  H HD21 . LEU A 1 72 ? 0.357   -14.512 -3.581  1.00 0.00 ? 72 LEU A HD21 3 
ATOM 3459  H HD22 . LEU A 1 72 ? -1.069  -13.560 -3.996  1.00 0.00 ? 72 LEU A HD22 3 
ATOM 3460  H HD23 . LEU A 1 72 ? 0.240   -13.742 -5.165  1.00 0.00 ? 72 LEU A HD23 3 
ATOM 3461  N N    . TYR A 1 73 ? 4.767   -13.277 -1.581  1.00 0.00 ? 73 TYR A N    3 
ATOM 3462  C CA   . TYR A 1 73 ? 6.218   -13.335 -1.456  1.00 0.00 ? 73 TYR A CA   3 
ATOM 3463  C C    . TYR A 1 73 ? 6.654   -14.784 -1.320  1.00 0.00 ? 73 TYR A C    3 
ATOM 3464  O O    . TYR A 1 73 ? 7.567   -15.239 -2.001  1.00 0.00 ? 73 TYR A O    3 
ATOM 3465  C CB   . TYR A 1 73 ? 6.693   -12.533 -0.238  1.00 0.00 ? 73 TYR A CB   3 
ATOM 3466  C CG   . TYR A 1 73 ? 8.190   -12.579 -0.030  1.00 0.00 ? 73 TYR A CG   3 
ATOM 3467  C CD1  . TYR A 1 73 ? 9.046   -11.814 -0.814  1.00 0.00 ? 73 TYR A CD1  3 
ATOM 3468  C CD2  . TYR A 1 73 ? 8.749   -13.405 0.937   1.00 0.00 ? 73 TYR A CD2  3 
ATOM 3469  C CE1  . TYR A 1 73 ? 10.417  -11.871 -0.638  1.00 0.00 ? 73 TYR A CE1  3 
ATOM 3470  C CE2  . TYR A 1 73 ? 10.119  -13.466 1.120   1.00 0.00 ? 73 TYR A CE2  3 
ATOM 3471  C CZ   . TYR A 1 73 ? 10.946  -12.697 0.331   1.00 0.00 ? 73 TYR A CZ   3 
ATOM 3472  O OH   . TYR A 1 73 ? 12.308  -12.755 0.512   1.00 0.00 ? 73 TYR A OH   3 
ATOM 3473  H H    . TYR A 1 73 ? 4.248   -12.779 -0.920  1.00 0.00 ? 73 TYR A H    3 
ATOM 3474  H HA   . TYR A 1 73 ? 6.653   -12.916 -2.357  1.00 0.00 ? 73 TYR A HA   3 
ATOM 3475  H HB2  . TYR A 1 73 ? 6.413   -11.499 -0.364  1.00 0.00 ? 73 TYR A HB2  3 
ATOM 3476  H HB3  . TYR A 1 73 ? 6.220   -12.925 0.652   1.00 0.00 ? 73 TYR A HB3  3 
ATOM 3477  H HD1  . TYR A 1 73 ? 8.626   -11.164 -1.570  1.00 0.00 ? 73 TYR A HD1  3 
ATOM 3478  H HD2  . TYR A 1 73 ? 8.095   -14.007 1.553   1.00 0.00 ? 73 TYR A HD2  3 
ATOM 3479  H HE1  . TYR A 1 73 ? 11.067  -11.270 -1.257  1.00 0.00 ? 73 TYR A HE1  3 
ATOM 3480  H HE2  . TYR A 1 73 ? 10.536  -14.113 1.878   1.00 0.00 ? 73 TYR A HE2  3 
ATOM 3481  H HH   . TYR A 1 73 ? 12.519  -12.526 1.420   1.00 0.00 ? 73 TYR A HH   3 
ATOM 3482  N N    . VAL A 1 74 ? 5.973   -15.506 -0.441  1.00 0.00 ? 74 VAL A N    3 
ATOM 3483  C CA   . VAL A 1 74 ? 6.267   -16.910 -0.218  1.00 0.00 ? 74 VAL A CA   3 
ATOM 3484  C C    . VAL A 1 74 ? 5.661   -17.765 -1.330  1.00 0.00 ? 74 VAL A C    3 
ATOM 3485  O O    . VAL A 1 74 ? 6.234   -18.776 -1.730  1.00 0.00 ? 74 VAL A O    3 
ATOM 3486  C CB   . VAL A 1 74 ? 5.745   -17.380 1.161   1.00 0.00 ? 74 VAL A CB   3 
ATOM 3487  C CG1  . VAL A 1 74 ? 4.258   -17.096 1.306   1.00 0.00 ? 74 VAL A CG1  3 
ATOM 3488  C CG2  . VAL A 1 74 ? 6.035   -18.859 1.385   1.00 0.00 ? 74 VAL A CG2  3 
ATOM 3489  H H    . VAL A 1 74 ? 5.246   -15.085 0.062   1.00 0.00 ? 74 VAL A H    3 
ATOM 3490  H HA   . VAL A 1 74 ? 7.344   -17.030 -0.230  1.00 0.00 ? 74 VAL A HA   3 
ATOM 3491  H HB   . VAL A 1 74 ? 6.265   -16.818 1.924   1.00 0.00 ? 74 VAL A HB   3 
ATOM 3492  H HG11 . VAL A 1 74 ? 3.786   -17.154 0.341   1.00 0.00 ? 74 VAL A HG11 3 
ATOM 3493  H HG12 . VAL A 1 74 ? 3.816   -17.826 1.968   1.00 0.00 ? 74 VAL A HG12 3 
ATOM 3494  H HG13 . VAL A 1 74 ? 4.119   -16.108 1.717   1.00 0.00 ? 74 VAL A HG13 3 
ATOM 3495  H HG21 . VAL A 1 74 ? 6.181   -19.347 0.433   1.00 0.00 ? 74 VAL A HG21 3 
ATOM 3496  H HG22 . VAL A 1 74 ? 6.927   -18.963 1.985   1.00 0.00 ? 74 VAL A HG22 3 
ATOM 3497  H HG23 . VAL A 1 74 ? 5.199   -19.315 1.899   1.00 0.00 ? 74 VAL A HG23 3 
ATOM 3498  N N    . MET A 1 75 ? 4.506   -17.351 -1.842  1.00 0.00 ? 75 MET A N    3 
ATOM 3499  C CA   . MET A 1 75 ? 3.854   -18.102 -2.909  1.00 0.00 ? 75 MET A CA   3 
ATOM 3500  C C    . MET A 1 75 ? 4.614   -18.005 -4.233  1.00 0.00 ? 75 MET A C    3 
ATOM 3501  O O    . MET A 1 75 ? 5.265   -18.955 -4.650  1.00 0.00 ? 75 MET A O    3 
ATOM 3502  C CB   . MET A 1 75 ? 2.411   -17.635 -3.094  1.00 0.00 ? 75 MET A CB   3 
ATOM 3503  C CG   . MET A 1 75 ? 1.396   -18.465 -2.321  1.00 0.00 ? 75 MET A CG   3 
ATOM 3504  S SD   . MET A 1 75 ? 1.763   -18.577 -0.561  1.00 0.00 ? 75 MET A SD   3 
ATOM 3505  C CE   . MET A 1 75 ? 0.367   -19.542 0.011   1.00 0.00 ? 75 MET A CE   3 
ATOM 3506  H H    . MET A 1 75 ? 4.088   -16.524 -1.502  1.00 0.00 ? 75 MET A H    3 
ATOM 3507  H HA   . MET A 1 75 ? 3.839   -19.136 -2.603  1.00 0.00 ? 75 MET A HA   3 
ATOM 3508  H HB2  . MET A 1 75 ? 2.333   -16.612 -2.763  1.00 0.00 ? 75 MET A HB2  3 
ATOM 3509  H HB3  . MET A 1 75 ? 2.161   -17.686 -4.143  1.00 0.00 ? 75 MET A HB3  3 
ATOM 3510  H HG2  . MET A 1 75 ? 0.423   -18.016 -2.439  1.00 0.00 ? 75 MET A HG2  3 
ATOM 3511  H HG3  . MET A 1 75 ? 1.380   -19.464 -2.734  1.00 0.00 ? 75 MET A HG3  3 
ATOM 3512  H HE1  . MET A 1 75 ? -0.544  -19.145 -0.412  1.00 0.00 ? 75 MET A HE1  3 
ATOM 3513  H HE2  . MET A 1 75 ? 0.489   -20.570 -0.299  1.00 0.00 ? 75 MET A HE2  3 
ATOM 3514  H HE3  . MET A 1 75 ? 0.314   -19.496 1.090   1.00 0.00 ? 75 MET A HE3  3 
ATOM 3515  N N    . PHE A 1 76 ? 4.528   -16.864 -4.902  1.00 0.00 ? 76 PHE A N    3 
ATOM 3516  C CA   . PHE A 1 76 ? 5.202   -16.698 -6.188  1.00 0.00 ? 76 PHE A CA   3 
ATOM 3517  C C    . PHE A 1 76 ? 6.708   -16.952 -6.104  1.00 0.00 ? 76 PHE A C    3 
ATOM 3518  O O    . PHE A 1 76 ? 7.323   -17.358 -7.089  1.00 0.00 ? 76 PHE A O    3 
ATOM 3519  C CB   . PHE A 1 76 ? 4.963   -15.297 -6.760  1.00 0.00 ? 76 PHE A CB   3 
ATOM 3520  C CG   . PHE A 1 76 ? 3.572   -15.067 -7.282  1.00 0.00 ? 76 PHE A CG   3 
ATOM 3521  C CD1  . PHE A 1 76 ? 3.018   -15.910 -8.235  1.00 0.00 ? 76 PHE A CD1  3 
ATOM 3522  C CD2  . PHE A 1 76 ? 2.820   -14.003 -6.821  1.00 0.00 ? 76 PHE A CD2  3 
ATOM 3523  C CE1  . PHE A 1 76 ? 1.739   -15.692 -8.710  1.00 0.00 ? 76 PHE A CE1  3 
ATOM 3524  C CE2  . PHE A 1 76 ? 1.542   -13.780 -7.292  1.00 0.00 ? 76 PHE A CE2  3 
ATOM 3525  C CZ   . PHE A 1 76 ? 1.000   -14.626 -8.237  1.00 0.00 ? 76 PHE A CZ   3 
ATOM 3526  H H    . PHE A 1 76 ? 3.989   -16.129 -4.540  1.00 0.00 ? 76 PHE A H    3 
ATOM 3527  H HA   . PHE A 1 76 ? 4.775   -17.427 -6.864  1.00 0.00 ? 76 PHE A HA   3 
ATOM 3528  H HB2  . PHE A 1 76 ? 5.144   -14.567 -5.985  1.00 0.00 ? 76 PHE A HB2  3 
ATOM 3529  H HB3  . PHE A 1 76 ? 5.656   -15.129 -7.569  1.00 0.00 ? 76 PHE A HB3  3 
ATOM 3530  H HD1  . PHE A 1 76 ? 3.595   -16.744 -8.604  1.00 0.00 ? 76 PHE A HD1  3 
ATOM 3531  H HD2  . PHE A 1 76 ? 3.245   -13.340 -6.084  1.00 0.00 ? 76 PHE A HD2  3 
ATOM 3532  H HE1  . PHE A 1 76 ? 1.318   -16.354 -9.452  1.00 0.00 ? 76 PHE A HE1  3 
ATOM 3533  H HE2  . PHE A 1 76 ? 0.967   -12.945 -6.920  1.00 0.00 ? 76 PHE A HE2  3 
ATOM 3534  H HZ   . PHE A 1 76 ? 0.000   -14.454 -8.606  1.00 0.00 ? 76 PHE A HZ   3 
ATOM 3535  N N    . ALA A 1 77 ? 7.307   -16.688 -4.949  1.00 0.00 ? 77 ALA A N    3 
ATOM 3536  C CA   . ALA A 1 77 ? 8.745   -16.868 -4.791  1.00 0.00 ? 77 ALA A CA   3 
ATOM 3537  C C    . ALA A 1 77 ? 9.114   -18.238 -4.234  1.00 0.00 ? 77 ALA A C    3 
ATOM 3538  O O    . ALA A 1 77 ? 9.930   -18.956 -4.813  1.00 0.00 ? 77 ALA A O    3 
ATOM 3539  C CB   . ALA A 1 77 ? 9.320   -15.766 -3.915  1.00 0.00 ? 77 ALA A CB   3 
ATOM 3540  H H    . ALA A 1 77 ? 6.783   -16.344 -4.202  1.00 0.00 ? 77 ALA A H    3 
ATOM 3541  H HA   . ALA A 1 77 ? 9.186   -16.772 -5.761  1.00 0.00 ? 77 ALA A HA   3 
ATOM 3542  H HB1  . ALA A 1 77 ? 8.652   -14.919 -3.920  1.00 0.00 ? 77 ALA A HB1  3 
ATOM 3543  H HB2  . ALA A 1 77 ? 9.431   -16.131 -2.904  1.00 0.00 ? 77 ALA A HB2  3 
ATOM 3544  H HB3  . ALA A 1 77 ? 10.285  -15.467 -4.298  1.00 0.00 ? 77 ALA A HB3  3 
ATOM 3545  N N    . VAL A 1 78 ? 8.531   -18.584 -3.100  1.00 0.00 ? 78 VAL A N    3 
ATOM 3546  C CA   . VAL A 1 78 ? 8.821   -19.858 -2.452  1.00 0.00 ? 78 VAL A CA   3 
ATOM 3547  C C    . VAL A 1 78 ? 7.851   -20.961 -2.884  1.00 0.00 ? 78 VAL A C    3 
ATOM 3548  O O    . VAL A 1 78 ? 8.067   -22.136 -2.586  1.00 0.00 ? 78 VAL A O    3 
ATOM 3549  C CB   . VAL A 1 78 ? 8.790   -19.724 -0.913  1.00 0.00 ? 78 VAL A CB   3 
ATOM 3550  C CG1  . VAL A 1 78 ? 9.342   -20.973 -0.244  1.00 0.00 ? 78 VAL A CG1  3 
ATOM 3551  C CG2  . VAL A 1 78 ? 9.562   -18.490 -0.471  1.00 0.00 ? 78 VAL A CG2  3 
ATOM 3552  H H    . VAL A 1 78 ? 7.909   -17.964 -2.683  1.00 0.00 ? 78 VAL A H    3 
ATOM 3553  H HA   . VAL A 1 78 ? 9.817   -20.143 -2.740  1.00 0.00 ? 78 VAL A HA   3 
ATOM 3554  H HB   . VAL A 1 78 ? 7.767   -19.609 -0.599  1.00 0.00 ? 78 VAL A HB   3 
ATOM 3555  H HG11 . VAL A 1 78 ? 9.173   -21.830 -0.877  1.00 0.00 ? 78 VAL A HG11 3 
ATOM 3556  H HG12 . VAL A 1 78 ? 10.402  -20.854 -0.076  1.00 0.00 ? 78 VAL A HG12 3 
ATOM 3557  H HG13 . VAL A 1 78 ? 8.845   -21.123 0.704   1.00 0.00 ? 78 VAL A HG13 3 
ATOM 3558  H HG21 . VAL A 1 78 ? 9.125   -17.612 -0.923  1.00 0.00 ? 78 VAL A HG21 3 
ATOM 3559  H HG22 . VAL A 1 78 ? 9.513   -18.402 0.605   1.00 0.00 ? 78 VAL A HG22 3 
ATOM 3560  H HG23 . VAL A 1 78 ? 10.592  -18.581 -0.778  1.00 0.00 ? 78 VAL A HG23 3 
ATOM 3561  N N    . ALA A 1 79 ? 6.788   -20.592 -3.594  1.00 0.00 ? 79 ALA A N    3 
ATOM 3562  C CA   . ALA A 1 79 ? 5.809   -21.574 -4.051  1.00 0.00 ? 79 ALA A CA   3 
ATOM 3563  C C    . ALA A 1 79 ? 5.198   -22.327 -2.875  1.00 0.00 ? 79 ALA A C    3 
ATOM 3564  O O    . ALA A 1 79 ? 5.219   -21.848 -1.741  1.00 0.00 ? 79 ALA A O    3 
ATOM 3565  C CB   . ALA A 1 79 ? 6.456   -22.549 -5.024  1.00 0.00 ? 79 ALA A CB   3 
ATOM 3566  H H    . ALA A 1 79 ? 6.658   -19.644 -3.816  1.00 0.00 ? 79 ALA A H    3 
ATOM 3567  H HA   . ALA A 1 79 ? 5.024   -21.050 -4.574  1.00 0.00 ? 79 ALA A HA   3 
ATOM 3568  H HB1  . ALA A 1 79 ? 7.530   -22.470 -4.953  1.00 0.00 ? 79 ALA A HB1  3 
ATOM 3569  H HB2  . ALA A 1 79 ? 6.153   -23.557 -4.781  1.00 0.00 ? 79 ALA A HB2  3 
ATOM 3570  H HB3  . ALA A 1 79 ? 6.144   -22.313 -6.032  1.00 0.00 ? 79 ALA A HB3  3 
ATOM 3571  N N    . MET A 1 1  ? -6.705  -29.536 0.679   1.00 0.00 ? 1  MET A N    4 
ATOM 3572  C CA   . MET A 1 1  ? -6.876  -28.099 1.052   1.00 0.00 ? 1  MET A CA   4 
ATOM 3573  C C    . MET A 1 1  ? -5.870  -27.178 0.356   1.00 0.00 ? 1  MET A C    4 
ATOM 3574  O O    . MET A 1 1  ? -5.965  -25.956 0.467   1.00 0.00 ? 1  MET A O    4 
ATOM 3575  C CB   . MET A 1 1  ? -6.736  -27.962 2.571   1.00 0.00 ? 1  MET A CB   4 
ATOM 3576  C CG   . MET A 1 1  ? -7.807  -28.696 3.357   1.00 0.00 ? 1  MET A CG   4 
ATOM 3577  S SD   . MET A 1 1  ? -7.620  -28.495 5.138   1.00 0.00 ? 1  MET A SD   4 
ATOM 3578  C CE   . MET A 1 1  ? -5.979  -29.169 5.383   1.00 0.00 ? 1  MET A CE   4 
ATOM 3579  H H1   . MET A 1 1  ? -5.761  -29.656 0.272   1.00 0.00 ? 1  MET A H1   4 
ATOM 3580  H H2   . MET A 1 1  ? -6.812  -30.106 1.541   1.00 0.00 ? 1  MET A H2   4 
ATOM 3581  H H3   . MET A 1 1  ? -7.443  -29.770 -0.015  1.00 0.00 ? 1  MET A H3   4 
ATOM 3582  H HA   . MET A 1 1  ? -7.868  -27.797 0.767   1.00 0.00 ? 1  MET A HA   4 
ATOM 3583  H HB2  . MET A 1 1  ? -5.774  -28.350 2.868   1.00 0.00 ? 1  MET A HB2  4 
ATOM 3584  H HB3  . MET A 1 1  ? -6.786  -26.917 2.830   1.00 0.00 ? 1  MET A HB3  4 
ATOM 3585  H HG2  . MET A 1 1  ? -8.774  -28.315 3.066   1.00 0.00 ? 1  MET A HG2  4 
ATOM 3586  H HG3  . MET A 1 1  ? -7.750  -29.745 3.120   1.00 0.00 ? 1  MET A HG3  4 
ATOM 3587  H HE1  . MET A 1 1  ? -5.763  -29.880 4.600   1.00 0.00 ? 1  MET A HE1  4 
ATOM 3588  H HE2  . MET A 1 1  ? -5.255  -28.369 5.354   1.00 0.00 ? 1  MET A HE2  4 
ATOM 3589  H HE3  . MET A 1 1  ? -5.932  -29.663 6.341   1.00 0.00 ? 1  MET A HE3  4 
ATOM 3590  N N    . GLU A 1 2  ? -4.912  -27.758 -0.356  1.00 0.00 ? 2  GLU A N    4 
ATOM 3591  C CA   . GLU A 1 2  ? -3.902  -26.977 -1.057  1.00 0.00 ? 2  GLU A CA   4 
ATOM 3592  C C    . GLU A 1 2  ? -4.524  -26.173 -2.193  1.00 0.00 ? 2  GLU A C    4 
ATOM 3593  O O    . GLU A 1 2  ? -4.382  -24.951 -2.258  1.00 0.00 ? 2  GLU A O    4 
ATOM 3594  C CB   . GLU A 1 2  ? -2.811  -27.897 -1.609  1.00 0.00 ? 2  GLU A CB   4 
ATOM 3595  C CG   . GLU A 1 2  ? -1.703  -27.160 -2.341  1.00 0.00 ? 2  GLU A CG   4 
ATOM 3596  C CD   . GLU A 1 2  ? -0.925  -26.220 -1.441  1.00 0.00 ? 2  GLU A CD   4 
ATOM 3597  O OE1  . GLU A 1 2  ? -1.257  -26.135 -0.239  1.00 0.00 ? 2  GLU A OE1  4 
ATOM 3598  O OE2  . GLU A 1 2  ? 0.017   -25.567 -1.937  1.00 0.00 ? 2  GLU A OE2  4 
ATOM 3599  H H    . GLU A 1 2  ? -4.883  -28.731 -0.411  1.00 0.00 ? 2  GLU A H    4 
ATOM 3600  H HA   . GLU A 1 2  ? -3.462  -26.293 -0.349  1.00 0.00 ? 2  GLU A HA   4 
ATOM 3601  H HB2  . GLU A 1 2  ? -2.369  -28.445 -0.790  1.00 0.00 ? 2  GLU A HB2  4 
ATOM 3602  H HB3  . GLU A 1 2  ? -3.261  -28.599 -2.297  1.00 0.00 ? 2  GLU A HB3  4 
ATOM 3603  H HG2  . GLU A 1 2  ? -1.018  -27.885 -2.754  1.00 0.00 ? 2  GLU A HG2  4 
ATOM 3604  H HG3  . GLU A 1 2  ? -2.142  -26.585 -3.143  1.00 0.00 ? 2  GLU A HG3  4 
ATOM 3605  N N    . ASN A 1 3  ? -5.212  -26.869 -3.092  1.00 0.00 ? 3  ASN A N    4 
ATOM 3606  C CA   . ASN A 1 3  ? -5.852  -26.218 -4.227  1.00 0.00 ? 3  ASN A CA   4 
ATOM 3607  C C    . ASN A 1 3  ? -6.821  -25.142 -3.752  1.00 0.00 ? 3  ASN A C    4 
ATOM 3608  O O    . ASN A 1 3  ? -6.899  -24.062 -4.335  1.00 0.00 ? 3  ASN A O    4 
ATOM 3609  C CB   . ASN A 1 3  ? -6.587  -27.244 -5.092  1.00 0.00 ? 3  ASN A CB   4 
ATOM 3610  C CG   . ASN A 1 3  ? -7.208  -26.620 -6.326  1.00 0.00 ? 3  ASN A CG   4 
ATOM 3611  O OD1  . ASN A 1 3  ? -6.514  -26.019 -7.148  1.00 0.00 ? 3  ASN A OD1  4 
ATOM 3612  N ND2  . ASN A 1 3  ? -8.521  -26.759 -6.463  1.00 0.00 ? 3  ASN A ND2  4 
ATOM 3613  H H    . ASN A 1 3  ? -5.287  -27.841 -2.991  1.00 0.00 ? 3  ASN A H    4 
ATOM 3614  H HA   . ASN A 1 3  ? -5.082  -25.750 -4.816  1.00 0.00 ? 3  ASN A HA   4 
ATOM 3615  H HB2  . ASN A 1 3  ? -5.889  -28.005 -5.409  1.00 0.00 ? 3  ASN A HB2  4 
ATOM 3616  H HB3  . ASN A 1 3  ? -7.372  -27.702 -4.507  1.00 0.00 ? 3  ASN A HB3  4 
ATOM 3617  H HD21 . ASN A 1 3  ? -9.010  -27.250 -5.770  1.00 0.00 ? 3  ASN A HD21 4 
ATOM 3618  H HD22 . ASN A 1 3  ? -8.948  -26.364 -7.252  1.00 0.00 ? 3  ASN A HD22 4 
ATOM 3619  N N    . LEU A 1 4  ? -7.551  -25.446 -2.685  1.00 0.00 ? 4  LEU A N    4 
ATOM 3620  C CA   . LEU A 1 4  ? -8.513  -24.506 -2.121  1.00 0.00 ? 4  LEU A CA   4 
ATOM 3621  C C    . LEU A 1 4  ? -7.799  -23.341 -1.456  1.00 0.00 ? 4  LEU A C    4 
ATOM 3622  O O    . LEU A 1 4  ? -8.162  -22.187 -1.662  1.00 0.00 ? 4  LEU A O    4 
ATOM 3623  C CB   . LEU A 1 4  ? -9.427  -25.210 -1.117  1.00 0.00 ? 4  LEU A CB   4 
ATOM 3624  C CG   . LEU A 1 4  ? -10.287 -26.329 -1.707  1.00 0.00 ? 4  LEU A CG   4 
ATOM 3625  C CD1  . LEU A 1 4  ? -11.194 -26.924 -0.642  1.00 0.00 ? 4  LEU A CD1  4 
ATOM 3626  C CD2  . LEU A 1 4  ? -11.105 -25.807 -2.878  1.00 0.00 ? 4  LEU A CD2  4 
ATOM 3627  H H    . LEU A 1 4  ? -7.435  -26.322 -2.264  1.00 0.00 ? 4  LEU A H    4 
ATOM 3628  H HA   . LEU A 1 4  ? -9.112  -24.115 -2.929  1.00 0.00 ? 4  LEU A HA   4 
ATOM 3629  H HB2  . LEU A 1 4  ? -8.811  -25.629 -0.335  1.00 0.00 ? 4  LEU A HB2  4 
ATOM 3630  H HB3  . LEU A 1 4  ? -10.084 -24.473 -0.681  1.00 0.00 ? 4  LEU A HB3  4 
ATOM 3631  H HG   . LEU A 1 4  ? -9.642  -27.115 -2.071  1.00 0.00 ? 4  LEU A HG   4 
ATOM 3632  H HD11 . LEU A 1 4  ? -10.596 -27.290 0.179   1.00 0.00 ? 4  LEU A HD11 4 
ATOM 3633  H HD12 . LEU A 1 4  ? -11.873 -26.164 -0.282  1.00 0.00 ? 4  LEU A HD12 4 
ATOM 3634  H HD13 . LEU A 1 4  ? -11.760 -27.739 -1.066  1.00 0.00 ? 4  LEU A HD13 4 
ATOM 3635  H HD21 . LEU A 1 4  ? -11.714 -24.978 -2.550  1.00 0.00 ? 4  LEU A HD21 4 
ATOM 3636  H HD22 . LEU A 1 4  ? -10.439 -25.477 -3.662  1.00 0.00 ? 4  LEU A HD22 4 
ATOM 3637  H HD23 . LEU A 1 4  ? -11.740 -26.596 -3.253  1.00 0.00 ? 4  LEU A HD23 4 
ATOM 3638  N N    . ASN A 1 5  ? -6.772  -23.642 -0.673  1.00 0.00 ? 5  ASN A N    4 
ATOM 3639  C CA   . ASN A 1 5  ? -6.012  -22.594 -0.008  1.00 0.00 ? 5  ASN A CA   4 
ATOM 3640  C C    . ASN A 1 5  ? -5.178  -21.826 -1.025  1.00 0.00 ? 5  ASN A C    4 
ATOM 3641  O O    . ASN A 1 5  ? -4.671  -20.746 -0.737  1.00 0.00 ? 5  ASN A O    4 
ATOM 3642  C CB   . ASN A 1 5  ? -5.111  -23.178 1.085   1.00 0.00 ? 5  ASN A CB   4 
ATOM 3643  C CG   . ASN A 1 5  ? -5.879  -23.854 2.217   1.00 0.00 ? 5  ASN A CG   4 
ATOM 3644  O OD1  . ASN A 1 5  ? -5.274  -24.418 3.129   1.00 0.00 ? 5  ASN A OD1  4 
ATOM 3645  N ND2  . ASN A 1 5  ? -7.210  -23.796 2.179   1.00 0.00 ? 5  ASN A ND2  4 
ATOM 3646  H H    . ASN A 1 5  ? -6.513  -24.579 -0.551  1.00 0.00 ? 5  ASN A H    4 
ATOM 3647  H HA   . ASN A 1 5  ? -6.720  -21.911 0.437   1.00 0.00 ? 5  ASN A HA   4 
ATOM 3648  H HB2  . ASN A 1 5  ? -4.453  -23.911 0.642   1.00 0.00 ? 5  ASN A HB2  4 
ATOM 3649  H HB3  . ASN A 1 5  ? -4.516  -22.381 1.509   1.00 0.00 ? 5  ASN A HB3  4 
ATOM 3650  H HD21 . ASN A 1 5  ? -7.637  -23.327 1.436   1.00 0.00 ? 5  ASN A HD21 4 
ATOM 3651  H HD22 . ASN A 1 5  ? -7.708  -24.227 2.904   1.00 0.00 ? 5  ASN A HD22 4 
ATOM 3652  N N    . MET A 1 6  ? -5.050  -22.387 -2.223  1.00 0.00 ? 6  MET A N    4 
ATOM 3653  C CA   . MET A 1 6  ? -4.299  -21.746 -3.288  1.00 0.00 ? 6  MET A CA   4 
ATOM 3654  C C    . MET A 1 6  ? -5.183  -20.722 -3.991  1.00 0.00 ? 6  MET A C    4 
ATOM 3655  O O    . MET A 1 6  ? -4.876  -19.524 -4.017  1.00 0.00 ? 6  MET A O    4 
ATOM 3656  C CB   . MET A 1 6  ? -3.800  -22.799 -4.280  1.00 0.00 ? 6  MET A CB   4 
ATOM 3657  C CG   . MET A 1 6  ? -2.993  -22.231 -5.436  1.00 0.00 ? 6  MET A CG   4 
ATOM 3658  S SD   . MET A 1 6  ? -2.348  -23.520 -6.520  1.00 0.00 ? 6  MET A SD   4 
ATOM 3659  C CE   . MET A 1 6  ? -1.455  -22.546 -7.731  1.00 0.00 ? 6  MET A CE   4 
ATOM 3660  H H    . MET A 1 6  ? -5.482  -23.250 -2.400  1.00 0.00 ? 6  MET A H    4 
ATOM 3661  H HA   . MET A 1 6  ? -3.455  -21.240 -2.845  1.00 0.00 ? 6  MET A HA   4 
ATOM 3662  H HB2  . MET A 1 6  ? -3.180  -23.507 -3.753  1.00 0.00 ? 6  MET A HB2  4 
ATOM 3663  H HB3  . MET A 1 6  ? -4.654  -23.318 -4.689  1.00 0.00 ? 6  MET A HB3  4 
ATOM 3664  H HG2  . MET A 1 6  ? -3.632  -21.580 -6.015  1.00 0.00 ? 6  MET A HG2  4 
ATOM 3665  H HG3  . MET A 1 6  ? -2.164  -21.666 -5.038  1.00 0.00 ? 6  MET A HG3  4 
ATOM 3666  H HE1  . MET A 1 6  ? -0.935  -21.743 -7.232  1.00 0.00 ? 6  MET A HE1  4 
ATOM 3667  H HE2  . MET A 1 6  ? -0.741  -23.176 -8.242  1.00 0.00 ? 6  MET A HE2  4 
ATOM 3668  H HE3  . MET A 1 6  ? -2.150  -22.136 -8.447  1.00 0.00 ? 6  MET A HE3  4 
ATOM 3669  N N    . ASP A 1 7  ? -6.299  -21.200 -4.537  1.00 0.00 ? 7  ASP A N    4 
ATOM 3670  C CA   . ASP A 1 7  ? -7.242  -20.334 -5.224  1.00 0.00 ? 7  ASP A CA   4 
ATOM 3671  C C    . ASP A 1 7  ? -7.902  -19.387 -4.231  1.00 0.00 ? 7  ASP A C    4 
ATOM 3672  O O    . ASP A 1 7  ? -8.069  -18.201 -4.512  1.00 0.00 ? 7  ASP A O    4 
ATOM 3673  C CB   . ASP A 1 7  ? -8.305  -21.163 -5.948  1.00 0.00 ? 7  ASP A CB   4 
ATOM 3674  C CG   . ASP A 1 7  ? -9.253  -21.852 -4.989  1.00 0.00 ? 7  ASP A CG   4 
ATOM 3675  O OD1  . ASP A 1 7  ? -8.767  -22.548 -4.080  1.00 0.00 ? 7  ASP A OD1  4 
ATOM 3676  O OD2  . ASP A 1 7  ? -10.482 -21.692 -5.149  1.00 0.00 ? 7  ASP A OD2  4 
ATOM 3677  H H    . ASP A 1 7  ? -6.496  -22.157 -4.466  1.00 0.00 ? 7  ASP A H    4 
ATOM 3678  H HA   . ASP A 1 7  ? -6.693  -19.752 -5.950  1.00 0.00 ? 7  ASP A HA   4 
ATOM 3679  H HB2  . ASP A 1 7  ? -8.880  -20.515 -6.589  1.00 0.00 ? 7  ASP A HB2  4 
ATOM 3680  H HB3  . ASP A 1 7  ? -7.818  -21.916 -6.551  1.00 0.00 ? 7  ASP A HB3  4 
ATOM 3681  N N    . LEU A 1 8  ? -8.277  -19.911 -3.062  1.00 0.00 ? 8  LEU A N    4 
ATOM 3682  C CA   . LEU A 1 8  ? -8.907  -19.079 -2.044  1.00 0.00 ? 8  LEU A CA   4 
ATOM 3683  C C    . LEU A 1 8  ? -7.961  -17.954 -1.644  1.00 0.00 ? 8  LEU A C    4 
ATOM 3684  O O    . LEU A 1 8  ? -8.390  -16.842 -1.344  1.00 0.00 ? 8  LEU A O    4 
ATOM 3685  C CB   . LEU A 1 8  ? -9.290  -19.918 -0.824  1.00 0.00 ? 8  LEU A CB   4 
ATOM 3686  C CG   . LEU A 1 8  ? -10.158 -19.217 0.233   1.00 0.00 ? 8  LEU A CG   4 
ATOM 3687  C CD1  . LEU A 1 8  ? -9.336  -18.249 1.077   1.00 0.00 ? 8  LEU A CD1  4 
ATOM 3688  C CD2  . LEU A 1 8  ? -11.320 -18.491 -0.430  1.00 0.00 ? 8  LEU A CD2  4 
ATOM 3689  H H    . LEU A 1 8  ? -8.120  -20.872 -2.878  1.00 0.00 ? 8  LEU A H    4 
ATOM 3690  H HA   . LEU A 1 8  ? -9.796  -18.652 -2.468  1.00 0.00 ? 8  LEU A HA   4 
ATOM 3691  H HB2  . LEU A 1 8  ? -9.822  -20.791 -1.170  1.00 0.00 ? 8  LEU A HB2  4 
ATOM 3692  H HB3  . LEU A 1 8  ? -8.383  -20.239 -0.351  1.00 0.00 ? 8  LEU A HB3  4 
ATOM 3693  H HG   . LEU A 1 8  ? -10.570 -19.963 0.897   1.00 0.00 ? 8  LEU A HG   4 
ATOM 3694  H HD11 . LEU A 1 8  ? -8.459  -17.945 0.534   1.00 0.00 ? 8  LEU A HD11 4 
ATOM 3695  H HD12 . LEU A 1 8  ? -9.933  -17.382 1.313   1.00 0.00 ? 8  LEU A HD12 4 
ATOM 3696  H HD13 . LEU A 1 8  ? -9.038  -18.738 1.992   1.00 0.00 ? 8  LEU A HD13 4 
ATOM 3697  H HD21 . LEU A 1 8  ? -11.459 -18.872 -1.431  1.00 0.00 ? 8  LEU A HD21 4 
ATOM 3698  H HD22 . LEU A 1 8  ? -12.220 -18.652 0.143   1.00 0.00 ? 8  LEU A HD22 4 
ATOM 3699  H HD23 . LEU A 1 8  ? -11.106 -17.433 -0.475  1.00 0.00 ? 8  LEU A HD23 4 
ATOM 3700  N N    . LEU A 1 9  ? -6.668  -18.259 -1.654  1.00 0.00 ? 9  LEU A N    4 
ATOM 3701  C CA   . LEU A 1 9  ? -5.647  -17.286 -1.300  1.00 0.00 ? 9  LEU A CA   4 
ATOM 3702  C C    . LEU A 1 9  ? -5.553  -16.185 -2.345  1.00 0.00 ? 9  LEU A C    4 
ATOM 3703  O O    . LEU A 1 9  ? -5.837  -15.022 -2.056  1.00 0.00 ? 9  LEU A O    4 
ATOM 3704  C CB   . LEU A 1 9  ? -4.303  -17.986 -1.135  1.00 0.00 ? 9  LEU A CB   4 
ATOM 3705  C CG   . LEU A 1 9  ? -3.139  -17.089 -0.734  1.00 0.00 ? 9  LEU A CG   4 
ATOM 3706  C CD1  . LEU A 1 9  ? -3.440  -16.372 0.573   1.00 0.00 ? 9  LEU A CD1  4 
ATOM 3707  C CD2  . LEU A 1 9  ? -1.877  -17.918 -0.605  1.00 0.00 ? 9  LEU A CD2  4 
ATOM 3708  H H    . LEU A 1 9  ? -6.393  -19.166 -1.910  1.00 0.00 ? 9  LEU A H    4 
ATOM 3709  H HA   . LEU A 1 9  ? -5.925  -16.843 -0.358  1.00 0.00 ? 9  LEU A HA   4 
ATOM 3710  H HB2  . LEU A 1 9  ? -4.412  -18.744 -0.378  1.00 0.00 ? 9  LEU A HB2  4 
ATOM 3711  H HB3  . LEU A 1 9  ? -4.053  -18.466 -2.070  1.00 0.00 ? 9  LEU A HB3  4 
ATOM 3712  H HG   . LEU A 1 9  ? -2.978  -16.345 -1.499  1.00 0.00 ? 9  LEU A HG   4 
ATOM 3713  H HD11 . LEU A 1 9  ? -4.413  -15.907 0.512   1.00 0.00 ? 9  LEU A HD11 4 
ATOM 3714  H HD12 . LEU A 1 9  ? -3.433  -17.085 1.384   1.00 0.00 ? 9  LEU A HD12 4 
ATOM 3715  H HD13 . LEU A 1 9  ? -2.689  -15.617 0.751   1.00 0.00 ? 9  LEU A HD13 4 
ATOM 3716  H HD21 . LEU A 1 9  ? -2.100  -18.834 -0.078  1.00 0.00 ? 9  LEU A HD21 4 
ATOM 3717  H HD22 . LEU A 1 9  ? -1.500  -18.152 -1.590  1.00 0.00 ? 9  LEU A HD22 4 
ATOM 3718  H HD23 . LEU A 1 9  ? -1.133  -17.360 -0.056  1.00 0.00 ? 9  LEU A HD23 4 
ATOM 3719  N N    . TYR A 1 10 ? -5.175  -16.543 -3.571  1.00 0.00 ? 10 TYR A N    4 
ATOM 3720  C CA   . TYR A 1 10 ? -5.066  -15.547 -4.635  1.00 0.00 ? 10 TYR A CA   4 
ATOM 3721  C C    . TYR A 1 10 ? -6.369  -14.773 -4.756  1.00 0.00 ? 10 TYR A C    4 
ATOM 3722  O O    . TYR A 1 10 ? -6.373  -13.551 -4.906  1.00 0.00 ? 10 TYR A O    4 
ATOM 3723  C CB   . TYR A 1 10 ? -4.745  -16.202 -5.977  1.00 0.00 ? 10 TYR A CB   4 
ATOM 3724  C CG   . TYR A 1 10 ? -3.657  -17.249 -5.909  1.00 0.00 ? 10 TYR A CG   4 
ATOM 3725  C CD1  . TYR A 1 10 ? -2.537  -17.066 -5.111  1.00 0.00 ? 10 TYR A CD1  4 
ATOM 3726  C CD2  . TYR A 1 10 ? -3.747  -18.412 -6.659  1.00 0.00 ? 10 TYR A CD2  4 
ATOM 3727  C CE1  . TYR A 1 10 ? -1.536  -18.016 -5.062  1.00 0.00 ? 10 TYR A CE1  4 
ATOM 3728  C CE2  . TYR A 1 10 ? -2.752  -19.368 -6.614  1.00 0.00 ? 10 TYR A CE2  4 
ATOM 3729  C CZ   . TYR A 1 10 ? -1.648  -19.165 -5.814  1.00 0.00 ? 10 TYR A CZ   4 
ATOM 3730  O OH   . TYR A 1 10 ? -0.652  -20.113 -5.768  1.00 0.00 ? 10 TYR A OH   4 
ATOM 3731  H H    . TYR A 1 10 ? -4.973  -17.487 -3.762  1.00 0.00 ? 10 TYR A H    4 
ATOM 3732  H HA   . TYR A 1 10 ? -4.269  -14.859 -4.371  1.00 0.00 ? 10 TYR A HA   4 
ATOM 3733  H HB2  . TYR A 1 10 ? -5.638  -16.674 -6.358  1.00 0.00 ? 10 TYR A HB2  4 
ATOM 3734  H HB3  . TYR A 1 10 ? -4.426  -15.438 -6.672  1.00 0.00 ? 10 TYR A HB3  4 
ATOM 3735  H HD1  . TYR A 1 10 ? -2.457  -16.168 -4.515  1.00 0.00 ? 10 TYR A HD1  4 
ATOM 3736  H HD2  . TYR A 1 10 ? -4.616  -18.567 -7.283  1.00 0.00 ? 10 TYR A HD2  4 
ATOM 3737  H HE1  . TYR A 1 10 ? -0.671  -17.857 -4.434  1.00 0.00 ? 10 TYR A HE1  4 
ATOM 3738  H HE2  . TYR A 1 10 ? -2.841  -20.267 -7.204  1.00 0.00 ? 10 TYR A HE2  4 
ATOM 3739  H HH   . TYR A 1 10 ? -0.069  -20.002 -6.523  1.00 0.00 ? 10 TYR A HH   4 
ATOM 3740  N N    . MET A 1 11 ? -7.476  -15.501 -4.680  1.00 0.00 ? 11 MET A N    4 
ATOM 3741  C CA   . MET A 1 11 ? -8.794  -14.899 -4.769  1.00 0.00 ? 11 MET A CA   4 
ATOM 3742  C C    . MET A 1 11 ? -9.027  -14.009 -3.555  1.00 0.00 ? 11 MET A C    4 
ATOM 3743  O O    . MET A 1 11 ? -9.626  -12.937 -3.657  1.00 0.00 ? 11 MET A O    4 
ATOM 3744  C CB   . MET A 1 11 ? -9.857  -15.987 -4.858  1.00 0.00 ? 11 MET A CB   4 
ATOM 3745  C CG   . MET A 1 11 ? -11.182 -15.491 -5.409  1.00 0.00 ? 11 MET A CG   4 
ATOM 3746  S SD   . MET A 1 11 ? -12.063 -14.406 -4.268  1.00 0.00 ? 11 MET A SD   4 
ATOM 3747  C CE   . MET A 1 11 ? -12.357 -15.521 -2.896  1.00 0.00 ? 11 MET A CE   4 
ATOM 3748  H H    . MET A 1 11 ? -7.402  -16.470 -4.553  1.00 0.00 ? 11 MET A H    4 
ATOM 3749  H HA   . MET A 1 11 ? -8.831  -14.295 -5.665  1.00 0.00 ? 11 MET A HA   4 
ATOM 3750  H HB2  . MET A 1 11 ? -9.490  -16.776 -5.501  1.00 0.00 ? 11 MET A HB2  4 
ATOM 3751  H HB3  . MET A 1 11 ? -10.028 -16.389 -3.871  1.00 0.00 ? 11 MET A HB3  4 
ATOM 3752  H HG2  . MET A 1 11 ? -10.992 -14.946 -6.320  1.00 0.00 ? 11 MET A HG2  4 
ATOM 3753  H HG3  . MET A 1 11 ? -11.800 -16.342 -5.627  1.00 0.00 ? 11 MET A HG3  4 
ATOM 3754  H HE1  . MET A 1 11 ? -11.940 -16.490 -3.124  1.00 0.00 ? 11 MET A HE1  4 
ATOM 3755  H HE2  . MET A 1 11 ? -11.890 -15.126 -2.007  1.00 0.00 ? 11 MET A HE2  4 
ATOM 3756  H HE3  . MET A 1 11 ? -13.421 -15.616 -2.733  1.00 0.00 ? 11 MET A HE3  4 
ATOM 3757  N N    . ALA A 1 12 ? -8.512  -14.451 -2.411  1.00 0.00 ? 12 ALA A N    4 
ATOM 3758  C CA   . ALA A 1 12 ? -8.627  -13.686 -1.179  1.00 0.00 ? 12 ALA A CA   4 
ATOM 3759  C C    . ALA A 1 12 ? -7.884  -12.375 -1.320  1.00 0.00 ? 12 ALA A C    4 
ATOM 3760  O O    . ALA A 1 12 ? -8.280  -11.373 -0.745  1.00 0.00 ? 12 ALA A O    4 
ATOM 3761  C CB   . ALA A 1 12 ? -8.096  -14.484 0.003   1.00 0.00 ? 12 ALA A CB   4 
ATOM 3762  H H    . ALA A 1 12 ? -8.022  -15.300 -2.403  1.00 0.00 ? 12 ALA A H    4 
ATOM 3763  H HA   . ALA A 1 12 ? -9.674  -13.467 -1.007  1.00 0.00 ? 12 ALA A HA   4 
ATOM 3764  H HB1  . ALA A 1 12 ? -7.132  -14.901 -0.249  1.00 0.00 ? 12 ALA A HB1  4 
ATOM 3765  H HB2  . ALA A 1 12 ? -7.995  -13.834 0.860   1.00 0.00 ? 12 ALA A HB2  4 
ATOM 3766  H HB3  . ALA A 1 12 ? -8.784  -15.283 0.236   1.00 0.00 ? 12 ALA A HB3  4 
ATOM 3767  N N    . ALA A 1 13 ? -6.817  -12.382 -2.109  1.00 0.00 ? 13 ALA A N    4 
ATOM 3768  C CA   . ALA A 1 13 ? -6.049  -11.175 -2.346  1.00 0.00 ? 13 ALA A CA   4 
ATOM 3769  C C    . ALA A 1 13 ? -6.888  -10.197 -3.156  1.00 0.00 ? 13 ALA A C    4 
ATOM 3770  O O    . ALA A 1 13 ? -6.797  -8.986  -2.978  1.00 0.00 ? 13 ALA A O    4 
ATOM 3771  C CB   . ALA A 1 13 ? -4.752  -11.498 -3.069  1.00 0.00 ? 13 ALA A CB   4 
ATOM 3772  H H    . ALA A 1 13 ? -6.555  -13.208 -2.557  1.00 0.00 ? 13 ALA A H    4 
ATOM 3773  H HA   . ALA A 1 13 ? -5.813  -10.733 -1.384  1.00 0.00 ? 13 ALA A HA   4 
ATOM 3774  H HB1  . ALA A 1 13 ? -4.953  -12.186 -3.878  1.00 0.00 ? 13 ALA A HB1  4 
ATOM 3775  H HB2  . ALA A 1 13 ? -4.324  -10.589 -3.468  1.00 0.00 ? 13 ALA A HB2  4 
ATOM 3776  H HB3  . ALA A 1 13 ? -4.056  -11.950 -2.378  1.00 0.00 ? 13 ALA A HB3  4 
ATOM 3777  N N    . ALA A 1 14 ? -7.731  -10.740 -4.032  1.00 0.00 ? 14 ALA A N    4 
ATOM 3778  C CA   . ALA A 1 14 ? -8.613  -9.918  -4.847  1.00 0.00 ? 14 ALA A CA   4 
ATOM 3779  C C    . ALA A 1 14 ? -9.648  -9.253  -3.954  1.00 0.00 ? 14 ALA A C    4 
ATOM 3780  O O    . ALA A 1 14 ? -9.782  -8.029  -3.939  1.00 0.00 ? 14 ALA A O    4 
ATOM 3781  C CB   . ALA A 1 14 ? -9.292  -10.759 -5.919  1.00 0.00 ? 14 ALA A CB   4 
ATOM 3782  H H    . ALA A 1 14 ? -7.774  -11.714 -4.116  1.00 0.00 ? 14 ALA A H    4 
ATOM 3783  H HA   . ALA A 1 14 ? -8.016  -9.158  -5.331  1.00 0.00 ? 14 ALA A HA   4 
ATOM 3784  H HB1  . ALA A 1 14 ? -8.543  -11.272 -6.503  1.00 0.00 ? 14 ALA A HB1  4 
ATOM 3785  H HB2  . ALA A 1 14 ? -9.942  -11.484 -5.450  1.00 0.00 ? 14 ALA A HB2  4 
ATOM 3786  H HB3  . ALA A 1 14 ? -9.875  -10.118 -6.563  1.00 0.00 ? 14 ALA A HB3  4 
ATOM 3787  N N    . VAL A 1 15 ? -10.358 -10.073 -3.185  1.00 0.00 ? 15 VAL A N    4 
ATOM 3788  C CA   . VAL A 1 15 ? -11.364 -9.574  -2.259  1.00 0.00 ? 15 VAL A CA   4 
ATOM 3789  C C    . VAL A 1 15 ? -10.706 -8.679  -1.217  1.00 0.00 ? 15 VAL A C    4 
ATOM 3790  O O    . VAL A 1 15 ? -11.224 -7.624  -0.868  1.00 0.00 ? 15 VAL A O    4 
ATOM 3791  C CB   . VAL A 1 15 ? -12.096 -10.730 -1.546  1.00 0.00 ? 15 VAL A CB   4 
ATOM 3792  C CG1  . VAL A 1 15 ? -13.184 -10.196 -0.626  1.00 0.00 ? 15 VAL A CG1  4 
ATOM 3793  C CG2  . VAL A 1 15 ? -12.677 -11.702 -2.561  1.00 0.00 ? 15 VAL A CG2  4 
ATOM 3794  H H    . VAL A 1 15 ? -10.187 -11.039 -3.229  1.00 0.00 ? 15 VAL A H    4 
ATOM 3795  H HA   . VAL A 1 15 ? -12.089 -8.998  -2.819  1.00 0.00 ? 15 VAL A HA   4 
ATOM 3796  H HB   . VAL A 1 15 ? -11.376 -11.264 -0.940  1.00 0.00 ? 15 VAL A HB   4 
ATOM 3797  H HG11 . VAL A 1 15 ? -12.796 -9.369  -0.051  1.00 0.00 ? 15 VAL A HG11 4 
ATOM 3798  H HG12 . VAL A 1 15 ? -14.023 -9.861  -1.218  1.00 0.00 ? 15 VAL A HG12 4 
ATOM 3799  H HG13 . VAL A 1 15 ? -13.507 -10.980 0.043   1.00 0.00 ? 15 VAL A HG13 4 
ATOM 3800  H HG21 . VAL A 1 15 ? -12.218 -11.535 -3.524  1.00 0.00 ? 15 VAL A HG21 4 
ATOM 3801  H HG22 . VAL A 1 15 ? -12.481 -12.715 -2.240  1.00 0.00 ? 15 VAL A HG22 4 
ATOM 3802  H HG23 . VAL A 1 15 ? -13.743 -11.549 -2.638  1.00 0.00 ? 15 VAL A HG23 4 
ATOM 3803  N N    . MET A 1 16 ? -9.546  -9.118  -0.738  1.00 0.00 ? 16 MET A N    4 
ATOM 3804  C CA   . MET A 1 16 ? -8.778  -8.376  0.260   1.00 0.00 ? 16 MET A CA   4 
ATOM 3805  C C    . MET A 1 16 ? -8.341  -7.014  -0.262  1.00 0.00 ? 16 MET A C    4 
ATOM 3806  O O    . MET A 1 16 ? -8.539  -5.990  0.394   1.00 0.00 ? 16 MET A O    4 
ATOM 3807  C CB   . MET A 1 16 ? -7.552  -9.189  0.682   1.00 0.00 ? 16 MET A CB   4 
ATOM 3808  C CG   . MET A 1 16 ? -7.853  -10.250 1.717   1.00 0.00 ? 16 MET A CG   4 
ATOM 3809  S SD   . MET A 1 16 ? -8.434  -9.555  3.277   1.00 0.00 ? 16 MET A SD   4 
ATOM 3810  C CE   . MET A 1 16 ? -8.670  -11.045 4.243   1.00 0.00 ? 16 MET A CE   4 
ATOM 3811  H H    . MET A 1 16 ? -9.193  -9.969  -1.071  1.00 0.00 ? 16 MET A H    4 
ATOM 3812  H HA   . MET A 1 16 ? -9.411  -8.226  1.115   1.00 0.00 ? 16 MET A HA   4 
ATOM 3813  H HB2  . MET A 1 16 ? -7.139  -9.675  -0.188  1.00 0.00 ? 16 MET A HB2  4 
ATOM 3814  H HB3  . MET A 1 16 ? -6.817  -8.532  1.085   1.00 0.00 ? 16 MET A HB3  4 
ATOM 3815  H HG2  . MET A 1 16 ? -8.613  -10.894 1.324   1.00 0.00 ? 16 MET A HG2  4 
ATOM 3816  H HG3  . MET A 1 16 ? -6.954  -10.821 1.905   1.00 0.00 ? 16 MET A HG3  4 
ATOM 3817  H HE1  . MET A 1 16 ? -9.162  -11.793 3.639   1.00 0.00 ? 16 MET A HE1  4 
ATOM 3818  H HE2  . MET A 1 16 ? -7.711  -11.419 4.568   1.00 0.00 ? 16 MET A HE2  4 
ATOM 3819  H HE3  . MET A 1 16 ? -9.279  -10.822 5.106   1.00 0.00 ? 16 MET A HE3  4 
ATOM 3820  N N    . MET A 1 17 ? -7.736  -7.011  -1.436  1.00 0.00 ? 17 MET A N    4 
ATOM 3821  C CA   . MET A 1 17 ? -7.261  -5.776  -2.047  1.00 0.00 ? 17 MET A CA   4 
ATOM 3822  C C    . MET A 1 17 ? -8.432  -4.879  -2.419  1.00 0.00 ? 17 MET A C    4 
ATOM 3823  O O    . MET A 1 17 ? -8.374  -3.661  -2.249  1.00 0.00 ? 17 MET A O    4 
ATOM 3824  C CB   . MET A 1 17 ? -6.416  -6.077  -3.288  1.00 0.00 ? 17 MET A CB   4 
ATOM 3825  C CG   . MET A 1 17 ? -5.076  -6.725  -2.974  1.00 0.00 ? 17 MET A CG   4 
ATOM 3826  S SD   . MET A 1 17 ? -3.980  -5.632  -2.052  1.00 0.00 ? 17 MET A SD   4 
ATOM 3827  C CE   . MET A 1 17 ? -3.839  -4.259  -3.191  1.00 0.00 ? 17 MET A CE   4 
ATOM 3828  H H    . MET A 1 17 ? -7.605  -7.859  -1.899  1.00 0.00 ? 17 MET A H    4 
ATOM 3829  H HA   . MET A 1 17 ? -6.646  -5.263  -1.321  1.00 0.00 ? 17 MET A HA   4 
ATOM 3830  H HB2  . MET A 1 17 ? -6.969  -6.740  -3.937  1.00 0.00 ? 17 MET A HB2  4 
ATOM 3831  H HB3  . MET A 1 17 ? -6.227  -5.152  -3.813  1.00 0.00 ? 17 MET A HB3  4 
ATOM 3832  H HG2  . MET A 1 17 ? -5.248  -7.614  -2.387  1.00 0.00 ? 17 MET A HG2  4 
ATOM 3833  H HG3  . MET A 1 17 ? -4.595  -6.994  -3.903  1.00 0.00 ? 17 MET A HG3  4 
ATOM 3834  H HE1  . MET A 1 17 ? -3.486  -4.617  -4.146  1.00 0.00 ? 17 MET A HE1  4 
ATOM 3835  H HE2  . MET A 1 17 ? -4.806  -3.794  -3.316  1.00 0.00 ? 17 MET A HE2  4 
ATOM 3836  H HE3  . MET A 1 17 ? -3.141  -3.536  -2.798  1.00 0.00 ? 17 MET A HE3  4 
ATOM 3837  N N    . GLY A 1 18 ? -9.498  -5.490  -2.921  1.00 0.00 ? 18 GLY A N    4 
ATOM 3838  C CA   . GLY A 1 18 ? -10.670 -4.731  -3.306  1.00 0.00 ? 18 GLY A CA   4 
ATOM 3839  C C    . GLY A 1 18 ? -11.404 -4.159  -2.113  1.00 0.00 ? 18 GLY A C    4 
ATOM 3840  O O    . GLY A 1 18 ? -11.718 -2.975  -2.086  1.00 0.00 ? 18 GLY A O    4 
ATOM 3841  H H    . GLY A 1 18 ? -9.491  -6.464  -3.028  1.00 0.00 ? 18 GLY A H    4 
ATOM 3842  H HA2  . GLY A 1 18 ? -10.362 -3.916  -3.949  1.00 0.00 ? 18 GLY A HA2  4 
ATOM 3843  H HA3  . GLY A 1 18 ? -11.342 -5.375  -3.856  1.00 0.00 ? 18 GLY A HA3  4 
ATOM 3844  N N    . LEU A 1 19 ? -11.680 -5.001  -1.124  1.00 0.00 ? 19 LEU A N    4 
ATOM 3845  C CA   . LEU A 1 19 ? -12.387 -4.563  0.074   1.00 0.00 ? 19 LEU A CA   4 
ATOM 3846  C C    . LEU A 1 19 ? -11.604 -3.456  0.768   1.00 0.00 ? 19 LEU A C    4 
ATOM 3847  O O    . LEU A 1 19 ? -12.162 -2.415  1.130   1.00 0.00 ? 19 LEU A O    4 
ATOM 3848  C CB   . LEU A 1 19 ? -12.618 -5.747  1.022   1.00 0.00 ? 19 LEU A CB   4 
ATOM 3849  C CG   . LEU A 1 19 ? -11.371 -6.317  1.698   1.00 0.00 ? 19 LEU A CG   4 
ATOM 3850  C CD1  . LEU A 1 19 ? -10.990 -5.495  2.921   1.00 0.00 ? 19 LEU A CD1  4 
ATOM 3851  C CD2  . LEU A 1 19 ? -11.594 -7.771  2.083   1.00 0.00 ? 19 LEU A CD2  4 
ATOM 3852  H H    . LEU A 1 19 ? -11.404 -5.935  -1.202  1.00 0.00 ? 19 LEU A H    4 
ATOM 3853  H HA   . LEU A 1 19 ? -13.344 -4.169  -0.235  1.00 0.00 ? 19 LEU A HA   4 
ATOM 3854  H HB2  . LEU A 1 19 ? -13.302 -5.431  1.793   1.00 0.00 ? 19 LEU A HB2  4 
ATOM 3855  H HB3  . LEU A 1 19 ? -13.085 -6.542  0.457   1.00 0.00 ? 19 LEU A HB3  4 
ATOM 3856  H HG   . LEU A 1 19 ? -10.547 -6.277  1.002   1.00 0.00 ? 19 LEU A HG   4 
ATOM 3857  H HD11 . LEU A 1 19 ? -11.497 -4.543  2.890   1.00 0.00 ? 19 LEU A HD11 4 
ATOM 3858  H HD12 . LEU A 1 19 ? -11.281 -6.026  3.816   1.00 0.00 ? 19 LEU A HD12 4 
ATOM 3859  H HD13 . LEU A 1 19 ? -9.923  -5.336  2.930   1.00 0.00 ? 19 LEU A HD13 4 
ATOM 3860  H HD21 . LEU A 1 19 ? -12.509 -7.857  2.652   1.00 0.00 ? 19 LEU A HD21 4 
ATOM 3861  H HD22 . LEU A 1 19 ? -11.670 -8.372  1.190   1.00 0.00 ? 19 LEU A HD22 4 
ATOM 3862  H HD23 . LEU A 1 19 ? -10.764 -8.118  2.679   1.00 0.00 ? 19 LEU A HD23 4 
ATOM 3863  N N    . ALA A 1 20 ? -10.303 -3.676  0.934   1.00 0.00 ? 20 ALA A N    4 
ATOM 3864  C CA   . ALA A 1 20 ? -9.447  -2.687  1.563   1.00 0.00 ? 20 ALA A CA   4 
ATOM 3865  C C    . ALA A 1 20 ? -9.351  -1.455  0.679   1.00 0.00 ? 20 ALA A C    4 
ATOM 3866  O O    . ALA A 1 20 ? -9.246  -0.330  1.167   1.00 0.00 ? 20 ALA A O    4 
ATOM 3867  C CB   . ALA A 1 20 ? -8.067  -3.265  1.832   1.00 0.00 ? 20 ALA A CB   4 
ATOM 3868  H H    . ALA A 1 20 ? -9.911  -4.515  0.611   1.00 0.00 ? 20 ALA A H    4 
ATOM 3869  H HA   . ALA A 1 20 ? -9.892  -2.409  2.509   1.00 0.00 ? 20 ALA A HA   4 
ATOM 3870  H HB1  . ALA A 1 20 ? -8.110  -4.342  1.770   1.00 0.00 ? 20 ALA A HB1  4 
ATOM 3871  H HB2  . ALA A 1 20 ? -7.368  -2.890  1.098   1.00 0.00 ? 20 ALA A HB2  4 
ATOM 3872  H HB3  . ALA A 1 20 ? -7.742  -2.976  2.820   1.00 0.00 ? 20 ALA A HB3  4 
ATOM 3873  N N    . ALA A 1 21 ? -9.403  -1.680  -0.632  1.00 0.00 ? 21 ALA A N    4 
ATOM 3874  C CA   . ALA A 1 21 ? -9.338  -0.590  -1.592  1.00 0.00 ? 21 ALA A CA   4 
ATOM 3875  C C    . ALA A 1 21 ? -10.578 0.274   -1.492  1.00 0.00 ? 21 ALA A C    4 
ATOM 3876  O O    . ALA A 1 21 ? -10.499 1.498   -1.511  1.00 0.00 ? 21 ALA A O    4 
ATOM 3877  C CB   . ALA A 1 21 ? -9.173  -1.126  -3.006  1.00 0.00 ? 21 ALA A CB   4 
ATOM 3878  H H    . ALA A 1 21 ? -9.497  -2.602  -0.956  1.00 0.00 ? 21 ALA A H    4 
ATOM 3879  H HA   . ALA A 1 21 ? -8.483  0.012   -1.354  1.00 0.00 ? 21 ALA A HA   4 
ATOM 3880  H HB1  . ALA A 1 21 ? -9.967  -1.824  -3.222  1.00 0.00 ? 21 ALA A HB1  4 
ATOM 3881  H HB2  . ALA A 1 21 ? -9.214  -0.307  -3.708  1.00 0.00 ? 21 ALA A HB2  4 
ATOM 3882  H HB3  . ALA A 1 21 ? -8.220  -1.626  -3.093  1.00 0.00 ? 21 ALA A HB3  4 
ATOM 3883  N N    . ILE A 1 22 ? -11.721 -0.377  -1.358  1.00 0.00 ? 22 ILE A N    4 
ATOM 3884  C CA   . ILE A 1 22 ? -12.987 0.328   -1.227  1.00 0.00 ? 22 ILE A CA   4 
ATOM 3885  C C    . ILE A 1 22 ? -12.978 1.177   0.036   1.00 0.00 ? 22 ILE A C    4 
ATOM 3886  O O    . ILE A 1 22 ? -13.097 2.398   -0.028  1.00 0.00 ? 22 ILE A O    4 
ATOM 3887  C CB   . ILE A 1 22 ? -14.183 -0.640  -1.180  1.00 0.00 ? 22 ILE A CB   4 
ATOM 3888  C CG1  . ILE A 1 22 ? -14.229 -1.491  -2.448  1.00 0.00 ? 22 ILE A CG1  4 
ATOM 3889  C CG2  . ILE A 1 22 ? -15.487 0.127   -1.009  1.00 0.00 ? 22 ILE A CG2  4 
ATOM 3890  C CD1  . ILE A 1 22 ? -15.317 -2.543  -2.429  1.00 0.00 ? 22 ILE A CD1  4 
ATOM 3891  H H    . ILE A 1 22 ? -11.706 -1.353  -1.331  1.00 0.00 ? 22 ILE A H    4 
ATOM 3892  H HA   . ILE A 1 22 ? -13.104 0.971   -2.084  1.00 0.00 ? 22 ILE A HA   4 
ATOM 3893  H HB   . ILE A 1 22 ? -14.059 -1.284  -0.326  1.00 0.00 ? 22 ILE A HB   4 
ATOM 3894  H HG12 . ILE A 1 22 ? -14.405 -0.850  -3.298  1.00 0.00 ? 22 ILE A HG12 4 
ATOM 3895  H HG13 . ILE A 1 22 ? -13.284 -1.991  -2.572  1.00 0.00 ? 22 ILE A HG13 4 
ATOM 3896  H HG21 . ILE A 1 22 ? -15.332 1.163   -1.274  1.00 0.00 ? 22 ILE A HG21 4 
ATOM 3897  H HG22 . ILE A 1 22 ? -16.243 -0.299  -1.653  1.00 0.00 ? 22 ILE A HG22 4 
ATOM 3898  H HG23 . ILE A 1 22 ? -15.812 0.063   0.018   1.00 0.00 ? 22 ILE A HG23 4 
ATOM 3899  H HD11 . ILE A 1 22 ? -16.189 -2.150  -1.927  1.00 0.00 ? 22 ILE A HD11 4 
ATOM 3900  H HD12 . ILE A 1 22 ? -15.575 -2.813  -3.442  1.00 0.00 ? 22 ILE A HD12 4 
ATOM 3901  H HD13 . ILE A 1 22 ? -14.963 -3.417  -1.901  1.00 0.00 ? 22 ILE A HD13 4 
ATOM 3902  N N    . GLY A 1 23 ? -12.820 0.524   1.186   1.00 0.00 ? 23 GLY A N    4 
ATOM 3903  C CA   . GLY A 1 23 ? -12.785 1.249   2.445   1.00 0.00 ? 23 GLY A CA   4 
ATOM 3904  C C    . GLY A 1 23 ? -11.699 2.306   2.456   1.00 0.00 ? 23 GLY A C    4 
ATOM 3905  O O    . GLY A 1 23 ? -11.931 3.452   2.857   1.00 0.00 ? 23 GLY A O    4 
ATOM 3906  H H    . GLY A 1 23 ? -12.716 -0.453  1.178   1.00 0.00 ? 23 GLY A H    4 
ATOM 3907  H HA2  . GLY A 1 23 ? -13.742 1.724   2.604   1.00 0.00 ? 23 GLY A HA2  4 
ATOM 3908  H HA3  . GLY A 1 23 ? -12.603 0.549   3.249   1.00 0.00 ? 23 GLY A HA3  4 
ATOM 3909  N N    . ALA A 1 24 ? -10.511 1.919   2.000   1.00 0.00 ? 24 ALA A N    4 
ATOM 3910  C CA   . ALA A 1 24 ? -9.380  2.834   1.941   1.00 0.00 ? 24 ALA A CA   4 
ATOM 3911  C C    . ALA A 1 24 ? -9.678  3.992   1.004   1.00 0.00 ? 24 ALA A C    4 
ATOM 3912  O O    . ALA A 1 24 ? -9.350  5.137   1.293   1.00 0.00 ? 24 ALA A O    4 
ATOM 3913  C CB   . ALA A 1 24 ? -8.128  2.100   1.490   1.00 0.00 ? 24 ALA A CB   4 
ATOM 3914  H H    . ALA A 1 24 ? -10.397 0.997   1.687   1.00 0.00 ? 24 ALA A H    4 
ATOM 3915  H HA   . ALA A 1 24 ? -9.209  3.220   2.936   1.00 0.00 ? 24 ALA A HA   4 
ATOM 3916  H HB1  . ALA A 1 24 ? -8.311  1.630   0.535   1.00 0.00 ? 24 ALA A HB1  4 
ATOM 3917  H HB2  . ALA A 1 24 ? -7.314  2.803   1.393   1.00 0.00 ? 24 ALA A HB2  4 
ATOM 3918  H HB3  . ALA A 1 24 ? -7.870  1.346   2.218   1.00 0.00 ? 24 ALA A HB3  4 
ATOM 3919  N N    . ALA A 1 25 ? -10.311 3.687   -0.122  1.00 0.00 ? 25 ALA A N    4 
ATOM 3920  C CA   . ALA A 1 25 ? -10.658 4.715   -1.093  1.00 0.00 ? 25 ALA A CA   4 
ATOM 3921  C C    . ALA A 1 25 ? -11.646 5.704   -0.485  1.00 0.00 ? 25 ALA A C    4 
ATOM 3922  O O    . ALA A 1 25 ? -11.500 6.916   -0.623  1.00 0.00 ? 25 ALA A O    4 
ATOM 3923  C CB   . ALA A 1 25 ? -11.237 4.092   -2.354  1.00 0.00 ? 25 ALA A CB   4 
ATOM 3924  H H    . ALA A 1 25 ? -10.551 2.755   -0.298  1.00 0.00 ? 25 ALA A H    4 
ATOM 3925  H HA   . ALA A 1 25 ? -9.752  5.241   -1.360  1.00 0.00 ? 25 ALA A HA   4 
ATOM 3926  H HB1  . ALA A 1 25 ? -10.588 3.299   -2.696  1.00 0.00 ? 25 ALA A HB1  4 
ATOM 3927  H HB2  . ALA A 1 25 ? -12.216 3.690   -2.141  1.00 0.00 ? 25 ALA A HB2  4 
ATOM 3928  H HB3  . ALA A 1 25 ? -11.317 4.846   -3.124  1.00 0.00 ? 25 ALA A HB3  4 
ATOM 3929  N N    . ILE A 1 26 ? -12.640 5.175   0.218   1.00 0.00 ? 26 ILE A N    4 
ATOM 3930  C CA   . ILE A 1 26 ? -13.637 6.013   0.866   1.00 0.00 ? 26 ILE A CA   4 
ATOM 3931  C C    . ILE A 1 26 ? -12.987 6.984   1.848   1.00 0.00 ? 26 ILE A C    4 
ATOM 3932  O O    . ILE A 1 26 ? -13.100 8.198   1.691   1.00 0.00 ? 26 ILE A O    4 
ATOM 3933  C CB   . ILE A 1 26 ? -14.686 5.169   1.613   1.00 0.00 ? 26 ILE A CB   4 
ATOM 3934  C CG1  . ILE A 1 26 ? -15.390 4.218   0.646   1.00 0.00 ? 26 ILE A CG1  4 
ATOM 3935  C CG2  . ILE A 1 26 ? -15.704 6.067   2.304   1.00 0.00 ? 26 ILE A CG2  4 
ATOM 3936  C CD1  . ILE A 1 26 ? -16.331 3.250   1.329   1.00 0.00 ? 26 ILE A CD1  4 
ATOM 3937  H H    . ILE A 1 26 ? -12.695 4.201   0.313   1.00 0.00 ? 26 ILE A H    4 
ATOM 3938  H HA   . ILE A 1 26 ? -14.145 6.577   0.099   1.00 0.00 ? 26 ILE A HA   4 
ATOM 3939  H HB   . ILE A 1 26 ? -14.177 4.594   2.368   1.00 0.00 ? 26 ILE A HB   4 
ATOM 3940  H HG12 . ILE A 1 26 ? -15.965 4.795   -0.061  1.00 0.00 ? 26 ILE A HG12 4 
ATOM 3941  H HG13 . ILE A 1 26 ? -14.649 3.644   0.114   1.00 0.00 ? 26 ILE A HG13 4 
ATOM 3942  H HG21 . ILE A 1 26 ? -15.193 6.751   2.964   1.00 0.00 ? 26 ILE A HG21 4 
ATOM 3943  H HG22 . ILE A 1 26 ? -16.253 6.626   1.561   1.00 0.00 ? 26 ILE A HG22 4 
ATOM 3944  H HG23 . ILE A 1 26 ? -16.390 5.459   2.877   1.00 0.00 ? 26 ILE A HG23 4 
ATOM 3945  H HD11 . ILE A 1 26 ? -15.848 2.830   2.199   1.00 0.00 ? 26 ILE A HD11 4 
ATOM 3946  H HD12 . ILE A 1 26 ? -17.227 3.774   1.631   1.00 0.00 ? 26 ILE A HD12 4 
ATOM 3947  H HD13 . ILE A 1 26 ? -16.592 2.458   0.644   1.00 0.00 ? 26 ILE A HD13 4 
ATOM 3948  N N    . GLY A 1 27 ? -12.315 6.448   2.867   1.00 0.00 ? 27 GLY A N    4 
ATOM 3949  C CA   . GLY A 1 27 ? -11.681 7.307   3.858   1.00 0.00 ? 27 GLY A CA   4 
ATOM 3950  C C    . GLY A 1 27 ? -10.525 8.110   3.298   1.00 0.00 ? 27 GLY A C    4 
ATOM 3951  O O    . GLY A 1 27 ? -10.388 9.296   3.603   1.00 0.00 ? 27 GLY A O    4 
ATOM 3952  H H    . GLY A 1 27 ? -12.258 5.470   2.952   1.00 0.00 ? 27 GLY A H    4 
ATOM 3953  H HA2  . GLY A 1 27 ? -12.421 7.995   4.240   1.00 0.00 ? 27 GLY A HA2  4 
ATOM 3954  H HA3  . GLY A 1 27 ? -11.325 6.707   4.675   1.00 0.00 ? 27 GLY A HA3  4 
ATOM 3955  N N    . ILE A 1 28 ? -9.687  7.481   2.477   1.00 0.00 ? 28 ILE A N    4 
ATOM 3956  C CA   . ILE A 1 28 ? -8.557  8.192   1.891   1.00 0.00 ? 28 ILE A CA   4 
ATOM 3957  C C    . ILE A 1 28 ? -9.084  9.418   1.180   1.00 0.00 ? 28 ILE A C    4 
ATOM 3958  O O    . ILE A 1 28 ? -8.609  10.530  1.375   1.00 0.00 ? 28 ILE A O    4 
ATOM 3959  C CB   . ILE A 1 28 ? -7.752  7.307   0.915   1.00 0.00 ? 28 ILE A CB   4 
ATOM 3960  C CG1  . ILE A 1 28 ? -6.362  7.896   0.695   1.00 0.00 ? 28 ILE A CG1  4 
ATOM 3961  C CG2  . ILE A 1 28 ? -8.468  7.132   -0.416  1.00 0.00 ? 28 ILE A CG2  4 
ATOM 3962  C CD1  . ILE A 1 28 ? -5.563  8.038   1.969   1.00 0.00 ? 28 ILE A CD1  4 
ATOM 3963  H H    . ILE A 1 28 ? -9.834  6.538   2.260   1.00 0.00 ? 28 ILE A H    4 
ATOM 3964  H HA   . ILE A 1 28 ? -7.908  8.504   2.694   1.00 0.00 ? 28 ILE A HA   4 
ATOM 3965  H HB   . ILE A 1 28 ? -7.657  6.340   1.358   1.00 0.00 ? 28 ILE A HB   4 
ATOM 3966  H HG12 . ILE A 1 28 ? -5.807  7.253   0.033   1.00 0.00 ? 28 ILE A HG12 4 
ATOM 3967  H HG13 . ILE A 1 28 ? -6.458  8.874   0.251   1.00 0.00 ? 28 ILE A HG13 4 
ATOM 3968  H HG21 . ILE A 1 28 ? -9.443  6.713   -0.240  1.00 0.00 ? 28 ILE A HG21 4 
ATOM 3969  H HG22 . ILE A 1 28 ? -8.568  8.088   -0.905  1.00 0.00 ? 28 ILE A HG22 4 
ATOM 3970  H HG23 . ILE A 1 28 ? -7.901  6.463   -1.045  1.00 0.00 ? 28 ILE A HG23 4 
ATOM 3971  H HD11 . ILE A 1 28 ? -6.168  7.730   2.809   1.00 0.00 ? 28 ILE A HD11 4 
ATOM 3972  H HD12 . ILE A 1 28 ? -4.684  7.416   1.911   1.00 0.00 ? 28 ILE A HD12 4 
ATOM 3973  H HD13 . ILE A 1 28 ? -5.268  9.068   2.096   1.00 0.00 ? 28 ILE A HD13 4 
ATOM 3974  N N    . GLY A 1 29 ? -10.129 9.193   0.409   1.00 0.00 ? 29 GLY A N    4 
ATOM 3975  C CA   . GLY A 1 29 ? -10.782 10.279  -0.288  1.00 0.00 ? 29 GLY A CA   4 
ATOM 3976  C C    . GLY A 1 29 ? -11.352 11.279  0.696   1.00 0.00 ? 29 GLY A C    4 
ATOM 3977  O O    . GLY A 1 29 ? -11.329 12.485  0.457   1.00 0.00 ? 29 GLY A O    4 
ATOM 3978  H H    . GLY A 1 29 ? -10.478 8.278   0.348   1.00 0.00 ? 29 GLY A H    4 
ATOM 3979  H HA2  . GLY A 1 29 ? -10.065 10.774  -0.928  1.00 0.00 ? 29 GLY A HA2  4 
ATOM 3980  H HA3  . GLY A 1 29 ? -11.585 9.883   -0.893  1.00 0.00 ? 29 GLY A HA3  4 
ATOM 3981  N N    . ILE A 1 30 ? -11.857 10.769  1.821   1.00 0.00 ? 30 ILE A N    4 
ATOM 3982  C CA   . ILE A 1 30 ? -12.425 11.621  2.860   1.00 0.00 ? 30 ILE A CA   4 
ATOM 3983  C C    . ILE A 1 30 ? -11.367 12.571  3.424   1.00 0.00 ? 30 ILE A C    4 
ATOM 3984  O O    . ILE A 1 30 ? -11.398 13.772  3.155   1.00 0.00 ? 30 ILE A O    4 
ATOM 3985  C CB   . ILE A 1 30 ? -13.049 10.777  4.006   1.00 0.00 ? 30 ILE A CB   4 
ATOM 3986  C CG1  . ILE A 1 30 ? -14.250 9.995   3.480   1.00 0.00 ? 30 ILE A CG1  4 
ATOM 3987  C CG2  . ILE A 1 30 ? -13.480 11.662  5.171   1.00 0.00 ? 30 ILE A CG2  4 
ATOM 3988  C CD1  . ILE A 1 30 ? -14.893 9.102   4.518   1.00 0.00 ? 30 ILE A CD1  4 
ATOM 3989  H H    . ILE A 1 30 ? -11.842 9.796   1.955   1.00 0.00 ? 30 ILE A H    4 
ATOM 3990  H HA   . ILE A 1 30 ? -13.214 12.208  2.409   1.00 0.00 ? 30 ILE A HA   4 
ATOM 3991  H HB   . ILE A 1 30 ? -12.305 10.072  4.368   1.00 0.00 ? 30 ILE A HB   4 
ATOM 3992  H HG12 . ILE A 1 30 ? -14.999 10.690  3.133   1.00 0.00 ? 30 ILE A HG12 4 
ATOM 3993  H HG13 . ILE A 1 30 ? -13.935 9.380   2.659   1.00 0.00 ? 30 ILE A HG13 4 
ATOM 3994  H HG21 . ILE A 1 30 ? -12.770 12.462  5.305   1.00 0.00 ? 30 ILE A HG21 4 
ATOM 3995  H HG22 . ILE A 1 30 ? -14.455 12.079  4.962   1.00 0.00 ? 30 ILE A HG22 4 
ATOM 3996  H HG23 . ILE A 1 30 ? -13.530 11.071  6.073   1.00 0.00 ? 30 ILE A HG23 4 
ATOM 3997  H HD11 . ILE A 1 30 ? -15.023 9.655   5.437   1.00 0.00 ? 30 ILE A HD11 4 
ATOM 3998  H HD12 . ILE A 1 30 ? -15.855 8.768   4.160   1.00 0.00 ? 30 ILE A HD12 4 
ATOM 3999  H HD13 . ILE A 1 30 ? -14.261 8.246   4.700   1.00 0.00 ? 30 ILE A HD13 4 
ATOM 4000  N N    . LEU A 1 31 ? -10.436 12.027  4.207   1.00 0.00 ? 31 LEU A N    4 
ATOM 4001  C CA   . LEU A 1 31 ? -9.371  12.825  4.819   1.00 0.00 ? 31 LEU A CA   4 
ATOM 4002  C C    . LEU A 1 31 ? -8.361  13.280  3.770   1.00 0.00 ? 31 LEU A C    4 
ATOM 4003  O O    . LEU A 1 31 ? -7.907  14.425  3.786   1.00 0.00 ? 31 LEU A O    4 
ATOM 4004  C CB   . LEU A 1 31 ? -8.671  12.008  5.913   1.00 0.00 ? 31 LEU A CB   4 
ATOM 4005  C CG   . LEU A 1 31 ? -7.576  12.739  6.701   1.00 0.00 ? 31 LEU A CG   4 
ATOM 4006  C CD1  . LEU A 1 31 ? -6.327  12.941  5.852   1.00 0.00 ? 31 LEU A CD1  4 
ATOM 4007  C CD2  . LEU A 1 31 ? -8.092  14.073  7.218   1.00 0.00 ? 31 LEU A CD2  4 
ATOM 4008  H H    . LEU A 1 31 ? -10.469 11.064  4.385   1.00 0.00 ? 31 LEU A H    4 
ATOM 4009  H HA   . LEU A 1 31 ? -9.824  13.702  5.269   1.00 0.00 ? 31 LEU A HA   4 
ATOM 4010  H HB2  . LEU A 1 31 ? -9.422  11.672  6.613   1.00 0.00 ? 31 LEU A HB2  4 
ATOM 4011  H HB3  . LEU A 1 31 ? -8.227  11.138  5.450   1.00 0.00 ? 31 LEU A HB3  4 
ATOM 4012  H HG   . LEU A 1 31 ? -7.299  12.138  7.556   1.00 0.00 ? 31 LEU A HG   4 
ATOM 4013  H HD11 . LEU A 1 31 ? -6.417  12.375  4.937   1.00 0.00 ? 31 LEU A HD11 4 
ATOM 4014  H HD12 . LEU A 1 31 ? -6.216  13.990  5.618   1.00 0.00 ? 31 LEU A HD12 4 
ATOM 4015  H HD13 . LEU A 1 31 ? -5.462  12.603  6.402   1.00 0.00 ? 31 LEU A HD13 4 
ATOM 4016  H HD21 . LEU A 1 31 ? -8.988  13.913  7.800   1.00 0.00 ? 31 LEU A HD21 4 
ATOM 4017  H HD22 . LEU A 1 31 ? -7.337  14.537  7.836   1.00 0.00 ? 31 LEU A HD22 4 
ATOM 4018  H HD23 . LEU A 1 31 ? -8.317  14.720  6.382   1.00 0.00 ? 31 LEU A HD23 4 
ATOM 4019  N N    . GLY A 1 32 ? -8.011  12.379  2.863   1.00 0.00 ? 32 GLY A N    4 
ATOM 4020  C CA   . GLY A 1 32 ? -7.059  12.714  1.821   1.00 0.00 ? 32 GLY A CA   4 
ATOM 4021  C C    . GLY A 1 32 ? -7.600  13.774  0.885   1.00 0.00 ? 32 GLY A C    4 
ATOM 4022  O O    . GLY A 1 32 ? -6.896  14.720  0.539   1.00 0.00 ? 32 GLY A O    4 
ATOM 4023  H H    . GLY A 1 32 ? -8.401  11.481  2.898   1.00 0.00 ? 32 GLY A H    4 
ATOM 4024  H HA2  . GLY A 1 32 ? -6.152  13.079  2.279   1.00 0.00 ? 32 GLY A HA2  4 
ATOM 4025  H HA3  . GLY A 1 32 ? -6.831  11.825  1.250   1.00 0.00 ? 32 GLY A HA3  4 
ATOM 4026  N N    . GLY A 1 33 ? -8.860  13.625  0.486   1.00 0.00 ? 33 GLY A N    4 
ATOM 4027  C CA   . GLY A 1 33 ? -9.471  14.594  -0.405  1.00 0.00 ? 33 GLY A CA   4 
ATOM 4028  C C    . GLY A 1 33 ? -9.598  15.965  0.231   1.00 0.00 ? 33 GLY A C    4 
ATOM 4029  O O    . GLY A 1 33 ? -9.416  16.982  -0.437  1.00 0.00 ? 33 GLY A O    4 
ATOM 4030  H H    . GLY A 1 33 ? -9.379  12.857  0.804   1.00 0.00 ? 33 GLY A H    4 
ATOM 4031  H HA2  . GLY A 1 33 ? -8.866  14.677  -1.298  1.00 0.00 ? 33 GLY A HA2  4 
ATOM 4032  H HA3  . GLY A 1 33 ? -10.455 14.245  -0.684  1.00 0.00 ? 33 GLY A HA3  4 
ATOM 4033  N N    . LYS A 1 34 ? -9.916  15.994  1.524   1.00 0.00 ? 34 LYS A N    4 
ATOM 4034  C CA   . LYS A 1 34 ? -10.067 17.257  2.243   1.00 0.00 ? 34 LYS A CA   4 
ATOM 4035  C C    . LYS A 1 34 ? -8.709  17.913  2.461   1.00 0.00 ? 34 LYS A C    4 
ATOM 4036  O O    . LYS A 1 34 ? -8.526  19.104  2.190   1.00 0.00 ? 34 LYS A O    4 
ATOM 4037  C CB   . LYS A 1 34 ? -10.770 17.030  3.589   1.00 0.00 ? 34 LYS A CB   4 
ATOM 4038  C CG   . LYS A 1 34 ? -10.015 16.115  4.537   1.00 0.00 ? 34 LYS A CG   4 
ATOM 4039  C CD   . LYS A 1 34 ? -10.756 15.941  5.858   1.00 0.00 ? 34 LYS A CD   4 
ATOM 4040  C CE   . LYS A 1 34 ? -12.112 15.282  5.658   1.00 0.00 ? 34 LYS A CE   4 
ATOM 4041  N NZ   . LYS A 1 34 ? -12.839 15.094  6.945   1.00 0.00 ? 34 LYS A NZ   4 
ATOM 4042  H H    . LYS A 1 34 ? -10.052 15.151  2.004   1.00 0.00 ? 34 LYS A H    4 
ATOM 4043  H HA   . LYS A 1 34 ? -10.667 17.911  1.631   1.00 0.00 ? 34 LYS A HA   4 
ATOM 4044  H HB2  . LYS A 1 34 ? -10.900 17.977  4.079   1.00 0.00 ? 34 LYS A HB2  4 
ATOM 4045  H HB3  . LYS A 1 34 ? -11.740 16.595  3.404   1.00 0.00 ? 34 LYS A HB3  4 
ATOM 4046  H HG2  . LYS A 1 34 ? -9.901  15.151  4.072   1.00 0.00 ? 34 LYS A HG2  4 
ATOM 4047  H HG3  . LYS A 1 34 ? -9.043  16.540  4.735   1.00 0.00 ? 34 LYS A HG3  4 
ATOM 4048  H HD2  . LYS A 1 34 ? -10.163 15.325  6.515   1.00 0.00 ? 34 LYS A HD2  4 
ATOM 4049  H HD3  . LYS A 1 34 ? -10.902 16.913  6.307   1.00 0.00 ? 34 LYS A HD3  4 
ATOM 4050  H HE2  . LYS A 1 34 ? -12.708 15.901  5.006   1.00 0.00 ? 34 LYS A HE2  4 
ATOM 4051  H HE3  . LYS A 1 34 ? -11.959 14.318  5.198   1.00 0.00 ? 34 LYS A HE3  4 
ATOM 4052  H HZ1  . LYS A 1 34 ? -12.265 15.443  7.737   1.00 0.00 ? 34 LYS A HZ1  4 
ATOM 4053  H HZ2  . LYS A 1 34 ? -13.738 15.616  6.927   1.00 0.00 ? 34 LYS A HZ2  4 
ATOM 4054  H HZ3  . LYS A 1 34 ? -13.041 14.085  7.096   1.00 0.00 ? 34 LYS A HZ3  4 
ATOM 4055  N N    . PHE A 1 35 ? -7.756  17.127  2.935   1.00 0.00 ? 35 PHE A N    4 
ATOM 4056  C CA   . PHE A 1 35 ? -6.414  17.629  3.173   1.00 0.00 ? 35 PHE A CA   4 
ATOM 4057  C C    . PHE A 1 35 ? -5.799  18.051  1.847   1.00 0.00 ? 35 PHE A C    4 
ATOM 4058  O O    . PHE A 1 35 ? -5.266  19.153  1.709   1.00 0.00 ? 35 PHE A O    4 
ATOM 4059  C CB   . PHE A 1 35 ? -5.553  16.544  3.827   1.00 0.00 ? 35 PHE A CB   4 
ATOM 4060  C CG   . PHE A 1 35 ? -4.379  17.085  4.594   1.00 0.00 ? 35 PHE A CG   4 
ATOM 4061  C CD1  . PHE A 1 35 ? -3.418  17.864  3.969   1.00 0.00 ? 35 PHE A CD1  4 
ATOM 4062  C CD2  . PHE A 1 35 ? -4.243  16.818  5.945   1.00 0.00 ? 35 PHE A CD2  4 
ATOM 4063  C CE1  . PHE A 1 35 ? -2.346  18.366  4.680   1.00 0.00 ? 35 PHE A CE1  4 
ATOM 4064  C CE2  . PHE A 1 35 ? -3.172  17.317  6.660   1.00 0.00 ? 35 PHE A CE2  4 
ATOM 4065  C CZ   . PHE A 1 35 ? -2.223  18.093  6.027   1.00 0.00 ? 35 PHE A CZ   4 
ATOM 4066  H H    . PHE A 1 35 ? -7.958  16.185  3.120   1.00 0.00 ? 35 PHE A H    4 
ATOM 4067  H HA   . PHE A 1 35 ? -6.478  18.486  3.833   1.00 0.00 ? 35 PHE A HA   4 
ATOM 4068  H HB2  . PHE A 1 35 ? -6.163  15.976  4.511   1.00 0.00 ? 35 PHE A HB2  4 
ATOM 4069  H HB3  . PHE A 1 35 ? -5.175  15.884  3.060   1.00 0.00 ? 35 PHE A HB3  4 
ATOM 4070  H HD1  . PHE A 1 35 ? -3.512  18.082  2.917   1.00 0.00 ? 35 PHE A HD1  4 
ATOM 4071  H HD2  . PHE A 1 35 ? -4.985  16.211  6.442   1.00 0.00 ? 35 PHE A HD2  4 
ATOM 4072  H HE1  . PHE A 1 35 ? -1.604  18.972  4.182   1.00 0.00 ? 35 PHE A HE1  4 
ATOM 4073  H HE2  . PHE A 1 35 ? -3.078  17.101  7.714   1.00 0.00 ? 35 PHE A HE2  4 
ATOM 4074  H HZ   . PHE A 1 35 ? -1.385  18.485  6.584   1.00 0.00 ? 35 PHE A HZ   4 
ATOM 4075  N N    . LEU A 1 36 ? -5.891  17.153  0.870   1.00 0.00 ? 36 LEU A N    4 
ATOM 4076  C CA   . LEU A 1 36 ? -5.351  17.395  -0.463  1.00 0.00 ? 36 LEU A CA   4 
ATOM 4077  C C    . LEU A 1 36 ? -5.927  18.663  -1.069  1.00 0.00 ? 36 LEU A C    4 
ATOM 4078  O O    . LEU A 1 36 ? -5.181  19.514  -1.541  1.00 0.00 ? 36 LEU A O    4 
ATOM 4079  C CB   . LEU A 1 36 ? -5.630  16.206  -1.389  1.00 0.00 ? 36 LEU A CB   4 
ATOM 4080  C CG   . LEU A 1 36 ? -4.962  16.279  -2.769  1.00 0.00 ? 36 LEU A CG   4 
ATOM 4081  C CD1  . LEU A 1 36 ? -5.152  14.973  -3.524  1.00 0.00 ? 36 LEU A CD1  4 
ATOM 4082  C CD2  . LEU A 1 36 ? -5.517  17.439  -3.586  1.00 0.00 ? 36 LEU A CD2  4 
ATOM 4083  H H    . LEU A 1 36 ? -6.333  16.301  1.055   1.00 0.00 ? 36 LEU A H    4 
ATOM 4084  H HA   . LEU A 1 36 ? -4.282  17.516  -0.366  1.00 0.00 ? 36 LEU A HA   4 
ATOM 4085  H HB2  . LEU A 1 36 ? -5.288  15.307  -0.896  1.00 0.00 ? 36 LEU A HB2  4 
ATOM 4086  H HB3  . LEU A 1 36 ? -6.697  16.134  -1.536  1.00 0.00 ? 36 LEU A HB3  4 
ATOM 4087  H HG   . LEU A 1 36 ? -3.902  16.438  -2.638  1.00 0.00 ? 36 LEU A HG   4 
ATOM 4088  H HD11 . LEU A 1 36 ? -5.902  14.375  -3.028  1.00 0.00 ? 36 LEU A HD11 4 
ATOM 4089  H HD12 . LEU A 1 36 ? -5.468  15.182  -4.536  1.00 0.00 ? 36 LEU A HD12 4 
ATOM 4090  H HD13 . LEU A 1 36 ? -4.217  14.432  -3.545  1.00 0.00 ? 36 LEU A HD13 4 
ATOM 4091  H HD21 . LEU A 1 36 ? -6.547  17.614  -3.313  1.00 0.00 ? 36 LEU A HD21 4 
ATOM 4092  H HD22 . LEU A 1 36 ? -4.937  18.328  -3.388  1.00 0.00 ? 36 LEU A HD22 4 
ATOM 4093  H HD23 . LEU A 1 36 ? -5.458  17.200  -4.638  1.00 0.00 ? 36 LEU A HD23 4 
ATOM 4094  N N    . GLU A 1 37 ? -7.253  18.794  -1.075  1.00 0.00 ? 37 GLU A N    4 
ATOM 4095  C CA   . GLU A 1 37 ? -7.873  19.973  -1.650  1.00 0.00 ? 37 GLU A CA   4 
ATOM 4096  C C    . GLU A 1 37 ? -7.345  21.224  -0.960  1.00 0.00 ? 37 GLU A C    4 
ATOM 4097  O O    . GLU A 1 37 ? -6.867  22.156  -1.612  1.00 0.00 ? 37 GLU A O    4 
ATOM 4098  C CB   . GLU A 1 37 ? -9.397  19.887  -1.549  1.00 0.00 ? 37 GLU A CB   4 
ATOM 4099  C CG   . GLU A 1 37 ? -9.939  19.895  -0.132  1.00 0.00 ? 37 GLU A CG   4 
ATOM 4100  C CD   . GLU A 1 37 ? -11.452 19.784  -0.090  1.00 0.00 ? 37 GLU A CD   4 
ATOM 4101  O OE1  . GLU A 1 37 ? -11.986 18.758  -0.562  1.00 0.00 ? 37 GLU A OE1  4 
ATOM 4102  O OE2  . GLU A 1 37 ? -12.101 20.725  0.411   1.00 0.00 ? 37 GLU A OE2  4 
ATOM 4103  H H    . GLU A 1 37 ? -7.821  18.090  -0.695  1.00 0.00 ? 37 GLU A H    4 
ATOM 4104  H HA   . GLU A 1 37 ? -7.594  20.012  -2.695  1.00 0.00 ? 37 GLU A HA   4 
ATOM 4105  H HB2  . GLU A 1 37 ? -9.825  20.719  -2.076  1.00 0.00 ? 37 GLU A HB2  4 
ATOM 4106  H HB3  . GLU A 1 37 ? -9.720  18.975  -2.025  1.00 0.00 ? 37 GLU A HB3  4 
ATOM 4107  H HG2  . GLU A 1 37 ? -9.518  19.059  0.404   1.00 0.00 ? 37 GLU A HG2  4 
ATOM 4108  H HG3  . GLU A 1 37 ? -9.648  20.818  0.347   1.00 0.00 ? 37 GLU A HG3  4 
ATOM 4109  N N    . GLY A 1 38 ? -7.403  21.229  0.367   1.00 0.00 ? 38 GLY A N    4 
ATOM 4110  C CA   . GLY A 1 38 ? -6.900  22.366  1.117   1.00 0.00 ? 38 GLY A CA   4 
ATOM 4111  C C    . GLY A 1 38 ? -5.464  22.695  0.746   1.00 0.00 ? 38 GLY A C    4 
ATOM 4112  O O    . GLY A 1 38 ? -5.151  23.830  0.382   1.00 0.00 ? 38 GLY A O    4 
ATOM 4113  H H    . GLY A 1 38 ? -7.774  20.448  0.839   1.00 0.00 ? 38 GLY A H    4 
ATOM 4114  H HA2  . GLY A 1 38 ? -7.523  23.226  0.911   1.00 0.00 ? 38 GLY A HA2  4 
ATOM 4115  H HA3  . GLY A 1 38 ? -6.948  22.142  2.173   1.00 0.00 ? 38 GLY A HA3  4 
ATOM 4116  N N    . ALA A 1 39 ? -4.592  21.693  0.830   1.00 0.00 ? 39 ALA A N    4 
ATOM 4117  C CA   . ALA A 1 39 ? -3.183  21.872  0.496   1.00 0.00 ? 39 ALA A CA   4 
ATOM 4118  C C    . ALA A 1 39 ? -3.011  22.206  -0.980  1.00 0.00 ? 39 ALA A C    4 
ATOM 4119  O O    . ALA A 1 39 ? -2.217  23.069  -1.347  1.00 0.00 ? 39 ALA A O    4 
ATOM 4120  C CB   . ALA A 1 39 ? -2.389  20.620  0.853   1.00 0.00 ? 39 ALA A CB   4 
ATOM 4121  H H    . ALA A 1 39 ? -4.905  20.810  1.119   1.00 0.00 ? 39 ALA A H    4 
ATOM 4122  H HA   . ALA A 1 39 ? -2.802  22.691  1.090   1.00 0.00 ? 39 ALA A HA   4 
ATOM 4123  H HB1  . ALA A 1 39 ? -3.064  19.847  1.188   1.00 0.00 ? 39 ALA A HB1  4 
ATOM 4124  H HB2  . ALA A 1 39 ? -1.849  20.274  -0.018  1.00 0.00 ? 39 ALA A HB2  4 
ATOM 4125  H HB3  . ALA A 1 39 ? -1.689  20.852  1.641   1.00 0.00 ? 39 ALA A HB3  4 
ATOM 4126  N N    . ALA A 1 40 ? -3.757  21.513  -1.830  1.00 0.00 ? 40 ALA A N    4 
ATOM 4127  C CA   . ALA A 1 40 ? -3.681  21.741  -3.266  1.00 0.00 ? 40 ALA A CA   4 
ATOM 4128  C C    . ALA A 1 40 ? -3.979  23.198  -3.593  1.00 0.00 ? 40 ALA A C    4 
ATOM 4129  O O    . ALA A 1 40 ? -3.444  23.749  -4.555  1.00 0.00 ? 40 ALA A O    4 
ATOM 4130  C CB   . ALA A 1 40 ? -4.628  20.814  -4.006  1.00 0.00 ? 40 ALA A CB   4 
ATOM 4131  H H    . ALA A 1 40 ? -4.372  20.834  -1.484  1.00 0.00 ? 40 ALA A H    4 
ATOM 4132  H HA   . ALA A 1 40 ? -2.672  21.513  -3.582  1.00 0.00 ? 40 ALA A HA   4 
ATOM 4133  H HB1  . ALA A 1 40 ? -5.478  20.593  -3.379  1.00 0.00 ? 40 ALA A HB1  4 
ATOM 4134  H HB2  . ALA A 1 40 ? -4.964  21.292  -4.913  1.00 0.00 ? 40 ALA A HB2  4 
ATOM 4135  H HB3  . ALA A 1 40 ? -4.111  19.898  -4.251  1.00 0.00 ? 40 ALA A HB3  4 
ATOM 4136  N N    . ARG A 1 41 ? -4.820  23.824  -2.776  1.00 0.00 ? 41 ARG A N    4 
ATOM 4137  C CA   . ARG A 1 41 ? -5.158  25.224  -2.972  1.00 0.00 ? 41 ARG A CA   4 
ATOM 4138  C C    . ARG A 1 41 ? -4.076  26.102  -2.366  1.00 0.00 ? 41 ARG A C    4 
ATOM 4139  O O    . ARG A 1 41 ? -3.729  27.156  -2.901  1.00 0.00 ? 41 ARG A O    4 
ATOM 4140  C CB   . ARG A 1 41 ? -6.496  25.555  -2.314  1.00 0.00 ? 41 ARG A CB   4 
ATOM 4141  C CG   . ARG A 1 41 ? -7.674  24.761  -2.847  1.00 0.00 ? 41 ARG A CG   4 
ATOM 4142  C CD   . ARG A 1 41 ? -8.903  24.998  -1.988  1.00 0.00 ? 41 ARG A CD   4 
ATOM 4143  N NE   . ARG A 1 41 ? -10.024 24.141  -2.366  1.00 0.00 ? 41 ARG A NE   4 
ATOM 4144  C CZ   . ARG A 1 41 ? -11.211 24.168  -1.762  1.00 0.00 ? 41 ARG A CZ   4 
ATOM 4145  N NH1  . ARG A 1 41 ? -11.440 25.027  -0.776  1.00 0.00 ? 41 ARG A NH1  4 
ATOM 4146  N NH2  . ARG A 1 41 ? -12.172 23.340  -2.146  1.00 0.00 ? 41 ARG A NH2  4 
ATOM 4147  H H    . ARG A 1 41 ? -5.212  23.336  -2.017  1.00 0.00 ? 41 ARG A H    4 
ATOM 4148  H HA   . ARG A 1 41 ? -5.216  25.413  -4.025  1.00 0.00 ? 41 ARG A HA   4 
ATOM 4149  H HB2  . ARG A 1 41 ? -6.416  25.364  -1.254  1.00 0.00 ? 41 ARG A HB2  4 
ATOM 4150  H HB3  . ARG A 1 41 ? -6.700  26.603  -2.464  1.00 0.00 ? 41 ARG A HB3  4 
ATOM 4151  H HG2  . ARG A 1 41 ? -7.882  25.078  -3.857  1.00 0.00 ? 41 ARG A HG2  4 
ATOM 4152  H HG3  . ARG A 1 41 ? -7.429  23.712  -2.838  1.00 0.00 ? 41 ARG A HG3  4 
ATOM 4153  H HD2  . ARG A 1 41 ? -8.643  24.801  -0.958  1.00 0.00 ? 41 ARG A HD2  4 
ATOM 4154  H HD3  . ARG A 1 41 ? -9.200  26.032  -2.090  1.00 0.00 ? 41 ARG A HD3  4 
ATOM 4155  H HE   . ARG A 1 41 ? -9.884  23.506  -3.100  1.00 0.00 ? 41 ARG A HE   4 
ATOM 4156  H HH11 . ARG A 1 41 ? -10.721 25.656  -0.483  1.00 0.00 ? 41 ARG A HH11 4 
ATOM 4157  H HH12 . ARG A 1 41 ? -12.332 25.042  -0.326  1.00 0.00 ? 41 ARG A HH12 4 
ATOM 4158  H HH21 . ARG A 1 41 ? -12.007 22.692  -2.891  1.00 0.00 ? 41 ARG A HH21 4 
ATOM 4159  H HH22 . ARG A 1 41 ? -13.061 23.360  -1.690  1.00 0.00 ? 41 ARG A HH22 4 
ATOM 4160  N N    . GLN A 1 42 ? -3.564  25.652  -1.230  1.00 0.00 ? 42 GLN A N    4 
ATOM 4161  C CA   . GLN A 1 42 ? -2.531  26.364  -0.501  1.00 0.00 ? 42 GLN A CA   4 
ATOM 4162  C C    . GLN A 1 42 ? -1.430  26.866  -1.441  1.00 0.00 ? 42 GLN A C    4 
ATOM 4163  O O    . GLN A 1 42 ? -0.882  26.112  -2.246  1.00 0.00 ? 42 GLN A O    4 
ATOM 4164  C CB   . GLN A 1 42 ? -1.932  25.470  0.585   1.00 0.00 ? 42 GLN A CB   4 
ATOM 4165  C CG   . GLN A 1 42 ? -1.119  26.227  1.628   1.00 0.00 ? 42 GLN A CG   4 
ATOM 4166  C CD   . GLN A 1 42 ? -1.946  27.195  2.471   1.00 0.00 ? 42 GLN A CD   4 
ATOM 4167  O OE1  . GLN A 1 42 ? -1.394  27.958  3.265   1.00 0.00 ? 42 GLN A OE1  4 
ATOM 4168  N NE2  . GLN A 1 42 ? -3.271  27.168  2.322   1.00 0.00 ? 42 GLN A NE2  4 
ATOM 4169  H H    . GLN A 1 42 ? -3.904  24.821  -0.865  1.00 0.00 ? 42 GLN A H    4 
ATOM 4170  H HA   . GLN A 1 42 ? -3.001  27.211  -0.032  1.00 0.00 ? 42 GLN A HA   4 
ATOM 4171  H HB2  . GLN A 1 42 ? -2.732  24.949  1.091   1.00 0.00 ? 42 GLN A HB2  4 
ATOM 4172  H HB3  . GLN A 1 42 ? -1.287  24.748  0.118   1.00 0.00 ? 42 GLN A HB3  4 
ATOM 4173  H HG2  . GLN A 1 42 ? -0.657  25.510  2.290   1.00 0.00 ? 42 GLN A HG2  4 
ATOM 4174  H HG3  . GLN A 1 42 ? -0.346  26.787  1.120   1.00 0.00 ? 42 GLN A HG3  4 
ATOM 4175  H HE21 . GLN A 1 42 ? -3.657  26.535  1.684   1.00 0.00 ? 42 GLN A HE21 4 
ATOM 4176  H HE22 . GLN A 1 42 ? -3.807  27.790  2.857   1.00 0.00 ? 42 GLN A HE22 4 
ATOM 4177  N N    . PRO A 1 43 ? -1.124  28.164  -1.347  1.00 0.00 ? 43 PRO A N    4 
ATOM 4178  C CA   . PRO A 1 43 ? -0.122  28.846  -2.166  1.00 0.00 ? 43 PRO A CA   4 
ATOM 4179  C C    . PRO A 1 43 ? 1.089   28.002  -2.583  1.00 0.00 ? 43 PRO A C    4 
ATOM 4180  O O    . PRO A 1 43 ? 1.641   28.222  -3.661  1.00 0.00 ? 43 PRO A O    4 
ATOM 4181  C CB   . PRO A 1 43 ? 0.314   29.980  -1.247  1.00 0.00 ? 43 PRO A CB   4 
ATOM 4182  C CG   . PRO A 1 43 ? -0.923  30.351  -0.498  1.00 0.00 ? 43 PRO A CG   4 
ATOM 4183  C CD   . PRO A 1 43 ? -1.775  29.105  -0.421  1.00 0.00 ? 43 PRO A CD   4 
ATOM 4184  H HA   . PRO A 1 43 ? -0.570  29.268  -3.050  1.00 0.00 ? 43 PRO A HA   4 
ATOM 4185  H HB2  . PRO A 1 43 ? 1.090   29.629  -0.582  1.00 0.00 ? 43 PRO A HB2  4 
ATOM 4186  H HB3  . PRO A 1 43 ? 0.682   30.805  -1.837  1.00 0.00 ? 43 PRO A HB3  4 
ATOM 4187  H HG2  . PRO A 1 43 ? -0.663  30.685  0.495   1.00 0.00 ? 43 PRO A HG2  4 
ATOM 4188  H HG3  . PRO A 1 43 ? -1.450  31.131  -1.027  1.00 0.00 ? 43 PRO A HG3  4 
ATOM 4189  H HD2  . PRO A 1 43 ? -1.779  28.707  0.583   1.00 0.00 ? 43 PRO A HD2  4 
ATOM 4190  H HD3  . PRO A 1 43 ? -2.785  29.315  -0.744  1.00 0.00 ? 43 PRO A HD3  4 
ATOM 4191  N N    . ASP A 1 44 ? 1.532   27.064  -1.745  1.00 0.00 ? 44 ASP A N    4 
ATOM 4192  C CA   . ASP A 1 44 ? 2.709   26.260  -2.098  1.00 0.00 ? 44 ASP A CA   4 
ATOM 4193  C C    . ASP A 1 44 ? 2.595   24.790  -1.694  1.00 0.00 ? 44 ASP A C    4 
ATOM 4194  O O    . ASP A 1 44 ? 3.608   24.138  -1.445  1.00 0.00 ? 44 ASP A O    4 
ATOM 4195  C CB   . ASP A 1 44 ? 3.962   26.866  -1.463  1.00 0.00 ? 44 ASP A CB   4 
ATOM 4196  C CG   . ASP A 1 44 ? 4.253   28.262  -1.975  1.00 0.00 ? 44 ASP A CG   4 
ATOM 4197  O OD1  . ASP A 1 44 ? 4.491   28.410  -3.192  1.00 0.00 ? 44 ASP A OD1  4 
ATOM 4198  O OD2  . ASP A 1 44 ? 4.241   29.208  -1.160  1.00 0.00 ? 44 ASP A OD2  4 
ATOM 4199  H H    . ASP A 1 44 ? 1.086   26.927  -0.885  1.00 0.00 ? 44 ASP A H    4 
ATOM 4200  H HA   . ASP A 1 44 ? 2.821   26.304  -3.174  1.00 0.00 ? 44 ASP A HA   4 
ATOM 4201  H HB2  . ASP A 1 44 ? 3.827   26.916  -0.392  1.00 0.00 ? 44 ASP A HB2  4 
ATOM 4202  H HB3  . ASP A 1 44 ? 4.812   26.236  -1.684  1.00 0.00 ? 44 ASP A HB3  4 
ATOM 4203  N N    . LEU A 1 45 ? 1.379   24.255  -1.653  1.00 0.00 ? 45 LEU A N    4 
ATOM 4204  C CA   . LEU A 1 45 ? 1.187   22.846  -1.299  1.00 0.00 ? 45 LEU A CA   4 
ATOM 4205  C C    . LEU A 1 45 ? 0.634   22.039  -2.479  1.00 0.00 ? 45 LEU A C    4 
ATOM 4206  O O    . LEU A 1 45 ? 0.307   20.858  -2.338  1.00 0.00 ? 45 LEU A O    4 
ATOM 4207  C CB   . LEU A 1 45 ? 0.273   22.713  -0.079  1.00 0.00 ? 45 LEU A CB   4 
ATOM 4208  C CG   . LEU A 1 45 ? 0.956   22.944  1.273   1.00 0.00 ? 45 LEU A CG   4 
ATOM 4209  C CD1  . LEU A 1 45 ? 1.680   24.280  1.294   1.00 0.00 ? 45 LEU A CD1  4 
ATOM 4210  C CD2  . LEU A 1 45 ? -0.062  22.873  2.403   1.00 0.00 ? 45 LEU A CD2  4 
ATOM 4211  H H    . LEU A 1 45 ? 0.601   24.807  -1.878  1.00 0.00 ? 45 LEU A H    4 
ATOM 4212  H HA   . LEU A 1 45 ? 2.157   22.442  -1.042  1.00 0.00 ? 45 LEU A HA   4 
ATOM 4213  H HB2  . LEU A 1 45 ? -0.525  23.426  -0.180  1.00 0.00 ? 45 LEU A HB2  4 
ATOM 4214  H HB3  . LEU A 1 45 ? -0.150  21.721  -0.078  1.00 0.00 ? 45 LEU A HB3  4 
ATOM 4215  H HG   . LEU A 1 45 ? 1.687   22.167  1.435   1.00 0.00 ? 45 LEU A HG   4 
ATOM 4216  H HD11 . LEU A 1 45 ? 1.018   25.056  0.937   1.00 0.00 ? 45 LEU A HD11 4 
ATOM 4217  H HD12 . LEU A 1 45 ? 1.989   24.507  2.304   1.00 0.00 ? 45 LEU A HD12 4 
ATOM 4218  H HD13 . LEU A 1 45 ? 2.550   24.227  0.658   1.00 0.00 ? 45 LEU A HD13 4 
ATOM 4219  H HD21 . LEU A 1 45 ? -1.057  22.991  2.000   1.00 0.00 ? 45 LEU A HD21 4 
ATOM 4220  H HD22 . LEU A 1 45 ? 0.013   21.915  2.897   1.00 0.00 ? 45 LEU A HD22 4 
ATOM 4221  H HD23 . LEU A 1 45 ? 0.132   23.662  3.115   1.00 0.00 ? 45 LEU A HD23 4 
ATOM 4222  N N    . ILE A 1 46 ? 0.551   22.671  -3.650  1.00 0.00 ? 46 ILE A N    4 
ATOM 4223  C CA   . ILE A 1 46 ? 0.058   21.993  -4.847  1.00 0.00 ? 46 ILE A CA   4 
ATOM 4224  C C    . ILE A 1 46 ? 0.752   20.638  -5.027  1.00 0.00 ? 46 ILE A C    4 
ATOM 4225  O O    . ILE A 1 46 ? 0.094   19.632  -5.284  1.00 0.00 ? 46 ILE A O    4 
ATOM 4226  C CB   . ILE A 1 46 ? 0.254   22.838  -6.128  1.00 0.00 ? 46 ILE A CB   4 
ATOM 4227  C CG1  . ILE A 1 46 ? -0.458  24.195  -6.021  1.00 0.00 ? 46 ILE A CG1  4 
ATOM 4228  C CG2  . ILE A 1 46 ? -0.250  22.081  -7.353  1.00 0.00 ? 46 ILE A CG2  4 
ATOM 4229  C CD1  . ILE A 1 46 ? 0.298   25.234  -5.222  1.00 0.00 ? 46 ILE A CD1  4 
ATOM 4230  H H    . ILE A 1 46 ? 0.838   23.600  -3.710  1.00 0.00 ? 46 ILE A H    4 
ATOM 4231  H HA   . ILE A 1 46 ? -1.002  21.824  -4.715  1.00 0.00 ? 46 ILE A HA   4 
ATOM 4232  H HB   . ILE A 1 46 ? 1.307   23.002  -6.253  1.00 0.00 ? 46 ILE A HB   4 
ATOM 4233  H HG12 . ILE A 1 46 ? -0.609  24.592  -7.014  1.00 0.00 ? 46 ILE A HG12 4 
ATOM 4234  H HG13 . ILE A 1 46 ? -1.420  24.049  -5.551  1.00 0.00 ? 46 ILE A HG13 4 
ATOM 4235  H HG21 . ILE A 1 46 ? -0.539  21.081  -7.066  1.00 0.00 ? 46 ILE A HG21 4 
ATOM 4236  H HG22 . ILE A 1 46 ? -1.103  22.596  -7.769  1.00 0.00 ? 46 ILE A HG22 4 
ATOM 4237  H HG23 . ILE A 1 46 ? 0.536   22.031  -8.092  1.00 0.00 ? 46 ILE A HG23 4 
ATOM 4238  H HD11 . ILE A 1 46 ? 1.273   24.851  -4.960  1.00 0.00 ? 46 ILE A HD11 4 
ATOM 4239  H HD12 . ILE A 1 46 ? 0.412   26.131  -5.815  1.00 0.00 ? 46 ILE A HD12 4 
ATOM 4240  H HD13 . ILE A 1 46 ? -0.253  25.467  -4.322  1.00 0.00 ? 46 ILE A HD13 4 
ATOM 4241  N N    . PRO A 1 47 ? 2.098   20.582  -4.907  1.00 0.00 ? 47 PRO A N    4 
ATOM 4242  C CA   . PRO A 1 47 ? 2.833   19.331  -5.056  1.00 0.00 ? 47 PRO A CA   4 
ATOM 4243  C C    . PRO A 1 47 ? 2.744   18.487  -3.792  1.00 0.00 ? 47 PRO A C    4 
ATOM 4244  O O    . PRO A 1 47 ? 2.988   17.274  -3.808  1.00 0.00 ? 47 PRO A O    4 
ATOM 4245  C CB   . PRO A 1 47 ? 4.261   19.789  -5.325  1.00 0.00 ? 47 PRO A CB   4 
ATOM 4246  C CG   . PRO A 1 47 ? 4.377   21.091  -4.608  1.00 0.00 ? 47 PRO A CG   4 
ATOM 4247  C CD   . PRO A 1 47 ? 3.002   21.717  -4.622  1.00 0.00 ? 47 PRO A CD   4 
ATOM 4248  H HA   . PRO A 1 47 ? 2.457   18.758  -5.891  1.00 0.00 ? 47 PRO A HA   4 
ATOM 4249  H HB2  . PRO A 1 47 ? 4.958   19.058  -4.938  1.00 0.00 ? 47 PRO A HB2  4 
ATOM 4250  H HB3  . PRO A 1 47 ? 4.410   19.911  -6.388  1.00 0.00 ? 47 PRO A HB3  4 
ATOM 4251  H HG2  . PRO A 1 47 ? 4.698   20.920  -3.591  1.00 0.00 ? 47 PRO A HG2  4 
ATOM 4252  H HG3  . PRO A 1 47 ? 5.082   21.728  -5.120  1.00 0.00 ? 47 PRO A HG3  4 
ATOM 4253  H HD2  . PRO A 1 47 ? 2.785   22.151  -3.663  1.00 0.00 ? 47 PRO A HD2  4 
ATOM 4254  H HD3  . PRO A 1 47 ? 2.939   22.464  -5.398  1.00 0.00 ? 47 PRO A HD3  4 
ATOM 4255  N N    . LEU A 1 48 ? 2.348   19.130  -2.699  1.00 0.00 ? 48 LEU A N    4 
ATOM 4256  C CA   . LEU A 1 48 ? 2.157   18.428  -1.446  1.00 0.00 ? 48 LEU A CA   4 
ATOM 4257  C C    . LEU A 1 48 ? 0.940   17.544  -1.619  1.00 0.00 ? 48 LEU A C    4 
ATOM 4258  O O    . LEU A 1 48 ? 0.836   16.468  -1.035  1.00 0.00 ? 48 LEU A O    4 
ATOM 4259  C CB   . LEU A 1 48 ? 1.928   19.414  -0.298  1.00 0.00 ? 48 LEU A CB   4 
ATOM 4260  C CG   . LEU A 1 48 ? 1.532   18.771  1.030   1.00 0.00 ? 48 LEU A CG   4 
ATOM 4261  C CD1  . LEU A 1 48 ? 2.695   17.988  1.615   1.00 0.00 ? 48 LEU A CD1  4 
ATOM 4262  C CD2  . LEU A 1 48 ? 1.043   19.830  2.006   1.00 0.00 ? 48 LEU A CD2  4 
ATOM 4263  H H    . LEU A 1 48 ? 2.137   20.085  -2.750  1.00 0.00 ? 48 LEU A H    4 
ATOM 4264  H HA   . LEU A 1 48 ? 3.028   17.819  -1.248  1.00 0.00 ? 48 LEU A HA   4 
ATOM 4265  H HB2  . LEU A 1 48 ? 2.837   19.977  -0.147  1.00 0.00 ? 48 LEU A HB2  4 
ATOM 4266  H HB3  . LEU A 1 48 ? 1.144   20.097  -0.587  1.00 0.00 ? 48 LEU A HB3  4 
ATOM 4267  H HG   . LEU A 1 48 ? 0.721   18.079  0.856   1.00 0.00 ? 48 LEU A HG   4 
ATOM 4268  H HD11 . LEU A 1 48 ? 3.580   18.608  1.622   1.00 0.00 ? 48 LEU A HD11 4 
ATOM 4269  H HD12 . LEU A 1 48 ? 2.457   17.689  2.624   1.00 0.00 ? 48 LEU A HD12 4 
ATOM 4270  H HD13 . LEU A 1 48 ? 2.876   17.111  1.012   1.00 0.00 ? 48 LEU A HD13 4 
ATOM 4271  H HD21 . LEU A 1 48 ? 0.334   20.477  1.508   1.00 0.00 ? 48 LEU A HD21 4 
ATOM 4272  H HD22 . LEU A 1 48 ? 0.562   19.350  2.846   1.00 0.00 ? 48 LEU A HD22 4 
ATOM 4273  H HD23 . LEU A 1 48 ? 1.881   20.413  2.355   1.00 0.00 ? 48 LEU A HD23 4 
ATOM 4274  N N    . LEU A 1 49 ? 0.027   18.034  -2.461  1.00 0.00 ? 49 LEU A N    4 
ATOM 4275  C CA   . LEU A 1 49 ? -1.208  17.348  -2.788  1.00 0.00 ? 49 LEU A CA   4 
ATOM 4276  C C    . LEU A 1 49 ? -0.934  15.879  -3.127  1.00 0.00 ? 49 LEU A C    4 
ATOM 4277  O O    . LEU A 1 49 ? -1.441  14.975  -2.462  1.00 0.00 ? 49 LEU A O    4 
ATOM 4278  C CB   . LEU A 1 49 ? -1.891  18.106  -3.949  1.00 0.00 ? 49 LEU A CB   4 
ATOM 4279  C CG   . LEU A 1 49 ? -1.940  17.412  -5.318  1.00 0.00 ? 49 LEU A CG   4 
ATOM 4280  C CD1  . LEU A 1 49 ? -2.822  16.169  -5.277  1.00 0.00 ? 49 LEU A CD1  4 
ATOM 4281  C CD2  . LEU A 1 49 ? -2.434  18.380  -6.385  1.00 0.00 ? 49 LEU A CD2  4 
ATOM 4282  H H    . LEU A 1 49 ? 0.201   18.900  -2.890  1.00 0.00 ? 49 LEU A H    4 
ATOM 4283  H HA   . LEU A 1 49 ? -1.847  17.390  -1.918  1.00 0.00 ? 49 LEU A HA   4 
ATOM 4284  H HB2  . LEU A 1 49 ? -2.902  18.333  -3.654  1.00 0.00 ? 49 LEU A HB2  4 
ATOM 4285  H HB3  . LEU A 1 49 ? -1.357  19.045  -4.080  1.00 0.00 ? 49 LEU A HB3  4 
ATOM 4286  H HG   . LEU A 1 49 ? -0.944  17.107  -5.590  1.00 0.00 ? 49 LEU A HG   4 
ATOM 4287  H HD11 . LEU A 1 49 ? -3.015  15.898  -4.252  1.00 0.00 ? 49 LEU A HD11 4 
ATOM 4288  H HD12 . LEU A 1 49 ? -3.759  16.376  -5.774  1.00 0.00 ? 49 LEU A HD12 4 
ATOM 4289  H HD13 . LEU A 1 49 ? -2.321  15.355  -5.778  1.00 0.00 ? 49 LEU A HD13 4 
ATOM 4290  H HD21 . LEU A 1 49 ? -2.823  19.270  -5.913  1.00 0.00 ? 49 LEU A HD21 4 
ATOM 4291  H HD22 . LEU A 1 49 ? -1.615  18.646  -7.036  1.00 0.00 ? 49 LEU A HD22 4 
ATOM 4292  H HD23 . LEU A 1 49 ? -3.216  17.910  -6.964  1.00 0.00 ? 49 LEU A HD23 4 
ATOM 4293  N N    . ARG A 1 50 ? -0.111  15.652  -4.146  1.00 0.00 ? 50 ARG A N    4 
ATOM 4294  C CA   . ARG A 1 50 ? 0.241   14.310  -4.560  1.00 0.00 ? 50 ARG A CA   4 
ATOM 4295  C C    . ARG A 1 50 ? 1.170   13.675  -3.543  1.00 0.00 ? 50 ARG A C    4 
ATOM 4296  O O    . ARG A 1 50 ? 1.025   12.506  -3.186  1.00 0.00 ? 50 ARG A O    4 
ATOM 4297  C CB   . ARG A 1 50 ? 0.913   14.354  -5.928  1.00 0.00 ? 50 ARG A CB   4 
ATOM 4298  C CG   . ARG A 1 50 ? -0.030  14.724  -7.059  1.00 0.00 ? 50 ARG A CG   4 
ATOM 4299  C CD   . ARG A 1 50 ? 0.689   14.749  -8.397  1.00 0.00 ? 50 ARG A CD   4 
ATOM 4300  N NE   . ARG A 1 50 ? 1.742   15.761  -8.433  1.00 0.00 ? 50 ARG A NE   4 
ATOM 4301  C CZ   . ARG A 1 50 ? 2.502   16.000  -9.500  1.00 0.00 ? 50 ARG A CZ   4 
ATOM 4302  N NH1  . ARG A 1 50 ? 2.328   15.305  -10.617 1.00 0.00 ? 50 ARG A NH1  4 
ATOM 4303  N NH2  . ARG A 1 50 ? 3.437   16.938  -9.449  1.00 0.00 ? 50 ARG A NH2  4 
ATOM 4304  H H    . ARG A 1 50 ? 0.284   16.406  -4.624  1.00 0.00 ? 50 ARG A H    4 
ATOM 4305  H HA   . ARG A 1 50 ? -0.668  13.727  -4.629  1.00 0.00 ? 50 ARG A HA   4 
ATOM 4306  H HB2  . ARG A 1 50 ? 1.710   15.082  -5.900  1.00 0.00 ? 50 ARG A HB2  4 
ATOM 4307  H HB3  . ARG A 1 50 ? 1.330   13.390  -6.137  1.00 0.00 ? 50 ARG A HB3  4 
ATOM 4308  H HG2  . ARG A 1 50 ? -0.826  13.995  -7.104  1.00 0.00 ? 50 ARG A HG2  4 
ATOM 4309  H HG3  . ARG A 1 50 ? -0.444  15.701  -6.864  1.00 0.00 ? 50 ARG A HG3  4 
ATOM 4310  H HD2  . ARG A 1 50 ? 1.130   13.779  -8.573  1.00 0.00 ? 50 ARG A HD2  4 
ATOM 4311  H HD3  . ARG A 1 50 ? -0.030  14.961  -9.174  1.00 0.00 ? 50 ARG A HD3  4 
ATOM 4312  H HE   . ARG A 1 50 ? 1.891   16.288  -7.622  1.00 0.00 ? 50 ARG A HE   4 
ATOM 4313  H HH11 . ARG A 1 50 ? 1.624   14.596  -10.661 1.00 0.00 ? 50 ARG A HH11 4 
ATOM 4314  H HH12 . ARG A 1 50 ? 2.901   15.489  -11.415 1.00 0.00 ? 50 ARG A HH12 4 
ATOM 4315  H HH21 . ARG A 1 50 ? 3.572   17.466  -8.610  1.00 0.00 ? 50 ARG A HH21 4 
ATOM 4316  H HH22 . ARG A 1 50 ? 4.008   17.118  -10.250 1.00 0.00 ? 50 ARG A HH22 4 
ATOM 4317  N N    . THR A 1 51 ? 2.128   14.464  -3.077  1.00 0.00 ? 51 THR A N    4 
ATOM 4318  C CA   . THR A 1 51 ? 3.098   13.994  -2.096  1.00 0.00 ? 51 THR A CA   4 
ATOM 4319  C C    . THR A 1 51 ? 2.404   13.380  -0.889  1.00 0.00 ? 51 THR A C    4 
ATOM 4320  O O    . THR A 1 51 ? 2.847   12.370  -0.352  1.00 0.00 ? 51 THR A O    4 
ATOM 4321  C CB   . THR A 1 51 ? 3.983   15.155  -1.656  1.00 0.00 ? 51 THR A CB   4 
ATOM 4322  O OG1  . THR A 1 51 ? 4.535   15.806  -2.784  1.00 0.00 ? 51 THR A OG1  4 
ATOM 4323  C CG2  . THR A 1 51 ? 5.122   14.738  -0.754  1.00 0.00 ? 51 THR A CG2  4 
ATOM 4324  H H    . THR A 1 51 ? 2.186   15.391  -3.402  1.00 0.00 ? 51 THR A H    4 
ATOM 4325  H HA   . THR A 1 51 ? 3.710   13.239  -2.573  1.00 0.00 ? 51 THR A HA   4 
ATOM 4326  H HB   . THR A 1 51 ? 3.377   15.870  -1.118  1.00 0.00 ? 51 THR A HB   4 
ATOM 4327  H HG1  . THR A 1 51 ? 3.832   16.259  -3.265  1.00 0.00 ? 51 THR A HG1  4 
ATOM 4328  H HG21 . THR A 1 51 ? 5.140   13.661  -0.667  1.00 0.00 ? 51 THR A HG21 4 
ATOM 4329  H HG22 . THR A 1 51 ? 6.057   15.080  -1.173  1.00 0.00 ? 51 THR A HG22 4 
ATOM 4330  H HG23 . THR A 1 51 ? 4.983   15.176  0.222   1.00 0.00 ? 51 THR A HG23 4 
ATOM 4331  N N    . GLN A 1 52 ? 1.310   13.991  -0.463  1.00 0.00 ? 52 GLN A N    4 
ATOM 4332  C CA   . GLN A 1 52 ? 0.565   13.485  0.681   1.00 0.00 ? 52 GLN A CA   4 
ATOM 4333  C C    . GLN A 1 52 ? -0.402  12.398  0.237   1.00 0.00 ? 52 GLN A C    4 
ATOM 4334  O O    . GLN A 1 52 ? -0.670  11.451  0.972   1.00 0.00 ? 52 GLN A O    4 
ATOM 4335  C CB   . GLN A 1 52 ? -0.206  14.610  1.364   1.00 0.00 ? 52 GLN A CB   4 
ATOM 4336  C CG   . GLN A 1 52 ? -1.309  15.199  0.505   1.00 0.00 ? 52 GLN A CG   4 
ATOM 4337  C CD   . GLN A 1 52 ? -2.096  16.263  1.232   1.00 0.00 ? 52 GLN A CD   4 
ATOM 4338  O OE1  . GLN A 1 52 ? -1.546  17.279  1.663   1.00 0.00 ? 52 GLN A OE1  4 
ATOM 4339  N NE2  . GLN A 1 52 ? -3.391  16.036  1.372   1.00 0.00 ? 52 GLN A NE2  4 
ATOM 4340  H H    . GLN A 1 52 ? 0.996   14.795  -0.927  1.00 0.00 ? 52 GLN A H    4 
ATOM 4341  H HA   . GLN A 1 52 ? 1.270   13.063  1.382   1.00 0.00 ? 52 GLN A HA   4 
ATOM 4342  H HB2  . GLN A 1 52 ? -0.652  14.223  2.268   1.00 0.00 ? 52 GLN A HB2  4 
ATOM 4343  H HB3  . GLN A 1 52 ? 0.484   15.401  1.621   1.00 0.00 ? 52 GLN A HB3  4 
ATOM 4344  H HG2  . GLN A 1 52 ? -0.873  15.634  -0.379  1.00 0.00 ? 52 GLN A HG2  4 
ATOM 4345  H HG3  . GLN A 1 52 ? -1.984  14.407  0.217   1.00 0.00 ? 52 GLN A HG3  4 
ATOM 4346  H HE21 . GLN A 1 52 ? -3.760  15.208  1.002   1.00 0.00 ? 52 GLN A HE21 4 
ATOM 4347  H HE22 . GLN A 1 52 ? -3.924  16.700  1.843   1.00 0.00 ? 52 GLN A HE22 4 
ATOM 4348  N N    . PHE A 1 53 ? -0.932  12.548  -0.971  1.00 0.00 ? 53 PHE A N    4 
ATOM 4349  C CA   . PHE A 1 53 ? -1.883  11.581  -1.506  1.00 0.00 ? 53 PHE A CA   4 
ATOM 4350  C C    . PHE A 1 53 ? -1.283  10.178  -1.543  1.00 0.00 ? 53 PHE A C    4 
ATOM 4351  O O    . PHE A 1 53 ? -1.909  9.219   -1.086  1.00 0.00 ? 53 PHE A O    4 
ATOM 4352  C CB   . PHE A 1 53 ? -2.332  11.990  -2.913  1.00 0.00 ? 53 PHE A CB   4 
ATOM 4353  C CG   . PHE A 1 53 ? -3.419  11.111  -3.461  1.00 0.00 ? 53 PHE A CG   4 
ATOM 4354  C CD1  . PHE A 1 53 ? -3.155  9.806   -3.829  1.00 0.00 ? 53 PHE A CD1  4 
ATOM 4355  C CD2  . PHE A 1 53 ? -4.712  11.584  -3.578  1.00 0.00 ? 53 PHE A CD2  4 
ATOM 4356  C CE1  . PHE A 1 53 ? -4.160  8.989   -4.306  1.00 0.00 ? 53 PHE A CE1  4 
ATOM 4357  C CE2  . PHE A 1 53 ? -5.721  10.776  -4.057  1.00 0.00 ? 53 PHE A CE2  4 
ATOM 4358  C CZ   . PHE A 1 53 ? -5.445  9.476   -4.421  1.00 0.00 ? 53 PHE A CZ   4 
ATOM 4359  H H    . PHE A 1 53 ? -0.685  13.332  -1.511  1.00 0.00 ? 53 PHE A H    4 
ATOM 4360  H HA   . PHE A 1 53 ? -2.749  11.572  -0.854  1.00 0.00 ? 53 PHE A HA   4 
ATOM 4361  H HB2  . PHE A 1 53 ? -2.703  13.003  -2.889  1.00 0.00 ? 53 PHE A HB2  4 
ATOM 4362  H HB3  . PHE A 1 53 ? -1.487  11.933  -3.584  1.00 0.00 ? 53 PHE A HB3  4 
ATOM 4363  H HD1  . PHE A 1 53 ? -2.148  9.424   -3.743  1.00 0.00 ? 53 PHE A HD1  4 
ATOM 4364  H HD2  . PHE A 1 53 ? -4.931  12.600  -3.292  1.00 0.00 ? 53 PHE A HD2  4 
ATOM 4365  H HE1  . PHE A 1 53 ? -3.940  7.971   -4.590  1.00 0.00 ? 53 PHE A HE1  4 
ATOM 4366  H HE2  . PHE A 1 53 ? -6.727  11.160  -4.145  1.00 0.00 ? 53 PHE A HE2  4 
ATOM 4367  H HZ   . PHE A 1 53 ? -6.233  8.839   -4.792  1.00 0.00 ? 53 PHE A HZ   4 
ATOM 4368  N N    . PHE A 1 54 ? -0.076  10.053  -2.100  1.00 0.00 ? 54 PHE A N    4 
ATOM 4369  C CA   . PHE A 1 54 ? 0.575   8.748   -2.214  1.00 0.00 ? 54 PHE A CA   4 
ATOM 4370  C C    . PHE A 1 54 ? 1.085   8.249   -0.856  1.00 0.00 ? 54 PHE A C    4 
ATOM 4371  O O    . PHE A 1 54 ? 1.117   7.042   -0.608  1.00 0.00 ? 54 PHE A O    4 
ATOM 4372  C CB   . PHE A 1 54 ? 1.701   8.793   -3.267  1.00 0.00 ? 54 PHE A CB   4 
ATOM 4373  C CG   . PHE A 1 54 ? 3.056   9.182   -2.749  1.00 0.00 ? 54 PHE A CG   4 
ATOM 4374  C CD1  . PHE A 1 54 ? 3.272   10.419  -2.182  1.00 0.00 ? 54 PHE A CD1  4 
ATOM 4375  C CD2  . PHE A 1 54 ? 4.113   8.294   -2.831  1.00 0.00 ? 54 PHE A CD2  4 
ATOM 4376  C CE1  . PHE A 1 54 ? 4.517   10.763  -1.702  1.00 0.00 ? 54 PHE A CE1  4 
ATOM 4377  C CE2  . PHE A 1 54 ? 5.359   8.636   -2.353  1.00 0.00 ? 54 PHE A CE2  4 
ATOM 4378  C CZ   . PHE A 1 54 ? 5.559   9.871   -1.787  1.00 0.00 ? 54 PHE A CZ   4 
ATOM 4379  H H    . PHE A 1 54 ? 0.376   10.850  -2.456  1.00 0.00 ? 54 PHE A H    4 
ATOM 4380  H HA   . PHE A 1 54 ? -0.179  8.046   -2.562  1.00 0.00 ? 54 PHE A HA   4 
ATOM 4381  H HB2  . PHE A 1 54 ? 1.795   7.817   -3.716  1.00 0.00 ? 54 PHE A HB2  4 
ATOM 4382  H HB3  . PHE A 1 54 ? 1.427   9.503   -4.032  1.00 0.00 ? 54 PHE A HB3  4 
ATOM 4383  H HD1  . PHE A 1 54 ? 2.454   11.120  -2.114  1.00 0.00 ? 54 PHE A HD1  4 
ATOM 4384  H HD2  . PHE A 1 54 ? 3.956   7.324   -3.275  1.00 0.00 ? 54 PHE A HD2  4 
ATOM 4385  H HE1  . PHE A 1 54 ? 4.677   11.736  -1.262  1.00 0.00 ? 54 PHE A HE1  4 
ATOM 4386  H HE2  . PHE A 1 54 ? 6.175   7.933   -2.420  1.00 0.00 ? 54 PHE A HE2  4 
ATOM 4387  H HZ   . PHE A 1 54 ? 6.535   10.143  -1.411  1.00 0.00 ? 54 PHE A HZ   4 
ATOM 4388  N N    . ILE A 1 55 ? 1.454   9.172   0.035   1.00 0.00 ? 55 ILE A N    4 
ATOM 4389  C CA   . ILE A 1 55 ? 1.919   8.788   1.371   1.00 0.00 ? 55 ILE A CA   4 
ATOM 4390  C C    . ILE A 1 55 ? 0.755   8.236   2.185   1.00 0.00 ? 55 ILE A C    4 
ATOM 4391  O O    . ILE A 1 55 ? 0.796   7.107   2.674   1.00 0.00 ? 55 ILE A O    4 
ATOM 4392  C CB   . ILE A 1 55 ? 2.543   9.973   2.153   1.00 0.00 ? 55 ILE A CB   4 
ATOM 4393  C CG1  . ILE A 1 55 ? 3.789   10.506  1.450   1.00 0.00 ? 55 ILE A CG1  4 
ATOM 4394  C CG2  . ILE A 1 55 ? 2.886   9.553   3.578   1.00 0.00 ? 55 ILE A CG2  4 
ATOM 4395  C CD1  . ILE A 1 55 ? 4.934   9.514   1.405   1.00 0.00 ? 55 ILE A CD1  4 
ATOM 4396  H H    . ILE A 1 55 ? 1.388   10.124  -0.199  1.00 0.00 ? 55 ILE A H    4 
ATOM 4397  H HA   . ILE A 1 55 ? 2.665   8.016   1.259   1.00 0.00 ? 55 ILE A HA   4 
ATOM 4398  H HB   . ILE A 1 55 ? 1.807   10.762  2.209   1.00 0.00 ? 55 ILE A HB   4 
ATOM 4399  H HG12 . ILE A 1 55 ? 3.536   10.770  0.441   1.00 0.00 ? 55 ILE A HG12 4 
ATOM 4400  H HG13 . ILE A 1 55 ? 4.134   11.388  1.969   1.00 0.00 ? 55 ILE A HG13 4 
ATOM 4401  H HG21 . ILE A 1 55 ? 2.784   8.481   3.672   1.00 0.00 ? 55 ILE A HG21 4 
ATOM 4402  H HG22 . ILE A 1 55 ? 3.903   9.839   3.805   1.00 0.00 ? 55 ILE A HG22 4 
ATOM 4403  H HG23 . ILE A 1 55 ? 2.214   10.039  4.268   1.00 0.00 ? 55 ILE A HG23 4 
ATOM 4404  H HD11 . ILE A 1 55 ? 4.577   8.566   1.029   1.00 0.00 ? 55 ILE A HD11 4 
ATOM 4405  H HD12 . ILE A 1 55 ? 5.712   9.890   0.759   1.00 0.00 ? 55 ILE A HD12 4 
ATOM 4406  H HD13 . ILE A 1 55 ? 5.328   9.378   2.402   1.00 0.00 ? 55 ILE A HD13 4 
ATOM 4407  N N    . VAL A 1 56 ? -0.287  9.048   2.316   1.00 0.00 ? 56 VAL A N    4 
ATOM 4408  C CA   . VAL A 1 56 ? -1.472  8.665   3.066   1.00 0.00 ? 56 VAL A CA   4 
ATOM 4409  C C    . VAL A 1 56 ? -2.145  7.442   2.452   1.00 0.00 ? 56 VAL A C    4 
ATOM 4410  O O    . VAL A 1 56 ? -2.615  6.562   3.168   1.00 0.00 ? 56 VAL A O    4 
ATOM 4411  C CB   . VAL A 1 56 ? -2.482  9.825   3.145   1.00 0.00 ? 56 VAL A CB   4 
ATOM 4412  C CG1  . VAL A 1 56 ? -3.665  9.454   4.025   1.00 0.00 ? 56 VAL A CG1  4 
ATOM 4413  C CG2  . VAL A 1 56 ? -1.801  11.083  3.661   1.00 0.00 ? 56 VAL A CG2  4 
ATOM 4414  H H    . VAL A 1 56 ? -0.254  9.931   1.895   1.00 0.00 ? 56 VAL A H    4 
ATOM 4415  H HA   . VAL A 1 56 ? -1.162  8.420   4.072   1.00 0.00 ? 56 VAL A HA   4 
ATOM 4416  H HB   . VAL A 1 56 ? -2.851  10.024  2.149   1.00 0.00 ? 56 VAL A HB   4 
ATOM 4417  H HG11 . VAL A 1 56 ? -3.995  8.456   3.782   1.00 0.00 ? 56 VAL A HG11 4 
ATOM 4418  H HG12 . VAL A 1 56 ? -3.366  9.492   5.062   1.00 0.00 ? 56 VAL A HG12 4 
ATOM 4419  H HG13 . VAL A 1 56 ? -4.471  10.152  3.858   1.00 0.00 ? 56 VAL A HG13 4 
ATOM 4420  H HG21 . VAL A 1 56 ? -0.922  11.286  3.068   1.00 0.00 ? 56 VAL A HG21 4 
ATOM 4421  H HG22 . VAL A 1 56 ? -2.483  11.918  3.592   1.00 0.00 ? 56 VAL A HG22 4 
ATOM 4422  H HG23 . VAL A 1 56 ? -1.513  10.939  4.692   1.00 0.00 ? 56 VAL A HG23 4 
ATOM 4423  N N    . MET A 1 57 ? -2.183  7.380   1.124   1.00 0.00 ? 57 MET A N    4 
ATOM 4424  C CA   . MET A 1 57 ? -2.795  6.243   0.446   1.00 0.00 ? 57 MET A CA   4 
ATOM 4425  C C    . MET A 1 57 ? -1.919  5.011   0.593   1.00 0.00 ? 57 MET A C    4 
ATOM 4426  O O    . MET A 1 57 ? -2.410  3.887   0.689   1.00 0.00 ? 57 MET A O    4 
ATOM 4427  C CB   . MET A 1 57 ? -3.020  6.544   -1.036  1.00 0.00 ? 57 MET A CB   4 
ATOM 4428  C CG   . MET A 1 57 ? -3.693  5.409   -1.793  1.00 0.00 ? 57 MET A CG   4 
ATOM 4429  S SD   . MET A 1 57 ? -5.294  4.959   -1.096  1.00 0.00 ? 57 MET A SD   4 
ATOM 4430  C CE   . MET A 1 57 ? -5.805  3.660   -2.219  1.00 0.00 ? 57 MET A CE   4 
ATOM 4431  H H    . MET A 1 57 ? -1.787  8.102   0.593   1.00 0.00 ? 57 MET A H    4 
ATOM 4432  H HA   . MET A 1 57 ? -3.743  6.048   0.915   1.00 0.00 ? 57 MET A HA   4 
ATOM 4433  H HB2  . MET A 1 57 ? -3.638  7.425   -1.124  1.00 0.00 ? 57 MET A HB2  4 
ATOM 4434  H HB3  . MET A 1 57 ? -2.064  6.737   -1.501  1.00 0.00 ? 57 MET A HB3  4 
ATOM 4435  H HG2  . MET A 1 57 ? -3.838  5.713   -2.819  1.00 0.00 ? 57 MET A HG2  4 
ATOM 4436  H HG3  . MET A 1 57 ? -3.048  4.542   -1.763  1.00 0.00 ? 57 MET A HG3  4 
ATOM 4437  H HE1  . MET A 1 57 ? -5.125  3.619   -3.056  1.00 0.00 ? 57 MET A HE1  4 
ATOM 4438  H HE2  . MET A 1 57 ? -5.795  2.712   -1.701  1.00 0.00 ? 57 MET A HE2  4 
ATOM 4439  H HE3  . MET A 1 57 ? -6.803  3.863   -2.576  1.00 0.00 ? 57 MET A HE3  4 
ATOM 4440  N N    . GLY A 1 58 ? -0.615  5.239   0.606   1.00 0.00 ? 58 GLY A N    4 
ATOM 4441  C CA   . GLY A 1 58 ? 0.329   4.147   0.738   1.00 0.00 ? 58 GLY A CA   4 
ATOM 4442  C C    . GLY A 1 58 ? 0.317   3.540   2.125   1.00 0.00 ? 58 GLY A C    4 
ATOM 4443  O O    . GLY A 1 58 ? 0.365   2.318   2.270   1.00 0.00 ? 58 GLY A O    4 
ATOM 4444  H H    . GLY A 1 58 ? -0.293  6.159   0.521   1.00 0.00 ? 58 GLY A H    4 
ATOM 4445  H HA2  . GLY A 1 58 ? 0.078   3.380   0.018   1.00 0.00 ? 58 GLY A HA2  4 
ATOM 4446  H HA3  . GLY A 1 58 ? 1.318   4.513   0.524   1.00 0.00 ? 58 GLY A HA3  4 
ATOM 4447  N N    . LEU A 1 59 ? 0.250   4.385   3.153   1.00 0.00 ? 59 LEU A N    4 
ATOM 4448  C CA   . LEU A 1 59 ? 0.226   3.893   4.518   1.00 0.00 ? 59 LEU A CA   4 
ATOM 4449  C C    . LEU A 1 59 ? -1.053  3.095   4.767   1.00 0.00 ? 59 LEU A C    4 
ATOM 4450  O O    . LEU A 1 59 ? -1.066  2.168   5.576   1.00 0.00 ? 59 LEU A O    4 
ATOM 4451  C CB   . LEU A 1 59 ? 0.399   5.041   5.524   1.00 0.00 ? 59 LEU A CB   4 
ATOM 4452  C CG   . LEU A 1 59 ? -0.581  6.211   5.402   1.00 0.00 ? 59 LEU A CG   4 
ATOM 4453  C CD1  . LEU A 1 59 ? -1.955  5.822   5.922   1.00 0.00 ? 59 LEU A CD1  4 
ATOM 4454  C CD2  . LEU A 1 59 ? -0.047  7.428   6.150   1.00 0.00 ? 59 LEU A CD2  4 
ATOM 4455  H H    . LEU A 1 59 ? 0.211   5.350   2.989   1.00 0.00 ? 59 LEU A H    4 
ATOM 4456  H HA   . LEU A 1 59 ? 1.062   3.218   4.625   1.00 0.00 ? 59 LEU A HA   4 
ATOM 4457  H HB2  . LEU A 1 59 ? 0.301   4.630   6.514   1.00 0.00 ? 59 LEU A HB2  4 
ATOM 4458  H HB3  . LEU A 1 59 ? 1.401   5.431   5.416   1.00 0.00 ? 59 LEU A HB3  4 
ATOM 4459  H HG   . LEU A 1 59 ? -0.681  6.478   4.358   1.00 0.00 ? 59 LEU A HG   4 
ATOM 4460  H HD11 . LEU A 1 59 ? -1.928  4.812   6.302   1.00 0.00 ? 59 LEU A HD11 4 
ATOM 4461  H HD12 . LEU A 1 59 ? -2.245  6.496   6.715   1.00 0.00 ? 59 LEU A HD12 4 
ATOM 4462  H HD13 . LEU A 1 59 ? -2.672  5.886   5.121   1.00 0.00 ? 59 LEU A HD13 4 
ATOM 4463  H HD21 . LEU A 1 59 ? 0.850   7.156   6.689   1.00 0.00 ? 59 LEU A HD21 4 
ATOM 4464  H HD22 . LEU A 1 59 ? 0.183   8.212   5.445   1.00 0.00 ? 59 LEU A HD22 4 
ATOM 4465  H HD23 . LEU A 1 59 ? -0.792  7.778   6.849   1.00 0.00 ? 59 LEU A HD23 4 
ATOM 4466  N N    . VAL A 1 60 ? -2.111  3.416   4.020   1.00 0.00 ? 60 VAL A N    4 
ATOM 4467  C CA   . VAL A 1 60 ? -3.368  2.680   4.130   1.00 0.00 ? 60 VAL A CA   4 
ATOM 4468  C C    . VAL A 1 60 ? -3.245  1.361   3.375   1.00 0.00 ? 60 VAL A C    4 
ATOM 4469  O O    . VAL A 1 60 ? -3.529  0.290   3.909   1.00 0.00 ? 60 VAL A O    4 
ATOM 4470  C CB   . VAL A 1 60 ? -4.567  3.467   3.549   1.00 0.00 ? 60 VAL A CB   4 
ATOM 4471  C CG1  . VAL A 1 60 ? -5.846  2.646   3.652   1.00 0.00 ? 60 VAL A CG1  4 
ATOM 4472  C CG2  . VAL A 1 60 ? -4.739  4.804   4.252   1.00 0.00 ? 60 VAL A CG2  4 
ATOM 4473  H H    . VAL A 1 60 ? -2.033  4.132   3.355   1.00 0.00 ? 60 VAL A H    4 
ATOM 4474  H HA   . VAL A 1 60 ? -3.558  2.477   5.177   1.00 0.00 ? 60 VAL A HA   4 
ATOM 4475  H HB   . VAL A 1 60 ? -4.373  3.657   2.503   1.00 0.00 ? 60 VAL A HB   4 
ATOM 4476  H HG11 . VAL A 1 60 ? -6.010  2.366   4.682   1.00 0.00 ? 60 VAL A HG11 4 
ATOM 4477  H HG12 . VAL A 1 60 ? -6.680  3.235   3.302   1.00 0.00 ? 60 VAL A HG12 4 
ATOM 4478  H HG13 . VAL A 1 60 ? -5.752  1.756   3.048   1.00 0.00 ? 60 VAL A HG13 4 
ATOM 4479  H HG21 . VAL A 1 60 ? -4.071  4.855   5.096   1.00 0.00 ? 60 VAL A HG21 4 
ATOM 4480  H HG22 . VAL A 1 60 ? -4.515  5.604   3.561   1.00 0.00 ? 60 VAL A HG22 4 
ATOM 4481  H HG23 . VAL A 1 60 ? -5.758  4.902   4.595   1.00 0.00 ? 60 VAL A HG23 4 
ATOM 4482  N N    . ASP A 1 61 ? -2.804  1.459   2.122   1.00 0.00 ? 61 ASP A N    4 
ATOM 4483  C CA   . ASP A 1 61 ? -2.624  0.296   1.271   1.00 0.00 ? 61 ASP A CA   4 
ATOM 4484  C C    . ASP A 1 61 ? -1.468  -0.572  1.749   1.00 0.00 ? 61 ASP A C    4 
ATOM 4485  O O    . ASP A 1 61 ? -1.318  -1.718  1.316   1.00 0.00 ? 61 ASP A O    4 
ATOM 4486  C CB   . ASP A 1 61 ? -2.376  0.750   -0.165  1.00 0.00 ? 61 ASP A CB   4 
ATOM 4487  C CG   . ASP A 1 61 ? -3.602  1.388   -0.791  1.00 0.00 ? 61 ASP A CG   4 
ATOM 4488  O OD1  . ASP A 1 61 ? -4.101  2.388   -0.238  1.00 0.00 ? 61 ASP A OD1  4 
ATOM 4489  O OD2  . ASP A 1 61 ? -4.062  0.885   -1.839  1.00 0.00 ? 61 ASP A OD2  4 
ATOM 4490  H H    . ASP A 1 61 ? -2.590  2.342   1.760   1.00 0.00 ? 61 ASP A H    4 
ATOM 4491  H HA   . ASP A 1 61 ? -3.533  -0.286  1.307   1.00 0.00 ? 61 ASP A HA   4 
ATOM 4492  H HB2  . ASP A 1 61 ? -1.570  1.475   -0.174  1.00 0.00 ? 61 ASP A HB2  4 
ATOM 4493  H HB3  . ASP A 1 61 ? -2.093  -0.102  -0.757  1.00 0.00 ? 61 ASP A HB3  4 
ATOM 4494  N N    . ALA A 1 62 ? -0.657  -0.043  2.656   1.00 0.00 ? 62 ALA A N    4 
ATOM 4495  C CA   . ALA A 1 62 ? 0.454   -0.808  3.187   1.00 0.00 ? 62 ALA A CA   4 
ATOM 4496  C C    . ALA A 1 62 ? -0.074  -2.084  3.832   1.00 0.00 ? 62 ALA A C    4 
ATOM 4497  O O    . ALA A 1 62 ? 0.567   -3.130  3.784   1.00 0.00 ? 62 ALA A O    4 
ATOM 4498  C CB   . ALA A 1 62 ? 1.244   0.017   4.192   1.00 0.00 ? 62 ALA A CB   4 
ATOM 4499  H H    . ALA A 1 62 ? -0.818  0.867   2.982   1.00 0.00 ? 62 ALA A H    4 
ATOM 4500  H HA   . ALA A 1 62 ? 1.107   -1.070  2.367   1.00 0.00 ? 62 ALA A HA   4 
ATOM 4501  H HB1  . ALA A 1 62 ? 0.565   0.614   4.781   1.00 0.00 ? 62 ALA A HB1  4 
ATOM 4502  H HB2  . ALA A 1 62 ? 1.802   -0.643  4.841   1.00 0.00 ? 62 ALA A HB2  4 
ATOM 4503  H HB3  . ALA A 1 62 ? 1.927   0.667   3.665   1.00 0.00 ? 62 ALA A HB3  4 
ATOM 4504  N N    . ILE A 1 63 ? -1.269  -1.989  4.413   1.00 0.00 ? 63 ILE A N    4 
ATOM 4505  C CA   . ILE A 1 63 ? -1.896  -3.134  5.050   1.00 0.00 ? 63 ILE A CA   4 
ATOM 4506  C C    . ILE A 1 63 ? -2.126  -4.251  4.027   1.00 0.00 ? 63 ILE A C    4 
ATOM 4507  O O    . ILE A 1 63 ? -1.517  -5.313  4.144   1.00 0.00 ? 63 ILE A O    4 
ATOM 4508  C CB   . ILE A 1 63 ? -3.201  -2.741  5.783   1.00 0.00 ? 63 ILE A CB   4 
ATOM 4509  C CG1  . ILE A 1 63 ? -2.887  -1.737  6.894   1.00 0.00 ? 63 ILE A CG1  4 
ATOM 4510  C CG2  . ILE A 1 63 ? -3.894  -3.967  6.360   1.00 0.00 ? 63 ILE A CG2  4 
ATOM 4511  C CD1  . ILE A 1 63 ? -4.113  -1.273  7.650   1.00 0.00 ? 63 ILE A CD1  4 
ATOM 4512  H H    . ILE A 1 63 ? -1.740  -1.134  4.396   1.00 0.00 ? 63 ILE A H    4 
ATOM 4513  H HA   . ILE A 1 63 ? -1.200  -3.502  5.795   1.00 0.00 ? 63 ILE A HA   4 
ATOM 4514  H HB   . ILE A 1 63 ? -3.862  -2.274  5.085   1.00 0.00 ? 63 ILE A HB   4 
ATOM 4515  H HG12 . ILE A 1 63 ? -2.212  -2.192  7.602   1.00 0.00 ? 63 ILE A HG12 4 
ATOM 4516  H HG13 . ILE A 1 63 ? -2.416  -0.867  6.459   1.00 0.00 ? 63 ILE A HG13 4 
ATOM 4517  H HG21 . ILE A 1 63 ? -3.946  -4.740  5.608   1.00 0.00 ? 63 ILE A HG21 4 
ATOM 4518  H HG22 . ILE A 1 63 ? -3.335  -4.330  7.210   1.00 0.00 ? 63 ILE A HG22 4 
ATOM 4519  H HG23 . ILE A 1 63 ? -4.893  -3.703  6.674   1.00 0.00 ? 63 ILE A HG23 4 
ATOM 4520  H HD11 . ILE A 1 63 ? -4.732  -2.124  7.890   1.00 0.00 ? 63 ILE A HD11 4 
ATOM 4521  H HD12 . ILE A 1 63 ? -3.809  -0.780  8.561   1.00 0.00 ? 63 ILE A HD12 4 
ATOM 4522  H HD13 . ILE A 1 63 ? -4.673  -0.582  7.037   1.00 0.00 ? 63 ILE A HD13 4 
ATOM 4523  N N    . PRO A 1 64 ? -2.987  -4.062  2.993   1.00 0.00 ? 64 PRO A N    4 
ATOM 4524  C CA   . PRO A 1 64 ? -3.190  -5.107  1.996   1.00 0.00 ? 64 PRO A CA   4 
ATOM 4525  C C    . PRO A 1 64 ? -1.871  -5.516  1.366   1.00 0.00 ? 64 PRO A C    4 
ATOM 4526  O O    . PRO A 1 64 ? -1.711  -6.646  0.909   1.00 0.00 ? 64 PRO A O    4 
ATOM 4527  C CB   . PRO A 1 64 ? -4.097  -4.467  0.942   1.00 0.00 ? 64 PRO A CB   4 
ATOM 4528  C CG   . PRO A 1 64 ? -4.742  -3.315  1.622   1.00 0.00 ? 64 PRO A CG   4 
ATOM 4529  C CD   . PRO A 1 64 ? -3.804  -2.862  2.707   1.00 0.00 ? 64 PRO A CD   4 
ATOM 4530  H HA   . PRO A 1 64 ? -3.661  -5.972  2.422   1.00 0.00 ? 64 PRO A HA   4 
ATOM 4531  H HB2  . PRO A 1 64 ? -3.500  -4.142  0.103   1.00 0.00 ? 64 PRO A HB2  4 
ATOM 4532  H HB3  . PRO A 1 64 ? -4.830  -5.189  0.612   1.00 0.00 ? 64 PRO A HB3  4 
ATOM 4533  H HG2  . PRO A 1 64 ? -4.903  -2.516  0.913   1.00 0.00 ? 64 PRO A HG2  4 
ATOM 4534  H HG3  . PRO A 1 64 ? -5.682  -3.628  2.051   1.00 0.00 ? 64 PRO A HG3  4 
ATOM 4535  H HD2  . PRO A 1 64 ? -3.196  -2.047  2.361   1.00 0.00 ? 64 PRO A HD2  4 
ATOM 4536  H HD3  . PRO A 1 64 ? -4.378  -2.571  3.561   1.00 0.00 ? 64 PRO A HD3  4 
ATOM 4537  N N    . MET A 1 65 ? -0.924  -4.587  1.365   1.00 0.00 ? 65 MET A N    4 
ATOM 4538  C CA   . MET A 1 65 ? 0.389   -4.847  0.812   1.00 0.00 ? 65 MET A CA   4 
ATOM 4539  C C    . MET A 1 65 ? 1.147   -5.802  1.722   1.00 0.00 ? 65 MET A C    4 
ATOM 4540  O O    . MET A 1 65 ? 1.952   -6.609  1.264   1.00 0.00 ? 65 MET A O    4 
ATOM 4541  C CB   . MET A 1 65 ? 1.154   -3.535  0.660   1.00 0.00 ? 65 MET A CB   4 
ATOM 4542  C CG   . MET A 1 65 ? 2.557   -3.702  0.116   1.00 0.00 ? 65 MET A CG   4 
ATOM 4543  S SD   . MET A 1 65 ? 2.592   -4.463  -1.519  1.00 0.00 ? 65 MET A SD   4 
ATOM 4544  C CE   . MET A 1 65 ? 4.356   -4.531  -1.822  1.00 0.00 ? 65 MET A CE   4 
ATOM 4545  H H    . MET A 1 65 ? -1.110  -3.707  1.760   1.00 0.00 ? 65 MET A H    4 
ATOM 4546  H HA   . MET A 1 65 ? 0.264   -5.306  -0.160  1.00 0.00 ? 65 MET A HA   4 
ATOM 4547  H HB2  . MET A 1 65 ? 0.608   -2.890  -0.010  1.00 0.00 ? 65 MET A HB2  4 
ATOM 4548  H HB3  . MET A 1 65 ? 1.221   -3.059  1.628   1.00 0.00 ? 65 MET A HB3  4 
ATOM 4549  H HG2  . MET A 1 65 ? 3.010   -2.729  0.052   1.00 0.00 ? 65 MET A HG2  4 
ATOM 4550  H HG3  . MET A 1 65 ? 3.124   -4.318  0.799   1.00 0.00 ? 65 MET A HG3  4 
ATOM 4551  H HE1  . MET A 1 65 ? 4.839   -5.060  -1.015  1.00 0.00 ? 65 MET A HE1  4 
ATOM 4552  H HE2  . MET A 1 65 ? 4.541   -5.047  -2.754  1.00 0.00 ? 65 MET A HE2  4 
ATOM 4553  H HE3  . MET A 1 65 ? 4.749   -3.528  -1.882  1.00 0.00 ? 65 MET A HE3  4 
ATOM 4554  N N    . ILE A 1 66 ? 0.853   -5.720  3.017   1.00 0.00 ? 66 ILE A N    4 
ATOM 4555  C CA   . ILE A 1 66 ? 1.484   -6.593  3.998   1.00 0.00 ? 66 ILE A CA   4 
ATOM 4556  C C    . ILE A 1 66 ? 0.853   -7.976  3.926   1.00 0.00 ? 66 ILE A C    4 
ATOM 4557  O O    . ILE A 1 66 ? 1.550   -8.989  3.923   1.00 0.00 ? 66 ILE A O    4 
ATOM 4558  C CB   . ILE A 1 66 ? 1.355   -6.021  5.434   1.00 0.00 ? 66 ILE A CB   4 
ATOM 4559  C CG1  . ILE A 1 66 ? 2.213   -4.763  5.577   1.00 0.00 ? 66 ILE A CG1  4 
ATOM 4560  C CG2  . ILE A 1 66 ? 1.759   -7.048  6.485   1.00 0.00 ? 66 ILE A CG2  4 
ATOM 4561  C CD1  . ILE A 1 66 ? 2.033   -4.058  6.903   1.00 0.00 ? 66 ILE A CD1  4 
ATOM 4562  H H    . ILE A 1 66 ? 0.178   -5.070  3.315   1.00 0.00 ? 66 ILE A H    4 
ATOM 4563  H HA   . ILE A 1 66 ? 2.537   -6.671  3.754   1.00 0.00 ? 66 ILE A HA   4 
ATOM 4564  H HB   . ILE A 1 66 ? 0.322   -5.761  5.605   1.00 0.00 ? 66 ILE A HB   4 
ATOM 4565  H HG12 . ILE A 1 66 ? 3.255   -5.036  5.489   1.00 0.00 ? 66 ILE A HG12 4 
ATOM 4566  H HG13 . ILE A 1 66 ? 1.962   -4.070  4.793   1.00 0.00 ? 66 ILE A HG13 4 
ATOM 4567  H HG21 . ILE A 1 66 ? 1.418   -8.028  6.189   1.00 0.00 ? 66 ILE A HG21 4 
ATOM 4568  H HG22 . ILE A 1 66 ? 2.834   -7.057  6.585   1.00 0.00 ? 66 ILE A HG22 4 
ATOM 4569  H HG23 . ILE A 1 66 ? 1.313   -6.784  7.432   1.00 0.00 ? 66 ILE A HG23 4 
ATOM 4570  H HD11 . ILE A 1 66 ? 1.223   -4.519  7.449   1.00 0.00 ? 66 ILE A HD11 4 
ATOM 4571  H HD12 . ILE A 1 66 ? 2.944   -4.133  7.478   1.00 0.00 ? 66 ILE A HD12 4 
ATOM 4572  H HD13 . ILE A 1 66 ? 1.802   -3.018  6.729   1.00 0.00 ? 66 ILE A HD13 4 
ATOM 4573  N N    . ALA A 1 67 ? -0.472  -8.005  3.848   1.00 0.00 ? 67 ALA A N    4 
ATOM 4574  C CA   . ALA A 1 67 ? -1.199  -9.259  3.757   1.00 0.00 ? 67 ALA A CA   4 
ATOM 4575  C C    . ALA A 1 67 ? -0.907  -9.943  2.431   1.00 0.00 ? 67 ALA A C    4 
ATOM 4576  O O    . ALA A 1 67 ? -0.407  -11.067 2.396   1.00 0.00 ? 67 ALA A O    4 
ATOM 4577  C CB   . ALA A 1 67 ? -2.692  -9.017  3.918   1.00 0.00 ? 67 ALA A CB   4 
ATOM 4578  H H    . ALA A 1 67 ? -0.970  -7.164  3.838   1.00 0.00 ? 67 ALA A H    4 
ATOM 4579  H HA   . ALA A 1 67 ? -0.866  -9.892  4.560   1.00 0.00 ? 67 ALA A HA   4 
ATOM 4580  H HB1  . ALA A 1 67 ? -2.850  -8.081  4.432   1.00 0.00 ? 67 ALA A HB1  4 
ATOM 4581  H HB2  . ALA A 1 67 ? -3.157  -8.977  2.945   1.00 0.00 ? 67 ALA A HB2  4 
ATOM 4582  H HB3  . ALA A 1 67 ? -3.126  -9.822  4.493   1.00 0.00 ? 67 ALA A HB3  4 
ATOM 4583  N N    . VAL A 1 68 ? -1.203  -9.247  1.341   1.00 0.00 ? 68 VAL A N    4 
ATOM 4584  C CA   . VAL A 1 68 ? -0.956  -9.779  0.012   1.00 0.00 ? 68 VAL A CA   4 
ATOM 4585  C C    . VAL A 1 68 ? 0.534   -9.990  -0.200  1.00 0.00 ? 68 VAL A C    4 
ATOM 4586  O O    . VAL A 1 68 ? 0.949   -10.983 -0.794  1.00 0.00 ? 68 VAL A O    4 
ATOM 4587  C CB   . VAL A 1 68 ? -1.505  -8.844  -1.085  1.00 0.00 ? 68 VAL A CB   4 
ATOM 4588  C CG1  . VAL A 1 68 ? -1.242  -9.420  -2.470  1.00 0.00 ? 68 VAL A CG1  4 
ATOM 4589  C CG2  . VAL A 1 68 ? -2.993  -8.600  -0.878  1.00 0.00 ? 68 VAL A CG2  4 
ATOM 4590  H H    . VAL A 1 68 ? -1.585  -8.350  1.435   1.00 0.00 ? 68 VAL A H    4 
ATOM 4591  H HA   . VAL A 1 68 ? -1.457  -10.735 -0.064  1.00 0.00 ? 68 VAL A HA   4 
ATOM 4592  H HB   . VAL A 1 68 ? -0.992  -7.893  -1.010  1.00 0.00 ? 68 VAL A HB   4 
ATOM 4593  H HG11 . VAL A 1 68 ? -0.204  -9.707  -2.550  1.00 0.00 ? 68 VAL A HG11 4 
ATOM 4594  H HG12 . VAL A 1 68 ? -1.867  -10.287 -2.624  1.00 0.00 ? 68 VAL A HG12 4 
ATOM 4595  H HG13 . VAL A 1 68 ? -1.469  -8.675  -3.218  1.00 0.00 ? 68 VAL A HG13 4 
ATOM 4596  H HG21 . VAL A 1 68 ? -3.397  -9.362  -0.229  1.00 0.00 ? 68 VAL A HG21 4 
ATOM 4597  H HG22 . VAL A 1 68 ? -3.141  -7.630  -0.428  1.00 0.00 ? 68 VAL A HG22 4 
ATOM 4598  H HG23 . VAL A 1 68 ? -3.501  -8.635  -1.831  1.00 0.00 ? 68 VAL A HG23 4 
ATOM 4599  N N    . GLY A 1 69 ? 1.337   -9.052  0.297   1.00 0.00 ? 69 GLY A N    4 
ATOM 4600  C CA   . GLY A 1 69 ? 2.776   -9.163  0.155   1.00 0.00 ? 69 GLY A CA   4 
ATOM 4601  C C    . GLY A 1 69 ? 3.323   -10.360 0.905   1.00 0.00 ? 69 GLY A C    4 
ATOM 4602  O O    . GLY A 1 69 ? 4.105   -11.135 0.359   1.00 0.00 ? 69 GLY A O    4 
ATOM 4603  H H    . GLY A 1 69 ? 0.950   -8.284  0.767   1.00 0.00 ? 69 GLY A H    4 
ATOM 4604  H HA2  . GLY A 1 69 ? 3.021   -9.260  -0.893  1.00 0.00 ? 69 GLY A HA2  4 
ATOM 4605  H HA3  . GLY A 1 69 ? 3.242   -8.268  0.541   1.00 0.00 ? 69 GLY A HA3  4 
ATOM 4606  N N    . LEU A 1 70 ? 2.901   -10.517 2.159   1.00 0.00 ? 70 LEU A N    4 
ATOM 4607  C CA   . LEU A 1 70 ? 3.347   -11.639 2.976   1.00 0.00 ? 70 LEU A CA   4 
ATOM 4608  C C    . LEU A 1 70 ? 2.931   -12.945 2.320   1.00 0.00 ? 70 LEU A C    4 
ATOM 4609  O O    . LEU A 1 70 ? 3.715   -13.889 2.234   1.00 0.00 ? 70 LEU A O    4 
ATOM 4610  C CB   . LEU A 1 70 ? 2.750   -11.551 4.385   1.00 0.00 ? 70 LEU A CB   4 
ATOM 4611  C CG   . LEU A 1 70 ? 3.341   -12.519 5.419   1.00 0.00 ? 70 LEU A CG   4 
ATOM 4612  C CD1  . LEU A 1 70 ? 3.072   -13.967 5.027   1.00 0.00 ? 70 LEU A CD1  4 
ATOM 4613  C CD2  . LEU A 1 70 ? 4.835   -12.279 5.587   1.00 0.00 ? 70 LEU A CD2  4 
ATOM 4614  H H    . LEU A 1 70 ? 2.270   -9.870  2.536   1.00 0.00 ? 70 LEU A H    4 
ATOM 4615  H HA   . LEU A 1 70 ? 4.424   -11.602 3.040   1.00 0.00 ? 70 LEU A HA   4 
ATOM 4616  H HB2  . LEU A 1 70 ? 2.889   -10.545 4.746   1.00 0.00 ? 70 LEU A HB2  4 
ATOM 4617  H HB3  . LEU A 1 70 ? 1.690   -11.744 4.314   1.00 0.00 ? 70 LEU A HB3  4 
ATOM 4618  H HG   . LEU A 1 70 ? 2.866   -12.343 6.373   1.00 0.00 ? 70 LEU A HG   4 
ATOM 4619  H HD11 . LEU A 1 70 ? 2.154   -14.022 4.462   1.00 0.00 ? 70 LEU A HD11 4 
ATOM 4620  H HD12 . LEU A 1 70 ? 3.890   -14.334 4.424   1.00 0.00 ? 70 LEU A HD12 4 
ATOM 4621  H HD13 . LEU A 1 70 ? 2.983   -14.570 5.919   1.00 0.00 ? 70 LEU A HD13 4 
ATOM 4622  H HD21 . LEU A 1 70 ? 5.183   -11.610 4.813   1.00 0.00 ? 70 LEU A HD21 4 
ATOM 4623  H HD22 . LEU A 1 70 ? 5.021   -11.835 6.554   1.00 0.00 ? 70 LEU A HD22 4 
ATOM 4624  H HD23 . LEU A 1 70 ? 5.363   -13.218 5.514   1.00 0.00 ? 70 LEU A HD23 4 
ATOM 4625  N N    . GLY A 1 71 ? 1.687   -12.986 1.859   1.00 0.00 ? 71 GLY A N    4 
ATOM 4626  C CA   . GLY A 1 71 ? 1.182   -14.181 1.212   1.00 0.00 ? 71 GLY A CA   4 
ATOM 4627  C C    . GLY A 1 71 ? 1.970   -14.533 -0.036  1.00 0.00 ? 71 GLY A C    4 
ATOM 4628  O O    . GLY A 1 71 ? 2.422   -15.666 -0.197  1.00 0.00 ? 71 GLY A O    4 
ATOM 4629  H H    . GLY A 1 71 ? 1.105   -12.195 1.961   1.00 0.00 ? 71 GLY A H    4 
ATOM 4630  H HA2  . GLY A 1 71 ? 1.239   -15.007 1.906   1.00 0.00 ? 71 GLY A HA2  4 
ATOM 4631  H HA3  . GLY A 1 71 ? 0.149   -14.024 0.940   1.00 0.00 ? 71 GLY A HA3  4 
ATOM 4632  N N    . LEU A 1 72 ? 2.133   -13.553 -0.920  1.00 0.00 ? 72 LEU A N    4 
ATOM 4633  C CA   . LEU A 1 72 ? 2.869   -13.756 -2.160  1.00 0.00 ? 72 LEU A CA   4 
ATOM 4634  C C    . LEU A 1 72 ? 4.356   -13.948 -1.890  1.00 0.00 ? 72 LEU A C    4 
ATOM 4635  O O    . LEU A 1 72 ? 5.057   -14.594 -2.668  1.00 0.00 ? 72 LEU A O    4 
ATOM 4636  C CB   . LEU A 1 72 ? 2.649   -12.575 -3.108  1.00 0.00 ? 72 LEU A CB   4 
ATOM 4637  C CG   . LEU A 1 72 ? 3.111   -11.218 -2.585  1.00 0.00 ? 72 LEU A CG   4 
ATOM 4638  C CD1  . LEU A 1 72 ? 4.625   -11.097 -2.655  1.00 0.00 ? 72 LEU A CD1  4 
ATOM 4639  C CD2  . LEU A 1 72 ? 2.440   -10.099 -3.365  1.00 0.00 ? 72 LEU A CD2  4 
ATOM 4640  H H    . LEU A 1 72 ? 1.751   -12.676 -0.731  1.00 0.00 ? 72 LEU A H    4 
ATOM 4641  H HA   . LEU A 1 72 ? 2.483   -14.648 -2.623  1.00 0.00 ? 72 LEU A HA   4 
ATOM 4642  H HB2  . LEU A 1 72 ? 3.176   -12.777 -4.027  1.00 0.00 ? 72 LEU A HB2  4 
ATOM 4643  H HB3  . LEU A 1 72 ? 1.594   -12.507 -3.322  1.00 0.00 ? 72 LEU A HB3  4 
ATOM 4644  H HG   . LEU A 1 72 ? 2.821   -11.129 -1.552  1.00 0.00 ? 72 LEU A HG   4 
ATOM 4645  H HD11 . LEU A 1 72 ? 5.012   -11.813 -3.365  1.00 0.00 ? 72 LEU A HD11 4 
ATOM 4646  H HD12 . LEU A 1 72 ? 4.891   -10.099 -2.971  1.00 0.00 ? 72 LEU A HD12 4 
ATOM 4647  H HD13 . LEU A 1 72 ? 5.046   -11.290 -1.680  1.00 0.00 ? 72 LEU A HD13 4 
ATOM 4648  H HD21 . LEU A 1 72 ? 1.404   -10.351 -3.539  1.00 0.00 ? 72 LEU A HD21 4 
ATOM 4649  H HD22 . LEU A 1 72 ? 2.495   -9.180  -2.799  1.00 0.00 ? 72 LEU A HD22 4 
ATOM 4650  H HD23 . LEU A 1 72 ? 2.941   -9.969  -4.313  1.00 0.00 ? 72 LEU A HD23 4 
ATOM 4651  N N    . TYR A 1 73 ? 4.832   -13.398 -0.775  1.00 0.00 ? 73 TYR A N    4 
ATOM 4652  C CA   . TYR A 1 73 ? 6.238   -13.523 -0.407  1.00 0.00 ? 73 TYR A CA   4 
ATOM 4653  C C    . TYR A 1 73 ? 6.630   -14.995 -0.376  1.00 0.00 ? 73 TYR A C    4 
ATOM 4654  O O    . TYR A 1 73 ? 7.646   -15.396 -0.942  1.00 0.00 ? 73 TYR A O    4 
ATOM 4655  C CB   . TYR A 1 73 ? 6.492   -12.871 0.956   1.00 0.00 ? 73 TYR A CB   4 
ATOM 4656  C CG   . TYR A 1 73 ? 7.958   -12.667 1.265   1.00 0.00 ? 73 TYR A CG   4 
ATOM 4657  C CD1  . TYR A 1 73 ? 8.782   -13.739 1.574   1.00 0.00 ? 73 TYR A CD1  4 
ATOM 4658  C CD2  . TYR A 1 73 ? 8.519   -11.396 1.225   1.00 0.00 ? 73 TYR A CD2  4 
ATOM 4659  C CE1  . TYR A 1 73 ? 10.129  -13.553 1.835   1.00 0.00 ? 73 TYR A CE1  4 
ATOM 4660  C CE2  . TYR A 1 73 ? 9.863   -11.201 1.488   1.00 0.00 ? 73 TYR A CE2  4 
ATOM 4661  C CZ   . TYR A 1 73 ? 10.663  -12.283 1.792   1.00 0.00 ? 73 TYR A CZ   4 
ATOM 4662  O OH   . TYR A 1 73 ? 12.003  -12.097 2.053   1.00 0.00 ? 73 TYR A OH   4 
ATOM 4663  H H    . TYR A 1 73 ? 4.225   -12.904 -0.185  1.00 0.00 ? 73 TYR A H    4 
ATOM 4664  H HA   . TYR A 1 73 ? 6.830   -13.017 -1.162  1.00 0.00 ? 73 TYR A HA   4 
ATOM 4665  H HB2  . TYR A 1 73 ? 6.011   -11.906 0.979   1.00 0.00 ? 73 TYR A HB2  4 
ATOM 4666  H HB3  . TYR A 1 73 ? 6.071   -13.496 1.730   1.00 0.00 ? 73 TYR A HB3  4 
ATOM 4667  H HD1  . TYR A 1 73 ? 8.359   -14.732 1.608   1.00 0.00 ? 73 TYR A HD1  4 
ATOM 4668  H HD2  . TYR A 1 73 ? 7.888   -10.551 0.986   1.00 0.00 ? 73 TYR A HD2  4 
ATOM 4669  H HE1  . TYR A 1 73 ? 10.757  -14.399 2.073   1.00 0.00 ? 73 TYR A HE1  4 
ATOM 4670  H HE2  . TYR A 1 73 ? 10.282  -10.205 1.456   1.00 0.00 ? 73 TYR A HE2  4 
ATOM 4671  H HH   . TYR A 1 73 ? 12.190  -11.158 2.126   1.00 0.00 ? 73 TYR A HH   4 
ATOM 4672  N N    . VAL A 1 74 ? 5.796   -15.797 0.274   1.00 0.00 ? 74 VAL A N    4 
ATOM 4673  C CA   . VAL A 1 74 ? 6.021   -17.234 0.370   1.00 0.00 ? 74 VAL A CA   4 
ATOM 4674  C C    . VAL A 1 74 ? 5.345   -17.964 -0.788  1.00 0.00 ? 74 VAL A C    4 
ATOM 4675  O O    . VAL A 1 74 ? 5.779   -19.036 -1.207  1.00 0.00 ? 74 VAL A O    4 
ATOM 4676  C CB   . VAL A 1 74 ? 5.504   -17.801 1.709   1.00 0.00 ? 74 VAL A CB   4 
ATOM 4677  C CG1  . VAL A 1 74 ? 3.997   -17.619 1.834   1.00 0.00 ? 74 VAL A CG1  4 
ATOM 4678  C CG2  . VAL A 1 74 ? 5.889   -19.265 1.851   1.00 0.00 ? 74 VAL A CG2  4 
ATOM 4679  H H    . VAL A 1 74 ? 4.994   -15.414 0.688   1.00 0.00 ? 74 VAL A H    4 
ATOM 4680  H HA   . VAL A 1 74 ? 7.089   -17.413 0.316   1.00 0.00 ? 74 VAL A HA   4 
ATOM 4681  H HB   . VAL A 1 74 ? 5.974   -17.250 2.510   1.00 0.00 ? 74 VAL A HB   4 
ATOM 4682  H HG11 . VAL A 1 74 ? 3.601   -17.236 0.906   1.00 0.00 ? 74 VAL A HG11 4 
ATOM 4683  H HG12 . VAL A 1 74 ? 3.536   -18.570 2.055   1.00 0.00 ? 74 VAL A HG12 4 
ATOM 4684  H HG13 . VAL A 1 74 ? 3.784   -16.923 2.631   1.00 0.00 ? 74 VAL A HG13 4 
ATOM 4685  H HG21 . VAL A 1 74 ? 6.918   -19.398 1.548   1.00 0.00 ? 74 VAL A HG21 4 
ATOM 4686  H HG22 . VAL A 1 74 ? 5.775   -19.569 2.881   1.00 0.00 ? 74 VAL A HG22 4 
ATOM 4687  H HG23 . VAL A 1 74 ? 5.249   -19.869 1.224   1.00 0.00 ? 74 VAL A HG23 4 
ATOM 4688  N N    . MET A 1 75 ? 4.265   -17.387 -1.298  1.00 0.00 ? 75 MET A N    4 
ATOM 4689  C CA   . MET A 1 75 ? 3.534   -17.998 -2.394  1.00 0.00 ? 75 MET A CA   4 
ATOM 4690  C C    . MET A 1 75 ? 4.177   -17.694 -3.740  1.00 0.00 ? 75 MET A C    4 
ATOM 4691  O O    . MET A 1 75 ? 4.822   -18.544 -4.342  1.00 0.00 ? 75 MET A O    4 
ATOM 4692  C CB   . MET A 1 75 ? 2.091   -17.504 -2.388  1.00 0.00 ? 75 MET A CB   4 
ATOM 4693  C CG   . MET A 1 75 ? 1.268   -18.062 -1.243  1.00 0.00 ? 75 MET A CG   4 
ATOM 4694  S SD   . MET A 1 75 ? 1.165   -19.864 -1.259  1.00 0.00 ? 75 MET A SD   4 
ATOM 4695  C CE   . MET A 1 75 ? 0.283   -20.156 -2.792  1.00 0.00 ? 75 MET A CE   4 
ATOM 4696  H H    . MET A 1 75 ? 3.950   -16.539 -0.930  1.00 0.00 ? 75 MET A H    4 
ATOM 4697  H HA   . MET A 1 75 ? 3.535   -19.064 -2.235  1.00 0.00 ? 75 MET A HA   4 
ATOM 4698  H HB2  . MET A 1 75 ? 2.092   -16.429 -2.307  1.00 0.00 ? 75 MET A HB2  4 
ATOM 4699  H HB3  . MET A 1 75 ? 1.619   -17.780 -3.316  1.00 0.00 ? 75 MET A HB3  4 
ATOM 4700  H HG2  . MET A 1 75 ? 1.717   -17.752 -0.311  1.00 0.00 ? 75 MET A HG2  4 
ATOM 4701  H HG3  . MET A 1 75 ? 0.277   -17.657 -1.312  1.00 0.00 ? 75 MET A HG3  4 
ATOM 4702  H HE1  . MET A 1 75 ? 0.464   -19.339 -3.474  1.00 0.00 ? 75 MET A HE1  4 
ATOM 4703  H HE2  . MET A 1 75 ? 0.628   -21.078 -3.236  1.00 0.00 ? 75 MET A HE2  4 
ATOM 4704  H HE3  . MET A 1 75 ? -0.775  -20.229 -2.589  1.00 0.00 ? 75 MET A HE3  4 
ATOM 4705  N N    . PHE A 1 76 ? 3.995   -16.471 -4.207  1.00 0.00 ? 76 PHE A N    4 
ATOM 4706  C CA   . PHE A 1 76 ? 4.540   -16.052 -5.489  1.00 0.00 ? 76 PHE A CA   4 
ATOM 4707  C C    . PHE A 1 76 ? 6.060   -16.196 -5.550  1.00 0.00 ? 76 PHE A C    4 
ATOM 4708  O O    . PHE A 1 76 ? 6.623   -16.397 -6.624  1.00 0.00 ? 76 PHE A O    4 
ATOM 4709  C CB   . PHE A 1 76 ? 4.143   -14.600 -5.762  1.00 0.00 ? 76 PHE A CB   4 
ATOM 4710  C CG   . PHE A 1 76 ? 2.668   -14.395 -6.031  1.00 0.00 ? 76 PHE A CG   4 
ATOM 4711  C CD1  . PHE A 1 76 ? 1.794   -15.471 -6.131  1.00 0.00 ? 76 PHE A CD1  4 
ATOM 4712  C CD2  . PHE A 1 76 ? 2.161   -13.117 -6.195  1.00 0.00 ? 76 PHE A CD2  4 
ATOM 4713  C CE1  . PHE A 1 76 ? 0.452   -15.270 -6.387  1.00 0.00 ? 76 PHE A CE1  4 
ATOM 4714  C CE2  . PHE A 1 76 ? 0.819   -12.913 -6.453  1.00 0.00 ? 76 PHE A CE2  4 
ATOM 4715  C CZ   . PHE A 1 76 ? -0.035  -13.990 -6.549  1.00 0.00 ? 76 PHE A CZ   4 
ATOM 4716  H H    . PHE A 1 76 ? 3.468   -15.835 -3.683  1.00 0.00 ? 76 PHE A H    4 
ATOM 4717  H HA   . PHE A 1 76 ? 4.106   -16.683 -6.256  1.00 0.00 ? 76 PHE A HA   4 
ATOM 4718  H HB2  . PHE A 1 76 ? 4.406   -14.000 -4.905  1.00 0.00 ? 76 PHE A HB2  4 
ATOM 4719  H HB3  . PHE A 1 76 ? 4.693   -14.246 -6.618  1.00 0.00 ? 76 PHE A HB3  4 
ATOM 4720  H HD1  . PHE A 1 76 ? 2.170   -16.474 -6.004  1.00 0.00 ? 76 PHE A HD1  4 
ATOM 4721  H HD2  . PHE A 1 76 ? 2.827   -12.272 -6.121  1.00 0.00 ? 76 PHE A HD2  4 
ATOM 4722  H HE1  . PHE A 1 76 ? -0.217  -16.115 -6.461  1.00 0.00 ? 76 PHE A HE1  4 
ATOM 4723  H HE2  . PHE A 1 76 ? 0.441   -11.909 -6.578  1.00 0.00 ? 76 PHE A HE2  4 
ATOM 4724  H HZ   . PHE A 1 76 ? -1.085  -13.831 -6.750  1.00 0.00 ? 76 PHE A HZ   4 
ATOM 4725  N N    . ALA A 1 77 ? 6.724   -16.085 -4.404  1.00 0.00 ? 77 ALA A N    4 
ATOM 4726  C CA   . ALA A 1 77 ? 8.175   -16.190 -4.363  1.00 0.00 ? 77 ALA A CA   4 
ATOM 4727  C C    . ALA A 1 77 ? 8.645   -17.588 -3.983  1.00 0.00 ? 77 ALA A C    4 
ATOM 4728  O O    . ALA A 1 77 ? 9.434   -18.205 -4.698  1.00 0.00 ? 77 ALA A O    4 
ATOM 4729  C CB   . ALA A 1 77 ? 8.749   -15.153 -3.407  1.00 0.00 ? 77 ALA A CB   4 
ATOM 4730  H H    . ALA A 1 77 ? 6.235   -15.916 -3.579  1.00 0.00 ? 77 ALA A H    4 
ATOM 4731  H HA   . ALA A 1 77 ? 8.540   -15.967 -5.342  1.00 0.00 ? 77 ALA A HA   4 
ATOM 4732  H HB1  . ALA A 1 77 ? 7.942   -14.607 -2.942  1.00 0.00 ? 77 ALA A HB1  4 
ATOM 4733  H HB2  . ALA A 1 77 ? 9.336   -15.647 -2.647  1.00 0.00 ? 77 ALA A HB2  4 
ATOM 4734  H HB3  . ALA A 1 77 ? 9.375   -14.467 -3.957  1.00 0.00 ? 77 ALA A HB3  4 
ATOM 4735  N N    . VAL A 1 78 ? 8.171   -18.074 -2.850  1.00 0.00 ? 78 VAL A N    4 
ATOM 4736  C CA   . VAL A 1 78 ? 8.560   -19.392 -2.365  1.00 0.00 ? 78 VAL A CA   4 
ATOM 4737  C C    . VAL A 1 78 ? 7.661   -20.500 -2.920  1.00 0.00 ? 78 VAL A C    4 
ATOM 4738  O O    . VAL A 1 78 ? 7.891   -21.679 -2.652  1.00 0.00 ? 78 VAL A O    4 
ATOM 4739  C CB   . VAL A 1 78 ? 8.566   -19.454 -0.820  1.00 0.00 ? 78 VAL A CB   4 
ATOM 4740  C CG1  . VAL A 1 78 ? 9.041   -20.815 -0.332  1.00 0.00 ? 78 VAL A CG1  4 
ATOM 4741  C CG2  . VAL A 1 78 ? 9.434   -18.344 -0.248  1.00 0.00 ? 78 VAL A CG2  4 
ATOM 4742  H H    . VAL A 1 78 ? 7.561   -17.530 -2.323  1.00 0.00 ? 78 VAL A H    4 
ATOM 4743  H HA   . VAL A 1 78 ? 9.567   -19.569 -2.705  1.00 0.00 ? 78 VAL A HA   4 
ATOM 4744  H HB   . VAL A 1 78 ? 7.561   -19.308 -0.465  1.00 0.00 ? 78 VAL A HB   4 
ATOM 4745  H HG11 . VAL A 1 78 ? 9.880   -21.138 -0.930  1.00 0.00 ? 78 VAL A HG11 4 
ATOM 4746  H HG12 . VAL A 1 78 ? 9.344   -20.741 0.701   1.00 0.00 ? 78 VAL A HG12 4 
ATOM 4747  H HG13 . VAL A 1 78 ? 8.237   -21.530 -0.422  1.00 0.00 ? 78 VAL A HG13 4 
ATOM 4748  H HG21 . VAL A 1 78 ? 9.076   -17.387 -0.601  1.00 0.00 ? 78 VAL A HG21 4 
ATOM 4749  H HG22 . VAL A 1 78 ? 9.386   -18.370 0.831   1.00 0.00 ? 78 VAL A HG22 4 
ATOM 4750  H HG23 . VAL A 1 78 ? 10.455  -18.485 -0.566  1.00 0.00 ? 78 VAL A HG23 4 
ATOM 4751  N N    . ALA A 1 79 ? 6.643   -20.130 -3.697  1.00 0.00 ? 79 ALA A N    4 
ATOM 4752  C CA   . ALA A 1 79 ? 5.735   -21.120 -4.278  1.00 0.00 ? 79 ALA A CA   4 
ATOM 4753  C C    . ALA A 1 79 ? 5.106   -21.991 -3.197  1.00 0.00 ? 79 ALA A C    4 
ATOM 4754  O O    . ALA A 1 79 ? 5.718   -22.951 -2.725  1.00 0.00 ? 79 ALA A O    4 
ATOM 4755  C CB   . ALA A 1 79 ? 6.479   -21.984 -5.286  1.00 0.00 ? 79 ALA A CB   4 
ATOM 4756  H H    . ALA A 1 79 ? 6.497   -19.175 -3.886  1.00 0.00 ? 79 ALA A H    4 
ATOM 4757  H HA   . ALA A 1 79 ? 4.951   -20.595 -4.803  1.00 0.00 ? 79 ALA A HA   4 
ATOM 4758  H HB1  . ALA A 1 79 ? 7.049   -21.351 -5.952  1.00 0.00 ? 79 ALA A HB1  4 
ATOM 4759  H HB2  . ALA A 1 79 ? 7.147   -22.652 -4.764  1.00 0.00 ? 79 ALA A HB2  4 
ATOM 4760  H HB3  . ALA A 1 79 ? 5.768   -22.561 -5.860  1.00 0.00 ? 79 ALA A HB3  4 
ATOM 4761  N N    . MET A 1 1  ? -6.629  -29.480 1.966   1.00 0.00 ? 1  MET A N    5 
ATOM 4762  C CA   . MET A 1 1  ? -6.917  -28.025 2.080   1.00 0.00 ? 1  MET A CA   5 
ATOM 4763  C C    . MET A 1 1  ? -5.777  -27.174 1.520   1.00 0.00 ? 1  MET A C    5 
ATOM 4764  O O    . MET A 1 1  ? -5.867  -25.948 1.489   1.00 0.00 ? 1  MET A O    5 
ATOM 4765  C CB   . MET A 1 1  ? -7.153  -27.695 3.556   1.00 0.00 ? 1  MET A CB   5 
ATOM 4766  C CG   . MET A 1 1  ? -7.475  -26.233 3.816   1.00 0.00 ? 1  MET A CG   5 
ATOM 4767  S SD   . MET A 1 1  ? -7.792  -25.893 5.558   1.00 0.00 ? 1  MET A SD   5 
ATOM 4768  C CE   . MET A 1 1  ? -8.107  -24.130 5.508   1.00 0.00 ? 1  MET A CE   5 
ATOM 4769  H H1   . MET A 1 1  ? -5.715  -29.660 2.427   1.00 0.00 ? 1  MET A H1   5 
ATOM 4770  H H2   . MET A 1 1  ? -7.395  -29.993 2.447   1.00 0.00 ? 1  MET A H2   5 
ATOM 4771  H H3   . MET A 1 1  ? -6.594  -29.719 0.955   1.00 0.00 ? 1  MET A H3   5 
ATOM 4772  H HA   . MET A 1 1  ? -7.815  -27.812 1.521   1.00 0.00 ? 1  MET A HA   5 
ATOM 4773  H HB2  . MET A 1 1  ? -7.977  -28.290 3.918   1.00 0.00 ? 1  MET A HB2  5 
ATOM 4774  H HB3  . MET A 1 1  ? -6.267  -27.947 4.114   1.00 0.00 ? 1  MET A HB3  5 
ATOM 4775  H HG2  . MET A 1 1  ? -6.640  -25.630 3.493   1.00 0.00 ? 1  MET A HG2  5 
ATOM 4776  H HG3  . MET A 1 1  ? -8.350  -25.969 3.246   1.00 0.00 ? 1  MET A HG3  5 
ATOM 4777  H HE1  . MET A 1 1  ? -8.131  -23.798 4.481   1.00 0.00 ? 1  MET A HE1  5 
ATOM 4778  H HE2  . MET A 1 1  ? -9.057  -23.920 5.976   1.00 0.00 ? 1  MET A HE2  5 
ATOM 4779  H HE3  . MET A 1 1  ? -7.323  -23.610 6.037   1.00 0.00 ? 1  MET A HE3  5 
ATOM 4780  N N    . GLU A 1 2  ? -4.709  -27.827 1.074   1.00 0.00 ? 2  GLU A N    5 
ATOM 4781  C CA   . GLU A 1 2  ? -3.561  -27.121 0.518   1.00 0.00 ? 2  GLU A CA   5 
ATOM 4782  C C    . GLU A 1 2  ? -3.947  -26.353 -0.741  1.00 0.00 ? 2  GLU A C    5 
ATOM 4783  O O    . GLU A 1 2  ? -3.669  -25.158 -0.865  1.00 0.00 ? 2  GLU A O    5 
ATOM 4784  C CB   . GLU A 1 2  ? -2.434  -28.108 0.207   1.00 0.00 ? 2  GLU A CB   5 
ATOM 4785  C CG   . GLU A 1 2  ? -1.914  -28.842 1.432   1.00 0.00 ? 2  GLU A CG   5 
ATOM 4786  C CD   . GLU A 1 2  ? -0.783  -29.797 1.103   1.00 0.00 ? 2  GLU A CD   5 
ATOM 4787  O OE1  . GLU A 1 2  ? 0.257   -29.332 0.593   1.00 0.00 ? 2  GLU A OE1  5 
ATOM 4788  O OE2  . GLU A 1 2  ? -0.938  -31.010 1.357   1.00 0.00 ? 2  GLU A OE2  5 
ATOM 4789  H H    . GLU A 1 2  ? -4.692  -28.803 1.116   1.00 0.00 ? 2  GLU A H    5 
ATOM 4790  H HA   . GLU A 1 2  ? -3.215  -26.418 1.260   1.00 0.00 ? 2  GLU A HA   5 
ATOM 4791  H HB2  . GLU A 1 2  ? -2.799  -28.841 -0.496  1.00 0.00 ? 2  GLU A HB2  5 
ATOM 4792  H HB3  . GLU A 1 2  ? -1.612  -27.570 -0.241  1.00 0.00 ? 2  GLU A HB3  5 
ATOM 4793  H HG2  . GLU A 1 2  ? -1.553  -28.115 2.145   1.00 0.00 ? 2  GLU A HG2  5 
ATOM 4794  H HG3  . GLU A 1 2  ? -2.725  -29.403 1.871   1.00 0.00 ? 2  GLU A HG3  5 
ATOM 4795  N N    . ASN A 1 3  ? -4.589  -27.046 -1.675  1.00 0.00 ? 3  ASN A N    5 
ATOM 4796  C CA   . ASN A 1 3  ? -5.012  -26.423 -2.920  1.00 0.00 ? 3  ASN A CA   5 
ATOM 4797  C C    . ASN A 1 3  ? -6.088  -25.381 -2.658  1.00 0.00 ? 3  ASN A C    5 
ATOM 4798  O O    . ASN A 1 3  ? -6.105  -24.322 -3.281  1.00 0.00 ? 3  ASN A O    5 
ATOM 4799  C CB   . ASN A 1 3  ? -5.530  -27.476 -3.903  1.00 0.00 ? 3  ASN A CB   5 
ATOM 4800  C CG   . ASN A 1 3  ? -4.466  -28.488 -4.281  1.00 0.00 ? 3  ASN A CG   5 
ATOM 4801  O OD1  . ASN A 1 3  ? -3.413  -28.131 -4.808  1.00 0.00 ? 3  ASN A OD1  5 
ATOM 4802  N ND2  . ASN A 1 3  ? -4.739  -29.760 -4.014  1.00 0.00 ? 3  ASN A ND2  5 
ATOM 4803  H H    . ASN A 1 3  ? -4.782  -27.993 -1.521  1.00 0.00 ? 3  ASN A H    5 
ATOM 4804  H HA   . ASN A 1 3  ? -4.155  -25.933 -3.351  1.00 0.00 ? 3  ASN A HA   5 
ATOM 4805  H HB2  . ASN A 1 3  ? -6.359  -28.002 -3.453  1.00 0.00 ? 3  ASN A HB2  5 
ATOM 4806  H HB3  . ASN A 1 3  ? -5.869  -26.983 -4.803  1.00 0.00 ? 3  ASN A HB3  5 
ATOM 4807  H HD21 . ASN A 1 3  ? -5.598  -29.971 -3.594  1.00 0.00 ? 3  ASN A HD21 5 
ATOM 4808  H HD22 . ASN A 1 3  ? -4.069  -30.436 -4.251  1.00 0.00 ? 3  ASN A HD22 5 
ATOM 4809  N N    . LEU A 1 4  ? -6.980  -25.686 -1.723  1.00 0.00 ? 4  LEU A N    5 
ATOM 4810  C CA   . LEU A 1 4  ? -8.057  -24.770 -1.371  1.00 0.00 ? 4  LEU A CA   5 
ATOM 4811  C C    . LEU A 1 4  ? -7.507  -23.573 -0.605  1.00 0.00 ? 4  LEU A C    5 
ATOM 4812  O O    . LEU A 1 4  ? -8.009  -22.460 -0.736  1.00 0.00 ? 4  LEU A O    5 
ATOM 4813  C CB   . LEU A 1 4  ? -9.122  -25.488 -0.541  1.00 0.00 ? 4  LEU A CB   5 
ATOM 4814  C CG   . LEU A 1 4  ? -9.753  -26.709 -1.216  1.00 0.00 ? 4  LEU A CG   5 
ATOM 4815  C CD1  . LEU A 1 4  ? -10.789 -27.348 -0.305  1.00 0.00 ? 4  LEU A CD1  5 
ATOM 4816  C CD2  . LEU A 1 4  ? -10.379 -26.319 -2.548  1.00 0.00 ? 4  LEU A CD2  5 
ATOM 4817  H H    . LEU A 1 4  ? -6.908  -26.544 -1.257  1.00 0.00 ? 4  LEU A H    5 
ATOM 4818  H HA   . LEU A 1 4  ? -8.503  -24.413 -2.287  1.00 0.00 ? 4  LEU A HA   5 
ATOM 4819  H HB2  . LEU A 1 4  ? -8.670  -25.808 0.387   1.00 0.00 ? 4  LEU A HB2  5 
ATOM 4820  H HB3  . LEU A 1 4  ? -9.908  -24.783 -0.316  1.00 0.00 ? 4  LEU A HB3  5 
ATOM 4821  H HG   . LEU A 1 4  ? -8.983  -27.442 -1.410  1.00 0.00 ? 4  LEU A HG   5 
ATOM 4822  H HD11 . LEU A 1 4  ? -10.630 -27.016 0.709   1.00 0.00 ? 4  LEU A HD11 5 
ATOM 4823  H HD12 . LEU A 1 4  ? -11.779 -27.059 -0.628  1.00 0.00 ? 4  LEU A HD12 5 
ATOM 4824  H HD13 . LEU A 1 4  ? -10.695 -28.423 -0.352  1.00 0.00 ? 4  LEU A HD13 5 
ATOM 4825  H HD21 . LEU A 1 4  ? -9.701  -25.680 -3.093  1.00 0.00 ? 4  LEU A HD21 5 
ATOM 4826  H HD22 . LEU A 1 4  ? -10.577 -27.210 -3.126  1.00 0.00 ? 4  LEU A HD22 5 
ATOM 4827  H HD23 . LEU A 1 4  ? -11.304 -25.792 -2.369  1.00 0.00 ? 4  LEU A HD23 5 
ATOM 4828  N N    . ASN A 1 5  ? -6.455  -23.802 0.174   1.00 0.00 ? 5  ASN A N    5 
ATOM 4829  C CA   . ASN A 1 5  ? -5.829  -22.727 0.933   1.00 0.00 ? 5  ASN A CA   5 
ATOM 4830  C C    . ASN A 1 5  ? -5.029  -21.838 -0.009  1.00 0.00 ? 5  ASN A C    5 
ATOM 4831  O O    . ASN A 1 5  ? -4.896  -20.635 0.211   1.00 0.00 ? 5  ASN A O    5 
ATOM 4832  C CB   . ASN A 1 5  ? -4.919  -23.291 2.027   1.00 0.00 ? 5  ASN A CB   5 
ATOM 4833  C CG   . ASN A 1 5  ? -4.279  -22.200 2.866   1.00 0.00 ? 5  ASN A CG   5 
ATOM 4834  O OD1  . ASN A 1 5  ? -4.971  -21.409 3.508   1.00 0.00 ? 5  ASN A OD1  5 
ATOM 4835  N ND2  . ASN A 1 5  ? -2.952  -22.150 2.863   1.00 0.00 ? 5  ASN A ND2  5 
ATOM 4836  H H    . ASN A 1 5  ? -6.083  -24.706 0.225   1.00 0.00 ? 5  ASN A H    5 
ATOM 4837  H HA   . ASN A 1 5  ? -6.613  -22.139 1.386   1.00 0.00 ? 5  ASN A HA   5 
ATOM 4838  H HB2  . ASN A 1 5  ? -5.500  -23.927 2.681   1.00 0.00 ? 5  ASN A HB2  5 
ATOM 4839  H HB3  . ASN A 1 5  ? -4.133  -23.875 1.570   1.00 0.00 ? 5  ASN A HB3  5 
ATOM 4840  H HD21 . ASN A 1 5  ? -2.465  -22.810 2.325   1.00 0.00 ? 5  ASN A HD21 5 
ATOM 4841  H HD22 . ASN A 1 5  ? -2.514  -21.456 3.397   1.00 0.00 ? 5  ASN A HD22 5 
ATOM 4842  N N    . MET A 1 6  ? -4.508  -22.450 -1.068  1.00 0.00 ? 6  MET A N    5 
ATOM 4843  C CA   . MET A 1 6  ? -3.733  -21.737 -2.069  1.00 0.00 ? 6  MET A CA   5 
ATOM 4844  C C    . MET A 1 6  ? -4.675  -20.957 -2.995  1.00 0.00 ? 6  MET A C    5 
ATOM 4845  O O    . MET A 1 6  ? -4.464  -19.769 -3.273  1.00 0.00 ? 6  MET A O    5 
ATOM 4846  C CB   . MET A 1 6  ? -2.884  -22.741 -2.861  1.00 0.00 ? 6  MET A CB   5 
ATOM 4847  C CG   . MET A 1 6  ? -1.989  -22.114 -3.913  1.00 0.00 ? 6  MET A CG   5 
ATOM 4848  S SD   . MET A 1 6  ? -0.943  -23.321 -4.753  1.00 0.00 ? 6  MET A SD   5 
ATOM 4849  C CE   . MET A 1 6  ? 0.054   -23.926 -3.393  1.00 0.00 ? 6  MET A CE   5 
ATOM 4850  H H    . MET A 1 6  ? -4.660  -23.413 -1.184  1.00 0.00 ? 6  MET A H    5 
ATOM 4851  H HA   . MET A 1 6  ? -3.084  -21.041 -1.560  1.00 0.00 ? 6  MET A HA   5 
ATOM 4852  H HB2  . MET A 1 6  ? -2.258  -23.283 -2.168  1.00 0.00 ? 6  MET A HB2  5 
ATOM 4853  H HB3  . MET A 1 6  ? -3.545  -23.440 -3.352  1.00 0.00 ? 6  MET A HB3  5 
ATOM 4854  H HG2  . MET A 1 6  ? -2.611  -21.638 -4.649  1.00 0.00 ? 6  MET A HG2  5 
ATOM 4855  H HG3  . MET A 1 6  ? -1.357  -21.376 -3.441  1.00 0.00 ? 6  MET A HG3  5 
ATOM 4856  H HE1  . MET A 1 6  ? -0.358  -23.574 -2.459  1.00 0.00 ? 6  MET A HE1  5 
ATOM 4857  H HE2  . MET A 1 6  ? 0.056   -25.006 -3.401  1.00 0.00 ? 6  MET A HE2  5 
ATOM 4858  H HE3  . MET A 1 6  ? 1.066   -23.563 -3.500  1.00 0.00 ? 6  MET A HE3  5 
ATOM 4859  N N    . ASP A 1 7  ? -5.733  -21.633 -3.442  1.00 0.00 ? 7  ASP A N    5 
ATOM 4860  C CA   . ASP A 1 7  ? -6.729  -21.016 -4.307  1.00 0.00 ? 7  ASP A CA   5 
ATOM 4861  C C    . ASP A 1 7  ? -7.516  -19.962 -3.541  1.00 0.00 ? 7  ASP A C    5 
ATOM 4862  O O    . ASP A 1 7  ? -7.716  -18.847 -4.026  1.00 0.00 ? 7  ASP A O    5 
ATOM 4863  C CB   . ASP A 1 7  ? -7.682  -22.073 -4.867  1.00 0.00 ? 7  ASP A CB   5 
ATOM 4864  C CG   . ASP A 1 7  ? -6.984  -23.059 -5.785  1.00 0.00 ? 7  ASP A CG   5 
ATOM 4865  O OD1  . ASP A 1 7  ? -6.343  -22.612 -6.759  1.00 0.00 ? 7  ASP A OD1  5 
ATOM 4866  O OD2  . ASP A 1 7  ? -7.086  -24.279 -5.534  1.00 0.00 ? 7  ASP A OD2  5 
ATOM 4867  H H    . ASP A 1 7  ? -5.856  -22.563 -3.170  1.00 0.00 ? 7  ASP A H    5 
ATOM 4868  H HA   . ASP A 1 7  ? -6.212  -20.539 -5.123  1.00 0.00 ? 7  ASP A HA   5 
ATOM 4869  H HB2  . ASP A 1 7  ? -8.124  -22.622 -4.048  1.00 0.00 ? 7  ASP A HB2  5 
ATOM 4870  H HB3  . ASP A 1 7  ? -8.463  -21.581 -5.425  1.00 0.00 ? 7  ASP A HB3  5 
ATOM 4871  N N    . LEU A 1 8  ? -7.957  -20.316 -2.336  1.00 0.00 ? 8  LEU A N    5 
ATOM 4872  C CA   . LEU A 1 8  ? -8.710  -19.383 -1.507  1.00 0.00 ? 8  LEU A CA   5 
ATOM 4873  C C    . LEU A 1 8  ? -7.855  -18.158 -1.228  1.00 0.00 ? 8  LEU A C    5 
ATOM 4874  O O    . LEU A 1 8  ? -8.362  -17.044 -1.114  1.00 0.00 ? 8  LEU A O    5 
ATOM 4875  C CB   . LEU A 1 8  ? -9.147  -20.050 -0.201  1.00 0.00 ? 8  LEU A CB   5 
ATOM 4876  C CG   . LEU A 1 8  ? -10.110 -19.244 0.687   1.00 0.00 ? 8  LEU A CG   5 
ATOM 4877  C CD1  . LEU A 1 8  ? -9.395  -18.100 1.394   1.00 0.00 ? 8  LEU A CD1  5 
ATOM 4878  C CD2  . LEU A 1 8  ? -11.281 -18.717 -0.131  1.00 0.00 ? 8  LEU A CD2  5 
ATOM 4879  H H    . LEU A 1 8  ? -7.765  -21.217 -1.996  1.00 0.00 ? 8  LEU A H    5 
ATOM 4880  H HA   . LEU A 1 8  ? -9.581  -19.082 -2.058  1.00 0.00 ? 8  LEU A HA   5 
ATOM 4881  H HB2  . LEU A 1 8  ? -9.624  -20.988 -0.444  1.00 0.00 ? 8  LEU A HB2  5 
ATOM 4882  H HB3  . LEU A 1 8  ? -8.262  -20.258 0.372   1.00 0.00 ? 8  LEU A HB3  5 
ATOM 4883  H HG   . LEU A 1 8  ? -10.509 -19.900 1.448   1.00 0.00 ? 8  LEU A HG   5 
ATOM 4884  H HD11 . LEU A 1 8  ? -8.430  -17.939 0.944   1.00 0.00 ? 8  LEU A HD11 5 
ATOM 4885  H HD12 . LEU A 1 8  ? -9.986  -17.199 1.312   1.00 0.00 ? 8  LEU A HD12 5 
ATOM 4886  H HD13 . LEU A 1 8  ? -9.265  -18.350 2.437   1.00 0.00 ? 8  LEU A HD13 5 
ATOM 4887  H HD21 . LEU A 1 8  ? -10.918 -18.307 -1.061  1.00 0.00 ? 8  LEU A HD21 5 
ATOM 4888  H HD22 . LEU A 1 8  ? -11.968 -19.524 -0.339  1.00 0.00 ? 8  LEU A HD22 5 
ATOM 4889  H HD23 . LEU A 1 8  ? -11.791 -17.945 0.427   1.00 0.00 ? 8  LEU A HD23 5 
ATOM 4890  N N    . LEU A 1 9  ? -6.544  -18.374 -1.141  1.00 0.00 ? 9  LEU A N    5 
ATOM 4891  C CA   . LEU A 1 9  ? -5.609  -17.288 -0.901  1.00 0.00 ? 9  LEU A CA   5 
ATOM 4892  C C    . LEU A 1 9  ? -5.625  -16.325 -2.079  1.00 0.00 ? 9  LEU A C    5 
ATOM 4893  O O    . LEU A 1 9  ? -5.934  -15.145 -1.920  1.00 0.00 ? 9  LEU A O    5 
ATOM 4894  C CB   . LEU A 1 9  ? -4.199  -17.832 -0.678  1.00 0.00 ? 9  LEU A CB   5 
ATOM 4895  C CG   . LEU A 1 9  ? -3.127  -16.770 -0.424  1.00 0.00 ? 9  LEU A CG   5 
ATOM 4896  C CD1  . LEU A 1 9  ? -3.453  -15.966 0.826   1.00 0.00 ? 9  LEU A CD1  5 
ATOM 4897  C CD2  . LEU A 1 9  ? -1.762  -17.422 -0.299  1.00 0.00 ? 9  LEU A CD2  5 
ATOM 4898  H H    . LEU A 1 9  ? -6.199  -19.284 -1.257  1.00 0.00 ? 9  LEU A H    5 
ATOM 4899  H HA   . LEU A 1 9  ? -5.932  -16.763 -0.014  1.00 0.00 ? 9  LEU A HA   5 
ATOM 4900  H HB2  . LEU A 1 9  ? -4.222  -18.497 0.172   1.00 0.00 ? 9  LEU A HB2  5 
ATOM 4901  H HB3  . LEU A 1 9  ? -3.911  -18.398 -1.550  1.00 0.00 ? 9  LEU A HB3  5 
ATOM 4902  H HG   . LEU A 1 9  ? -3.098  -16.089 -1.261  1.00 0.00 ? 9  LEU A HG   5 
ATOM 4903  H HD11 . LEU A 1 9  ? -4.523  -15.881 0.934   1.00 0.00 ? 9  LEU A HD11 5 
ATOM 4904  H HD12 . LEU A 1 9  ? -3.043  -16.466 1.692   1.00 0.00 ? 9  LEU A HD12 5 
ATOM 4905  H HD13 . LEU A 1 9  ? -3.021  -14.980 0.742   1.00 0.00 ? 9  LEU A HD13 5 
ATOM 4906  H HD21 . LEU A 1 9  ? -1.800  -18.422 -0.705  1.00 0.00 ? 9  LEU A HD21 5 
ATOM 4907  H HD22 . LEU A 1 9  ? -1.033  -16.839 -0.842  1.00 0.00 ? 9  LEU A HD22 5 
ATOM 4908  H HD23 . LEU A 1 9  ? -1.482  -17.469 0.744   1.00 0.00 ? 9  LEU A HD23 5 
ATOM 4909  N N    . TYR A 1 10 ? -5.326  -16.841 -3.276  1.00 0.00 ? 10 TYR A N    5 
ATOM 4910  C CA   . TYR A 1 10 ? -5.336  -16.010 -4.484  1.00 0.00 ? 10 TYR A CA   5 
ATOM 4911  C C    . TYR A 1 10 ? -6.610  -15.184 -4.531  1.00 0.00 ? 10 TYR A C    5 
ATOM 4912  O O    . TYR A 1 10 ? -6.579  -13.961 -4.654  1.00 0.00 ? 10 TYR A O    5 
ATOM 4913  C CB   . TYR A 1 10 ? -5.297  -16.876 -5.742  1.00 0.00 ? 10 TYR A CB   5 
ATOM 4914  C CG   . TYR A 1 10 ? -4.177  -17.888 -5.801  1.00 0.00 ? 10 TYR A CG   5 
ATOM 4915  C CD1  . TYR A 1 10 ? -3.028  -17.769 -5.024  1.00 0.00 ? 10 TYR A CD1  5 
ATOM 4916  C CD2  . TYR A 1 10 ? -4.275  -18.965 -6.662  1.00 0.00 ? 10 TYR A CD2  5 
ATOM 4917  C CE1  . TYR A 1 10 ? -2.019  -18.703 -5.107  1.00 0.00 ? 10 TYR A CE1  5 
ATOM 4918  C CE2  . TYR A 1 10 ? -3.270  -19.903 -6.749  1.00 0.00 ? 10 TYR A CE2  5 
ATOM 4919  C CZ   . TYR A 1 10 ? -2.145  -19.767 -5.970  1.00 0.00 ? 10 TYR A CZ   5 
ATOM 4920  O OH   . TYR A 1 10 ? -1.136  -20.702 -6.060  1.00 0.00 ? 10 TYR A OH   5 
ATOM 4921  H H    . TYR A 1 10 ? -5.111  -17.800 -3.350  1.00 0.00 ? 10 TYR A H    5 
ATOM 4922  H HA   . TYR A 1 10 ? -4.476  -15.348 -4.463  1.00 0.00 ? 10 TYR A HA   5 
ATOM 4923  H HB2  . TYR A 1 10 ? -6.225  -17.419 -5.817  1.00 0.00 ? 10 TYR A HB2  5 
ATOM 4924  H HB3  . TYR A 1 10 ? -5.201  -16.229 -6.603  1.00 0.00 ? 10 TYR A HB3  5 
ATOM 4925  H HD1  . TYR A 1 10 ? -2.929  -16.934 -4.346  1.00 0.00 ? 10 TYR A HD1  5 
ATOM 4926  H HD2  . TYR A 1 10 ? -5.166  -19.068 -7.267  1.00 0.00 ? 10 TYR A HD2  5 
ATOM 4927  H HE1  . TYR A 1 10 ? -1.134  -18.599 -4.495  1.00 0.00 ? 10 TYR A HE1  5 
ATOM 4928  H HE2  . TYR A 1 10 ? -3.368  -20.737 -7.428  1.00 0.00 ? 10 TYR A HE2  5 
ATOM 4929  H HH   . TYR A 1 10 ? -0.495  -20.554 -5.360  1.00 0.00 ? 10 TYR A HH   5 
ATOM 4930  N N    . MET A 1 11 ? -7.732  -15.883 -4.431  1.00 0.00 ? 11 MET A N    5 
ATOM 4931  C CA   . MET A 1 11 ? -9.035  -15.250 -4.461  1.00 0.00 ? 11 MET A CA   5 
ATOM 4932  C C    . MET A 1 11 ? -9.165  -14.289 -3.292  1.00 0.00 ? 11 MET A C    5 
ATOM 4933  O O    . MET A 1 11 ? -9.715  -13.196 -3.425  1.00 0.00 ? 11 MET A O    5 
ATOM 4934  C CB   . MET A 1 11 ? -10.122 -16.319 -4.400  1.00 0.00 ? 11 MET A CB   5 
ATOM 4935  C CG   . MET A 1 11 ? -11.515 -15.794 -4.712  1.00 0.00 ? 11 MET A CG   5 
ATOM 4936  S SD   . MET A 1 11 ? -12.775 -17.079 -4.629  1.00 0.00 ? 11 MET A SD   5 
ATOM 4937  C CE   . MET A 1 11 ? -14.243 -16.141 -5.047  1.00 0.00 ? 11 MET A CE   5 
ATOM 4938  H H    . MET A 1 11 ? -7.678  -16.858 -4.338  1.00 0.00 ? 11 MET A H    5 
ATOM 4939  H HA   . MET A 1 11 ? -9.122  -14.699 -5.386  1.00 0.00 ? 11 MET A HA   5 
ATOM 4940  H HB2  . MET A 1 11 ? -9.878  -17.098 -5.110  1.00 0.00 ? 11 MET A HB2  5 
ATOM 4941  H HB3  . MET A 1 11 ? -10.135 -16.743 -3.407  1.00 0.00 ? 11 MET A HB3  5 
ATOM 4942  H HG2  . MET A 1 11 ? -11.762 -15.021 -3.999  1.00 0.00 ? 11 MET A HG2  5 
ATOM 4943  H HG3  . MET A 1 11 ? -11.512 -15.376 -5.708  1.00 0.00 ? 11 MET A HG3  5 
ATOM 4944  H HE1  . MET A 1 11 ? -14.031 -15.086 -4.963  1.00 0.00 ? 11 MET A HE1  5 
ATOM 4945  H HE2  . MET A 1 11 ? -14.540 -16.370 -6.059  1.00 0.00 ? 11 MET A HE2  5 
ATOM 4946  H HE3  . MET A 1 11 ? -15.042 -16.404 -4.369  1.00 0.00 ? 11 MET A HE3  5 
ATOM 4947  N N    . ALA A 1 12 ? -8.625  -14.699 -2.150  1.00 0.00 ? 12 ALA A N    5 
ATOM 4948  C CA   . ALA A 1 12 ? -8.652  -13.870 -0.954  1.00 0.00 ? 12 ALA A CA   5 
ATOM 4949  C C    . ALA A 1 12 ? -7.895  -12.583 -1.204  1.00 0.00 ? 12 ALA A C    5 
ATOM 4950  O O    . ALA A 1 12 ? -8.266  -11.540 -0.692  1.00 0.00 ? 12 ALA A O    5 
ATOM 4951  C CB   . ALA A 1 12 ? -8.064  -14.619 0.234   1.00 0.00 ? 12 ALA A CB   5 
ATOM 4952  H H    . ALA A 1 12 ? -8.185  -15.573 -2.119  1.00 0.00 ? 12 ALA A H    5 
ATOM 4953  H HA   . ALA A 1 12 ? -9.681  -13.624 -0.731  1.00 0.00 ? 12 ALA A HA   5 
ATOM 4954  H HB1  . ALA A 1 12 ? -7.053  -14.919 0.006   1.00 0.00 ? 12 ALA A HB1  5 
ATOM 4955  H HB2  . ALA A 1 12 ? -8.061  -13.972 1.098   1.00 0.00 ? 12 ALA A HB2  5 
ATOM 4956  H HB3  . ALA A 1 12 ? -8.662  -15.493 0.441   1.00 0.00 ? 12 ALA A HB3  5 
ATOM 4957  N N    . ALA A 1 13 ? -6.845  -12.657 -2.013  1.00 0.00 ? 13 ALA A N    5 
ATOM 4958  C CA   . ALA A 1 13 ? -6.064  -11.478 -2.342  1.00 0.00 ? 13 ALA A CA   5 
ATOM 4959  C C    . ALA A 1 13 ? -6.937  -10.472 -3.076  1.00 0.00 ? 13 ALA A C    5 
ATOM 4960  O O    . ALA A 1 13 ? -6.872  -9.272  -2.822  1.00 0.00 ? 13 ALA A O    5 
ATOM 4961  C CB   . ALA A 1 13 ? -4.854  -11.854 -3.184  1.00 0.00 ? 13 ALA A CB   5 
ATOM 4962  H H    . ALA A 1 13 ? -6.603  -13.517 -2.409  1.00 0.00 ? 13 ALA A H    5 
ATOM 4963  H HA   . ALA A 1 13 ? -5.716  -11.037 -1.417  1.00 0.00 ? 13 ALA A HA   5 
ATOM 4964  H HB1  . ALA A 1 13 ? -5.038  -12.798 -3.677  1.00 0.00 ? 13 ALA A HB1  5 
ATOM 4965  H HB2  . ALA A 1 13 ? -4.680  -11.089 -3.928  1.00 0.00 ? 13 ALA A HB2  5 
ATOM 4966  H HB3  . ALA A 1 13 ? -3.986  -11.942 -2.549  1.00 0.00 ? 13 ALA A HB3  5 
ATOM 4967  N N    . ALA A 1 14 ? -7.774  -10.975 -3.979  1.00 0.00 ? 14 ALA A N    5 
ATOM 4968  C CA   . ALA A 1 14 ? -8.677  -10.121 -4.736  1.00 0.00 ? 14 ALA A CA   5 
ATOM 4969  C C    . ALA A 1 14 ? -9.698  -9.484  -3.804  1.00 0.00 ? 14 ALA A C    5 
ATOM 4970  O O    . ALA A 1 14 ? -9.863  -8.265  -3.785  1.00 0.00 ? 14 ALA A O    5 
ATOM 4971  C CB   . ALA A 1 14 ? -9.374  -10.918 -5.828  1.00 0.00 ? 14 ALA A CB   5 
ATOM 4972  H H    . ALA A 1 14 ? -7.791  -11.943 -4.129  1.00 0.00 ? 14 ALA A H    5 
ATOM 4973  H HA   . ALA A 1 14 ? -8.091  -9.342  -5.205  1.00 0.00 ? 14 ALA A HA   5 
ATOM 4974  H HB1  . ALA A 1 14 ? -8.829  -11.832 -6.011  1.00 0.00 ? 14 ALA A HB1  5 
ATOM 4975  H HB2  . ALA A 1 14 ? -10.380 -11.157 -5.514  1.00 0.00 ? 14 ALA A HB2  5 
ATOM 4976  H HB3  . ALA A 1 14 ? -9.410  -10.332 -6.735  1.00 0.00 ? 14 ALA A HB3  5 
ATOM 4977  N N    . VAL A 1 15 ? -10.372 -10.319 -3.016  1.00 0.00 ? 15 VAL A N    5 
ATOM 4978  C CA   . VAL A 1 15 ? -11.367 -9.838  -2.067  1.00 0.00 ? 15 VAL A CA   5 
ATOM 4979  C C    . VAL A 1 15 ? -10.723 -8.892  -1.059  1.00 0.00 ? 15 VAL A C    5 
ATOM 4980  O O    . VAL A 1 15 ? -11.261 -7.833  -0.759  1.00 0.00 ? 15 VAL A O    5 
ATOM 4981  C CB   . VAL A 1 15 ? -12.036 -11.007 -1.317  1.00 0.00 ? 15 VAL A CB   5 
ATOM 4982  C CG1  . VAL A 1 15 ? -13.141 -10.501 -0.402  1.00 0.00 ? 15 VAL A CG1  5 
ATOM 4983  C CG2  . VAL A 1 15 ? -12.579 -12.028 -2.305  1.00 0.00 ? 15 VAL A CG2  5 
ATOM 4984  H H    . VAL A 1 15 ? -10.184 -11.279 -3.070  1.00 0.00 ? 15 VAL A H    5 
ATOM 4985  H HA   . VAL A 1 15 ? -12.129 -9.304  -2.618  1.00 0.00 ? 15 VAL A HA   5 
ATOM 4986  H HB   . VAL A 1 15 ? -11.289 -11.491 -0.707  1.00 0.00 ? 15 VAL A HB   5 
ATOM 4987  H HG11 . VAL A 1 15 ? -12.941 -9.476  -0.128  1.00 0.00 ? 15 VAL A HG11 5 
ATOM 4988  H HG12 . VAL A 1 15 ? -14.089 -10.558 -0.917  1.00 0.00 ? 15 VAL A HG12 5 
ATOM 4989  H HG13 . VAL A 1 15 ? -13.178 -11.111 0.488   1.00 0.00 ? 15 VAL A HG13 5 
ATOM 4990  H HG21 . VAL A 1 15 ? -13.284 -11.550 -2.968  1.00 0.00 ? 15 VAL A HG21 5 
ATOM 4991  H HG22 . VAL A 1 15 ? -11.763 -12.439 -2.881  1.00 0.00 ? 15 VAL A HG22 5 
ATOM 4992  H HG23 . VAL A 1 15 ? -13.074 -12.823 -1.766  1.00 0.00 ? 15 VAL A HG23 5 
ATOM 4993  N N    . MET A 1 16 ? -9.557  -9.281  -0.554  1.00 0.00 ? 16 MET A N    5 
ATOM 4994  C CA   . MET A 1 16 ? -8.820  -8.464  0.413   1.00 0.00 ? 16 MET A CA   5 
ATOM 4995  C C    . MET A 1 16 ? -8.419  -7.129  -0.202  1.00 0.00 ? 16 MET A C    5 
ATOM 4996  O O    . MET A 1 16 ? -8.730  -6.066  0.327   1.00 0.00 ? 16 MET A O    5 
ATOM 4997  C CB   . MET A 1 16 ? -7.574  -9.212  0.909   1.00 0.00 ? 16 MET A CB   5 
ATOM 4998  C CG   . MET A 1 16 ? -7.614  -9.577  2.378   1.00 0.00 ? 16 MET A CG   5 
ATOM 4999  S SD   . MET A 1 16 ? -7.076  -8.239  3.464   1.00 0.00 ? 16 MET A SD   5 
ATOM 5000  C CE   . MET A 1 16 ? -8.320  -6.992  3.145   1.00 0.00 ? 16 MET A CE   5 
ATOM 5001  H H    . MET A 1 16 ? -9.180  -10.137 -0.843  1.00 0.00 ? 16 MET A H    5 
ATOM 5002  H HA   . MET A 1 16 ? -9.472  -8.275  1.245   1.00 0.00 ? 16 MET A HA   5 
ATOM 5003  H HB2  . MET A 1 16 ? -7.460  -10.119 0.346   1.00 0.00 ? 16 MET A HB2  5 
ATOM 5004  H HB3  . MET A 1 16 ? -6.711  -8.597  0.748   1.00 0.00 ? 16 MET A HB3  5 
ATOM 5005  H HG2  . MET A 1 16 ? -8.622  -9.835  2.628   1.00 0.00 ? 16 MET A HG2  5 
ATOM 5006  H HG3  . MET A 1 16 ? -6.975  -10.432 2.538   1.00 0.00 ? 16 MET A HG3  5 
ATOM 5007  H HE1  . MET A 1 16 ? -9.263  -7.469  2.933   1.00 0.00 ? 16 MET A HE1  5 
ATOM 5008  H HE2  . MET A 1 16 ? -8.424  -6.358  4.012   1.00 0.00 ? 16 MET A HE2  5 
ATOM 5009  H HE3  . MET A 1 16 ? -8.019  -6.394  2.298   1.00 0.00 ? 16 MET A HE3  5 
ATOM 5010  N N    . MET A 1 17 ? -7.722  -7.196  -1.322  1.00 0.00 ? 17 MET A N    5 
ATOM 5011  C CA   . MET A 1 17 ? -7.272  -5.994  -2.017  1.00 0.00 ? 17 MET A CA   5 
ATOM 5012  C C    . MET A 1 17 ? -8.461  -5.117  -2.396  1.00 0.00 ? 17 MET A C    5 
ATOM 5013  O O    . MET A 1 17 ? -8.421  -3.895  -2.250  1.00 0.00 ? 17 MET A O    5 
ATOM 5014  C CB   . MET A 1 17 ? -6.480  -6.364  -3.275  1.00 0.00 ? 17 MET A CB   5 
ATOM 5015  C CG   . MET A 1 17 ? -5.149  -7.044  -2.991  1.00 0.00 ? 17 MET A CG   5 
ATOM 5016  S SD   . MET A 1 17 ? -3.967  -5.955  -2.176  1.00 0.00 ? 17 MET A SD   5 
ATOM 5017  C CE   . MET A 1 17 ? -3.836  -4.634  -3.377  1.00 0.00 ? 17 MET A CE   5 
ATOM 5018  H H    . MET A 1 17 ? -7.505  -8.073  -1.690  1.00 0.00 ? 17 MET A H    5 
ATOM 5019  H HA   . MET A 1 17 ? -6.630  -5.442  -1.346  1.00 0.00 ? 17 MET A HA   5 
ATOM 5020  H HB2  . MET A 1 17 ? -7.077  -7.031  -3.879  1.00 0.00 ? 17 MET A HB2  5 
ATOM 5021  H HB3  . MET A 1 17 ? -6.284  -5.464  -3.839  1.00 0.00 ? 17 MET A HB3  5 
ATOM 5022  H HG2  . MET A 1 17 ? -5.324  -7.896  -2.353  1.00 0.00 ? 17 MET A HG2  5 
ATOM 5023  H HG3  . MET A 1 17 ? -4.725  -7.379  -3.926  1.00 0.00 ? 17 MET A HG3  5 
ATOM 5024  H HE1  . MET A 1 17 ? -4.382  -4.903  -4.269  1.00 0.00 ? 17 MET A HE1  5 
ATOM 5025  H HE2  . MET A 1 17 ? -4.249  -3.727  -2.960  1.00 0.00 ? 17 MET A HE2  5 
ATOM 5026  H HE3  . MET A 1 17 ? -2.797  -4.475  -3.625  1.00 0.00 ? 17 MET A HE3  5 
ATOM 5027  N N    . GLY A 1 18 ? -9.523  -5.755  -2.875  1.00 0.00 ? 18 GLY A N    5 
ATOM 5028  C CA   . GLY A 1 18 ? -10.712 -5.026  -3.270  1.00 0.00 ? 18 GLY A CA   5 
ATOM 5029  C C    . GLY A 1 18 ? -11.440 -4.415  -2.093  1.00 0.00 ? 18 GLY A C    5 
ATOM 5030  O O    . GLY A 1 18 ? -11.709 -3.219  -2.082  1.00 0.00 ? 18 GLY A O    5 
ATOM 5031  H H    . GLY A 1 18 ? -9.502  -6.730  -2.959  1.00 0.00 ? 18 GLY A H    5 
ATOM 5032  H HA2  . GLY A 1 18 ? -10.426 -4.236  -3.952  1.00 0.00 ? 18 GLY A HA2  5 
ATOM 5033  H HA3  . GLY A 1 18 ? -11.383 -5.702  -3.782  1.00 0.00 ? 18 GLY A HA3  5 
ATOM 5034  N N    . LEU A 1 19 ? -11.768 -5.240  -1.103  1.00 0.00 ? 19 LEU A N    5 
ATOM 5035  C CA   . LEU A 1 19 ? -12.478 -4.770  0.081   1.00 0.00 ? 19 LEU A CA   5 
ATOM 5036  C C    . LEU A 1 19 ? -11.686 -3.662  0.764   1.00 0.00 ? 19 LEU A C    5 
ATOM 5037  O O    . LEU A 1 19 ? -12.242 -2.631  1.152   1.00 0.00 ? 19 LEU A O    5 
ATOM 5038  C CB   . LEU A 1 19 ? -12.726 -5.932  1.047   1.00 0.00 ? 19 LEU A CB   5 
ATOM 5039  C CG   . LEU A 1 19 ? -11.492 -6.458  1.782   1.00 0.00 ? 19 LEU A CG   5 
ATOM 5040  C CD1  . LEU A 1 19 ? -11.150 -5.569  2.972   1.00 0.00 ? 19 LEU A CD1  5 
ATOM 5041  C CD2  . LEU A 1 19 ? -11.710 -7.895  2.229   1.00 0.00 ? 19 LEU A CD2  5 
ATOM 5042  H H    . LEU A 1 19 ? -11.532 -6.183  -1.174  1.00 0.00 ? 19 LEU A H    5 
ATOM 5043  H HA   . LEU A 1 19 ? -13.429 -4.370  -0.241  1.00 0.00 ? 19 LEU A HA   5 
ATOM 5044  H HB2  . LEU A 1 19 ? -13.446 -5.611  1.784   1.00 0.00 ? 19 LEU A HB2  5 
ATOM 5045  H HB3  . LEU A 1 19 ? -13.154 -6.751  0.484   1.00 0.00 ? 19 LEU A HB3  5 
ATOM 5046  H HG   . LEU A 1 19 ? -10.651 -6.439  1.105   1.00 0.00 ? 19 LEU A HG   5 
ATOM 5047  H HD11 . LEU A 1 19 ? -11.827 -4.727  3.001   1.00 0.00 ? 19 LEU A HD11 5 
ATOM 5048  H HD12 . LEU A 1 19 ? -11.246 -6.138  3.886   1.00 0.00 ? 19 LEU A HD12 5 
ATOM 5049  H HD13 . LEU A 1 19 ? -10.135 -5.213  2.875   1.00 0.00 ? 19 LEU A HD13 5 
ATOM 5050  H HD21 . LEU A 1 19 ? -12.754 -8.046  2.461   1.00 0.00 ? 19 LEU A HD21 5 
ATOM 5051  H HD22 . LEU A 1 19 ? -11.418 -8.568  1.435   1.00 0.00 ? 19 LEU A HD22 5 
ATOM 5052  H HD23 . LEU A 1 19 ? -11.114 -8.095  3.107   1.00 0.00 ? 19 LEU A HD23 5 
ATOM 5053  N N    . ALA A 1 20 ? -10.377 -3.867  0.888   1.00 0.00 ? 20 ALA A N    5 
ATOM 5054  C CA   . ALA A 1 20 ? -9.515  -2.869  1.498   1.00 0.00 ? 20 ALA A CA   5 
ATOM 5055  C C    . ALA A 1 20 ? -9.446  -1.650  0.595   1.00 0.00 ? 20 ALA A C    5 
ATOM 5056  O O    . ALA A 1 20 ? -9.342  -0.519  1.064   1.00 0.00 ? 20 ALA A O    5 
ATOM 5057  C CB   . ALA A 1 20 ? -8.122  -3.431  1.756   1.00 0.00 ? 20 ALA A CB   5 
ATOM 5058  H H    . ALA A 1 20 ? -9.985  -4.698  0.546   1.00 0.00 ? 20 ALA A H    5 
ATOM 5059  H HA   . ALA A 1 20 ? -9.951  -2.583  2.446   1.00 0.00 ? 20 ALA A HA   5 
ATOM 5060  H HB1  . ALA A 1 20 ? -8.017  -4.379  1.255   1.00 0.00 ? 20 ALA A HB1  5 
ATOM 5061  H HB2  . ALA A 1 20 ? -7.380  -2.742  1.382   1.00 0.00 ? 20 ALA A HB2  5 
ATOM 5062  H HB3  . ALA A 1 20 ? -7.982  -3.570  2.818   1.00 0.00 ? 20 ALA A HB3  5 
ATOM 5063  N N    . ALA A 1 21 ? -9.532  -1.895  -0.711  1.00 0.00 ? 21 ALA A N    5 
ATOM 5064  C CA   . ALA A 1 21 ? -9.507  -0.816  -1.688  1.00 0.00 ? 21 ALA A CA   5 
ATOM 5065  C C    . ALA A 1 21 ? -10.758 0.028   -1.554  1.00 0.00 ? 21 ALA A C    5 
ATOM 5066  O O    . ALA A 1 21 ? -10.707 1.254   -1.619  1.00 0.00 ? 21 ALA A O    5 
ATOM 5067  C CB   . ALA A 1 21 ? -9.377  -1.367  -3.101  1.00 0.00 ? 21 ALA A CB   5 
ATOM 5068  H H    . ALA A 1 21 ? -9.630  -2.824  -1.020  1.00 0.00 ? 21 ALA A H    5 
ATOM 5069  H HA   . ALA A 1 21 ? -8.653  -0.200  -1.481  1.00 0.00 ? 21 ALA A HA   5 
ATOM 5070  H HB1  . ALA A 1 21 ? -10.184 -2.058  -3.293  1.00 0.00 ? 21 ALA A HB1  5 
ATOM 5071  H HB2  . ALA A 1 21 ? -9.424  -0.553  -3.809  1.00 0.00 ? 21 ALA A HB2  5 
ATOM 5072  H HB3  . ALA A 1 21 ? -8.432  -1.878  -3.203  1.00 0.00 ? 21 ALA A HB3  5 
ATOM 5073  N N    . ILE A 1 22 ? -11.879 -0.644  -1.338  1.00 0.00 ? 22 ILE A N    5 
ATOM 5074  C CA   . ILE A 1 22 ? -13.154 0.036   -1.158  1.00 0.00 ? 22 ILE A CA   5 
ATOM 5075  C C    . ILE A 1 22 ? -13.091 0.918   0.080   1.00 0.00 ? 22 ILE A C    5 
ATOM 5076  O O    . ILE A 1 22 ? -13.164 2.142   -0.013  1.00 0.00 ? 22 ILE A O    5 
ATOM 5077  C CB   . ILE A 1 22 ? -14.322 -0.960  -1.006  1.00 0.00 ? 22 ILE A CB   5 
ATOM 5078  C CG1  . ILE A 1 22 ? -14.375 -1.908  -2.202  1.00 0.00 ? 22 ILE A CG1  5 
ATOM 5079  C CG2  . ILE A 1 22 ? -15.643 -0.218  -0.855  1.00 0.00 ? 22 ILE A CG2  5 
ATOM 5080  C CD1  . ILE A 1 22 ? -14.598 -1.210  -3.525  1.00 0.00 ? 22 ILE A CD1  5 
ATOM 5081  H H    . ILE A 1 22 ? -11.839 -1.619  -1.276  1.00 0.00 ? 22 ILE A H    5 
ATOM 5082  H HA   . ILE A 1 22 ? -13.338 0.650   -2.025  1.00 0.00 ? 22 ILE A HA   5 
ATOM 5083  H HB   . ILE A 1 22 ? -14.157 -1.532  -0.110  1.00 0.00 ? 22 ILE A HB   5 
ATOM 5084  H HG12 . ILE A 1 22 ? -13.443 -2.438  -2.266  1.00 0.00 ? 22 ILE A HG12 5 
ATOM 5085  H HG13 . ILE A 1 22 ? -15.178 -2.616  -2.058  1.00 0.00 ? 22 ILE A HG13 5 
ATOM 5086  H HG21 . ILE A 1 22 ? -15.513 0.812   -1.156  1.00 0.00 ? 22 ILE A HG21 5 
ATOM 5087  H HG22 . ILE A 1 22 ? -16.392 -0.683  -1.478  1.00 0.00 ? 22 ILE A HG22 5 
ATOM 5088  H HG23 . ILE A 1 22 ? -15.960 -0.254  0.177   1.00 0.00 ? 22 ILE A HG23 5 
ATOM 5089  H HD11 . ILE A 1 22 ? -13.928 -0.369  -3.606  1.00 0.00 ? 22 ILE A HD11 5 
ATOM 5090  H HD12 . ILE A 1 22 ? -14.408 -1.902  -4.334  1.00 0.00 ? 22 ILE A HD12 5 
ATOM 5091  H HD13 . ILE A 1 22 ? -15.620 -0.865  -3.581  1.00 0.00 ? 22 ILE A HD13 5 
ATOM 5092  N N    . GLY A 1 23 ? -12.933 0.288   1.242   1.00 0.00 ? 23 GLY A N    5 
ATOM 5093  C CA   . GLY A 1 23 ? -12.843 1.039   2.481   1.00 0.00 ? 23 GLY A CA   5 
ATOM 5094  C C    . GLY A 1 23 ? -11.789 2.125   2.402   1.00 0.00 ? 23 GLY A C    5 
ATOM 5095  O O    . GLY A 1 23 ? -12.055 3.291   2.708   1.00 0.00 ? 23 GLY A O    5 
ATOM 5096  H H    . GLY A 1 23 ? -12.864 -0.693  1.255   1.00 0.00 ? 23 GLY A H    5 
ATOM 5097  H HA2  . GLY A 1 23 ? -13.802 1.490   2.690   1.00 0.00 ? 23 GLY A HA2  5 
ATOM 5098  H HA3  . GLY A 1 23 ? -12.590 0.363   3.286   1.00 0.00 ? 23 GLY A HA3  5 
ATOM 5099  N N    . ALA A 1 24 ? -10.592 1.738   1.970   1.00 0.00 ? 24 ALA A N    5 
ATOM 5100  C CA   . ALA A 1 24 ? -9.491  2.676   1.827   1.00 0.00 ? 24 ALA A CA   5 
ATOM 5101  C C    . ALA A 1 24 ? -9.872  3.799   0.874   1.00 0.00 ? 24 ALA A C    5 
ATOM 5102  O O    . ALA A 1 24 ? -9.580  4.961   1.123   1.00 0.00 ? 24 ALA A O    5 
ATOM 5103  C CB   . ALA A 1 24 ? -8.245  1.961   1.329   1.00 0.00 ? 24 ALA A CB   5 
ATOM 5104  H H    . ALA A 1 24 ? -10.452 0.798   1.732   1.00 0.00 ? 24 ALA A H    5 
ATOM 5105  H HA   . ALA A 1 24 ? -9.278  3.096   2.799   1.00 0.00 ? 24 ALA A HA   5 
ATOM 5106  H HB1  . ALA A 1 24 ? -8.486  1.397   0.439   1.00 0.00 ? 24 ALA A HB1  5 
ATOM 5107  H HB2  . ALA A 1 24 ? -7.481  2.688   1.096   1.00 0.00 ? 24 ALA A HB2  5 
ATOM 5108  H HB3  . ALA A 1 24 ? -7.884  1.290   2.093   1.00 0.00 ? 24 ALA A HB3  5 
ATOM 5109  N N    . ALA A 1 25 ? -10.533 3.440   -0.220  1.00 0.00 ? 25 ALA A N    5 
ATOM 5110  C CA   . ALA A 1 25 ? -10.957 4.421   -1.211  1.00 0.00 ? 25 ALA A CA   5 
ATOM 5111  C C    . ALA A 1 25 ? -11.836 5.496   -0.577  1.00 0.00 ? 25 ALA A C    5 
ATOM 5112  O O    . ALA A 1 25 ? -11.503 6.677   -0.602  1.00 0.00 ? 25 ALA A O    5 
ATOM 5113  C CB   . ALA A 1 25 ? -11.693 3.737   -2.354  1.00 0.00 ? 25 ALA A CB   5 
ATOM 5114  H H    . ALA A 1 25 ? -10.740 2.493   -0.364  1.00 0.00 ? 25 ALA A H    5 
ATOM 5115  H HA   . ALA A 1 25 ? -10.070 4.889   -1.615  1.00 0.00 ? 25 ALA A HA   5 
ATOM 5116  H HB1  . ALA A 1 25 ? -12.221 2.873   -1.977  1.00 0.00 ? 25 ALA A HB1  5 
ATOM 5117  H HB2  . ALA A 1 25 ? -12.400 4.428   -2.791  1.00 0.00 ? 25 ALA A HB2  5 
ATOM 5118  H HB3  . ALA A 1 25 ? -10.981 3.427   -3.104  1.00 0.00 ? 25 ALA A HB3  5 
ATOM 5119  N N    . ILE A 1 26 ? -12.953 5.081   0.003   1.00 0.00 ? 26 ILE A N    5 
ATOM 5120  C CA   . ILE A 1 26 ? -13.869 6.017   0.646   1.00 0.00 ? 26 ILE A CA   5 
ATOM 5121  C C    . ILE A 1 26 ? -13.154 6.891   1.683   1.00 0.00 ? 26 ILE A C    5 
ATOM 5122  O O    . ILE A 1 26 ? -13.183 8.118   1.589   1.00 0.00 ? 26 ILE A O    5 
ATOM 5123  C CB   . ILE A 1 26 ? -15.058 5.285   1.298   1.00 0.00 ? 26 ILE A CB   5 
ATOM 5124  C CG1  . ILE A 1 26 ? -16.035 4.829   0.216   1.00 0.00 ? 26 ILE A CG1  5 
ATOM 5125  C CG2  . ILE A 1 26 ? -15.770 6.177   2.309   1.00 0.00 ? 26 ILE A CG2  5 
ATOM 5126  C CD1  . ILE A 1 26 ? -15.473 3.785   -0.722  1.00 0.00 ? 26 ILE A CD1  5 
ATOM 5127  H H    . ILE A 1 26 ? -13.166 4.124   0.005   1.00 0.00 ? 26 ILE A H    5 
ATOM 5128  H HA   . ILE A 1 26 ? -14.270 6.654   -0.126  1.00 0.00 ? 26 ILE A HA   5 
ATOM 5129  H HB   . ILE A 1 26 ? -14.680 4.420   1.818   1.00 0.00 ? 26 ILE A HB   5 
ATOM 5130  H HG12 . ILE A 1 26 ? -16.906 4.415   0.686   1.00 0.00 ? 26 ILE A HG12 5 
ATOM 5131  H HG13 . ILE A 1 26 ? -16.327 5.683   -0.377  1.00 0.00 ? 26 ILE A HG13 5 
ATOM 5132  H HG21 . ILE A 1 26 ? -15.726 7.203   1.975   1.00 0.00 ? 26 ILE A HG21 5 
ATOM 5133  H HG22 . ILE A 1 26 ? -16.802 5.870   2.395   1.00 0.00 ? 26 ILE A HG22 5 
ATOM 5134  H HG23 . ILE A 1 26 ? -15.286 6.089   3.270   1.00 0.00 ? 26 ILE A HG23 5 
ATOM 5135  H HD11 . ILE A 1 26 ? -15.064 2.971   -0.147  1.00 0.00 ? 26 ILE A HD11 5 
ATOM 5136  H HD12 . ILE A 1 26 ? -16.260 3.414   -1.362  1.00 0.00 ? 26 ILE A HD12 5 
ATOM 5137  H HD13 . ILE A 1 26 ? -14.695 4.226   -1.328  1.00 0.00 ? 26 ILE A HD13 5 
ATOM 5138  N N    . GLY A 1 27 ? -12.518 6.264   2.670   1.00 0.00 ? 27 GLY A N    5 
ATOM 5139  C CA   . GLY A 1 27 ? -11.829 7.031   3.699   1.00 0.00 ? 27 GLY A CA   5 
ATOM 5140  C C    . GLY A 1 27 ? -10.699 7.876   3.147   1.00 0.00 ? 27 GLY A C    5 
ATOM 5141  O O    . GLY A 1 27 ? -10.499 9.013   3.580   1.00 0.00 ? 27 GLY A O    5 
ATOM 5142  H H    . GLY A 1 27 ? -12.525 5.282   2.709   1.00 0.00 ? 27 GLY A H    5 
ATOM 5143  H HA2  . GLY A 1 27 ? -12.544 7.683   4.180   1.00 0.00 ? 27 GLY A HA2  5 
ATOM 5144  H HA3  . GLY A 1 27 ? -11.432 6.360   4.436   1.00 0.00 ? 27 GLY A HA3  5 
ATOM 5145  N N    . ILE A 1 28 ? -9.955  7.331   2.183   1.00 0.00 ? 28 ILE A N    5 
ATOM 5146  C CA   . ILE A 1 28 ? -8.853  8.072   1.584   1.00 0.00 ? 28 ILE A CA   5 
ATOM 5147  C C    . ILE A 1 28 ? -9.407  9.352   1.001   1.00 0.00 ? 28 ILE A C    5 
ATOM 5148  O O    . ILE A 1 28 ? -8.864  10.434  1.191   1.00 0.00 ? 28 ILE A O    5 
ATOM 5149  C CB   . ILE A 1 28 ? -8.123  7.261   0.487   1.00 0.00 ? 28 ILE A CB   5 
ATOM 5150  C CG1  . ILE A 1 28 ? -6.673  7.725   0.373   1.00 0.00 ? 28 ILE A CG1  5 
ATOM 5151  C CG2  . ILE A 1 28 ? -8.818  7.372   -0.863  1.00 0.00 ? 28 ILE A CG2  5 
ATOM 5152  C CD1  . ILE A 1 28 ? -5.884  7.552   1.651   1.00 0.00 ? 28 ILE A CD1  5 
ATOM 5153  H H    . ILE A 1 28 ? -10.159 6.429   1.872   1.00 0.00 ? 28 ILE A H    5 
ATOM 5154  H HA   . ILE A 1 28 ? -8.148  8.317   2.365   1.00 0.00 ? 28 ILE A HA   5 
ATOM 5155  H HB   . ILE A 1 28 ? -8.138  6.233   0.777   1.00 0.00 ? 28 ILE A HB   5 
ATOM 5156  H HG12 . ILE A 1 28 ? -6.180  7.156   -0.399  1.00 0.00 ? 28 ILE A HG12 5 
ATOM 5157  H HG13 . ILE A 1 28 ? -6.656  8.773   0.110   1.00 0.00 ? 28 ILE A HG13 5 
ATOM 5158  H HG21 . ILE A 1 28 ? -9.842  7.058   -0.766  1.00 0.00 ? 28 ILE A HG21 5 
ATOM 5159  H HG22 . ILE A 1 28 ? -8.786  8.396   -1.204  1.00 0.00 ? 28 ILE A HG22 5 
ATOM 5160  H HG23 . ILE A 1 28 ? -8.316  6.740   -1.580  1.00 0.00 ? 28 ILE A HG23 5 
ATOM 5161  H HD11 . ILE A 1 28 ? -6.344  6.783   2.256   1.00 0.00 ? 28 ILE A HD11 5 
ATOM 5162  H HD12 . ILE A 1 28 ? -4.870  7.265   1.414   1.00 0.00 ? 28 ILE A HD12 5 
ATOM 5163  H HD13 . ILE A 1 28 ? -5.877  8.483   2.198   1.00 0.00 ? 28 ILE A HD13 5 
ATOM 5164  N N    . GLY A 1 29 ? -10.536 9.207   0.334   1.00 0.00 ? 29 GLY A N    5 
ATOM 5165  C CA   . GLY A 1 29 ? -11.210 10.352  -0.233  1.00 0.00 ? 29 GLY A CA   5 
ATOM 5166  C C    . GLY A 1 29 ? -11.649 11.306  0.858   1.00 0.00 ? 29 GLY A C    5 
ATOM 5167  O O    . GLY A 1 29 ? -11.608 12.523  0.688   1.00 0.00 ? 29 GLY A O    5 
ATOM 5168  H H    . GLY A 1 29 ? -10.926 8.311   0.259   1.00 0.00 ? 29 GLY A H    5 
ATOM 5169  H HA2  . GLY A 1 29 ? -10.537 10.864  -0.907  1.00 0.00 ? 29 GLY A HA2  5 
ATOM 5170  H HA3  . GLY A 1 29 ? -12.079 10.019  -0.781  1.00 0.00 ? 29 GLY A HA3  5 
ATOM 5171  N N    . ILE A 1 30 ? -12.053 10.739  1.997   1.00 0.00 ? 30 ILE A N    5 
ATOM 5172  C CA   . ILE A 1 30 ? -12.484 11.539  3.139   1.00 0.00 ? 30 ILE A CA   5 
ATOM 5173  C C    . ILE A 1 30 ? -11.351 12.451  3.622   1.00 0.00 ? 30 ILE A C    5 
ATOM 5174  O O    . ILE A 1 30 ? -11.391 13.663  3.415   1.00 0.00 ? 30 ILE A O    5 
ATOM 5175  C CB   . ILE A 1 30 ? -12.994 10.634  4.301   1.00 0.00 ? 30 ILE A CB   5 
ATOM 5176  C CG1  . ILE A 1 30 ? -14.502 10.403  4.170   1.00 0.00 ? 30 ILE A CG1  5 
ATOM 5177  C CG2  . ILE A 1 30 ? -12.681 11.237  5.666   1.00 0.00 ? 30 ILE A CG2  5 
ATOM 5178  C CD1  . ILE A 1 30 ? -14.923 9.795   2.853   1.00 0.00 ? 30 ILE A CD1  5 
ATOM 5179  H H    . ILE A 1 30 ? -12.050 9.756   2.074   1.00 0.00 ? 30 ILE A H    5 
ATOM 5180  H HA   . ILE A 1 30 ? -13.308 12.159  2.810   1.00 0.00 ? 30 ILE A HA   5 
ATOM 5181  H HB   . ILE A 1 30 ? -12.490 9.675   4.235   1.00 0.00 ? 30 ILE A HB   5 
ATOM 5182  H HG12 . ILE A 1 30 ? -14.826 9.739   4.957   1.00 0.00 ? 30 ILE A HG12 5 
ATOM 5183  H HG13 . ILE A 1 30 ? -15.013 11.351  4.276   1.00 0.00 ? 30 ILE A HG13 5 
ATOM 5184  H HG21 . ILE A 1 30 ? -12.771 12.312  5.616   1.00 0.00 ? 30 ILE A HG21 5 
ATOM 5185  H HG22 . ILE A 1 30 ? -13.377 10.852  6.397   1.00 0.00 ? 30 ILE A HG22 5 
ATOM 5186  H HG23 . ILE A 1 30 ? -11.675 10.972  5.954   1.00 0.00 ? 30 ILE A HG23 5 
ATOM 5187  H HD11 . ILE A 1 30 ? -14.144 9.941   2.122   1.00 0.00 ? 30 ILE A HD11 5 
ATOM 5188  H HD12 . ILE A 1 30 ? -15.098 8.738   2.986   1.00 0.00 ? 30 ILE A HD12 5 
ATOM 5189  H HD13 . ILE A 1 30 ? -15.830 10.270  2.510   1.00 0.00 ? 30 ILE A HD13 5 
ATOM 5190  N N    . LEU A 1 31 ? -10.342 11.856  4.254   1.00 0.00 ? 31 LEU A N    5 
ATOM 5191  C CA   . LEU A 1 31 ? -9.193  12.607  4.767   1.00 0.00 ? 31 LEU A CA   5 
ATOM 5192  C C    . LEU A 1 31 ? -8.355  13.144  3.614   1.00 0.00 ? 31 LEU A C    5 
ATOM 5193  O O    . LEU A 1 31 ? -7.893  14.284  3.641   1.00 0.00 ? 31 LEU A O    5 
ATOM 5194  C CB   . LEU A 1 31 ? -8.350  11.691  5.667   1.00 0.00 ? 31 LEU A CB   5 
ATOM 5195  C CG   . LEU A 1 31 ? -7.212  12.360  6.450   1.00 0.00 ? 31 LEU A CG   5 
ATOM 5196  C CD1  . LEU A 1 31 ? -6.082  12.793  5.527   1.00 0.00 ? 31 LEU A CD1  5 
ATOM 5197  C CD2  . LEU A 1 31 ? -7.737  13.545  7.240   1.00 0.00 ? 31 LEU A CD2  5 
ATOM 5198  H H    . LEU A 1 31 ? -10.367 10.882  4.379   1.00 0.00 ? 31 LEU A H    5 
ATOM 5199  H HA   . LEU A 1 31 ? -9.566  13.445  5.352   1.00 0.00 ? 31 LEU A HA   5 
ATOM 5200  H HB2  . LEU A 1 31 ? -9.011  11.220  6.378   1.00 0.00 ? 31 LEU A HB2  5 
ATOM 5201  H HB3  . LEU A 1 31 ? -7.917  10.920  5.045   1.00 0.00 ? 31 LEU A HB3  5 
ATOM 5202  H HG   . LEU A 1 31 ? -6.807  11.647  7.153   1.00 0.00 ? 31 LEU A HG   5 
ATOM 5203  H HD11 . LEU A 1 31 ? -5.820  11.976  4.871   1.00 0.00 ? 31 LEU A HD11 5 
ATOM 5204  H HD12 . LEU A 1 31 ? -6.398  13.639  4.940   1.00 0.00 ? 31 LEU A HD12 5 
ATOM 5205  H HD13 . LEU A 1 31 ? -5.223  13.069  6.119   1.00 0.00 ? 31 LEU A HD13 5 
ATOM 5206  H HD21 . LEU A 1 31 ? -8.769  13.371  7.505   1.00 0.00 ? 31 LEU A HD21 5 
ATOM 5207  H HD22 . LEU A 1 31 ? -7.150  13.667  8.139   1.00 0.00 ? 31 LEU A HD22 5 
ATOM 5208  H HD23 . LEU A 1 31 ? -7.664  14.439  6.639   1.00 0.00 ? 31 LEU A HD23 5 
ATOM 5209  N N    . GLY A 1 32 ? -8.169  12.315  2.597   1.00 0.00 ? 32 GLY A N    5 
ATOM 5210  C CA   . GLY A 1 32 ? -7.393  12.725  1.441   1.00 0.00 ? 32 GLY A CA   5 
ATOM 5211  C C    . GLY A 1 32 ? -7.998  13.931  0.756   1.00 0.00 ? 32 GLY A C    5 
ATOM 5212  O O    . GLY A 1 32 ? -7.286  14.857  0.385   1.00 0.00 ? 32 GLY A O    5 
ATOM 5213  H H    . GLY A 1 32 ? -8.563  11.420  2.628   1.00 0.00 ? 32 GLY A H    5 
ATOM 5214  H HA2  . GLY A 1 32 ? -6.390  12.970  1.762   1.00 0.00 ? 32 GLY A HA2  5 
ATOM 5215  H HA3  . GLY A 1 32 ? -7.345  11.908  0.736   1.00 0.00 ? 32 GLY A HA3  5 
ATOM 5216  N N    . GLY A 1 33 ? -9.317  13.924  0.601   1.00 0.00 ? 33 GLY A N    5 
ATOM 5217  C CA   . GLY A 1 33 ? -9.989  15.041  -0.037  1.00 0.00 ? 33 GLY A CA   5 
ATOM 5218  C C    . GLY A 1 33 ? -9.823  16.327  0.745   1.00 0.00 ? 33 GLY A C    5 
ATOM 5219  O O    . GLY A 1 33 ? -9.476  17.364  0.182   1.00 0.00 ? 33 GLY A O    5 
ATOM 5220  H H    . GLY A 1 33 ? -9.838  13.161  0.926   1.00 0.00 ? 33 GLY A H    5 
ATOM 5221  H HA2  . GLY A 1 33 ? -9.580  15.179  -1.029  1.00 0.00 ? 33 GLY A HA2  5 
ATOM 5222  H HA3  . GLY A 1 33 ? -11.043 14.818  -0.121  1.00 0.00 ? 33 GLY A HA3  5 
ATOM 5223  N N    . LYS A 1 34 ? -10.071 16.259  2.050   1.00 0.00 ? 34 LYS A N    5 
ATOM 5224  C CA   . LYS A 1 34 ? -9.948  17.425  2.914   1.00 0.00 ? 34 LYS A CA   5 
ATOM 5225  C C    . LYS A 1 34 ? -8.509  17.935  2.940   1.00 0.00 ? 34 LYS A C    5 
ATOM 5226  O O    . LYS A 1 34 ? -8.253  19.125  2.721   1.00 0.00 ? 34 LYS A O    5 
ATOM 5227  C CB   . LYS A 1 34 ? -10.428 17.085  4.330   1.00 0.00 ? 34 LYS A CB   5 
ATOM 5228  C CG   . LYS A 1 34 ? -9.653  15.973  5.009   1.00 0.00 ? 34 LYS A CG   5 
ATOM 5229  C CD   . LYS A 1 34 ? -10.199 15.673  6.400   1.00 0.00 ? 34 LYS A CD   5 
ATOM 5230  C CE   . LYS A 1 34 ? -11.519 14.916  6.352   1.00 0.00 ? 34 LYS A CE   5 
ATOM 5231  N NZ   . LYS A 1 34 ? -12.689 15.812  6.134   1.00 0.00 ? 34 LYS A NZ   5 
ATOM 5232  H H    . LYS A 1 34 ? -10.343 15.402  2.440   1.00 0.00 ? 34 LYS A H    5 
ATOM 5233  H HA   . LYS A 1 34 ? -10.581 18.201  2.509   1.00 0.00 ? 34 LYS A HA   5 
ATOM 5234  H HB2  . LYS A 1 34 ? -10.348 17.960  4.947   1.00 0.00 ? 34 LYS A HB2  5 
ATOM 5235  H HB3  . LYS A 1 34 ? -11.460 16.788  4.276   1.00 0.00 ? 34 LYS A HB3  5 
ATOM 5236  H HG2  . LYS A 1 34 ? -9.723  15.082  4.406   1.00 0.00 ? 34 LYS A HG2  5 
ATOM 5237  H HG3  . LYS A 1 34 ? -8.619  16.271  5.098   1.00 0.00 ? 34 LYS A HG3  5 
ATOM 5238  H HD2  . LYS A 1 34 ? -9.480  15.081  6.937   1.00 0.00 ? 34 LYS A HD2  5 
ATOM 5239  H HD3  . LYS A 1 34 ? -10.352 16.608  6.921   1.00 0.00 ? 34 LYS A HD3  5 
ATOM 5240  H HE2  . LYS A 1 34 ? -11.473 14.201  5.547   1.00 0.00 ? 34 LYS A HE2  5 
ATOM 5241  H HE3  . LYS A 1 34 ? -11.648 14.392  7.287   1.00 0.00 ? 34 LYS A HE3  5 
ATOM 5242  H HZ1  . LYS A 1 34 ? -12.554 16.383  5.280   1.00 0.00 ? 34 LYS A HZ1  5 
ATOM 5243  H HZ2  . LYS A 1 34 ? -13.555 15.247  6.024   1.00 0.00 ? 34 LYS A HZ2  5 
ATOM 5244  H HZ3  . LYS A 1 34 ? -12.808 16.449  6.946   1.00 0.00 ? 34 LYS A HZ3  5 
ATOM 5245  N N    . PHE A 1 35 ? -7.570  17.031  3.196   1.00 0.00 ? 35 PHE A N    5 
ATOM 5246  C CA   . PHE A 1 35 ? -6.159  17.391  3.246   1.00 0.00 ? 35 PHE A CA   5 
ATOM 5247  C C    . PHE A 1 35 ? -5.703  17.902  1.886   1.00 0.00 ? 35 PHE A C    5 
ATOM 5248  O O    . PHE A 1 35 ? -5.082  18.957  1.775   1.00 0.00 ? 35 PHE A O    5 
ATOM 5249  C CB   . PHE A 1 35 ? -5.314  16.187  3.653   1.00 0.00 ? 35 PHE A CB   5 
ATOM 5250  C CG   . PHE A 1 35 ? -3.973  16.581  4.193   1.00 0.00 ? 35 PHE A CG   5 
ATOM 5251  C CD1  . PHE A 1 35 ? -3.872  17.248  5.401   1.00 0.00 ? 35 PHE A CD1  5 
ATOM 5252  C CD2  . PHE A 1 35 ? -2.822  16.323  3.477   1.00 0.00 ? 35 PHE A CD2  5 
ATOM 5253  C CE1  . PHE A 1 35 ? -2.643  17.649  5.883   1.00 0.00 ? 35 PHE A CE1  5 
ATOM 5254  C CE2  . PHE A 1 35 ? -1.591  16.718  3.957   1.00 0.00 ? 35 PHE A CE2  5 
ATOM 5255  C CZ   . PHE A 1 35 ? -1.501  17.383  5.160   1.00 0.00 ? 35 PHE A CZ   5 
ATOM 5256  H H    . PHE A 1 35 ? -7.833  16.099  3.353   1.00 0.00 ? 35 PHE A H    5 
ATOM 5257  H HA   . PHE A 1 35 ? -6.034  18.179  3.980   1.00 0.00 ? 35 PHE A HA   5 
ATOM 5258  H HB2  . PHE A 1 35 ? -5.837  15.627  4.409   1.00 0.00 ? 35 PHE A HB2  5 
ATOM 5259  H HB3  . PHE A 1 35 ? -5.156  15.558  2.790   1.00 0.00 ? 35 PHE A HB3  5 
ATOM 5260  H HD1  . PHE A 1 35 ? -4.766  17.456  5.969   1.00 0.00 ? 35 PHE A HD1  5 
ATOM 5261  H HD2  . PHE A 1 35 ? -2.890  15.800  2.534   1.00 0.00 ? 35 PHE A HD2  5 
ATOM 5262  H HE1  . PHE A 1 35 ? -2.577  18.171  6.827   1.00 0.00 ? 35 PHE A HE1  5 
ATOM 5263  H HE2  . PHE A 1 35 ? -0.696  16.507  3.389   1.00 0.00 ? 35 PHE A HE2  5 
ATOM 5264  H HZ   . PHE A 1 35 ? -0.537  17.696  5.534   1.00 0.00 ? 35 PHE A HZ   5 
ATOM 5265  N N    . LEU A 1 36 ? -6.030  17.137  0.853   1.00 0.00 ? 36 LEU A N    5 
ATOM 5266  C CA   . LEU A 1 36 ? -5.677  17.493  -0.517  1.00 0.00 ? 36 LEU A CA   5 
ATOM 5267  C C    . LEU A 1 36 ? -6.338  18.817  -0.894  1.00 0.00 ? 36 LEU A C    5 
ATOM 5268  O O    . LEU A 1 36 ? -5.750  19.643  -1.588  1.00 0.00 ? 36 LEU A O    5 
ATOM 5269  C CB   . LEU A 1 36 ? -6.119  16.378  -1.477  1.00 0.00 ? 36 LEU A CB   5 
ATOM 5270  C CG   . LEU A 1 36 ? -5.615  16.479  -2.923  1.00 0.00 ? 36 LEU A CG   5 
ATOM 5271  C CD1  . LEU A 1 36 ? -6.183  17.708  -3.618  1.00 0.00 ? 36 LEU A CD1  5 
ATOM 5272  C CD2  . LEU A 1 36 ? -4.093  16.485  -2.963  1.00 0.00 ? 36 LEU A CD2  5 
ATOM 5273  H H    . LEU A 1 36 ? -6.529  16.311  1.020   1.00 0.00 ? 36 LEU A H    5 
ATOM 5274  H HA   . LEU A 1 36 ? -4.605  17.607  -0.569  1.00 0.00 ? 36 LEU A HA   5 
ATOM 5275  H HB2  . LEU A 1 36 ? -5.780  15.436  -1.072  1.00 0.00 ? 36 LEU A HB2  5 
ATOM 5276  H HB3  . LEU A 1 36 ? -7.199  16.368  -1.502  1.00 0.00 ? 36 LEU A HB3  5 
ATOM 5277  H HG   . LEU A 1 36 ? -5.954  15.610  -3.469  1.00 0.00 ? 36 LEU A HG   5 
ATOM 5278  H HD11 . LEU A 1 36 ? -7.152  17.941  -3.202  1.00 0.00 ? 36 LEU A HD11 5 
ATOM 5279  H HD12 . LEU A 1 36 ? -5.519  18.544  -3.471  1.00 0.00 ? 36 LEU A HD12 5 
ATOM 5280  H HD13 . LEU A 1 36 ? -6.283  17.510  -4.675  1.00 0.00 ? 36 LEU A HD13 5 
ATOM 5281  H HD21 . LEU A 1 36 ? -3.706  16.618  -1.963  1.00 0.00 ? 36 LEU A HD21 5 
ATOM 5282  H HD22 . LEU A 1 36 ? -3.740  15.545  -3.361  1.00 0.00 ? 36 LEU A HD22 5 
ATOM 5283  H HD23 . LEU A 1 36 ? -3.751  17.292  -3.593  1.00 0.00 ? 36 LEU A HD23 5 
ATOM 5284  N N    . GLU A 1 37 ? -7.564  19.014  -0.413  1.00 0.00 ? 37 GLU A N    5 
ATOM 5285  C CA   . GLU A 1 37 ? -8.308  20.239  -0.685  1.00 0.00 ? 37 GLU A CA   5 
ATOM 5286  C C    . GLU A 1 37 ? -7.546  21.460  -0.186  1.00 0.00 ? 37 GLU A C    5 
ATOM 5287  O O    . GLU A 1 37 ? -7.244  22.370  -0.956  1.00 0.00 ? 37 GLU A O    5 
ATOM 5288  C CB   . GLU A 1 37 ? -9.687  20.186  -0.024  1.00 0.00 ? 37 GLU A CB   5 
ATOM 5289  C CG   . GLU A 1 37 ? -10.519 21.442  -0.244  1.00 0.00 ? 37 GLU A CG   5 
ATOM 5290  C CD   . GLU A 1 37 ? -10.851 21.676  -1.706  1.00 0.00 ? 37 GLU A CD   5 
ATOM 5291  O OE1  . GLU A 1 37 ? -10.449 20.847  -2.549  1.00 0.00 ? 37 GLU A OE1  5 
ATOM 5292  O OE2  . GLU A 1 37 ? -11.518 22.690  -2.006  1.00 0.00 ? 37 GLU A OE2  5 
ATOM 5293  H H    . GLU A 1 37 ? -7.973  18.321  0.144   1.00 0.00 ? 37 GLU A H    5 
ATOM 5294  H HA   . GLU A 1 37 ? -8.434  20.320  -1.756  1.00 0.00 ? 37 GLU A HA   5 
ATOM 5295  H HB2  . GLU A 1 37 ? -10.235 19.346  -0.423  1.00 0.00 ? 37 GLU A HB2  5 
ATOM 5296  H HB3  . GLU A 1 37 ? -9.559  20.049  1.040   1.00 0.00 ? 37 GLU A HB3  5 
ATOM 5297  H HG2  . GLU A 1 37 ? -11.442 21.347  0.307   1.00 0.00 ? 37 GLU A HG2  5 
ATOM 5298  H HG3  . GLU A 1 37 ? -9.966  22.293  0.125   1.00 0.00 ? 37 GLU A HG3  5 
ATOM 5299  N N    . GLY A 1 38 ? -7.243  21.479  1.109   1.00 0.00 ? 38 GLY A N    5 
ATOM 5300  C CA   . GLY A 1 38 ? -6.519  22.605  1.679   1.00 0.00 ? 38 GLY A CA   5 
ATOM 5301  C C    . GLY A 1 38 ? -5.130  22.753  1.088   1.00 0.00 ? 38 GLY A C    5 
ATOM 5302  O O    . GLY A 1 38 ? -4.778  23.805  0.540   1.00 0.00 ? 38 GLY A O    5 
ATOM 5303  H H    . GLY A 1 38 ? -7.514  20.727  1.682   1.00 0.00 ? 38 GLY A H    5 
ATOM 5304  H HA2  . GLY A 1 38 ? -7.079  23.512  1.493   1.00 0.00 ? 38 GLY A HA2  5 
ATOM 5305  H HA3  . GLY A 1 38 ? -6.431  22.463  2.747   1.00 0.00 ? 38 GLY A HA3  5 
ATOM 5306  N N    . ALA A 1 39 ? -4.340  21.689  1.195   1.00 0.00 ? 39 ALA A N    5 
ATOM 5307  C CA   . ALA A 1 39 ? -2.980  21.683  0.667   1.00 0.00 ? 39 ALA A CA   5 
ATOM 5308  C C    . ALA A 1 39 ? -2.947  22.160  -0.779  1.00 0.00 ? 39 ALA A C    5 
ATOM 5309  O O    . ALA A 1 39 ? -1.929  22.654  -1.263  1.00 0.00 ? 39 ALA A O    5 
ATOM 5310  C CB   . ALA A 1 39 ? -2.393  20.287  0.765   1.00 0.00 ? 39 ALA A CB   5 
ATOM 5311  H H    . ALA A 1 39 ? -4.681  20.884  1.637   1.00 0.00 ? 39 ALA A H    5 
ATOM 5312  H HA   . ALA A 1 39 ? -2.384  22.345  1.273   1.00 0.00 ? 39 ALA A HA   5 
ATOM 5313  H HB1  . ALA A 1 39 ? -3.043  19.588  0.260   1.00 0.00 ? 39 ALA A HB1  5 
ATOM 5314  H HB2  . ALA A 1 39 ? -1.420  20.275  0.299   1.00 0.00 ? 39 ALA A HB2  5 
ATOM 5315  H HB3  . ALA A 1 39 ? -2.301  20.008  1.802   1.00 0.00 ? 39 ALA A HB3  5 
ATOM 5316  N N    . ALA A 1 40 ? -4.068  21.999  -1.468  1.00 0.00 ? 40 ALA A N    5 
ATOM 5317  C CA   . ALA A 1 40 ? -4.165  22.407  -2.857  1.00 0.00 ? 40 ALA A CA   5 
ATOM 5318  C C    . ALA A 1 40 ? -4.704  23.821  -2.952  1.00 0.00 ? 40 ALA A C    5 
ATOM 5319  O O    . ALA A 1 40 ? -4.318  24.587  -3.836  1.00 0.00 ? 40 ALA A O    5 
ATOM 5320  C CB   . ALA A 1 40 ? -5.048  21.439  -3.619  1.00 0.00 ? 40 ALA A CB   5 
ATOM 5321  H H    . ALA A 1 40 ? -4.845  21.592  -1.035  1.00 0.00 ? 40 ALA A H    5 
ATOM 5322  H HA   . ALA A 1 40 ? -3.175  22.376  -3.287  1.00 0.00 ? 40 ALA A HA   5 
ATOM 5323  H HB1  . ALA A 1 40 ? -4.755  20.433  -3.379  1.00 0.00 ? 40 ALA A HB1  5 
ATOM 5324  H HB2  . ALA A 1 40 ? -6.077  21.592  -3.336  1.00 0.00 ? 40 ALA A HB2  5 
ATOM 5325  H HB3  . ALA A 1 40 ? -4.932  21.605  -4.678  1.00 0.00 ? 40 ALA A HB3  5 
ATOM 5326  N N    . ARG A 1 41 ? -5.580  24.173  -2.019  1.00 0.00 ? 41 ARG A N    5 
ATOM 5327  C CA   . ARG A 1 41 ? -6.143  25.511  -1.988  1.00 0.00 ? 41 ARG A CA   5 
ATOM 5328  C C    . ARG A 1 41 ? -5.057  26.530  -1.728  1.00 0.00 ? 41 ARG A C    5 
ATOM 5329  O O    . ARG A 1 41 ? -5.172  27.693  -2.114  1.00 0.00 ? 41 ARG A O    5 
ATOM 5330  C CB   . ARG A 1 41 ? -7.235  25.618  -0.927  1.00 0.00 ? 41 ARG A CB   5 
ATOM 5331  C CG   . ARG A 1 41 ? -8.573  25.077  -1.388  1.00 0.00 ? 41 ARG A CG   5 
ATOM 5332  C CD   . ARG A 1 41 ? -9.104  25.879  -2.565  1.00 0.00 ? 41 ARG A CD   5 
ATOM 5333  N NE   . ARG A 1 41 ? -8.426  25.548  -3.818  1.00 0.00 ? 41 ARG A NE   5 
ATOM 5334  C CZ   . ARG A 1 41 ? -8.431  24.339  -4.375  1.00 0.00 ? 41 ARG A CZ   5 
ATOM 5335  N NH1  . ARG A 1 41 ? -9.126  23.346  -3.831  1.00 0.00 ? 41 ARG A NH1  5 
ATOM 5336  N NH2  . ARG A 1 41 ? -7.749  24.123  -5.492  1.00 0.00 ? 41 ARG A NH2  5 
ATOM 5337  H H    . ARG A 1 41 ? -5.836  23.527  -1.329  1.00 0.00 ? 41 ARG A H    5 
ATOM 5338  H HA   . ARG A 1 41 ? -6.564  25.707  -2.952  1.00 0.00 ? 41 ARG A HA   5 
ATOM 5339  H HB2  . ARG A 1 41 ? -6.929  25.064  -0.051  1.00 0.00 ? 41 ARG A HB2  5 
ATOM 5340  H HB3  . ARG A 1 41 ? -7.362  26.656  -0.661  1.00 0.00 ? 41 ARG A HB3  5 
ATOM 5341  H HG2  . ARG A 1 41 ? -8.448  24.050  -1.689  1.00 0.00 ? 41 ARG A HG2  5 
ATOM 5342  H HG3  . ARG A 1 41 ? -9.279  25.137  -0.573  1.00 0.00 ? 41 ARG A HG3  5 
ATOM 5343  H HD2  . ARG A 1 41 ? -10.159 25.688  -2.672  1.00 0.00 ? 41 ARG A HD2  5 
ATOM 5344  H HD3  . ARG A 1 41 ? -8.944  26.929  -2.354  1.00 0.00 ? 41 ARG A HD3  5 
ATOM 5345  H HE   . ARG A 1 41 ? -7.927  26.266  -4.262  1.00 0.00 ? 41 ARG A HE   5 
ATOM 5346  H HH11 . ARG A 1 41 ? -9.655  23.504  -2.997  1.00 0.00 ? 41 ARG A HH11 5 
ATOM 5347  H HH12 . ARG A 1 41 ? -9.119  22.441  -4.254  1.00 0.00 ? 41 ARG A HH12 5 
ATOM 5348  H HH21 . ARG A 1 41 ? -7.234  24.870  -5.914  1.00 0.00 ? 41 ARG A HH21 5 
ATOM 5349  H HH22 . ARG A 1 41 ? -7.749  23.216  -5.912  1.00 0.00 ? 41 ARG A HH22 5 
ATOM 5350  N N    . GLN A 1 42 ? -3.990  26.081  -1.089  1.00 0.00 ? 42 GLN A N    5 
ATOM 5351  C CA   . GLN A 1 42 ? -2.876  26.938  -0.802  1.00 0.00 ? 42 GLN A CA   5 
ATOM 5352  C C    . GLN A 1 42 ? -1.758  26.700  -1.813  1.00 0.00 ? 42 GLN A C    5 
ATOM 5353  O O    . GLN A 1 42 ? -1.213  25.599  -1.905  1.00 0.00 ? 42 GLN A O    5 
ATOM 5354  C CB   . GLN A 1 42 ? -2.355  26.691  0.604   1.00 0.00 ? 42 GLN A CB   5 
ATOM 5355  C CG   . GLN A 1 42 ? -3.309  27.126  1.706   1.00 0.00 ? 42 GLN A CG   5 
ATOM 5356  C CD   . GLN A 1 42 ? -3.639  28.605  1.647   1.00 0.00 ? 42 GLN A CD   5 
ATOM 5357  O OE1  . GLN A 1 42 ? -4.239  29.081  0.684   1.00 0.00 ? 42 GLN A OE1  5 
ATOM 5358  N NE2  . GLN A 1 42 ? -3.247  29.340  2.680   1.00 0.00 ? 42 GLN A NE2  5 
ATOM 5359  H H    . GLN A 1 42 ? -3.950  25.150  -0.815  1.00 0.00 ? 42 GLN A H    5 
ATOM 5360  H HA   . GLN A 1 42 ? -3.227  27.954  -0.880  1.00 0.00 ? 42 GLN A HA   5 
ATOM 5361  H HB2  . GLN A 1 42 ? -2.161  25.634  0.722   1.00 0.00 ? 42 GLN A HB2  5 
ATOM 5362  H HB3  . GLN A 1 42 ? -1.433  27.228  0.716   1.00 0.00 ? 42 GLN A HB3  5 
ATOM 5363  H HG2  . GLN A 1 42 ? -4.227  26.565  1.611   1.00 0.00 ? 42 GLN A HG2  5 
ATOM 5364  H HG3  . GLN A 1 42 ? -2.855  26.911  2.662   1.00 0.00 ? 42 GLN A HG3  5 
ATOM 5365  H HE21 . GLN A 1 42 ? -2.774  28.893  3.413   1.00 0.00 ? 42 GLN A HE21 5 
ATOM 5366  H HE22 . GLN A 1 42 ? -3.449  30.298  2.669   1.00 0.00 ? 42 GLN A HE22 5 
ATOM 5367  N N    . PRO A 1 43 ? -1.416  27.724  -2.600  1.00 0.00 ? 43 PRO A N    5 
ATOM 5368  C CA   . PRO A 1 43 ? -0.371  27.630  -3.624  1.00 0.00 ? 43 PRO A CA   5 
ATOM 5369  C C    . PRO A 1 43 ? 0.989   27.176  -3.080  1.00 0.00 ? 43 PRO A C    5 
ATOM 5370  O O    . PRO A 1 43 ? 1.914   26.933  -3.853  1.00 0.00 ? 43 PRO A O    5 
ATOM 5371  C CB   . PRO A 1 43 ? -0.263  29.057  -4.175  1.00 0.00 ? 43 PRO A CB   5 
ATOM 5372  C CG   . PRO A 1 43 ? -1.031  29.927  -3.238  1.00 0.00 ? 43 PRO A CG   5 
ATOM 5373  C CD   . PRO A 1 43 ? -2.046  29.048  -2.573  1.00 0.00 ? 43 PRO A CD   5 
ATOM 5374  H HA   . PRO A 1 43 ? -0.667  26.965  -4.418  1.00 0.00 ? 43 PRO A HA   5 
ATOM 5375  H HB2  . PRO A 1 43 ? 0.775   29.348  -4.209  1.00 0.00 ? 43 PRO A HB2  5 
ATOM 5376  H HB3  . PRO A 1 43 ? -0.680  29.089  -5.169  1.00 0.00 ? 43 PRO A HB3  5 
ATOM 5377  H HG2  . PRO A 1 43 ? -0.364  30.350  -2.502  1.00 0.00 ? 43 PRO A HG2  5 
ATOM 5378  H HG3  . PRO A 1 43 ? -1.524  30.712  -3.792  1.00 0.00 ? 43 PRO A HG3  5 
ATOM 5379  H HD2  . PRO A 1 43 ? -2.218  29.371  -1.556  1.00 0.00 ? 43 PRO A HD2  5 
ATOM 5380  H HD3  . PRO A 1 43 ? -2.971  29.041  -3.131  1.00 0.00 ? 43 PRO A HD3  5 
ATOM 5381  N N    . ASP A 1 44 ? 1.118   27.069  -1.760  1.00 0.00 ? 44 ASP A N    5 
ATOM 5382  C CA   . ASP A 1 44 ? 2.381   26.650  -1.153  1.00 0.00 ? 44 ASP A CA   5 
ATOM 5383  C C    . ASP A 1 44 ? 2.365   25.162  -0.793  1.00 0.00 ? 44 ASP A C    5 
ATOM 5384  O O    . ASP A 1 44 ? 3.414   24.524  -0.705  1.00 0.00 ? 44 ASP A O    5 
ATOM 5385  C CB   . ASP A 1 44 ? 2.655   27.486  0.099   1.00 0.00 ? 44 ASP A CB   5 
ATOM 5386  C CG   . ASP A 1 44 ? 4.000   27.175  0.730   1.00 0.00 ? 44 ASP A CG   5 
ATOM 5387  O OD1  . ASP A 1 44 ? 4.744   26.342  0.172   1.00 0.00 ? 44 ASP A OD1  5 
ATOM 5388  O OD2  . ASP A 1 44 ? 4.311   27.770  1.783   1.00 0.00 ? 44 ASP A OD2  5 
ATOM 5389  H H    . ASP A 1 44 ? 0.359   27.282  -1.182  1.00 0.00 ? 44 ASP A H    5 
ATOM 5390  H HA   . ASP A 1 44 ? 3.172   26.829  -1.870  1.00 0.00 ? 44 ASP A HA   5 
ATOM 5391  H HB2  . ASP A 1 44 ? 2.639   28.533  -0.166  1.00 0.00 ? 44 ASP A HB2  5 
ATOM 5392  H HB3  . ASP A 1 44 ? 1.883   27.292  0.828   1.00 0.00 ? 44 ASP A HB3  5 
ATOM 5393  N N    . LEU A 1 45 ? 1.172   24.616  -0.571  1.00 0.00 ? 45 LEU A N    5 
ATOM 5394  C CA   . LEU A 1 45 ? 1.026   23.207  -0.203  1.00 0.00 ? 45 LEU A CA   5 
ATOM 5395  C C    . LEU A 1 45 ? 0.819   22.305  -1.427  1.00 0.00 ? 45 LEU A C    5 
ATOM 5396  O O    . LEU A 1 45 ? 0.481   21.122  -1.296  1.00 0.00 ? 45 LEU A O    5 
ATOM 5397  C CB   . LEU A 1 45 ? -0.132  23.049  0.785   1.00 0.00 ? 45 LEU A CB   5 
ATOM 5398  C CG   . LEU A 1 45 ? 0.098   23.672  2.165   1.00 0.00 ? 45 LEU A CG   5 
ATOM 5399  C CD1  . LEU A 1 45 ? 1.312   23.052  2.839   1.00 0.00 ? 45 LEU A CD1  5 
ATOM 5400  C CD2  . LEU A 1 45 ? 0.262   25.180  2.056   1.00 0.00 ? 45 LEU A CD2  5 
ATOM 5401  H H    . LEU A 1 45 ? 0.370   25.174  -0.647  1.00 0.00 ? 45 LEU A H    5 
ATOM 5402  H HA   . LEU A 1 45 ? 1.938   22.902  0.290   1.00 0.00 ? 45 LEU A HA   5 
ATOM 5403  H HB2  . LEU A 1 45 ? -1.008  23.510  0.355   1.00 0.00 ? 45 LEU A HB2  5 
ATOM 5404  H HB3  . LEU A 1 45 ? -0.326  21.996  0.917   1.00 0.00 ? 45 LEU A HB3  5 
ATOM 5405  H HG   . LEU A 1 45 ? -0.762  23.473  2.787   1.00 0.00 ? 45 LEU A HG   5 
ATOM 5406  H HD11 . LEU A 1 45 ? 2.187   23.217  2.228   1.00 0.00 ? 45 LEU A HD11 5 
ATOM 5407  H HD12 . LEU A 1 45 ? 1.458   23.510  3.807   1.00 0.00 ? 45 LEU A HD12 5 
ATOM 5408  H HD13 . LEU A 1 45 ? 1.154   21.992  2.962   1.00 0.00 ? 45 LEU A HD13 5 
ATOM 5409  H HD21 . LEU A 1 45 ? -0.230  25.531  1.161   1.00 0.00 ? 45 LEU A HD21 5 
ATOM 5410  H HD22 . LEU A 1 45 ? -0.182  25.653  2.919   1.00 0.00 ? 45 LEU A HD22 5 
ATOM 5411  H HD23 . LEU A 1 45 ? 1.312   25.426  2.009   1.00 0.00 ? 45 LEU A HD23 5 
ATOM 5412  N N    . ILE A 1 46 ? 1.034   22.851  -2.622  1.00 0.00 ? 46 ILE A N    5 
ATOM 5413  C CA   . ILE A 1 46 ? 0.874   22.058  -3.837  1.00 0.00 ? 46 ILE A CA   5 
ATOM 5414  C C    . ILE A 1 46 ? 1.719   20.790  -3.751  1.00 0.00 ? 46 ILE A C    5 
ATOM 5415  O O    . ILE A 1 46 ? 1.253   19.708  -4.086  1.00 0.00 ? 46 ILE A O    5 
ATOM 5416  C CB   . ILE A 1 46 ? 1.280   22.822  -5.107  1.00 0.00 ? 46 ILE A CB   5 
ATOM 5417  C CG1  . ILE A 1 46 ? 0.722   24.244  -5.088  1.00 0.00 ? 46 ILE A CG1  5 
ATOM 5418  C CG2  . ILE A 1 46 ? 0.786   22.080  -6.338  1.00 0.00 ? 46 ILE A CG2  5 
ATOM 5419  C CD1  . ILE A 1 46 ? 1.107   25.056  -6.306  1.00 0.00 ? 46 ILE A CD1  5 
ATOM 5420  H H    . ILE A 1 46 ? 1.311   23.786  -2.685  1.00 0.00 ? 46 ILE A H    5 
ATOM 5421  H HA   . ILE A 1 46 ? -0.167  21.781  -3.922  1.00 0.00 ? 46 ILE A HA   5 
ATOM 5422  H HB   . ILE A 1 46 ? 2.352   22.855  -5.146  1.00 0.00 ? 46 ILE A HB   5 
ATOM 5423  H HG12 . ILE A 1 46 ? -0.355  24.202  -5.044  1.00 0.00 ? 46 ILE A HG12 5 
ATOM 5424  H HG13 . ILE A 1 46 ? 1.094   24.756  -4.217  1.00 0.00 ? 46 ILE A HG13 5 
ATOM 5425  H HG21 . ILE A 1 46 ? -0.283  21.937  -6.267  1.00 0.00 ? 46 ILE A HG21 5 
ATOM 5426  H HG22 . ILE A 1 46 ? 1.014   22.656  -7.222  1.00 0.00 ? 46 ILE A HG22 5 
ATOM 5427  H HG23 . ILE A 1 46 ? 1.272   21.120  -6.398  1.00 0.00 ? 46 ILE A HG23 5 
ATOM 5428  H HD11 . ILE A 1 46 ? 2.174   24.994  -6.457  1.00 0.00 ? 46 ILE A HD11 5 
ATOM 5429  H HD12 . ILE A 1 46 ? 0.596   24.667  -7.174  1.00 0.00 ? 46 ILE A HD12 5 
ATOM 5430  H HD13 . ILE A 1 46 ? 0.824   26.088  -6.154  1.00 0.00 ? 46 ILE A HD13 5 
ATOM 5431  N N    . PRO A 1 47 ? 2.980   20.897  -3.289  1.00 0.00 ? 47 PRO A N    5 
ATOM 5432  C CA   . PRO A 1 47 ? 3.850   19.732  -3.156  1.00 0.00 ? 47 PRO A CA   5 
ATOM 5433  C C    . PRO A 1 47 ? 3.357   18.818  -2.049  1.00 0.00 ? 47 PRO A C    5 
ATOM 5434  O O    . PRO A 1 47 ? 3.658   17.623  -2.029  1.00 0.00 ? 47 PRO A O    5 
ATOM 5435  C CB   . PRO A 1 47 ? 5.226   20.321  -2.810  1.00 0.00 ? 47 PRO A CB   5 
ATOM 5436  C CG   . PRO A 1 47 ? 5.104   21.790  -3.055  1.00 0.00 ? 47 PRO A CG   5 
ATOM 5437  C CD   . PRO A 1 47 ? 3.654   22.127  -2.856  1.00 0.00 ? 47 PRO A CD   5 
ATOM 5438  H HA   . PRO A 1 47 ? 3.899   19.175  -4.079  1.00 0.00 ? 47 PRO A HA   5 
ATOM 5439  H HB2  . PRO A 1 47 ? 5.457   20.113  -1.775  1.00 0.00 ? 47 PRO A HB2  5 
ATOM 5440  H HB3  . PRO A 1 47 ? 5.978   19.877  -3.445  1.00 0.00 ? 47 PRO A HB3  5 
ATOM 5441  H HG2  . PRO A 1 47 ? 5.716   22.332  -2.349  1.00 0.00 ? 47 PRO A HG2  5 
ATOM 5442  H HG3  . PRO A 1 47 ? 5.407   22.019  -4.066  1.00 0.00 ? 47 PRO A HG3  5 
ATOM 5443  H HD2  . PRO A 1 47 ? 3.453   22.336  -1.815  1.00 0.00 ? 47 PRO A HD2  5 
ATOM 5444  H HD3  . PRO A 1 47 ? 3.369   22.964  -3.475  1.00 0.00 ? 47 PRO A HD3  5 
ATOM 5445  N N    . LEU A 1 48 ? 2.569   19.388  -1.141  1.00 0.00 ? 48 LEU A N    5 
ATOM 5446  C CA   . LEU A 1 48 ? 1.992   18.622  -0.056  1.00 0.00 ? 48 LEU A CA   5 
ATOM 5447  C C    . LEU A 1 48 ? 1.023   17.633  -0.668  1.00 0.00 ? 48 LEU A C    5 
ATOM 5448  O O    . LEU A 1 48 ? 0.961   16.469  -0.286  1.00 0.00 ? 48 LEU A O    5 
ATOM 5449  C CB   . LEU A 1 48 ? 1.254   19.546  0.916   1.00 0.00 ? 48 LEU A CB   5 
ATOM 5450  C CG   . LEU A 1 48 ? 0.701   18.868  2.170   1.00 0.00 ? 48 LEU A CG   5 
ATOM 5451  C CD1  . LEU A 1 48 ? 1.830   18.283  3.005   1.00 0.00 ? 48 LEU A CD1  5 
ATOM 5452  C CD2  . LEU A 1 48 ? -0.116  19.857  2.985   1.00 0.00 ? 48 LEU A CD2  5 
ATOM 5453  H H    . LEU A 1 48 ? 2.347   20.339  -1.223  1.00 0.00 ? 48 LEU A H    5 
ATOM 5454  H HA   . LEU A 1 48 ? 2.781   18.093  0.459   1.00 0.00 ? 48 LEU A HA   5 
ATOM 5455  H HB2  . LEU A 1 48 ? 1.933   20.327  1.224   1.00 0.00 ? 48 LEU A HB2  5 
ATOM 5456  H HB3  . LEU A 1 48 ? 0.425   20.000  0.390   1.00 0.00 ? 48 LEU A HB3  5 
ATOM 5457  H HG   . LEU A 1 48 ? 0.051   18.057  1.875   1.00 0.00 ? 48 LEU A HG   5 
ATOM 5458  H HD11 . LEU A 1 48 ? 2.736   18.255  2.420   1.00 0.00 ? 48 LEU A HD11 5 
ATOM 5459  H HD12 . LEU A 1 48 ? 1.985   18.896  3.881   1.00 0.00 ? 48 LEU A HD12 5 
ATOM 5460  H HD13 . LEU A 1 48 ? 1.569   17.280  3.311   1.00 0.00 ? 48 LEU A HD13 5 
ATOM 5461  H HD21 . LEU A 1 48 ? -0.392  20.696  2.362   1.00 0.00 ? 48 LEU A HD21 5 
ATOM 5462  H HD22 . LEU A 1 48 ? -1.006  19.372  3.349   1.00 0.00 ? 48 LEU A HD22 5 
ATOM 5463  H HD23 . LEU A 1 48 ? 0.471   20.206  3.822   1.00 0.00 ? 48 LEU A HD23 5 
ATOM 5464  N N    . LEU A 1 49 ? 0.289   18.135  -1.657  1.00 0.00 ? 49 LEU A N    5 
ATOM 5465  C CA   . LEU A 1 49 ? -0.692  17.356  -2.400  1.00 0.00 ? 49 LEU A CA   5 
ATOM 5466  C C    . LEU A 1 49 ? -0.160  15.991  -2.810  1.00 0.00 ? 49 LEU A C    5 
ATOM 5467  O O    . LEU A 1 49 ? -0.690  14.958  -2.401  1.00 0.00 ? 49 LEU A O    5 
ATOM 5468  C CB   . LEU A 1 49 ? -1.106  18.143  -3.640  1.00 0.00 ? 49 LEU A CB   5 
ATOM 5469  C CG   . LEU A 1 49 ? -1.809  19.464  -3.342  1.00 0.00 ? 49 LEU A CG   5 
ATOM 5470  C CD1  . LEU A 1 49 ? -2.270  20.131  -4.628  1.00 0.00 ? 49 LEU A CD1  5 
ATOM 5471  C CD2  . LEU A 1 49 ? -2.981  19.235  -2.401  1.00 0.00 ? 49 LEU A CD2  5 
ATOM 5472  H H    . LEU A 1 49 ? 0.424   19.080  -1.907  1.00 0.00 ? 49 LEU A H    5 
ATOM 5473  H HA   . LEU A 1 49 ? -1.552  17.218  -1.769  1.00 0.00 ? 49 LEU A HA   5 
ATOM 5474  H HB2  . LEU A 1 49 ? -0.214  18.355  -4.225  1.00 0.00 ? 49 LEU A HB2  5 
ATOM 5475  H HB3  . LEU A 1 49 ? -1.768  17.532  -4.232  1.00 0.00 ? 49 LEU A HB3  5 
ATOM 5476  H HG   . LEU A 1 49 ? -1.112  20.130  -2.854  1.00 0.00 ? 49 LEU A HG   5 
ATOM 5477  H HD11 . LEU A 1 49 ? -1.691  19.752  -5.457  1.00 0.00 ? 49 LEU A HD11 5 
ATOM 5478  H HD12 . LEU A 1 49 ? -3.316  19.915  -4.790  1.00 0.00 ? 49 LEU A HD12 5 
ATOM 5479  H HD13 . LEU A 1 49 ? -2.130  21.199  -4.549  1.00 0.00 ? 49 LEU A HD13 5 
ATOM 5480  H HD21 . LEU A 1 49 ? -2.830  18.326  -1.845  1.00 0.00 ? 49 LEU A HD21 5 
ATOM 5481  H HD22 . LEU A 1 49 ? -3.061  20.060  -1.718  1.00 0.00 ? 49 LEU A HD22 5 
ATOM 5482  H HD23 . LEU A 1 49 ? -3.887  19.154  -2.974  1.00 0.00 ? 49 LEU A HD23 5 
ATOM 5483  N N    . ARG A 1 50 ? 0.869   15.992  -3.642  1.00 0.00 ? 50 ARG A N    5 
ATOM 5484  C CA   . ARG A 1 50 ? 1.452   14.757  -4.123  1.00 0.00 ? 50 ARG A CA   5 
ATOM 5485  C C    . ARG A 1 50 ? 2.133   14.014  -2.981  1.00 0.00 ? 50 ARG A C    5 
ATOM 5486  O O    . ARG A 1 50 ? 2.023   12.791  -2.860  1.00 0.00 ? 50 ARG A O    5 
ATOM 5487  C CB   . ARG A 1 50 ? 2.446   15.066  -5.238  1.00 0.00 ? 50 ARG A CB   5 
ATOM 5488  C CG   . ARG A 1 50 ? 1.801   15.714  -6.453  1.00 0.00 ? 50 ARG A CG   5 
ATOM 5489  C CD   . ARG A 1 50 ? 2.823   16.024  -7.536  1.00 0.00 ? 50 ARG A CD   5 
ATOM 5490  N NE   . ARG A 1 50 ? 3.884   16.906  -7.055  1.00 0.00 ? 50 ARG A NE   5 
ATOM 5491  C CZ   . ARG A 1 50 ? 3.683   18.158  -6.651  1.00 0.00 ? 50 ARG A CZ   5 
ATOM 5492  N NH1  . ARG A 1 50 ? 2.472   18.697  -6.708  1.00 0.00 ? 50 ARG A NH1  5 
ATOM 5493  N NH2  . ARG A 1 50 ? 4.699   18.882  -6.202  1.00 0.00 ? 50 ARG A NH2  5 
ATOM 5494  H H    . ARG A 1 50 ? 1.238   16.843  -3.951  1.00 0.00 ? 50 ARG A H    5 
ATOM 5495  H HA   . ARG A 1 50 ? 0.657   14.142  -4.520  1.00 0.00 ? 50 ARG A HA   5 
ATOM 5496  H HB2  . ARG A 1 50 ? 3.202   15.736  -4.856  1.00 0.00 ? 50 ARG A HB2  5 
ATOM 5497  H HB3  . ARG A 1 50 ? 2.911   14.154  -5.546  1.00 0.00 ? 50 ARG A HB3  5 
ATOM 5498  H HG2  . ARG A 1 50 ? 1.061   15.038  -6.857  1.00 0.00 ? 50 ARG A HG2  5 
ATOM 5499  H HG3  . ARG A 1 50 ? 1.322   16.631  -6.147  1.00 0.00 ? 50 ARG A HG3  5 
ATOM 5500  H HD2  . ARG A 1 50 ? 3.265   15.097  -7.874  1.00 0.00 ? 50 ARG A HD2  5 
ATOM 5501  H HD3  . ARG A 1 50 ? 2.318   16.503  -8.363  1.00 0.00 ? 50 ARG A HD3  5 
ATOM 5502  H HE   . ARG A 1 50 ? 4.794   16.543  -7.022  1.00 0.00 ? 50 ARG A HE   5 
ATOM 5503  H HH11 . ARG A 1 50 ? 1.702   18.167  -7.060  1.00 0.00 ? 50 ARG A HH11 5 
ATOM 5504  H HH12 . ARG A 1 50 ? 2.330   19.634  -6.395  1.00 0.00 ? 50 ARG A HH12 5 
ATOM 5505  H HH21 . ARG A 1 50 ? 5.617   18.487  -6.166  1.00 0.00 ? 50 ARG A HH21 5 
ATOM 5506  H HH22 . ARG A 1 50 ? 4.548   19.823  -5.897  1.00 0.00 ? 50 ARG A HH22 5 
ATOM 5507  N N    . THR A 1 51 ? 2.826   14.768  -2.135  1.00 0.00 ? 51 THR A N    5 
ATOM 5508  C CA   . THR A 1 51 ? 3.524   14.197  -0.993  1.00 0.00 ? 51 THR A CA   5 
ATOM 5509  C C    . THR A 1 51 ? 2.553   13.484  -0.057  1.00 0.00 ? 51 THR A C    5 
ATOM 5510  O O    . THR A 1 51 ? 2.861   12.425  0.479   1.00 0.00 ? 51 THR A O    5 
ATOM 5511  C CB   . THR A 1 51 ? 4.261   15.299  -0.235  1.00 0.00 ? 51 THR A CB   5 
ATOM 5512  O OG1  . THR A 1 51 ? 5.112   16.013  -1.111  1.00 0.00 ? 51 THR A OG1  5 
ATOM 5513  C CG2  . THR A 1 51 ? 5.100   14.786  0.912   1.00 0.00 ? 51 THR A CG2  5 
ATOM 5514  H H    . THR A 1 51 ? 2.866   15.740  -2.281  1.00 0.00 ? 51 THR A H    5 
ATOM 5515  H HA   . THR A 1 51 ? 4.245   13.481  -1.367  1.00 0.00 ? 51 THR A HA   5 
ATOM 5516  H HB   . THR A 1 51 ? 3.534   15.991  0.168   1.00 0.00 ? 51 THR A HB   5 
ATOM 5517  H HG1  . THR A 1 51 ? 4.575   16.494  -1.752  1.00 0.00 ? 51 THR A HG1  5 
ATOM 5518  H HG21 . THR A 1 51 ? 5.802   14.051  0.547   1.00 0.00 ? 51 THR A HG21 5 
ATOM 5519  H HG22 . THR A 1 51 ? 5.639   15.608  1.360   1.00 0.00 ? 51 THR A HG22 5 
ATOM 5520  H HG23 . THR A 1 51 ? 4.457   14.334  1.653   1.00 0.00 ? 51 THR A HG23 5 
ATOM 5521  N N    . GLN A 1 52 ? 1.378   14.073  0.139   1.00 0.00 ? 52 GLN A N    5 
ATOM 5522  C CA   . GLN A 1 52 ? 0.367   13.487  1.016   1.00 0.00 ? 52 GLN A CA   5 
ATOM 5523  C C    . GLN A 1 52 ? -0.400  12.402  0.279   1.00 0.00 ? 52 GLN A C    5 
ATOM 5524  O O    . GLN A 1 52 ? -0.878  11.443  0.881   1.00 0.00 ? 52 GLN A O    5 
ATOM 5525  C CB   . GLN A 1 52 ? -0.593  14.569  1.535   1.00 0.00 ? 52 GLN A CB   5 
ATOM 5526  C CG   . GLN A 1 52 ? -1.490  15.190  0.464   1.00 0.00 ? 52 GLN A CG   5 
ATOM 5527  C CD   . GLN A 1 52 ? -2.636  14.291  0.002   1.00 0.00 ? 52 GLN A CD   5 
ATOM 5528  O OE1  . GLN A 1 52 ? -3.242  14.543  -1.040  1.00 0.00 ? 52 GLN A OE1  5 
ATOM 5529  N NE2  . GLN A 1 52 ? -2.966  13.261  0.777   1.00 0.00 ? 52 GLN A NE2  5 
ATOM 5530  H H    . GLN A 1 52 ? 1.185   14.919  -0.315  1.00 0.00 ? 52 GLN A H    5 
ATOM 5531  H HA   . GLN A 1 52 ? 0.879   13.038  1.859   1.00 0.00 ? 52 GLN A HA   5 
ATOM 5532  H HB2  . GLN A 1 52 ? -1.225  14.139  2.297   1.00 0.00 ? 52 GLN A HB2  5 
ATOM 5533  H HB3  . GLN A 1 52 ? -0.007  15.362  1.979   1.00 0.00 ? 52 GLN A HB3  5 
ATOM 5534  H HG2  . GLN A 1 52 ? -1.916  16.100  0.860   1.00 0.00 ? 52 GLN A HG2  5 
ATOM 5535  H HG3  . GLN A 1 52 ? -0.882  15.433  -0.392  1.00 0.00 ? 52 GLN A HG3  5 
ATOM 5536  H HE21 . GLN A 1 52 ? -2.467  13.122  1.605   1.00 0.00 ? 52 GLN A HE21 5 
ATOM 5537  H HE22 . GLN A 1 52 ? -3.699  12.681  0.485   1.00 0.00 ? 52 GLN A HE22 5 
ATOM 5538  N N    . PHE A 1 53 ? -0.516  12.564  -1.032  1.00 0.00 ? 53 PHE A N    5 
ATOM 5539  C CA   . PHE A 1 53 ? -1.227  11.601  -1.855  1.00 0.00 ? 53 PHE A CA   5 
ATOM 5540  C C    . PHE A 1 53 ? -0.557  10.233  -1.769  1.00 0.00 ? 53 PHE A C    5 
ATOM 5541  O O    . PHE A 1 53 ? -1.192  9.248   -1.393  1.00 0.00 ? 53 PHE A O    5 
ATOM 5542  C CB   . PHE A 1 53 ? -1.269  12.086  -3.310  1.00 0.00 ? 53 PHE A CB   5 
ATOM 5543  C CG   . PHE A 1 53 ? -2.134  11.247  -4.210  1.00 0.00 ? 53 PHE A CG   5 
ATOM 5544  C CD1  . PHE A 1 53 ? -1.767  9.956   -4.548  1.00 0.00 ? 53 PHE A CD1  5 
ATOM 5545  C CD2  . PHE A 1 53 ? -3.323  11.754  -4.711  1.00 0.00 ? 53 PHE A CD2  5 
ATOM 5546  C CE1  . PHE A 1 53 ? -2.568  9.186   -5.370  1.00 0.00 ? 53 PHE A CE1  5 
ATOM 5547  C CE2  . PHE A 1 53 ? -4.127  10.989  -5.532  1.00 0.00 ? 53 PHE A CE2  5 
ATOM 5548  C CZ   . PHE A 1 53 ? -3.750  9.703   -5.863  1.00 0.00 ? 53 PHE A CZ   5 
ATOM 5549  H H    . PHE A 1 53 ? -0.115  13.351  -1.456  1.00 0.00 ? 53 PHE A H    5 
ATOM 5550  H HA   . PHE A 1 53 ? -2.242  11.521  -1.479  1.00 0.00 ? 53 PHE A HA   5 
ATOM 5551  H HB2  . PHE A 1 53 ? -1.652  13.095  -3.334  1.00 0.00 ? 53 PHE A HB2  5 
ATOM 5552  H HB3  . PHE A 1 53 ? -0.267  12.078  -3.712  1.00 0.00 ? 53 PHE A HB3  5 
ATOM 5553  H HD1  . PHE A 1 53 ? -0.844  9.550   -4.163  1.00 0.00 ? 53 PHE A HD1  5 
ATOM 5554  H HD2  . PHE A 1 53 ? -3.620  12.761  -4.454  1.00 0.00 ? 53 PHE A HD2  5 
ATOM 5555  H HE1  . PHE A 1 53 ? -2.271  8.179   -5.627  1.00 0.00 ? 53 PHE A HE1  5 
ATOM 5556  H HE2  . PHE A 1 53 ? -5.052  11.397  -5.916  1.00 0.00 ? 53 PHE A HE2  5 
ATOM 5557  H HZ   . PHE A 1 53 ? -4.378  9.103   -6.506  1.00 0.00 ? 53 PHE A HZ   5 
ATOM 5558  N N    . PHE A 1 54 ? 0.731   10.178  -2.115  1.00 0.00 ? 54 PHE A N    5 
ATOM 5559  C CA   . PHE A 1 54 ? 1.477   8.918   -2.095  1.00 0.00 ? 54 PHE A CA   5 
ATOM 5560  C C    . PHE A 1 54 ? 1.715   8.400   -0.665  1.00 0.00 ? 54 PHE A C    5 
ATOM 5561  O O    . PHE A 1 54 ? 1.706   7.189   -0.441  1.00 0.00 ? 54 PHE A O    5 
ATOM 5562  C CB   . PHE A 1 54 ? 2.800   9.064   -2.875  1.00 0.00 ? 54 PHE A CB   5 
ATOM 5563  C CG   . PHE A 1 54 ? 3.981   9.515   -2.065  1.00 0.00 ? 54 PHE A CG   5 
ATOM 5564  C CD1  . PHE A 1 54 ? 3.935   10.687  -1.341  1.00 0.00 ? 54 PHE A CD1  5 
ATOM 5565  C CD2  . PHE A 1 54 ? 5.139   8.758   -2.037  1.00 0.00 ? 54 PHE A CD2  5 
ATOM 5566  C CE1  . PHE A 1 54 ? 5.023   11.098  -0.600  1.00 0.00 ? 54 PHE A CE1  5 
ATOM 5567  C CE2  . PHE A 1 54 ? 6.231   9.163   -1.297  1.00 0.00 ? 54 PHE A CE2  5 
ATOM 5568  C CZ   . PHE A 1 54 ? 6.171   10.337  -0.576  1.00 0.00 ? 54 PHE A CZ   5 
ATOM 5569  H H    . PHE A 1 54 ? 1.186   11.000  -2.403  1.00 0.00 ? 54 PHE A H    5 
ATOM 5570  H HA   . PHE A 1 54 ? 0.866   8.183   -2.615  1.00 0.00 ? 54 PHE A HA   5 
ATOM 5571  H HB2  . PHE A 1 54 ? 3.053   8.113   -3.314  1.00 0.00 ? 54 PHE A HB2  5 
ATOM 5572  H HB3  . PHE A 1 54 ? 2.653   9.787   -3.666  1.00 0.00 ? 54 PHE A HB3  5 
ATOM 5573  H HD1  . PHE A 1 54 ? 3.036   11.284  -1.358  1.00 0.00 ? 54 PHE A HD1  5 
ATOM 5574  H HD2  . PHE A 1 54 ? 5.184   7.839   -2.602  1.00 0.00 ? 54 PHE A HD2  5 
ATOM 5575  H HE1  . PHE A 1 54 ? 4.976   12.020  -0.038  1.00 0.00 ? 54 PHE A HE1  5 
ATOM 5576  H HE2  . PHE A 1 54 ? 7.127   8.562   -1.281  1.00 0.00 ? 54 PHE A HE2  5 
ATOM 5577  H HZ   . PHE A 1 54 ? 7.022   10.659  0.006   1.00 0.00 ? 54 PHE A HZ   5 
ATOM 5578  N N    . ILE A 1 55 ? 1.915   9.302   0.307   1.00 0.00 ? 55 ILE A N    5 
ATOM 5579  C CA   . ILE A 1 55 ? 2.133   8.870   1.695   1.00 0.00 ? 55 ILE A CA   5 
ATOM 5580  C C    . ILE A 1 55 ? 0.843   8.327   2.298   1.00 0.00 ? 55 ILE A C    5 
ATOM 5581  O O    . ILE A 1 55 ? 0.796   7.197   2.777   1.00 0.00 ? 55 ILE A O    5 
ATOM 5582  C CB   . ILE A 1 55 ? 2.651   10.005  2.615   1.00 0.00 ? 55 ILE A CB   5 
ATOM 5583  C CG1  . ILE A 1 55 ? 3.938   10.611  2.067   1.00 0.00 ? 55 ILE A CG1  5 
ATOM 5584  C CG2  . ILE A 1 55 ? 2.879   9.486   4.031   1.00 0.00 ? 55 ILE A CG2  5 
ATOM 5585  C CD1  . ILE A 1 55 ? 4.567   11.642  2.981   1.00 0.00 ? 55 ILE A CD1  5 
ATOM 5586  H H    . ILE A 1 55 ? 1.905   10.260  0.094   1.00 0.00 ? 55 ILE A H    5 
ATOM 5587  H HA   . ILE A 1 55 ? 2.868   8.079   1.682   1.00 0.00 ? 55 ILE A HA   5 
ATOM 5588  H HB   . ILE A 1 55 ? 1.892   10.772  2.660   1.00 0.00 ? 55 ILE A HB   5 
ATOM 5589  H HG12 . ILE A 1 55 ? 4.662   9.828   1.907   1.00 0.00 ? 55 ILE A HG12 5 
ATOM 5590  H HG13 . ILE A 1 55 ? 3.715   11.097  1.133   1.00 0.00 ? 55 ILE A HG13 5 
ATOM 5591  H HG21 . ILE A 1 55 ? 2.351   8.553   4.166   1.00 0.00 ? 55 ILE A HG21 5 
ATOM 5592  H HG22 . ILE A 1 55 ? 3.935   9.326   4.190   1.00 0.00 ? 55 ILE A HG22 5 
ATOM 5593  H HG23 . ILE A 1 55 ? 2.515   10.211  4.743   1.00 0.00 ? 55 ILE A HG23 5 
ATOM 5594  H HD11 . ILE A 1 55 ? 3.987   11.723  3.887   1.00 0.00 ? 55 ILE A HD11 5 
ATOM 5595  H HD12 . ILE A 1 55 ? 5.576   11.340  3.226   1.00 0.00 ? 55 ILE A HD12 5 
ATOM 5596  H HD13 . ILE A 1 55 ? 4.590   12.598  2.481   1.00 0.00 ? 55 ILE A HD13 5 
ATOM 5597  N N    . VAL A 1 56 ? -0.196  9.152   2.287   1.00 0.00 ? 56 VAL A N    5 
ATOM 5598  C CA   . VAL A 1 56 ? -1.483  8.770   2.851   1.00 0.00 ? 56 VAL A CA   5 
ATOM 5599  C C    . VAL A 1 56 ? -2.089  7.583   2.108   1.00 0.00 ? 56 VAL A C    5 
ATOM 5600  O O    . VAL A 1 56 ? -2.705  6.710   2.719   1.00 0.00 ? 56 VAL A O    5 
ATOM 5601  C CB   . VAL A 1 56 ? -2.470  9.955   2.829   1.00 0.00 ? 56 VAL A CB   5 
ATOM 5602  C CG1  . VAL A 1 56 ? -3.809  9.562   3.441   1.00 0.00 ? 56 VAL A CG1  5 
ATOM 5603  C CG2  . VAL A 1 56 ? -1.873  11.149  3.562   1.00 0.00 ? 56 VAL A CG2  5 
ATOM 5604  H H    . VAL A 1 56 ? -0.090  10.046  1.902   1.00 0.00 ? 56 VAL A H    5 
ATOM 5605  H HA   . VAL A 1 56 ? -1.321  8.485   3.882   1.00 0.00 ? 56 VAL A HA   5 
ATOM 5606  H HB   . VAL A 1 56 ? -2.638  10.240  1.800   1.00 0.00 ? 56 VAL A HB   5 
ATOM 5607  H HG11 . VAL A 1 56 ? -3.834  8.495   3.600   1.00 0.00 ? 56 VAL A HG11 5 
ATOM 5608  H HG12 . VAL A 1 56 ? -3.936  10.070  4.387   1.00 0.00 ? 56 VAL A HG12 5 
ATOM 5609  H HG13 . VAL A 1 56 ? -4.607  9.845   2.772   1.00 0.00 ? 56 VAL A HG13 5 
ATOM 5610  H HG21 . VAL A 1 56 ? -0.973  10.845  4.074   1.00 0.00 ? 56 VAL A HG21 5 
ATOM 5611  H HG22 . VAL A 1 56 ? -1.635  11.926  2.852   1.00 0.00 ? 56 VAL A HG22 5 
ATOM 5612  H HG23 . VAL A 1 56 ? -2.585  11.526  4.281   1.00 0.00 ? 56 VAL A HG23 5 
ATOM 5613  N N    . MET A 1 57 ? -1.909  7.548   0.792   1.00 0.00 ? 57 MET A N    5 
ATOM 5614  C CA   . MET A 1 57 ? -2.439  6.454   -0.015  1.00 0.00 ? 57 MET A CA   5 
ATOM 5615  C C    . MET A 1 57 ? -1.619  5.193   0.199   1.00 0.00 ? 57 MET A C    5 
ATOM 5616  O O    . MET A 1 57 ? -2.154  4.087   0.260   1.00 0.00 ? 57 MET A O    5 
ATOM 5617  C CB   . MET A 1 57 ? -2.433  6.832   -1.498  1.00 0.00 ? 57 MET A CB   5 
ATOM 5618  C CG   . MET A 1 57 ? -2.976  5.742   -2.411  1.00 0.00 ? 57 MET A CG   5 
ATOM 5619  S SD   . MET A 1 57 ? -4.725  5.402   -2.134  1.00 0.00 ? 57 MET A SD   5 
ATOM 5620  C CE   . MET A 1 57 ? -5.464  6.919   -2.735  1.00 0.00 ? 57 MET A CE   5 
ATOM 5621  H H    . MET A 1 57 ? -1.406  8.268   0.355   1.00 0.00 ? 57 MET A H    5 
ATOM 5622  H HA   . MET A 1 57 ? -3.449  6.266   0.302   1.00 0.00 ? 57 MET A HA   5 
ATOM 5623  H HB2  . MET A 1 57 ? -3.033  7.717   -1.634  1.00 0.00 ? 57 MET A HB2  5 
ATOM 5624  H HB3  . MET A 1 57 ? -1.417  7.044   -1.800  1.00 0.00 ? 57 MET A HB3  5 
ATOM 5625  H HG2  . MET A 1 57 ? -2.845  6.054   -3.435  1.00 0.00 ? 57 MET A HG2  5 
ATOM 5626  H HG3  . MET A 1 57 ? -2.415  4.835   -2.239  1.00 0.00 ? 57 MET A HG3  5 
ATOM 5627  H HE1  . MET A 1 57 ? -4.865  7.761   -2.423  1.00 0.00 ? 57 MET A HE1  5 
ATOM 5628  H HE2  . MET A 1 57 ? -5.514  6.892   -3.814  1.00 0.00 ? 57 MET A HE2  5 
ATOM 5629  H HE3  . MET A 1 57 ? -6.461  7.019   -2.332  1.00 0.00 ? 57 MET A HE3  5 
ATOM 5630  N N    . GLY A 1 58 ? -0.313  5.377   0.303   1.00 0.00 ? 58 GLY A N    5 
ATOM 5631  C CA   . GLY A 1 58 ? 0.587   4.255   0.497   1.00 0.00 ? 58 GLY A CA   5 
ATOM 5632  C C    . GLY A 1 58 ? 0.439   3.614   1.862   1.00 0.00 ? 58 GLY A C    5 
ATOM 5633  O O    . GLY A 1 58 ? 0.396   2.390   1.970   1.00 0.00 ? 58 GLY A O    5 
ATOM 5634  H H    . GLY A 1 58 ? 0.043   6.285   0.239   1.00 0.00 ? 58 GLY A H    5 
ATOM 5635  H HA2  . GLY A 1 58 ? 0.384   3.511   -0.259  1.00 0.00 ? 58 GLY A HA2  5 
ATOM 5636  H HA3  . GLY A 1 58 ? 1.602   4.597   0.381   1.00 0.00 ? 58 GLY A HA3  5 
ATOM 5637  N N    . LEU A 1 59 ? 0.359   4.432   2.908   1.00 0.00 ? 59 LEU A N    5 
ATOM 5638  C CA   . LEU A 1 59 ? 0.207   3.915   4.260   1.00 0.00 ? 59 LEU A CA   5 
ATOM 5639  C C    . LEU A 1 59 ? -1.078  3.103   4.368   1.00 0.00 ? 59 LEU A C    5 
ATOM 5640  O O    . LEU A 1 59 ? -1.114  2.050   5.004   1.00 0.00 ? 59 LEU A O    5 
ATOM 5641  C CB   . LEU A 1 59 ? 0.195   5.063   5.269   1.00 0.00 ? 59 LEU A CB   5 
ATOM 5642  C CG   . LEU A 1 59 ? 1.499   5.860   5.357   1.00 0.00 ? 59 LEU A CG   5 
ATOM 5643  C CD1  . LEU A 1 59 ? 1.363   7.001   6.354   1.00 0.00 ? 59 LEU A CD1  5 
ATOM 5644  C CD2  . LEU A 1 59 ? 2.653   4.948   5.741   1.00 0.00 ? 59 LEU A CD2  5 
ATOM 5645  H H    . LEU A 1 59 ? 0.394   5.403   2.768   1.00 0.00 ? 59 LEU A H    5 
ATOM 5646  H HA   . LEU A 1 59 ? 1.048   3.269   4.467   1.00 0.00 ? 59 LEU A HA   5 
ATOM 5647  H HB2  . LEU A 1 59 ? -0.598  5.743   4.996   1.00 0.00 ? 59 LEU A HB2  5 
ATOM 5648  H HB3  . LEU A 1 59 ? -0.019  4.658   6.245   1.00 0.00 ? 59 LEU A HB3  5 
ATOM 5649  H HG   . LEU A 1 59 ? 1.717   6.284   4.390   1.00 0.00 ? 59 LEU A HG   5 
ATOM 5650  H HD11 . LEU A 1 59 ? 0.725   6.693   7.169   1.00 0.00 ? 59 LEU A HD11 5 
ATOM 5651  H HD12 . LEU A 1 59 ? 2.338   7.261   6.739   1.00 0.00 ? 59 LEU A HD12 5 
ATOM 5652  H HD13 . LEU A 1 59 ? 0.929   7.859   5.862   1.00 0.00 ? 59 LEU A HD13 5 
ATOM 5653  H HD21 . LEU A 1 59 ? 2.320   4.239   6.483   1.00 0.00 ? 59 LEU A HD21 5 
ATOM 5654  H HD22 . LEU A 1 59 ? 3.000   4.419   4.866   1.00 0.00 ? 59 LEU A HD22 5 
ATOM 5655  H HD23 . LEU A 1 59 ? 3.460   5.542   6.146   1.00 0.00 ? 59 LEU A HD23 5 
ATOM 5656  N N    . VAL A 1 60 ? -2.124  3.592   3.712   1.00 0.00 ? 60 VAL A N    5 
ATOM 5657  C CA   . VAL A 1 60 ? -3.413  2.915   3.707   1.00 0.00 ? 60 VAL A CA   5 
ATOM 5658  C C    . VAL A 1 60 ? -3.347  1.633   2.882   1.00 0.00 ? 60 VAL A C    5 
ATOM 5659  O O    . VAL A 1 60 ? -3.879  0.598   3.280   1.00 0.00 ? 60 VAL A O    5 
ATOM 5660  C CB   . VAL A 1 60 ? -4.517  3.831   3.142   1.00 0.00 ? 60 VAL A CB   5 
ATOM 5661  C CG1  . VAL A 1 60 ? -5.864  3.124   3.148   1.00 0.00 ? 60 VAL A CG1  5 
ATOM 5662  C CG2  . VAL A 1 60 ? -4.589  5.127   3.934   1.00 0.00 ? 60 VAL A CG2  5 
ATOM 5663  H H    . VAL A 1 60 ? -2.022  4.424   3.206   1.00 0.00 ? 60 VAL A H    5 
ATOM 5664  H HA   . VAL A 1 60 ? -3.667  2.667   4.728   1.00 0.00 ? 60 VAL A HA   5 
ATOM 5665  H HB   . VAL A 1 60 ? -4.266  4.076   2.118   1.00 0.00 ? 60 VAL A HB   5 
ATOM 5666  H HG11 . VAL A 1 60 ? -5.759  2.143   2.709   1.00 0.00 ? 60 VAL A HG11 5 
ATOM 5667  H HG12 . VAL A 1 60 ? -6.216  3.029   4.165   1.00 0.00 ? 60 VAL A HG12 5 
ATOM 5668  H HG13 . VAL A 1 60 ? -6.574  3.701   2.575   1.00 0.00 ? 60 VAL A HG13 5 
ATOM 5669  H HG21 . VAL A 1 60 ? -3.667  5.269   4.477   1.00 0.00 ? 60 VAL A HG21 5 
ATOM 5670  H HG22 . VAL A 1 60 ? -4.740  5.954   3.257   1.00 0.00 ? 60 VAL A HG22 5 
ATOM 5671  H HG23 . VAL A 1 60 ? -5.413  5.078   4.630   1.00 0.00 ? 60 VAL A HG23 5 
ATOM 5672  N N    . ASP A 1 61 ? -2.684  1.710   1.730   1.00 0.00 ? 61 ASP A N    5 
ATOM 5673  C CA   . ASP A 1 61 ? -2.541  0.565   0.845   1.00 0.00 ? 61 ASP A CA   5 
ATOM 5674  C C    . ASP A 1 61 ? -1.447  -0.383  1.324   1.00 0.00 ? 61 ASP A C    5 
ATOM 5675  O O    . ASP A 1 61 ? -1.350  -1.522  0.863   1.00 0.00 ? 61 ASP A O    5 
ATOM 5676  C CB   . ASP A 1 61 ? -2.235  1.047   -0.572  1.00 0.00 ? 61 ASP A CB   5 
ATOM 5677  C CG   . ASP A 1 61 ? -3.432  1.708   -1.226  1.00 0.00 ? 61 ASP A CG   5 
ATOM 5678  O OD1  . ASP A 1 61 ? -4.459  1.022   -1.415  1.00 0.00 ? 61 ASP A OD1  5 
ATOM 5679  O OD2  . ASP A 1 61 ? -3.347  2.912   -1.545  1.00 0.00 ? 61 ASP A OD2  5 
ATOM 5680  H H    . ASP A 1 61 ? -2.279  2.559   1.466   1.00 0.00 ? 61 ASP A H    5 
ATOM 5681  H HA   . ASP A 1 61 ? -3.482  0.032   0.840   1.00 0.00 ? 61 ASP A HA   5 
ATOM 5682  H HB2  . ASP A 1 61 ? -1.423  1.763   -0.537  1.00 0.00 ? 61 ASP A HB2  5 
ATOM 5683  H HB3  . ASP A 1 61 ? -1.939  0.207   -1.172  1.00 0.00 ? 61 ASP A HB3  5 
ATOM 5684  N N    . ALA A 1 62 ? -0.634  0.071   2.262   1.00 0.00 ? 62 ALA A N    5 
ATOM 5685  C CA   . ALA A 1 62 ? 0.420   -0.773  2.792   1.00 0.00 ? 62 ALA A CA   5 
ATOM 5686  C C    . ALA A 1 62 ? -0.178  -1.938  3.576   1.00 0.00 ? 62 ALA A C    5 
ATOM 5687  O O    . ALA A 1 62 ? 0.466   -2.965  3.759   1.00 0.00 ? 62 ALA A O    5 
ATOM 5688  C CB   . ALA A 1 62 ? 1.358   0.035   3.675   1.00 0.00 ? 62 ALA A CB   5 
ATOM 5689  H H    . ALA A 1 62 ? -0.751  0.980   2.612   1.00 0.00 ? 62 ALA A H    5 
ATOM 5690  H HA   . ALA A 1 62 ? 0.987   -1.163  1.961   1.00 0.00 ? 62 ALA A HA   5 
ATOM 5691  H HB1  . ALA A 1 62 ? 1.500   1.015   3.246   1.00 0.00 ? 62 ALA A HB1  5 
ATOM 5692  H HB2  . ALA A 1 62 ? 0.929   0.133   4.661   1.00 0.00 ? 62 ALA A HB2  5 
ATOM 5693  H HB3  . ALA A 1 62 ? 2.311   -0.469  3.744   1.00 0.00 ? 62 ALA A HB3  5 
ATOM 5694  N N    . ILE A 1 63 ? -1.418  -1.775  4.032   1.00 0.00 ? 63 ILE A N    5 
ATOM 5695  C CA   . ILE A 1 63 ? -2.087  -2.819  4.796   1.00 0.00 ? 63 ILE A CA   5 
ATOM 5696  C C    . ILE A 1 63 ? -2.328  -4.068  3.949   1.00 0.00 ? 63 ILE A C    5 
ATOM 5697  O O    . ILE A 1 63 ? -1.893  -5.156  4.327   1.00 0.00 ? 63 ILE A O    5 
ATOM 5698  C CB   . ILE A 1 63 ? -3.408  -2.315  5.425   1.00 0.00 ? 63 ILE A CB   5 
ATOM 5699  C CG1  . ILE A 1 63 ? -3.104  -1.239  6.466   1.00 0.00 ? 63 ILE A CG1  5 
ATOM 5700  C CG2  . ILE A 1 63 ? -4.180  -3.464  6.063   1.00 0.00 ? 63 ILE A CG2  5 
ATOM 5701  C CD1  . ILE A 1 63 ? -4.343  -0.669  7.124   1.00 0.00 ? 63 ILE A CD1  5 
ATOM 5702  H H    . ILE A 1 63 ? -1.891  -0.940  3.848   1.00 0.00 ? 63 ILE A H    5 
ATOM 5703  H HA   . ILE A 1 63 ? -1.423  -3.089  5.607   1.00 0.00 ? 63 ILE A HA   5 
ATOM 5704  H HB   . ILE A 1 63 ? -4.020  -1.886  4.651   1.00 0.00 ? 63 ILE A HB   5 
ATOM 5705  H HG12 . ILE A 1 63 ? -2.481  -1.664  7.240   1.00 0.00 ? 63 ILE A HG12 5 
ATOM 5706  H HG13 . ILE A 1 63 ? -2.576  -0.427  5.990   1.00 0.00 ? 63 ILE A HG13 5 
ATOM 5707  H HG21 . ILE A 1 63 ? -4.368  -4.227  5.324   1.00 0.00 ? 63 ILE A HG21 5 
ATOM 5708  H HG22 . ILE A 1 63 ? -3.599  -3.882  6.872   1.00 0.00 ? 63 ILE A HG22 5 
ATOM 5709  H HG23 . ILE A 1 63 ? -5.119  -3.096  6.448   1.00 0.00 ? 63 ILE A HG23 5 
ATOM 5710  H HD11 . ILE A 1 63 ? -5.063  -1.458  7.281   1.00 0.00 ? 63 ILE A HD11 5 
ATOM 5711  H HD12 . ILE A 1 63 ? -4.077  -0.230  8.075   1.00 0.00 ? 63 ILE A HD12 5 
ATOM 5712  H HD13 . ILE A 1 63 ? -4.773  0.089   6.486   1.00 0.00 ? 63 ILE A HD13 5 
ATOM 5713  N N    . PRO A 1 64 ? -3.018  -3.958  2.795   1.00 0.00 ? 64 PRO A N    5 
ATOM 5714  C CA   . PRO A 1 64 ? -3.273  -5.107  1.941   1.00 0.00 ? 64 PRO A CA   5 
ATOM 5715  C C    . PRO A 1 64 ? -2.044  -5.464  1.131   1.00 0.00 ? 64 PRO A C    5 
ATOM 5716  O O    . PRO A 1 64 ? -1.845  -6.617  0.759   1.00 0.00 ? 64 PRO A O    5 
ATOM 5717  C CB   . PRO A 1 64 ? -4.427  -4.647  1.031   1.00 0.00 ? 64 PRO A CB   5 
ATOM 5718  C CG   . PRO A 1 64 ? -4.832  -3.305  1.549   1.00 0.00 ? 64 PRO A CG   5 
ATOM 5719  C CD   . PRO A 1 64 ? -3.609  -2.750  2.213   1.00 0.00 ? 64 PRO A CD   5 
ATOM 5720  H HA   . PRO A 1 64 ? -3.572  -5.962  2.517   1.00 0.00 ? 64 PRO A HA   5 
ATOM 5721  H HB2  . PRO A 1 64 ? -4.076  -4.584  0.014   1.00 0.00 ? 64 PRO A HB2  5 
ATOM 5722  H HB3  . PRO A 1 64 ? -5.240  -5.355  1.094   1.00 0.00 ? 64 PRO A HB3  5 
ATOM 5723  H HG2  . PRO A 1 64 ? -5.137  -2.669  0.731   1.00 0.00 ? 64 PRO A HG2  5 
ATOM 5724  H HG3  . PRO A 1 64 ? -5.633  -3.410  2.265   1.00 0.00 ? 64 PRO A HG3  5 
ATOM 5725  H HD2  . PRO A 1 64 ? -2.962  -2.314  1.477   1.00 0.00 ? 64 PRO A HD2  5 
ATOM 5726  H HD3  . PRO A 1 64 ? -3.873  -2.033  2.963   1.00 0.00 ? 64 PRO A HD3  5 
ATOM 5727  N N    . MET A 1 65 ? -1.201  -4.472  0.887   1.00 0.00 ? 65 MET A N    5 
ATOM 5728  C CA   . MET A 1 65 ? 0.023   -4.700  0.149   1.00 0.00 ? 65 MET A CA   5 
ATOM 5729  C C    . MET A 1 65 ? 0.991   -5.507  1.007   1.00 0.00 ? 65 MET A C    5 
ATOM 5730  O O    . MET A 1 65 ? 1.765   -6.316  0.498   1.00 0.00 ? 65 MET A O    5 
ATOM 5731  C CB   . MET A 1 65 ? 0.644   -3.364  -0.246  1.00 0.00 ? 65 MET A CB   5 
ATOM 5732  C CG   . MET A 1 65 ? 1.946   -3.496  -1.006  1.00 0.00 ? 65 MET A CG   5 
ATOM 5733  S SD   . MET A 1 65 ? 1.775   -4.429  -2.540  1.00 0.00 ? 65 MET A SD   5 
ATOM 5734  C CE   . MET A 1 65 ? 0.648   -3.384  -3.460  1.00 0.00 ? 65 MET A CE   5 
ATOM 5735  H H    . MET A 1 65 ? -1.396  -3.569  1.231   1.00 0.00 ? 65 MET A H    5 
ATOM 5736  H HA   . MET A 1 65 ? -0.219  -5.267  -0.742  1.00 0.00 ? 65 MET A HA   5 
ATOM 5737  H HB2  . MET A 1 65 ? -0.057  -2.825  -0.863  1.00 0.00 ? 65 MET A HB2  5 
ATOM 5738  H HB3  . MET A 1 65 ? 0.832   -2.791  0.651   1.00 0.00 ? 65 MET A HB3  5 
ATOM 5739  H HG2  . MET A 1 65 ? 2.297   -2.506  -1.241  1.00 0.00 ? 65 MET A HG2  5 
ATOM 5740  H HG3  . MET A 1 65 ? 2.669   -3.993  -0.375  1.00 0.00 ? 65 MET A HG3  5 
ATOM 5741  H HE1  . MET A 1 65 ? 0.090   -2.764  -2.774  1.00 0.00 ? 65 MET A HE1  5 
ATOM 5742  H HE2  . MET A 1 65 ? 1.209   -2.757  -4.136  1.00 0.00 ? 65 MET A HE2  5 
ATOM 5743  H HE3  . MET A 1 65 ? -0.035  -4.002  -4.024  1.00 0.00 ? 65 MET A HE3  5 
ATOM 5744  N N    . ILE A 1 66 ? 0.910   -5.297  2.321   1.00 0.00 ? 66 ILE A N    5 
ATOM 5745  C CA   . ILE A 1 66 ? 1.756   -6.017  3.268   1.00 0.00 ? 66 ILE A CA   5 
ATOM 5746  C C    . ILE A 1 66 ? 1.164   -7.393  3.545   1.00 0.00 ? 66 ILE A C    5 
ATOM 5747  O O    . ILE A 1 66 ? 1.877   -8.392  3.548   1.00 0.00 ? 66 ILE A O    5 
ATOM 5748  C CB   . ILE A 1 66 ? 1.942   -5.208  4.586   1.00 0.00 ? 66 ILE A CB   5 
ATOM 5749  C CG1  . ILE A 1 66 ? 3.100   -4.209  4.437   1.00 0.00 ? 66 ILE A CG1  5 
ATOM 5750  C CG2  . ILE A 1 66 ? 2.192   -6.109  5.794   1.00 0.00 ? 66 ILE A CG2  5 
ATOM 5751  C CD1  . ILE A 1 66 ? 3.098   -3.425  3.139   1.00 0.00 ? 66 ILE A CD1  5 
ATOM 5752  H H    . ILE A 1 66 ? 0.247   -4.655  2.664   1.00 0.00 ? 66 ILE A H    5 
ATOM 5753  H HA   . ILE A 1 66 ? 2.729   -6.145  2.812   1.00 0.00 ? 66 ILE A HA   5 
ATOM 5754  H HB   . ILE A 1 66 ? 1.034   -4.662  4.776   1.00 0.00 ? 66 ILE A HB   5 
ATOM 5755  H HG12 . ILE A 1 66 ? 3.054   -3.498  5.246   1.00 0.00 ? 66 ILE A HG12 5 
ATOM 5756  H HG13 . ILE A 1 66 ? 4.035   -4.748  4.496   1.00 0.00 ? 66 ILE A HG13 5 
ATOM 5757  H HG21 . ILE A 1 66 ? 1.727   -7.068  5.641   1.00 0.00 ? 66 ILE A HG21 5 
ATOM 5758  H HG22 . ILE A 1 66 ? 3.255   -6.241  5.930   1.00 0.00 ? 66 ILE A HG22 5 
ATOM 5759  H HG23 . ILE A 1 66 ? 1.772   -5.645  6.675   1.00 0.00 ? 66 ILE A HG23 5 
ATOM 5760  H HD11 . ILE A 1 66 ? 2.928   -4.096  2.311   1.00 0.00 ? 66 ILE A HD11 5 
ATOM 5761  H HD12 . ILE A 1 66 ? 2.320   -2.681  3.165   1.00 0.00 ? 66 ILE A HD12 5 
ATOM 5762  H HD13 . ILE A 1 66 ? 4.055   -2.940  3.014   1.00 0.00 ? 66 ILE A HD13 5 
ATOM 5763  N N    . ALA A 1 67 ? -0.146  -7.444  3.754   1.00 0.00 ? 67 ALA A N    5 
ATOM 5764  C CA   . ALA A 1 67 ? -0.816  -8.705  4.005   1.00 0.00 ? 67 ALA A CA   5 
ATOM 5765  C C    . ALA A 1 67 ? -0.740  -9.588  2.771   1.00 0.00 ? 67 ALA A C    5 
ATOM 5766  O O    . ALA A 1 67 ? -0.294  -10.733 2.838   1.00 0.00 ? 67 ALA A O    5 
ATOM 5767  C CB   . ALA A 1 67 ? -2.262  -8.473  4.414   1.00 0.00 ? 67 ALA A CB   5 
ATOM 5768  H H    . ALA A 1 67 ? -0.670  -6.620  3.725   1.00 0.00 ? 67 ALA A H    5 
ATOM 5769  H HA   . ALA A 1 67 ? -0.305  -9.193  4.818   1.00 0.00 ? 67 ALA A HA   5 
ATOM 5770  H HB1  . ALA A 1 67 ? -2.663  -7.636  3.861   1.00 0.00 ? 67 ALA A HB1  5 
ATOM 5771  H HB2  . ALA A 1 67 ? -2.843  -9.358  4.198   1.00 0.00 ? 67 ALA A HB2  5 
ATOM 5772  H HB3  . ALA A 1 67 ? -2.309  -8.261  5.472   1.00 0.00 ? 67 ALA A HB3  5 
ATOM 5773  N N    . VAL A 1 68 ? -1.160  -9.037  1.639   1.00 0.00 ? 68 VAL A N    5 
ATOM 5774  C CA   . VAL A 1 68 ? -1.124  -9.763  0.381   1.00 0.00 ? 68 VAL A CA   5 
ATOM 5775  C C    . VAL A 1 68 ? 0.315   -9.993  -0.054  1.00 0.00 ? 68 VAL A C    5 
ATOM 5776  O O    . VAL A 1 68 ? 0.669   -11.086 -0.487  1.00 0.00 ? 68 VAL A O    5 
ATOM 5777  C CB   . VAL A 1 68 ? -1.884  -9.007  -0.731  1.00 0.00 ? 68 VAL A CB   5 
ATOM 5778  C CG1  . VAL A 1 68 ? -1.823  -9.772  -2.049  1.00 0.00 ? 68 VAL A CG1  5 
ATOM 5779  C CG2  . VAL A 1 68 ? -3.331  -8.777  -0.317  1.00 0.00 ? 68 VAL A CG2  5 
ATOM 5780  H H    . VAL A 1 68 ? -1.491  -8.115  1.650   1.00 0.00 ? 68 VAL A H    5 
ATOM 5781  H HA   . VAL A 1 68 ? -1.601  -10.722 0.534   1.00 0.00 ? 68 VAL A HA   5 
ATOM 5782  H HB   . VAL A 1 68 ? -1.412  -8.042  -0.877  1.00 0.00 ? 68 VAL A HB   5 
ATOM 5783  H HG11 . VAL A 1 68 ? -1.061  -10.535 -1.989  1.00 0.00 ? 68 VAL A HG11 5 
ATOM 5784  H HG12 . VAL A 1 68 ? -2.779  -10.233 -2.243  1.00 0.00 ? 68 VAL A HG12 5 
ATOM 5785  H HG13 . VAL A 1 68 ? -1.584  -9.087  -2.850  1.00 0.00 ? 68 VAL A HG13 5 
ATOM 5786  H HG21 . VAL A 1 68 ? -3.757  -9.706  0.030   1.00 0.00 ? 68 VAL A HG21 5 
ATOM 5787  H HG22 . VAL A 1 68 ? -3.368  -8.045  0.475   1.00 0.00 ? 68 VAL A HG22 5 
ATOM 5788  H HG23 . VAL A 1 68 ? -3.893  -8.419  -1.164  1.00 0.00 ? 68 VAL A HG23 5 
ATOM 5789  N N    . GLY A 1 69 ? 1.143   -8.960  0.073   1.00 0.00 ? 69 GLY A N    5 
ATOM 5790  C CA   . GLY A 1 69 ? 2.536   -9.084  -0.307  1.00 0.00 ? 69 GLY A CA   5 
ATOM 5791  C C    . GLY A 1 69 ? 3.265   -10.106 0.538   1.00 0.00 ? 69 GLY A C    5 
ATOM 5792  O O    . GLY A 1 69 ? 4.035   -10.913 0.019   1.00 0.00 ? 69 GLY A O    5 
ATOM 5793  H H    . GLY A 1 69 ? 0.807   -8.110  0.431   1.00 0.00 ? 69 GLY A H    5 
ATOM 5794  H HA2  . GLY A 1 69 ? 2.592   -9.380  -1.345  1.00 0.00 ? 69 GLY A HA2  5 
ATOM 5795  H HA3  . GLY A 1 69 ? 3.021   -8.125  -0.191  1.00 0.00 ? 69 GLY A HA3  5 
ATOM 5796  N N    . LEU A 1 70 ? 3.015   -10.081 1.843   1.00 0.00 ? 70 LEU A N    5 
ATOM 5797  C CA   . LEU A 1 70 ? 3.647   -11.022 2.759   1.00 0.00 ? 70 LEU A CA   5 
ATOM 5798  C C    . LEU A 1 70 ? 3.204   -12.437 2.429   1.00 0.00 ? 70 LEU A C    5 
ATOM 5799  O O    . LEU A 1 70 ? 4.019   -13.358 2.355   1.00 0.00 ? 70 LEU A O    5 
ATOM 5800  C CB   . LEU A 1 70 ? 3.285   -10.683 4.208   1.00 0.00 ? 70 LEU A CB   5 
ATOM 5801  C CG   . LEU A 1 70 ? 4.079   -11.430 5.286   1.00 0.00 ? 70 LEU A CG   5 
ATOM 5802  C CD1  . LEU A 1 70 ? 3.771   -12.920 5.259   1.00 0.00 ? 70 LEU A CD1  5 
ATOM 5803  C CD2  . LEU A 1 70 ? 5.571   -11.188 5.110   1.00 0.00 ? 70 LEU A CD2  5 
ATOM 5804  H H    . LEU A 1 70 ? 2.383   -9.420  2.197   1.00 0.00 ? 70 LEU A H    5 
ATOM 5805  H HA   . LEU A 1 70 ? 4.717   -10.947 2.631   1.00 0.00 ? 70 LEU A HA   5 
ATOM 5806  H HB2  . LEU A 1 70 ? 3.435   -9.626  4.354   1.00 0.00 ? 70 LEU A HB2  5 
ATOM 5807  H HB3  . LEU A 1 70 ? 2.236   -10.901 4.354   1.00 0.00 ? 70 LEU A HB3  5 
ATOM 5808  H HG   . LEU A 1 70 ? 3.793   -11.052 6.257   1.00 0.00 ? 70 LEU A HG   5 
ATOM 5809  H HD11 . LEU A 1 70 ? 2.727   -13.068 5.025   1.00 0.00 ? 70 LEU A HD11 5 
ATOM 5810  H HD12 . LEU A 1 70 ? 4.380   -13.400 4.508   1.00 0.00 ? 70 LEU A HD12 5 
ATOM 5811  H HD13 . LEU A 1 70 ? 3.988   -13.350 6.226   1.00 0.00 ? 70 LEU A HD13 5 
ATOM 5812  H HD21 . LEU A 1 70 ? 5.727   -10.403 4.384   1.00 0.00 ? 70 LEU A HD21 5 
ATOM 5813  H HD22 . LEU A 1 70 ? 6.002   -10.893 6.055   1.00 0.00 ? 70 LEU A HD22 5 
ATOM 5814  H HD23 . LEU A 1 70 ? 6.046   -12.094 4.765   1.00 0.00 ? 70 LEU A HD23 5 
ATOM 5815  N N    . GLY A 1 71 ? 1.901   -12.601 2.230   1.00 0.00 ? 71 GLY A N    5 
ATOM 5816  C CA   . GLY A 1 71 ? 1.360   -13.910 1.909   1.00 0.00 ? 71 GLY A CA   5 
ATOM 5817  C C    . GLY A 1 71 ? 1.968   -14.496 0.650   1.00 0.00 ? 71 GLY A C    5 
ATOM 5818  O O    . GLY A 1 71 ? 2.505   -15.605 0.669   1.00 0.00 ? 71 GLY A O    5 
ATOM 5819  H H    . GLY A 1 71 ? 1.300   -11.825 2.303   1.00 0.00 ? 71 GLY A H    5 
ATOM 5820  H HA2  . GLY A 1 71 ? 1.552   -14.580 2.736   1.00 0.00 ? 71 GLY A HA2  5 
ATOM 5821  H HA3  . GLY A 1 71 ? 0.292   -13.823 1.773   1.00 0.00 ? 71 GLY A HA3  5 
ATOM 5822  N N    . LEU A 1 72 ? 1.886   -13.754 -0.451  1.00 0.00 ? 72 LEU A N    5 
ATOM 5823  C CA   . LEU A 1 72 ? 2.420   -14.220 -1.723  1.00 0.00 ? 72 LEU A CA   5 
ATOM 5824  C C    . LEU A 1 72 ? 3.940   -14.294 -1.695  1.00 0.00 ? 72 LEU A C    5 
ATOM 5825  O O    . LEU A 1 72 ? 4.543   -15.118 -2.383  1.00 0.00 ? 72 LEU A O    5 
ATOM 5826  C CB   . LEU A 1 72 ? 1.949   -13.329 -2.871  1.00 0.00 ? 72 LEU A CB   5 
ATOM 5827  C CG   . LEU A 1 72 ? 2.302   -11.849 -2.750  1.00 0.00 ? 72 LEU A CG   5 
ATOM 5828  C CD1  . LEU A 1 72 ? 3.781   -11.617 -3.021  1.00 0.00 ? 72 LEU A CD1  5 
ATOM 5829  C CD2  . LEU A 1 72 ? 1.442   -11.022 -3.696  1.00 0.00 ? 72 LEU A CD2  5 
ATOM 5830  H H    . LEU A 1 72 ? 1.453   -12.878 -0.405  1.00 0.00 ? 72 LEU A H    5 
ATOM 5831  H HA   . LEU A 1 72 ? 2.030   -15.212 -1.884  1.00 0.00 ? 72 LEU A HA   5 
ATOM 5832  H HB2  . LEU A 1 72 ? 2.385   -13.704 -3.784  1.00 0.00 ? 72 LEU A HB2  5 
ATOM 5833  H HB3  . LEU A 1 72 ? 0.875   -13.415 -2.944  1.00 0.00 ? 72 LEU A HB3  5 
ATOM 5834  H HG   . LEU A 1 72 ? 2.099   -11.528 -1.744  1.00 0.00 ? 72 LEU A HG   5 
ATOM 5835  H HD11 . LEU A 1 72 ? 4.183   -12.454 -3.572  1.00 0.00 ? 72 LEU A HD11 5 
ATOM 5836  H HD12 . LEU A 1 72 ? 3.904   -10.713 -3.599  1.00 0.00 ? 72 LEU A HD12 5 
ATOM 5837  H HD13 . LEU A 1 72 ? 4.307   -11.517 -2.084  1.00 0.00 ? 72 LEU A HD13 5 
ATOM 5838  H HD21 . LEU A 1 72 ? 1.255   -11.585 -4.599  1.00 0.00 ? 72 LEU A HD21 5 
ATOM 5839  H HD22 . LEU A 1 72 ? 0.503   -10.789 -3.218  1.00 0.00 ? 72 LEU A HD22 5 
ATOM 5840  H HD23 . LEU A 1 72 ? 1.957   -10.106 -3.944  1.00 0.00 ? 72 LEU A HD23 5 
ATOM 5841  N N    . TYR A 1 73 ? 4.559   -13.452 -0.874  1.00 0.00 ? 73 TYR A N    5 
ATOM 5842  C CA   . TYR A 1 73 ? 6.011   -13.441 -0.751  1.00 0.00 ? 73 TYR A CA   5 
ATOM 5843  C C    . TYR A 1 73 ? 6.512   -14.848 -0.457  1.00 0.00 ? 73 TYR A C    5 
ATOM 5844  O O    . TYR A 1 73 ? 7.465   -15.325 -1.065  1.00 0.00 ? 73 TYR A O    5 
ATOM 5845  C CB   . TYR A 1 73 ? 6.449   -12.485 0.363   1.00 0.00 ? 73 TYR A CB   5 
ATOM 5846  C CG   . TYR A 1 73 ? 7.948   -12.379 0.514   1.00 0.00 ? 73 TYR A CG   5 
ATOM 5847  C CD1  . TYR A 1 73 ? 8.707   -11.631 -0.379  1.00 0.00 ? 73 TYR A CD1  5 
ATOM 5848  C CD2  . TYR A 1 73 ? 8.606   -13.050 1.535   1.00 0.00 ? 73 TYR A CD2  5 
ATOM 5849  C CE1  . TYR A 1 73 ? 10.082  -11.554 -0.255  1.00 0.00 ? 73 TYR A CE1  5 
ATOM 5850  C CE2  . TYR A 1 73 ? 9.981   -12.974 1.669   1.00 0.00 ? 73 TYR A CE2  5 
ATOM 5851  C CZ   . TYR A 1 73 ? 10.714  -12.226 0.771   1.00 0.00 ? 73 TYR A CZ   5 
ATOM 5852  O OH   . TYR A 1 73 ? 12.083  -12.152 0.898   1.00 0.00 ? 73 TYR A OH   5 
ATOM 5853  H H    . TYR A 1 73 ? 4.027   -12.833 -0.333  1.00 0.00 ? 73 TYR A H    5 
ATOM 5854  H HA   . TYR A 1 73 ? 6.425   -13.110 -1.696  1.00 0.00 ? 73 TYR A HA   5 
ATOM 5855  H HB2  . TYR A 1 73 ? 6.069   -11.498 0.151   1.00 0.00 ? 73 TYR A HB2  5 
ATOM 5856  H HB3  . TYR A 1 73 ? 6.042   -12.828 1.303   1.00 0.00 ? 73 TYR A HB3  5 
ATOM 5857  H HD1  . TYR A 1 73 ? 8.207   -11.101 -1.178  1.00 0.00 ? 73 TYR A HD1  5 
ATOM 5858  H HD2  . TYR A 1 73 ? 8.026   -13.635 2.235   1.00 0.00 ? 73 TYR A HD2  5 
ATOM 5859  H HE1  . TYR A 1 73 ? 10.658  -10.968 -0.958  1.00 0.00 ? 73 TYR A HE1  5 
ATOM 5860  H HE2  . TYR A 1 73 ? 10.478  -13.501 2.472   1.00 0.00 ? 73 TYR A HE2  5 
ATOM 5861  H HH   . TYR A 1 73 ? 12.386  -11.286 0.615   1.00 0.00 ? 73 TYR A HH   5 
ATOM 5862  N N    . VAL A 1 74 ? 5.839   -15.509 0.476   1.00 0.00 ? 74 VAL A N    5 
ATOM 5863  C CA   . VAL A 1 74 ? 6.183   -16.873 0.856   1.00 0.00 ? 74 VAL A CA   5 
ATOM 5864  C C    . VAL A 1 74 ? 5.365   -17.876 0.049   1.00 0.00 ? 74 VAL A C    5 
ATOM 5865  O O    . VAL A 1 74 ? 5.790   -19.005 -0.187  1.00 0.00 ? 74 VAL A O    5 
ATOM 5866  C CB   . VAL A 1 74 ? 5.937   -17.113 2.361   1.00 0.00 ? 74 VAL A CB   5 
ATOM 5867  C CG1  . VAL A 1 74 ? 4.465   -16.927 2.701   1.00 0.00 ? 74 VAL A CG1  5 
ATOM 5868  C CG2  . VAL A 1 74 ? 6.418   -18.497 2.773   1.00 0.00 ? 74 VAL A CG2  5 
ATOM 5869  H H    . VAL A 1 74 ? 5.080   -15.071 0.912   1.00 0.00 ? 74 VAL A H    5 
ATOM 5870  H HA   . VAL A 1 74 ? 7.233   -17.029 0.649   1.00 0.00 ? 74 VAL A HA   5 
ATOM 5871  H HB   . VAL A 1 74 ? 6.504   -16.379 2.916   1.00 0.00 ? 74 VAL A HB   5 
ATOM 5872  H HG11 . VAL A 1 74 ? 4.154   -15.930 2.431   1.00 0.00 ? 74 VAL A HG11 5 
ATOM 5873  H HG12 . VAL A 1 74 ? 3.876   -17.649 2.154   1.00 0.00 ? 74 VAL A HG12 5 
ATOM 5874  H HG13 . VAL A 1 74 ? 4.319   -17.076 3.761   1.00 0.00 ? 74 VAL A HG13 5 
ATOM 5875  H HG21 . VAL A 1 74 ? 6.978   -18.940 1.965   1.00 0.00 ? 74 VAL A HG21 5 
ATOM 5876  H HG22 . VAL A 1 74 ? 7.050   -18.413 3.645   1.00 0.00 ? 74 VAL A HG22 5 
ATOM 5877  H HG23 . VAL A 1 74 ? 5.567   -19.120 3.006   1.00 0.00 ? 74 VAL A HG23 5 
ATOM 5878  N N    . MET A 1 75 ? 4.169   -17.463 -0.348  1.00 0.00 ? 75 MET A N    5 
ATOM 5879  C CA   . MET A 1 75 ? 3.277   -18.328 -1.098  1.00 0.00 ? 75 MET A CA   5 
ATOM 5880  C C    . MET A 1 75 ? 3.607   -18.348 -2.592  1.00 0.00 ? 75 MET A C    5 
ATOM 5881  O O    . MET A 1 75 ? 4.070   -19.355 -3.118  1.00 0.00 ? 75 MET A O    5 
ATOM 5882  C CB   . MET A 1 75 ? 1.831   -17.885 -0.871  1.00 0.00 ? 75 MET A CB   5 
ATOM 5883  C CG   . MET A 1 75 ? 1.339   -18.152 0.543   1.00 0.00 ? 75 MET A CG   5 
ATOM 5884  S SD   . MET A 1 75 ? 1.138   -19.910 0.889   1.00 0.00 ? 75 MET A SD   5 
ATOM 5885  C CE   . MET A 1 75 ? 0.521   -19.857 2.571   1.00 0.00 ? 75 MET A CE   5 
ATOM 5886  H H    . MET A 1 75 ? 3.871   -16.562 -0.117  1.00 0.00 ? 75 MET A H    5 
ATOM 5887  H HA   . MET A 1 75 ? 3.393   -19.325 -0.708  1.00 0.00 ? 75 MET A HA   5 
ATOM 5888  H HB2  . MET A 1 75 ? 1.753   -16.826 -1.059  1.00 0.00 ? 75 MET A HB2  5 
ATOM 5889  H HB3  . MET A 1 75 ? 1.188   -18.409 -1.560  1.00 0.00 ? 75 MET A HB3  5 
ATOM 5890  H HG2  . MET A 1 75 ? 2.059   -17.747 1.240   1.00 0.00 ? 75 MET A HG2  5 
ATOM 5891  H HG3  . MET A 1 75 ? 0.393   -17.658 0.682   1.00 0.00 ? 75 MET A HG3  5 
ATOM 5892  H HE1  . MET A 1 75 ? -0.181  -19.042 2.672   1.00 0.00 ? 75 MET A HE1  5 
ATOM 5893  H HE2  . MET A 1 75 ? 0.026   -20.788 2.803   1.00 0.00 ? 75 MET A HE2  5 
ATOM 5894  H HE3  . MET A 1 75 ? 1.345   -19.707 3.253   1.00 0.00 ? 75 MET A HE3  5 
ATOM 5895  N N    . PHE A 1 76 ? 3.350   -17.245 -3.278  1.00 0.00 ? 76 PHE A N    5 
ATOM 5896  C CA   . PHE A 1 76 ? 3.602   -17.171 -4.716  1.00 0.00 ? 76 PHE A CA   5 
ATOM 5897  C C    . PHE A 1 76 ? 5.073   -17.376 -5.073  1.00 0.00 ? 76 PHE A C    5 
ATOM 5898  O O    . PHE A 1 76 ? 5.382   -17.852 -6.166  1.00 0.00 ? 76 PHE A O    5 
ATOM 5899  C CB   . PHE A 1 76 ? 3.116   -15.832 -5.279  1.00 0.00 ? 76 PHE A CB   5 
ATOM 5900  C CG   . PHE A 1 76 ? 1.624   -15.747 -5.440  1.00 0.00 ? 76 PHE A CG   5 
ATOM 5901  C CD1  . PHE A 1 76 ? 0.784   -15.917 -4.354  1.00 0.00 ? 76 PHE A CD1  5 
ATOM 5902  C CD2  . PHE A 1 76 ? 1.062   -15.510 -6.682  1.00 0.00 ? 76 PHE A CD2  5 
ATOM 5903  C CE1  . PHE A 1 76 ? -0.585  -15.852 -4.501  1.00 0.00 ? 76 PHE A CE1  5 
ATOM 5904  C CE2  . PHE A 1 76 ? -0.308  -15.443 -6.836  1.00 0.00 ? 76 PHE A CE2  5 
ATOM 5905  C CZ   . PHE A 1 76 ? -1.131  -15.614 -5.744  1.00 0.00 ? 76 PHE A CZ   5 
ATOM 5906  H H    . PHE A 1 76 ? 2.963   -16.473 -2.819  1.00 0.00 ? 76 PHE A H    5 
ATOM 5907  H HA   . PHE A 1 76 ? 3.032   -17.964 -5.179  1.00 0.00 ? 76 PHE A HA   5 
ATOM 5908  H HB2  . PHE A 1 76 ? 3.425   -15.040 -4.615  1.00 0.00 ? 76 PHE A HB2  5 
ATOM 5909  H HB3  . PHE A 1 76 ? 3.566   -15.677 -6.248  1.00 0.00 ? 76 PHE A HB3  5 
ATOM 5910  H HD1  . PHE A 1 76 ? 1.210   -16.101 -3.380  1.00 0.00 ? 76 PHE A HD1  5 
ATOM 5911  H HD2  . PHE A 1 76 ? 1.707   -15.376 -7.538  1.00 0.00 ? 76 PHE A HD2  5 
ATOM 5912  H HE1  . PHE A 1 76 ? -1.226  -15.985 -3.643  1.00 0.00 ? 76 PHE A HE1  5 
ATOM 5913  H HE2  . PHE A 1 76 ? -0.736  -15.256 -7.810  1.00 0.00 ? 76 PHE A HE2  5 
ATOM 5914  H HZ   . PHE A 1 76 ? -2.204  -15.563 -5.862  1.00 0.00 ? 76 PHE A HZ   5 
ATOM 5915  N N    . ALA A 1 77 ? 5.983   -17.021 -4.171  1.00 0.00 ? 77 ALA A N    5 
ATOM 5916  C CA   . ALA A 1 77 ? 7.404   -17.175 -4.446  1.00 0.00 ? 77 ALA A CA   5 
ATOM 5917  C C    . ALA A 1 77 ? 7.967   -18.438 -3.819  1.00 0.00 ? 77 ALA A C    5 
ATOM 5918  O O    . ALA A 1 77 ? 8.514   -19.299 -4.508  1.00 0.00 ? 77 ALA A O    5 
ATOM 5919  C CB   . ALA A 1 77 ? 8.176   -15.956 -3.970  1.00 0.00 ? 77 ALA A CB   5 
ATOM 5920  H H    . ALA A 1 77 ? 5.699   -16.643 -3.316  1.00 0.00 ? 77 ALA A H    5 
ATOM 5921  H HA   . ALA A 1 77 ? 7.521   -17.242 -5.507  1.00 0.00 ? 77 ALA A HA   5 
ATOM 5922  H HB1  . ALA A 1 77 ? 7.702   -15.061 -4.343  1.00 0.00 ? 77 ALA A HB1  5 
ATOM 5923  H HB2  . ALA A 1 77 ? 8.188   -15.937 -2.894  1.00 0.00 ? 77 ALA A HB2  5 
ATOM 5924  H HB3  . ALA A 1 77 ? 9.190   -16.007 -4.338  1.00 0.00 ? 77 ALA A HB3  5 
ATOM 5925  N N    . VAL A 1 78 ? 7.846   -18.532 -2.509  1.00 0.00 ? 78 VAL A N    5 
ATOM 5926  C CA   . VAL A 1 78 ? 8.356   -19.682 -1.777  1.00 0.00 ? 78 VAL A CA   5 
ATOM 5927  C C    . VAL A 1 78 ? 7.367   -20.850 -1.780  1.00 0.00 ? 78 VAL A C    5 
ATOM 5928  O O    . VAL A 1 78 ? 7.666   -21.918 -1.243  1.00 0.00 ? 78 VAL A O    5 
ATOM 5929  C CB   . VAL A 1 78 ? 8.713   -19.306 -0.321  1.00 0.00 ? 78 VAL A CB   5 
ATOM 5930  C CG1  . VAL A 1 78 ? 9.302   -20.499 0.420   1.00 0.00 ? 78 VAL A CG1  5 
ATOM 5931  C CG2  . VAL A 1 78 ? 9.675   -18.128 -0.296  1.00 0.00 ? 78 VAL A CG2  5 
ATOM 5932  H H    . VAL A 1 78 ? 7.414   -17.808 -2.023  1.00 0.00 ? 78 VAL A H    5 
ATOM 5933  H HA   . VAL A 1 78 ? 9.262   -19.998 -2.267  1.00 0.00 ? 78 VAL A HA   5 
ATOM 5934  H HB   . VAL A 1 78 ? 7.811   -19.011 0.187   1.00 0.00 ? 78 VAL A HB   5 
ATOM 5935  H HG11 . VAL A 1 78 ? 10.014  -21.001 -0.217  1.00 0.00 ? 78 VAL A HG11 5 
ATOM 5936  H HG12 . VAL A 1 78 ? 9.799   -20.154 1.315   1.00 0.00 ? 78 VAL A HG12 5 
ATOM 5937  H HG13 . VAL A 1 78 ? 8.512   -21.183 0.688   1.00 0.00 ? 78 VAL A HG13 5 
ATOM 5938  H HG21 . VAL A 1 78 ? 10.148  -18.028 -1.261  1.00 0.00 ? 78 VAL A HG21 5 
ATOM 5939  H HG22 . VAL A 1 78 ? 9.129   -17.224 -0.068  1.00 0.00 ? 78 VAL A HG22 5 
ATOM 5940  H HG23 . VAL A 1 78 ? 10.429  -18.293 0.459   1.00 0.00 ? 78 VAL A HG23 5 
ATOM 5941  N N    . ALA A 1 79 ? 6.192   -20.660 -2.386  1.00 0.00 ? 79 ALA A N    5 
ATOM 5942  C CA   . ALA A 1 79 ? 5.195   -21.729 -2.441  1.00 0.00 ? 79 ALA A CA   5 
ATOM 5943  C C    . ALA A 1 79 ? 4.708   -22.099 -1.044  1.00 0.00 ? 79 ALA A C    5 
ATOM 5944  O O    . ALA A 1 79 ? 3.515   -22.306 -0.826  1.00 0.00 ? 79 ALA A O    5 
ATOM 5945  C CB   . ALA A 1 79 ? 5.772   -22.951 -3.141  1.00 0.00 ? 79 ALA A CB   5 
ATOM 5946  H H    . ALA A 1 79 ? 5.991   -19.793 -2.805  1.00 0.00 ? 79 ALA A H    5 
ATOM 5947  H HA   . ALA A 1 79 ? 4.354   -21.380 -3.020  1.00 0.00 ? 79 ALA A HA   5 
ATOM 5948  H HB1  . ALA A 1 79 ? 6.252   -22.647 -4.060  1.00 0.00 ? 79 ALA A HB1  5 
ATOM 5949  H HB2  . ALA A 1 79 ? 6.495   -23.427 -2.498  1.00 0.00 ? 79 ALA A HB2  5 
ATOM 5950  H HB3  . ALA A 1 79 ? 4.976   -23.647 -3.365  1.00 0.00 ? 79 ALA A HB3  5 
ATOM 5951  N N    . MET A 1 1  ? -5.088  -29.935 0.424   1.00 0.00 ? 1  MET A N    6 
ATOM 5952  C CA   . MET A 1 1  ? -5.555  -28.591 0.865   1.00 0.00 ? 1  MET A CA   6 
ATOM 5953  C C    . MET A 1 1  ? -4.585  -27.492 0.437   1.00 0.00 ? 1  MET A C    6 
ATOM 5954  O O    . MET A 1 1  ? -4.833  -26.312 0.674   1.00 0.00 ? 1  MET A O    6 
ATOM 5955  C CB   . MET A 1 1  ? -5.701  -28.587 2.392   1.00 0.00 ? 1  MET A CB   6 
ATOM 5956  C CG   . MET A 1 1  ? -7.062  -29.047 2.915   1.00 0.00 ? 1  MET A CG   6 
ATOM 5957  S SD   . MET A 1 1  ? -7.415  -30.793 2.618   1.00 0.00 ? 1  MET A SD   6 
ATOM 5958  C CE   . MET A 1 1  ? -8.168  -30.722 0.994   1.00 0.00 ? 1  MET A CE   6 
ATOM 5959  H H1   . MET A 1 1  ? -4.135  -30.082 0.810   1.00 0.00 ? 1  MET A H1   6 
ATOM 5960  H H2   . MET A 1 1  ? -5.749  -30.642 0.792   1.00 0.00 ? 1  MET A H2   6 
ATOM 5961  H H3   . MET A 1 1  ? -5.074  -29.941 -0.616  1.00 0.00 ? 1  MET A H3   6 
ATOM 5962  H HA   . MET A 1 1  ? -6.517  -28.396 0.417   1.00 0.00 ? 1  MET A HA   6 
ATOM 5963  H HB2  . MET A 1 1  ? -4.947  -29.237 2.811   1.00 0.00 ? 1  MET A HB2  6 
ATOM 5964  H HB3  . MET A 1 1  ? -5.528  -27.582 2.750   1.00 0.00 ? 1  MET A HB3  6 
ATOM 5965  H HG2  . MET A 1 1  ? -7.099  -28.870 3.978   1.00 0.00 ? 1  MET A HG2  6 
ATOM 5966  H HG3  . MET A 1 1  ? -7.828  -28.455 2.431   1.00 0.00 ? 1  MET A HG3  6 
ATOM 5967  H HE1  . MET A 1 1  ? -8.527  -29.724 0.811   1.00 0.00 ? 1  MET A HE1  6 
ATOM 5968  H HE2  . MET A 1 1  ? -7.440  -30.987 0.244   1.00 0.00 ? 1  MET A HE2  6 
ATOM 5969  H HE3  . MET A 1 1  ? -8.997  -31.414 0.950   1.00 0.00 ? 1  MET A HE3  6 
ATOM 5970  N N    . GLU A 1 2  ? -3.482  -27.886 -0.194  1.00 0.00 ? 2  GLU A N    6 
ATOM 5971  C CA   . GLU A 1 2  ? -2.476  -26.933 -0.649  1.00 0.00 ? 2  GLU A CA   6 
ATOM 5972  C C    . GLU A 1 2  ? -3.027  -26.037 -1.757  1.00 0.00 ? 2  GLU A C    6 
ATOM 5973  O O    . GLU A 1 2  ? -2.963  -24.808 -1.676  1.00 0.00 ? 2  GLU A O    6 
ATOM 5974  C CB   . GLU A 1 2  ? -1.235  -27.675 -1.144  1.00 0.00 ? 2  GLU A CB   6 
ATOM 5975  C CG   . GLU A 1 2  ? -0.575  -28.527 -0.072  1.00 0.00 ? 2  GLU A CG   6 
ATOM 5976  C CD   . GLU A 1 2  ? 0.634   -29.281 -0.590  1.00 0.00 ? 2  GLU A CD   6 
ATOM 5977  O OE1  . GLU A 1 2  ? 1.590   -28.624 -1.052  1.00 0.00 ? 2  GLU A OE1  6 
ATOM 5978  O OE2  . GLU A 1 2  ? 0.625   -30.529 -0.532  1.00 0.00 ? 2  GLU A OE2  6 
ATOM 5979  H H    . GLU A 1 2  ? -3.340  -28.839 -0.358  1.00 0.00 ? 2  GLU A H    6 
ATOM 5980  H HA   . GLU A 1 2  ? -2.198  -26.320 0.195   1.00 0.00 ? 2  GLU A HA   6 
ATOM 5981  H HB2  . GLU A 1 2  ? -1.518  -28.319 -1.964  1.00 0.00 ? 2  GLU A HB2  6 
ATOM 5982  H HB3  . GLU A 1 2  ? -0.513  -26.953 -1.494  1.00 0.00 ? 2  GLU A HB3  6 
ATOM 5983  H HG2  . GLU A 1 2  ? -0.259  -27.885 0.736   1.00 0.00 ? 2  GLU A HG2  6 
ATOM 5984  H HG3  . GLU A 1 2  ? -1.296  -29.242 0.298   1.00 0.00 ? 2  GLU A HG3  6 
ATOM 5985  N N    . ASN A 1 3  ? -3.562  -26.661 -2.797  1.00 0.00 ? 3  ASN A N    6 
ATOM 5986  C CA   . ASN A 1 3  ? -4.118  -25.919 -3.917  1.00 0.00 ? 3  ASN A CA   6 
ATOM 5987  C C    . ASN A 1 3  ? -5.301  -25.072 -3.470  1.00 0.00 ? 3  ASN A C    6 
ATOM 5988  O O    . ASN A 1 3  ? -5.546  -24.001 -4.017  1.00 0.00 ? 3  ASN A O    6 
ATOM 5989  C CB   . ASN A 1 3  ? -4.557  -26.872 -5.030  1.00 0.00 ? 3  ASN A CB   6 
ATOM 5990  C CG   . ASN A 1 3  ? -3.415  -27.722 -5.555  1.00 0.00 ? 3  ASN A CG   6 
ATOM 5991  O OD1  . ASN A 1 3  ? -2.406  -27.201 -6.030  1.00 0.00 ? 3  ASN A OD1  6 
ATOM 5992  N ND2  . ASN A 1 3  ? -3.571  -29.039 -5.475  1.00 0.00 ? 3  ASN A ND2  6 
ATOM 5993  H H    . ASN A 1 3  ? -3.582  -27.640 -2.811  1.00 0.00 ? 3  ASN A H    6 
ATOM 5994  H HA   . ASN A 1 3  ? -3.347  -25.266 -4.297  1.00 0.00 ? 3  ASN A HA   6 
ATOM 5995  H HB2  . ASN A 1 3  ? -5.325  -27.530 -4.648  1.00 0.00 ? 3  ASN A HB2  6 
ATOM 5996  H HB3  . ASN A 1 3  ? -4.959  -26.296 -5.849  1.00 0.00 ? 3  ASN A HB3  6 
ATOM 5997  H HD21 . ASN A 1 3  ? -4.402  -29.385 -5.089  1.00 0.00 ? 3  ASN A HD21 6 
ATOM 5998  H HD22 . ASN A 1 3  ? -2.847  -29.611 -5.809  1.00 0.00 ? 3  ASN A HD22 6 
ATOM 5999  N N    . LEU A 1 4  ? -6.034  -25.558 -2.471  1.00 0.00 ? 4  LEU A N    6 
ATOM 6000  C CA   . LEU A 1 4  ? -7.193  -24.839 -1.955  1.00 0.00 ? 4  LEU A CA   6 
ATOM 6001  C C    . LEU A 1 4  ? -6.774  -23.618 -1.150  1.00 0.00 ? 4  LEU A C    6 
ATOM 6002  O O    . LEU A 1 4  ? -7.259  -22.519 -1.399  1.00 0.00 ? 4  LEU A O    6 
ATOM 6003  C CB   . LEU A 1 4  ? -8.065  -25.766 -1.108  1.00 0.00 ? 4  LEU A CB   6 
ATOM 6004  C CG   . LEU A 1 4  ? -8.610  -26.988 -1.850  1.00 0.00 ? 4  LEU A CG   6 
ATOM 6005  C CD1  . LEU A 1 4  ? -9.504  -27.813 -0.940  1.00 0.00 ? 4  LEU A CD1  6 
ATOM 6006  C CD2  . LEU A 1 4  ? -9.367  -26.560 -3.098  1.00 0.00 ? 4  LEU A CD2  6 
ATOM 6007  H H    . LEU A 1 4  ? -5.788  -26.419 -2.073  1.00 0.00 ? 4  LEU A H    6 
ATOM 6008  H HA   . LEU A 1 4  ? -7.768  -24.494 -2.799  1.00 0.00 ? 4  LEU A HA   6 
ATOM 6009  H HB2  . LEU A 1 4  ? -7.480  -26.108 -0.267  1.00 0.00 ? 4  LEU A HB2  6 
ATOM 6010  H HB3  . LEU A 1 4  ? -8.903  -25.197 -0.735  1.00 0.00 ? 4  LEU A HB3  6 
ATOM 6011  H HG   . LEU A 1 4  ? -7.781  -27.611 -2.159  1.00 0.00 ? 4  LEU A HG   6 
ATOM 6012  H HD11 . LEU A 1 4  ? -10.075 -27.155 -0.303  1.00 0.00 ? 4  LEU A HD11 6 
ATOM 6013  H HD12 . LEU A 1 4  ? -10.176 -28.408 -1.539  1.00 0.00 ? 4  LEU A HD12 6 
ATOM 6014  H HD13 . LEU A 1 4  ? -8.893  -28.461 -0.332  1.00 0.00 ? 4  LEU A HD13 6 
ATOM 6015  H HD21 . LEU A 1 4  ? -10.000 -25.718 -2.862  1.00 0.00 ? 4  LEU A HD21 6 
ATOM 6016  H HD22 . LEU A 1 4  ? -8.662  -26.276 -3.866  1.00 0.00 ? 4  LEU A HD22 6 
ATOM 6017  H HD23 . LEU A 1 4  ? -9.973  -27.380 -3.450  1.00 0.00 ? 4  LEU A HD23 6 
ATOM 6018  N N    . ASN A 1 5  ? -5.868  -23.796 -0.196  1.00 0.00 ? 5  ASN A N    6 
ATOM 6019  C CA   . ASN A 1 5  ? -5.414  -22.660 0.597   1.00 0.00 ? 5  ASN A CA   6 
ATOM 6020  C C    . ASN A 1 5  ? -4.573  -21.729 -0.274  1.00 0.00 ? 5  ASN A C    6 
ATOM 6021  O O    . ASN A 1 5  ? -4.361  -20.566 0.069   1.00 0.00 ? 5  ASN A O    6 
ATOM 6022  C CB   . ASN A 1 5  ? -4.617  -23.112 1.827   1.00 0.00 ? 5  ASN A CB   6 
ATOM 6023  C CG   . ASN A 1 5  ? -3.245  -23.648 1.475   1.00 0.00 ? 5  ASN A CG   6 
ATOM 6024  O OD1  . ASN A 1 5  ? -3.115  -24.569 0.677   1.00 0.00 ? 5  ASN A OD1  6 
ATOM 6025  N ND2  . ASN A 1 5  ? -2.211  -23.068 2.074   1.00 0.00 ? 5  ASN A ND2  6 
ATOM 6026  H H    . ASN A 1 5  ? -5.499  -24.690 -0.031  1.00 0.00 ? 5  ASN A H    6 
ATOM 6027  H HA   . ASN A 1 5  ? -6.291  -22.121 0.923   1.00 0.00 ? 5  ASN A HA   6 
ATOM 6028  H HB2  . ASN A 1 5  ? -4.490  -22.273 2.494   1.00 0.00 ? 5  ASN A HB2  6 
ATOM 6029  H HB3  . ASN A 1 5  ? -5.166  -23.890 2.338   1.00 0.00 ? 5  ASN A HB3  6 
ATOM 6030  H HD21 . ASN A 1 5  ? -2.392  -22.337 2.702   1.00 0.00 ? 5  ASN A HD21 6 
ATOM 6031  H HD22 . ASN A 1 5  ? -1.311  -23.393 1.865   1.00 0.00 ? 5  ASN A HD22 6 
ATOM 6032  N N    . MET A 1 6  ? -4.096  -22.249 -1.405  1.00 0.00 ? 6  MET A N    6 
ATOM 6033  C CA   . MET A 1 6  ? -3.290  -21.461 -2.326  1.00 0.00 ? 6  MET A CA   6 
ATOM 6034  C C    . MET A 1 6  ? -4.191  -20.682 -3.290  1.00 0.00 ? 6  MET A C    6 
ATOM 6035  O O    . MET A 1 6  ? -4.006  -19.477 -3.494  1.00 0.00 ? 6  MET A O    6 
ATOM 6036  C CB   . MET A 1 6  ? -2.337  -22.379 -3.095  1.00 0.00 ? 6  MET A CB   6 
ATOM 6037  C CG   . MET A 1 6  ? -1.239  -21.645 -3.849  1.00 0.00 ? 6  MET A CG   6 
ATOM 6038  S SD   . MET A 1 6  ? -0.278  -20.551 -2.784  1.00 0.00 ? 6  MET A SD   6 
ATOM 6039  C CE   . MET A 1 6  ? 0.963   -19.955 -3.930  1.00 0.00 ? 6  MET A CE   6 
ATOM 6040  H H    . MET A 1 6  ? -4.291  -23.188 -1.628  1.00 0.00 ? 6  MET A H    6 
ATOM 6041  H HA   . MET A 1 6  ? -2.715  -20.759 -1.743  1.00 0.00 ? 6  MET A HA   6 
ATOM 6042  H HB2  . MET A 1 6  ? -1.871  -23.055 -2.395  1.00 0.00 ? 6  MET A HB2  6 
ATOM 6043  H HB3  . MET A 1 6  ? -2.910  -22.955 -3.807  1.00 0.00 ? 6  MET A HB3  6 
ATOM 6044  H HG2  . MET A 1 6  ? -0.572  -22.375 -4.283  1.00 0.00 ? 6  MET A HG2  6 
ATOM 6045  H HG3  . MET A 1 6  ? -1.687  -21.061 -4.634  1.00 0.00 ? 6  MET A HG3  6 
ATOM 6046  H HE1  . MET A 1 6  ? 0.821   -20.424 -4.892  1.00 0.00 ? 6  MET A HE1  6 
ATOM 6047  H HE2  . MET A 1 6  ? 0.873   -18.883 -4.035  1.00 0.00 ? 6  MET A HE2  6 
ATOM 6048  H HE3  . MET A 1 6  ? 1.945   -20.197 -3.553  1.00 0.00 ? 6  MET A HE3  6 
ATOM 6049  N N    . ASP A 1 7  ? -5.182  -21.367 -3.866  1.00 0.00 ? 7  ASP A N    6 
ATOM 6050  C CA   . ASP A 1 7  ? -6.112  -20.728 -4.783  1.00 0.00 ? 7  ASP A CA   6 
ATOM 6051  C C    . ASP A 1 7  ? -7.060  -19.822 -4.011  1.00 0.00 ? 7  ASP A C    6 
ATOM 6052  O O    . ASP A 1 7  ? -7.359  -18.708 -4.446  1.00 0.00 ? 7  ASP A O    6 
ATOM 6053  C CB   . ASP A 1 7  ? -6.888  -21.766 -5.603  1.00 0.00 ? 7  ASP A CB   6 
ATOM 6054  C CG   . ASP A 1 7  ? -7.892  -22.559 -4.788  1.00 0.00 ? 7  ASP A CG   6 
ATOM 6055  O OD1  . ASP A 1 7  ? -8.793  -21.939 -4.186  1.00 0.00 ? 7  ASP A OD1  6 
ATOM 6056  O OD2  . ASP A 1 7  ? -7.793  -23.803 -4.775  1.00 0.00 ? 7  ASP A OD2  6 
ATOM 6057  H H    . ASP A 1 7  ? -5.293  -22.312 -3.660  1.00 0.00 ? 7  ASP A H    6 
ATOM 6058  H HA   . ASP A 1 7  ? -5.536  -20.115 -5.455  1.00 0.00 ? 7  ASP A HA   6 
ATOM 6059  H HB2  . ASP A 1 7  ? -7.420  -21.259 -6.387  1.00 0.00 ? 7  ASP A HB2  6 
ATOM 6060  H HB3  . ASP A 1 7  ? -6.185  -22.459 -6.046  1.00 0.00 ? 7  ASP A HB3  6 
ATOM 6061  N N    . LEU A 1 8  ? -7.514  -20.289 -2.848  1.00 0.00 ? 8  LEU A N    6 
ATOM 6062  C CA   . LEU A 1 8  ? -8.394  -19.498 -2.020  1.00 0.00 ? 8  LEU A CA   6 
ATOM 6063  C C    . LEU A 1 8  ? -7.677  -18.225 -1.592  1.00 0.00 ? 8  LEU A C    6 
ATOM 6064  O O    . LEU A 1 8  ? -8.295  -17.170 -1.442  1.00 0.00 ? 8  LEU A O    6 
ATOM 6065  C CB   . LEU A 1 8  ? -8.821  -20.302 -0.796  1.00 0.00 ? 8  LEU A CB   6 
ATOM 6066  C CG   . LEU A 1 8  ? -9.820  -21.432 -1.062  1.00 0.00 ? 8  LEU A CG   6 
ATOM 6067  C CD1  . LEU A 1 8  ? -10.135 -22.177 0.230   1.00 0.00 ? 8  LEU A CD1  6 
ATOM 6068  C CD2  . LEU A 1 8  ? -11.095 -20.880 -1.682  1.00 0.00 ? 8  LEU A CD2  6 
ATOM 6069  H H    . LEU A 1 8  ? -7.237  -21.175 -2.533  1.00 0.00 ? 8  LEU A H    6 
ATOM 6070  H HA   . LEU A 1 8  ? -9.265  -19.236 -2.603  1.00 0.00 ? 8  LEU A HA   6 
ATOM 6071  H HB2  . LEU A 1 8  ? -7.936  -20.731 -0.350  1.00 0.00 ? 8  LEU A HB2  6 
ATOM 6072  H HB3  . LEU A 1 8  ? -9.258  -19.626 -0.094  1.00 0.00 ? 8  LEU A HB3  6 
ATOM 6073  H HG   . LEU A 1 8  ? -9.386  -22.137 -1.756  1.00 0.00 ? 8  LEU A HG   6 
ATOM 6074  H HD11 . LEU A 1 8  ? -9.439  -21.873 0.999   1.00 0.00 ? 8  LEU A HD11 6 
ATOM 6075  H HD12 . LEU A 1 8  ? -11.141 -21.945 0.543   1.00 0.00 ? 8  LEU A HD12 6 
ATOM 6076  H HD13 . LEU A 1 8  ? -10.045 -23.240 0.063   1.00 0.00 ? 8  LEU A HD13 6 
ATOM 6077  H HD21 . LEU A 1 8  ? -11.528 -20.144 -1.019  1.00 0.00 ? 8  LEU A HD21 6 
ATOM 6078  H HD22 . LEU A 1 8  ? -10.864 -20.417 -2.630  1.00 0.00 ? 8  LEU A HD22 6 
ATOM 6079  H HD23 . LEU A 1 8  ? -11.800 -21.684 -1.835  1.00 0.00 ? 8  LEU A HD23 6 
ATOM 6080  N N    . LEU A 1 9  ? -6.360  -18.327 -1.414  1.00 0.00 ? 9  LEU A N    6 
ATOM 6081  C CA   . LEU A 1 9  ? -5.564  -17.175 -1.026  1.00 0.00 ? 9  LEU A CA   6 
ATOM 6082  C C    . LEU A 1 9  ? -5.486  -16.197 -2.190  1.00 0.00 ? 9  LEU A C    6 
ATOM 6083  O O    . LEU A 1 9  ? -5.762  -15.010 -2.025  1.00 0.00 ? 9  LEU A O    6 
ATOM 6084  C CB   . LEU A 1 9  ? -4.167  -17.596 -0.557  1.00 0.00 ? 9  LEU A CB   6 
ATOM 6085  C CG   . LEU A 1 9  ? -3.303  -16.458 -0.007  1.00 0.00 ? 9  LEU A CG   6 
ATOM 6086  C CD1  . LEU A 1 9  ? -2.143  -17.008 0.810   1.00 0.00 ? 9  LEU A CD1  6 
ATOM 6087  C CD2  . LEU A 1 9  ? -2.785  -15.585 -1.141  1.00 0.00 ? 9  LEU A CD2  6 
ATOM 6088  H H    . LEU A 1 9  ? -5.919  -19.189 -1.562  1.00 0.00 ? 9  LEU A H    6 
ATOM 6089  H HA   . LEU A 1 9  ? -6.074  -16.691 -0.206  1.00 0.00 ? 9  LEU A HA   6 
ATOM 6090  H HB2  . LEU A 1 9  ? -4.281  -18.339 0.220   1.00 0.00 ? 9  LEU A HB2  6 
ATOM 6091  H HB3  . LEU A 1 9  ? -3.647  -18.046 -1.387  1.00 0.00 ? 9  LEU A HB3  6 
ATOM 6092  H HG   . LEU A 1 9  ? -3.906  -15.839 0.642   1.00 0.00 ? 9  LEU A HG   6 
ATOM 6093  H HD11 . LEU A 1 9  ? -2.072  -18.075 0.664   1.00 0.00 ? 9  LEU A HD11 6 
ATOM 6094  H HD12 . LEU A 1 9  ? -1.225  -16.538 0.494   1.00 0.00 ? 9  LEU A HD12 6 
ATOM 6095  H HD13 . LEU A 1 9  ? -2.311  -16.799 1.857   1.00 0.00 ? 9  LEU A HD13 6 
ATOM 6096  H HD21 . LEU A 1 9  ? -2.549  -16.205 -1.993  1.00 0.00 ? 9  LEU A HD21 6 
ATOM 6097  H HD22 . LEU A 1 9  ? -3.541  -14.865 -1.415  1.00 0.00 ? 9  LEU A HD22 6 
ATOM 6098  H HD23 . LEU A 1 9  ? -1.894  -15.067 -0.817  1.00 0.00 ? 9  LEU A HD23 6 
ATOM 6099  N N    . TYR A 1 10 ? -5.161  -16.702 -3.388  1.00 0.00 ? 10 TYR A N    6 
ATOM 6100  C CA   . TYR A 1 10 ? -5.105  -15.842 -4.575  1.00 0.00 ? 10 TYR A CA   6 
ATOM 6101  C C    . TYR A 1 10 ? -6.369  -15.007 -4.643  1.00 0.00 ? 10 TYR A C    6 
ATOM 6102  O O    . TYR A 1 10 ? -6.332  -13.780 -4.736  1.00 0.00 ? 10 TYR A O    6 
ATOM 6103  C CB   . TYR A 1 10 ? -5.047  -16.662 -5.868  1.00 0.00 ? 10 TYR A CB   6 
ATOM 6104  C CG   . TYR A 1 10 ? -3.880  -17.605 -6.007  1.00 0.00 ? 10 TYR A CG   6 
ATOM 6105  C CD1  . TYR A 1 10 ? -2.820  -17.601 -5.114  1.00 0.00 ? 10 TYR A CD1  6 
ATOM 6106  C CD2  . TYR A 1 10 ? -3.853  -18.505 -7.056  1.00 0.00 ? 10 TYR A CD2  6 
ATOM 6107  C CE1  . TYR A 1 10 ? -1.764  -18.475 -5.267  1.00 0.00 ? 10 TYR A CE1  6 
ATOM 6108  C CE2  . TYR A 1 10 ? -2.803  -19.383 -7.217  1.00 0.00 ? 10 TYR A CE2  6 
ATOM 6109  C CZ   . TYR A 1 10 ? -1.762  -19.365 -6.321  1.00 0.00 ? 10 TYR A CZ   6 
ATOM 6110  O OH   . TYR A 1 10 ? -0.712  -20.238 -6.478  1.00 0.00 ? 10 TYR A OH   6 
ATOM 6111  H H    . TYR A 1 10 ? -4.985  -17.666 -3.477  1.00 0.00 ? 10 TYR A H    6 
ATOM 6112  H HA   . TYR A 1 10 ? -4.238  -15.195 -4.504  1.00 0.00 ? 10 TYR A HA   6 
ATOM 6113  H HB2  . TYR A 1 10 ? -5.945  -17.256 -5.939  1.00 0.00 ? 10 TYR A HB2  6 
ATOM 6114  H HB3  . TYR A 1 10 ? -5.019  -15.979 -6.704  1.00 0.00 ? 10 TYR A HB3  6 
ATOM 6115  H HD1  . TYR A 1 10 ? -2.824  -16.903 -4.293  1.00 0.00 ? 10 TYR A HD1  6 
ATOM 6116  H HD2  . TYR A 1 10 ? -4.681  -18.514 -7.754  1.00 0.00 ? 10 TYR A HD2  6 
ATOM 6117  H HE1  . TYR A 1 10 ? -0.947  -18.462 -4.563  1.00 0.00 ? 10 TYR A HE1  6 
ATOM 6118  H HE2  . TYR A 1 10 ? -2.803  -20.079 -8.043  1.00 0.00 ? 10 TYR A HE2  6 
ATOM 6119  H HH   . TYR A 1 10 ? 0.014   -19.790 -6.920  1.00 0.00 ? 10 TYR A HH   6 
ATOM 6120  N N    . MET A 1 11 ? -7.492  -15.714 -4.611  1.00 0.00 ? 11 MET A N    6 
ATOM 6121  C CA   . MET A 1 11 ? -8.801  -15.097 -4.679  1.00 0.00 ? 11 MET A CA   6 
ATOM 6122  C C    . MET A 1 11 ? -9.024  -14.210 -3.467  1.00 0.00 ? 11 MET A C    6 
ATOM 6123  O O    . MET A 1 11 ? -9.593  -13.124 -3.572  1.00 0.00 ? 11 MET A O    6 
ATOM 6124  C CB   . MET A 1 11 ? -9.869  -16.187 -4.751  1.00 0.00 ? 11 MET A CB   6 
ATOM 6125  C CG   . MET A 1 11 ? -11.236 -15.676 -5.177  1.00 0.00 ? 11 MET A CG   6 
ATOM 6126  S SD   . MET A 1 11 ? -12.471 -16.986 -5.272  1.00 0.00 ? 11 MET A SD   6 
ATOM 6127  C CE   . MET A 1 11 ? -11.738 -18.052 -6.511  1.00 0.00 ? 11 MET A CE   6 
ATOM 6128  H H    . MET A 1 11 ? -7.434  -16.692 -4.548  1.00 0.00 ? 11 MET A H    6 
ATOM 6129  H HA   . MET A 1 11 ? -8.843  -14.492 -5.574  1.00 0.00 ? 11 MET A HA   6 
ATOM 6130  H HB2  . MET A 1 11 ? -9.543  -16.942 -5.456  1.00 0.00 ? 11 MET A HB2  6 
ATOM 6131  H HB3  . MET A 1 11 ? -9.967  -16.640 -3.775  1.00 0.00 ? 11 MET A HB3  6 
ATOM 6132  H HG2  . MET A 1 11 ? -11.569 -14.940 -4.460  1.00 0.00 ? 11 MET A HG2  6 
ATOM 6133  H HG3  . MET A 1 11 ? -11.146 -15.215 -6.150  1.00 0.00 ? 11 MET A HG3  6 
ATOM 6134  H HE1  . MET A 1 11 ? -10.741 -18.329 -6.201  1.00 0.00 ? 11 MET A HE1  6 
ATOM 6135  H HE2  . MET A 1 11 ? -12.340 -18.942 -6.623  1.00 0.00 ? 11 MET A HE2  6 
ATOM 6136  H HE3  . MET A 1 11 ? -11.689 -17.527 -7.453  1.00 0.00 ? 11 MET A HE3  6 
ATOM 6137  N N    . ALA A 1 12 ? -8.552  -14.674 -2.316  1.00 0.00 ? 12 ALA A N    6 
ATOM 6138  C CA   . ALA A 1 12 ? -8.680  -13.912 -1.083  1.00 0.00 ? 12 ALA A CA   6 
ATOM 6139  C C    . ALA A 1 12 ? -7.960  -12.585 -1.219  1.00 0.00 ? 12 ALA A C    6 
ATOM 6140  O O    . ALA A 1 12 ? -8.394  -11.587 -0.665  1.00 0.00 ? 12 ALA A O    6 
ATOM 6141  C CB   . ALA A 1 12 ? -8.139  -14.702 0.097   1.00 0.00 ? 12 ALA A CB   6 
ATOM 6142  H H    . ALA A 1 12 ? -8.094  -15.541 -2.299  1.00 0.00 ? 12 ALA A H    6 
ATOM 6143  H HA   . ALA A 1 12 ? -9.732  -13.717 -0.914  1.00 0.00 ? 12 ALA A HA   6 
ATOM 6144  H HB1  . ALA A 1 12 ? -7.458  -15.458 -0.258  1.00 0.00 ? 12 ALA A HB1  6 
ATOM 6145  H HB2  . ALA A 1 12 ? -7.619  -14.036 0.769   1.00 0.00 ? 12 ALA A HB2  6 
ATOM 6146  H HB3  . ALA A 1 12 ? -8.957  -15.174 0.621   1.00 0.00 ? 12 ALA A HB3  6 
ATOM 6147  N N    . ALA A 1 13 ? -6.870  -12.579 -1.978  1.00 0.00 ? 13 ALA A N    6 
ATOM 6148  C CA   . ALA A 1 13 ? -6.106  -11.363 -2.205  1.00 0.00 ? 13 ALA A CA   6 
ATOM 6149  C C    . ALA A 1 13 ? -6.916  -10.388 -3.041  1.00 0.00 ? 13 ALA A C    6 
ATOM 6150  O O    . ALA A 1 13 ? -6.868  -9.180  -2.823  1.00 0.00 ? 13 ALA A O    6 
ATOM 6151  C CB   . ALA A 1 13 ? -4.790  -11.689 -2.892  1.00 0.00 ? 13 ALA A CB   6 
ATOM 6152  H H    . ALA A 1 13 ? -6.580  -13.406 -2.407  1.00 0.00 ? 13 ALA A H    6 
ATOM 6153  H HA   . ALA A 1 13 ? -5.894  -10.912 -1.244  1.00 0.00 ? 13 ALA A HA   6 
ATOM 6154  H HB1  . ALA A 1 13 ? -4.982  -12.299 -3.764  1.00 0.00 ? 13 ALA A HB1  6 
ATOM 6155  H HB2  . ALA A 1 13 ? -4.304  -10.772 -3.194  1.00 0.00 ? 13 ALA A HB2  6 
ATOM 6156  H HB3  . ALA A 1 13 ? -4.150  -12.229 -2.210  1.00 0.00 ? 13 ALA A HB3  6 
ATOM 6157  N N    . ALA A 1 14 ? -7.676  -10.927 -3.991  1.00 0.00 ? 14 ALA A N    6 
ATOM 6158  C CA   . ALA A 1 14 ? -8.517  -10.105 -4.847  1.00 0.00 ? 14 ALA A CA   6 
ATOM 6159  C C    . ALA A 1 14 ? -9.626  -9.477  -4.017  1.00 0.00 ? 14 ALA A C    6 
ATOM 6160  O O    . ALA A 1 14 ? -9.826  -8.263  -4.038  1.00 0.00 ? 14 ALA A O    6 
ATOM 6161  C CB   . ALA A 1 14 ? -9.100  -10.936 -5.982  1.00 0.00 ? 14 ALA A CB   6 
ATOM 6162  H H    . ALA A 1 14 ? -7.681  -11.899 -4.108  1.00 0.00 ? 14 ALA A H    6 
ATOM 6163  H HA   . ALA A 1 14 ? -7.905  -9.322  -5.274  1.00 0.00 ? 14 ALA A HA   6 
ATOM 6164  H HB1  . ALA A 1 14 ? -9.092  -11.980 -5.706  1.00 0.00 ? 14 ALA A HB1  6 
ATOM 6165  H HB2  . ALA A 1 14 ? -10.116 -10.621 -6.173  1.00 0.00 ? 14 ALA A HB2  6 
ATOM 6166  H HB3  . ALA A 1 14 ? -8.506  -10.794 -6.873  1.00 0.00 ? 14 ALA A HB3  6 
ATOM 6167  N N    . VAL A 1 15 ? -10.327 -10.319 -3.264  1.00 0.00 ? 15 VAL A N    6 
ATOM 6168  C CA   . VAL A 1 15 ? -11.402 -9.856  -2.398  1.00 0.00 ? 15 VAL A CA   6 
ATOM 6169  C C    . VAL A 1 15 ? -10.835 -8.927  -1.335  1.00 0.00 ? 15 VAL A C    6 
ATOM 6170  O O    . VAL A 1 15 ? -11.356 -7.843  -1.100  1.00 0.00 ? 15 VAL A O    6 
ATOM 6171  C CB   . VAL A 1 15 ? -12.124 -11.035 -1.718  1.00 0.00 ? 15 VAL A CB   6 
ATOM 6172  C CG1  . VAL A 1 15 ? -13.300 -10.541 -0.888  1.00 0.00 ? 15 VAL A CG1  6 
ATOM 6173  C CG2  . VAL A 1 15 ? -12.580 -12.047 -2.758  1.00 0.00 ? 15 VAL A CG2  6 
ATOM 6174  H H    . VAL A 1 15 ? -10.103 -11.272 -3.279  1.00 0.00 ? 15 VAL A H    6 
ATOM 6175  H HA   . VAL A 1 15 ? -12.117 -9.313  -3.004  1.00 0.00 ? 15 VAL A HA   6 
ATOM 6176  H HB   . VAL A 1 15 ? -11.426 -11.525 -1.055  1.00 0.00 ? 15 VAL A HB   6 
ATOM 6177  H HG11 . VAL A 1 15 ? -13.518 -9.515  -1.144  1.00 0.00 ? 15 VAL A HG11 6 
ATOM 6178  H HG12 . VAL A 1 15 ? -14.168 -11.153 -1.090  1.00 0.00 ? 15 VAL A HG12 6 
ATOM 6179  H HG13 . VAL A 1 15 ? -13.053 -10.605 0.161   1.00 0.00 ? 15 VAL A HG13 6 
ATOM 6180  H HG21 . VAL A 1 15 ? -11.729 -12.372 -3.341  1.00 0.00 ? 15 VAL A HG21 6 
ATOM 6181  H HG22 . VAL A 1 15 ? -13.022 -12.898 -2.263  1.00 0.00 ? 15 VAL A HG22 6 
ATOM 6182  H HG23 . VAL A 1 15 ? -13.308 -11.590 -3.410  1.00 0.00 ? 15 VAL A HG23 6 
ATOM 6183  N N    . MET A 1 16 ? -9.743  -9.360  -0.715  1.00 0.00 ? 16 MET A N    6 
ATOM 6184  C CA   . MET A 1 16 ? -9.072  -8.565  0.312   1.00 0.00 ? 16 MET A CA   6 
ATOM 6185  C C    . MET A 1 16 ? -8.629  -7.222  -0.247  1.00 0.00 ? 16 MET A C    6 
ATOM 6186  O O    . MET A 1 16 ? -8.826  -6.179  0.376   1.00 0.00 ? 16 MET A O    6 
ATOM 6187  C CB   . MET A 1 16 ? -7.861  -9.321  0.878   1.00 0.00 ? 16 MET A CB   6 
ATOM 6188  C CG   . MET A 1 16 ? -8.158  -10.070 2.167   1.00 0.00 ? 16 MET A CG   6 
ATOM 6189  S SD   . MET A 1 16 ? -9.512  -11.249 1.995   1.00 0.00 ? 16 MET A SD   6 
ATOM 6190  C CE   . MET A 1 16 ? -9.634  -11.872 3.670   1.00 0.00 ? 16 MET A CE   6 
ATOM 6191  H H    . MET A 1 16 ? -9.373  -10.232 -0.964  1.00 0.00 ? 16 MET A H    6 
ATOM 6192  H HA   . MET A 1 16 ? -9.779  -8.388  1.103   1.00 0.00 ? 16 MET A HA   6 
ATOM 6193  H HB2  . MET A 1 16 ? -7.521  -10.032 0.145   1.00 0.00 ? 16 MET A HB2  6 
ATOM 6194  H HB3  . MET A 1 16 ? -7.064  -8.620  1.066   1.00 0.00 ? 16 MET A HB3  6 
ATOM 6195  H HG2  . MET A 1 16 ? -7.270  -10.606 2.468   1.00 0.00 ? 16 MET A HG2  6 
ATOM 6196  H HG3  . MET A 1 16 ? -8.419  -9.353  2.932   1.00 0.00 ? 16 MET A HG3  6 
ATOM 6197  H HE1  . MET A 1 16 ? -9.778  -11.045 4.350   1.00 0.00 ? 16 MET A HE1  6 
ATOM 6198  H HE2  . MET A 1 16 ? -10.472 -12.548 3.742   1.00 0.00 ? 16 MET A HE2  6 
ATOM 6199  H HE3  . MET A 1 16 ? -8.725  -12.395 3.928   1.00 0.00 ? 16 MET A HE3  6 
ATOM 6200  N N    . MET A 1 17 ? -8.031  -7.261  -1.425  1.00 0.00 ? 17 MET A N    6 
ATOM 6201  C CA   . MET A 1 17 ? -7.552  -6.053  -2.085  1.00 0.00 ? 17 MET A CA   6 
ATOM 6202  C C    . MET A 1 17 ? -8.708  -5.137  -2.460  1.00 0.00 ? 17 MET A C    6 
ATOM 6203  O O    . MET A 1 17 ? -8.628  -3.924  -2.281  1.00 0.00 ? 17 MET A O    6 
ATOM 6204  C CB   . MET A 1 17 ? -6.748  -6.409  -3.338  1.00 0.00 ? 17 MET A CB   6 
ATOM 6205  C CG   . MET A 1 17 ? -5.322  -6.840  -3.045  1.00 0.00 ? 17 MET A CG   6 
ATOM 6206  S SD   . MET A 1 17 ? -4.313  -5.485  -2.411  1.00 0.00 ? 17 MET A SD   6 
ATOM 6207  C CE   . MET A 1 17 ? -2.685  -6.233  -2.417  1.00 0.00 ? 17 MET A CE   6 
ATOM 6208  H H    . MET A 1 17 ? -7.911  -8.126  -1.863  1.00 0.00 ? 17 MET A H    6 
ATOM 6209  H HA   . MET A 1 17 ? -6.907  -5.532  -1.392  1.00 0.00 ? 17 MET A HA   6 
ATOM 6210  H HB2  . MET A 1 17 ? -7.247  -7.215  -3.856  1.00 0.00 ? 17 MET A HB2  6 
ATOM 6211  H HB3  . MET A 1 17 ? -6.715  -5.544  -3.984  1.00 0.00 ? 17 MET A HB3  6 
ATOM 6212  H HG2  . MET A 1 17 ? -5.342  -7.628  -2.308  1.00 0.00 ? 17 MET A HG2  6 
ATOM 6213  H HG3  . MET A 1 17 ? -4.875  -7.211  -3.955  1.00 0.00 ? 17 MET A HG3  6 
ATOM 6214  H HE1  . MET A 1 17 ? -2.768  -7.277  -2.159  1.00 0.00 ? 17 MET A HE1  6 
ATOM 6215  H HE2  . MET A 1 17 ? -2.251  -6.137  -3.401  1.00 0.00 ? 17 MET A HE2  6 
ATOM 6216  H HE3  . MET A 1 17 ? -2.055  -5.731  -1.696  1.00 0.00 ? 17 MET A HE3  6 
ATOM 6217  N N    . GLY A 1 18 ? -9.779  -5.727  -2.981  1.00 0.00 ? 18 GLY A N    6 
ATOM 6218  C CA   . GLY A 1 18 ? -10.935 -4.948  -3.381  1.00 0.00 ? 18 GLY A CA   6 
ATOM 6219  C C    . GLY A 1 18 ? -11.689 -4.376  -2.204  1.00 0.00 ? 18 GLY A C    6 
ATOM 6220  O O    . GLY A 1 18 ? -11.985 -3.187  -2.175  1.00 0.00 ? 18 GLY A O    6 
ATOM 6221  H H    . GLY A 1 18 ? -9.784  -6.699  -3.097  1.00 0.00 ? 18 GLY A H    6 
ATOM 6222  H HA2  . GLY A 1 18 ? -10.605 -4.134  -4.012  1.00 0.00 ? 18 GLY A HA2  6 
ATOM 6223  H HA3  . GLY A 1 18 ? -11.602 -5.580  -3.950  1.00 0.00 ? 18 GLY A HA3  6 
ATOM 6224  N N    . LEU A 1 19 ? -12.007 -5.222  -1.229  1.00 0.00 ? 19 LEU A N    6 
ATOM 6225  C CA   . LEU A 1 19 ? -12.736 -4.779  -0.048  1.00 0.00 ? 19 LEU A CA   6 
ATOM 6226  C C    . LEU A 1 19 ? -11.942 -3.706  0.679   1.00 0.00 ? 19 LEU A C    6 
ATOM 6227  O O    . LEU A 1 19 ? -12.484 -2.668  1.073   1.00 0.00 ? 19 LEU A O    6 
ATOM 6228  C CB   . LEU A 1 19 ? -13.016 -5.969  0.875   1.00 0.00 ? 19 LEU A CB   6 
ATOM 6229  C CG   . LEU A 1 19 ? -11.792 -6.574  1.564   1.00 0.00 ? 19 LEU A CG   6 
ATOM 6230  C CD1  . LEU A 1 19 ? -11.465 -5.827  2.849   1.00 0.00 ? 19 LEU A CD1  6 
ATOM 6231  C CD2  . LEU A 1 19 ? -12.023 -8.049  1.850   1.00 0.00 ? 19 LEU A CD2  6 
ATOM 6232  H H    . LEU A 1 19 ? -11.746 -6.161  -1.307  1.00 0.00 ? 19 LEU A H    6 
ATOM 6233  H HA   . LEU A 1 19 ? -13.674 -4.355  -0.376  1.00 0.00 ? 19 LEU A HA   6 
ATOM 6234  H HB2  . LEU A 1 19 ? -13.709 -5.649  1.638   1.00 0.00 ? 19 LEU A HB2  6 
ATOM 6235  H HB3  . LEU A 1 19 ? -13.487 -6.744  0.288   1.00 0.00 ? 19 LEU A HB3  6 
ATOM 6236  H HG   . LEU A 1 19 ? -10.940 -6.488  0.904   1.00 0.00 ? 19 LEU A HG   6 
ATOM 6237  H HD11 . LEU A 1 19 ? -11.795 -4.803  2.770   1.00 0.00 ? 19 LEU A HD11 6 
ATOM 6238  H HD12 . LEU A 1 19 ? -11.970 -6.302  3.677   1.00 0.00 ? 19 LEU A HD12 6 
ATOM 6239  H HD13 . LEU A 1 19 ? -10.398 -5.849  3.018   1.00 0.00 ? 19 LEU A HD13 6 
ATOM 6240  H HD21 . LEU A 1 19 ? -13.054 -8.206  2.129   1.00 0.00 ? 19 LEU A HD21 6 
ATOM 6241  H HD22 . LEU A 1 19 ? -11.798 -8.627  0.965   1.00 0.00 ? 19 LEU A HD22 6 
ATOM 6242  H HD23 . LEU A 1 19 ? -11.380 -8.364  2.658   1.00 0.00 ? 19 LEU A HD23 6 
ATOM 6243  N N    . ALA A 1 20 ? -10.645 -3.951  0.831   1.00 0.00 ? 20 ALA A N    6 
ATOM 6244  C CA   . ALA A 1 20 ? -9.769  -2.997  1.483   1.00 0.00 ? 20 ALA A CA   6 
ATOM 6245  C C    . ALA A 1 20 ? -9.681  -1.738  0.640   1.00 0.00 ? 20 ALA A C    6 
ATOM 6246  O O    . ALA A 1 20 ? -9.662  -0.628  1.164   1.00 0.00 ? 20 ALA A O    6 
ATOM 6247  C CB   . ALA A 1 20 ? -8.387  -3.595  1.698   1.00 0.00 ? 20 ALA A CB   6 
ATOM 6248  H H    . ALA A 1 20 ? -10.268 -4.784  0.476   1.00 0.00 ? 20 ALA A H    6 
ATOM 6249  H HA   . ALA A 1 20 ? -10.192 -2.753  2.447   1.00 0.00 ? 20 ALA A HA   6 
ATOM 6250  H HB1  . ALA A 1 20 ? -8.084  -4.134  0.813   1.00 0.00 ? 20 ALA A HB1  6 
ATOM 6251  H HB2  . ALA A 1 20 ? -7.680  -2.804  1.898   1.00 0.00 ? 20 ALA A HB2  6 
ATOM 6252  H HB3  . ALA A 1 20 ? -8.415  -4.272  2.540   1.00 0.00 ? 20 ALA A HB3  6 
ATOM 6253  N N    . ALA A 1 21 ? -9.647  -1.929  -0.677  1.00 0.00 ? 21 ALA A N    6 
ATOM 6254  C CA   . ALA A 1 21 ? -9.580  -0.813  -1.612  1.00 0.00 ? 21 ALA A CA   6 
ATOM 6255  C C    . ALA A 1 21 ? -10.804 0.067   -1.477  1.00 0.00 ? 21 ALA A C    6 
ATOM 6256  O O    . ALA A 1 21 ? -10.703 1.290   -1.429  1.00 0.00 ? 21 ALA A O    6 
ATOM 6257  C CB   . ALA A 1 21 ? -9.445  -1.314  -3.041  1.00 0.00 ? 21 ALA A CB   6 
ATOM 6258  H H    . ALA A 1 21 ? -9.681  -2.846  -1.026  1.00 0.00 ? 21 ALA A H    6 
ATOM 6259  H HA   . ALA A 1 21 ? -8.712  -0.232  -1.373  1.00 0.00 ? 21 ALA A HA   6 
ATOM 6260  H HB1  . ALA A 1 21 ? -9.693  -2.362  -3.080  1.00 0.00 ? 21 ALA A HB1  6 
ATOM 6261  H HB2  . ALA A 1 21 ? -10.117 -0.762  -3.683  1.00 0.00 ? 21 ALA A HB2  6 
ATOM 6262  H HB3  . ALA A 1 21 ? -8.429  -1.171  -3.380  1.00 0.00 ? 21 ALA A HB3  6 
ATOM 6263  N N    . ILE A 1 22 ? -11.958 -0.570  -1.406  1.00 0.00 ? 22 ILE A N    6 
ATOM 6264  C CA   . ILE A 1 22 ? -13.214 0.148   -1.265  1.00 0.00 ? 22 ILE A CA   6 
ATOM 6265  C C    . ILE A 1 22 ? -13.213 0.962   0.022   1.00 0.00 ? 22 ILE A C    6 
ATOM 6266  O O    . ILE A 1 22 ? -13.295 2.186   -0.013  1.00 0.00 ? 22 ILE A O    6 
ATOM 6267  C CB   . ILE A 1 22 ? -14.426 -0.802  -1.273  1.00 0.00 ? 22 ILE A CB   6 
ATOM 6268  C CG1  . ILE A 1 22 ? -14.437 -1.638  -2.552  1.00 0.00 ? 22 ILE A CG1  6 
ATOM 6269  C CG2  . ILE A 1 22 ? -15.725 -0.018  -1.140  1.00 0.00 ? 22 ILE A CG2  6 
ATOM 6270  C CD1  . ILE A 1 22 ? -14.511 -0.811  -3.816  1.00 0.00 ? 22 ILE A CD1  6 
ATOM 6271  H H    . ILE A 1 22 ? -11.961 -1.547  -1.442  1.00 0.00 ? 22 ILE A H    6 
ATOM 6272  H HA   . ILE A 1 22 ? -13.306 0.822   -2.103  1.00 0.00 ? 22 ILE A HA   6 
ATOM 6273  H HB   . ILE A 1 22 ? -14.343 -1.457  -0.424  1.00 0.00 ? 22 ILE A HB   6 
ATOM 6274  H HG12 . ILE A 1 22 ? -13.537 -2.222  -2.596  1.00 0.00 ? 22 ILE A HG12 6 
ATOM 6275  H HG13 . ILE A 1 22 ? -15.291 -2.298  -2.536  1.00 0.00 ? 22 ILE A HG13 6 
ATOM 6276  H HG21 . ILE A 1 22 ? -15.533 1.030   -1.322  1.00 0.00 ? 22 ILE A HG21 6 
ATOM 6277  H HG22 . ILE A 1 22 ? -16.441 -0.382  -1.861  1.00 0.00 ? 22 ILE A HG22 6 
ATOM 6278  H HG23 . ILE A 1 22 ? -16.121 -0.145  -0.144  1.00 0.00 ? 22 ILE A HG23 6 
ATOM 6279  H HD11 . ILE A 1 22 ? -14.756 0.210   -3.564  1.00 0.00 ? 22 ILE A HD11 6 
ATOM 6280  H HD12 . ILE A 1 22 ? -13.555 -0.837  -4.320  1.00 0.00 ? 22 ILE A HD12 6 
ATOM 6281  H HD13 . ILE A 1 22 ? -15.273 -1.214  -4.467  1.00 0.00 ? 22 ILE A HD13 6 
ATOM 6282  N N    . GLY A 1 23 ? -13.099 0.278   1.158   1.00 0.00 ? 23 GLY A N    6 
ATOM 6283  C CA   . GLY A 1 23 ? -13.074 0.974   2.434   1.00 0.00 ? 23 GLY A CA   6 
ATOM 6284  C C    . GLY A 1 23 ? -11.991 2.037   2.479   1.00 0.00 ? 23 GLY A C    6 
ATOM 6285  O O    . GLY A 1 23 ? -12.257 3.205   2.785   1.00 0.00 ? 23 GLY A O    6 
ATOM 6286  H H    . GLY A 1 23 ? -13.023 -0.702  1.129   1.00 0.00 ? 23 GLY A H    6 
ATOM 6287  H HA2  . GLY A 1 23 ? -14.035 1.441   2.599   1.00 0.00 ? 23 GLY A HA2  6 
ATOM 6288  H HA3  . GLY A 1 23 ? -12.893 0.257   3.223   1.00 0.00 ? 23 GLY A HA3  6 
ATOM 6289  N N    . ALA A 1 24 ? -10.765 1.629   2.161   1.00 0.00 ? 24 ALA A N    6 
ATOM 6290  C CA   . ALA A 1 24 ? -9.631  2.542   2.149   1.00 0.00 ? 24 ALA A CA   6 
ATOM 6291  C C    . ALA A 1 24 ? -9.894  3.713   1.216   1.00 0.00 ? 24 ALA A C    6 
ATOM 6292  O O    . ALA A 1 24 ? -9.573  4.855   1.534   1.00 0.00 ? 24 ALA A O    6 
ATOM 6293  C CB   . ALA A 1 24 ? -8.367  1.812   1.724   1.00 0.00 ? 24 ALA A CB   6 
ATOM 6294  H H    . ALA A 1 24 ? -10.623 0.690   1.919   1.00 0.00 ? 24 ALA A H    6 
ATOM 6295  H HA   . ALA A 1 24 ? -9.487  2.916   3.152   1.00 0.00 ? 24 ALA A HA   6 
ATOM 6296  H HB1  . ALA A 1 24 ? -8.615  1.056   0.999   1.00 0.00 ? 24 ALA A HB1  6 
ATOM 6297  H HB2  . ALA A 1 24 ? -7.679  2.515   1.283   1.00 0.00 ? 24 ALA A HB2  6 
ATOM 6298  H HB3  . ALA A 1 24 ? -7.911  1.349   2.586   1.00 0.00 ? 24 ALA A HB3  6 
ATOM 6299  N N    . ALA A 1 25 ? -10.476 3.413   0.059   1.00 0.00 ? 25 ALA A N    6 
ATOM 6300  C CA   . ALA A 1 25 ? -10.785 4.436   -0.930  1.00 0.00 ? 25 ALA A CA   6 
ATOM 6301  C C    . ALA A 1 25 ? -11.773 5.450   -0.366  1.00 0.00 ? 25 ALA A C    6 
ATOM 6302  O O    . ALA A 1 25 ? -11.603 6.659   -0.530  1.00 0.00 ? 25 ALA A O    6 
ATOM 6303  C CB   . ALA A 1 25 ? -11.346 3.799   -2.190  1.00 0.00 ? 25 ALA A CB   6 
ATOM 6304  H H    . ALA A 1 25 ? -10.703 2.479   -0.133  1.00 0.00 ? 25 ALA A H    6 
ATOM 6305  H HA   . ALA A 1 25 ? -9.866  4.943   -1.186  1.00 0.00 ? 25 ALA A HA   6 
ATOM 6306  H HB1  . ALA A 1 25 ? -12.079 3.052   -1.922  1.00 0.00 ? 25 ALA A HB1  6 
ATOM 6307  H HB2  . ALA A 1 25 ? -11.813 4.558   -2.801  1.00 0.00 ? 25 ALA A HB2  6 
ATOM 6308  H HB3  . ALA A 1 25 ? -10.545 3.333   -2.745  1.00 0.00 ? 25 ALA A HB3  6 
ATOM 6309  N N    . ILE A 1 26 ? -12.800 4.953   0.308   1.00 0.00 ? 26 ILE A N    6 
ATOM 6310  C CA   . ILE A 1 26 ? -13.800 5.824   0.899   1.00 0.00 ? 26 ILE A CA   6 
ATOM 6311  C C    . ILE A 1 26 ? -13.161 6.778   1.901   1.00 0.00 ? 26 ILE A C    6 
ATOM 6312  O O    . ILE A 1 26 ? -13.305 7.992   1.784   1.00 0.00 ? 26 ILE A O    6 
ATOM 6313  C CB   . ILE A 1 26 ? -14.912 5.024   1.602   1.00 0.00 ? 26 ILE A CB   6 
ATOM 6314  C CG1  . ILE A 1 26 ? -15.550 4.034   0.631   1.00 0.00 ? 26 ILE A CG1  6 
ATOM 6315  C CG2  . ILE A 1 26 ? -15.970 5.963   2.165   1.00 0.00 ? 26 ILE A CG2  6 
ATOM 6316  C CD1  . ILE A 1 26 ? -16.563 3.117   1.280   1.00 0.00 ? 26 ILE A CD1  6 
ATOM 6317  H H    . ILE A 1 26 ? -12.882 3.982   0.414   1.00 0.00 ? 26 ILE A H    6 
ATOM 6318  H HA   . ILE A 1 26 ? -14.251 6.398   0.105   1.00 0.00 ? 26 ILE A HA   6 
ATOM 6319  H HB   . ILE A 1 26 ? -14.472 4.483   2.422   1.00 0.00 ? 26 ILE A HB   6 
ATOM 6320  H HG12 . ILE A 1 26 ? -16.056 4.583   -0.150  1.00 0.00 ? 26 ILE A HG12 6 
ATOM 6321  H HG13 . ILE A 1 26 ? -14.780 3.424   0.192   1.00 0.00 ? 26 ILE A HG13 6 
ATOM 6322  H HG21 . ILE A 1 26 ? -15.491 6.772   2.692   1.00 0.00 ? 26 ILE A HG21 6 
ATOM 6323  H HG22 . ILE A 1 26 ? -16.561 6.363   1.354   1.00 0.00 ? 26 ILE A HG22 6 
ATOM 6324  H HG23 . ILE A 1 26 ? -16.611 5.419   2.843   1.00 0.00 ? 26 ILE A HG23 6 
ATOM 6325  H HD11 . ILE A 1 26 ? -16.314 2.985   2.323   1.00 0.00 ? 26 ILE A HD11 6 
ATOM 6326  H HD12 . ILE A 1 26 ? -17.547 3.551   1.197   1.00 0.00 ? 26 ILE A HD12 6 
ATOM 6327  H HD13 . ILE A 1 26 ? -16.550 2.158   0.784   1.00 0.00 ? 26 ILE A HD13 6 
ATOM 6328  N N    . GLY A 1 27 ? -12.456 6.227   2.890   1.00 0.00 ? 27 GLY A N    6 
ATOM 6329  C CA   . GLY A 1 27 ? -11.823 7.072   3.895   1.00 0.00 ? 27 GLY A CA   6 
ATOM 6330  C C    . GLY A 1 27 ? -10.740 7.962   3.323   1.00 0.00 ? 27 GLY A C    6 
ATOM 6331  O O    . GLY A 1 27 ? -10.744 9.170   3.559   1.00 0.00 ? 27 GLY A O    6 
ATOM 6332  H H    . GLY A 1 27 ? -12.372 5.248   2.943   1.00 0.00 ? 27 GLY A H    6 
ATOM 6333  H HA2  . GLY A 1 27 ? -12.580 7.700   4.340   1.00 0.00 ? 27 GLY A HA2  6 
ATOM 6334  H HA3  . GLY A 1 27 ? -11.398 6.460   4.666   1.00 0.00 ? 27 GLY A HA3  6 
ATOM 6335  N N    . ILE A 1 28 ? -9.806  7.387   2.561   1.00 0.00 ? 28 ILE A N    6 
ATOM 6336  C CA   . ILE A 1 28 ? -8.745  8.189   1.969   1.00 0.00 ? 28 ILE A CA   6 
ATOM 6337  C C    . ILE A 1 28 ? -9.362  9.394   1.295   1.00 0.00 ? 28 ILE A C    6 
ATOM 6338  O O    . ILE A 1 28 ? -8.949  10.524  1.508   1.00 0.00 ? 28 ILE A O    6 
ATOM 6339  C CB   . ILE A 1 28 ? -7.894  7.398   0.959   1.00 0.00 ? 28 ILE A CB   6 
ATOM 6340  C CG1  . ILE A 1 28 ? -8.751  6.799   -0.149  1.00 0.00 ? 28 ILE A CG1  6 
ATOM 6341  C CG2  . ILE A 1 28 ? -7.093  6.317   1.662   1.00 0.00 ? 28 ILE A CG2  6 
ATOM 6342  C CD1  . ILE A 1 28 ? -8.974  7.734   -1.319  1.00 0.00 ? 28 ILE A CD1  6 
ATOM 6343  H H    . ILE A 1 28 ? -9.837  6.424   2.391   1.00 0.00 ? 28 ILE A H    6 
ATOM 6344  H HA   . ILE A 1 28 ? -8.104  8.531   2.768   1.00 0.00 ? 28 ILE A HA   6 
ATOM 6345  H HB   . ILE A 1 28 ? -7.206  8.087   0.517   1.00 0.00 ? 28 ILE A HB   6 
ATOM 6346  H HG12 . ILE A 1 28 ? -8.270  5.907   -0.522  1.00 0.00 ? 28 ILE A HG12 6 
ATOM 6347  H HG13 . ILE A 1 28 ? -9.713  6.540   0.256   1.00 0.00 ? 28 ILE A HG13 6 
ATOM 6348  H HG21 . ILE A 1 28 ? -7.599  6.027   2.572   1.00 0.00 ? 28 ILE A HG21 6 
ATOM 6349  H HG22 . ILE A 1 28 ? -7.003  5.459   1.013   1.00 0.00 ? 28 ILE A HG22 6 
ATOM 6350  H HG23 . ILE A 1 28 ? -6.109  6.693   1.899   1.00 0.00 ? 28 ILE A HG23 6 
ATOM 6351  H HD11 . ILE A 1 28 ? -8.481  8.675   -1.127  1.00 0.00 ? 28 ILE A HD11 6 
ATOM 6352  H HD12 . ILE A 1 28 ? -8.565  7.292   -2.216  1.00 0.00 ? 28 ILE A HD12 6 
ATOM 6353  H HD13 . ILE A 1 28 ? -10.032 7.902   -1.452  1.00 0.00 ? 28 ILE A HD13 6 
ATOM 6354  N N    . GLY A 1 29 ? -10.404 9.138   0.531   1.00 0.00 ? 29 GLY A N    6 
ATOM 6355  C CA   . GLY A 1 29 ? -11.118 10.217  -0.118  1.00 0.00 ? 29 GLY A CA   6 
ATOM 6356  C C    . GLY A 1 29 ? -11.687 11.176  0.912   1.00 0.00 ? 29 GLY A C    6 
ATOM 6357  O O    . GLY A 1 29 ? -11.664 12.392  0.723   1.00 0.00 ? 29 GLY A O    6 
ATOM 6358  H H    . GLY A 1 29 ? -10.707 8.214   0.436   1.00 0.00 ? 29 GLY A H    6 
ATOM 6359  H HA2  . GLY A 1 29 ? -10.441 10.750  -0.770  1.00 0.00 ? 29 GLY A HA2  6 
ATOM 6360  H HA3  . GLY A 1 29 ? -11.928 9.807   -0.702  1.00 0.00 ? 29 GLY A HA3  6 
ATOM 6361  N N    . ILE A 1 30 ? -12.189 10.616  2.018   1.00 0.00 ? 30 ILE A N    6 
ATOM 6362  C CA   . ILE A 1 30 ? -12.758 11.414  3.102   1.00 0.00 ? 30 ILE A CA   6 
ATOM 6363  C C    . ILE A 1 30 ? -11.733 12.411  3.648   1.00 0.00 ? 30 ILE A C    6 
ATOM 6364  O O    . ILE A 1 30 ? -11.838 13.615  3.407   1.00 0.00 ? 30 ILE A O    6 
ATOM 6365  C CB   . ILE A 1 30 ? -13.283 10.512  4.259   1.00 0.00 ? 30 ILE A CB   6 
ATOM 6366  C CG1  . ILE A 1 30 ? -14.477 9.687   3.784   1.00 0.00 ? 30 ILE A CG1  6 
ATOM 6367  C CG2  . ILE A 1 30 ? -13.685 11.351  5.468   1.00 0.00 ? 30 ILE A CG2  6 
ATOM 6368  C CD1  . ILE A 1 30 ? -14.974 8.698   4.817   1.00 0.00 ? 30 ILE A CD1  6 
ATOM 6369  H H    . ILE A 1 30 ? -12.166 9.638   2.108   1.00 0.00 ? 30 ILE A H    6 
ATOM 6370  H HA   . ILE A 1 30 ? -13.599 11.965  2.699   1.00 0.00 ? 30 ILE A HA   6 
ATOM 6371  H HB   . ILE A 1 30 ? -12.491 9.832   4.565   1.00 0.00 ? 30 ILE A HB   6 
ATOM 6372  H HG12 . ILE A 1 30 ? -15.293 10.352  3.544   1.00 0.00 ? 30 ILE A HG12 6 
ATOM 6373  H HG13 . ILE A 1 30 ? -14.197 9.138   2.904   1.00 0.00 ? 30 ILE A HG13 6 
ATOM 6374  H HG21 . ILE A 1 30 ? -12.915 12.074  5.682   1.00 0.00 ? 30 ILE A HG21 6 
ATOM 6375  H HG22 . ILE A 1 30 ? -14.611 11.863  5.257   1.00 0.00 ? 30 ILE A HG22 6 
ATOM 6376  H HG23 . ILE A 1 30 ? -13.818 10.706  6.325   1.00 0.00 ? 30 ILE A HG23 6 
ATOM 6377  H HD11 . ILE A 1 30 ? -14.170 8.452   5.494   1.00 0.00 ? 30 ILE A HD11 6 
ATOM 6378  H HD12 . ILE A 1 30 ? -15.791 9.135   5.371   1.00 0.00 ? 30 ILE A HD12 6 
ATOM 6379  H HD13 . ILE A 1 30 ? -15.313 7.800   4.322   1.00 0.00 ? 30 ILE A HD13 6 
ATOM 6380  N N    . LEU A 1 31 ? -10.749 11.903  4.385   1.00 0.00 ? 31 LEU A N    6 
ATOM 6381  C CA   . LEU A 1 31 ? -9.709  12.749  4.975   1.00 0.00 ? 31 LEU A CA   6 
ATOM 6382  C C    . LEU A 1 31 ? -8.735  13.237  3.912   1.00 0.00 ? 31 LEU A C    6 
ATOM 6383  O O    . LEU A 1 31 ? -8.304  14.391  3.930   1.00 0.00 ? 31 LEU A O    6 
ATOM 6384  C CB   . LEU A 1 31 ? -8.950  11.973  6.057   1.00 0.00 ? 31 LEU A CB   6 
ATOM 6385  C CG   . LEU A 1 31 ? -7.842  12.757  6.768   1.00 0.00 ? 31 LEU A CG   6 
ATOM 6386  C CD1  . LEU A 1 31 ? -8.419  13.963  7.494   1.00 0.00 ? 31 LEU A CD1  6 
ATOM 6387  C CD2  . LEU A 1 31 ? -7.095  11.859  7.741   1.00 0.00 ? 31 LEU A CD2  6 
ATOM 6388  H H    . LEU A 1 31 ? -10.723 10.935  4.541   1.00 0.00 ? 31 LEU A H    6 
ATOM 6389  H HA   . LEU A 1 31 ? -10.191 13.611  5.426   1.00 0.00 ? 31 LEU A HA   6 
ATOM 6390  H HB2  . LEU A 1 31 ? -9.660  11.641  6.799   1.00 0.00 ? 31 LEU A HB2  6 
ATOM 6391  H HB3  . LEU A 1 31 ? -8.503  11.102  5.597   1.00 0.00 ? 31 LEU A HB3  6 
ATOM 6392  H HG   . LEU A 1 31 ? -7.136  13.116  6.033   1.00 0.00 ? 31 LEU A HG   6 
ATOM 6393  H HD11 . LEU A 1 31 ? -9.403  13.721  7.867   1.00 0.00 ? 31 LEU A HD11 6 
ATOM 6394  H HD12 . LEU A 1 31 ? -7.775  14.225  8.321   1.00 0.00 ? 31 LEU A HD12 6 
ATOM 6395  H HD13 . LEU A 1 31 ? -8.486  14.797  6.812   1.00 0.00 ? 31 LEU A HD13 6 
ATOM 6396  H HD21 . LEU A 1 31 ? -7.290  10.824  7.500   1.00 0.00 ? 31 LEU A HD21 6 
ATOM 6397  H HD22 . LEU A 1 31 ? -6.034  12.051  7.667   1.00 0.00 ? 31 LEU A HD22 6 
ATOM 6398  H HD23 . LEU A 1 31 ? -7.428  12.063  8.747   1.00 0.00 ? 31 LEU A HD23 6 
ATOM 6399  N N    . GLY A 1 32 ? -8.389  12.355  2.985   1.00 0.00 ? 32 GLY A N    6 
ATOM 6400  C CA   . GLY A 1 32 ? -7.471  12.723  1.925   1.00 0.00 ? 32 GLY A CA   6 
ATOM 6401  C C    . GLY A 1 32 ? -8.000  13.879  1.109   1.00 0.00 ? 32 GLY A C    6 
ATOM 6402  O O    . GLY A 1 32 ? -7.247  14.771  0.730   1.00 0.00 ? 32 GLY A O    6 
ATOM 6403  H H    . GLY A 1 32 ? -8.763  11.450  3.018   1.00 0.00 ? 32 GLY A H    6 
ATOM 6404  H HA2  . GLY A 1 32 ? -6.524  13.004  2.364   1.00 0.00 ? 32 GLY A HA2  6 
ATOM 6405  H HA3  . GLY A 1 32 ? -7.316  11.875  1.273   1.00 0.00 ? 32 GLY A HA3  6 
ATOM 6406  N N    . GLY A 1 33 ? -9.304  13.872  0.850   1.00 0.00 ? 33 GLY A N    6 
ATOM 6407  C CA   . GLY A 1 33 ? -9.910  14.943  0.084   1.00 0.00 ? 33 GLY A CA   6 
ATOM 6408  C C    . GLY A 1 33 ? -9.826  16.271  0.804   1.00 0.00 ? 33 GLY A C    6 
ATOM 6409  O O    . GLY A 1 33 ? -9.386  17.265  0.233   1.00 0.00 ? 33 GLY A O    6 
ATOM 6410  H H    . GLY A 1 33 ? -9.859  13.137  1.188   1.00 0.00 ? 33 GLY A H    6 
ATOM 6411  H HA2  . GLY A 1 33 ? -9.402  15.026  -0.866  1.00 0.00 ? 33 GLY A HA2  6 
ATOM 6412  H HA3  . GLY A 1 33 ? -10.950 14.706  -0.093  1.00 0.00 ? 33 GLY A HA3  6 
ATOM 6413  N N    . LYS A 1 34 ? -10.240 16.286  2.067   1.00 0.00 ? 34 LYS A N    6 
ATOM 6414  C CA   . LYS A 1 34 ? -10.199 17.502  2.869   1.00 0.00 ? 34 LYS A CA   6 
ATOM 6415  C C    . LYS A 1 34 ? -8.763  18.009  3.007   1.00 0.00 ? 34 LYS A C    6 
ATOM 6416  O O    . LYS A 1 34 ? -8.465  19.175  2.719   1.00 0.00 ? 34 LYS A O    6 
ATOM 6417  C CB   . LYS A 1 34 ? -10.815 17.245  4.251   1.00 0.00 ? 34 LYS A CB   6 
ATOM 6418  C CG   . LYS A 1 34 ? -10.170 16.108  5.021   1.00 0.00 ? 34 LYS A CG   6 
ATOM 6419  C CD   . LYS A 1 34 ? -10.904 15.816  6.328   1.00 0.00 ? 34 LYS A CD   6 
ATOM 6420  C CE   . LYS A 1 34 ? -10.752 16.944  7.340   1.00 0.00 ? 34 LYS A CE   6 
ATOM 6421  N NZ   . LYS A 1 34 ? -11.491 18.170  6.931   1.00 0.00 ? 34 LYS A NZ   6 
ATOM 6422  H H    . LYS A 1 34 ? -10.576 15.458  2.471   1.00 0.00 ? 34 LYS A H    6 
ATOM 6423  H HA   . LYS A 1 34 ? -10.783 18.252  2.358   1.00 0.00 ? 34 LYS A HA   6 
ATOM 6424  H HB2  . LYS A 1 34 ? -10.717 18.135  4.839   1.00 0.00 ? 34 LYS A HB2  6 
ATOM 6425  H HB3  . LYS A 1 34 ? -11.861 17.017  4.129   1.00 0.00 ? 34 LYS A HB3  6 
ATOM 6426  H HG2  . LYS A 1 34 ? -10.186 15.222  4.408   1.00 0.00 ? 34 LYS A HG2  6 
ATOM 6427  H HG3  . LYS A 1 34 ? -9.148  16.376  5.247   1.00 0.00 ? 34 LYS A HG3  6 
ATOM 6428  H HD2  . LYS A 1 34 ? -11.953 15.685  6.115   1.00 0.00 ? 34 LYS A HD2  6 
ATOM 6429  H HD3  . LYS A 1 34 ? -10.507 14.909  6.756   1.00 0.00 ? 34 LYS A HD3  6 
ATOM 6430  H HE2  . LYS A 1 34 ? -11.132 16.607  8.293   1.00 0.00 ? 34 LYS A HE2  6 
ATOM 6431  H HE3  . LYS A 1 34 ? -9.702  17.182  7.439   1.00 0.00 ? 34 LYS A HE3  6 
ATOM 6432  H HZ1  . LYS A 1 34 ? -12.173 17.943  6.181   1.00 0.00 ? 34 LYS A HZ1  6 
ATOM 6433  H HZ2  . LYS A 1 34 ? -12.008 18.564  7.743   1.00 0.00 ? 34 LYS A HZ2  6 
ATOM 6434  H HZ3  . LYS A 1 34 ? -10.826 18.887  6.578   1.00 0.00 ? 34 LYS A HZ3  6 
ATOM 6435  N N    . PHE A 1 35 ? -7.875  17.121  3.439   1.00 0.00 ? 35 PHE A N    6 
ATOM 6436  C CA   . PHE A 1 35 ? -6.470  17.465  3.617   1.00 0.00 ? 35 PHE A CA   6 
ATOM 6437  C C    . PHE A 1 35 ? -5.873  17.907  2.293   1.00 0.00 ? 35 PHE A C    6 
ATOM 6438  O O    . PHE A 1 35 ? -5.279  18.982  2.183   1.00 0.00 ? 35 PHE A O    6 
ATOM 6439  C CB   . PHE A 1 35 ? -5.700  16.259  4.152   1.00 0.00 ? 35 PHE A CB   6 
ATOM 6440  C CG   . PHE A 1 35 ? -4.341  16.610  4.679   1.00 0.00 ? 35 PHE A CG   6 
ATOM 6441  C CD1  . PHE A 1 35 ? -4.206  17.470  5.755   1.00 0.00 ? 35 PHE A CD1  6 
ATOM 6442  C CD2  . PHE A 1 35 ? -3.202  16.097  4.089   1.00 0.00 ? 35 PHE A CD2  6 
ATOM 6443  C CE1  . PHE A 1 35 ? -2.957  17.810  6.232   1.00 0.00 ? 35 PHE A CE1  6 
ATOM 6444  C CE2  . PHE A 1 35 ? -1.951  16.432  4.563   1.00 0.00 ? 35 PHE A CE2  6 
ATOM 6445  C CZ   . PHE A 1 35 ? -1.828  17.291  5.633   1.00 0.00 ? 35 PHE A CZ   6 
ATOM 6446  H H    . PHE A 1 35 ? -8.172  16.209  3.638   1.00 0.00 ? 35 PHE A H    6 
ATOM 6447  H HA   . PHE A 1 35 ? -6.404  18.280  4.329   1.00 0.00 ? 35 PHE A HA   6 
ATOM 6448  H HB2  . PHE A 1 35 ? -6.264  15.806  4.947   1.00 0.00 ? 35 PHE A HB2  6 
ATOM 6449  H HB3  . PHE A 1 35 ? -5.573  15.539  3.356   1.00 0.00 ? 35 PHE A HB3  6 
ATOM 6450  H HD1  . PHE A 1 35 ? -5.090  17.877  6.223   1.00 0.00 ? 35 PHE A HD1  6 
ATOM 6451  H HD2  . PHE A 1 35 ? -3.298  15.423  3.252   1.00 0.00 ? 35 PHE A HD2  6 
ATOM 6452  H HE1  . PHE A 1 35 ? -2.864  18.483  7.071   1.00 0.00 ? 35 PHE A HE1  6 
ATOM 6453  H HE2  . PHE A 1 35 ? -1.068  16.023  4.092   1.00 0.00 ? 35 PHE A HE2  6 
ATOM 6454  H HZ   . PHE A 1 35 ? -0.848  17.556  6.004   1.00 0.00 ? 35 PHE A HZ   6 
ATOM 6455  N N    . LEU A 1 36 ? -6.046  17.060  1.289   1.00 0.00 ? 36 LEU A N    6 
ATOM 6456  C CA   . LEU A 1 36 ? -5.544  17.345  -0.048  1.00 0.00 ? 36 LEU A CA   6 
ATOM 6457  C C    . LEU A 1 36 ? -6.149  18.639  -0.570  1.00 0.00 ? 36 LEU A C    6 
ATOM 6458  O O    . LEU A 1 36 ? -5.486  19.409  -1.259  1.00 0.00 ? 36 LEU A O    6 
ATOM 6459  C CB   . LEU A 1 36 ? -5.873  16.194  -1.004  1.00 0.00 ? 36 LEU A CB   6 
ATOM 6460  C CG   . LEU A 1 36 ? -5.386  16.375  -2.444  1.00 0.00 ? 36 LEU A CG   6 
ATOM 6461  C CD1  . LEU A 1 36 ? -3.883  16.609  -2.484  1.00 0.00 ? 36 LEU A CD1  6 
ATOM 6462  C CD2  . LEU A 1 36 ? -5.756  15.161  -3.281  1.00 0.00 ? 36 LEU A CD2  6 
ATOM 6463  H H    . LEU A 1 36 ? -6.529  16.225  1.455   1.00 0.00 ? 36 LEU A H    6 
ATOM 6464  H HA   . LEU A 1 36 ? -4.475  17.460  0.017   1.00 0.00 ? 36 LEU A HA   6 
ATOM 6465  H HB2  . LEU A 1 36 ? -5.435  15.289  -0.608  1.00 0.00 ? 36 LEU A HB2  6 
ATOM 6466  H HB3  . LEU A 1 36 ? -6.946  16.071  -1.029  1.00 0.00 ? 36 LEU A HB3  6 
ATOM 6467  H HG   . LEU A 1 36 ? -5.870  17.240  -2.875  1.00 0.00 ? 36 LEU A HG   6 
ATOM 6468  H HD11 . LEU A 1 36 ? -3.545  16.936  -1.515  1.00 0.00 ? 36 LEU A HD11 6 
ATOM 6469  H HD12 . LEU A 1 36 ? -3.382  15.691  -2.748  1.00 0.00 ? 36 LEU A HD12 6 
ATOM 6470  H HD13 . LEU A 1 36 ? -3.656  17.368  -3.218  1.00 0.00 ? 36 LEU A HD13 6 
ATOM 6471  H HD21 . LEU A 1 36 ? -5.400  14.267  -2.791  1.00 0.00 ? 36 LEU A HD21 6 
ATOM 6472  H HD22 . LEU A 1 36 ? -6.829  15.110  -3.388  1.00 0.00 ? 36 LEU A HD22 6 
ATOM 6473  H HD23 . LEU A 1 36 ? -5.298  15.242  -4.256  1.00 0.00 ? 36 LEU A HD23 6 
ATOM 6474  N N    . GLU A 1 37 ? -7.413  18.878  -0.227  1.00 0.00 ? 37 GLU A N    6 
ATOM 6475  C CA   . GLU A 1 37 ? -8.103  20.089  -0.656  1.00 0.00 ? 37 GLU A CA   6 
ATOM 6476  C C    . GLU A 1 37 ? -7.347  21.323  -0.180  1.00 0.00 ? 37 GLU A C    6 
ATOM 6477  O O    . GLU A 1 37 ? -6.924  22.152  -0.986  1.00 0.00 ? 37 GLU A O    6 
ATOM 6478  C CB   . GLU A 1 37 ? -9.537  20.114  -0.118  1.00 0.00 ? 37 GLU A CB   6 
ATOM 6479  C CG   . GLU A 1 37 ? -10.332 21.331  -0.561  1.00 0.00 ? 37 GLU A CG   6 
ATOM 6480  C CD   . GLU A 1 37 ? -10.542 21.382  -2.062  1.00 0.00 ? 37 GLU A CD   6 
ATOM 6481  O OE1  . GLU A 1 37 ? -9.537  21.435  -2.803  1.00 0.00 ? 37 GLU A OE1  6 
ATOM 6482  O OE2  . GLU A 1 37 ? -11.712 21.368  -2.499  1.00 0.00 ? 37 GLU A OE2  6 
ATOM 6483  H H    . GLU A 1 37 ? -7.886  18.230  0.335   1.00 0.00 ? 37 GLU A H    6 
ATOM 6484  H HA   . GLU A 1 37 ? -8.131  20.089  -1.737  1.00 0.00 ? 37 GLU A HA   6 
ATOM 6485  H HB2  . GLU A 1 37 ? -10.053 19.230  -0.460  1.00 0.00 ? 37 GLU A HB2  6 
ATOM 6486  H HB3  . GLU A 1 37 ? -9.504  20.106  0.962   1.00 0.00 ? 37 GLU A HB3  6 
ATOM 6487  H HG2  . GLU A 1 37 ? -11.298 21.308  -0.079  1.00 0.00 ? 37 GLU A HG2  6 
ATOM 6488  H HG3  . GLU A 1 37 ? -9.802  22.221  -0.258  1.00 0.00 ? 37 GLU A HG3  6 
ATOM 6489  N N    . GLY A 1 38 ? -7.167  21.432  1.136   1.00 0.00 ? 38 GLY A N    6 
ATOM 6490  C CA   . GLY A 1 38 ? -6.446  22.568  1.692   1.00 0.00 ? 38 GLY A CA   6 
ATOM 6491  C C    . GLY A 1 38 ? -5.048  22.701  1.107   1.00 0.00 ? 38 GLY A C    6 
ATOM 6492  O O    . GLY A 1 38 ? -4.673  23.747  0.552   1.00 0.00 ? 38 GLY A O    6 
ATOM 6493  H H    . GLY A 1 38 ? -7.520  20.732  1.733   1.00 0.00 ? 38 GLY A H    6 
ATOM 6494  H HA2  . GLY A 1 38 ? -7.003  23.472  1.493   1.00 0.00 ? 38 GLY A HA2  6 
ATOM 6495  H HA3  . GLY A 1 38 ? -6.363  22.441  2.762   1.00 0.00 ? 38 GLY A HA3  6 
ATOM 6496  N N    . ALA A 1 39 ? -4.271  21.633  1.234   1.00 0.00 ? 39 ALA A N    6 
ATOM 6497  C CA   . ALA A 1 39 ? -2.908  21.616  0.724   1.00 0.00 ? 39 ALA A CA   6 
ATOM 6498  C C    . ALA A 1 39 ? -2.878  21.789  -0.791  1.00 0.00 ? 39 ALA A C    6 
ATOM 6499  O O    . ALA A 1 39 ? -1.836  22.100  -1.367  1.00 0.00 ? 39 ALA A O    6 
ATOM 6500  C CB   . ALA A 1 39 ? -2.221  20.327  1.129   1.00 0.00 ? 39 ALA A CB   6 
ATOM 6501  H H    . ALA A 1 39 ? -4.624  20.835  1.685   1.00 0.00 ? 39 ALA A H    6 
ATOM 6502  H HA   . ALA A 1 39 ? -2.376  22.436  1.179   1.00 0.00 ? 39 ALA A HA   6 
ATOM 6503  H HB1  . ALA A 1 39 ? -2.925  19.513  1.066   1.00 0.00 ? 39 ALA A HB1  6 
ATOM 6504  H HB2  . ALA A 1 39 ? -1.389  20.140  0.466   1.00 0.00 ? 39 ALA A HB2  6 
ATOM 6505  H HB3  . ALA A 1 39 ? -1.863  20.417  2.143   1.00 0.00 ? 39 ALA A HB3  6 
ATOM 6506  N N    . ALA A 1 40 ? -4.020  21.595  -1.439  1.00 0.00 ? 40 ALA A N    6 
ATOM 6507  C CA   . ALA A 1 40 ? -4.101  21.750  -2.883  1.00 0.00 ? 40 ALA A CA   6 
ATOM 6508  C C    . ALA A 1 40 ? -4.600  23.140  -3.251  1.00 0.00 ? 40 ALA A C    6 
ATOM 6509  O O    . ALA A 1 40 ? -4.312  23.642  -4.337  1.00 0.00 ? 40 ALA A O    6 
ATOM 6510  C CB   . ALA A 1 40 ? -4.976  20.668  -3.485  1.00 0.00 ? 40 ALA A CB   6 
ATOM 6511  H H    . ALA A 1 40 ? -4.825  21.353  -0.937  1.00 0.00 ? 40 ALA A H    6 
ATOM 6512  H HA   . ALA A 1 40 ? -3.105  21.632  -3.282  1.00 0.00 ? 40 ALA A HA   6 
ATOM 6513  H HB1  . ALA A 1 40 ? -5.959  20.712  -3.045  1.00 0.00 ? 40 ALA A HB1  6 
ATOM 6514  H HB2  . ALA A 1 40 ? -5.047  20.814  -4.552  1.00 0.00 ? 40 ALA A HB2  6 
ATOM 6515  H HB3  . ALA A 1 40 ? -4.532  19.701  -3.281  1.00 0.00 ? 40 ALA A HB3  6 
ATOM 6516  N N    . ARG A 1 41 ? -5.315  23.779  -2.328  1.00 0.00 ? 41 ARG A N    6 
ATOM 6517  C CA   . ARG A 1 41 ? -5.801  25.127  -2.560  1.00 0.00 ? 41 ARG A CA   6 
ATOM 6518  C C    . ARG A 1 41 ? -4.723  26.127  -2.158  1.00 0.00 ? 41 ARG A C    6 
ATOM 6519  O O    . ARG A 1 41 ? -4.784  27.300  -2.525  1.00 0.00 ? 41 ARG A O    6 
ATOM 6520  C CB   . ARG A 1 41 ? -7.087  25.385  -1.778  1.00 0.00 ? 41 ARG A CB   6 
ATOM 6521  C CG   . ARG A 1 41 ? -6.928  25.226  -0.281  1.00 0.00 ? 41 ARG A CG   6 
ATOM 6522  C CD   . ARG A 1 41 ? -8.226  25.512  0.451   1.00 0.00 ? 41 ARG A CD   6 
ATOM 6523  N NE   . ARG A 1 41 ? -8.723  26.858  0.180   1.00 0.00 ? 41 ARG A NE   6 
ATOM 6524  C CZ   . ARG A 1 41 ? -9.846  27.349  0.695   1.00 0.00 ? 41 ARG A CZ   6 
ATOM 6525  N NH1  . ARG A 1 41 ? -10.582 26.615  1.518   1.00 0.00 ? 41 ARG A NH1  6 
ATOM 6526  N NH2  . ARG A 1 41 ? -10.234 28.579  0.391   1.00 0.00 ? 41 ARG A NH2  6 
ATOM 6527  H H    . ARG A 1 41 ? -5.496  23.348  -1.468  1.00 0.00 ? 41 ARG A H    6 
ATOM 6528  H HA   . ARG A 1 41 ? -5.998  25.232  -3.615  1.00 0.00 ? 41 ARG A HA   6 
ATOM 6529  H HB2  . ARG A 1 41 ? -7.417  26.390  -1.975  1.00 0.00 ? 41 ARG A HB2  6 
ATOM 6530  H HB3  . ARG A 1 41 ? -7.846  24.693  -2.112  1.00 0.00 ? 41 ARG A HB3  6 
ATOM 6531  H HG2  . ARG A 1 41 ? -6.628  24.214  -0.075  1.00 0.00 ? 41 ARG A HG2  6 
ATOM 6532  H HG3  . ARG A 1 41 ? -6.168  25.910  0.068   1.00 0.00 ? 41 ARG A HG3  6 
ATOM 6533  H HD2  . ARG A 1 41 ? -8.968  24.793  0.136   1.00 0.00 ? 41 ARG A HD2  6 
ATOM 6534  H HD3  . ARG A 1 41 ? -8.054  25.408  1.513   1.00 0.00 ? 41 ARG A HD3  6 
ATOM 6535  H HE   . ARG A 1 41 ? -8.195  27.424  -0.423  1.00 0.00 ? 41 ARG A HE   6 
ATOM 6536  H HH11 . ARG A 1 41 ? -10.296 25.686  1.752   1.00 0.00 ? 41 ARG A HH11 6 
ATOM 6537  H HH12 . ARG A 1 41 ? -11.424 26.990  1.902   1.00 0.00 ? 41 ARG A HH12 6 
ATOM 6538  H HH21 . ARG A 1 41 ? -9.684  29.137  -0.230  1.00 0.00 ? 41 ARG A HH21 6 
ATOM 6539  H HH22 . ARG A 1 41 ? -11.079 28.946  0.777   1.00 0.00 ? 41 ARG A HH22 6 
ATOM 6540  N N    . GLN A 1 42 ? -3.728  25.640  -1.409  1.00 0.00 ? 42 GLN A N    6 
ATOM 6541  C CA   . GLN A 1 42 ? -2.611  26.460  -0.968  1.00 0.00 ? 42 GLN A CA   6 
ATOM 6542  C C    . GLN A 1 42 ? -1.412  26.278  -1.908  1.00 0.00 ? 42 GLN A C    6 
ATOM 6543  O O    . GLN A 1 42 ? -0.610  25.360  -1.736  1.00 0.00 ? 42 GLN A O    6 
ATOM 6544  C CB   . GLN A 1 42 ? -2.224  26.069  0.453   1.00 0.00 ? 42 GLN A CB   6 
ATOM 6545  C CG   . GLN A 1 42 ? -3.284  26.409  1.487   1.00 0.00 ? 42 GLN A CG   6 
ATOM 6546  C CD   . GLN A 1 42 ? -2.860  26.051  2.898   1.00 0.00 ? 42 GLN A CD   6 
ATOM 6547  O OE1  . GLN A 1 42 ? -1.866  26.564  3.410   1.00 0.00 ? 42 GLN A OE1  6 
ATOM 6548  N NE2  . GLN A 1 42 ? -3.618  25.166  3.537   1.00 0.00 ? 42 GLN A NE2  6 
ATOM 6549  H H    . GLN A 1 42 ? -3.742  24.696  -1.147  1.00 0.00 ? 42 GLN A H    6 
ATOM 6550  H HA   . GLN A 1 42 ? -2.922  27.493  -0.982  1.00 0.00 ? 42 GLN A HA   6 
ATOM 6551  H HB2  . GLN A 1 42 ? -2.053  25.004  0.483   1.00 0.00 ? 42 GLN A HB2  6 
ATOM 6552  H HB3  . GLN A 1 42 ? -1.316  26.575  0.714   1.00 0.00 ? 42 GLN A HB3  6 
ATOM 6553  H HG2  . GLN A 1 42 ? -3.482  27.470  1.447   1.00 0.00 ? 42 GLN A HG2  6 
ATOM 6554  H HG3  . GLN A 1 42 ? -4.188  25.865  1.250   1.00 0.00 ? 42 GLN A HG3  6 
ATOM 6555  H HE21 . GLN A 1 42 ? -4.399  24.802  3.070   1.00 0.00 ? 42 GLN A HE21 6 
ATOM 6556  H HE22 . GLN A 1 42 ? -3.364  24.913  4.449   1.00 0.00 ? 42 GLN A HE22 6 
ATOM 6557  N N    . PRO A 1 43 ? -1.283  27.154  -2.922  1.00 0.00 ? 43 PRO A N    6 
ATOM 6558  C CA   . PRO A 1 43 ? -0.196  27.105  -3.909  1.00 0.00 ? 43 PRO A CA   6 
ATOM 6559  C C    . PRO A 1 43 ? 1.172   26.710  -3.338  1.00 0.00 ? 43 PRO A C    6 
ATOM 6560  O O    . PRO A 1 43 ? 2.027   26.219  -4.069  1.00 0.00 ? 43 PRO A O    6 
ATOM 6561  C CB   . PRO A 1 43 ? -0.150  28.541  -4.420  1.00 0.00 ? 43 PRO A CB   6 
ATOM 6562  C CG   . PRO A 1 43 ? -1.558  29.022  -4.334  1.00 0.00 ? 43 PRO A CG   6 
ATOM 6563  C CD   . PRO A 1 43 ? -2.207  28.274  -3.196  1.00 0.00 ? 43 PRO A CD   6 
ATOM 6564  H HA   . PRO A 1 43 ? -0.439  26.446  -4.726  1.00 0.00 ? 43 PRO A HA   6 
ATOM 6565  H HB2  . PRO A 1 43 ? 0.506   29.127  -3.792  1.00 0.00 ? 43 PRO A HB2  6 
ATOM 6566  H HB3  . PRO A 1 43 ? 0.209   28.554  -5.438  1.00 0.00 ? 43 PRO A HB3  6 
ATOM 6567  H HG2  . PRO A 1 43 ? -1.569  30.082  -4.133  1.00 0.00 ? 43 PRO A HG2  6 
ATOM 6568  H HG3  . PRO A 1 43 ? -2.072  28.811  -5.260  1.00 0.00 ? 43 PRO A HG3  6 
ATOM 6569  H HD2  . PRO A 1 43 ? -2.304  28.911  -2.329  1.00 0.00 ? 43 PRO A HD2  6 
ATOM 6570  H HD3  . PRO A 1 43 ? -3.172  27.905  -3.503  1.00 0.00 ? 43 PRO A HD3  6 
ATOM 6571  N N    . ASP A 1 44 ? 1.392   26.947  -2.051  1.00 0.00 ? 44 ASP A N    6 
ATOM 6572  C CA   . ASP A 1 44 ? 2.682   26.626  -1.436  1.00 0.00 ? 44 ASP A CA   6 
ATOM 6573  C C    . ASP A 1 44 ? 2.766   25.167  -0.973  1.00 0.00 ? 44 ASP A C    6 
ATOM 6574  O O    . ASP A 1 44 ? 3.770   24.757  -0.391  1.00 0.00 ? 44 ASP A O    6 
ATOM 6575  C CB   . ASP A 1 44 ? 2.950   27.571  -0.263  1.00 0.00 ? 44 ASP A CB   6 
ATOM 6576  C CG   . ASP A 1 44 ? 1.828   27.568  0.754   1.00 0.00 ? 44 ASP A CG   6 
ATOM 6577  O OD1  . ASP A 1 44 ? 0.677   27.857  0.366   1.00 0.00 ? 44 ASP A OD1  6 
ATOM 6578  O OD2  . ASP A 1 44 ? 2.101   27.282  1.938   1.00 0.00 ? 44 ASP A OD2  6 
ATOM 6579  H H    . ASP A 1 44 ? 0.691   27.361  -1.509  1.00 0.00 ? 44 ASP A H    6 
ATOM 6580  H HA   . ASP A 1 44 ? 3.445   26.789  -2.184  1.00 0.00 ? 44 ASP A HA   6 
ATOM 6581  H HB2  . ASP A 1 44 ? 3.861   27.269  0.233   1.00 0.00 ? 44 ASP A HB2  6 
ATOM 6582  H HB3  . ASP A 1 44 ? 3.068   28.577  -0.641  1.00 0.00 ? 44 ASP A HB3  6 
ATOM 6583  N N    . LEU A 1 45 ? 1.718   24.385  -1.231  1.00 0.00 ? 45 LEU A N    6 
ATOM 6584  C CA   . LEU A 1 45 ? 1.692   22.977  -0.832  1.00 0.00 ? 45 LEU A CA   6 
ATOM 6585  C C    . LEU A 1 45 ? 1.632   22.039  -2.043  1.00 0.00 ? 45 LEU A C    6 
ATOM 6586  O O    . LEU A 1 45 ? 1.271   20.866  -1.913  1.00 0.00 ? 45 LEU A O    6 
ATOM 6587  C CB   . LEU A 1 45 ? 0.509   22.729  0.104   1.00 0.00 ? 45 LEU A CB   6 
ATOM 6588  C CG   . LEU A 1 45 ? 0.648   23.353  1.496   1.00 0.00 ? 45 LEU A CG   6 
ATOM 6589  C CD1  . LEU A 1 45 ? 1.889   22.828  2.199   1.00 0.00 ? 45 LEU A CD1  6 
ATOM 6590  C CD2  . LEU A 1 45 ? 0.705   24.867  1.394   1.00 0.00 ? 45 LEU A CD2  6 
ATOM 6591  H H    . LEU A 1 45 ? 0.944   24.761  -1.696  1.00 0.00 ? 45 LEU A H    6 
ATOM 6592  H HA   . LEU A 1 45 ? 2.603   22.766  -0.290  1.00 0.00 ? 45 LEU A HA   6 
ATOM 6593  H HB2  . LEU A 1 45 ? -0.376  23.138  -0.357  1.00 0.00 ? 45 LEU A HB2  6 
ATOM 6594  H HB3  . LEU A 1 45 ? 0.379   21.665  0.221   1.00 0.00 ? 45 LEU A HB3  6 
ATOM 6595  H HG   . LEU A 1 45 ? -0.213  23.089  2.092   1.00 0.00 ? 45 LEU A HG   6 
ATOM 6596  H HD11 . LEU A 1 45 ? 1.968   21.762  2.047   1.00 0.00 ? 45 LEU A HD11 6 
ATOM 6597  H HD12 . LEU A 1 45 ? 2.764   23.315  1.796   1.00 0.00 ? 45 LEU A HD12 6 
ATOM 6598  H HD13 . LEU A 1 45 ? 1.816   23.037  3.257   1.00 0.00 ? 45 LEU A HD13 6 
ATOM 6599  H HD21 . LEU A 1 45 ? 0.220   25.187  0.484   1.00 0.00 ? 45 LEU A HD21 6 
ATOM 6600  H HD22 . LEU A 1 45 ? 0.205   25.304  2.244   1.00 0.00 ? 45 LEU A HD22 6 
ATOM 6601  H HD23 . LEU A 1 45 ? 1.737   25.185  1.382   1.00 0.00 ? 45 LEU A HD23 6 
ATOM 6602  N N    . ILE A 1 46 ? 1.997   22.541  -3.224  1.00 0.00 ? 46 ILE A N    6 
ATOM 6603  C CA   . ILE A 1 46 ? 1.979   21.705  -4.423  1.00 0.00 ? 46 ILE A CA   6 
ATOM 6604  C C    . ILE A 1 46 ? 2.763   20.422  -4.191  1.00 0.00 ? 46 ILE A C    6 
ATOM 6605  O O    . ILE A 1 46 ? 2.305   19.341  -4.537  1.00 0.00 ? 46 ILE A O    6 
ATOM 6606  C CB   . ILE A 1 46 ? 2.571   22.405  -5.654  1.00 0.00 ? 46 ILE A CB   6 
ATOM 6607  C CG1  . ILE A 1 46 ? 1.991   23.806  -5.810  1.00 0.00 ? 46 ILE A CG1  6 
ATOM 6608  C CG2  . ILE A 1 46 ? 2.300   21.579  -6.904  1.00 0.00 ? 46 ILE A CG2  6 
ATOM 6609  C CD1  . ILE A 1 46 ? 2.547   24.555  -6.998  1.00 0.00 ? 46 ILE A CD1  6 
ATOM 6610  H H    . ILE A 1 46 ? 2.288   23.474  -3.285  1.00 0.00 ? 46 ILE A H    6 
ATOM 6611  H HA   . ILE A 1 46 ? 0.951   21.454  -4.638  1.00 0.00 ? 46 ILE A HA   6 
ATOM 6612  H HB   . ILE A 1 46 ? 3.634   22.467  -5.524  1.00 0.00 ? 46 ILE A HB   6 
ATOM 6613  H HG12 . ILE A 1 46 ? 0.922   23.733  -5.934  1.00 0.00 ? 46 ILE A HG12 6 
ATOM 6614  H HG13 . ILE A 1 46 ? 2.210   24.376  -4.923  1.00 0.00 ? 46 ILE A HG13 6 
ATOM 6615  H HG21 . ILE A 1 46 ? 2.578   20.551  -6.723  1.00 0.00 ? 46 ILE A HG21 6 
ATOM 6616  H HG22 . ILE A 1 46 ? 1.248   21.629  -7.147  1.00 0.00 ? 46 ILE A HG22 6 
ATOM 6617  H HG23 . ILE A 1 46 ? 2.879   21.969  -7.726  1.00 0.00 ? 46 ILE A HG23 6 
ATOM 6618  H HD11 . ILE A 1 46 ? 3.489   24.113  -7.295  1.00 0.00 ? 46 ILE A HD11 6 
ATOM 6619  H HD12 . ILE A 1 46 ? 1.849   24.498  -7.818  1.00 0.00 ? 46 ILE A HD12 6 
ATOM 6620  H HD13 . ILE A 1 46 ? 2.704   25.589  -6.729  1.00 0.00 ? 46 ILE A HD13 6 
ATOM 6621  N N    . PRO A 1 47 ? 3.967   20.512  -3.603  1.00 0.00 ? 47 PRO A N    6 
ATOM 6622  C CA   . PRO A 1 47 ? 4.776   19.330  -3.337  1.00 0.00 ? 47 PRO A CA   6 
ATOM 6623  C C    . PRO A 1 47 ? 4.122   18.466  -2.274  1.00 0.00 ? 47 PRO A C    6 
ATOM 6624  O O    . PRO A 1 47 ? 4.367   17.259  -2.196  1.00 0.00 ? 47 PRO A O    6 
ATOM 6625  C CB   . PRO A 1 47 ? 6.117   19.886  -2.844  1.00 0.00 ? 47 PRO A CB   6 
ATOM 6626  C CG   . PRO A 1 47 ? 6.085   21.347  -3.156  1.00 0.00 ? 47 PRO A CG   6 
ATOM 6627  C CD   . PRO A 1 47 ? 4.634   21.742  -3.152  1.00 0.00 ? 47 PRO A CD   6 
ATOM 6628  H HA   . PRO A 1 47 ? 4.917   18.743  -4.234  1.00 0.00 ? 47 PRO A HA   6 
ATOM 6629  H HB2  . PRO A 1 47 ? 6.211   19.715  -1.781  1.00 0.00 ? 47 PRO A HB2  6 
ATOM 6630  H HB3  . PRO A 1 47 ? 6.925   19.392  -3.364  1.00 0.00 ? 47 PRO A HB3  6 
ATOM 6631  H HG2  . PRO A 1 47 ? 6.624   21.895  -2.399  1.00 0.00 ? 47 PRO A HG2  6 
ATOM 6632  H HG3  . PRO A 1 47 ? 6.518   21.524  -4.130  1.00 0.00 ? 47 PRO A HG3  6 
ATOM 6633  H HD2  . PRO A 1 47 ? 4.320   22.014  -2.156  1.00 0.00 ? 47 PRO A HD2  6 
ATOM 6634  H HD3  . PRO A 1 47 ? 4.461   22.554  -3.841  1.00 0.00 ? 47 PRO A HD3  6 
ATOM 6635  N N    . LEU A 1 48 ? 3.265   19.095  -1.473  1.00 0.00 ? 48 LEU A N    6 
ATOM 6636  C CA   . LEU A 1 48 ? 2.537   18.387  -0.440  1.00 0.00 ? 48 LEU A CA   6 
ATOM 6637  C C    . LEU A 1 48 ? 1.544   17.468  -1.127  1.00 0.00 ? 48 LEU A C    6 
ATOM 6638  O O    . LEU A 1 48 ? 1.321   16.337  -0.703  1.00 0.00 ? 48 LEU A O    6 
ATOM 6639  C CB   . LEU A 1 48 ? 1.814   19.374  0.487   1.00 0.00 ? 48 LEU A CB   6 
ATOM 6640  C CG   . LEU A 1 48 ? 1.205   18.750  1.744   1.00 0.00 ? 48 LEU A CG   6 
ATOM 6641  C CD1  . LEU A 1 48 ? 2.266   18.003  2.540   1.00 0.00 ? 48 LEU A CD1  6 
ATOM 6642  C CD2  . LEU A 1 48 ? 0.549   19.820  2.605   1.00 0.00 ? 48 LEU A CD2  6 
ATOM 6643  H H    . LEU A 1 48 ? 3.098   20.054  -1.602  1.00 0.00 ? 48 LEU A H    6 
ATOM 6644  H HA   . LEU A 1 48 ? 3.240   17.796  0.129   1.00 0.00 ? 48 LEU A HA   6 
ATOM 6645  H HB2  . LEU A 1 48 ? 2.522   20.132  0.793   1.00 0.00 ? 48 LEU A HB2  6 
ATOM 6646  H HB3  . LEU A 1 48 ? 1.019   19.854  -0.072  1.00 0.00 ? 48 LEU A HB3  6 
ATOM 6647  H HG   . LEU A 1 48 ? 0.444   18.041  1.453   1.00 0.00 ? 48 LEU A HG   6 
ATOM 6648  H HD11 . LEU A 1 48 ? 3.226   18.116  2.058   1.00 0.00 ? 48 LEU A HD11 6 
ATOM 6649  H HD12 . LEU A 1 48 ? 2.317   18.405  3.540   1.00 0.00 ? 48 LEU A HD12 6 
ATOM 6650  H HD13 . LEU A 1 48 ? 2.009   16.955  2.586   1.00 0.00 ? 48 LEU A HD13 6 
ATOM 6651  H HD21 . LEU A 1 48 ? 0.283   20.666  1.989   1.00 0.00 ? 48 LEU A HD21 6 
ATOM 6652  H HD22 . LEU A 1 48 ? -0.340  19.415  3.066   1.00 0.00 ? 48 LEU A HD22 6 
ATOM 6653  H HD23 . LEU A 1 48 ? 1.240   20.137  3.372   1.00 0.00 ? 48 LEU A HD23 6 
ATOM 6654  N N    . LEU A 1 49 ? 0.987   17.978  -2.227  1.00 0.00 ? 49 LEU A N    6 
ATOM 6655  C CA   . LEU A 1 49 ? 0.034   17.241  -3.050  1.00 0.00 ? 49 LEU A CA   6 
ATOM 6656  C C    . LEU A 1 49 ? 0.507   15.816  -3.304  1.00 0.00 ? 49 LEU A C    6 
ATOM 6657  O O    . LEU A 1 49 ? -0.123  14.848  -2.875  1.00 0.00 ? 49 LEU A O    6 
ATOM 6658  C CB   . LEU A 1 49 ? -0.142  17.960  -4.392  1.00 0.00 ? 49 LEU A CB   6 
ATOM 6659  C CG   . LEU A 1 49 ? -0.747  19.362  -4.313  1.00 0.00 ? 49 LEU A CG   6 
ATOM 6660  C CD1  . LEU A 1 49 ? -0.978  19.928  -5.711  1.00 0.00 ? 49 LEU A CD1  6 
ATOM 6661  C CD2  . LEU A 1 49 ? -2.046  19.336  -3.523  1.00 0.00 ? 49 LEU A CD2  6 
ATOM 6662  H H    . LEU A 1 49 ? 1.245   18.884  -2.507  1.00 0.00 ? 49 LEU A H    6 
ATOM 6663  H HA   . LEU A 1 49 ? -0.911  17.212  -2.535  1.00 0.00 ? 49 LEU A HA   6 
ATOM 6664  H HB2  . LEU A 1 49 ? 0.834   18.041  -4.862  1.00 0.00 ? 49 LEU A HB2  6 
ATOM 6665  H HB3  . LEU A 1 49 ? -0.773  17.353  -5.021  1.00 0.00 ? 49 LEU A HB3  6 
ATOM 6666  H HG   . LEU A 1 49 ? -0.057  20.016  -3.801  1.00 0.00 ? 49 LEU A HG   6 
ATOM 6667  H HD11 . LEU A 1 49 ? -0.528  19.275  -6.445  1.00 0.00 ? 49 LEU A HD11 6 
ATOM 6668  H HD12 . LEU A 1 49 ? -2.040  20.002  -5.900  1.00 0.00 ? 49 LEU A HD12 6 
ATOM 6669  H HD13 . LEU A 1 49 ? -0.533  20.909  -5.782  1.00 0.00 ? 49 LEU A HD13 6 
ATOM 6670  H HD21 . LEU A 1 49 ? -1.999  18.564  -2.773  1.00 0.00 ? 49 LEU A HD21 6 
ATOM 6671  H HD22 . LEU A 1 49 ? -2.189  20.289  -3.045  1.00 0.00 ? 49 LEU A HD22 6 
ATOM 6672  H HD23 . LEU A 1 49 ? -2.871  19.138  -4.191  1.00 0.00 ? 49 LEU A HD23 6 
ATOM 6673  N N    . ARG A 1 50 ? 1.610   15.701  -4.027  1.00 0.00 ? 50 ARG A N    6 
ATOM 6674  C CA   . ARG A 1 50 ? 2.175   14.414  -4.372  1.00 0.00 ? 50 ARG A CA   6 
ATOM 6675  C C    . ARG A 1 50 ? 2.698   13.699  -3.132  1.00 0.00 ? 50 ARG A C    6 
ATOM 6676  O O    . ARG A 1 50 ? 2.515   12.490  -2.972  1.00 0.00 ? 50 ARG A O    6 
ATOM 6677  C CB   . ARG A 1 50 ? 3.307   14.617  -5.371  1.00 0.00 ? 50 ARG A CB   6 
ATOM 6678  C CG   . ARG A 1 50 ? 4.423   15.503  -4.840  1.00 0.00 ? 50 ARG A CG   6 
ATOM 6679  C CD   . ARG A 1 50 ? 5.503   15.736  -5.881  1.00 0.00 ? 50 ARG A CD   6 
ATOM 6680  N NE   . ARG A 1 50 ? 6.599   16.544  -5.349  1.00 0.00 ? 50 ARG A NE   6 
ATOM 6681  C CZ   . ARG A 1 50 ? 7.667   16.904  -6.056  1.00 0.00 ? 50 ARG A CZ   6 
ATOM 6682  N NH1  . ARG A 1 50 ? 7.784   16.540  -7.326  1.00 0.00 ? 50 ARG A NH1  6 
ATOM 6683  N NH2  . ARG A 1 50 ? 8.621   17.632  -5.491  1.00 0.00 ? 50 ARG A NH2  6 
ATOM 6684  H H    . ARG A 1 50 ? 2.054   16.510  -4.352  1.00 0.00 ? 50 ARG A H    6 
ATOM 6685  H HA   . ARG A 1 50 ? 1.401   13.816  -4.833  1.00 0.00 ? 50 ARG A HA   6 
ATOM 6686  H HB2  . ARG A 1 50 ? 3.723   13.661  -5.617  1.00 0.00 ? 50 ARG A HB2  6 
ATOM 6687  H HB3  . ARG A 1 50 ? 2.910   15.070  -6.266  1.00 0.00 ? 50 ARG A HB3  6 
ATOM 6688  H HG2  . ARG A 1 50 ? 4.005   16.456  -4.552  1.00 0.00 ? 50 ARG A HG2  6 
ATOM 6689  H HG3  . ARG A 1 50 ? 4.865   15.028  -3.976  1.00 0.00 ? 50 ARG A HG3  6 
ATOM 6690  H HD2  . ARG A 1 50 ? 5.893   14.781  -6.200  1.00 0.00 ? 50 ARG A HD2  6 
ATOM 6691  H HD3  . ARG A 1 50 ? 5.066   16.249  -6.726  1.00 0.00 ? 50 ARG A HD3  6 
ATOM 6692  H HE   . ARG A 1 50 ? 6.536   16.832  -4.414  1.00 0.00 ? 50 ARG A HE   6 
ATOM 6693  H HH11 . ARG A 1 50 ? 7.067   15.992  -7.759  1.00 0.00 ? 50 ARG A HH11 6 
ATOM 6694  H HH12 . ARG A 1 50 ? 8.591   16.812  -7.851  1.00 0.00 ? 50 ARG A HH12 6 
ATOM 6695  H HH21 . ARG A 1 50 ? 8.537   17.910  -4.534  1.00 0.00 ? 50 ARG A HH21 6 
ATOM 6696  H HH22 . ARG A 1 50 ? 9.422   17.903  -6.023  1.00 0.00 ? 50 ARG A HH22 6 
ATOM 6697  N N    . THR A 1 51 ? 3.359   14.455  -2.263  1.00 0.00 ? 51 THR A N    6 
ATOM 6698  C CA   . THR A 1 51 ? 3.928   13.897  -1.042  1.00 0.00 ? 51 THR A CA   6 
ATOM 6699  C C    . THR A 1 51 ? 2.858   13.245  -0.176  1.00 0.00 ? 51 THR A C    6 
ATOM 6700  O O    . THR A 1 51 ? 3.089   12.198  0.422   1.00 0.00 ? 51 THR A O    6 
ATOM 6701  C CB   . THR A 1 51 ? 4.640   14.990  -0.249  1.00 0.00 ? 51 THR A CB   6 
ATOM 6702  O OG1  . THR A 1 51 ? 5.608   15.633  -1.053  1.00 0.00 ? 51 THR A OG1  6 
ATOM 6703  C CG2  . THR A 1 51 ? 5.340   14.479  0.991   1.00 0.00 ? 51 THR A CG2  6 
ATOM 6704  H H    . THR A 1 51 ? 3.479   15.414  -2.451  1.00 0.00 ? 51 THR A H    6 
ATOM 6705  H HA   . THR A 1 51 ? 4.650   13.144  -1.333  1.00 0.00 ? 51 THR A HA   6 
ATOM 6706  H HB   . THR A 1 51 ? 3.912   15.726  0.062   1.00 0.00 ? 51 THR A HB   6 
ATOM 6707  H HG1  . THR A 1 51 ? 5.166   16.089  -1.777  1.00 0.00 ? 51 THR A HG1  6 
ATOM 6708  H HG21 . THR A 1 51 ? 5.105   13.436  1.136   1.00 0.00 ? 51 THR A HG21 6 
ATOM 6709  H HG22 . THR A 1 51 ? 6.406   14.596  0.872   1.00 0.00 ? 51 THR A HG22 6 
ATOM 6710  H HG23 . THR A 1 51 ? 5.011   15.047  1.849   1.00 0.00 ? 51 THR A HG23 6 
ATOM 6711  N N    . GLN A 1 52 ? 1.689   13.871  -0.104  1.00 0.00 ? 52 GLN A N    6 
ATOM 6712  C CA   . GLN A 1 52 ? 0.595   13.341  0.702   1.00 0.00 ? 52 GLN A CA   6 
ATOM 6713  C C    . GLN A 1 52 ? -0.159  12.274  -0.073  1.00 0.00 ? 52 GLN A C    6 
ATOM 6714  O O    . GLN A 1 52 ? -0.677  11.323  0.501   1.00 0.00 ? 52 GLN A O    6 
ATOM 6715  C CB   . GLN A 1 52 ? -0.370  14.454  1.113   1.00 0.00 ? 52 GLN A CB   6 
ATOM 6716  C CG   . GLN A 1 52 ? -1.190  15.010  -0.042  1.00 0.00 ? 52 GLN A CG   6 
ATOM 6717  C CD   . GLN A 1 52 ? -2.114  16.127  0.389   1.00 0.00 ? 52 GLN A CD   6 
ATOM 6718  O OE1  . GLN A 1 52 ? -3.058  15.908  1.147   1.00 0.00 ? 52 GLN A OE1  6 
ATOM 6719  N NE2  . GLN A 1 52 ? -1.840  17.333  -0.085  1.00 0.00 ? 52 GLN A NE2  6 
ATOM 6720  H H    . GLN A 1 52 ? 1.561   14.706  -0.599  1.00 0.00 ? 52 GLN A H    6 
ATOM 6721  H HA   . GLN A 1 52 ? 1.018   12.896  1.593   1.00 0.00 ? 52 GLN A HA   6 
ATOM 6722  H HB2  . GLN A 1 52 ? -1.053  14.065  1.854   1.00 0.00 ? 52 GLN A HB2  6 
ATOM 6723  H HB3  . GLN A 1 52 ? 0.197   15.264  1.548   1.00 0.00 ? 52 GLN A HB3  6 
ATOM 6724  H HG2  . GLN A 1 52 ? -0.522  15.389  -0.797  1.00 0.00 ? 52 GLN A HG2  6 
ATOM 6725  H HG3  . GLN A 1 52 ? -1.785  14.211  -0.460  1.00 0.00 ? 52 GLN A HG3  6 
ATOM 6726  H HE21 . GLN A 1 52 ? -1.066  17.432  -0.677  1.00 0.00 ? 52 GLN A HE21 6 
ATOM 6727  H HE22 . GLN A 1 52 ? -2.423  18.073  0.171   1.00 0.00 ? 52 GLN A HE22 6 
ATOM 6728  N N    . PHE A 1 53 ? -0.218  12.440  -1.387  1.00 0.00 ? 53 PHE A N    6 
ATOM 6729  C CA   . PHE A 1 53 ? -0.916  11.487  -2.237  1.00 0.00 ? 53 PHE A CA   6 
ATOM 6730  C C    . PHE A 1 53 ? -0.314  10.094  -2.090  1.00 0.00 ? 53 PHE A C    6 
ATOM 6731  O O    . PHE A 1 53 ? -1.031  9.125   -1.842  1.00 0.00 ? 53 PHE A O    6 
ATOM 6732  C CB   . PHE A 1 53 ? -0.855  11.927  -3.708  1.00 0.00 ? 53 PHE A CB   6 
ATOM 6733  C CG   . PHE A 1 53 ? -1.546  10.978  -4.651  1.00 0.00 ? 53 PHE A CG   6 
ATOM 6734  C CD1  . PHE A 1 53 ? -2.905  10.736  -4.537  1.00 0.00 ? 53 PHE A CD1  6 
ATOM 6735  C CD2  . PHE A 1 53 ? -0.835  10.322  -5.644  1.00 0.00 ? 53 PHE A CD2  6 
ATOM 6736  C CE1  . PHE A 1 53 ? -3.542  9.858   -5.394  1.00 0.00 ? 53 PHE A CE1  6 
ATOM 6737  C CE2  . PHE A 1 53 ? -1.468  9.445   -6.504  1.00 0.00 ? 53 PHE A CE2  6 
ATOM 6738  C CZ   . PHE A 1 53 ? -2.823  9.212   -6.378  1.00 0.00 ? 53 PHE A CZ   6 
ATOM 6739  H H    . PHE A 1 53 ? 0.215   13.219  -1.792  1.00 0.00 ? 53 PHE A H    6 
ATOM 6740  H HA   . PHE A 1 53 ? -1.955  11.457  -1.921  1.00 0.00 ? 53 PHE A HA   6 
ATOM 6741  H HB2  . PHE A 1 53 ? -1.323  12.894  -3.809  1.00 0.00 ? 53 PHE A HB2  6 
ATOM 6742  H HB3  . PHE A 1 53 ? 0.179   11.999  -4.009  1.00 0.00 ? 53 PHE A HB3  6 
ATOM 6743  H HD1  . PHE A 1 53 ? -3.471  11.240  -3.768  1.00 0.00 ? 53 PHE A HD1  6 
ATOM 6744  H HD2  . PHE A 1 53 ? 0.224   10.503  -5.744  1.00 0.00 ? 53 PHE A HD2  6 
ATOM 6745  H HE1  . PHE A 1 53 ? -4.602  9.679   -5.294  1.00 0.00 ? 53 PHE A HE1  6 
ATOM 6746  H HE2  . PHE A 1 53 ? -0.903  8.941   -7.274  1.00 0.00 ? 53 PHE A HE2  6 
ATOM 6747  H HZ   . PHE A 1 53 ? -3.319  8.525   -7.049  1.00 0.00 ? 53 PHE A HZ   6 
ATOM 6748  N N    . PHE A 1 54 ? 1.004   9.995   -2.256  1.00 0.00 ? 54 PHE A N    6 
ATOM 6749  C CA   . PHE A 1 54 ? 1.679   8.705   -2.163  1.00 0.00 ? 54 PHE A CA   6 
ATOM 6750  C C    . PHE A 1 54 ? 1.780   8.227   -0.705  1.00 0.00 ? 54 PHE A C    6 
ATOM 6751  O O    . PHE A 1 54 ? 1.690   7.028   -0.440  1.00 0.00 ? 54 PHE A O    6 
ATOM 6752  C CB   . PHE A 1 54 ? 3.053   8.767   -2.860  1.00 0.00 ? 54 PHE A CB   6 
ATOM 6753  C CG   . PHE A 1 54 ? 4.207   9.168   -1.988  1.00 0.00 ? 54 PHE A CG   6 
ATOM 6754  C CD1  . PHE A 1 54 ? 4.166   10.328  -1.246  1.00 0.00 ? 54 PHE A CD1  6 
ATOM 6755  C CD2  . PHE A 1 54 ? 5.337   8.372   -1.922  1.00 0.00 ? 54 PHE A CD2  6 
ATOM 6756  C CE1  . PHE A 1 54 ? 5.230   10.687  -0.448  1.00 0.00 ? 54 PHE A CE1  6 
ATOM 6757  C CE2  . PHE A 1 54 ? 6.402   8.728   -1.126  1.00 0.00 ? 54 PHE A CE2  6 
ATOM 6758  C CZ   . PHE A 1 54 ? 6.347   9.886   -0.387  1.00 0.00 ? 54 PHE A CZ   6 
ATOM 6759  H H    . PHE A 1 54 ? 1.527   10.799  -2.462  1.00 0.00 ? 54 PHE A H    6 
ATOM 6760  H HA   . PHE A 1 54 ? 1.063   7.990   -2.703  1.00 0.00 ? 54 PHE A HA   6 
ATOM 6761  H HB2  . PHE A 1 54 ? 3.279   7.796   -3.267  1.00 0.00 ? 54 PHE A HB2  6 
ATOM 6762  H HB3  . PHE A 1 54 ? 2.995   9.482   -3.669  1.00 0.00 ? 54 PHE A HB3  6 
ATOM 6763  H HD1  . PHE A 1 54 ? 3.288   10.957  -1.291  1.00 0.00 ? 54 PHE A HD1  6 
ATOM 6764  H HD2  . PHE A 1 54 ? 5.380   7.462   -2.502  1.00 0.00 ? 54 PHE A HD2  6 
ATOM 6765  H HE1  . PHE A 1 54 ? 5.189   11.598  0.130   1.00 0.00 ? 54 PHE A HE1  6 
ATOM 6766  H HE2  . PHE A 1 54 ? 7.279   8.098   -1.078  1.00 0.00 ? 54 PHE A HE2  6 
ATOM 6767  H HZ   . PHE A 1 54 ? 7.180   10.166  0.241   1.00 0.00 ? 54 PHE A HZ   6 
ATOM 6768  N N    . ILE A 1 55 ? 1.929   9.161   0.242   1.00 0.00 ? 55 ILE A N    6 
ATOM 6769  C CA   . ILE A 1 55 ? 1.992   8.796   1.666   1.00 0.00 ? 55 ILE A CA   6 
ATOM 6770  C C    . ILE A 1 55 ? 0.631   8.311   2.141   1.00 0.00 ? 55 ILE A C    6 
ATOM 6771  O O    . ILE A 1 55 ? 0.500   7.227   2.700   1.00 0.00 ? 55 ILE A O    6 
ATOM 6772  C CB   . ILE A 1 55 ? 2.418   9.981   2.577   1.00 0.00 ? 55 ILE A CB   6 
ATOM 6773  C CG1  . ILE A 1 55 ? 3.862   10.393  2.306   1.00 0.00 ? 55 ILE A CG1  6 
ATOM 6774  C CG2  . ILE A 1 55 ? 2.240   9.629   4.055   1.00 0.00 ? 55 ILE A CG2  6 
ATOM 6775  C CD1  . ILE A 1 55 ? 4.888   9.387   2.784   1.00 0.00 ? 55 ILE A CD1  6 
ATOM 6776  H H    . ILE A 1 55 ? 1.966   10.106  -0.017  1.00 0.00 ? 55 ILE A H    6 
ATOM 6777  H HA   . ILE A 1 55 ? 2.708   7.997   1.779   1.00 0.00 ? 55 ILE A HA   6 
ATOM 6778  H HB   . ILE A 1 55 ? 1.769   10.816  2.358   1.00 0.00 ? 55 ILE A HB   6 
ATOM 6779  H HG12 . ILE A 1 55 ? 3.991   10.519  1.250   1.00 0.00 ? 55 ILE A HG12 6 
ATOM 6780  H HG13 . ILE A 1 55 ? 4.060   11.332  2.802   1.00 0.00 ? 55 ILE A HG13 6 
ATOM 6781  H HG21 . ILE A 1 55 ? 1.879   8.615   4.145   1.00 0.00 ? 55 ILE A HG21 6 
ATOM 6782  H HG22 . ILE A 1 55 ? 3.188   9.720   4.565   1.00 0.00 ? 55 ILE A HG22 6 
ATOM 6783  H HG23 . ILE A 1 55 ? 1.526   10.305  4.501   1.00 0.00 ? 55 ILE A HG23 6 
ATOM 6784  H HD11 . ILE A 1 55 ? 4.386   8.556   3.258   1.00 0.00 ? 55 ILE A HD11 6 
ATOM 6785  H HD12 . ILE A 1 55 ? 5.460   9.030   1.944   1.00 0.00 ? 55 ILE A HD12 6 
ATOM 6786  H HD13 . ILE A 1 55 ? 5.552   9.859   3.494   1.00 0.00 ? 55 ILE A HD13 6 
ATOM 6787  N N    . VAL A 1 56 ? -0.375  9.147   1.930   1.00 0.00 ? 56 VAL A N    6 
ATOM 6788  C CA   . VAL A 1 56 ? -1.733  8.843   2.351   1.00 0.00 ? 56 VAL A CA   6 
ATOM 6789  C C    . VAL A 1 56 ? -2.306  7.635   1.615   1.00 0.00 ? 56 VAL A C    6 
ATOM 6790  O O    . VAL A 1 56 ? -3.037  6.841   2.196   1.00 0.00 ? 56 VAL A O    6 
ATOM 6791  C CB   . VAL A 1 56 ? -2.663  10.057  2.148   1.00 0.00 ? 56 VAL A CB   6 
ATOM 6792  C CG1  . VAL A 1 56 ? -4.077  9.740   2.614   1.00 0.00 ? 56 VAL A CG1  6 
ATOM 6793  C CG2  . VAL A 1 56 ? -2.110  11.275  2.877   1.00 0.00 ? 56 VAL A CG2  6 
ATOM 6794  H H    . VAL A 1 56 ? -0.193  10.002  1.498   1.00 0.00 ? 56 VAL A H    6 
ATOM 6795  H HA   . VAL A 1 56 ? -1.697  8.615   3.411   1.00 0.00 ? 56 VAL A HA   6 
ATOM 6796  H HB   . VAL A 1 56 ? -2.698  10.283  1.093   1.00 0.00 ? 56 VAL A HB   6 
ATOM 6797  H HG11 . VAL A 1 56 ? -4.035  9.064   3.455   1.00 0.00 ? 56 VAL A HG11 6 
ATOM 6798  H HG12 . VAL A 1 56 ? -4.573  10.653  2.909   1.00 0.00 ? 56 VAL A HG12 6 
ATOM 6799  H HG13 . VAL A 1 56 ? -4.626  9.277   1.807   1.00 0.00 ? 56 VAL A HG13 6 
ATOM 6800  H HG21 . VAL A 1 56 ? -1.183  11.013  3.364   1.00 0.00 ? 56 VAL A HG21 6 
ATOM 6801  H HG22 . VAL A 1 56 ? -1.930  12.068  2.167   1.00 0.00 ? 56 VAL A HG22 6 
ATOM 6802  H HG23 . VAL A 1 56 ? -2.824  11.610  3.616   1.00 0.00 ? 56 VAL A HG23 6 
ATOM 6803  N N    . MET A 1 57 ? -1.984  7.488   0.340   1.00 0.00 ? 57 MET A N    6 
ATOM 6804  C CA   . MET A 1 57 ? -2.482  6.362   -0.425  1.00 0.00 ? 57 MET A CA   6 
ATOM 6805  C C    . MET A 1 57 ? -1.623  5.128   -0.176  1.00 0.00 ? 57 MET A C    6 
ATOM 6806  O O    . MET A 1 57 ? -2.100  3.995   -0.252  1.00 0.00 ? 57 MET A O    6 
ATOM 6807  C CB   . MET A 1 57 ? -2.491  6.707   -1.910  1.00 0.00 ? 57 MET A CB   6 
ATOM 6808  C CG   . MET A 1 57 ? -3.456  7.823   -2.276  1.00 0.00 ? 57 MET A CG   6 
ATOM 6809  S SD   . MET A 1 57 ? -5.168  7.426   -1.875  1.00 0.00 ? 57 MET A SD   6 
ATOM 6810  C CE   . MET A 1 57 ? -6.007  8.866   -2.533  1.00 0.00 ? 57 MET A CE   6 
ATOM 6811  H H    . MET A 1 57 ? -1.401  8.143   -0.098  1.00 0.00 ? 57 MET A H    6 
ATOM 6812  H HA   . MET A 1 57 ? -3.488  6.154   -0.100  1.00 0.00 ? 57 MET A HA   6 
ATOM 6813  H HB2  . MET A 1 57 ? -1.498  7.012   -2.201  1.00 0.00 ? 57 MET A HB2  6 
ATOM 6814  H HB3  . MET A 1 57 ? -2.763  5.830   -2.466  1.00 0.00 ? 57 MET A HB3  6 
ATOM 6815  H HG2  . MET A 1 57 ? -3.174  8.714   -1.736  1.00 0.00 ? 57 MET A HG2  6 
ATOM 6816  H HG3  . MET A 1 57 ? -3.385  8.009   -3.337  1.00 0.00 ? 57 MET A HG3  6 
ATOM 6817  H HE1  . MET A 1 57 ? -5.661  9.053   -3.540  1.00 0.00 ? 57 MET A HE1  6 
ATOM 6818  H HE2  . MET A 1 57 ? -7.072  8.688   -2.546  1.00 0.00 ? 57 MET A HE2  6 
ATOM 6819  H HE3  . MET A 1 57 ? -5.793  9.723   -1.913  1.00 0.00 ? 57 MET A HE3  6 
ATOM 6820  N N    . GLY A 1 58 ? -0.352  5.361   0.117   1.00 0.00 ? 58 GLY A N    6 
ATOM 6821  C CA   . GLY A 1 58 ? 0.570   4.270   0.359   1.00 0.00 ? 58 GLY A CA   6 
ATOM 6822  C C    . GLY A 1 58 ? 0.492   3.699   1.762   1.00 0.00 ? 58 GLY A C    6 
ATOM 6823  O O    . GLY A 1 58 ? 0.621   2.488   1.938   1.00 0.00 ? 58 GLY A O    6 
ATOM 6824  H H    . GLY A 1 58 ? -0.036  6.286   0.159   1.00 0.00 ? 58 GLY A H    6 
ATOM 6825  H HA2  . GLY A 1 58 ? 0.358   3.478   -0.344  1.00 0.00 ? 58 GLY A HA2  6 
ATOM 6826  H HA3  . GLY A 1 58 ? 1.574   4.620   0.183   1.00 0.00 ? 58 GLY A HA3  6 
ATOM 6827  N N    . LEU A 1 59 ? 0.291   4.550   2.771   1.00 0.00 ? 59 LEU A N    6 
ATOM 6828  C CA   . LEU A 1 59 ? 0.213   4.067   4.143   1.00 0.00 ? 59 LEU A CA   6 
ATOM 6829  C C    . LEU A 1 59 ? -1.092  3.301   4.352   1.00 0.00 ? 59 LEU A C    6 
ATOM 6830  O O    . LEU A 1 59 ? -1.198  2.458   5.243   1.00 0.00 ? 59 LEU A O    6 
ATOM 6831  C CB   . LEU A 1 59 ? 0.368   5.227   5.147   1.00 0.00 ? 59 LEU A CB   6 
ATOM 6832  C CG   . LEU A 1 59 ? -0.899  5.977   5.560   1.00 0.00 ? 59 LEU A CG   6 
ATOM 6833  C CD1  . LEU A 1 59 ? -1.673  6.428   4.350   1.00 0.00 ? 59 LEU A CD1  6 
ATOM 6834  C CD2  . LEU A 1 59 ? -1.764  5.130   6.487   1.00 0.00 ? 59 LEU A CD2  6 
ATOM 6835  H H    . LEU A 1 59 ? 0.195   5.509   2.593   1.00 0.00 ? 59 LEU A H    6 
ATOM 6836  H HA   . LEU A 1 59 ? 1.033   3.377   4.284   1.00 0.00 ? 59 LEU A HA   6 
ATOM 6837  H HB2  . LEU A 1 59 ? 0.812   4.838   6.035   1.00 0.00 ? 59 LEU A HB2  6 
ATOM 6838  H HB3  . LEU A 1 59 ? 1.051   5.945   4.718   1.00 0.00 ? 59 LEU A HB3  6 
ATOM 6839  H HG   . LEU A 1 59 ? -0.606  6.863   6.101   1.00 0.00 ? 59 LEU A HG   6 
ATOM 6840  H HD11 . LEU A 1 59 ? -1.541  5.723   3.552   1.00 0.00 ? 59 LEU A HD11 6 
ATOM 6841  H HD12 . LEU A 1 59 ? -2.720  6.507   4.599   1.00 0.00 ? 59 LEU A HD12 6 
ATOM 6842  H HD13 . LEU A 1 59 ? -1.304  7.386   4.042   1.00 0.00 ? 59 LEU A HD13 6 
ATOM 6843  H HD21 . LEU A 1 59 ? -1.283  4.180   6.662   1.00 0.00 ? 59 LEU A HD21 6 
ATOM 6844  H HD22 . LEU A 1 59 ? -1.894  5.646   7.426   1.00 0.00 ? 59 LEU A HD22 6 
ATOM 6845  H HD23 . LEU A 1 59 ? -2.728  4.967   6.030   1.00 0.00 ? 59 LEU A HD23 6 
ATOM 6846  N N    . VAL A 1 60 ? -2.065  3.575   3.486   1.00 0.00 ? 60 VAL A N    6 
ATOM 6847  C CA   . VAL A 1 60 ? -3.354  2.905   3.526   1.00 0.00 ? 60 VAL A CA   6 
ATOM 6848  C C    . VAL A 1 60 ? -3.296  1.629   2.693   1.00 0.00 ? 60 VAL A C    6 
ATOM 6849  O O    . VAL A 1 60 ? -3.754  0.571   3.124   1.00 0.00 ? 60 VAL A O    6 
ATOM 6850  C CB   . VAL A 1 60 ? -4.486  3.828   3.009   1.00 0.00 ? 60 VAL A CB   6 
ATOM 6851  C CG1  . VAL A 1 60 ? -5.798  3.070   2.882   1.00 0.00 ? 60 VAL A CG1  6 
ATOM 6852  C CG2  . VAL A 1 60 ? -4.661  5.020   3.936   1.00 0.00 ? 60 VAL A CG2  6 
ATOM 6853  H H    . VAL A 1 60 ? -1.900  4.232   2.780   1.00 0.00 ? 60 VAL A H    6 
ATOM 6854  H HA   . VAL A 1 60 ? -3.568  2.646   4.556   1.00 0.00 ? 60 VAL A HA   6 
ATOM 6855  H HB   . VAL A 1 60 ? -4.209  4.198   2.030   1.00 0.00 ? 60 VAL A HB   6 
ATOM 6856  H HG11 . VAL A 1 60 ? -5.659  2.216   2.237   1.00 0.00 ? 60 VAL A HG11 6 
ATOM 6857  H HG12 . VAL A 1 60 ? -6.117  2.737   3.858   1.00 0.00 ? 60 VAL A HG12 6 
ATOM 6858  H HG13 . VAL A 1 60 ? -6.548  3.724   2.461   1.00 0.00 ? 60 VAL A HG13 6 
ATOM 6859  H HG21 . VAL A 1 60 ? -4.285  4.771   4.917   1.00 0.00 ? 60 VAL A HG21 6 
ATOM 6860  H HG22 . VAL A 1 60 ? -4.115  5.862   3.547   1.00 0.00 ? 60 VAL A HG22 6 
ATOM 6861  H HG23 . VAL A 1 60 ? -5.708  5.273   4.006   1.00 0.00 ? 60 VAL A HG23 6 
ATOM 6862  N N    . ASP A 1 61 ? -2.709  1.731   1.504   1.00 0.00 ? 61 ASP A N    6 
ATOM 6863  C CA   . ASP A 1 61 ? -2.572  0.588   0.624   1.00 0.00 ? 61 ASP A CA   6 
ATOM 6864  C C    . ASP A 1 61 ? -1.486  -0.358  1.132   1.00 0.00 ? 61 ASP A C    6 
ATOM 6865  O O    . ASP A 1 61 ? -1.476  -1.550  0.807   1.00 0.00 ? 61 ASP A O    6 
ATOM 6866  C CB   . ASP A 1 61 ? -2.237  1.064   -0.787  1.00 0.00 ? 61 ASP A CB   6 
ATOM 6867  C CG   . ASP A 1 61 ? -3.348  1.901   -1.395  1.00 0.00 ? 61 ASP A CG   6 
ATOM 6868  O OD1  . ASP A 1 61 ? -4.369  2.124   -0.710  1.00 0.00 ? 61 ASP A OD1  6 
ATOM 6869  O OD2  . ASP A 1 61 ? -3.196  2.337   -2.556  1.00 0.00 ? 61 ASP A OD2  6 
ATOM 6870  H H    . ASP A 1 61 ? -2.348  2.595   1.214   1.00 0.00 ? 61 ASP A H    6 
ATOM 6871  H HA   . ASP A 1 61 ? -3.515  0.063   0.609   1.00 0.00 ? 61 ASP A HA   6 
ATOM 6872  H HB2  . ASP A 1 61 ? -1.334  1.664   -0.756  1.00 0.00 ? 61 ASP A HB2  6 
ATOM 6873  H HB3  . ASP A 1 61 ? -2.071  0.209   -1.414  1.00 0.00 ? 61 ASP A HB3  6 
ATOM 6874  N N    . ALA A 1 62 ? -0.577  0.176   1.942   1.00 0.00 ? 62 ALA A N    6 
ATOM 6875  C CA   . ALA A 1 62 ? 0.496   -0.627  2.504   1.00 0.00 ? 62 ALA A CA   6 
ATOM 6876  C C    . ALA A 1 62 ? -0.076  -1.779  3.316   1.00 0.00 ? 62 ALA A C    6 
ATOM 6877  O O    . ALA A 1 62 ? 0.533   -2.839  3.417   1.00 0.00 ? 62 ALA A O    6 
ATOM 6878  C CB   . ALA A 1 62 ? 1.412   0.227   3.367   1.00 0.00 ? 62 ALA A CB   6 
ATOM 6879  H H    . ALA A 1 62 ? -0.637  1.125   2.174   1.00 0.00 ? 62 ALA A H    6 
ATOM 6880  H HA   . ALA A 1 62 ? 1.076   -1.027  1.687   1.00 0.00 ? 62 ALA A HA   6 
ATOM 6881  H HB1  . ALA A 1 62 ? 0.951   1.187   3.544   1.00 0.00 ? 62 ALA A HB1  6 
ATOM 6882  H HB2  . ALA A 1 62 ? 1.583   -0.268  4.312   1.00 0.00 ? 62 ALA A HB2  6 
ATOM 6883  H HB3  . ALA A 1 62 ? 2.355   0.369   2.861   1.00 0.00 ? 62 ALA A HB3  6 
ATOM 6884  N N    . ILE A 1 63 ? -1.258  -1.569  3.886   1.00 0.00 ? 63 ILE A N    6 
ATOM 6885  C CA   . ILE A 1 63 ? -1.906  -2.601  4.676   1.00 0.00 ? 63 ILE A CA   6 
ATOM 6886  C C    . ILE A 1 63 ? -2.115  -3.859  3.829   1.00 0.00 ? 63 ILE A C    6 
ATOM 6887  O O    . ILE A 1 63 ? -1.438  -4.864  4.052   1.00 0.00 ? 63 ILE A O    6 
ATOM 6888  C CB   . ILE A 1 63 ? -3.224  -2.086  5.309   1.00 0.00 ? 63 ILE A CB   6 
ATOM 6889  C CG1  . ILE A 1 63 ? -2.908  -1.234  6.540   1.00 0.00 ? 63 ILE A CG1  6 
ATOM 6890  C CG2  . ILE A 1 63 ? -4.162  -3.230  5.683   1.00 0.00 ? 63 ILE A CG2  6 
ATOM 6891  C CD1  . ILE A 1 63 ? -2.201  0.068   6.221   1.00 0.00 ? 63 ILE A CD1  6 
ATOM 6892  H H    . ILE A 1 63 ? -1.705  -0.708  3.761   1.00 0.00 ? 63 ILE A H    6 
ATOM 6893  H HA   . ILE A 1 63 ? -1.229  -2.852  5.484   1.00 0.00 ? 63 ILE A HA   6 
ATOM 6894  H HB   . ILE A 1 63 ? -3.723  -1.462  4.585   1.00 0.00 ? 63 ILE A HB   6 
ATOM 6895  H HG12 . ILE A 1 63 ? -3.828  -0.994  7.050   1.00 0.00 ? 63 ILE A HG12 6 
ATOM 6896  H HG13 . ILE A 1 63 ? -2.270  -1.802  7.205   1.00 0.00 ? 63 ILE A HG13 6 
ATOM 6897  H HG21 . ILE A 1 63 ? -3.642  -4.172  5.585   1.00 0.00 ? 63 ILE A HG21 6 
ATOM 6898  H HG22 . ILE A 1 63 ? -4.490  -3.107  6.705   1.00 0.00 ? 63 ILE A HG22 6 
ATOM 6899  H HG23 . ILE A 1 63 ? -5.019  -3.221  5.029   1.00 0.00 ? 63 ILE A HG23 6 
ATOM 6900  H HD11 . ILE A 1 63 ? -1.308  -0.136  5.651   1.00 0.00 ? 63 ILE A HD11 6 
ATOM 6901  H HD12 . ILE A 1 63 ? -2.858  0.703   5.646   1.00 0.00 ? 63 ILE A HD12 6 
ATOM 6902  H HD13 . ILE A 1 63 ? -1.933  0.566   7.141   1.00 0.00 ? 63 ILE A HD13 6 
ATOM 6903  N N    . PRO A 1 64 ? -3.028  -3.850  2.834   1.00 0.00 ? 64 PRO A N    6 
ATOM 6904  C CA   . PRO A 1 64 ? -3.226  -5.023  1.993   1.00 0.00 ? 64 PRO A CA   6 
ATOM 6905  C C    . PRO A 1 64 ? -1.932  -5.430  1.314   1.00 0.00 ? 64 PRO A C    6 
ATOM 6906  O O    . PRO A 1 64 ? -1.721  -6.597  0.998   1.00 0.00 ? 64 PRO A O    6 
ATOM 6907  C CB   . PRO A 1 64 ? -4.252  -4.583  0.945   1.00 0.00 ? 64 PRO A CB   6 
ATOM 6908  C CG   . PRO A 1 64 ? -4.896  -3.361  1.497   1.00 0.00 ? 64 PRO A CG   6 
ATOM 6909  C CD   . PRO A 1 64 ? -3.914  -2.735  2.450   1.00 0.00 ? 64 PRO A CD   6 
ATOM 6910  H HA   . PRO A 1 64 ? -3.601  -5.853  2.560   1.00 0.00 ? 64 PRO A HA   6 
ATOM 6911  H HB2  . PRO A 1 64 ? -3.748  -4.372  0.013   1.00 0.00 ? 64 PRO A HB2  6 
ATOM 6912  H HB3  . PRO A 1 64 ? -4.975  -5.371  0.795   1.00 0.00 ? 64 PRO A HB3  6 
ATOM 6913  H HG2  . PRO A 1 64 ? -5.121  -2.674  0.695   1.00 0.00 ? 64 PRO A HG2  6 
ATOM 6914  H HG3  . PRO A 1 64 ? -5.801  -3.631  2.020   1.00 0.00 ? 64 PRO A HG3  6 
ATOM 6915  H HD2  . PRO A 1 64 ? -3.362  -1.949  1.963   1.00 0.00 ? 64 PRO A HD2  6 
ATOM 6916  H HD3  . PRO A 1 64 ? -4.444  -2.354  3.302   1.00 0.00 ? 64 PRO A HD3  6 
ATOM 6917  N N    . MET A 1 65 ? -1.062  -4.454  1.105   1.00 0.00 ? 65 MET A N    6 
ATOM 6918  C CA   . MET A 1 65 ? 0.217   -4.705  0.472   1.00 0.00 ? 65 MET A CA   6 
ATOM 6919  C C    . MET A 1 65 ? 1.126   -5.479  1.415   1.00 0.00 ? 65 MET A C    6 
ATOM 6920  O O    . MET A 1 65 ? 1.955   -6.277  0.980   1.00 0.00 ? 65 MET A O    6 
ATOM 6921  C CB   . MET A 1 65 ? 0.861   -3.382  0.078   1.00 0.00 ? 65 MET A CB   6 
ATOM 6922  C CG   . MET A 1 65 ? 2.214   -3.531  -0.586  1.00 0.00 ? 65 MET A CG   6 
ATOM 6923  S SD   . MET A 1 65 ? 2.151   -4.518  -2.093  1.00 0.00 ? 65 MET A SD   6 
ATOM 6924  C CE   . MET A 1 65 ? 1.035   -3.539  -3.094  1.00 0.00 ? 65 MET A CE   6 
ATOM 6925  H H    . MET A 1 65 ? -1.282  -3.540  1.391   1.00 0.00 ? 65 MET A H    6 
ATOM 6926  H HA   . MET A 1 65 ? 0.043   -5.293  -0.416  1.00 0.00 ? 65 MET A HA   6 
ATOM 6927  H HB2  . MET A 1 65 ? 0.204   -2.867  -0.605  1.00 0.00 ? 65 MET A HB2  6 
ATOM 6928  H HB3  . MET A 1 65 ? 0.984   -2.781  0.965   1.00 0.00 ? 65 MET A HB3  6 
ATOM 6929  H HG2  . MET A 1 65 ? 2.577   -2.548  -0.831  1.00 0.00 ? 65 MET A HG2  6 
ATOM 6930  H HG3  . MET A 1 65 ? 2.893   -4.001  0.111   1.00 0.00 ? 65 MET A HG3  6 
ATOM 6931  H HE1  . MET A 1 65 ? 1.295   -2.495  -3.008  1.00 0.00 ? 65 MET A HE1  6 
ATOM 6932  H HE2  . MET A 1 65 ? 1.115   -3.846  -4.128  1.00 0.00 ? 65 MET A HE2  6 
ATOM 6933  H HE3  . MET A 1 65 ? 0.021   -3.688  -2.754  1.00 0.00 ? 65 MET A HE3  6 
ATOM 6934  N N    . ILE A 1 66 ? 0.941   -5.257  2.712   1.00 0.00 ? 66 ILE A N    6 
ATOM 6935  C CA   . ILE A 1 66 ? 1.731   -5.949  3.722   1.00 0.00 ? 66 ILE A CA   6 
ATOM 6936  C C    . ILE A 1 66 ? 1.181   -7.353  3.923   1.00 0.00 ? 66 ILE A C    6 
ATOM 6937  O O    . ILE A 1 66 ? 1.936   -8.319  3.985   1.00 0.00 ? 66 ILE A O    6 
ATOM 6938  C CB   . ILE A 1 66 ? 1.750   -5.175  5.067   1.00 0.00 ? 66 ILE A CB   6 
ATOM 6939  C CG1  . ILE A 1 66 ? 2.599   -3.908  4.934   1.00 0.00 ? 66 ILE A CG1  6 
ATOM 6940  C CG2  . ILE A 1 66 ? 2.281   -6.039  6.207   1.00 0.00 ? 66 ILE A CG2  6 
ATOM 6941  C CD1  . ILE A 1 66 ? 2.551   -3.018  6.156   1.00 0.00 ? 66 ILE A CD1  6 
ATOM 6942  H H    . ILE A 1 66 ? 0.241   -4.630  2.996   1.00 0.00 ? 66 ILE A H    6 
ATOM 6943  H HA   . ILE A 1 66 ? 2.750   -6.022  3.358   1.00 0.00 ? 66 ILE A HA   6 
ATOM 6944  H HB   . ILE A 1 66 ? 0.737   -4.892  5.310   1.00 0.00 ? 66 ILE A HB   6 
ATOM 6945  H HG12 . ILE A 1 66 ? 3.629   -4.192  4.775   1.00 0.00 ? 66 ILE A HG12 6 
ATOM 6946  H HG13 . ILE A 1 66 ? 2.257   -3.335  4.089   1.00 0.00 ? 66 ILE A HG13 6 
ATOM 6947  H HG21 . ILE A 1 66 ? 2.202   -7.082  5.943   1.00 0.00 ? 66 ILE A HG21 6 
ATOM 6948  H HG22 . ILE A 1 66 ? 3.316   -5.793  6.393   1.00 0.00 ? 66 ILE A HG22 6 
ATOM 6949  H HG23 . ILE A 1 66 ? 1.701   -5.851  7.099   1.00 0.00 ? 66 ILE A HG23 6 
ATOM 6950  H HD11 . ILE A 1 66 ? 2.752   -3.608  7.039   1.00 0.00 ? 66 ILE A HD11 6 
ATOM 6951  H HD12 . ILE A 1 66 ? 3.294   -2.239  6.067   1.00 0.00 ? 66 ILE A HD12 6 
ATOM 6952  H HD13 . ILE A 1 66 ? 1.570   -2.571  6.238   1.00 0.00 ? 66 ILE A HD13 6 
ATOM 6953  N N    . ALA A 1 67 ? -0.139  -7.460  4.001   1.00 0.00 ? 67 ALA A N    6 
ATOM 6954  C CA   . ALA A 1 67 ? -0.775  -8.753  4.173   1.00 0.00 ? 67 ALA A CA   6 
ATOM 6955  C C    . ALA A 1 67 ? -0.609  -9.583  2.914   1.00 0.00 ? 67 ALA A C    6 
ATOM 6956  O O    . ALA A 1 67 ? -0.057  -10.682 2.946   1.00 0.00 ? 67 ALA A O    6 
ATOM 6957  C CB   . ALA A 1 67 ? -2.245  -8.584  4.524   1.00 0.00 ? 67 ALA A CB   6 
ATOM 6958  H H    . ALA A 1 67 ? -0.694  -6.658  3.928   1.00 0.00 ? 67 ALA A H    6 
ATOM 6959  H HA   . ALA A 1 67 ? -0.284  -9.253  4.990   1.00 0.00 ? 67 ALA A HA   6 
ATOM 6960  H HB1  . ALA A 1 67 ? -2.424  -7.566  4.837   1.00 0.00 ? 67 ALA A HB1  6 
ATOM 6961  H HB2  . ALA A 1 67 ? -2.850  -8.805  3.658   1.00 0.00 ? 67 ALA A HB2  6 
ATOM 6962  H HB3  . ALA A 1 67 ? -2.504  -9.258  5.327   1.00 0.00 ? 67 ALA A HB3  6 
ATOM 6963  N N    . VAL A 1 68 ? -1.070  -9.036  1.797   1.00 0.00 ? 68 VAL A N    6 
ATOM 6964  C CA   . VAL A 1 68 ? -0.954  -9.713  0.517   1.00 0.00 ? 68 VAL A CA   6 
ATOM 6965  C C    . VAL A 1 68 ? 0.515   -9.895  0.153   1.00 0.00 ? 68 VAL A C    6 
ATOM 6966  O O    . VAL A 1 68 ? 0.929   -10.965 -0.285  1.00 0.00 ? 68 VAL A O    6 
ATOM 6967  C CB   . VAL A 1 68 ? -1.679  -8.932  -0.602  1.00 0.00 ? 68 VAL A CB   6 
ATOM 6968  C CG1  . VAL A 1 68 ? -1.504  -9.617  -1.948  1.00 0.00 ? 68 VAL A CG1  6 
ATOM 6969  C CG2  . VAL A 1 68 ? -3.158  -8.774  -0.269  1.00 0.00 ? 68 VAL A CG2  6 
ATOM 6970  H H    . VAL A 1 68 ? -1.485  -8.150  1.834   1.00 0.00 ? 68 VAL A H    6 
ATOM 6971  H HA   . VAL A 1 68 ? -1.415  -10.688 0.612   1.00 0.00 ? 68 VAL A HA   6 
ATOM 6972  H HB   . VAL A 1 68 ? -1.242  -7.947  -0.670  1.00 0.00 ? 68 VAL A HB   6 
ATOM 6973  H HG11 . VAL A 1 68 ? -1.372  -10.676 -1.799  1.00 0.00 ? 68 VAL A HG11 6 
ATOM 6974  H HG12 . VAL A 1 68 ? -2.380  -9.445  -2.556  1.00 0.00 ? 68 VAL A HG12 6 
ATOM 6975  H HG13 . VAL A 1 68 ? -0.636  -9.211  -2.447  1.00 0.00 ? 68 VAL A HG13 6 
ATOM 6976  H HG21 . VAL A 1 68 ? -3.446  -9.522  0.454   1.00 0.00 ? 68 VAL A HG21 6 
ATOM 6977  H HG22 . VAL A 1 68 ? -3.332  -7.791  0.142   1.00 0.00 ? 68 VAL A HG22 6 
ATOM 6978  H HG23 . VAL A 1 68 ? -3.745  -8.897  -1.168  1.00 0.00 ? 68 VAL A HG23 6 
ATOM 6979  N N    . GLY A 1 69 ? 1.309   -8.848  0.353   1.00 0.00 ? 69 GLY A N    6 
ATOM 6980  C CA   . GLY A 1 69 ? 2.722   -8.935  0.047   1.00 0.00 ? 69 GLY A CA   6 
ATOM 6981  C C    . GLY A 1 69 ? 3.411   -10.044 0.817   1.00 0.00 ? 69 GLY A C    6 
ATOM 6982  O O    . GLY A 1 69 ? 4.167   -10.821 0.242   1.00 0.00 ? 69 GLY A O    6 
ATOM 6983  H H    . GLY A 1 69 ? 0.935   -8.017  0.719   1.00 0.00 ? 69 GLY A H    6 
ATOM 6984  H HA2  . GLY A 1 69 ? 2.837   -9.123  -1.013  1.00 0.00 ? 69 GLY A HA2  6 
ATOM 6985  H HA3  . GLY A 1 69 ? 3.196   -7.996  0.290   1.00 0.00 ? 69 GLY A HA3  6 
ATOM 6986  N N    . LEU A 1 70 ? 3.150   -10.123 2.120   1.00 0.00 ? 70 LEU A N    6 
ATOM 6987  C CA   . LEU A 1 70 ? 3.752   -11.145 2.955   1.00 0.00 ? 70 LEU A CA   6 
ATOM 6988  C C    . LEU A 1 70 ? 3.261   -12.531 2.560   1.00 0.00 ? 70 LEU A C    6 
ATOM 6989  O O    . LEU A 1 70 ? 4.055   -13.463 2.423   1.00 0.00 ? 70 LEU A O    6 
ATOM 6990  C CB   . LEU A 1 70 ? 3.437   -10.870 4.424   1.00 0.00 ? 70 LEU A CB   6 
ATOM 6991  C CG   . LEU A 1 70 ? 4.446   -9.982  5.158   1.00 0.00 ? 70 LEU A CG   6 
ATOM 6992  C CD1  . LEU A 1 70 ? 5.799   -10.674 5.242   1.00 0.00 ? 70 LEU A CD1  6 
ATOM 6993  C CD2  . LEU A 1 70 ? 4.580   -8.630  4.470   1.00 0.00 ? 70 LEU A CD2  6 
ATOM 6994  H H    . LEU A 1 70 ? 2.536   -9.483  2.533   1.00 0.00 ? 70 LEU A H    6 
ATOM 6995  H HA   . LEU A 1 70 ? 4.821   -11.102 2.813   1.00 0.00 ? 70 LEU A HA   6 
ATOM 6996  H HB2  . LEU A 1 70 ? 2.465   -10.402 4.483   1.00 0.00 ? 70 LEU A HB2  6 
ATOM 6997  H HB3  . LEU A 1 70 ? 3.384   -11.810 4.932   1.00 0.00 ? 70 LEU A HB3  6 
ATOM 6998  H HG   . LEU A 1 70 ? 4.099   -9.812  6.166   1.00 0.00 ? 70 LEU A HG   6 
ATOM 6999  H HD11 . LEU A 1 70 ? 5.822   -11.505 4.553   1.00 0.00 ? 70 LEU A HD11 6 
ATOM 7000  H HD12 . LEU A 1 70 ? 6.581   -9.973  4.987   1.00 0.00 ? 70 LEU A HD12 6 
ATOM 7001  H HD13 . LEU A 1 70 ? 5.956   -11.036 6.247   1.00 0.00 ? 70 LEU A HD13 6 
ATOM 7002  H HD21 . LEU A 1 70 ? 4.247   -8.710  3.448   1.00 0.00 ? 70 LEU A HD21 6 
ATOM 7003  H HD22 . LEU A 1 70 ? 3.976   -7.901  4.989   1.00 0.00 ? 70 LEU A HD22 6 
ATOM 7004  H HD23 . LEU A 1 70 ? 5.614   -8.318  4.487   1.00 0.00 ? 70 LEU A HD23 6 
ATOM 7005  N N    . GLY A 1 71 ? 1.951   -12.667 2.372   1.00 0.00 ? 71 GLY A N    6 
ATOM 7006  C CA   . GLY A 1 71 ? 1.398   -13.952 1.989   1.00 0.00 ? 71 GLY A CA   6 
ATOM 7007  C C    . GLY A 1 71 ? 1.922   -14.412 0.642   1.00 0.00 ? 71 GLY A C    6 
ATOM 7008  O O    . GLY A 1 71 ? 2.436   -15.520 0.509   1.00 0.00 ? 71 GLY A O    6 
ATOM 7009  H H    . GLY A 1 71 ? 1.359   -11.890 2.491   1.00 0.00 ? 71 GLY A H    6 
ATOM 7010  H HA2  . GLY A 1 71 ? 1.664   -14.685 2.738   1.00 0.00 ? 71 GLY A HA2  6 
ATOM 7011  H HA3  . GLY A 1 71 ? 0.322   -13.875 1.938   1.00 0.00 ? 71 GLY A HA3  6 
ATOM 7012  N N    . LEU A 1 72 ? 1.797   -13.547 -0.356  1.00 0.00 ? 72 LEU A N    6 
ATOM 7013  C CA   . LEU A 1 72 ? 2.260   -13.844 -1.705  1.00 0.00 ? 72 LEU A CA   6 
ATOM 7014  C C    . LEU A 1 72 ? 3.777   -13.977 -1.745  1.00 0.00 ? 72 LEU A C    6 
ATOM 7015  O O    . LEU A 1 72 ? 4.323   -14.762 -2.519  1.00 0.00 ? 72 LEU A O    6 
ATOM 7016  C CB   . LEU A 1 72 ? 1.800   -12.741 -2.660  1.00 0.00 ? 72 LEU A CB   6 
ATOM 7017  C CG   . LEU A 1 72 ? 0.325   -12.803 -3.058  1.00 0.00 ? 72 LEU A CG   6 
ATOM 7018  C CD1  . LEU A 1 72 ? -0.564  -12.984 -1.836  1.00 0.00 ? 72 LEU A CD1  6 
ATOM 7019  C CD2  . LEU A 1 72 ? -0.067  -11.553 -3.828  1.00 0.00 ? 72 LEU A CD2  6 
ATOM 7020  H H    . LEU A 1 72 ? 1.388   -12.680 -0.178  1.00 0.00 ? 72 LEU A H    6 
ATOM 7021  H HA   . LEU A 1 72 ? 1.815   -14.783 -2.013  1.00 0.00 ? 72 LEU A HA   6 
ATOM 7022  H HB2  . LEU A 1 72 ? 1.984   -11.787 -2.188  1.00 0.00 ? 72 LEU A HB2  6 
ATOM 7023  H HB3  . LEU A 1 72 ? 2.396   -12.799 -3.559  1.00 0.00 ? 72 LEU A HB3  6 
ATOM 7024  H HG   . LEU A 1 72 ? 0.175   -13.650 -3.701  1.00 0.00 ? 72 LEU A HG   6 
ATOM 7025  H HD11 . LEU A 1 72 ? -0.373  -12.197 -1.129  1.00 0.00 ? 72 LEU A HD11 6 
ATOM 7026  H HD12 . LEU A 1 72 ? -1.601  -12.953 -2.137  1.00 0.00 ? 72 LEU A HD12 6 
ATOM 7027  H HD13 . LEU A 1 72 ? -0.353  -13.938 -1.377  1.00 0.00 ? 72 LEU A HD13 6 
ATOM 7028  H HD21 . LEU A 1 72 ? 0.286   -10.681 -3.300  1.00 0.00 ? 72 LEU A HD21 6 
ATOM 7029  H HD22 . LEU A 1 72 ? 0.378   -11.581 -4.812  1.00 0.00 ? 72 LEU A HD22 6 
ATOM 7030  H HD23 . LEU A 1 72 ? -1.143  -11.508 -3.922  1.00 0.00 ? 72 LEU A HD23 6 
ATOM 7031  N N    . TYR A 1 73 ? 4.456   -13.218 -0.889  1.00 0.00 ? 73 TYR A N    6 
ATOM 7032  C CA   . TYR A 1 73 ? 5.913   -13.259 -0.819  1.00 0.00 ? 73 TYR A CA   6 
ATOM 7033  C C    . TYR A 1 73 ? 6.377   -14.693 -0.606  1.00 0.00 ? 73 TYR A C    6 
ATOM 7034  O O    . TYR A 1 73 ? 7.282   -15.179 -1.280  1.00 0.00 ? 73 TYR A O    6 
ATOM 7035  C CB   . TYR A 1 73 ? 6.420   -12.376 0.328   1.00 0.00 ? 73 TYR A CB   6 
ATOM 7036  C CG   . TYR A 1 73 ? 7.918   -12.411 0.502   1.00 0.00 ? 73 TYR A CG   6 
ATOM 7037  C CD1  . TYR A 1 73 ? 8.753   -11.705 -0.354  1.00 0.00 ? 73 TYR A CD1  6 
ATOM 7038  C CD2  . TYR A 1 73 ? 8.498   -13.169 1.510   1.00 0.00 ? 73 TYR A CD2  6 
ATOM 7039  C CE1  . TYR A 1 73 ? 10.127  -11.755 -0.211  1.00 0.00 ? 73 TYR A CE1  6 
ATOM 7040  C CE2  . TYR A 1 73 ? 9.872   -13.221 1.663   1.00 0.00 ? 73 TYR A CE2  6 
ATOM 7041  C CZ   . TYR A 1 73 ? 10.681  -12.513 0.800   1.00 0.00 ? 73 TYR A CZ   6 
ATOM 7042  O OH   . TYR A 1 73 ? 12.049  -12.564 0.945   1.00 0.00 ? 73 TYR A OH   6 
ATOM 7043  H H    . TYR A 1 73 ? 3.966   -12.628 -0.284  1.00 0.00 ? 73 TYR A H    6 
ATOM 7044  H HA   . TYR A 1 73 ? 6.310   -12.894 -1.760  1.00 0.00 ? 73 TYR A HA   6 
ATOM 7045  H HB2  . TYR A 1 73 ? 6.139   -11.353 0.135   1.00 0.00 ? 73 TYR A HB2  6 
ATOM 7046  H HB3  . TYR A 1 73 ? 5.968   -12.703 1.252   1.00 0.00 ? 73 TYR A HB3  6 
ATOM 7047  H HD1  . TYR A 1 73 ? 8.313   -11.108 -1.141  1.00 0.00 ? 73 TYR A HD1  6 
ATOM 7048  H HD2  . TYR A 1 73 ? 7.857   -13.722 2.182   1.00 0.00 ? 73 TYR A HD2  6 
ATOM 7049  H HE1  . TYR A 1 73 ? 10.762  -11.199 -0.886  1.00 0.00 ? 73 TYR A HE1  6 
ATOM 7050  H HE2  . TYR A 1 73 ? 10.306  -13.814 2.455   1.00 0.00 ? 73 TYR A HE2  6 
ATOM 7051  H HH   . TYR A 1 73 ? 12.462  -12.569 0.078   1.00 0.00 ? 73 TYR A HH   6 
ATOM 7052  N N    . VAL A 1 74 ? 5.730   -15.364 0.337   1.00 0.00 ? 74 VAL A N    6 
ATOM 7053  C CA   . VAL A 1 74 ? 6.045   -16.750 0.652   1.00 0.00 ? 74 VAL A CA   6 
ATOM 7054  C C    . VAL A 1 74 ? 5.273   -17.697 -0.261  1.00 0.00 ? 74 VAL A C    6 
ATOM 7055  O O    . VAL A 1 74 ? 5.733   -18.794 -0.577  1.00 0.00 ? 74 VAL A O    6 
ATOM 7056  C CB   . VAL A 1 74 ? 5.706   -17.077 2.123   1.00 0.00 ? 74 VAL A CB   6 
ATOM 7057  C CG1  . VAL A 1 74 ? 6.094   -18.508 2.464   1.00 0.00 ? 74 VAL A CG1  6 
ATOM 7058  C CG2  . VAL A 1 74 ? 6.393   -16.098 3.061   1.00 0.00 ? 74 VAL A CG2  6 
ATOM 7059  H H    . VAL A 1 74 ? 5.011   -14.917 0.832   1.00 0.00 ? 74 VAL A H    6 
ATOM 7060  H HA   . VAL A 1 74 ? 7.108   -16.896 0.505   1.00 0.00 ? 74 VAL A HA   6 
ATOM 7061  H HB   . VAL A 1 74 ? 4.638   -16.979 2.257   1.00 0.00 ? 74 VAL A HB   6 
ATOM 7062  H HG11 . VAL A 1 74 ? 7.073   -18.720 2.061   1.00 0.00 ? 74 VAL A HG11 6 
ATOM 7063  H HG12 . VAL A 1 74 ? 6.114   -18.629 3.538   1.00 0.00 ? 74 VAL A HG12 6 
ATOM 7064  H HG13 . VAL A 1 74 ? 5.373   -19.189 2.038   1.00 0.00 ? 74 VAL A HG13 6 
ATOM 7065  H HG21 . VAL A 1 74 ? 6.532   -15.152 2.559   1.00 0.00 ? 74 VAL A HG21 6 
ATOM 7066  H HG22 . VAL A 1 74 ? 5.783   -15.951 3.941   1.00 0.00 ? 74 VAL A HG22 6 
ATOM 7067  H HG23 . VAL A 1 74 ? 7.355   -16.494 3.353   1.00 0.00 ? 74 VAL A HG23 6 
ATOM 7068  N N    . MET A 1 75 ? 4.086   -17.273 -0.678  1.00 0.00 ? 75 MET A N    6 
ATOM 7069  C CA   . MET A 1 75 ? 3.249   -18.097 -1.537  1.00 0.00 ? 75 MET A CA   6 
ATOM 7070  C C    . MET A 1 75 ? 3.752   -18.123 -2.981  1.00 0.00 ? 75 MET A C    6 
ATOM 7071  O O    . MET A 1 75 ? 4.321   -19.116 -3.426  1.00 0.00 ? 75 MET A O    6 
ATOM 7072  C CB   . MET A 1 75 ? 1.802   -17.606 -1.487  1.00 0.00 ? 75 MET A CB   6 
ATOM 7073  C CG   . MET A 1 75 ? 1.093   -17.938 -0.182  1.00 0.00 ? 75 MET A CG   6 
ATOM 7074  S SD   . MET A 1 75 ? 1.052   -19.706 0.170   1.00 0.00 ? 75 MET A SD   6 
ATOM 7075  C CE   . MET A 1 75 ? 0.188   -19.720 1.739   1.00 0.00 ? 75 MET A CE   6 
ATOM 7076  H H    . MET A 1 75 ? 3.762   -16.394 -0.393  1.00 0.00 ? 75 MET A H    6 
ATOM 7077  H HA   . MET A 1 75 ? 3.282   -19.101 -1.147  1.00 0.00 ? 75 MET A HA   6 
ATOM 7078  H HB2  . MET A 1 75 ? 1.796   -16.536 -1.607  1.00 0.00 ? 75 MET A HB2  6 
ATOM 7079  H HB3  . MET A 1 75 ? 1.250   -18.051 -2.297  1.00 0.00 ? 75 MET A HB3  6 
ATOM 7080  H HG2  . MET A 1 75 ? 1.605   -17.441 0.627   1.00 0.00 ? 75 MET A HG2  6 
ATOM 7081  H HG3  . MET A 1 75 ? 0.078   -17.575 -0.240  1.00 0.00 ? 75 MET A HG3  6 
ATOM 7082  H HE1  . MET A 1 75 ? -0.364  -18.799 1.855   1.00 0.00 ? 75 MET A HE1  6 
ATOM 7083  H HE2  . MET A 1 75 ? -0.495  -20.555 1.766   1.00 0.00 ? 75 MET A HE2  6 
ATOM 7084  H HE3  . MET A 1 75 ? 0.903   -19.814 2.542   1.00 0.00 ? 75 MET A HE3  6 
ATOM 7085  N N    . PHE A 1 76 ? 3.534   -17.037 -3.714  1.00 0.00 ? 76 PHE A N    6 
ATOM 7086  C CA   . PHE A 1 76 ? 3.950   -16.971 -5.116  1.00 0.00 ? 76 PHE A CA   6 
ATOM 7087  C C    . PHE A 1 76 ? 5.462   -17.092 -5.302  1.00 0.00 ? 76 PHE A C    6 
ATOM 7088  O O    . PHE A 1 76 ? 5.919   -17.530 -6.356  1.00 0.00 ? 76 PHE A O    6 
ATOM 7089  C CB   . PHE A 1 76 ? 3.465   -15.674 -5.767  1.00 0.00 ? 76 PHE A CB   6 
ATOM 7090  C CG   . PHE A 1 76 ? 1.991   -15.660 -6.069  1.00 0.00 ? 76 PHE A CG   6 
ATOM 7091  C CD1  . PHE A 1 76 ? 1.397   -16.711 -6.749  1.00 0.00 ? 76 PHE A CD1  6 
ATOM 7092  C CD2  . PHE A 1 76 ? 1.202   -14.597 -5.671  1.00 0.00 ? 76 PHE A CD2  6 
ATOM 7093  C CE1  . PHE A 1 76 ? 0.042   -16.700 -7.020  1.00 0.00 ? 76 PHE A CE1  6 
ATOM 7094  C CE2  . PHE A 1 76 ? -0.151  -14.579 -5.942  1.00 0.00 ? 76 PHE A CE2  6 
ATOM 7095  C CZ   . PHE A 1 76 ? -0.731  -15.632 -6.616  1.00 0.00 ? 76 PHE A CZ   6 
ATOM 7096  H H    . PHE A 1 76 ? 3.067   -16.274 -3.315  1.00 0.00 ? 76 PHE A H    6 
ATOM 7097  H HA   . PHE A 1 76 ? 3.476   -17.803 -5.625  1.00 0.00 ? 76 PHE A HA   6 
ATOM 7098  H HB2  . PHE A 1 76 ? 3.672   -14.849 -5.101  1.00 0.00 ? 76 PHE A HB2  6 
ATOM 7099  H HB3  . PHE A 1 76 ? 3.999   -15.526 -6.691  1.00 0.00 ? 76 PHE A HB3  6 
ATOM 7100  H HD1  . PHE A 1 76 ? 2.002   -17.549 -7.064  1.00 0.00 ? 76 PHE A HD1  6 
ATOM 7101  H HD2  . PHE A 1 76 ? 1.655   -13.771 -5.143  1.00 0.00 ? 76 PHE A HD2  6 
ATOM 7102  H HE1  . PHE A 1 76 ? -0.409  -17.524 -7.550  1.00 0.00 ? 76 PHE A HE1  6 
ATOM 7103  H HE2  . PHE A 1 76 ? -0.755  -13.742 -5.625  1.00 0.00 ? 76 PHE A HE2  6 
ATOM 7104  H HZ   . PHE A 1 76 ? -1.790  -15.621 -6.826  1.00 0.00 ? 76 PHE A HZ   6 
ATOM 7105  N N    . ALA A 1 77 ? 6.241   -16.685 -4.305  1.00 0.00 ? 77 ALA A N    6 
ATOM 7106  C CA   . ALA A 1 77 ? 7.693   -16.739 -4.419  1.00 0.00 ? 77 ALA A CA   6 
ATOM 7107  C C    . ALA A 1 77 ? 8.286   -17.963 -3.738  1.00 0.00 ? 77 ALA A C    6 
ATOM 7108  O O    . ALA A 1 77 ? 9.110   -18.671 -4.318  1.00 0.00 ? 77 ALA A O    6 
ATOM 7109  C CB   . ALA A 1 77 ? 8.315   -15.468 -3.861  1.00 0.00 ? 77 ALA A CB   6 
ATOM 7110  H H    . ALA A 1 77 ? 5.838   -16.323 -3.494  1.00 0.00 ? 77 ALA A H    6 
ATOM 7111  H HA   . ALA A 1 77 ? 7.930   -16.787 -5.460  1.00 0.00 ? 77 ALA A HA   6 
ATOM 7112  H HB1  . ALA A 1 77 ? 7.560   -14.699 -3.791  1.00 0.00 ? 77 ALA A HB1  6 
ATOM 7113  H HB2  . ALA A 1 77 ? 8.722   -15.665 -2.881  1.00 0.00 ? 77 ALA A HB2  6 
ATOM 7114  H HB3  . ALA A 1 77 ? 9.106   -15.137 -4.518  1.00 0.00 ? 77 ALA A HB3  6 
ATOM 7115  N N    . VAL A 1 78 ? 7.880   -18.197 -2.503  1.00 0.00 ? 78 VAL A N    6 
ATOM 7116  C CA   . VAL A 1 78 ? 8.385   -19.326 -1.735  1.00 0.00 ? 78 VAL A CA   6 
ATOM 7117  C C    . VAL A 1 78 ? 7.509   -20.569 -1.898  1.00 0.00 ? 78 VAL A C    6 
ATOM 7118  O O    . VAL A 1 78 ? 7.858   -21.644 -1.411  1.00 0.00 ? 78 VAL A O    6 
ATOM 7119  C CB   . VAL A 1 78 ? 8.521   -18.983 -0.237  1.00 0.00 ? 78 VAL A CB   6 
ATOM 7120  C CG1  . VAL A 1 78 ? 9.101   -20.157 0.538   1.00 0.00 ? 78 VAL A CG1  6 
ATOM 7121  C CG2  . VAL A 1 78 ? 9.375   -17.739 -0.053  1.00 0.00 ? 78 VAL A CG2  6 
ATOM 7122  H H    . VAL A 1 78 ? 7.236   -17.591 -2.097  1.00 0.00 ? 78 VAL A H    6 
ATOM 7123  H HA   . VAL A 1 78 ? 9.368   -19.550 -2.112  1.00 0.00 ? 78 VAL A HA   6 
ATOM 7124  H HB   . VAL A 1 78 ? 7.541   -18.776 0.159   1.00 0.00 ? 78 VAL A HB   6 
ATOM 7125  H HG11 . VAL A 1 78 ? 9.707   -20.759 -0.121  1.00 0.00 ? 78 VAL A HG11 6 
ATOM 7126  H HG12 . VAL A 1 78 ? 9.710   -19.787 1.350   1.00 0.00 ? 78 VAL A HG12 6 
ATOM 7127  H HG13 . VAL A 1 78 ? 8.297   -20.758 0.937   1.00 0.00 ? 78 VAL A HG13 6 
ATOM 7128  H HG21 . VAL A 1 78 ? 9.075   -16.989 -0.770  1.00 0.00 ? 78 VAL A HG21 6 
ATOM 7129  H HG22 . VAL A 1 78 ? 9.239   -17.354 0.948   1.00 0.00 ? 78 VAL A HG22 6 
ATOM 7130  H HG23 . VAL A 1 78 ? 10.414  -17.990 -0.206  1.00 0.00 ? 78 VAL A HG23 6 
ATOM 7131  N N    . ALA A 1 79 ? 6.376   -20.428 -2.583  1.00 0.00 ? 79 ALA A N    6 
ATOM 7132  C CA   . ALA A 1 79 ? 5.475   -21.559 -2.799  1.00 0.00 ? 79 ALA A CA   6 
ATOM 7133  C C    . ALA A 1 79 ? 4.945   -21.578 -4.229  1.00 0.00 ? 79 ALA A C    6 
ATOM 7134  O O    . ALA A 1 79 ? 5.248   -22.485 -5.005  1.00 0.00 ? 79 ALA A O    6 
ATOM 7135  C CB   . ALA A 1 79 ? 4.322   -21.519 -1.809  1.00 0.00 ? 79 ALA A CB   6 
ATOM 7136  H H    . ALA A 1 79 ? 6.138   -19.550 -2.952  1.00 0.00 ? 79 ALA A H    6 
ATOM 7137  H HA   . ALA A 1 79 ? 6.035   -22.469 -2.625  1.00 0.00 ? 79 ALA A HA   6 
ATOM 7138  H HB1  . ALA A 1 79 ? 4.697   -21.265 -0.828  1.00 0.00 ? 79 ALA A HB1  6 
ATOM 7139  H HB2  . ALA A 1 79 ? 3.604   -20.777 -2.123  1.00 0.00 ? 79 ALA A HB2  6 
ATOM 7140  H HB3  . ALA A 1 79 ? 3.845   -22.488 -1.773  1.00 0.00 ? 79 ALA A HB3  6 
ATOM 7141  N N    . MET A 1 1  ? -6.175  -29.551 -0.331  1.00 0.00 ? 1  MET A N    7 
ATOM 7142  C CA   . MET A 1 1  ? -6.315  -28.182 0.236   1.00 0.00 ? 1  MET A CA   7 
ATOM 7143  C C    . MET A 1 1  ? -5.263  -27.237 -0.325  1.00 0.00 ? 1  MET A C    7 
ATOM 7144  O O    . MET A 1 1  ? -5.416  -26.016 -0.273  1.00 0.00 ? 1  MET A O    7 
ATOM 7145  C CB   . MET A 1 1  ? -6.198  -28.263 1.761   1.00 0.00 ? 1  MET A CB   7 
ATOM 7146  C CG   . MET A 1 1  ? -4.834  -28.722 2.248   1.00 0.00 ? 1  MET A CG   7 
ATOM 7147  S SD   . MET A 1 1  ? -4.725  -28.804 4.046   1.00 0.00 ? 1  MET A SD   7 
ATOM 7148  C CE   . MET A 1 1  ? -5.939  -30.073 4.402   1.00 0.00 ? 1  MET A CE   7 
ATOM 7149  H H1   . MET A 1 1  ? -6.032  -29.455 -1.356  1.00 0.00 ? 1  MET A H1   7 
ATOM 7150  H H2   . MET A 1 1  ? -5.355  -30.000 0.119   1.00 0.00 ? 1  MET A H2   7 
ATOM 7151  H H3   . MET A 1 1  ? -7.052  -30.071 -0.120  1.00 0.00 ? 1  MET A H3   7 
ATOM 7152  H HA   . MET A 1 1  ? -7.284  -27.807 -0.026  1.00 0.00 ? 1  MET A HA   7 
ATOM 7153  H HB2  . MET A 1 1  ? -6.395  -27.287 2.178   1.00 0.00 ? 1  MET A HB2  7 
ATOM 7154  H HB3  . MET A 1 1  ? -6.937  -28.957 2.129   1.00 0.00 ? 1  MET A HB3  7 
ATOM 7155  H HG2  . MET A 1 1  ? -4.633  -29.704 1.846   1.00 0.00 ? 1  MET A HG2  7 
ATOM 7156  H HG3  . MET A 1 1  ? -4.092  -28.029 1.888   1.00 0.00 ? 1  MET A HG3  7 
ATOM 7157  H HE1  . MET A 1 1  ? -6.859  -29.847 3.884   1.00 0.00 ? 1  MET A HE1  7 
ATOM 7158  H HE2  . MET A 1 1  ? -5.565  -31.031 4.072   1.00 0.00 ? 1  MET A HE2  7 
ATOM 7159  H HE3  . MET A 1 1  ? -6.123  -30.106 5.466   1.00 0.00 ? 1  MET A HE3  7 
ATOM 7160  N N    . GLU A 1 2  ? -4.204  -27.810 -0.869  1.00 0.00 ? 2  GLU A N    7 
ATOM 7161  C CA   . GLU A 1 2  ? -3.126  -27.024 -1.452  1.00 0.00 ? 2  GLU A CA   7 
ATOM 7162  C C    . GLU A 1 2  ? -3.638  -26.197 -2.623  1.00 0.00 ? 2  GLU A C    7 
ATOM 7163  O O    . GLU A 1 2  ? -3.431  -24.986 -2.679  1.00 0.00 ? 2  GLU A O    7 
ATOM 7164  C CB   . GLU A 1 2  ? -1.987  -27.935 -1.913  1.00 0.00 ? 2  GLU A CB   7 
ATOM 7165  C CG   . GLU A 1 2  ? -1.351  -28.729 -0.785  1.00 0.00 ? 2  GLU A CG   7 
ATOM 7166  C CD   . GLU A 1 2  ? -0.205  -29.600 -1.261  1.00 0.00 ? 2  GLU A CD   7 
ATOM 7167  O OE1  . GLU A 1 2  ? -0.441  -30.471 -2.125  1.00 0.00 ? 2  GLU A OE1  7 
ATOM 7168  O OE2  . GLU A 1 2  ? 0.928   -29.412 -0.772  1.00 0.00 ? 2  GLU A OE2  7 
ATOM 7169  H H    . GLU A 1 2  ? -4.152  -28.784 -0.886  1.00 0.00 ? 2  GLU A H    7 
ATOM 7170  H HA   . GLU A 1 2  ? -2.755  -26.355 -0.691  1.00 0.00 ? 2  GLU A HA   7 
ATOM 7171  H HB2  . GLU A 1 2  ? -2.373  -28.633 -2.641  1.00 0.00 ? 2  GLU A HB2  7 
ATOM 7172  H HB3  . GLU A 1 2  ? -1.221  -27.330 -2.375  1.00 0.00 ? 2  GLU A HB3  7 
ATOM 7173  H HG2  . GLU A 1 2  ? -0.973  -28.039 -0.044  1.00 0.00 ? 2  GLU A HG2  7 
ATOM 7174  H HG3  . GLU A 1 2  ? -2.103  -29.362 -0.337  1.00 0.00 ? 2  GLU A HG3  7 
ATOM 7175  N N    . ASN A 1 3  ? -4.308  -26.859 -3.558  1.00 0.00 ? 3  ASN A N    7 
ATOM 7176  C CA   . ASN A 1 3  ? -4.851  -26.181 -4.727  1.00 0.00 ? 3  ASN A CA   7 
ATOM 7177  C C    . ASN A 1 3  ? -5.805  -25.070 -4.310  1.00 0.00 ? 3  ASN A C    7 
ATOM 7178  O O    . ASN A 1 3  ? -5.735  -23.952 -4.819  1.00 0.00 ? 3  ASN A O    7 
ATOM 7179  C CB   . ASN A 1 3  ? -5.570  -27.179 -5.636  1.00 0.00 ? 3  ASN A CB   7 
ATOM 7180  C CG   . ASN A 1 3  ? -4.643  -28.262 -6.153  1.00 0.00 ? 3  ASN A CG   7 
ATOM 7181  O OD1  . ASN A 1 3  ? -3.649  -27.978 -6.821  1.00 0.00 ? 3  ASN A OD1  7 
ATOM 7182  N ND2  . ASN A 1 3  ? -4.965  -29.513 -5.846  1.00 0.00 ? 3  ASN A ND2  7 
ATOM 7183  H H    . ASN A 1 3  ? -4.441  -27.824 -3.459  1.00 0.00 ? 3  ASN A H    7 
ATOM 7184  H HA   . ASN A 1 3  ? -4.028  -25.744 -5.267  1.00 0.00 ? 3  ASN A HA   7 
ATOM 7185  H HB2  . ASN A 1 3  ? -6.371  -27.649 -5.083  1.00 0.00 ? 3  ASN A HB2  7 
ATOM 7186  H HB3  . ASN A 1 3  ? -5.985  -26.651 -6.483  1.00 0.00 ? 3  ASN A HB3  7 
ATOM 7187  H HD21 . ASN A 1 3  ? -5.772  -29.666 -5.310  1.00 0.00 ? 3  ASN A HD21 7 
ATOM 7188  H HD22 . ASN A 1 3  ? -4.383  -30.233 -6.167  1.00 0.00 ? 3  ASN A HD22 7 
ATOM 7189  N N    . LEU A 1 4  ? -6.691  -25.388 -3.376  1.00 0.00 ? 4  LEU A N    7 
ATOM 7190  C CA   . LEU A 1 4  ? -7.661  -24.420 -2.878  1.00 0.00 ? 4  LEU A CA   7 
ATOM 7191  C C    . LEU A 1 4  ? -6.972  -23.334 -2.069  1.00 0.00 ? 4  LEU A C    7 
ATOM 7192  O O    . LEU A 1 4  ? -7.396  -22.180 -2.084  1.00 0.00 ? 4  LEU A O    7 
ATOM 7193  C CB   . LEU A 1 4  ? -8.725  -25.118 -2.031  1.00 0.00 ? 4  LEU A CB   7 
ATOM 7194  C CG   . LEU A 1 4  ? -9.561  -26.159 -2.777  1.00 0.00 ? 4  LEU A CG   7 
ATOM 7195  C CD1  . LEU A 1 4  ? -10.610 -26.763 -1.856  1.00 0.00 ? 4  LEU A CD1  7 
ATOM 7196  C CD2  . LEU A 1 4  ? -10.215 -25.535 -4.001  1.00 0.00 ? 4  LEU A CD2  7 
ATOM 7197  H H    . LEU A 1 4  ? -6.688  -26.296 -3.010  1.00 0.00 ? 4  LEU A H    7 
ATOM 7198  H HA   . LEU A 1 4  ? -8.136  -23.959 -3.728  1.00 0.00 ? 4  LEU A HA   7 
ATOM 7199  H HB2  . LEU A 1 4  ? -8.233  -25.606 -1.201  1.00 0.00 ? 4  LEU A HB2  7 
ATOM 7200  H HB3  . LEU A 1 4  ? -9.394  -24.366 -1.639  1.00 0.00 ? 4  LEU A HB3  7 
ATOM 7201  H HG   . LEU A 1 4  ? -8.914  -26.956 -3.112  1.00 0.00 ? 4  LEU A HG   7 
ATOM 7202  H HD11 . LEU A 1 4  ? -10.835 -26.066 -1.063  1.00 0.00 ? 4  LEU A HD11 7 
ATOM 7203  H HD12 . LEU A 1 4  ? -11.508 -26.970 -2.420  1.00 0.00 ? 4  LEU A HD12 7 
ATOM 7204  H HD13 . LEU A 1 4  ? -10.231 -27.681 -1.433  1.00 0.00 ? 4  LEU A HD13 7 
ATOM 7205  H HD21 . LEU A 1 4  ? -10.651 -24.585 -3.729  1.00 0.00 ? 4  LEU A HD21 7 
ATOM 7206  H HD22 . LEU A 1 4  ? -9.471  -25.383 -4.769  1.00 0.00 ? 4  LEU A HD22 7 
ATOM 7207  H HD23 . LEU A 1 4  ? -10.986 -26.193 -4.372  1.00 0.00 ? 4  LEU A HD23 7 
ATOM 7208  N N    . ASN A 1 5  ? -5.903  -23.699 -1.374  1.00 0.00 ? 5  ASN A N    7 
ATOM 7209  C CA   . ASN A 1 5  ? -5.164  -22.733 -0.574  1.00 0.00 ? 5  ASN A CA   7 
ATOM 7210  C C    . ASN A 1 5  ? -4.410  -21.763 -1.475  1.00 0.00 ? 5  ASN A C    7 
ATOM 7211  O O    . ASN A 1 5  ? -4.174  -20.615 -1.101  1.00 0.00 ? 5  ASN A O    7 
ATOM 7212  C CB   . ASN A 1 5  ? -4.196  -23.443 0.376   1.00 0.00 ? 5  ASN A CB   7 
ATOM 7213  C CG   . ASN A 1 5  ? -3.430  -22.474 1.255   1.00 0.00 ? 5  ASN A CG   7 
ATOM 7214  O OD1  . ASN A 1 5  ? -4.021  -21.704 2.013   1.00 0.00 ? 5  ASN A OD1  7 
ATOM 7215  N ND2  . ASN A 1 5  ? -2.105  -22.508 1.161   1.00 0.00 ? 5  ASN A ND2  7 
ATOM 7216  H H    . ASN A 1 5  ? -5.603  -24.632 -1.403  1.00 0.00 ? 5  ASN A H    7 
ATOM 7217  H HA   . ASN A 1 5  ? -5.883  -22.172 0.004   1.00 0.00 ? 5  ASN A HA   7 
ATOM 7218  H HB2  . ASN A 1 5  ? -4.755  -24.113 1.016   1.00 0.00 ? 5  ASN A HB2  7 
ATOM 7219  H HB3  . ASN A 1 5  ? -3.486  -24.015 -0.203  1.00 0.00 ? 5  ASN A HB3  7 
ATOM 7220  H HD21 . ASN A 1 5  ? -1.703  -23.149 0.538   1.00 0.00 ? 5  ASN A HD21 7 
ATOM 7221  H HD22 . ASN A 1 5  ? -1.585  -21.893 1.717   1.00 0.00 ? 5  ASN A HD22 7 
ATOM 7222  N N    . MET A 1 6  ? -4.047  -22.225 -2.667  1.00 0.00 ? 6  MET A N    7 
ATOM 7223  C CA   . MET A 1 6  ? -3.339  -21.382 -3.620  1.00 0.00 ? 6  MET A CA   7 
ATOM 7224  C C    . MET A 1 6  ? -4.326  -20.474 -4.352  1.00 0.00 ? 6  MET A C    7 
ATOM 7225  O O    . MET A 1 6  ? -4.164  -19.249 -4.374  1.00 0.00 ? 6  MET A O    7 
ATOM 7226  C CB   . MET A 1 6  ? -2.559  -22.239 -4.620  1.00 0.00 ? 6  MET A CB   7 
ATOM 7227  C CG   . MET A 1 6  ? -1.498  -23.115 -3.974  1.00 0.00 ? 6  MET A CG   7 
ATOM 7228  S SD   . MET A 1 6  ? -0.228  -22.164 -3.120  1.00 0.00 ? 6  MET A SD   7 
ATOM 7229  C CE   . MET A 1 6  ? 0.768   -23.484 -2.433  1.00 0.00 ? 6  MET A CE   7 
ATOM 7230  H H    . MET A 1 6  ? -4.270  -23.148 -2.914  1.00 0.00 ? 6  MET A H    7 
ATOM 7231  H HA   . MET A 1 6  ? -2.648  -20.767 -3.065  1.00 0.00 ? 6  MET A HA   7 
ATOM 7232  H HB2  . MET A 1 6  ? -3.252  -22.878 -5.147  1.00 0.00 ? 6  MET A HB2  7 
ATOM 7233  H HB3  . MET A 1 6  ? -2.073  -21.589 -5.329  1.00 0.00 ? 6  MET A HB3  7 
ATOM 7234  H HG2  . MET A 1 6  ? -1.976  -23.763 -3.260  1.00 0.00 ? 6  MET A HG2  7 
ATOM 7235  H HG3  . MET A 1 6  ? -1.028  -23.711 -4.742  1.00 0.00 ? 6  MET A HG3  7 
ATOM 7236  H HE1  . MET A 1 6  ? 0.122   -24.262 -2.054  1.00 0.00 ? 6  MET A HE1  7 
ATOM 7237  H HE2  . MET A 1 6  ? 1.408   -23.891 -3.201  1.00 0.00 ? 6  MET A HE2  7 
ATOM 7238  H HE3  . MET A 1 6  ? 1.375   -23.096 -1.627  1.00 0.00 ? 6  MET A HE3  7 
ATOM 7239  N N    . ASP A 1 7  ? -5.363  -21.078 -4.936  1.00 0.00 ? 7  ASP A N    7 
ATOM 7240  C CA   . ASP A 1 7  ? -6.372  -20.311 -5.644  1.00 0.00 ? 7  ASP A CA   7 
ATOM 7241  C C    . ASP A 1 7  ? -7.109  -19.395 -4.676  1.00 0.00 ? 7  ASP A C    7 
ATOM 7242  O O    . ASP A 1 7  ? -7.393  -18.243 -5.001  1.00 0.00 ? 7  ASP A O    7 
ATOM 7243  C CB   . ASP A 1 7  ? -7.353  -21.227 -6.381  1.00 0.00 ? 7  ASP A CB   7 
ATOM 7244  C CG   . ASP A 1 7  ? -8.037  -22.227 -5.473  1.00 0.00 ? 7  ASP A CG   7 
ATOM 7245  O OD1  . ASP A 1 7  ? -8.687  -21.801 -4.496  1.00 0.00 ? 7  ASP A OD1  7 
ATOM 7246  O OD2  . ASP A 1 7  ? -7.937  -23.440 -5.751  1.00 0.00 ? 7  ASP A OD2  7 
ATOM 7247  H H    . ASP A 1 7  ? -5.454  -22.051 -4.877  1.00 0.00 ? 7  ASP A H    7 
ATOM 7248  H HA   . ASP A 1 7  ? -5.860  -19.695 -6.370  1.00 0.00 ? 7  ASP A HA   7 
ATOM 7249  H HB2  . ASP A 1 7  ? -8.112  -20.623 -6.845  1.00 0.00 ? 7  ASP A HB2  7 
ATOM 7250  H HB3  . ASP A 1 7  ? -6.818  -21.772 -7.147  1.00 0.00 ? 7  ASP A HB3  7 
ATOM 7251  N N    . LEU A 1 8  ? -7.394  -19.894 -3.471  1.00 0.00 ? 8  LEU A N    7 
ATOM 7252  C CA   . LEU A 1 8  ? -8.066  -19.073 -2.472  1.00 0.00 ? 8  LEU A CA   7 
ATOM 7253  C C    . LEU A 1 8  ? -7.175  -17.895 -2.104  1.00 0.00 ? 8  LEU A C    7 
ATOM 7254  O O    . LEU A 1 8  ? -7.657  -16.828 -1.725  1.00 0.00 ? 8  LEU A O    7 
ATOM 7255  C CB   . LEU A 1 8  ? -8.404  -19.882 -1.224  1.00 0.00 ? 8  LEU A CB   7 
ATOM 7256  C CG   . LEU A 1 8  ? -9.067  -19.084 -0.097  1.00 0.00 ? 8  LEU A CG   7 
ATOM 7257  C CD1  . LEU A 1 8  ? -10.354 -18.432 -0.586  1.00 0.00 ? 8  LEU A CD1  7 
ATOM 7258  C CD2  . LEU A 1 8  ? -9.341  -19.983 1.103   1.00 0.00 ? 8  LEU A CD2  7 
ATOM 7259  H H    . LEU A 1 8  ? -7.130  -20.817 -3.246  1.00 0.00 ? 8  LEU A H    7 
ATOM 7260  H HA   . LEU A 1 8  ? -8.977  -18.701 -2.906  1.00 0.00 ? 8  LEU A HA   7 
ATOM 7261  H HB2  . LEU A 1 8  ? -9.066  -20.688 -1.508  1.00 0.00 ? 8  LEU A HB2  7 
ATOM 7262  H HB3  . LEU A 1 8  ? -7.493  -20.303 -0.846  1.00 0.00 ? 8  LEU A HB3  7 
ATOM 7263  H HG   . LEU A 1 8  ? -8.397  -18.299 0.220   1.00 0.00 ? 8  LEU A HG   7 
ATOM 7264  H HD11 . LEU A 1 8  ? -10.534 -18.714 -1.614  1.00 0.00 ? 8  LEU A HD11 7 
ATOM 7265  H HD12 . LEU A 1 8  ? -11.182 -18.759 0.026   1.00 0.00 ? 8  LEU A HD12 7 
ATOM 7266  H HD13 . LEU A 1 8  ? -10.260 -17.358 -0.520  1.00 0.00 ? 8  LEU A HD13 7 
ATOM 7267  H HD21 . LEU A 1 8  ? -9.264  -21.018 0.805   1.00 0.00 ? 8  LEU A HD21 7 
ATOM 7268  H HD22 . LEU A 1 8  ? -8.618  -19.777 1.879   1.00 0.00 ? 8  LEU A HD22 7 
ATOM 7269  H HD23 . LEU A 1 8  ? -10.336 -19.790 1.479   1.00 0.00 ? 8  LEU A HD23 7 
ATOM 7270  N N    . LEU A 1 9  ? -5.866  -18.102 -2.234  1.00 0.00 ? 9  LEU A N    7 
ATOM 7271  C CA   . LEU A 1 9  ? -4.891  -17.067 -1.933  1.00 0.00 ? 9  LEU A CA   7 
ATOM 7272  C C    . LEU A 1 9  ? -4.975  -15.952 -2.964  1.00 0.00 ? 9  LEU A C    7 
ATOM 7273  O O    . LEU A 1 9  ? -5.357  -14.828 -2.642  1.00 0.00 ? 9  LEU A O    7 
ATOM 7274  C CB   . LEU A 1 9  ? -3.483  -17.661 -1.915  1.00 0.00 ? 9  LEU A CB   7 
ATOM 7275  C CG   . LEU A 1 9  ? -2.386  -16.741 -1.377  1.00 0.00 ? 9  LEU A CG   7 
ATOM 7276  C CD1  . LEU A 1 9  ? -2.224  -15.506 -2.247  1.00 0.00 ? 9  LEU A CD1  7 
ATOM 7277  C CD2  . LEU A 1 9  ? -2.676  -16.352 0.066   1.00 0.00 ? 9  LEU A CD2  7 
ATOM 7278  H H    . LEU A 1 9  ? -5.550  -18.974 -2.550  1.00 0.00 ? 9  LEU A H    7 
ATOM 7279  H HA   . LEU A 1 9  ? -5.119  -16.664 -0.958  1.00 0.00 ? 9  LEU A HA   7 
ATOM 7280  H HB2  . LEU A 1 9  ? -3.502  -18.554 -1.309  1.00 0.00 ? 9  LEU A HB2  7 
ATOM 7281  H HB3  . LEU A 1 9  ? -3.222  -17.938 -2.924  1.00 0.00 ? 9  LEU A HB3  7 
ATOM 7282  H HG   . LEU A 1 9  ? -1.453  -17.276 -1.394  1.00 0.00 ? 9  LEU A HG   7 
ATOM 7283  H HD11 . LEU A 1 9  ? -2.488  -15.745 -3.266  1.00 0.00 ? 9  LEU A HD11 7 
ATOM 7284  H HD12 . LEU A 1 9  ? -2.869  -14.720 -1.882  1.00 0.00 ? 9  LEU A HD12 7 
ATOM 7285  H HD13 . LEU A 1 9  ? -1.197  -15.177 -2.210  1.00 0.00 ? 9  LEU A HD13 7 
ATOM 7286  H HD21 . LEU A 1 9  ? -3.604  -16.805 0.384   1.00 0.00 ? 9  LEU A HD21 7 
ATOM 7287  H HD22 . LEU A 1 9  ? -1.872  -16.696 0.700   1.00 0.00 ? 9  LEU A HD22 7 
ATOM 7288  H HD23 . LEU A 1 9  ? -2.758  -15.277 0.141   1.00 0.00 ? 9  LEU A HD23 7 
ATOM 7289  N N    . TYR A 1 10 ? -4.638  -16.267 -4.217  1.00 0.00 ? 10 TYR A N    7 
ATOM 7290  C CA   . TYR A 1 10 ? -4.695  -15.262 -5.277  1.00 0.00 ? 10 TYR A CA   7 
ATOM 7291  C C    . TYR A 1 10 ? -6.061  -14.600 -5.273  1.00 0.00 ? 10 TYR A C    7 
ATOM 7292  O O    . TYR A 1 10 ? -6.193  -13.395 -5.488  1.00 0.00 ? 10 TYR A O    7 
ATOM 7293  C CB   . TYR A 1 10 ? -4.442  -15.883 -6.653  1.00 0.00 ? 10 TYR A CB   7 
ATOM 7294  C CG   . TYR A 1 10 ? -3.302  -16.874 -6.693  1.00 0.00 ? 10 TYR A CG   7 
ATOM 7295  C CD1  . TYR A 1 10 ? -2.150  -16.674 -5.944  1.00 0.00 ? 10 TYR A CD1  7 
ATOM 7296  C CD2  . TYR A 1 10 ? -3.374  -18.002 -7.498  1.00 0.00 ? 10 TYR A CD2  7 
ATOM 7297  C CE1  . TYR A 1 10 ? -1.104  -17.574 -5.994  1.00 0.00 ? 10 TYR A CE1  7 
ATOM 7298  C CE2  . TYR A 1 10 ? -2.332  -18.907 -7.553  1.00 0.00 ? 10 TYR A CE2  7 
ATOM 7299  C CZ   . TYR A 1 10 ? -1.199  -18.689 -6.800  1.00 0.00 ? 10 TYR A CZ   7 
ATOM 7300  O OH   . TYR A 1 10 ? -0.158  -19.587 -6.851  1.00 0.00 ? 10 TYR A OH   7 
ATOM 7301  H H    . TYR A 1 10 ? -4.354  -17.186 -4.429  1.00 0.00 ? 10 TYR A H    7 
ATOM 7302  H HA   . TYR A 1 10 ? -3.933  -14.514 -5.075  1.00 0.00 ? 10 TYR A HA   7 
ATOM 7303  H HB2  . TYR A 1 10 ? -5.336  -16.396 -6.972  1.00 0.00 ? 10 TYR A HB2  7 
ATOM 7304  H HB3  . TYR A 1 10 ? -4.220  -15.094 -7.357  1.00 0.00 ? 10 TYR A HB3  7 
ATOM 7305  H HD1  . TYR A 1 10 ? -2.080  -15.802 -5.313  1.00 0.00 ? 10 TYR A HD1  7 
ATOM 7306  H HD2  . TYR A 1 10 ? -4.265  -18.171 -8.086  1.00 0.00 ? 10 TYR A HD2  7 
ATOM 7307  H HE1  . TYR A 1 10 ? -0.216  -17.401 -5.404  1.00 0.00 ? 10 TYR A HE1  7 
ATOM 7308  H HE2  . TYR A 1 10 ? -2.408  -19.778 -8.187  1.00 0.00 ? 10 TYR A HE2  7 
ATOM 7309  H HH   . TYR A 1 10 ? 0.264   -19.639 -5.990  1.00 0.00 ? 10 TYR A HH   7 
ATOM 7310  N N    . MET A 1 11 ? -7.074  -15.415 -5.009  1.00 0.00 ? 11 MET A N    7 
ATOM 7311  C CA   . MET A 1 11 ? -8.447  -14.950 -4.952  1.00 0.00 ? 11 MET A CA   7 
ATOM 7312  C C    . MET A 1 11 ? -8.644  -14.084 -3.715  1.00 0.00 ? 11 MET A C    7 
ATOM 7313  O O    . MET A 1 11 ? -9.373  -13.092 -3.739  1.00 0.00 ? 11 MET A O    7 
ATOM 7314  C CB   . MET A 1 11 ? -9.382  -16.153 -4.936  1.00 0.00 ? 11 MET A CB   7 
ATOM 7315  C CG   . MET A 1 11 ? -10.822 -15.810 -5.266  1.00 0.00 ? 11 MET A CG   7 
ATOM 7316  S SD   . MET A 1 11 ? -11.675 -14.979 -3.915  1.00 0.00 ? 11 MET A SD   7 
ATOM 7317  C CE   . MET A 1 11 ? -13.308 -14.771 -4.622  1.00 0.00 ? 11 MET A CE   7 
ATOM 7318  H H    . MET A 1 11 ? -6.888  -16.362 -4.839  1.00 0.00 ? 11 MET A H    7 
ATOM 7319  H HA   . MET A 1 11 ? -8.645  -14.361 -5.835  1.00 0.00 ? 11 MET A HA   7 
ATOM 7320  H HB2  . MET A 1 11 ? -9.026  -16.875 -5.657  1.00 0.00 ? 11 MET A HB2  7 
ATOM 7321  H HB3  . MET A 1 11 ? -9.356  -16.598 -3.953  1.00 0.00 ? 11 MET A HB3  7 
ATOM 7322  H HG2  . MET A 1 11 ? -10.831 -15.161 -6.129  1.00 0.00 ? 11 MET A HG2  7 
ATOM 7323  H HG3  . MET A 1 11 ? -11.344 -16.720 -5.501  1.00 0.00 ? 11 MET A HG3  7 
ATOM 7324  H HE1  . MET A 1 11 ? -13.512 -15.587 -5.300  1.00 0.00 ? 11 MET A HE1  7 
ATOM 7325  H HE2  . MET A 1 11 ? -14.044 -14.768 -3.832  1.00 0.00 ? 11 MET A HE2  7 
ATOM 7326  H HE3  . MET A 1 11 ? -13.352 -13.836 -5.160  1.00 0.00 ? 11 MET A HE3  7 
ATOM 7327  N N    . ALA A 1 12 ? -7.955  -14.457 -2.640  1.00 0.00 ? 12 ALA A N    7 
ATOM 7328  C CA   . ALA A 1 12 ? -8.018  -13.705 -1.393  1.00 0.00 ? 12 ALA A CA   7 
ATOM 7329  C C    . ALA A 1 12 ? -7.420  -12.329 -1.594  1.00 0.00 ? 12 ALA A C    7 
ATOM 7330  O O    . ALA A 1 12 ? -7.860  -11.367 -0.986  1.00 0.00 ? 12 ALA A O    7 
ATOM 7331  C CB   . ALA A 1 12 ? -7.300  -14.449 -0.275  1.00 0.00 ? 12 ALA A CB   7 
ATOM 7332  H H    . ALA A 1 12 ? -7.374  -15.244 -2.695  1.00 0.00 ? 12 ALA A H    7 
ATOM 7333  H HA   . ALA A 1 12 ? -9.059  -13.587 -1.116  1.00 0.00 ? 12 ALA A HA   7 
ATOM 7334  H HB1  . ALA A 1 12 ? -6.381  -14.870 -0.654  1.00 0.00 ? 12 ALA A HB1  7 
ATOM 7335  H HB2  . ALA A 1 12 ? -7.077  -13.763 0.528   1.00 0.00 ? 12 ALA A HB2  7 
ATOM 7336  H HB3  . ALA A 1 12 ? -7.933  -15.241 0.095   1.00 0.00 ? 12 ALA A HB3  7 
ATOM 7337  N N    . ALA A 1 13 ? -6.432  -12.238 -2.475  1.00 0.00 ? 13 ALA A N    7 
ATOM 7338  C CA   . ALA A 1 13 ? -5.803  -10.966 -2.779  1.00 0.00 ? 13 ALA A CA   7 
ATOM 7339  C C    . ALA A 1 13 ? -6.806  -10.066 -3.481  1.00 0.00 ? 13 ALA A C    7 
ATOM 7340  O O    . ALA A 1 13 ? -6.826  -8.856  -3.271  1.00 0.00 ? 13 ALA A O    7 
ATOM 7341  C CB   . ALA A 1 13 ? -4.573  -11.179 -3.646  1.00 0.00 ? 13 ALA A CB   7 
ATOM 7342  H H    . ALA A 1 13 ? -6.134  -13.039 -2.946  1.00 0.00 ? 13 ALA A H    7 
ATOM 7343  H HA   . ALA A 1 13 ? -5.501  -10.502 -1.848  1.00 0.00 ? 13 ALA A HA   7 
ATOM 7344  H HB1  . ALA A 1 13 ? -4.813  -11.865 -4.446  1.00 0.00 ? 13 ALA A HB1  7 
ATOM 7345  H HB2  . ALA A 1 13 ? -4.259  -10.234 -4.065  1.00 0.00 ? 13 ALA A HB2  7 
ATOM 7346  H HB3  . ALA A 1 13 ? -3.775  -11.591 -3.046  1.00 0.00 ? 13 ALA A HB3  7 
ATOM 7347  N N    . ALA A 1 14 ? -7.659  -10.680 -4.299  1.00 0.00 ? 14 ALA A N    7 
ATOM 7348  C CA   . ALA A 1 14 ? -8.691  -9.946  -5.010  1.00 0.00 ? 14 ALA A CA   7 
ATOM 7349  C C    . ALA A 1 14 ? -9.692  -9.389  -4.011  1.00 0.00 ? 14 ALA A C    7 
ATOM 7350  O O    . ALA A 1 14 ? -9.967  -8.190  -3.992  1.00 0.00 ? 14 ALA A O    7 
ATOM 7351  C CB   . ALA A 1 14 ? -9.389  -10.844 -6.023  1.00 0.00 ? 14 ALA A CB   7 
ATOM 7352  H H    . ALA A 1 14 ? -7.603  -11.652 -4.407  1.00 0.00 ? 14 ALA A H    7 
ATOM 7353  H HA   . ALA A 1 14 ? -8.223  -9.128  -5.541  1.00 0.00 ? 14 ALA A HA   7 
ATOM 7354  H HB1  . ALA A 1 14 ? -8.649  -11.391 -6.589  1.00 0.00 ? 14 ALA A HB1  7 
ATOM 7355  H HB2  . ALA A 1 14 ? -10.033 -11.539 -5.505  1.00 0.00 ? 14 ALA A HB2  7 
ATOM 7356  H HB3  . ALA A 1 14 ? -9.980  -10.238 -6.693  1.00 0.00 ? 14 ALA A HB3  7 
ATOM 7357  N N    . VAL A 1 15 ? -10.213 -10.270 -3.159  1.00 0.00 ? 15 VAL A N    7 
ATOM 7358  C CA   . VAL A 1 15 ? -11.161 -9.866  -2.131  1.00 0.00 ? 15 VAL A CA   7 
ATOM 7359  C C    . VAL A 1 15 ? -10.503 -8.871  -1.186  1.00 0.00 ? 15 VAL A C    7 
ATOM 7360  O O    . VAL A 1 15 ? -11.065 -7.830  -0.875  1.00 0.00 ? 15 VAL A O    7 
ATOM 7361  C CB   . VAL A 1 15 ? -11.666 -11.072 -1.316  1.00 0.00 ? 15 VAL A CB   7 
ATOM 7362  C CG1  . VAL A 1 15 ? -12.732 -10.642 -0.320  1.00 0.00 ? 15 VAL A CG1  7 
ATOM 7363  C CG2  . VAL A 1 15 ? -12.194 -12.155 -2.240  1.00 0.00 ? 15 VAL A CG2  7 
ATOM 7364  H H    . VAL A 1 15 ? -9.935  -11.211 -3.214  1.00 0.00 ? 15 VAL A H    7 
ATOM 7365  H HA   . VAL A 1 15 ? -12.008 -9.396  -2.614  1.00 0.00 ? 15 VAL A HA   7 
ATOM 7366  H HB   . VAL A 1 15 ? -10.832 -11.479 -0.762  1.00 0.00 ? 15 VAL A HB   7 
ATOM 7367  H HG11 . VAL A 1 15 ? -12.493 -9.661  0.063   1.00 0.00 ? 15 VAL A HG11 7 
ATOM 7368  H HG12 . VAL A 1 15 ? -13.694 -10.612 -0.811  1.00 0.00 ? 15 VAL A HG12 7 
ATOM 7369  H HG13 . VAL A 1 15 ? -12.767 -11.348 0.497   1.00 0.00 ? 15 VAL A HG13 7 
ATOM 7370  H HG21 . VAL A 1 15 ? -12.544 -11.706 -3.158  1.00 0.00 ? 15 VAL A HG21 7 
ATOM 7371  H HG22 . VAL A 1 15 ? -11.401 -12.852 -2.460  1.00 0.00 ? 15 VAL A HG22 7 
ATOM 7372  H HG23 . VAL A 1 15 ? -13.009 -12.674 -1.758  1.00 0.00 ? 15 VAL A HG23 7 
ATOM 7373  N N    . MET A 1 16 ? -9.298  -9.206  -0.747  1.00 0.00 ? 16 MET A N    7 
ATOM 7374  C CA   . MET A 1 16 ? -8.535  -8.344  0.156   1.00 0.00 ? 16 MET A CA   7 
ATOM 7375  C C    . MET A 1 16 ? -8.304  -6.971  -0.460  1.00 0.00 ? 16 MET A C    7 
ATOM 7376  O O    . MET A 1 16 ? -8.514  -5.944  0.186   1.00 0.00 ? 16 MET A O    7 
ATOM 7377  C CB   . MET A 1 16 ? -7.192  -8.995  0.508   1.00 0.00 ? 16 MET A CB   7 
ATOM 7378  C CG   . MET A 1 16 ? -7.213  -9.774  1.814   1.00 0.00 ? 16 MET A CG   7 
ATOM 7379  S SD   . MET A 1 16 ? -8.462  -11.075 1.834   1.00 0.00 ? 16 MET A SD   7 
ATOM 7380  C CE   . MET A 1 16 ? -8.232  -11.736 3.483   1.00 0.00 ? 16 MET A CE   7 
ATOM 7381  H H    . MET A 1 16 ? -8.908  -10.055 -1.042  1.00 0.00 ? 16 MET A H    7 
ATOM 7382  H HA   . MET A 1 16 ? -9.114  -8.219  1.054   1.00 0.00 ? 16 MET A HA   7 
ATOM 7383  H HB2  . MET A 1 16 ? -6.917  -9.674  -0.284  1.00 0.00 ? 16 MET A HB2  7 
ATOM 7384  H HB3  . MET A 1 16 ? -6.436  -8.231  0.579   1.00 0.00 ? 16 MET A HB3  7 
ATOM 7385  H HG2  . MET A 1 16 ? -6.244  -10.226 1.963   1.00 0.00 ? 16 MET A HG2  7 
ATOM 7386  H HG3  . MET A 1 16 ? -7.416  -9.087  2.622   1.00 0.00 ? 16 MET A HG3  7 
ATOM 7387  H HE1  . MET A 1 16 ? -7.539  -11.112 4.027   1.00 0.00 ? 16 MET A HE1  7 
ATOM 7388  H HE2  . MET A 1 16 ? -9.181  -11.754 3.999   1.00 0.00 ? 16 MET A HE2  7 
ATOM 7389  H HE3  . MET A 1 16 ? -7.839  -12.739 3.418   1.00 0.00 ? 16 MET A HE3  7 
ATOM 7390  N N    . MET A 1 17 ? -7.872  -6.964  -1.709  1.00 0.00 ? 17 MET A N    7 
ATOM 7391  C CA   . MET A 1 17 ? -7.613  -5.718  -2.420  1.00 0.00 ? 17 MET A CA   7 
ATOM 7392  C C    . MET A 1 17 ? -8.914  -4.966  -2.675  1.00 0.00 ? 17 MET A C    7 
ATOM 7393  O O    . MET A 1 17 ? -8.961  -3.739  -2.591  1.00 0.00 ? 17 MET A O    7 
ATOM 7394  C CB   . MET A 1 17 ? -6.898  -5.993  -3.745  1.00 0.00 ? 17 MET A CB   7 
ATOM 7395  C CG   . MET A 1 17 ? -5.437  -6.384  -3.582  1.00 0.00 ? 17 MET A CG   7 
ATOM 7396  S SD   . MET A 1 17 ? -4.425  -5.027  -2.960  1.00 0.00 ? 17 MET A SD   7 
ATOM 7397  C CE   . MET A 1 17 ? -2.792  -5.759  -3.024  1.00 0.00 ? 17 MET A CE   7 
ATOM 7398  H H    . MET A 1 17 ? -7.727  -7.816  -2.162  1.00 0.00 ? 17 MET A H    7 
ATOM 7399  H HA   . MET A 1 17 ? -6.974  -5.107  -1.797  1.00 0.00 ? 17 MET A HA   7 
ATOM 7400  H HB2  . MET A 1 17 ? -7.408  -6.793  -4.260  1.00 0.00 ? 17 MET A HB2  7 
ATOM 7401  H HB3  . MET A 1 17 ? -6.941  -5.102  -4.355  1.00 0.00 ? 17 MET A HB3  7 
ATOM 7402  H HG2  . MET A 1 17 ? -5.375  -7.207  -2.886  1.00 0.00 ? 17 MET A HG2  7 
ATOM 7403  H HG3  . MET A 1 17 ? -5.051  -6.695  -4.540  1.00 0.00 ? 17 MET A HG3  7 
ATOM 7404  H HE1  . MET A 1 17 ? -2.880  -6.818  -3.214  1.00 0.00 ? 17 MET A HE1  7 
ATOM 7405  H HE2  . MET A 1 17 ? -2.222  -5.297  -3.816  1.00 0.00 ? 17 MET A HE2  7 
ATOM 7406  H HE3  . MET A 1 17 ? -2.291  -5.602  -2.081  1.00 0.00 ? 17 MET A HE3  7 
ATOM 7407  N N    . GLY A 1 18 ? -9.973  -5.712  -2.976  1.00 0.00 ? 18 GLY A N    7 
ATOM 7408  C CA   . GLY A 1 18 ? -11.260 -5.098  -3.231  1.00 0.00 ? 18 GLY A CA   7 
ATOM 7409  C C    . GLY A 1 18 ? -11.869 -4.512  -1.975  1.00 0.00 ? 18 GLY A C    7 
ATOM 7410  O O    . GLY A 1 18 ? -12.234 -3.341  -1.945  1.00 0.00 ? 18 GLY A O    7 
ATOM 7411  H H    . GLY A 1 18 ? -9.879  -6.685  -3.017  1.00 0.00 ? 18 GLY A H    7 
ATOM 7412  H HA2  . GLY A 1 18 ? -11.136 -4.310  -3.962  1.00 0.00 ? 18 GLY A HA2  7 
ATOM 7413  H HA3  . GLY A 1 18 ? -11.933 -5.843  -3.631  1.00 0.00 ? 18 GLY A HA3  7 
ATOM 7414  N N    . LEU A 1 19 ? -11.972 -5.333  -0.936  1.00 0.00 ? 19 LEU A N    7 
ATOM 7415  C CA   . LEU A 1 19 ? -12.533 -4.900  0.337   1.00 0.00 ? 19 LEU A CA   7 
ATOM 7416  C C    . LEU A 1 19 ? -11.708 -3.753  0.899   1.00 0.00 ? 19 LEU A C    7 
ATOM 7417  O O    . LEU A 1 19 ? -12.249 -2.753  1.387   1.00 0.00 ? 19 LEU A O    7 
ATOM 7418  C CB   . LEU A 1 19 ? -12.568 -6.077  1.318   1.00 0.00 ? 19 LEU A CB   7 
ATOM 7419  C CG   . LEU A 1 19 ? -11.206 -6.579  1.802   1.00 0.00 ? 19 LEU A CG   7 
ATOM 7420  C CD1  . LEU A 1 19 ? -10.719 -5.763  2.992   1.00 0.00 ? 19 LEU A CD1  7 
ATOM 7421  C CD2  . LEU A 1 19 ? -11.287 -8.056  2.160   1.00 0.00 ? 19 LEU A CD2  7 
ATOM 7422  H H    . LEU A 1 19 ? -11.656 -6.250  -1.025  1.00 0.00 ? 19 LEU A H    7 
ATOM 7423  H HA   . LEU A 1 19 ? -13.541 -4.554  0.158   1.00 0.00 ? 19 LEU A HA   7 
ATOM 7424  H HB2  . LEU A 1 19 ? -13.141 -5.780  2.181   1.00 0.00 ? 19 LEU A HB2  7 
ATOM 7425  H HB3  . LEU A 1 19 ? -13.076 -6.899  0.835   1.00 0.00 ? 19 LEU A HB3  7 
ATOM 7426  H HG   . LEU A 1 19 ? -10.485 -6.465  1.005   1.00 0.00 ? 19 LEU A HG   7 
ATOM 7427  H HD11 . LEU A 1 19 ? -11.543 -5.198  3.404   1.00 0.00 ? 19 LEU A HD11 7 
ATOM 7428  H HD12 . LEU A 1 19 ? -10.327 -6.428  3.748   1.00 0.00 ? 19 LEU A HD12 7 
ATOM 7429  H HD13 . LEU A 1 19 ? -9.941  -5.086  2.674   1.00 0.00 ? 19 LEU A HD13 7 
ATOM 7430  H HD21 . LEU A 1 19 ? -12.227 -8.257  2.650   1.00 0.00 ? 19 LEU A HD21 7 
ATOM 7431  H HD22 . LEU A 1 19 ? -11.217 -8.648  1.260   1.00 0.00 ? 19 LEU A HD22 7 
ATOM 7432  H HD23 . LEU A 1 19 ? -10.473 -8.310  2.823   1.00 0.00 ? 19 LEU A HD23 7 
ATOM 7433  N N    . ALA A 1 20 ? -10.392 -3.891  0.798   1.00 0.00 ? 20 ALA A N    7 
ATOM 7434  C CA   . ALA A 1 20 ? -9.485  -2.860  1.262   1.00 0.00 ? 20 ALA A CA   7 
ATOM 7435  C C    . ALA A 1 20 ? -9.624  -1.634  0.379   1.00 0.00 ? 20 ALA A C    7 
ATOM 7436  O O    . ALA A 1 20 ? -9.472  -0.503  0.835   1.00 0.00 ? 20 ALA A O    7 
ATOM 7437  C CB   . ALA A 1 20 ? -8.051  -3.368  1.257   1.00 0.00 ? 20 ALA A CB   7 
ATOM 7438  H H    . ALA A 1 20 ? -10.026 -4.697  0.377   1.00 0.00 ? 20 ALA A H    7 
ATOM 7439  H HA   . ALA A 1 20 ? -9.755  -2.602  2.277   1.00 0.00 ? 20 ALA A HA   7 
ATOM 7440  H HB1  . ALA A 1 20 ? -7.814  -3.769  0.282   1.00 0.00 ? 20 ALA A HB1  7 
ATOM 7441  H HB2  . ALA A 1 20 ? -7.381  -2.552  1.483   1.00 0.00 ? 20 ALA A HB2  7 
ATOM 7442  H HB3  . ALA A 1 20 ? -7.941  -4.142  2.002   1.00 0.00 ? 20 ALA A HB3  7 
ATOM 7443  N N    . ALA A 1 21 ? -9.936  -1.873  -0.894  1.00 0.00 ? 21 ALA A N    7 
ATOM 7444  C CA   . ALA A 1 21 ? -10.121 -0.793  -1.849  1.00 0.00 ? 21 ALA A CA   7 
ATOM 7445  C C    . ALA A 1 21 ? -11.367 0.001   -1.506  1.00 0.00 ? 21 ALA A C    7 
ATOM 7446  O O    . ALA A 1 21 ? -11.376 1.229   -1.576  1.00 0.00 ? 21 ALA A O    7 
ATOM 7447  C CB   . ALA A 1 21 ? -10.204 -1.341  -3.267  1.00 0.00 ? 21 ALA A CB   7 
ATOM 7448  H H    . ALA A 1 21 ? -10.056 -2.802  -1.190  1.00 0.00 ? 21 ALA A H    7 
ATOM 7449  H HA   . ALA A 1 21 ? -9.269  -0.144  -1.785  1.00 0.00 ? 21 ALA A HA   7 
ATOM 7450  H HB1  . ALA A 1 21 ? -10.908 -2.158  -3.297  1.00 0.00 ? 21 ALA A HB1  7 
ATOM 7451  H HB2  . ALA A 1 21 ? -10.532 -0.558  -3.935  1.00 0.00 ? 21 ALA A HB2  7 
ATOM 7452  H HB3  . ALA A 1 21 ? -9.230  -1.692  -3.574  1.00 0.00 ? 21 ALA A HB3  7 
ATOM 7453  N N    . ILE A 1 22 ? -12.409 -0.712  -1.105  1.00 0.00 ? 22 ILE A N    7 
ATOM 7454  C CA   . ILE A 1 22 ? -13.661 -0.076  -0.719  1.00 0.00 ? 22 ILE A CA   7 
ATOM 7455  C C    . ILE A 1 22 ? -13.435 0.790   0.511   1.00 0.00 ? 22 ILE A C    7 
ATOM 7456  O O    . ILE A 1 22 ? -13.608 2.007   0.466   1.00 0.00 ? 22 ILE A O    7 
ATOM 7457  C CB   . ILE A 1 22 ? -14.767 -1.104  -0.414  1.00 0.00 ? 22 ILE A CB   7 
ATOM 7458  C CG1  . ILE A 1 22 ? -14.948 -2.065  -1.587  1.00 0.00 ? 22 ILE A CG1  7 
ATOM 7459  C CG2  . ILE A 1 22 ? -16.080 -0.398  -0.101  1.00 0.00 ? 22 ILE A CG2  7 
ATOM 7460  C CD1  . ILE A 1 22 ? -15.353 -1.384  -2.877  1.00 0.00 ? 22 ILE A CD1  7 
ATOM 7461  H H    . ILE A 1 22 ? -12.323 -1.683  -1.054  1.00 0.00 ? 22 ILE A H    7 
ATOM 7462  H HA   . ILE A 1 22 ? -13.989 0.548   -1.536  1.00 0.00 ? 22 ILE A HA   7 
ATOM 7463  H HB   . ILE A 1 22 ? -14.472 -1.663  0.458   1.00 0.00 ? 22 ILE A HB   7 
ATOM 7464  H HG12 . ILE A 1 22 ? -14.021 -2.580  -1.764  1.00 0.00 ? 22 ILE A HG12 7 
ATOM 7465  H HG13 . ILE A 1 22 ? -15.714 -2.786  -1.338  1.00 0.00 ? 22 ILE A HG13 7 
ATOM 7466  H HG21 . ILE A 1 22 ? -15.877 0.532   0.407   1.00 0.00 ? 22 ILE A HG21 7 
ATOM 7467  H HG22 . ILE A 1 22 ? -16.607 -0.198  -1.022  1.00 0.00 ? 22 ILE A HG22 7 
ATOM 7468  H HG23 . ILE A 1 22 ? -16.686 -1.030  0.531   1.00 0.00 ? 22 ILE A HG23 7 
ATOM 7469  H HD11 . ILE A 1 22 ? -15.200 -0.319  -2.786  1.00 0.00 ? 22 ILE A HD11 7 
ATOM 7470  H HD12 . ILE A 1 22 ? -14.750 -1.766  -3.688  1.00 0.00 ? 22 ILE A HD12 7 
ATOM 7471  H HD13 . ILE A 1 22 ? -16.395 -1.582  -3.077  1.00 0.00 ? 22 ILE A HD13 7 
ATOM 7472  N N    . GLY A 1 23 ? -13.025 0.156   1.609   1.00 0.00 ? 23 GLY A N    7 
ATOM 7473  C CA   . GLY A 1 23 ? -12.765 0.899   2.829   1.00 0.00 ? 23 GLY A CA   7 
ATOM 7474  C C    . GLY A 1 23 ? -11.771 2.017   2.597   1.00 0.00 ? 23 GLY A C    7 
ATOM 7475  O O    . GLY A 1 23 ? -12.011 3.168   2.970   1.00 0.00 ? 23 GLY A O    7 
ATOM 7476  H H    . GLY A 1 23 ? -12.886 -0.818  1.585   1.00 0.00 ? 23 GLY A H    7 
ATOM 7477  H HA2  . GLY A 1 23 ? -13.694 1.319   3.190   1.00 0.00 ? 23 GLY A HA2  7 
ATOM 7478  H HA3  . GLY A 1 23 ? -12.370 0.225   3.575   1.00 0.00 ? 23 GLY A HA3  7 
ATOM 7479  N N    . ALA A 1 24 ? -10.653 1.674   1.962   1.00 0.00 ? 24 ALA A N    7 
ATOM 7480  C CA   . ALA A 1 24 ? -9.617  2.647   1.656   1.00 0.00 ? 24 ALA A CA   7 
ATOM 7481  C C    . ALA A 1 24 ? -10.175 3.772   0.799   1.00 0.00 ? 24 ALA A C    7 
ATOM 7482  O O    . ALA A 1 24 ? -9.868  4.936   1.019   1.00 0.00 ? 24 ALA A O    7 
ATOM 7483  C CB   . ALA A 1 24 ? -8.453  1.978   0.944   1.00 0.00 ? 24 ALA A CB   7 
ATOM 7484  H H    . ALA A 1 24 ? -10.531 0.743   1.681   1.00 0.00 ? 24 ALA A H    7 
ATOM 7485  H HA   . ALA A 1 24 ? -9.256  3.059   2.586   1.00 0.00 ? 24 ALA A HA   7 
ATOM 7486  H HB1  . ALA A 1 24 ? -8.819  1.448   0.076   1.00 0.00 ? 24 ALA A HB1  7 
ATOM 7487  H HB2  . ALA A 1 24 ? -7.743  2.728   0.631   1.00 0.00 ? 24 ALA A HB2  7 
ATOM 7488  H HB3  . ALA A 1 24 ? -7.972  1.282   1.614   1.00 0.00 ? 24 ALA A HB3  7 
ATOM 7489  N N    . ALA A 1 25 ? -10.995 3.412   -0.181  1.00 0.00 ? 25 ALA A N    7 
ATOM 7490  C CA   . ALA A 1 25 ? -11.594 4.394   -1.078  1.00 0.00 ? 25 ALA A CA   7 
ATOM 7491  C C    . ALA A 1 25 ? -12.438 5.405   -0.311  1.00 0.00 ? 25 ALA A C    7 
ATOM 7492  O O    . ALA A 1 25 ? -12.153 6.601   -0.321  1.00 0.00 ? 25 ALA A O    7 
ATOM 7493  C CB   . ALA A 1 25 ? -12.436 3.698   -2.137  1.00 0.00 ? 25 ALA A CB   7 
ATOM 7494  H H    . ALA A 1 25 ? -11.200 2.463   -0.306  1.00 0.00 ? 25 ALA A H    7 
ATOM 7495  H HA   . ALA A 1 25 ? -10.793 4.919   -1.579  1.00 0.00 ? 25 ALA A HA   7 
ATOM 7496  H HB1  . ALA A 1 25 ? -13.104 2.995   -1.662  1.00 0.00 ? 25 ALA A HB1  7 
ATOM 7497  H HB2  . ALA A 1 25 ? -13.014 4.435   -2.676  1.00 0.00 ? 25 ALA A HB2  7 
ATOM 7498  H HB3  . ALA A 1 25 ? -11.790 3.175   -2.825  1.00 0.00 ? 25 ALA A HB3  7 
ATOM 7499  N N    . ILE A 1 26 ? -13.477 4.925   0.359   1.00 0.00 ? 26 ILE A N    7 
ATOM 7500  C CA   . ILE A 1 26 ? -14.349 5.806   1.124   1.00 0.00 ? 26 ILE A CA   7 
ATOM 7501  C C    . ILE A 1 26 ? -13.544 6.700   2.067   1.00 0.00 ? 26 ILE A C    7 
ATOM 7502  O O    . ILE A 1 26 ? -13.705 7.920   2.057   1.00 0.00 ? 26 ILE A O    7 
ATOM 7503  C CB   . ILE A 1 26 ? -15.418 5.013   1.909   1.00 0.00 ? 26 ILE A CB   7 
ATOM 7504  C CG1  . ILE A 1 26 ? -16.495 4.504   0.949   1.00 0.00 ? 26 ILE A CG1  7 
ATOM 7505  C CG2  . ILE A 1 26 ? -16.061 5.859   3.007   1.00 0.00 ? 26 ILE A CG2  7 
ATOM 7506  C CD1  . ILE A 1 26 ? -16.033 3.406   0.016   1.00 0.00 ? 26 ILE A CD1  7 
ATOM 7507  H H    . ILE A 1 26 ? -13.658 3.963   0.341   1.00 0.00 ? 26 ILE A H    7 
ATOM 7508  H HA   . ILE A 1 26 ? -14.872 6.432   0.417   1.00 0.00 ? 26 ILE A HA   7 
ATOM 7509  H HB   . ILE A 1 26 ? -14.937 4.168   2.374   1.00 0.00 ? 26 ILE A HB   7 
ATOM 7510  H HG12 . ILE A 1 26 ? -17.319 4.125   1.520   1.00 0.00 ? 26 ILE A HG12 7 
ATOM 7511  H HG13 . ILE A 1 26 ? -16.838 5.330   0.342   1.00 0.00 ? 26 ILE A HG13 7 
ATOM 7512  H HG21 . ILE A 1 26 ? -15.467 6.741   3.186   1.00 0.00 ? 26 ILE A HG21 7 
ATOM 7513  H HG22 . ILE A 1 26 ? -17.054 6.152   2.699   1.00 0.00 ? 26 ILE A HG22 7 
ATOM 7514  H HG23 . ILE A 1 26 ? -16.124 5.280   3.916   1.00 0.00 ? 26 ILE A HG23 7 
ATOM 7515  H HD11 . ILE A 1 26 ? -15.648 2.581   0.595   1.00 0.00 ? 26 ILE A HD11 7 
ATOM 7516  H HD12 . ILE A 1 26 ? -16.868 3.068   -0.579  1.00 0.00 ? 26 ILE A HD12 7 
ATOM 7517  H HD13 . ILE A 1 26 ? -15.260 3.784   -0.634  1.00 0.00 ? 26 ILE A HD13 7 
ATOM 7518  N N    . GLY A 1 27 ? -12.683 6.098   2.883   1.00 0.00 ? 27 GLY A N    7 
ATOM 7519  C CA   . GLY A 1 27 ? -11.891 6.882   3.817   1.00 0.00 ? 27 GLY A CA   7 
ATOM 7520  C C    . GLY A 1 27 ? -10.851 7.750   3.138   1.00 0.00 ? 27 GLY A C    7 
ATOM 7521  O O    . GLY A 1 27 ? -10.565 8.852   3.605   1.00 0.00 ? 27 GLY A O    7 
ATOM 7522  H H    . GLY A 1 27 ? -12.589 5.120   2.857   1.00 0.00 ? 27 GLY A H    7 
ATOM 7523  H HA2  . GLY A 1 27 ? -12.557 7.523   4.379   1.00 0.00 ? 27 GLY A HA2  7 
ATOM 7524  H HA3  . GLY A 1 27 ? -11.396 6.224   4.505   1.00 0.00 ? 27 GLY A HA3  7 
ATOM 7525  N N    . ILE A 1 28 ? -10.281 7.274   2.029   1.00 0.00 ? 28 ILE A N    7 
ATOM 7526  C CA   . ILE A 1 28 ? -9.280  8.062   1.319   1.00 0.00 ? 28 ILE A CA   7 
ATOM 7527  C C    . ILE A 1 28 ? -9.906  9.389   0.957   1.00 0.00 ? 28 ILE A C    7 
ATOM 7528  O O    . ILE A 1 28 ? -9.327  10.451  1.167   1.00 0.00 ? 28 ILE A O    7 
ATOM 7529  C CB   . ILE A 1 28 ? -8.746  7.356   0.046   1.00 0.00 ? 28 ILE A CB   7 
ATOM 7530  C CG1  . ILE A 1 28 ? -7.320  7.821   -0.252  1.00 0.00 ? 28 ILE A CG1  7 
ATOM 7531  C CG2  . ILE A 1 28 ? -9.638  7.608   -1.163  1.00 0.00 ? 28 ILE A CG2  7 
ATOM 7532  C CD1  . ILE A 1 28 ? -6.357  7.568   0.886   1.00 0.00 ? 28 ILE A CD1  7 
ATOM 7533  H H    . ILE A 1 28 ? -10.544 6.398   1.688   1.00 0.00 ? 28 ILE A H    7 
ATOM 7534  H HA   . ILE A 1 28 ? -8.455  8.238   1.993   1.00 0.00 ? 28 ILE A HA   7 
ATOM 7535  H HB   . ILE A 1 28 ? -8.739  6.303   0.231   1.00 0.00 ? 28 ILE A HB   7 
ATOM 7536  H HG12 . ILE A 1 28 ? -6.950  7.293   -1.118  1.00 0.00 ? 28 ILE A HG12 7 
ATOM 7537  H HG13 . ILE A 1 28 ? -7.326  8.882   -0.454  1.00 0.00 ? 28 ILE A HG13 7 
ATOM 7538  H HG21 . ILE A 1 28 ? -10.647 7.316   -0.932  1.00 0.00 ? 28 ILE A HG21 7 
ATOM 7539  H HG22 . ILE A 1 28 ? -9.615  8.656   -1.416  1.00 0.00 ? 28 ILE A HG22 7 
ATOM 7540  H HG23 . ILE A 1 28 ? -9.280  7.028   -2.001  1.00 0.00 ? 28 ILE A HG23 7 
ATOM 7541  H HD11 . ILE A 1 28 ? -6.657  6.676   1.415   1.00 0.00 ? 28 ILE A HD11 7 
ATOM 7542  H HD12 . ILE A 1 28 ? -5.360  7.436   0.493   1.00 0.00 ? 28 ILE A HD12 7 
ATOM 7543  H HD13 . ILE A 1 28 ? -6.371  8.409   1.563   1.00 0.00 ? 28 ILE A HD13 7 
ATOM 7544  N N    . GLY A 1 29 ? -11.126 9.299   0.458   1.00 0.00 ? 29 GLY A N    7 
ATOM 7545  C CA   . GLY A 1 29 ? -11.874 10.487  0.110   1.00 0.00 ? 29 GLY A CA   7 
ATOM 7546  C C    . GLY A 1 29 ? -12.204 11.301  1.345   1.00 0.00 ? 29 GLY A C    7 
ATOM 7547  O O    . GLY A 1 29 ? -12.122 12.529  1.328   1.00 0.00 ? 29 GLY A O    7 
ATOM 7548  H H    . GLY A 1 29 ? -11.530 8.408   0.355   1.00 0.00 ? 29 GLY A H    7 
ATOM 7549  H HA2  . GLY A 1 29 ? -11.286 11.090  -0.568  1.00 0.00 ? 29 GLY A HA2  7 
ATOM 7550  H HA3  . GLY A 1 29 ? -12.794 10.197  -0.377  1.00 0.00 ? 29 GLY A HA3  7 
ATOM 7551  N N    . ILE A 1 30 ? -12.564 10.608  2.429   1.00 0.00 ? 30 ILE A N    7 
ATOM 7552  C CA   . ILE A 1 30 ? -12.891 11.273  3.689   1.00 0.00 ? 30 ILE A CA   7 
ATOM 7553  C C    . ILE A 1 30 ? -11.740 12.177  4.134   1.00 0.00 ? 30 ILE A C    7 
ATOM 7554  O O    . ILE A 1 30 ? -11.842 13.403  4.082   1.00 0.00 ? 30 ILE A O    7 
ATOM 7555  C CB   . ILE A 1 30 ? -13.204 10.242  4.801   1.00 0.00 ? 30 ILE A CB   7 
ATOM 7556  C CG1  . ILE A 1 30 ? -14.456 9.442   4.443   1.00 0.00 ? 30 ILE A CG1  7 
ATOM 7557  C CG2  . ILE A 1 30 ? -13.390 10.936  6.146   1.00 0.00 ? 30 ILE A CG2  7 
ATOM 7558  C CD1  . ILE A 1 30 ? -15.722 10.272  4.390   1.00 0.00 ? 30 ILE A CD1  7 
ATOM 7559  H H    . ILE A 1 30 ? -12.600 9.623   2.382   1.00 0.00 ? 30 ILE A H    7 
ATOM 7560  H HA   . ILE A 1 30 ? -13.770 11.881  3.526   1.00 0.00 ? 30 ILE A HA   7 
ATOM 7561  H HB   . ILE A 1 30 ? -12.366 9.558   4.886   1.00 0.00 ? 30 ILE A HB   7 
ATOM 7562  H HG12 . ILE A 1 30 ? -14.318 8.997   3.474   1.00 0.00 ? 30 ILE A HG12 7 
ATOM 7563  H HG13 . ILE A 1 30 ? -14.600 8.663   5.176   1.00 0.00 ? 30 ILE A HG13 7 
ATOM 7564  H HG21 . ILE A 1 30 ? -12.491 11.477  6.399   1.00 0.00 ? 30 ILE A HG21 7 
ATOM 7565  H HG22 . ILE A 1 30 ? -14.220 11.624  6.084   1.00 0.00 ? 30 ILE A HG22 7 
ATOM 7566  H HG23 . ILE A 1 30 ? -13.592 10.196  6.907   1.00 0.00 ? 30 ILE A HG23 7 
ATOM 7567  H HD11 . ILE A 1 30 ? -15.471 11.303  4.195   1.00 0.00 ? 30 ILE A HD11 7 
ATOM 7568  H HD12 . ILE A 1 30 ? -16.360 9.902   3.601   1.00 0.00 ? 30 ILE A HD12 7 
ATOM 7569  H HD13 . ILE A 1 30 ? -16.239 10.199  5.335   1.00 0.00 ? 30 ILE A HD13 7 
ATOM 7570  N N    . LEU A 1 31 ? -10.644 11.558  4.558   1.00 0.00 ? 31 LEU A N    7 
ATOM 7571  C CA   . LEU A 1 31 ? -9.461  12.288  5.004   1.00 0.00 ? 31 LEU A CA   7 
ATOM 7572  C C    . LEU A 1 31 ? -8.811  12.999  3.822   1.00 0.00 ? 31 LEU A C    7 
ATOM 7573  O O    . LEU A 1 31 ? -8.147  14.022  3.984   1.00 0.00 ? 31 LEU A O    7 
ATOM 7574  C CB   . LEU A 1 31 ? -8.478  11.304  5.652   1.00 0.00 ? 31 LEU A CB   7 
ATOM 7575  C CG   . LEU A 1 31 ? -7.318  11.922  6.443   1.00 0.00 ? 31 LEU A CG   7 
ATOM 7576  C CD1  . LEU A 1 31 ? -6.775  10.917  7.452   1.00 0.00 ? 31 LEU A CD1  7 
ATOM 7577  C CD2  . LEU A 1 31 ? -6.202  12.373  5.512   1.00 0.00 ? 31 LEU A CD2  7 
ATOM 7578  H H    . LEU A 1 31 ? -10.627 10.577  4.564   1.00 0.00 ? 31 LEU A H    7 
ATOM 7579  H HA   . LEU A 1 31 ? -9.768  13.028  5.738   1.00 0.00 ? 31 LEU A HA   7 
ATOM 7580  H HB2  . LEU A 1 31 ? -9.036  10.666  6.318   1.00 0.00 ? 31 LEU A HB2  7 
ATOM 7581  H HB3  . LEU A 1 31 ? -8.057  10.690  4.870   1.00 0.00 ? 31 LEU A HB3  7 
ATOM 7582  H HG   . LEU A 1 31 ? -7.677  12.784  6.987   1.00 0.00 ? 31 LEU A HG   7 
ATOM 7583  H HD11 . LEU A 1 31 ? -7.316  9.986   7.361   1.00 0.00 ? 31 LEU A HD11 7 
ATOM 7584  H HD12 . LEU A 1 31 ? -5.726  10.743  7.259   1.00 0.00 ? 31 LEU A HD12 7 
ATOM 7585  H HD13 . LEU A 1 31 ? -6.897  11.307  8.450   1.00 0.00 ? 31 LEU A HD13 7 
ATOM 7586  H HD21 . LEU A 1 31 ? -6.603  12.574  4.532   1.00 0.00 ? 31 LEU A HD21 7 
ATOM 7587  H HD22 . LEU A 1 31 ? -5.747  13.270  5.906   1.00 0.00 ? 31 LEU A HD22 7 
ATOM 7588  H HD23 . LEU A 1 31 ? -5.457  11.595  5.441   1.00 0.00 ? 31 LEU A HD23 7 
ATOM 7589  N N    . GLY A 1 32 ? -9.013  12.447  2.629   1.00 0.00 ? 32 GLY A N    7 
ATOM 7590  C CA   . GLY A 1 32 ? -8.446  13.037  1.430   1.00 0.00 ? 32 GLY A CA   7 
ATOM 7591  C C    . GLY A 1 32 ? -8.911  14.461  1.217   1.00 0.00 ? 32 GLY A C    7 
ATOM 7592  O O    . GLY A 1 32 ? -8.110  15.336  0.908   1.00 0.00 ? 32 GLY A O    7 
ATOM 7593  H H    . GLY A 1 32 ? -9.552  11.632  2.562   1.00 0.00 ? 32 GLY A H    7 
ATOM 7594  H HA2  . GLY A 1 32 ? -7.369  13.028  1.510   1.00 0.00 ? 32 GLY A HA2  7 
ATOM 7595  H HA3  . GLY A 1 32 ? -8.737  12.446  0.573   1.00 0.00 ? 32 GLY A HA3  7 
ATOM 7596  N N    . GLY A 1 33 ? -10.209 14.695  1.386   1.00 0.00 ? 33 GLY A N    7 
ATOM 7597  C CA   . GLY A 1 33 ? -10.745 16.033  1.209   1.00 0.00 ? 33 GLY A CA   7 
ATOM 7598  C C    . GLY A 1 33 ? -10.150 17.019  2.193   1.00 0.00 ? 33 GLY A C    7 
ATOM 7599  O O    . GLY A 1 33 ? -9.647  18.070  1.802   1.00 0.00 ? 33 GLY A O    7 
ATOM 7600  H H    . GLY A 1 33 ? -10.804 13.958  1.637   1.00 0.00 ? 33 GLY A H    7 
ATOM 7601  H HA2  . GLY A 1 33 ? -10.529 16.366  0.202   1.00 0.00 ? 33 GLY A HA2  7 
ATOM 7602  H HA3  . GLY A 1 33 ? -11.816 16.003  1.345   1.00 0.00 ? 33 GLY A HA3  7 
ATOM 7603  N N    . LYS A 1 34 ? -10.206 16.671  3.475   1.00 0.00 ? 34 LYS A N    7 
ATOM 7604  C CA   . LYS A 1 34 ? -9.669  17.521  4.533   1.00 0.00 ? 34 LYS A CA   7 
ATOM 7605  C C    . LYS A 1 34 ? -8.168  17.750  4.348   1.00 0.00 ? 34 LYS A C    7 
ATOM 7606  O O    . LYS A 1 34 ? -7.688  18.889  4.359   1.00 0.00 ? 34 LYS A O    7 
ATOM 7607  C CB   . LYS A 1 34 ? -9.944  16.880  5.901   1.00 0.00 ? 34 LYS A CB   7 
ATOM 7608  C CG   . LYS A 1 34 ? -9.369  15.483  6.059   1.00 0.00 ? 34 LYS A CG   7 
ATOM 7609  C CD   . LYS A 1 34 ? -9.728  14.887  7.410   1.00 0.00 ? 34 LYS A CD   7 
ATOM 7610  C CE   . LYS A 1 34 ? -9.136  15.700  8.551   1.00 0.00 ? 34 LYS A CE   7 
ATOM 7611  N NZ   . LYS A 1 34 ? -7.651  15.785  8.461   1.00 0.00 ? 34 LYS A NZ   7 
ATOM 7612  H H    . LYS A 1 34 ? -10.618 15.816  3.717   1.00 0.00 ? 34 LYS A H    7 
ATOM 7613  H HA   . LYS A 1 34 ? -10.176 18.474  4.483   1.00 0.00 ? 34 LYS A HA   7 
ATOM 7614  H HB2  . LYS A 1 34 ? -9.519  17.499  6.669   1.00 0.00 ? 34 LYS A HB2  7 
ATOM 7615  H HB3  . LYS A 1 34 ? -11.012 16.820  6.048   1.00 0.00 ? 34 LYS A HB3  7 
ATOM 7616  H HG2  . LYS A 1 34 ? -9.761  14.851  5.278   1.00 0.00 ? 34 LYS A HG2  7 
ATOM 7617  H HG3  . LYS A 1 34 ? -8.293  15.537  5.979   1.00 0.00 ? 34 LYS A HG3  7 
ATOM 7618  H HD2  . LYS A 1 34 ? -10.803 14.873  7.512   1.00 0.00 ? 34 LYS A HD2  7 
ATOM 7619  H HD3  . LYS A 1 34 ? -9.347  13.878  7.462   1.00 0.00 ? 34 LYS A HD3  7 
ATOM 7620  H HE2  . LYS A 1 34 ? -9.547  16.697  8.516   1.00 0.00 ? 34 LYS A HE2  7 
ATOM 7621  H HE3  . LYS A 1 34 ? -9.405  15.232  9.486   1.00 0.00 ? 34 LYS A HE3  7 
ATOM 7622  H HZ1  . LYS A 1 34 ? -7.299  15.146  7.719   1.00 0.00 ? 34 LYS A HZ1  7 
ATOM 7623  H HZ2  . LYS A 1 34 ? -7.362  16.757  8.230   1.00 0.00 ? 34 LYS A HZ2  7 
ATOM 7624  H HZ3  . LYS A 1 34 ? -7.222  15.515  9.369   1.00 0.00 ? 34 LYS A HZ3  7 
ATOM 7625  N N    . PHE A 1 35 ? -7.438  16.654  4.175   1.00 0.00 ? 35 PHE A N    7 
ATOM 7626  C CA   . PHE A 1 35 ? -5.991  16.699  3.998   1.00 0.00 ? 35 PHE A CA   7 
ATOM 7627  C C    . PHE A 1 35 ? -5.629  17.450  2.733   1.00 0.00 ? 35 PHE A C    7 
ATOM 7628  O O    . PHE A 1 35 ? -4.774  18.333  2.737   1.00 0.00 ? 35 PHE A O    7 
ATOM 7629  C CB   . PHE A 1 35 ? -5.447  15.276  3.922   1.00 0.00 ? 35 PHE A CB   7 
ATOM 7630  C CG   . PHE A 1 35 ? -3.956  15.184  4.078   1.00 0.00 ? 35 PHE A CG   7 
ATOM 7631  C CD1  . PHE A 1 35 ? -3.324  15.745  5.175   1.00 0.00 ? 35 PHE A CD1  7 
ATOM 7632  C CD2  . PHE A 1 35 ? -3.188  14.545  3.122   1.00 0.00 ? 35 PHE A CD2  7 
ATOM 7633  C CE1  . PHE A 1 35 ? -1.953  15.672  5.311   1.00 0.00 ? 35 PHE A CE1  7 
ATOM 7634  C CE2  . PHE A 1 35 ? -1.817  14.467  3.256   1.00 0.00 ? 35 PHE A CE2  7 
ATOM 7635  C CZ   . PHE A 1 35 ? -1.199  15.032  4.350   1.00 0.00 ? 35 PHE A CZ   7 
ATOM 7636  H H    . PHE A 1 35 ? -7.885  15.784  4.172   1.00 0.00 ? 35 PHE A H    7 
ATOM 7637  H HA   . PHE A 1 35 ? -5.557  17.204  4.854   1.00 0.00 ? 35 PHE A HA   7 
ATOM 7638  H HB2  . PHE A 1 35 ? -5.905  14.690  4.693   1.00 0.00 ? 35 PHE A HB2  7 
ATOM 7639  H HB3  . PHE A 1 35 ? -5.707  14.855  2.962   1.00 0.00 ? 35 PHE A HB3  7 
ATOM 7640  H HD1  . PHE A 1 35 ? -3.914  16.247  5.927   1.00 0.00 ? 35 PHE A HD1  7 
ATOM 7641  H HD2  . PHE A 1 35 ? -3.671  14.101  2.264   1.00 0.00 ? 35 PHE A HD2  7 
ATOM 7642  H HE1  . PHE A 1 35 ? -1.471  16.114  6.171   1.00 0.00 ? 35 PHE A HE1  7 
ATOM 7643  H HE2  . PHE A 1 35 ? -1.229  13.966  2.502   1.00 0.00 ? 35 PHE A HE2  7 
ATOM 7644  H HZ   . PHE A 1 35 ? -0.125  14.975  4.454   1.00 0.00 ? 35 PHE A HZ   7 
ATOM 7645  N N    . LEU A 1 36 ? -6.288  17.082  1.649   1.00 0.00 ? 36 LEU A N    7 
ATOM 7646  C CA   . LEU A 1 36 ? -6.049  17.717  0.361   1.00 0.00 ? 36 LEU A CA   7 
ATOM 7647  C C    . LEU A 1 36 ? -6.469  19.179  0.413   1.00 0.00 ? 36 LEU A C    7 
ATOM 7648  O O    . LEU A 1 36 ? -5.822  20.042  -0.177  1.00 0.00 ? 36 LEU A O    7 
ATOM 7649  C CB   . LEU A 1 36 ? -6.808  16.990  -0.752  1.00 0.00 ? 36 LEU A CB   7 
ATOM 7650  C CG   . LEU A 1 36 ? -6.609  17.557  -2.160  1.00 0.00 ? 36 LEU A CG   7 
ATOM 7651  C CD1  . LEU A 1 36 ? -5.138  17.542  -2.548  1.00 0.00 ? 36 LEU A CD1  7 
ATOM 7652  C CD2  . LEU A 1 36 ? -7.435  16.770  -3.166  1.00 0.00 ? 36 LEU A CD2  7 
ATOM 7653  H H    . LEU A 1 36 ? -6.948  16.363  1.722   1.00 0.00 ? 36 LEU A H    7 
ATOM 7654  H HA   . LEU A 1 36 ? -4.989  17.665  0.160   1.00 0.00 ? 36 LEU A HA   7 
ATOM 7655  H HB2  . LEU A 1 36 ? -6.496  15.957  -0.756  1.00 0.00 ? 36 LEU A HB2  7 
ATOM 7656  H HB3  . LEU A 1 36 ? -7.863  17.028  -0.523  1.00 0.00 ? 36 LEU A HB3  7 
ATOM 7657  H HG   . LEU A 1 36 ? -6.948  18.583  -2.178  1.00 0.00 ? 36 LEU A HG   7 
ATOM 7658  H HD11 . LEU A 1 36 ? -4.531  17.679  -1.667  1.00 0.00 ? 36 LEU A HD11 7 
ATOM 7659  H HD12 . LEU A 1 36 ? -4.898  16.595  -3.009  1.00 0.00 ? 36 LEU A HD12 7 
ATOM 7660  H HD13 . LEU A 1 36 ? -4.943  18.342  -3.246  1.00 0.00 ? 36 LEU A HD13 7 
ATOM 7661  H HD21 . LEU A 1 36 ? -7.293  15.713  -2.998  1.00 0.00 ? 36 LEU A HD21 7 
ATOM 7662  H HD22 . LEU A 1 36 ? -8.479  17.018  -3.048  1.00 0.00 ? 36 LEU A HD22 7 
ATOM 7663  H HD23 . LEU A 1 36 ? -7.116  17.021  -4.168  1.00 0.00 ? 36 LEU A HD23 7 
ATOM 7664  N N    . GLU A 1 37 ? -7.547  19.455  1.143   1.00 0.00 ? 37 GLU A N    7 
ATOM 7665  C CA   . GLU A 1 37 ? -8.042  20.820  1.285   1.00 0.00 ? 37 GLU A CA   7 
ATOM 7666  C C    . GLU A 1 37 ? -6.955  21.712  1.873   1.00 0.00 ? 37 GLU A C    7 
ATOM 7667  O O    . GLU A 1 37 ? -6.486  22.647  1.222   1.00 0.00 ? 37 GLU A O    7 
ATOM 7668  C CB   . GLU A 1 37 ? -9.288  20.852  2.175   1.00 0.00 ? 37 GLU A CB   7 
ATOM 7669  C CG   . GLU A 1 37 ? -9.854  22.250  2.377   1.00 0.00 ? 37 GLU A CG   7 
ATOM 7670  C CD   . GLU A 1 37 ? -11.084 22.261  3.266   1.00 0.00 ? 37 GLU A CD   7 
ATOM 7671  O OE1  . GLU A 1 37 ? -11.503 21.174  3.717   1.00 0.00 ? 37 GLU A OE1  7 
ATOM 7672  O OE2  . GLU A 1 37 ? -11.629 23.359  3.509   1.00 0.00 ? 37 GLU A OE2  7 
ATOM 7673  H H    . GLU A 1 37 ? -8.011  18.727  1.604   1.00 0.00 ? 37 GLU A H    7 
ATOM 7674  H HA   . GLU A 1 37 ? -8.300  21.185  0.301   1.00 0.00 ? 37 GLU A HA   7 
ATOM 7675  H HB2  . GLU A 1 37 ? -10.055 20.240  1.723   1.00 0.00 ? 37 GLU A HB2  7 
ATOM 7676  H HB3  . GLU A 1 37 ? -9.037  20.445  3.144   1.00 0.00 ? 37 GLU A HB3  7 
ATOM 7677  H HG2  . GLU A 1 37 ? -9.096  22.869  2.831   1.00 0.00 ? 37 GLU A HG2  7 
ATOM 7678  H HG3  . GLU A 1 37 ? -10.122 22.658  1.413   1.00 0.00 ? 37 GLU A HG3  7 
ATOM 7679  N N    . GLY A 1 38 ? -6.543  21.408  3.101   1.00 0.00 ? 38 GLY A N    7 
ATOM 7680  C CA   . GLY A 1 38 ? -5.499  22.194  3.737   1.00 0.00 ? 38 GLY A CA   7 
ATOM 7681  C C    . GLY A 1 38 ? -4.184  22.083  2.989   1.00 0.00 ? 38 GLY A C    7 
ATOM 7682  O O    . GLY A 1 38 ? -3.541  23.092  2.671   1.00 0.00 ? 38 GLY A O    7 
ATOM 7683  H H    . GLY A 1 38 ? -6.942  20.641  3.573   1.00 0.00 ? 38 GLY A H    7 
ATOM 7684  H HA2  . GLY A 1 38 ? -5.806  23.231  3.765   1.00 0.00 ? 38 GLY A HA2  7 
ATOM 7685  H HA3  . GLY A 1 38 ? -5.358  21.840  4.750   1.00 0.00 ? 38 GLY A HA3  7 
ATOM 7686  N N    . ALA A 1 39 ? -3.787  20.848  2.696   1.00 0.00 ? 39 ALA A N    7 
ATOM 7687  C CA   . ALA A 1 39 ? -2.551  20.597  1.971   1.00 0.00 ? 39 ALA A CA   7 
ATOM 7688  C C    . ALA A 1 39 ? -2.526  21.383  0.672   1.00 0.00 ? 39 ALA A C    7 
ATOM 7689  O O    . ALA A 1 39 ? -1.488  21.905  0.277   1.00 0.00 ? 39 ALA A O    7 
ATOM 7690  C CB   . ALA A 1 39 ? -2.393  19.115  1.690   1.00 0.00 ? 39 ALA A CB   7 
ATOM 7691  H H    . ALA A 1 39 ? -4.345  20.089  2.968   1.00 0.00 ? 39 ALA A H    7 
ATOM 7692  H HA   . ALA A 1 39 ? -1.728  20.914  2.591   1.00 0.00 ? 39 ALA A HA   7 
ATOM 7693  H HB1  . ALA A 1 39 ? -3.272  18.753  1.178   1.00 0.00 ? 39 ALA A HB1  7 
ATOM 7694  H HB2  . ALA A 1 39 ? -1.522  18.955  1.073   1.00 0.00 ? 39 ALA A HB2  7 
ATOM 7695  H HB3  . ALA A 1 39 ? -2.278  18.587  2.623   1.00 0.00 ? 39 ALA A HB3  7 
ATOM 7696  N N    . ALA A 1 40 ? -3.681  21.483  0.024   1.00 0.00 ? 40 ALA A N    7 
ATOM 7697  C CA   . ALA A 1 40 ? -3.781  22.225  -1.222  1.00 0.00 ? 40 ALA A CA   7 
ATOM 7698  C C    . ALA A 1 40 ? -3.926  23.711  -0.949  1.00 0.00 ? 40 ALA A C    7 
ATOM 7699  O O    . ALA A 1 40 ? -3.578  24.540  -1.790  1.00 0.00 ? 40 ALA A O    7 
ATOM 7700  C CB   . ALA A 1 40 ? -4.920  21.702  -2.074  1.00 0.00 ? 40 ALA A CB   7 
ATOM 7701  H H    . ALA A 1 40 ? -4.482  21.057  0.395   1.00 0.00 ? 40 ALA A H    7 
ATOM 7702  H HA   . ALA A 1 40 ? -2.864  22.075  -1.764  1.00 0.00 ? 40 ALA A HA   7 
ATOM 7703  H HB1  . ALA A 1 40 ? -4.746  20.657  -2.294  1.00 0.00 ? 40 ALA A HB1  7 
ATOM 7704  H HB2  . ALA A 1 40 ? -5.852  21.810  -1.541  1.00 0.00 ? 40 ALA A HB2  7 
ATOM 7705  H HB3  . ALA A 1 40 ? -4.964  22.260  -2.997  1.00 0.00 ? 40 ALA A HB3  7 
ATOM 7706  N N    . ARG A 1 41 ? -4.395  24.054  0.250   1.00 0.00 ? 41 ARG A N    7 
ATOM 7707  C CA   . ARG A 1 41 ? -4.510  25.453  0.622   1.00 0.00 ? 41 ARG A CA   7 
ATOM 7708  C C    . ARG A 1 41 ? -3.109  26.033  0.677   1.00 0.00 ? 41 ARG A C    7 
ATOM 7709  O O    . ARG A 1 41 ? -2.875  27.193  0.337   1.00 0.00 ? 41 ARG A O    7 
ATOM 7710  C CB   . ARG A 1 41 ? -5.208  25.615  1.974   1.00 0.00 ? 41 ARG A CB   7 
ATOM 7711  C CG   . ARG A 1 41 ? -5.380  27.066  2.393   1.00 0.00 ? 41 ARG A CG   7 
ATOM 7712  C CD   . ARG A 1 41 ? -6.002  27.178  3.776   1.00 0.00 ? 41 ARG A CD   7 
ATOM 7713  N NE   . ARG A 1 41 ? -6.138  28.569  4.203   1.00 0.00 ? 41 ARG A NE   7 
ATOM 7714  C CZ   . ARG A 1 41 ? -5.106  29.375  4.449   1.00 0.00 ? 41 ARG A CZ   7 
ATOM 7715  N NH1  . ARG A 1 41 ? -3.862  28.921  4.363   1.00 0.00 ? 41 ARG A NH1  7 
ATOM 7716  N NH2  . ARG A 1 41 ? -5.322  30.636  4.796   1.00 0.00 ? 41 ARG A NH2  7 
ATOM 7717  H H    . ARG A 1 41 ? -4.628  23.359  0.900   1.00 0.00 ? 41 ARG A H    7 
ATOM 7718  H HA   . ARG A 1 41 ? -5.069  25.960  -0.143  1.00 0.00 ? 41 ARG A HA   7 
ATOM 7719  H HB2  . ARG A 1 41 ? -6.184  25.158  1.920   1.00 0.00 ? 41 ARG A HB2  7 
ATOM 7720  H HB3  . ARG A 1 41 ? -4.624  25.113  2.732   1.00 0.00 ? 41 ARG A HB3  7 
ATOM 7721  H HG2  . ARG A 1 41 ? -4.412  27.545  2.402   1.00 0.00 ? 41 ARG A HG2  7 
ATOM 7722  H HG3  . ARG A 1 41 ? -6.021  27.562  1.678   1.00 0.00 ? 41 ARG A HG3  7 
ATOM 7723  H HD2  . ARG A 1 41 ? -6.980  26.721  3.755   1.00 0.00 ? 41 ARG A HD2  7 
ATOM 7724  H HD3  . ARG A 1 41 ? -5.374  26.654  4.481   1.00 0.00 ? 41 ARG A HD3  7 
ATOM 7725  H HE   . ARG A 1 41 ? -7.045  28.926  4.298   1.00 0.00 ? 41 ARG A HE   7 
ATOM 7726  H HH11 . ARG A 1 41 ? -3.691  27.968  4.114   1.00 0.00 ? 41 ARG A HH11 7 
ATOM 7727  H HH12 . ARG A 1 41 ? -3.093  29.535  4.545   1.00 0.00 ? 41 ARG A HH12 7 
ATOM 7728  H HH21 . ARG A 1 41 ? -6.257  30.981  4.871   1.00 0.00 ? 41 ARG A HH21 7 
ATOM 7729  H HH22 . ARG A 1 41 ? -4.549  31.242  4.982   1.00 0.00 ? 41 ARG A HH22 7 
ATOM 7730  N N    . GLN A 1 42 ? -2.178  25.182  1.093   1.00 0.00 ? 42 GLN A N    7 
ATOM 7731  C CA   . GLN A 1 42 ? -0.781  25.535  1.183   1.00 0.00 ? 42 GLN A CA   7 
ATOM 7732  C C    . GLN A 1 42 ? -0.253  25.992  -0.168  1.00 0.00 ? 42 GLN A C    7 
ATOM 7733  O O    . GLN A 1 42 ? -0.323  25.263  -1.158  1.00 0.00 ? 42 GLN A O    7 
ATOM 7734  C CB   . GLN A 1 42 ? 0.039   24.340  1.658   1.00 0.00 ? 42 GLN A CB   7 
ATOM 7735  C CG   . GLN A 1 42 ? -0.120  24.026  3.136   1.00 0.00 ? 42 GLN A CG   7 
ATOM 7736  C CD   . GLN A 1 42 ? 0.732   22.851  3.578   1.00 0.00 ? 42 GLN A CD   7 
ATOM 7737  O OE1  . GLN A 1 42 ? 1.960   22.892  3.490   1.00 0.00 ? 42 GLN A OE1  7 
ATOM 7738  N NE2  . GLN A 1 42 ? 0.085   21.797  4.062   1.00 0.00 ? 42 GLN A NE2  7 
ATOM 7739  H H    . GLN A 1 42 ? -2.443  24.281  1.333   1.00 0.00 ? 42 GLN A H    7 
ATOM 7740  H HA   . GLN A 1 42 ? -0.686  26.336  1.896   1.00 0.00 ? 42 GLN A HA   7 
ATOM 7741  H HB2  . GLN A 1 42 ? -0.263  23.470  1.096   1.00 0.00 ? 42 GLN A HB2  7 
ATOM 7742  H HB3  . GLN A 1 42 ? 1.080   24.537  1.456   1.00 0.00 ? 42 GLN A HB3  7 
ATOM 7743  H HG2  . GLN A 1 42 ? 0.168   24.894  3.710   1.00 0.00 ? 42 GLN A HG2  7 
ATOM 7744  H HG3  . GLN A 1 42 ? -1.156  23.794  3.333   1.00 0.00 ? 42 GLN A HG3  7 
ATOM 7745  H HE21 . GLN A 1 42 ? -0.893  21.836  4.107   1.00 0.00 ? 42 GLN A HE21 7 
ATOM 7746  H HE22 . GLN A 1 42 ? 0.611   21.024  4.354   1.00 0.00 ? 42 GLN A HE22 7 
ATOM 7747  N N    . PRO A 1 43 ? 0.296   27.205  -0.219  1.00 0.00 ? 43 PRO A N    7 
ATOM 7748  C CA   . PRO A 1 43 ? 0.858   27.768  -1.447  1.00 0.00 ? 43 PRO A CA   7 
ATOM 7749  C C    . PRO A 1 43 ? 2.021   26.940  -2.000  1.00 0.00 ? 43 PRO A C    7 
ATOM 7750  O O    . PRO A 1 43 ? 2.620   27.304  -3.012  1.00 0.00 ? 43 PRO A O    7 
ATOM 7751  C CB   . PRO A 1 43 ? 1.343   29.162  -1.031  1.00 0.00 ? 43 PRO A CB   7 
ATOM 7752  C CG   . PRO A 1 43 ? 1.392   29.153  0.462   1.00 0.00 ? 43 PRO A CG   7 
ATOM 7753  C CD   . PRO A 1 43 ? 0.409   28.115  0.925   1.00 0.00 ? 43 PRO A CD   7 
ATOM 7754  H HA   . PRO A 1 43 ? 0.101   27.866  -2.211  1.00 0.00 ? 43 PRO A HA   7 
ATOM 7755  H HB2  . PRO A 1 43 ? 2.321   29.341  -1.451  1.00 0.00 ? 43 PRO A HB2  7 
ATOM 7756  H HB3  . PRO A 1 43 ? 0.651   29.907  -1.395  1.00 0.00 ? 43 PRO A HB3  7 
ATOM 7757  H HG2  . PRO A 1 43 ? 2.388   28.894  0.793   1.00 0.00 ? 43 PRO A HG2  7 
ATOM 7758  H HG3  . PRO A 1 43 ? 1.115   30.125  0.842   1.00 0.00 ? 43 PRO A HG3  7 
ATOM 7759  H HD2  . PRO A 1 43 ? 0.787   27.590  1.790   1.00 0.00 ? 43 PRO A HD2  7 
ATOM 7760  H HD3  . PRO A 1 43 ? -0.550  28.563  1.149   1.00 0.00 ? 43 PRO A HD3  7 
ATOM 7761  N N    . ASP A 1 44 ? 2.343   25.826  -1.336  1.00 0.00 ? 44 ASP A N    7 
ATOM 7762  C CA   . ASP A 1 44 ? 3.431   24.960  -1.772  1.00 0.00 ? 44 ASP A CA   7 
ATOM 7763  C C    . ASP A 1 44 ? 2.961   23.508  -1.835  1.00 0.00 ? 44 ASP A C    7 
ATOM 7764  O O    . ASP A 1 44 ? 3.723   22.588  -1.558  1.00 0.00 ? 44 ASP A O    7 
ATOM 7765  C CB   . ASP A 1 44 ? 4.624   25.086  -0.820  1.00 0.00 ? 44 ASP A CB   7 
ATOM 7766  C CG   . ASP A 1 44 ? 5.910   24.539  -1.417  1.00 0.00 ? 44 ASP A CG   7 
ATOM 7767  O OD1  . ASP A 1 44 ? 5.926   23.359  -1.820  1.00 0.00 ? 44 ASP A OD1  7 
ATOM 7768  O OD2  . ASP A 1 44 ? 6.901   25.297  -1.482  1.00 0.00 ? 44 ASP A OD2  7 
ATOM 7769  H H    . ASP A 1 44 ? 1.839   25.580  -0.540  1.00 0.00 ? 44 ASP A H    7 
ATOM 7770  H HA   . ASP A 1 44 ? 3.735   25.271  -2.762  1.00 0.00 ? 44 ASP A HA   7 
ATOM 7771  H HB2  . ASP A 1 44 ? 4.777   26.128  -0.579  1.00 0.00 ? 44 ASP A HB2  7 
ATOM 7772  H HB3  . ASP A 1 44 ? 4.411   24.540  0.088   1.00 0.00 ? 44 ASP A HB3  7 
ATOM 7773  N N    . LEU A 1 45 ? 1.697   23.314  -2.195  1.00 0.00 ? 45 LEU A N    7 
ATOM 7774  C CA   . LEU A 1 45 ? 1.116   21.973  -2.299  1.00 0.00 ? 45 LEU A CA   7 
ATOM 7775  C C    . LEU A 1 45 ? 1.718   21.192  -3.460  1.00 0.00 ? 45 LEU A C    7 
ATOM 7776  O O    . LEU A 1 45 ? 1.832   19.970  -3.398  1.00 0.00 ? 45 LEU A O    7 
ATOM 7777  C CB   . LEU A 1 45 ? -0.404  22.069  -2.497  1.00 0.00 ? 45 LEU A CB   7 
ATOM 7778  C CG   . LEU A 1 45 ? -1.148  20.733  -2.676  1.00 0.00 ? 45 LEU A CG   7 
ATOM 7779  C CD1  . LEU A 1 45 ? -0.821  20.089  -4.017  1.00 0.00 ? 45 LEU A CD1  7 
ATOM 7780  C CD2  . LEU A 1 45 ? -0.829  19.783  -1.529  1.00 0.00 ? 45 LEU A CD2  7 
ATOM 7781  H H    . LEU A 1 45 ? 1.135   24.092  -2.392  1.00 0.00 ? 45 LEU A H    7 
ATOM 7782  H HA   . LEU A 1 45 ? 1.319   21.448  -1.379  1.00 0.00 ? 45 LEU A HA   7 
ATOM 7783  H HB2  . LEU A 1 45 ? -0.822  22.578  -1.643  1.00 0.00 ? 45 LEU A HB2  7 
ATOM 7784  H HB3  . LEU A 1 45 ? -0.588  22.672  -3.373  1.00 0.00 ? 45 LEU A HB3  7 
ATOM 7785  H HG   . LEU A 1 45 ? -2.209  20.920  -2.661  1.00 0.00 ? 45 LEU A HG   7 
ATOM 7786  H HD11 . LEU A 1 45 ? -0.355  20.816  -4.663  1.00 0.00 ? 45 LEU A HD11 7 
ATOM 7787  H HD12 . LEU A 1 45 ? -0.150  19.257  -3.864  1.00 0.00 ? 45 LEU A HD12 7 
ATOM 7788  H HD13 . LEU A 1 45 ? -1.732  19.736  -4.476  1.00 0.00 ? 45 LEU A HD13 7 
ATOM 7789  H HD21 . LEU A 1 45 ? -0.251  20.304  -0.780  1.00 0.00 ? 45 LEU A HD21 7 
ATOM 7790  H HD22 . LEU A 1 45 ? -1.750  19.428  -1.090  1.00 0.00 ? 45 LEU A HD22 7 
ATOM 7791  H HD23 . LEU A 1 45 ? -0.261  18.943  -1.903  1.00 0.00 ? 45 LEU A HD23 7 
ATOM 7792  N N    . ILE A 1 46 ? 2.053   21.905  -4.534  1.00 0.00 ? 46 ILE A N    7 
ATOM 7793  C CA   . ILE A 1 46 ? 2.596   21.286  -5.751  1.00 0.00 ? 46 ILE A CA   7 
ATOM 7794  C C    . ILE A 1 46 ? 3.397   20.007  -5.469  1.00 0.00 ? 46 ILE A C    7 
ATOM 7795  O O    . ILE A 1 46 ? 3.052   18.946  -5.986  1.00 0.00 ? 46 ILE A O    7 
ATOM 7796  C CB   . ILE A 1 46 ? 3.451   22.266  -6.586  1.00 0.00 ? 46 ILE A CB   7 
ATOM 7797  C CG1  . ILE A 1 46 ? 2.671   23.550  -6.898  1.00 0.00 ? 46 ILE A CG1  7 
ATOM 7798  C CG2  . ILE A 1 46 ? 3.908   21.610  -7.881  1.00 0.00 ? 46 ILE A CG2  7 
ATOM 7799  C CD1  . ILE A 1 46 ? 2.708   24.580  -5.788  1.00 0.00 ? 46 ILE A CD1  7 
ATOM 7800  H H    . ILE A 1 46 ? 1.898   22.871  -4.518  1.00 0.00 ? 46 ILE A H    7 
ATOM 7801  H HA   . ILE A 1 46 ? 1.747   21.002  -6.354  1.00 0.00 ? 46 ILE A HA   7 
ATOM 7802  H HB   . ILE A 1 46 ? 4.322   22.516  -6.015  1.00 0.00 ? 46 ILE A HB   7 
ATOM 7803  H HG12 . ILE A 1 46 ? 3.086   24.007  -7.784  1.00 0.00 ? 46 ILE A HG12 7 
ATOM 7804  H HG13 . ILE A 1 46 ? 1.636   23.298  -7.082  1.00 0.00 ? 46 ILE A HG13 7 
ATOM 7805  H HG21 . ILE A 1 46 ? 3.870   20.536  -7.777  1.00 0.00 ? 46 ILE A HG21 7 
ATOM 7806  H HG22 . ILE A 1 46 ? 3.256   21.914  -8.688  1.00 0.00 ? 46 ILE A HG22 7 
ATOM 7807  H HG23 . ILE A 1 46 ? 4.919   21.915  -8.103  1.00 0.00 ? 46 ILE A HG23 7 
ATOM 7808  H HD11 . ILE A 1 46 ? 3.446   24.293  -5.055  1.00 0.00 ? 46 ILE A HD11 7 
ATOM 7809  H HD12 . ILE A 1 46 ? 2.968   25.544  -6.202  1.00 0.00 ? 46 ILE A HD12 7 
ATOM 7810  H HD13 . ILE A 1 46 ? 1.737   24.640  -5.321  1.00 0.00 ? 46 ILE A HD13 7 
ATOM 7811  N N    . PRO A 1 47 ? 4.469   20.057  -4.655  1.00 0.00 ? 47 PRO A N    7 
ATOM 7812  C CA   . PRO A 1 47 ? 5.246   18.861  -4.354  1.00 0.00 ? 47 PRO A CA   7 
ATOM 7813  C C    . PRO A 1 47 ? 4.536   17.997  -3.329  1.00 0.00 ? 47 PRO A C    7 
ATOM 7814  O O    . PRO A 1 47 ? 4.689   16.773  -3.312  1.00 0.00 ? 47 PRO A O    7 
ATOM 7815  C CB   . PRO A 1 47 ? 6.551   19.418  -3.797  1.00 0.00 ? 47 PRO A CB   7 
ATOM 7816  C CG   . PRO A 1 47 ? 6.156   20.703  -3.157  1.00 0.00 ? 47 PRO A CG   7 
ATOM 7817  C CD   . PRO A 1 47 ? 5.006   21.245  -3.970  1.00 0.00 ? 47 PRO A CD   7 
ATOM 7818  H HA   . PRO A 1 47 ? 5.430   18.280  -5.245  1.00 0.00 ? 47 PRO A HA   7 
ATOM 7819  H HB2  . PRO A 1 47 ? 6.966   18.726  -3.079  1.00 0.00 ? 47 PRO A HB2  7 
ATOM 7820  H HB3  . PRO A 1 47 ? 7.253   19.578  -4.602  1.00 0.00 ? 47 PRO A HB3  7 
ATOM 7821  H HG2  . PRO A 1 47 ? 5.842   20.523  -2.138  1.00 0.00 ? 47 PRO A HG2  7 
ATOM 7822  H HG3  . PRO A 1 47 ? 6.986   21.393  -3.177  1.00 0.00 ? 47 PRO A HG3  7 
ATOM 7823  H HD2  . PRO A 1 47 ? 4.269   21.676  -3.325  1.00 0.00 ? 47 PRO A HD2  7 
ATOM 7824  H HD3  . PRO A 1 47 ? 5.364   21.972  -4.678  1.00 0.00 ? 47 PRO A HD3  7 
ATOM 7825  N N    . LEU A 1 48 ? 3.731   18.639  -2.490  1.00 0.00 ? 48 LEU A N    7 
ATOM 7826  C CA   . LEU A 1 48 ? 2.965   17.917  -1.495  1.00 0.00 ? 48 LEU A CA   7 
ATOM 7827  C C    . LEU A 1 48 ? 1.941   17.048  -2.212  1.00 0.00 ? 48 LEU A C    7 
ATOM 7828  O O    . LEU A 1 48 ? 1.457   16.061  -1.666  1.00 0.00 ? 48 LEU A O    7 
ATOM 7829  C CB   . LEU A 1 48 ? 2.263   18.881  -0.533  1.00 0.00 ? 48 LEU A CB   7 
ATOM 7830  C CG   . LEU A 1 48 ? 1.582   18.209  0.662   1.00 0.00 ? 48 LEU A CG   7 
ATOM 7831  C CD1  . LEU A 1 48 ? 2.561   17.300  1.391   1.00 0.00 ? 48 LEU A CD1  7 
ATOM 7832  C CD2  . LEU A 1 48 ? 1.022   19.253  1.614   1.00 0.00 ? 48 LEU A CD2  7 
ATOM 7833  H H    . LEU A 1 48 ? 3.629   19.611  -2.565  1.00 0.00 ? 48 LEU A H    7 
ATOM 7834  H HA   . LEU A 1 48 ? 3.643   17.286  -0.940  1.00 0.00 ? 48 LEU A HA   7 
ATOM 7835  H HB2  . LEU A 1 48 ? 2.995   19.584  -0.160  1.00 0.00 ? 48 LEU A HB2  7 
ATOM 7836  H HB3  . LEU A 1 48 ? 1.508   19.427  -1.087  1.00 0.00 ? 48 LEU A HB3  7 
ATOM 7837  H HG   . LEU A 1 48 ? 0.763   17.602  0.306   1.00 0.00 ? 48 LEU A HG   7 
ATOM 7838  H HD11 . LEU A 1 48 ? 3.425   17.871  1.695   1.00 0.00 ? 48 LEU A HD11 7 
ATOM 7839  H HD12 . LEU A 1 48 ? 2.081   16.881  2.263   1.00 0.00 ? 48 LEU A HD12 7 
ATOM 7840  H HD13 . LEU A 1 48 ? 2.870   16.501  0.733   1.00 0.00 ? 48 LEU A HD13 7 
ATOM 7841  H HD21 . LEU A 1 48 ? 0.524   20.027  1.050   1.00 0.00 ? 48 LEU A HD21 7 
ATOM 7842  H HD22 . LEU A 1 48 ? 0.314   18.787  2.285   1.00 0.00 ? 48 LEU A HD22 7 
ATOM 7843  H HD23 . LEU A 1 48 ? 1.827   19.686  2.188   1.00 0.00 ? 48 LEU A HD23 7 
ATOM 7844  N N    . LEU A 1 49 ? 1.638   17.431  -3.457  1.00 0.00 ? 49 LEU A N    7 
ATOM 7845  C CA   . LEU A 1 49 ? 0.694   16.715  -4.295  1.00 0.00 ? 49 LEU A CA   7 
ATOM 7846  C C    . LEU A 1 49 ? 1.115   15.251  -4.445  1.00 0.00 ? 49 LEU A C    7 
ATOM 7847  O O    . LEU A 1 49 ? 0.361   14.335  -4.103  1.00 0.00 ? 49 LEU A O    7 
ATOM 7848  C CB   . LEU A 1 49 ? 0.605   17.444  -5.651  1.00 0.00 ? 49 LEU A CB   7 
ATOM 7849  C CG   . LEU A 1 49 ? 1.061   16.672  -6.892  1.00 0.00 ? 49 LEU A CG   7 
ATOM 7850  C CD1  . LEU A 1 49 ? 0.118   15.516  -7.198  1.00 0.00 ? 49 LEU A CD1  7 
ATOM 7851  C CD2  . LEU A 1 49 ? 1.157   17.607  -8.089  1.00 0.00 ? 49 LEU A CD2  7 
ATOM 7852  H H    . LEU A 1 49 ? 2.079   18.225  -3.834  1.00 0.00 ? 49 LEU A H    7 
ATOM 7853  H HA   . LEU A 1 49 ? -0.269  16.749  -3.813  1.00 0.00 ? 49 LEU A HA   7 
ATOM 7854  H HB2  . LEU A 1 49 ? -0.419  17.747  -5.804  1.00 0.00 ? 49 LEU A HB2  7 
ATOM 7855  H HB3  . LEU A 1 49 ? 1.217   18.339  -5.580  1.00 0.00 ? 49 LEU A HB3  7 
ATOM 7856  H HG   . LEU A 1 49 ? 2.042   16.271  -6.708  1.00 0.00 ? 49 LEU A HG   7 
ATOM 7857  H HD11 . LEU A 1 49 ? -0.396  15.217  -6.296  1.00 0.00 ? 49 LEU A HD11 7 
ATOM 7858  H HD12 . LEU A 1 49 ? -0.606  15.828  -7.936  1.00 0.00 ? 49 LEU A HD12 7 
ATOM 7859  H HD13 . LEU A 1 49 ? 0.685   14.681  -7.582  1.00 0.00 ? 49 LEU A HD13 7 
ATOM 7860  H HD21 . LEU A 1 49 ? 0.262   18.209  -8.149  1.00 0.00 ? 49 LEU A HD21 7 
ATOM 7861  H HD22 . LEU A 1 49 ? 2.016   18.251  -7.973  1.00 0.00 ? 49 LEU A HD22 7 
ATOM 7862  H HD23 . LEU A 1 49 ? 1.262   17.026  -8.992  1.00 0.00 ? 49 LEU A HD23 7 
ATOM 7863  N N    . ARG A 1 50 ? 2.331   15.034  -4.934  1.00 0.00 ? 50 ARG A N    7 
ATOM 7864  C CA   . ARG A 1 50 ? 2.851   13.694  -5.109  1.00 0.00 ? 50 ARG A CA   7 
ATOM 7865  C C    . ARG A 1 50 ? 3.254   13.110  -3.768  1.00 0.00 ? 50 ARG A C    7 
ATOM 7866  O O    . ARG A 1 50 ? 3.126   11.905  -3.532  1.00 0.00 ? 50 ARG A O    7 
ATOM 7867  C CB   . ARG A 1 50 ? 4.050   13.719  -6.051  1.00 0.00 ? 50 ARG A CB   7 
ATOM 7868  C CG   . ARG A 1 50 ? 3.681   13.967  -7.502  1.00 0.00 ? 50 ARG A CG   7 
ATOM 7869  C CD   . ARG A 1 50 ? 4.907   13.919  -8.400  1.00 0.00 ? 50 ARG A CD   7 
ATOM 7870  N NE   . ARG A 1 50 ? 5.619   12.647  -8.288  1.00 0.00 ? 50 ARG A NE   7 
ATOM 7871  C CZ   . ARG A 1 50 ? 5.119   11.476  -8.680  1.00 0.00 ? 50 ARG A CZ   7 
ATOM 7872  N NH1  . ARG A 1 50 ? 3.930   11.416  -9.266  1.00 0.00 ? 50 ARG A NH1  7 
ATOM 7873  N NH2  . ARG A 1 50 ? 5.817   10.364  -8.498  1.00 0.00 ? 50 ARG A NH2  7 
ATOM 7874  H H    . ARG A 1 50 ? 2.899   15.792  -5.171  1.00 0.00 ? 50 ARG A H    7 
ATOM 7875  H HA   . ARG A 1 50 ? 2.072   13.082  -5.545  1.00 0.00 ? 50 ARG A HA   7 
ATOM 7876  H HB2  . ARG A 1 50 ? 4.726   14.501  -5.735  1.00 0.00 ? 50 ARG A HB2  7 
ATOM 7877  H HB3  . ARG A 1 50 ? 4.556   12.777  -5.986  1.00 0.00 ? 50 ARG A HB3  7 
ATOM 7878  H HG2  . ARG A 1 50 ? 2.982   13.208  -7.819  1.00 0.00 ? 50 ARG A HG2  7 
ATOM 7879  H HG3  . ARG A 1 50 ? 3.220   14.941  -7.586  1.00 0.00 ? 50 ARG A HG3  7 
ATOM 7880  H HD2  . ARG A 1 50 ? 4.591   14.055  -9.424  1.00 0.00 ? 50 ARG A HD2  7 
ATOM 7881  H HD3  . ARG A 1 50 ? 5.574   14.721  -8.121  1.00 0.00 ? 50 ARG A HD3  7 
ATOM 7882  H HE   . ARG A 1 50 ? 6.510   12.663  -7.882  1.00 0.00 ? 50 ARG A HE   7 
ATOM 7883  H HH11 . ARG A 1 50 ? 3.403   12.250  -9.420  1.00 0.00 ? 50 ARG A HH11 7 
ATOM 7884  H HH12 . ARG A 1 50 ? 3.560   10.532  -9.556  1.00 0.00 ? 50 ARG A HH12 7 
ATOM 7885  H HH21 . ARG A 1 50 ? 6.719   10.405  -8.067  1.00 0.00 ? 50 ARG A HH21 7 
ATOM 7886  H HH22 . ARG A 1 50 ? 5.443   9.485   -8.793  1.00 0.00 ? 50 ARG A HH22 7 
ATOM 7887  N N    . THR A 1 51 ? 3.758   13.974  -2.892  1.00 0.00 ? 51 THR A N    7 
ATOM 7888  C CA   . THR A 1 51 ? 4.183   13.540  -1.576  1.00 0.00 ? 51 THR A CA   7 
ATOM 7889  C C    . THR A 1 51 ? 2.993   13.037  -0.772  1.00 0.00 ? 51 THR A C    7 
ATOM 7890  O O    . THR A 1 51 ? 3.123   12.109  0.022   1.00 0.00 ? 51 THR A O    7 
ATOM 7891  C CB   . THR A 1 51 ? 4.904   14.667  -0.834  1.00 0.00 ? 51 THR A CB   7 
ATOM 7892  O OG1  . THR A 1 51 ? 6.099   15.018  -1.508  1.00 0.00 ? 51 THR A OG1  7 
ATOM 7893  C CG2  . THR A 1 51 ? 5.272   14.319  0.594   1.00 0.00 ? 51 THR A CG2  7 
ATOM 7894  H H    . THR A 1 51 ? 3.847   14.921  -3.141  1.00 0.00 ? 51 THR A H    7 
ATOM 7895  H HA   . THR A 1 51 ? 4.862   12.725  -1.720  1.00 0.00 ? 51 THR A HA   7 
ATOM 7896  H HB   . THR A 1 51 ? 4.262   15.534  -0.808  1.00 0.00 ? 51 THR A HB   7 
ATOM 7897  H HG1  . THR A 1 51 ? 6.554   14.220  -1.790  1.00 0.00 ? 51 THR A HG1  7 
ATOM 7898  H HG21 . THR A 1 51 ? 4.656   13.502  0.939   1.00 0.00 ? 51 THR A HG21 7 
ATOM 7899  H HG22 . THR A 1 51 ? 6.311   14.028  0.637   1.00 0.00 ? 51 THR A HG22 7 
ATOM 7900  H HG23 . THR A 1 51 ? 5.115   15.179  1.227   1.00 0.00 ? 51 THR A HG23 7 
ATOM 7901  N N    . GLN A 1 52 ? 1.831   13.641  -0.997  1.00 0.00 ? 52 GLN A N    7 
ATOM 7902  C CA   . GLN A 1 52 ? 0.622   13.227  -0.300  1.00 0.00 ? 52 GLN A CA   7 
ATOM 7903  C C    . GLN A 1 52 ? 0.036   12.009  -0.992  1.00 0.00 ? 52 GLN A C    7 
ATOM 7904  O O    . GLN A 1 52 ? -0.496  11.104  -0.349  1.00 0.00 ? 52 GLN A O    7 
ATOM 7905  C CB   . GLN A 1 52 ? -0.419  14.353  -0.273  1.00 0.00 ? 52 GLN A CB   7 
ATOM 7906  C CG   . GLN A 1 52 ? -1.003  14.681  -1.642  1.00 0.00 ? 52 GLN A CG   7 
ATOM 7907  C CD   . GLN A 1 52 ? -2.186  15.642  -1.593  1.00 0.00 ? 52 GLN A CD   7 
ATOM 7908  O OE1  . GLN A 1 52 ? -2.785  15.944  -2.626  1.00 0.00 ? 52 GLN A OE1  7 
ATOM 7909  N NE2  . GLN A 1 52 ? -2.531  16.133  -0.404  1.00 0.00 ? 52 GLN A NE2  7 
ATOM 7910  H H    . GLN A 1 52 ? 1.784   14.367  -1.653  1.00 0.00 ? 52 GLN A H    7 
ATOM 7911  H HA   . GLN A 1 52 ? 0.891   12.960  0.712   1.00 0.00 ? 52 GLN A HA   7 
ATOM 7912  H HB2  . GLN A 1 52 ? -1.231  14.059  0.376   1.00 0.00 ? 52 GLN A HB2  7 
ATOM 7913  H HB3  . GLN A 1 52 ? 0.041   15.247  0.123   1.00 0.00 ? 52 GLN A HB3  7 
ATOM 7914  H HG2  . GLN A 1 52 ? -0.233  15.129  -2.246  1.00 0.00 ? 52 GLN A HG2  7 
ATOM 7915  H HG3  . GLN A 1 52 ? -1.325  13.761  -2.107  1.00 0.00 ? 52 GLN A HG3  7 
ATOM 7916  H HE21 . GLN A 1 52 ? -2.015  15.862  0.381   1.00 0.00 ? 52 GLN A HE21 7 
ATOM 7917  H HE22 . GLN A 1 52 ? -3.291  16.750  -0.364  1.00 0.00 ? 52 GLN A HE22 7 
ATOM 7918  N N    . PHE A 1 53 ? 0.138   12.001  -2.315  1.00 0.00 ? 53 PHE A N    7 
ATOM 7919  C CA   . PHE A 1 53 ? -0.377  10.904  -3.116  1.00 0.00 ? 53 PHE A CA   7 
ATOM 7920  C C    . PHE A 1 53 ? 0.218   9.578   -2.659  1.00 0.00 ? 53 PHE A C    7 
ATOM 7921  O O    . PHE A 1 53 ? -0.515  8.645   -2.328  1.00 0.00 ? 53 PHE A O    7 
ATOM 7922  C CB   . PHE A 1 53 ? -0.063  11.142  -4.595  1.00 0.00 ? 53 PHE A CB   7 
ATOM 7923  C CG   . PHE A 1 53 ? -0.671  10.122  -5.514  1.00 0.00 ? 53 PHE A CG   7 
ATOM 7924  C CD1  . PHE A 1 53 ? -0.183  8.826   -5.557  1.00 0.00 ? 53 PHE A CD1  7 
ATOM 7925  C CD2  . PHE A 1 53 ? -1.740  10.459  -6.327  1.00 0.00 ? 53 PHE A CD2  7 
ATOM 7926  C CE1  . PHE A 1 53 ? -0.752  7.886   -6.395  1.00 0.00 ? 53 PHE A CE1  7 
ATOM 7927  C CE2  . PHE A 1 53 ? -2.311  9.524   -7.168  1.00 0.00 ? 53 PHE A CE2  7 
ATOM 7928  C CZ   . PHE A 1 53 ? -1.817  8.235   -7.202  1.00 0.00 ? 53 PHE A CZ   7 
ATOM 7929  H H    . PHE A 1 53 ? 0.570   12.761  -2.767  1.00 0.00 ? 53 PHE A H    7 
ATOM 7930  H HA   . PHE A 1 53 ? -1.454  10.869  -2.985  1.00 0.00 ? 53 PHE A HA   7 
ATOM 7931  H HB2  . PHE A 1 53 ? -0.437  12.112  -4.885  1.00 0.00 ? 53 PHE A HB2  7 
ATOM 7932  H HB3  . PHE A 1 53 ? 1.009   11.117  -4.733  1.00 0.00 ? 53 PHE A HB3  7 
ATOM 7933  H HD1  . PHE A 1 53 ? 0.650   8.552   -4.927  1.00 0.00 ? 53 PHE A HD1  7 
ATOM 7934  H HD2  . PHE A 1 53 ? -2.127  11.467  -6.302  1.00 0.00 ? 53 PHE A HD2  7 
ATOM 7935  H HE1  . PHE A 1 53 ? -0.362  6.879   -6.420  1.00 0.00 ? 53 PHE A HE1  7 
ATOM 7936  H HE2  . PHE A 1 53 ? -3.144  9.800   -7.797  1.00 0.00 ? 53 PHE A HE2  7 
ATOM 7937  H HZ   . PHE A 1 53 ? -2.262  7.503   -7.858  1.00 0.00 ? 53 PHE A HZ   7 
ATOM 7938  N N    . PHE A 1 54 ? 1.549   9.495   -2.637  1.00 0.00 ? 54 PHE A N    7 
ATOM 7939  C CA   . PHE A 1 54 ? 2.217   8.261   -2.228  1.00 0.00 ? 54 PHE A CA   7 
ATOM 7940  C C    . PHE A 1 54 ? 2.106   8.037   -0.716  1.00 0.00 ? 54 PHE A C    7 
ATOM 7941  O O    . PHE A 1 54 ? 1.886   6.910   -0.277  1.00 0.00 ? 54 PHE A O    7 
ATOM 7942  C CB   . PHE A 1 54 ? 3.679   8.246   -2.705  1.00 0.00 ? 54 PHE A CB   7 
ATOM 7943  C CG   . PHE A 1 54 ? 4.604   9.175   -1.987  1.00 0.00 ? 54 PHE A CG   7 
ATOM 7944  C CD1  . PHE A 1 54 ? 4.949   8.954   -0.669  1.00 0.00 ? 54 PHE A CD1  7 
ATOM 7945  C CD2  . PHE A 1 54 ? 5.135   10.267  -2.642  1.00 0.00 ? 54 PHE A CD2  7 
ATOM 7946  C CE1  . PHE A 1 54 ? 5.810   9.810   -0.017  1.00 0.00 ? 54 PHE A CE1  7 
ATOM 7947  C CE2  . PHE A 1 54 ? 5.994   11.125  -1.995  1.00 0.00 ? 54 PHE A CE2  7 
ATOM 7948  C CZ   . PHE A 1 54 ? 6.333   10.897  -0.681  1.00 0.00 ? 54 PHE A CZ   7 
ATOM 7949  H H    . PHE A 1 54 ? 2.088   10.270  -2.910  1.00 0.00 ? 54 PHE A H    7 
ATOM 7950  H HA   . PHE A 1 54 ? 1.698   7.443   -2.723  1.00 0.00 ? 54 PHE A HA   7 
ATOM 7951  H HB2  . PHE A 1 54 ? 4.073   7.251   -2.597  1.00 0.00 ? 54 PHE A HB2  7 
ATOM 7952  H HB3  . PHE A 1 54 ? 3.700   8.519   -3.751  1.00 0.00 ? 54 PHE A HB3  7 
ATOM 7953  H HD1  . PHE A 1 54 ? 4.538   8.104   -0.149  1.00 0.00 ? 54 PHE A HD1  7 
ATOM 7954  H HD2  . PHE A 1 54 ? 4.866   10.448  -3.673  1.00 0.00 ? 54 PHE A HD2  7 
ATOM 7955  H HE1  . PHE A 1 54 ? 6.074   9.629   1.014   1.00 0.00 ? 54 PHE A HE1  7 
ATOM 7956  H HE2  . PHE A 1 54 ? 6.406   11.976  -2.520  1.00 0.00 ? 54 PHE A HE2  7 
ATOM 7957  H HZ   . PHE A 1 54 ? 7.008   11.569  -0.172  1.00 0.00 ? 54 PHE A HZ   7 
ATOM 7958  N N    . ILE A 1 55 ? 2.206   9.103   0.085   1.00 0.00 ? 55 ILE A N    7 
ATOM 7959  C CA   . ILE A 1 55 ? 2.072   8.959   1.540   1.00 0.00 ? 55 ILE A CA   7 
ATOM 7960  C C    . ILE A 1 55 ? 0.691   8.418   1.894   1.00 0.00 ? 55 ILE A C    7 
ATOM 7961  O O    . ILE A 1 55 ? 0.561   7.362   2.512   1.00 0.00 ? 55 ILE A O    7 
ATOM 7962  C CB   . ILE A 1 55 ? 2.283   10.298  2.298   1.00 0.00 ? 55 ILE A CB   7 
ATOM 7963  C CG1  . ILE A 1 55 ? 3.753   10.709  2.283   1.00 0.00 ? 55 ILE A CG1  7 
ATOM 7964  C CG2  . ILE A 1 55 ? 1.797   10.187  3.739   1.00 0.00 ? 55 ILE A CG2  7 
ATOM 7965  C CD1  . ILE A 1 55 ? 4.658   9.745   3.019   1.00 0.00 ? 55 ILE A CD1  7 
ATOM 7966  H H    . ILE A 1 55 ? 2.345   9.994   -0.304  1.00 0.00 ? 55 ILE A H    7 
ATOM 7967  H HA   . ILE A 1 55 ? 2.822   8.255   1.877   1.00 0.00 ? 55 ILE A HA   7 
ATOM 7968  H HB   . ILE A 1 55 ? 1.698   11.059  1.806   1.00 0.00 ? 55 ILE A HB   7 
ATOM 7969  H HG12 . ILE A 1 55 ? 4.087   10.771  1.266   1.00 0.00 ? 55 ILE A HG12 7 
ATOM 7970  H HG13 . ILE A 1 55 ? 3.851   11.677  2.749   1.00 0.00 ? 55 ILE A HG13 7 
ATOM 7971  H HG21 . ILE A 1 55 ? 1.974   9.185   4.102   1.00 0.00 ? 55 ILE A HG21 7 
ATOM 7972  H HG22 . ILE A 1 55 ? 2.333   10.894  4.354   1.00 0.00 ? 55 ILE A HG22 7 
ATOM 7973  H HG23 . ILE A 1 55 ? 0.740   10.403  3.780   1.00 0.00 ? 55 ILE A HG23 7 
ATOM 7974  H HD11 . ILE A 1 55 ? 4.549   8.756   2.601   1.00 0.00 ? 55 ILE A HD11 7 
ATOM 7975  H HD12 . ILE A 1 55 ? 5.683   10.067  2.919   1.00 0.00 ? 55 ILE A HD12 7 
ATOM 7976  H HD13 . ILE A 1 55 ? 4.387   9.726   4.065   1.00 0.00 ? 55 ILE A HD13 7 
ATOM 7977  N N    . VAL A 1 56 ? -0.334  9.162   1.503   1.00 0.00 ? 56 VAL A N    7 
ATOM 7978  C CA   . VAL A 1 56 ? -1.712  8.789   1.784   1.00 0.00 ? 56 VAL A CA   7 
ATOM 7979  C C    . VAL A 1 56 ? -2.083  7.448   1.159   1.00 0.00 ? 56 VAL A C    7 
ATOM 7980  O O    . VAL A 1 56 ? -2.627  6.574   1.832   1.00 0.00 ? 56 VAL A O    7 
ATOM 7981  C CB   . VAL A 1 56 ? -2.688  9.868   1.274   1.00 0.00 ? 56 VAL A CB   7 
ATOM 7982  C CG1  . VAL A 1 56 ? -4.119  9.534   1.670   1.00 0.00 ? 56 VAL A CG1  7 
ATOM 7983  C CG2  . VAL A 1 56 ? -2.288  11.242  1.795   1.00 0.00 ? 56 VAL A CG2  7 
ATOM 7984  H H    . VAL A 1 56 ? -0.157  9.997   1.022   1.00 0.00 ? 56 VAL A H    7 
ATOM 7985  H HA   . VAL A 1 56 ? -1.822  8.713   2.855   1.00 0.00 ? 56 VAL A HA   7 
ATOM 7986  H HB   . VAL A 1 56 ? -2.635  9.889   0.194   1.00 0.00 ? 56 VAL A HB   7 
ATOM 7987  H HG11 . VAL A 1 56 ? -4.215  8.467   1.813   1.00 0.00 ? 56 VAL A HG11 7 
ATOM 7988  H HG12 . VAL A 1 56 ? -4.366  10.043  2.589   1.00 0.00 ? 56 VAL A HG12 7 
ATOM 7989  H HG13 . VAL A 1 56 ? -4.793  9.854   0.890   1.00 0.00 ? 56 VAL A HG13 7 
ATOM 7990  H HG21 . VAL A 1 56 ? -1.367  11.163  2.353   1.00 0.00 ? 56 VAL A HG21 7 
ATOM 7991  H HG22 . VAL A 1 56 ? -2.145  11.914  0.961   1.00 0.00 ? 56 VAL A HG22 7 
ATOM 7992  H HG23 . VAL A 1 56 ? -3.066  11.627  2.437   1.00 0.00 ? 56 VAL A HG23 7 
ATOM 7993  N N    . MET A 1 57 ? -1.795  7.286   -0.126  1.00 0.00 ? 57 MET A N    7 
ATOM 7994  C CA   . MET A 1 57 ? -2.118  6.047   -0.820  1.00 0.00 ? 57 MET A CA   7 
ATOM 7995  C C    . MET A 1 57 ? -1.253  4.910   -0.311  1.00 0.00 ? 57 MET A C    7 
ATOM 7996  O O    . MET A 1 57 ? -1.687  3.762   -0.240  1.00 0.00 ? 57 MET A O    7 
ATOM 7997  C CB   . MET A 1 57 ? -1.923  6.216   -2.328  1.00 0.00 ? 57 MET A CB   7 
ATOM 7998  C CG   . MET A 1 57 ? -2.397  5.023   -3.143  1.00 0.00 ? 57 MET A CG   7 
ATOM 7999  S SD   . MET A 1 57 ? -2.125  5.243   -4.912  1.00 0.00 ? 57 MET A SD   7 
ATOM 8000  C CE   . MET A 1 57 ? -2.771  3.700   -5.550  1.00 0.00 ? 57 MET A CE   7 
ATOM 8001  H H    . MET A 1 57 ? -1.360  8.013   -0.618  1.00 0.00 ? 57 MET A H    7 
ATOM 8002  H HA   . MET A 1 57 ? -3.150  5.815   -0.620  1.00 0.00 ? 57 MET A HA   7 
ATOM 8003  H HB2  . MET A 1 57 ? -2.468  7.088   -2.654  1.00 0.00 ? 57 MET A HB2  7 
ATOM 8004  H HB3  . MET A 1 57 ? -0.872  6.363   -2.529  1.00 0.00 ? 57 MET A HB3  7 
ATOM 8005  H HG2  . MET A 1 57 ? -1.862  4.144   -2.817  1.00 0.00 ? 57 MET A HG2  7 
ATOM 8006  H HG3  . MET A 1 57 ? -3.455  4.883   -2.970  1.00 0.00 ? 57 MET A HG3  7 
ATOM 8007  H HE1  . MET A 1 57 ? -2.907  3.002   -4.737  1.00 0.00 ? 57 MET A HE1  7 
ATOM 8008  H HE2  . MET A 1 57 ? -3.720  3.878   -6.033  1.00 0.00 ? 57 MET A HE2  7 
ATOM 8009  H HE3  . MET A 1 57 ? -2.075  3.287   -6.265  1.00 0.00 ? 57 MET A HE3  7 
ATOM 8010  N N    . GLY A 1 58 ? -0.023  5.243   0.029   1.00 0.00 ? 58 GLY A N    7 
ATOM 8011  C CA   . GLY A 1 58 ? 0.913   4.249   0.513   1.00 0.00 ? 58 GLY A CA   7 
ATOM 8012  C C    . GLY A 1 58 ? 0.606   3.758   1.914   1.00 0.00 ? 58 GLY A C    7 
ATOM 8013  O O    . GLY A 1 58 ? 0.691   2.559   2.180   1.00 0.00 ? 58 GLY A O    7 
ATOM 8014  H H    . GLY A 1 58 ? 0.258   6.176   -0.061  1.00 0.00 ? 58 GLY A H    7 
ATOM 8015  H HA2  . GLY A 1 58 ? 0.896   3.403   -0.161  1.00 0.00 ? 58 GLY A HA2  7 
ATOM 8016  H HA3  . GLY A 1 58 ? 1.900   4.673   0.501   1.00 0.00 ? 58 GLY A HA3  7 
ATOM 8017  N N    . LEU A 1 59 ? 0.254   4.670   2.822   1.00 0.00 ? 59 LEU A N    7 
ATOM 8018  C CA   . LEU A 1 59 ? -0.051  4.276   4.189   1.00 0.00 ? 59 LEU A CA   7 
ATOM 8019  C C    . LEU A 1 59 ? -1.322  3.438   4.215   1.00 0.00 ? 59 LEU A C    7 
ATOM 8020  O O    . LEU A 1 59 ? -1.445  2.499   5.001   1.00 0.00 ? 59 LEU A O    7 
ATOM 8021  C CB   . LEU A 1 59 ? -0.165  5.507   5.099   1.00 0.00 ? 59 LEU A CB   7 
ATOM 8022  C CG   . LEU A 1 59 ? -1.250  6.524   4.736   1.00 0.00 ? 59 LEU A CG   7 
ATOM 8023  C CD1  . LEU A 1 59 ? -2.591  6.129   5.335   1.00 0.00 ? 59 LEU A CD1  7 
ATOM 8024  C CD2  . LEU A 1 59 ? -0.845  7.915   5.207   1.00 0.00 ? 59 LEU A CD2  7 
ATOM 8025  H H    . LEU A 1 59 ? 0.202   5.615   2.571   1.00 0.00 ? 59 LEU A H    7 
ATOM 8026  H HA   . LEU A 1 59 ? 0.767   3.661   4.537   1.00 0.00 ? 59 LEU A HA   7 
ATOM 8027  H HB2  . LEU A 1 59 ? -0.357  5.160   6.100   1.00 0.00 ? 59 LEU A HB2  7 
ATOM 8028  H HB3  . LEU A 1 59 ? 0.787   6.017   5.095   1.00 0.00 ? 59 LEU A HB3  7 
ATOM 8029  H HG   . LEU A 1 59 ? -1.360  6.554   3.662   1.00 0.00 ? 59 LEU A HG   7 
ATOM 8030  H HD11 . LEU A 1 59 ? -2.793  5.091   5.124   1.00 0.00 ? 59 LEU A HD11 7 
ATOM 8031  H HD12 . LEU A 1 59 ? -2.566  6.278   6.405   1.00 0.00 ? 59 LEU A HD12 7 
ATOM 8032  H HD13 . LEU A 1 59 ? -3.371  6.740   4.907   1.00 0.00 ? 59 LEU A HD13 7 
ATOM 8033  H HD21 . LEU A 1 59 ? 0.167   8.120   4.893   1.00 0.00 ? 59 LEU A HD21 7 
ATOM 8034  H HD22 . LEU A 1 59 ? -1.512  8.648   4.778   1.00 0.00 ? 59 LEU A HD22 7 
ATOM 8035  H HD23 . LEU A 1 59 ? -0.906  7.961   6.284   1.00 0.00 ? 59 LEU A HD23 7 
ATOM 8036  N N    . VAL A 1 60 ? -2.247  3.757   3.315   1.00 0.00 ? 60 VAL A N    7 
ATOM 8037  C CA   . VAL A 1 60 ? -3.495  3.016   3.205   1.00 0.00 ? 60 VAL A CA   7 
ATOM 8038  C C    . VAL A 1 60 ? -3.254  1.690   2.494   1.00 0.00 ? 60 VAL A C    7 
ATOM 8039  O O    . VAL A 1 60 ? -3.659  0.630   2.971   1.00 0.00 ? 60 VAL A O    7 
ATOM 8040  C CB   . VAL A 1 60 ? -4.560  3.817   2.431   1.00 0.00 ? 60 VAL A CB   7 
ATOM 8041  C CG1  . VAL A 1 60 ? -5.862  3.038   2.347   1.00 0.00 ? 60 VAL A CG1  7 
ATOM 8042  C CG2  . VAL A 1 60 ? -4.788  5.171   3.082   1.00 0.00 ? 60 VAL A CG2  7 
ATOM 8043  H H    . VAL A 1 60 ? -2.074  4.496   2.695   1.00 0.00 ? 60 VAL A H    7 
ATOM 8044  H HA   . VAL A 1 60 ? -3.866  2.822   4.205   1.00 0.00 ? 60 VAL A HA   7 
ATOM 8045  H HB   . VAL A 1 60 ? -4.200  3.981   1.426   1.00 0.00 ? 60 VAL A HB   7 
ATOM 8046  H HG11 . VAL A 1 60 ? -6.047  2.540   3.288   1.00 0.00 ? 60 VAL A HG11 7 
ATOM 8047  H HG12 . VAL A 1 60 ? -6.674  3.718   2.134   1.00 0.00 ? 60 VAL A HG12 7 
ATOM 8048  H HG13 . VAL A 1 60 ? -5.789  2.303   1.559   1.00 0.00 ? 60 VAL A HG13 7 
ATOM 8049  H HG21 . VAL A 1 60 ? -3.837  5.611   3.336   1.00 0.00 ? 60 VAL A HG21 7 
ATOM 8050  H HG22 . VAL A 1 60 ? -5.309  5.817   2.393   1.00 0.00 ? 60 VAL A HG22 7 
ATOM 8051  H HG23 . VAL A 1 60 ? -5.378  5.048   3.978   1.00 0.00 ? 60 VAL A HG23 7 
ATOM 8052  N N    . ASP A 1 61 ? -2.580  1.759   1.350   1.00 0.00 ? 61 ASP A N    7 
ATOM 8053  C CA   . ASP A 1 61 ? -2.268  0.576   0.570   1.00 0.00 ? 61 ASP A CA   7 
ATOM 8054  C C    . ASP A 1 61 ? -1.238  -0.292  1.280   1.00 0.00 ? 61 ASP A C    7 
ATOM 8055  O O    . ASP A 1 61 ? -1.080  -1.474  0.963   1.00 0.00 ? 61 ASP A O    7 
ATOM 8056  C CB   . ASP A 1 61 ? -1.745  0.988   -0.806  1.00 0.00 ? 61 ASP A CB   7 
ATOM 8057  C CG   . ASP A 1 61 ? -2.828  1.591   -1.683  1.00 0.00 ? 61 ASP A CG   7 
ATOM 8058  O OD1  . ASP A 1 61 ? -3.497  2.546   -1.234  1.00 0.00 ? 61 ASP A OD1  7 
ATOM 8059  O OD2  . ASP A 1 61 ? -3.003  1.109   -2.823  1.00 0.00 ? 61 ASP A OD2  7 
ATOM 8060  H H    . ASP A 1 61 ? -2.276  2.630   1.024   1.00 0.00 ? 61 ASP A H    7 
ATOM 8061  H HA   . ASP A 1 61 ? -3.178  0.007   0.450   1.00 0.00 ? 61 ASP A HA   7 
ATOM 8062  H HB2  . ASP A 1 61 ? -0.952  1.719   -0.684  1.00 0.00 ? 61 ASP A HB2  7 
ATOM 8063  H HB3  . ASP A 1 61 ? -1.348  0.119   -1.301  1.00 0.00 ? 61 ASP A HB3  7 
ATOM 8064  N N    . ALA A 1 62 ? -0.538  0.291   2.248   1.00 0.00 ? 62 ALA A N    7 
ATOM 8065  C CA   . ALA A 1 62 ? 0.458   -0.451  3.000   1.00 0.00 ? 62 ALA A CA   7 
ATOM 8066  C C    . ALA A 1 62 ? -0.190  -1.662  3.651   1.00 0.00 ? 62 ALA A C    7 
ATOM 8067  O O    . ALA A 1 62 ? 0.420   -2.721  3.768   1.00 0.00 ? 62 ALA A O    7 
ATOM 8068  C CB   . ALA A 1 62 ? 1.111   0.436   4.049   1.00 0.00 ? 62 ALA A CB   7 
ATOM 8069  H H    . ALA A 1 62 ? -0.704  1.231   2.468   1.00 0.00 ? 62 ALA A H    7 
ATOM 8070  H HA   . ALA A 1 62 ? 1.219   -0.785  2.310   1.00 0.00 ? 62 ALA A HA   7 
ATOM 8071  H HB1  . ALA A 1 62 ? 0.346   0.942   4.619   1.00 0.00 ? 62 ALA A HB1  7 
ATOM 8072  H HB2  . ALA A 1 62 ? 1.711   -0.172  4.710   1.00 0.00 ? 62 ALA A HB2  7 
ATOM 8073  H HB3  . ALA A 1 62 ? 1.739   1.166   3.563   1.00 0.00 ? 62 ALA A HB3  7 
ATOM 8074  N N    . ILE A 1 63 ? -1.446  -1.500  4.053   1.00 0.00 ? 63 ILE A N    7 
ATOM 8075  C CA   . ILE A 1 63 ? -2.188  -2.580  4.676   1.00 0.00 ? 63 ILE A CA   7 
ATOM 8076  C C    . ILE A 1 63 ? -2.279  -3.780  3.726   1.00 0.00 ? 63 ILE A C    7 
ATOM 8077  O O    . ILE A 1 63 ? -1.653  -4.808  3.984   1.00 0.00 ? 63 ILE A O    7 
ATOM 8078  C CB   . ILE A 1 63 ? -3.579  -2.101  5.154   1.00 0.00 ? 63 ILE A CB   7 
ATOM 8079  C CG1  . ILE A 1 63 ? -3.412  -1.137  6.331   1.00 0.00 ? 63 ILE A CG1  7 
ATOM 8080  C CG2  . ILE A 1 63 ? -4.471  -3.276  5.546   1.00 0.00 ? 63 ILE A CG2  7 
ATOM 8081  C CD1  . ILE A 1 63 ? -4.723  -0.624  6.884   1.00 0.00 ? 63 ILE A CD1  7 
ATOM 8082  H H    . ILE A 1 63 ? -1.884  -0.638  3.914   1.00 0.00 ? 63 ILE A H    7 
ATOM 8083  H HA   . ILE A 1 63 ? -1.627  -2.887  5.550   1.00 0.00 ? 63 ILE A HA   7 
ATOM 8084  H HB   . ILE A 1 63 ? -4.050  -1.568  4.346   1.00 0.00 ? 63 ILE A HB   7 
ATOM 8085  H HG12 . ILE A 1 63 ? -2.889  -1.641  7.130   1.00 0.00 ? 63 ILE A HG12 7 
ATOM 8086  H HG13 . ILE A 1 63 ? -2.831  -0.286  6.008   1.00 0.00 ? 63 ILE A HG13 7 
ATOM 8087  H HG21 . ILE A 1 63 ? -3.928  -4.200  5.423   1.00 0.00 ? 63 ILE A HG21 7 
ATOM 8088  H HG22 . ILE A 1 63 ? -4.771  -3.172  6.578   1.00 0.00 ? 63 ILE A HG22 7 
ATOM 8089  H HG23 . ILE A 1 63 ? -5.348  -3.286  4.917   1.00 0.00 ? 63 ILE A HG23 7 
ATOM 8090  H HD11 . ILE A 1 63 ? -5.531  -0.928  6.237   1.00 0.00 ? 63 ILE A HD11 7 
ATOM 8091  H HD12 . ILE A 1 63 ? -4.881  -1.029  7.872   1.00 0.00 ? 63 ILE A HD12 7 
ATOM 8092  H HD13 . ILE A 1 63 ? -4.693  0.455   6.938   1.00 0.00 ? 63 ILE A HD13 7 
ATOM 8093  N N    . PRO A 1 64 ? -3.032  -3.695  2.602   1.00 0.00 ? 64 PRO A N    7 
ATOM 8094  C CA   . PRO A 1 64 ? -3.105  -4.815  1.671   1.00 0.00 ? 64 PRO A CA   7 
ATOM 8095  C C    . PRO A 1 64 ? -1.715  -5.260  1.251   1.00 0.00 ? 64 PRO A C    7 
ATOM 8096  O O    . PRO A 1 64 ? -1.497  -6.419  0.903   1.00 0.00 ? 64 PRO A O    7 
ATOM 8097  C CB   . PRO A 1 64 ? -3.862  -4.271  0.459   1.00 0.00 ? 64 PRO A CB   7 
ATOM 8098  C CG   . PRO A 1 64 ? -4.547  -3.031  0.919   1.00 0.00 ? 64 PRO A CG   7 
ATOM 8099  C CD   . PRO A 1 64 ? -3.839  -2.543  2.157   1.00 0.00 ? 64 PRO A CD   7 
ATOM 8100  H HA   . PRO A 1 64 ? -3.628  -5.648  2.098   1.00 0.00 ? 64 PRO A HA   7 
ATOM 8101  H HB2  . PRO A 1 64 ? -3.163  -4.056  -0.335  1.00 0.00 ? 64 PRO A HB2  7 
ATOM 8102  H HB3  . PRO A 1 64 ? -4.575  -5.008  0.122   1.00 0.00 ? 64 PRO A HB3  7 
ATOM 8103  H HG2  . PRO A 1 64 ? -4.495  -2.280  0.146   1.00 0.00 ? 64 PRO A HG2  7 
ATOM 8104  H HG3  . PRO A 1 64 ? -5.578  -3.254  1.147   1.00 0.00 ? 64 PRO A HG3  7 
ATOM 8105  H HD2  . PRO A 1 64 ? -3.214  -1.696  1.928   1.00 0.00 ? 64 PRO A HD2  7 
ATOM 8106  H HD3  . PRO A 1 64 ? -4.572  -2.282  2.899   1.00 0.00 ? 64 PRO A HD3  7 
ATOM 8107  N N    . MET A 1 65 ? -0.777  -4.324  1.303   1.00 0.00 ? 65 MET A N    7 
ATOM 8108  C CA   . MET A 1 65 ? 0.597   -4.606  0.946   1.00 0.00 ? 65 MET A CA   7 
ATOM 8109  C C    . MET A 1 65 ? 1.240   -5.481  2.009   1.00 0.00 ? 65 MET A C    7 
ATOM 8110  O O    . MET A 1 65 ? 2.108   -6.299  1.714   1.00 0.00 ? 65 MET A O    7 
ATOM 8111  C CB   . MET A 1 65 ? 1.368   -3.298  0.797   1.00 0.00 ? 65 MET A CB   7 
ATOM 8112  C CG   . MET A 1 65 ? 2.820   -3.484  0.415   1.00 0.00 ? 65 MET A CG   7 
ATOM 8113  S SD   . MET A 1 65 ? 3.023   -4.349  -1.155  1.00 0.00 ? 65 MET A SD   7 
ATOM 8114  C CE   . MET A 1 65 ? 4.810   -4.399  -1.284  1.00 0.00 ? 65 MET A CE   7 
ATOM 8115  H H    . MET A 1 65 ? -1.015  -3.421  1.603   1.00 0.00 ? 65 MET A H    7 
ATOM 8116  H HA   . MET A 1 65 ? 0.601   -5.132  0.002   1.00 0.00 ? 65 MET A HA   7 
ATOM 8117  H HB2  . MET A 1 65 ? 0.892   -2.699  0.037   1.00 0.00 ? 65 MET A HB2  7 
ATOM 8118  H HB3  . MET A 1 65 ? 1.332   -2.764  1.735   1.00 0.00 ? 65 MET A HB3  7 
ATOM 8119  H HG2  . MET A 1 65 ? 3.273   -2.511  0.334   1.00 0.00 ? 65 MET A HG2  7 
ATOM 8120  H HG3  . MET A 1 65 ? 3.317   -4.048  1.190   1.00 0.00 ? 65 MET A HG3  7 
ATOM 8121  H HE1  . MET A 1 65 ? 5.246   -3.929  -0.415  1.00 0.00 ? 65 MET A HE1  7 
ATOM 8122  H HE2  . MET A 1 65 ? 5.138   -5.426  -1.339  1.00 0.00 ? 65 MET A HE2  7 
ATOM 8123  H HE3  . MET A 1 65 ? 5.121   -3.872  -2.173  1.00 0.00 ? 65 MET A HE3  7 
ATOM 8124  N N    . ILE A 1 66 ? 0.786   -5.319  3.251   1.00 0.00 ? 66 ILE A N    7 
ATOM 8125  C CA   . ILE A 1 66 ? 1.305   -6.111  4.358   1.00 0.00 ? 66 ILE A CA   7 
ATOM 8126  C C    . ILE A 1 66 ? 0.689   -7.500  4.328   1.00 0.00 ? 66 ILE A C    7 
ATOM 8127  O O    . ILE A 1 66 ? 1.378   -8.502  4.508   1.00 0.00 ? 66 ILE A O    7 
ATOM 8128  C CB   . ILE A 1 66 ? 1.030   -5.437  5.728   1.00 0.00 ? 66 ILE A CB   7 
ATOM 8129  C CG1  . ILE A 1 66 ? 1.874   -4.170  5.869   1.00 0.00 ? 66 ILE A CG1  7 
ATOM 8130  C CG2  . ILE A 1 66 ? 1.320   -6.389  6.884   1.00 0.00 ? 66 ILE A CG2  7 
ATOM 8131  C CD1  . ILE A 1 66 ? 1.552   -3.365  7.109   1.00 0.00 ? 66 ILE A CD1  7 
ATOM 8132  H H    . ILE A 1 66 ? 0.070   -4.667  3.418   1.00 0.00 ? 66 ILE A H    7 
ATOM 8133  H HA   . ILE A 1 66 ? 2.378   -6.201  4.232   1.00 0.00 ? 66 ILE A HA   7 
ATOM 8134  H HB   . ILE A 1 66 ? -0.014  -5.170  5.771   1.00 0.00 ? 66 ILE A HB   7 
ATOM 8135  H HG12 . ILE A 1 66 ? 2.917   -4.446  5.918   1.00 0.00 ? 66 ILE A HG12 7 
ATOM 8136  H HG13 . ILE A 1 66 ? 1.715   -3.540  5.011   1.00 0.00 ? 66 ILE A HG13 7 
ATOM 8137  H HG21 . ILE A 1 66 ? 0.877   -7.352  6.682   1.00 0.00 ? 66 ILE A HG21 7 
ATOM 8138  H HG22 . ILE A 1 66 ? 2.388   -6.500  6.999   1.00 0.00 ? 66 ILE A HG22 7 
ATOM 8139  H HG23 . ILE A 1 66 ? 0.900   -5.984  7.793   1.00 0.00 ? 66 ILE A HG23 7 
ATOM 8140  H HD11 . ILE A 1 66 ? 0.867   -3.922  7.731   1.00 0.00 ? 66 ILE A HD11 7 
ATOM 8141  H HD12 . ILE A 1 66 ? 2.461   -3.171  7.658   1.00 0.00 ? 66 ILE A HD12 7 
ATOM 8142  H HD13 . ILE A 1 66 ? 1.097   -2.428  6.821   1.00 0.00 ? 66 ILE A HD13 7 
ATOM 8143  N N    . ALA A 1 67 ? -0.615  -7.552  4.083   1.00 0.00 ? 67 ALA A N    7 
ATOM 8144  C CA   . ALA A 1 67 ? -1.315  -8.818  4.015   1.00 0.00 ? 67 ALA A CA   7 
ATOM 8145  C C    . ALA A 1 67 ? -0.913  -9.563  2.753   1.00 0.00 ? 67 ALA A C    7 
ATOM 8146  O O    . ALA A 1 67 ? -0.389  -10.675 2.811   1.00 0.00 ? 67 ALA A O    7 
ATOM 8147  C CB   . ALA A 1 67 ? -2.821  -8.599  4.059   1.00 0.00 ? 67 ALA A CB   7 
ATOM 8148  H H    . ALA A 1 67 ? -1.110  -6.722  3.935   1.00 0.00 ? 67 ALA A H    7 
ATOM 8149  H HA   . ALA A 1 67 ? -1.027  -9.397  4.873   1.00 0.00 ? 67 ALA A HA   7 
ATOM 8150  H HB1  . ALA A 1 67 ? -3.029  -7.540  4.086   1.00 0.00 ? 67 ALA A HB1  7 
ATOM 8151  H HB2  . ALA A 1 67 ? -3.276  -9.033  3.182   1.00 0.00 ? 67 ALA A HB2  7 
ATOM 8152  H HB3  . ALA A 1 67 ? -3.226  -9.067  4.945   1.00 0.00 ? 67 ALA A HB3  7 
ATOM 8153  N N    . VAL A 1 68 ? -1.142  -8.926  1.612   1.00 0.00 ? 68 VAL A N    7 
ATOM 8154  C CA   . VAL A 1 68 ? -0.787  -9.510  0.331   1.00 0.00 ? 68 VAL A CA   7 
ATOM 8155  C C    . VAL A 1 68 ? 0.719   -9.721  0.248   1.00 0.00 ? 68 VAL A C    7 
ATOM 8156  O O    . VAL A 1 68 ? 1.183   -10.741 -0.254  1.00 0.00 ? 68 VAL A O    7 
ATOM 8157  C CB   . VAL A 1 68 ? -1.247  -8.620  -0.842  1.00 0.00 ? 68 VAL A CB   7 
ATOM 8158  C CG1  . VAL A 1 68 ? -0.904  -9.266  -2.176  1.00 0.00 ? 68 VAL A CG1  7 
ATOM 8159  C CG2  . VAL A 1 68 ? -2.739  -8.344  -0.743  1.00 0.00 ? 68 VAL A CG2  7 
ATOM 8160  H H    . VAL A 1 68 ? -1.546  -8.036  1.636   1.00 0.00 ? 68 VAL A H    7 
ATOM 8161  H HA   . VAL A 1 68 ? -1.283  -10.469 0.249   1.00 0.00 ? 68 VAL A HA   7 
ATOM 8162  H HB   . VAL A 1 68 ? -0.722  -7.676  -0.780  1.00 0.00 ? 68 VAL A HB   7 
ATOM 8163  H HG11 . VAL A 1 68 ? -1.016  -10.337 -2.098  1.00 0.00 ? 68 VAL A HG11 7 
ATOM 8164  H HG12 . VAL A 1 68 ? -1.569  -8.889  -2.940  1.00 0.00 ? 68 VAL A HG12 7 
ATOM 8165  H HG13 . VAL A 1 68 ? 0.115   -9.028  -2.439  1.00 0.00 ? 68 VAL A HG13 7 
ATOM 8166  H HG21 . VAL A 1 68 ? -3.038  -8.352  0.295   1.00 0.00 ? 68 VAL A HG21 7 
ATOM 8167  H HG22 . VAL A 1 68 ? -2.956  -7.379  -1.173  1.00 0.00 ? 68 VAL A HG22 7 
ATOM 8168  H HG23 . VAL A 1 68 ? -3.283  -9.108  -1.279  1.00 0.00 ? 68 VAL A HG23 7 
ATOM 8169  N N    . GLY A 1 69 ? 1.483   -8.756  0.757   1.00 0.00 ? 69 GLY A N    7 
ATOM 8170  C CA   . GLY A 1 69 ? 2.927   -8.878  0.730   1.00 0.00 ? 69 GLY A CA   7 
ATOM 8171  C C    . GLY A 1 69 ? 3.410   -10.090 1.499   1.00 0.00 ? 69 GLY A C    7 
ATOM 8172  O O    . GLY A 1 69 ? 4.208   -10.873 0.990   1.00 0.00 ? 69 GLY A O    7 
ATOM 8173  H H    . GLY A 1 69 ? 1.064   -7.963  1.157   1.00 0.00 ? 69 GLY A H    7 
ATOM 8174  H HA2  . GLY A 1 69 ? 3.253   -8.961  -0.299  1.00 0.00 ? 69 GLY A HA2  7 
ATOM 8175  H HA3  . GLY A 1 69 ? 3.367   -7.993  1.163   1.00 0.00 ? 69 GLY A HA3  7 
ATOM 8176  N N    . LEU A 1 70 ? 2.929   -10.246 2.731   1.00 0.00 ? 70 LEU A N    7 
ATOM 8177  C CA   . LEU A 1 70 ? 3.316   -11.362 3.563   1.00 0.00 ? 70 LEU A CA   7 
ATOM 8178  C C    . LEU A 1 70 ? 2.779   -12.675 3.008   1.00 0.00 ? 70 LEU A C    7 
ATOM 8179  O O    . LEU A 1 70 ? 3.479   -13.687 2.997   1.00 0.00 ? 70 LEU A O    7 
ATOM 8180  C CB   . LEU A 1 70 ? 2.801   -11.130 4.977   1.00 0.00 ? 70 LEU A CB   7 
ATOM 8181  C CG   . LEU A 1 70 ? 3.472   -9.980  5.732   1.00 0.00 ? 70 LEU A CG   7 
ATOM 8182  C CD1  . LEU A 1 70 ? 2.794   -9.753  7.077   1.00 0.00 ? 70 LEU A CD1  7 
ATOM 8183  C CD2  . LEU A 1 70 ? 4.957   -10.263 5.922   1.00 0.00 ? 70 LEU A CD2  7 
ATOM 8184  H H    . LEU A 1 70 ? 2.295   -9.596  3.094   1.00 0.00 ? 70 LEU A H    7 
ATOM 8185  H HA   . LEU A 1 70 ? 4.395   -11.403 3.584   1.00 0.00 ? 70 LEU A HA   7 
ATOM 8186  H HB2  . LEU A 1 70 ? 1.740   -10.931 4.924   1.00 0.00 ? 70 LEU A HB2  7 
ATOM 8187  H HB3  . LEU A 1 70 ? 2.947   -12.028 5.532   1.00 0.00 ? 70 LEU A HB3  7 
ATOM 8188  H HG   . LEU A 1 70 ? 3.376   -9.074  5.153   1.00 0.00 ? 70 LEU A HG   7 
ATOM 8189  H HD11 . LEU A 1 70 ? 1.878   -10.325 7.120   1.00 0.00 ? 70 LEU A HD11 7 
ATOM 8190  H HD12 . LEU A 1 70 ? 3.453   -10.068 7.872   1.00 0.00 ? 70 LEU A HD12 7 
ATOM 8191  H HD13 . LEU A 1 70 ? 2.567   -8.704  7.191   1.00 0.00 ? 70 LEU A HD13 7 
ATOM 8192  H HD21 . LEU A 1 70 ? 5.235   -11.135 5.347   1.00 0.00 ? 70 LEU A HD21 7 
ATOM 8193  H HD22 . LEU A 1 70 ? 5.531   -9.413  5.585   1.00 0.00 ? 70 LEU A HD22 7 
ATOM 8194  H HD23 . LEU A 1 70 ? 5.161   -10.442 6.967   1.00 0.00 ? 70 LEU A HD23 7 
ATOM 8195  N N    . GLY A 1 71 ? 1.534   -12.653 2.544   1.00 0.00 ? 71 GLY A N    7 
ATOM 8196  C CA   . GLY A 1 71 ? 0.931   -13.853 1.994   1.00 0.00 ? 71 GLY A CA   7 
ATOM 8197  C C    . GLY A 1 71 ? 1.615   -14.304 0.718   1.00 0.00 ? 71 GLY A C    7 
ATOM 8198  O O    . GLY A 1 71 ? 1.947   -15.476 0.563   1.00 0.00 ? 71 GLY A O    7 
ATOM 8199  H H    . GLY A 1 71 ? 1.020   -11.818 2.575   1.00 0.00 ? 71 GLY A H    7 
ATOM 8200  H HA2  . GLY A 1 71 ? 0.997   -14.646 2.726   1.00 0.00 ? 71 GLY A HA2  7 
ATOM 8201  H HA3  . GLY A 1 71 ? -0.110  -13.658 1.782   1.00 0.00 ? 71 GLY A HA3  7 
ATOM 8202  N N    . LEU A 1 72 ? 1.827   -13.368 -0.198  1.00 0.00 ? 72 LEU A N    7 
ATOM 8203  C CA   . LEU A 1 72 ? 2.475   -13.671 -1.468  1.00 0.00 ? 72 LEU A CA   7 
ATOM 8204  C C    . LEU A 1 72 ? 3.955   -13.968 -1.264  1.00 0.00 ? 72 LEU A C    7 
ATOM 8205  O O    . LEU A 1 72 ? 4.531   -14.809 -1.954  1.00 0.00 ? 72 LEU A O    7 
ATOM 8206  C CB   . LEU A 1 72 ? 2.315   -12.501 -2.443  1.00 0.00 ? 72 LEU A CB   7 
ATOM 8207  C CG   . LEU A 1 72 ? 0.873   -12.128 -2.801  1.00 0.00 ? 72 LEU A CG   7 
ATOM 8208  C CD1  . LEU A 1 72 ? 0.856   -11.012 -3.835  1.00 0.00 ? 72 LEU A CD1  7 
ATOM 8209  C CD2  . LEU A 1 72 ? 0.108   -13.341 -3.313  1.00 0.00 ? 72 LEU A CD2  7 
ATOM 8210  H H    . LEU A 1 72 ? 1.544   -12.454 -0.015  1.00 0.00 ? 72 LEU A H    7 
ATOM 8211  H HA   . LEU A 1 72 ? 1.997   -14.545 -1.885  1.00 0.00 ? 72 LEU A HA   7 
ATOM 8212  H HB2  . LEU A 1 72 ? 2.789   -11.632 -2.008  1.00 0.00 ? 72 LEU A HB2  7 
ATOM 8213  H HB3  . LEU A 1 72 ? 2.835   -12.747 -3.355  1.00 0.00 ? 72 LEU A HB3  7 
ATOM 8214  H HG   . LEU A 1 72 ? 0.372   -11.768 -1.915  1.00 0.00 ? 72 LEU A HG   7 
ATOM 8215  H HD11 . LEU A 1 72 ? 1.365   -10.147 -3.438  1.00 0.00 ? 72 LEU A HD11 7 
ATOM 8216  H HD12 . LEU A 1 72 ? 1.357   -11.345 -4.732  1.00 0.00 ? 72 LEU A HD12 7 
ATOM 8217  H HD13 . LEU A 1 72 ? -0.166  -10.754 -4.069  1.00 0.00 ? 72 LEU A HD13 7 
ATOM 8218  H HD21 . LEU A 1 72 ? 0.718   -14.225 -3.214  1.00 0.00 ? 72 LEU A HD21 7 
ATOM 8219  H HD22 . LEU A 1 72 ? -0.796  -13.461 -2.734  1.00 0.00 ? 72 LEU A HD22 7 
ATOM 8220  H HD23 . LEU A 1 72 ? -0.149  -13.195 -4.351  1.00 0.00 ? 72 LEU A HD23 7 
ATOM 8221  N N    . TYR A 1 73 ? 4.565   -13.277 -0.305  1.00 0.00 ? 73 TYR A N    7 
ATOM 8222  C CA   . TYR A 1 73 ? 5.982   -13.463 -0.008  1.00 0.00 ? 73 TYR A CA   7 
ATOM 8223  C C    . TYR A 1 73 ? 6.271   -14.929 0.276   1.00 0.00 ? 73 TYR A C    7 
ATOM 8224  O O    . TYR A 1 73 ? 7.218   -15.503 -0.255  1.00 0.00 ? 73 TYR A O    7 
ATOM 8225  C CB   . TYR A 1 73 ? 6.399   -12.604 1.193   1.00 0.00 ? 73 TYR A CB   7 
ATOM 8226  C CG   . TYR A 1 73 ? 7.867   -12.712 1.538   1.00 0.00 ? 73 TYR A CG   7 
ATOM 8227  C CD1  . TYR A 1 73 ? 8.831   -12.052 0.781   1.00 0.00 ? 73 TYR A CD1  7 
ATOM 8228  C CD2  . TYR A 1 73 ? 8.291   -13.493 2.604   1.00 0.00 ? 73 TYR A CD2  7 
ATOM 8229  C CE1  . TYR A 1 73 ? 10.176  -12.168 1.084   1.00 0.00 ? 73 TYR A CE1  7 
ATOM 8230  C CE2  . TYR A 1 73 ? 9.634   -13.610 2.914   1.00 0.00 ? 73 TYR A CE2  7 
ATOM 8231  C CZ   . TYR A 1 73 ? 10.571  -12.946 2.151   1.00 0.00 ? 73 TYR A CZ   7 
ATOM 8232  O OH   . TYR A 1 73 ? 11.907  -13.062 2.454   1.00 0.00 ? 73 TYR A OH   7 
ATOM 8233  H H    . TYR A 1 73 ? 4.049   -12.631 0.215   1.00 0.00 ? 73 TYR A H    7 
ATOM 8234  H HA   . TYR A 1 73 ? 6.549   -13.158 -0.881  1.00 0.00 ? 73 TYR A HA   7 
ATOM 8235  H HB2  . TYR A 1 73 ? 6.191   -11.569 0.975   1.00 0.00 ? 73 TYR A HB2  7 
ATOM 8236  H HB3  . TYR A 1 73 ? 5.829   -12.907 2.059   1.00 0.00 ? 73 TYR A HB3  7 
ATOM 8237  H HD1  . TYR A 1 73 ? 8.517   -11.437 -0.050  1.00 0.00 ? 73 TYR A HD1  7 
ATOM 8238  H HD2  . TYR A 1 73 ? 7.552   -14.011 3.200   1.00 0.00 ? 73 TYR A HD2  7 
ATOM 8239  H HE1  . TYR A 1 73 ? 10.912  -11.648 0.487   1.00 0.00 ? 73 TYR A HE1  7 
ATOM 8240  H HE2  . TYR A 1 73 ? 9.947   -14.220 3.751   1.00 0.00 ? 73 TYR A HE2  7 
ATOM 8241  H HH   . TYR A 1 73 ? 12.318  -12.195 2.428   1.00 0.00 ? 73 TYR A HH   7 
ATOM 8242  N N    . VAL A 1 74 ? 5.433   -15.532 1.107   1.00 0.00 ? 74 VAL A N    7 
ATOM 8243  C CA   . VAL A 1 74 ? 5.584   -16.937 1.454   1.00 0.00 ? 74 VAL A CA   7 
ATOM 8244  C C    . VAL A 1 74 ? 4.924   -17.824 0.398   1.00 0.00 ? 74 VAL A C    7 
ATOM 8245  O O    . VAL A 1 74 ? 5.318   -18.970 0.199   1.00 0.00 ? 74 VAL A O    7 
ATOM 8246  C CB   . VAL A 1 74 ? 4.984   -17.240 2.844   1.00 0.00 ? 74 VAL A CB   7 
ATOM 8247  C CG1  . VAL A 1 74 ? 3.502   -16.904 2.881   1.00 0.00 ? 74 VAL A CG1  7 
ATOM 8248  C CG2  . VAL A 1 74 ? 5.218   -18.693 3.235   1.00 0.00 ? 74 VAL A CG2  7 
ATOM 8249  H H    . VAL A 1 74 ? 4.689   -15.024 1.490   1.00 0.00 ? 74 VAL A H    7 
ATOM 8250  H HA   . VAL A 1 74 ? 6.644   -17.161 1.489   1.00 0.00 ? 74 VAL A HA   7 
ATOM 8251  H HB   . VAL A 1 74 ? 5.484   -16.614 3.569   1.00 0.00 ? 74 VAL A HB   7 
ATOM 8252  H HG11 . VAL A 1 74 ? 3.212   -16.453 1.945   1.00 0.00 ? 74 VAL A HG11 7 
ATOM 8253  H HG12 . VAL A 1 74 ? 2.930   -17.806 3.039   1.00 0.00 ? 74 VAL A HG12 7 
ATOM 8254  H HG13 . VAL A 1 74 ? 3.310   -16.211 3.688   1.00 0.00 ? 74 VAL A HG13 7 
ATOM 8255  H HG21 . VAL A 1 74 ? 5.324   -19.295 2.346   1.00 0.00 ? 74 VAL A HG21 7 
ATOM 8256  H HG22 . VAL A 1 74 ? 6.118   -18.765 3.827   1.00 0.00 ? 74 VAL A HG22 7 
ATOM 8257  H HG23 . VAL A 1 74 ? 4.378   -19.049 3.813   1.00 0.00 ? 74 VAL A HG23 7 
ATOM 8258  N N    . MET A 1 75 ? 3.909   -17.295 -0.283  1.00 0.00 ? 75 MET A N    7 
ATOM 8259  C CA   . MET A 1 75 ? 3.216   -18.073 -1.302  1.00 0.00 ? 75 MET A CA   7 
ATOM 8260  C C    . MET A 1 75 ? 3.997   -18.148 -2.613  1.00 0.00 ? 75 MET A C    7 
ATOM 8261  O O    . MET A 1 75 ? 4.579   -19.181 -2.931  1.00 0.00 ? 75 MET A O    7 
ATOM 8262  C CB   . MET A 1 75 ? 1.813   -17.521 -1.546  1.00 0.00 ? 75 MET A CB   7 
ATOM 8263  C CG   . MET A 1 75 ? 0.753   -18.158 -0.659  1.00 0.00 ? 75 MET A CG   7 
ATOM 8264  S SD   . MET A 1 75 ? 1.181   -18.150 1.092   1.00 0.00 ? 75 MET A SD   7 
ATOM 8265  C CE   . MET A 1 75 ? -0.296  -18.873 1.801   1.00 0.00 ? 75 MET A CE   7 
ATOM 8266  H H    . MET A 1 75 ? 3.624   -16.376 -0.098  1.00 0.00 ? 75 MET A H    7 
ATOM 8267  H HA   . MET A 1 75 ? 3.117   -19.070 -0.911  1.00 0.00 ? 75 MET A HA   7 
ATOM 8268  H HB2  . MET A 1 75 ? 1.816   -16.457 -1.365  1.00 0.00 ? 75 MET A HB2  7 
ATOM 8269  H HB3  . MET A 1 75 ? 1.543   -17.700 -2.576  1.00 0.00 ? 75 MET A HB3  7 
ATOM 8270  H HG2  . MET A 1 75 ? -0.166  -17.616 -0.783  1.00 0.00 ? 75 MET A HG2  7 
ATOM 8271  H HG3  . MET A 1 75 ? 0.609   -19.181 -0.975  1.00 0.00 ? 75 MET A HG3  7 
ATOM 8272  H HE1  . MET A 1 75 ? -1.041  -19.000 1.028   1.00 0.00 ? 75 MET A HE1  7 
ATOM 8273  H HE2  . MET A 1 75 ? -0.057  -19.835 2.230   1.00 0.00 ? 75 MET A HE2  7 
ATOM 8274  H HE3  . MET A 1 75 ? -0.683  -18.221 2.570   1.00 0.00 ? 75 MET A HE3  7 
ATOM 8275  N N    . PHE A 1 76 ? 4.014   -17.062 -3.378  1.00 0.00 ? 76 PHE A N    7 
ATOM 8276  C CA   . PHE A 1 76 ? 4.720   -17.054 -4.659  1.00 0.00 ? 76 PHE A CA   7 
ATOM 8277  C C    . PHE A 1 76 ? 6.206   -17.377 -4.506  1.00 0.00 ? 76 PHE A C    7 
ATOM 8278  O O    . PHE A 1 76 ? 6.831   -17.883 -5.438  1.00 0.00 ? 76 PHE A O    7 
ATOM 8279  C CB   . PHE A 1 76 ? 4.570   -15.701 -5.363  1.00 0.00 ? 76 PHE A CB   7 
ATOM 8280  C CG   . PHE A 1 76 ? 3.220   -15.477 -5.986  1.00 0.00 ? 76 PHE A CG   7 
ATOM 8281  C CD1  . PHE A 1 76 ? 2.664   -16.426 -6.828  1.00 0.00 ? 76 PHE A CD1  7 
ATOM 8282  C CD2  . PHE A 1 76 ? 2.512   -14.315 -5.736  1.00 0.00 ? 76 PHE A CD2  7 
ATOM 8283  C CE1  . PHE A 1 76 ? 1.425   -16.221 -7.403  1.00 0.00 ? 76 PHE A CE1  7 
ATOM 8284  C CE2  . PHE A 1 76 ? 1.274   -14.104 -6.309  1.00 0.00 ? 76 PHE A CE2  7 
ATOM 8285  C CZ   . PHE A 1 76 ? 0.729   -15.058 -7.143  1.00 0.00 ? 76 PHE A CZ   7 
ATOM 8286  H H    . PHE A 1 76 ? 3.531   -16.258 -3.088  1.00 0.00 ? 76 PHE A H    7 
ATOM 8287  H HA   . PHE A 1 76 ? 4.265   -17.817 -5.278  1.00 0.00 ? 76 PHE A HA   7 
ATOM 8288  H HB2  . PHE A 1 76 ? 4.736   -14.912 -4.645  1.00 0.00 ? 76 PHE A HB2  7 
ATOM 8289  H HB3  . PHE A 1 76 ? 5.313   -15.629 -6.141  1.00 0.00 ? 76 PHE A HB3  7 
ATOM 8290  H HD1  . PHE A 1 76 ? 3.207   -17.338 -7.031  1.00 0.00 ? 76 PHE A HD1  7 
ATOM 8291  H HD2  . PHE A 1 76 ? 2.937   -13.567 -5.086  1.00 0.00 ? 76 PHE A HD2  7 
ATOM 8292  H HE1  . PHE A 1 76 ? 1.003   -16.969 -8.057  1.00 0.00 ? 76 PHE A HE1  7 
ATOM 8293  H HE2  . PHE A 1 76 ? 0.732   -13.192 -6.104  1.00 0.00 ? 76 PHE A HE2  7 
ATOM 8294  H HZ   . PHE A 1 76 ? -0.240  -14.896 -7.590  1.00 0.00 ? 76 PHE A HZ   7 
ATOM 8295  N N    . ALA A 1 77 ? 6.778   -17.065 -3.349  1.00 0.00 ? 77 ALA A N    7 
ATOM 8296  C CA   . ALA A 1 77 ? 8.196   -17.307 -3.119  1.00 0.00 ? 77 ALA A CA   7 
ATOM 8297  C C    . ALA A 1 77 ? 8.461   -18.651 -2.455  1.00 0.00 ? 77 ALA A C    7 
ATOM 8298  O O    . ALA A 1 77 ? 9.224   -19.468 -2.970  1.00 0.00 ? 77 ALA A O    7 
ATOM 8299  C CB   . ALA A 1 77 ? 8.798   -16.178 -2.296  1.00 0.00 ? 77 ALA A CB   7 
ATOM 8300  H H    . ALA A 1 77 ? 6.246   -16.646 -2.648  1.00 0.00 ? 77 ALA A H    7 
ATOM 8301  H HA   . ALA A 1 77 ? 8.678   -17.304 -4.073  1.00 0.00 ? 77 ALA A HA   7 
ATOM 8302  H HB1  . ALA A 1 77 ? 8.117   -15.340 -2.282  1.00 0.00 ? 77 ALA A HB1  7 
ATOM 8303  H HB2  . ALA A 1 77 ? 8.973   -16.519 -1.287  1.00 0.00 ? 77 ALA A HB2  7 
ATOM 8304  H HB3  . ALA A 1 77 ? 9.735   -15.871 -2.738  1.00 0.00 ? 77 ALA A HB3  7 
ATOM 8305  N N    . VAL A 1 78 ? 7.851   -18.868 -1.302  1.00 0.00 ? 78 VAL A N    7 
ATOM 8306  C CA   . VAL A 1 78 ? 8.048   -20.109 -0.562  1.00 0.00 ? 78 VAL A CA   7 
ATOM 8307  C C    . VAL A 1 78 ? 7.071   -21.202 -0.998  1.00 0.00 ? 78 VAL A C    7 
ATOM 8308  O O    . VAL A 1 78 ? 7.208   -22.355 -0.590  1.00 0.00 ? 78 VAL A O    7 
ATOM 8309  C CB   . VAL A 1 78 ? 7.927   -19.894 0.962   1.00 0.00 ? 78 VAL A CB   7 
ATOM 8310  C CG1  . VAL A 1 78 ? 8.291   -21.163 1.715   1.00 0.00 ? 78 VAL A CG1  7 
ATOM 8311  C CG2  . VAL A 1 78 ? 8.802   -18.732 1.407   1.00 0.00 ? 78 VAL A CG2  7 
ATOM 8312  H H    . VAL A 1 78 ? 7.274   -18.175 -0.937  1.00 0.00 ? 78 VAL A H    7 
ATOM 8313  H HA   . VAL A 1 78 ? 9.050   -20.446 -0.769  1.00 0.00 ? 78 VAL A HA   7 
ATOM 8314  H HB   . VAL A 1 78 ? 6.905   -19.653 1.196   1.00 0.00 ? 78 VAL A HB   7 
ATOM 8315  H HG11 . VAL A 1 78 ? 9.057   -21.698 1.172   1.00 0.00 ? 78 VAL A HG11 7 
ATOM 8316  H HG12 . VAL A 1 78 ? 8.660   -20.906 2.697   1.00 0.00 ? 78 VAL A HG12 7 
ATOM 8317  H HG13 . VAL A 1 78 ? 7.415   -21.788 1.812   1.00 0.00 ? 78 VAL A HG13 7 
ATOM 8318  H HG21 . VAL A 1 78 ? 9.829   -18.931 1.140   1.00 0.00 ? 78 VAL A HG21 7 
ATOM 8319  H HG22 . VAL A 1 78 ? 8.471   -17.826 0.922   1.00 0.00 ? 78 VAL A HG22 7 
ATOM 8320  H HG23 . VAL A 1 78 ? 8.725   -18.614 2.479   1.00 0.00 ? 78 VAL A HG23 7 
ATOM 8321  N N    . ALA A 1 79 ? 6.090   -20.849 -1.828  1.00 0.00 ? 79 ALA A N    7 
ATOM 8322  C CA   . ALA A 1 79 ? 5.115   -21.828 -2.307  1.00 0.00 ? 79 ALA A CA   7 
ATOM 8323  C C    . ALA A 1 79 ? 4.909   -21.709 -3.814  1.00 0.00 ? 79 ALA A C    7 
ATOM 8324  O O    . ALA A 1 79 ? 3.780   -21.594 -4.292  1.00 0.00 ? 79 ALA A O    7 
ATOM 8325  C CB   . ALA A 1 79 ? 3.791   -21.666 -1.577  1.00 0.00 ? 79 ALA A CB   7 
ATOM 8326  H H    . ALA A 1 79 ? 6.020   -19.914 -2.128  1.00 0.00 ? 79 ALA A H    7 
ATOM 8327  H HA   . ALA A 1 79 ? 5.499   -22.816 -2.089  1.00 0.00 ? 79 ALA A HA   7 
ATOM 8328  H HB1  . ALA A 1 79 ? 3.588   -20.618 -1.434  1.00 0.00 ? 79 ALA A HB1  7 
ATOM 8329  H HB2  . ALA A 1 79 ? 3.000   -22.109 -2.163  1.00 0.00 ? 79 ALA A HB2  7 
ATOM 8330  H HB3  . ALA A 1 79 ? 3.846   -22.157 -0.617  1.00 0.00 ? 79 ALA A HB3  7 
ATOM 8331  N N    . MET A 1 1  ? -4.922  -28.211 3.658   1.00 0.00 ? 1  MET A N    8 
ATOM 8332  C CA   . MET A 1 1  ? -5.007  -26.729 3.743   1.00 0.00 ? 1  MET A CA   8 
ATOM 8333  C C    . MET A 1 1  ? -3.995  -26.049 2.826   1.00 0.00 ? 1  MET A C    8 
ATOM 8334  O O    . MET A 1 1  ? -4.031  -24.833 2.642   1.00 0.00 ? 1  MET A O    8 
ATOM 8335  C CB   . MET A 1 1  ? -4.767  -26.307 5.194   1.00 0.00 ? 1  MET A CB   8 
ATOM 8336  C CG   . MET A 1 1  ? -5.804  -26.845 6.164   1.00 0.00 ? 1  MET A CG   8 
ATOM 8337  S SD   . MET A 1 1  ? -5.500  -26.320 7.862   1.00 0.00 ? 1  MET A SD   8 
ATOM 8338  C CE   . MET A 1 1  ? -5.594  -24.541 7.688   1.00 0.00 ? 1  MET A CE   8 
ATOM 8339  H H1   . MET A 1 1  ? -4.964  -28.473 2.652   1.00 0.00 ? 1  MET A H1   8 
ATOM 8340  H H2   . MET A 1 1  ? -4.020  -28.502 4.084   1.00 0.00 ? 1  MET A H2   8 
ATOM 8341  H H3   . MET A 1 1  ? -5.728  -28.605 4.182   1.00 0.00 ? 1  MET A H3   8 
ATOM 8342  H HA   . MET A 1 1  ? -5.996  -26.430 3.446   1.00 0.00 ? 1  MET A HA   8 
ATOM 8343  H HB2  . MET A 1 1  ? -3.797  -26.663 5.504   1.00 0.00 ? 1  MET A HB2  8 
ATOM 8344  H HB3  . MET A 1 1  ? -4.781  -25.231 5.250   1.00 0.00 ? 1  MET A HB3  8 
ATOM 8345  H HG2  . MET A 1 1  ? -6.778  -26.492 5.862   1.00 0.00 ? 1  MET A HG2  8 
ATOM 8346  H HG3  . MET A 1 1  ? -5.784  -27.921 6.124   1.00 0.00 ? 1  MET A HG3  8 
ATOM 8347  H HE1  . MET A 1 1  ? -6.554  -24.269 7.272   1.00 0.00 ? 1  MET A HE1  8 
ATOM 8348  H HE2  . MET A 1 1  ? -5.479  -24.077 8.657   1.00 0.00 ? 1  MET A HE2  8 
ATOM 8349  H HE3  . MET A 1 1  ? -4.808  -24.200 7.030   1.00 0.00 ? 1  MET A HE3  8 
ATOM 8350  N N    . GLU A 1 2  ? -3.099  -26.838 2.250   1.00 0.00 ? 2  GLU A N    8 
ATOM 8351  C CA   . GLU A 1 2  ? -2.084  -26.304 1.348   1.00 0.00 ? 2  GLU A CA   8 
ATOM 8352  C C    . GLU A 1 2  ? -2.731  -25.575 0.175   1.00 0.00 ? 2  GLU A C    8 
ATOM 8353  O O    . GLU A 1 2  ? -2.611  -24.355 0.038   1.00 0.00 ? 2  GLU A O    8 
ATOM 8354  C CB   . GLU A 1 2  ? -1.173  -27.421 0.829   1.00 0.00 ? 2  GLU A CB   8 
ATOM 8355  C CG   . GLU A 1 2  ? -0.228  -27.985 1.881   1.00 0.00 ? 2  GLU A CG   8 
ATOM 8356  C CD   . GLU A 1 2  ? -0.951  -28.693 3.008   1.00 0.00 ? 2  GLU A CD   8 
ATOM 8357  O OE1  . GLU A 1 2  ? -1.646  -29.694 2.731   1.00 0.00 ? 2  GLU A OE1  8 
ATOM 8358  O OE2  . GLU A 1 2  ? -0.823  -28.248 4.168   1.00 0.00 ? 2  GLU A OE2  8 
ATOM 8359  H H    . GLU A 1 2  ? -3.124  -27.798 2.429   1.00 0.00 ? 2  GLU A H    8 
ATOM 8360  H HA   . GLU A 1 2  ? -1.490  -25.599 1.905   1.00 0.00 ? 2  GLU A HA   8 
ATOM 8361  H HB2  . GLU A 1 2  ? -1.789  -28.229 0.462   1.00 0.00 ? 2  GLU A HB2  8 
ATOM 8362  H HB3  . GLU A 1 2  ? -0.579  -27.035 0.014   1.00 0.00 ? 2  GLU A HB3  8 
ATOM 8363  H HG2  . GLU A 1 2  ? 0.439   -28.689 1.406   1.00 0.00 ? 2  GLU A HG2  8 
ATOM 8364  H HG3  . GLU A 1 2  ? 0.349   -27.172 2.298   1.00 0.00 ? 2  GLU A HG3  8 
ATOM 8365  N N    . ASN A 1 3  ? -3.414  -26.333 -0.673  1.00 0.00 ? 3  ASN A N    8 
ATOM 8366  C CA   . ASN A 1 3  ? -4.079  -25.764 -1.837  1.00 0.00 ? 3  ASN A CA   8 
ATOM 8367  C C    . ASN A 1 3  ? -5.113  -24.724 -1.418  1.00 0.00 ? 3  ASN A C    8 
ATOM 8368  O O    . ASN A 1 3  ? -5.337  -23.743 -2.128  1.00 0.00 ? 3  ASN A O    8 
ATOM 8369  C CB   . ASN A 1 3  ? -4.741  -26.869 -2.664  1.00 0.00 ? 3  ASN A CB   8 
ATOM 8370  C CG   . ASN A 1 3  ? -5.744  -27.674 -1.861  1.00 0.00 ? 3  ASN A CG   8 
ATOM 8371  O OD1  . ASN A 1 3  ? -5.399  -28.283 -0.848  1.00 0.00 ? 3  ASN A OD1  8 
ATOM 8372  N ND2  . ASN A 1 3  ? -6.992  -27.688 -2.314  1.00 0.00 ? 3  ASN A ND2  8 
ATOM 8373  H H    . ASN A 1 3  ? -3.472  -27.298 -0.513  1.00 0.00 ? 3  ASN A H    8 
ATOM 8374  H HA   . ASN A 1 3  ? -3.326  -25.280 -2.439  1.00 0.00 ? 3  ASN A HA   8 
ATOM 8375  H HB2  . ASN A 1 3  ? -5.256  -26.422 -3.502  1.00 0.00 ? 3  ASN A HB2  8 
ATOM 8376  H HB3  . ASN A 1 3  ? -3.979  -27.541 -3.032  1.00 0.00 ? 3  ASN A HB3  8 
ATOM 8377  H HD21 . ASN A 1 3  ? -7.194  -27.184 -3.130  1.00 0.00 ? 3  ASN A HD21 8 
ATOM 8378  H HD22 . ASN A 1 3  ? -7.661  -28.202 -1.814  1.00 0.00 ? 3  ASN A HD22 8 
ATOM 8379  N N    . LEU A 1 4  ? -5.734  -24.939 -0.263  1.00 0.00 ? 4  LEU A N    8 
ATOM 8380  C CA   . LEU A 1 4  ? -6.740  -24.011 0.246   1.00 0.00 ? 4  LEU A CA   8 
ATOM 8381  C C    . LEU A 1 4  ? -6.115  -22.683 0.639   1.00 0.00 ? 4  LEU A C    8 
ATOM 8382  O O    . LEU A 1 4  ? -6.679  -21.629 0.357   1.00 0.00 ? 4  LEU A O    8 
ATOM 8383  C CB   . LEU A 1 4  ? -7.490  -24.622 1.433   1.00 0.00 ? 4  LEU A CB   8 
ATOM 8384  C CG   . LEU A 1 4  ? -8.259  -25.908 1.121   1.00 0.00 ? 4  LEU A CG   8 
ATOM 8385  C CD1  . LEU A 1 4  ? -9.012  -26.393 2.351   1.00 0.00 ? 4  LEU A CD1  8 
ATOM 8386  C CD2  . LEU A 1 4  ? -9.216  -25.688 -0.040  1.00 0.00 ? 4  LEU A CD2  8 
ATOM 8387  H H    . LEU A 1 4  ? -5.508  -25.735 0.261   1.00 0.00 ? 4  LEU A H    8 
ATOM 8388  H HA   . LEU A 1 4  ? -7.441  -23.817 -0.550  1.00 0.00 ? 4  LEU A HA   8 
ATOM 8389  H HB2  . LEU A 1 4  ? -6.773  -24.834 2.213   1.00 0.00 ? 4  LEU A HB2  8 
ATOM 8390  H HB3  . LEU A 1 4  ? -8.193  -23.890 1.803   1.00 0.00 ? 4  LEU A HB3  8 
ATOM 8391  H HG   . LEU A 1 4  ? -7.557  -26.679 0.838   1.00 0.00 ? 4  LEU A HG   8 
ATOM 8392  H HD11 . LEU A 1 4  ? -8.468  -26.114 3.240   1.00 0.00 ? 4  LEU A HD11 8 
ATOM 8393  H HD12 . LEU A 1 4  ? -9.993  -25.943 2.373   1.00 0.00 ? 4  LEU A HD12 8 
ATOM 8394  H HD13 . LEU A 1 4  ? -9.111  -27.468 2.311   1.00 0.00 ? 4  LEU A HD13 8 
ATOM 8395  H HD21 . LEU A 1 4  ? -9.511  -24.650 -0.073  1.00 0.00 ? 4  LEU A HD21 8 
ATOM 8396  H HD22 . LEU A 1 4  ? -8.727  -25.953 -0.966  1.00 0.00 ? 4  LEU A HD22 8 
ATOM 8397  H HD23 . LEU A 1 4  ? -10.091 -26.307 0.093   1.00 0.00 ? 4  LEU A HD23 8 
ATOM 8398  N N    . ASN A 1 5  ? -4.944  -22.718 1.269   1.00 0.00 ? 5  ASN A N    8 
ATOM 8399  C CA   . ASN A 1 5  ? -4.290  -21.479 1.652   1.00 0.00 ? 5  ASN A CA   8 
ATOM 8400  C C    . ASN A 1 5  ? -3.784  -20.765 0.409   1.00 0.00 ? 5  ASN A C    8 
ATOM 8401  O O    . ASN A 1 5  ? -3.785  -19.540 0.347   1.00 0.00 ? 5  ASN A O    8 
ATOM 8402  C CB   . ASN A 1 5  ? -3.142  -21.708 2.644   1.00 0.00 ? 5  ASN A CB   8 
ATOM 8403  C CG   . ASN A 1 5  ? -1.978  -22.485 2.056   1.00 0.00 ? 5  ASN A CG   8 
ATOM 8404  O OD1  . ASN A 1 5  ? -1.513  -22.195 0.954   1.00 0.00 ? 5  ASN A OD1  8 
ATOM 8405  N ND2  . ASN A 1 5  ? -1.479  -23.458 2.808   1.00 0.00 ? 5  ASN A ND2  8 
ATOM 8406  H H    . ASN A 1 5  ? -4.517  -23.578 1.461   1.00 0.00 ? 5  ASN A H    8 
ATOM 8407  H HA   . ASN A 1 5  ? -5.036  -20.853 2.119   1.00 0.00 ? 5  ASN A HA   8 
ATOM 8408  H HB2  . ASN A 1 5  ? -2.770  -20.751 2.978   1.00 0.00 ? 5  ASN A HB2  8 
ATOM 8409  H HB3  . ASN A 1 5  ? -3.519  -22.255 3.496   1.00 0.00 ? 5  ASN A HB3  8 
ATOM 8410  H HD21 . ASN A 1 5  ? -1.885  -23.620 3.685   1.00 0.00 ? 5  ASN A HD21 8 
ATOM 8411  H HD22 . ASN A 1 5  ? -0.719  -23.968 2.459   1.00 0.00 ? 5  ASN A HD22 8 
ATOM 8412  N N    . MET A 1 6  ? -3.365  -21.540 -0.590  1.00 0.00 ? 6  MET A N    8 
ATOM 8413  C CA   . MET A 1 6  ? -2.874  -20.965 -1.835  1.00 0.00 ? 6  MET A CA   8 
ATOM 8414  C C    . MET A 1 6  ? -4.011  -20.302 -2.611  1.00 0.00 ? 6  MET A C    8 
ATOM 8415  O O    . MET A 1 6  ? -3.941  -19.111 -2.933  1.00 0.00 ? 6  MET A O    8 
ATOM 8416  C CB   . MET A 1 6  ? -2.192  -22.030 -2.698  1.00 0.00 ? 6  MET A CB   8 
ATOM 8417  C CG   . MET A 1 6  ? -0.933  -22.604 -2.069  1.00 0.00 ? 6  MET A CG   8 
ATOM 8418  S SD   . MET A 1 6  ? 0.057   -23.558 -3.237  1.00 0.00 ? 6  MET A SD   8 
ATOM 8419  C CE   . MET A 1 6  ? -1.128  -24.789 -3.771  1.00 0.00 ? 6  MET A CE   8 
ATOM 8420  H H    . MET A 1 6  ? -3.395  -22.519 -0.489  1.00 0.00 ? 6  MET A H    8 
ATOM 8421  H HA   . MET A 1 6  ? -2.148  -20.208 -1.578  1.00 0.00 ? 6  MET A HA   8 
ATOM 8422  H HB2  . MET A 1 6  ? -2.887  -22.839 -2.865  1.00 0.00 ? 6  MET A HB2  8 
ATOM 8423  H HB3  . MET A 1 6  ? -1.926  -21.592 -3.648  1.00 0.00 ? 6  MET A HB3  8 
ATOM 8424  H HG2  . MET A 1 6  ? -0.333  -21.790 -1.692  1.00 0.00 ? 6  MET A HG2  8 
ATOM 8425  H HG3  . MET A 1 6  ? -1.218  -23.248 -1.251  1.00 0.00 ? 6  MET A HG3  8 
ATOM 8426  H HE1  . MET A 1 6  ? -2.068  -24.309 -3.995  1.00 0.00 ? 6  MET A HE1  8 
ATOM 8427  H HE2  . MET A 1 6  ? -0.756  -25.284 -4.656  1.00 0.00 ? 6  MET A HE2  8 
ATOM 8428  H HE3  . MET A 1 6  ? -1.270  -25.516 -2.985  1.00 0.00 ? 6  MET A HE3  8 
ATOM 8429  N N    . ASP A 1 7  ? -5.066  -21.065 -2.903  1.00 0.00 ? 7  ASP A N    8 
ATOM 8430  C CA   . ASP A 1 7  ? -6.200  -20.517 -3.628  1.00 0.00 ? 7  ASP A CA   8 
ATOM 8431  C C    . ASP A 1 7  ? -6.854  -19.418 -2.806  1.00 0.00 ? 7  ASP A C    8 
ATOM 8432  O O    . ASP A 1 7  ? -7.176  -18.350 -3.329  1.00 0.00 ? 7  ASP A O    8 
ATOM 8433  C CB   . ASP A 1 7  ? -7.214  -21.610 -3.989  1.00 0.00 ? 7  ASP A CB   8 
ATOM 8434  C CG   . ASP A 1 7  ? -7.836  -22.280 -2.780  1.00 0.00 ? 7  ASP A CG   8 
ATOM 8435  O OD1  . ASP A 1 7  ? -8.496  -21.582 -1.984  1.00 0.00 ? 7  ASP A OD1  8 
ATOM 8436  O OD2  . ASP A 1 7  ? -7.681  -23.511 -2.643  1.00 0.00 ? 7  ASP A OD2  8 
ATOM 8437  H H    . ASP A 1 7  ? -5.082  -22.002 -2.622  1.00 0.00 ? 7  ASP A H    8 
ATOM 8438  H HA   . ASP A 1 7  ? -5.822  -20.081 -4.537  1.00 0.00 ? 7  ASP A HA   8 
ATOM 8439  H HB2  . ASP A 1 7  ? -8.004  -21.169 -4.571  1.00 0.00 ? 7  ASP A HB2  8 
ATOM 8440  H HB3  . ASP A 1 7  ? -6.719  -22.365 -4.583  1.00 0.00 ? 7  ASP A HB3  8 
ATOM 8441  N N    . LEU A 1 8  ? -7.030  -19.670 -1.511  1.00 0.00 ? 8  LEU A N    8 
ATOM 8442  C CA   . LEU A 1 8  ? -7.624  -18.670 -0.633  1.00 0.00 ? 8  LEU A CA   8 
ATOM 8443  C C    . LEU A 1 8  ? -6.759  -17.412 -0.620  1.00 0.00 ? 8  LEU A C    8 
ATOM 8444  O O    . LEU A 1 8  ? -7.261  -16.303 -0.442  1.00 0.00 ? 8  LEU A O    8 
ATOM 8445  C CB   . LEU A 1 8  ? -7.785  -19.223 0.785   1.00 0.00 ? 8  LEU A CB   8 
ATOM 8446  C CG   . LEU A 1 8  ? -8.533  -18.319 1.772   1.00 0.00 ? 8  LEU A CG   8 
ATOM 8447  C CD1  . LEU A 1 8  ? -7.698  -17.100 2.136   1.00 0.00 ? 8  LEU A CD1  8 
ATOM 8448  C CD2  . LEU A 1 8  ? -9.873  -17.893 1.190   1.00 0.00 ? 8  LEU A CD2  8 
ATOM 8449  H H    . LEU A 1 8  ? -6.744  -20.540 -1.137  1.00 0.00 ? 8  LEU A H    8 
ATOM 8450  H HA   . LEU A 1 8  ? -8.594  -18.421 -1.021  1.00 0.00 ? 8  LEU A HA   8 
ATOM 8451  H HB2  . LEU A 1 8  ? -8.313  -20.163 0.722   1.00 0.00 ? 8  LEU A HB2  8 
ATOM 8452  H HB3  . LEU A 1 8  ? -6.803  -19.408 1.177   1.00 0.00 ? 8  LEU A HB3  8 
ATOM 8453  H HG   . LEU A 1 8  ? -8.725  -18.872 2.679   1.00 0.00 ? 8  LEU A HG   8 
ATOM 8454  H HD11 . LEU A 1 8  ? -6.667  -17.277 1.875   1.00 0.00 ? 8  LEU A HD11 8 
ATOM 8455  H HD12 . LEU A 1 8  ? -8.065  -16.238 1.598   1.00 0.00 ? 8  LEU A HD12 8 
ATOM 8456  H HD13 . LEU A 1 8  ? -7.774  -16.918 3.198   1.00 0.00 ? 8  LEU A HD13 8 
ATOM 8457  H HD21 . LEU A 1 8  ? -9.710  -17.369 0.259   1.00 0.00 ? 8  LEU A HD21 8 
ATOM 8458  H HD22 . LEU A 1 8  ? -10.482 -18.766 1.011   1.00 0.00 ? 8  LEU A HD22 8 
ATOM 8459  H HD23 . LEU A 1 8  ? -10.376 -17.239 1.887   1.00 0.00 ? 8  LEU A HD23 8 
ATOM 8460  N N    . LEU A 1 9  ? -5.451  -17.592 -0.825  1.00 0.00 ? 9  LEU A N    8 
ATOM 8461  C CA   . LEU A 1 9  ? -4.519  -16.470 -0.843  1.00 0.00 ? 9  LEU A CA   8 
ATOM 8462  C C    . LEU A 1 9  ? -4.745  -15.603 -2.075  1.00 0.00 ? 9  LEU A C    8 
ATOM 8463  O O    . LEU A 1 9  ? -5.077  -14.423 -1.954  1.00 0.00 ? 9  LEU A O    8 
ATOM 8464  C CB   . LEU A 1 9  ? -3.070  -16.967 -0.796  1.00 0.00 ? 9  LEU A CB   8 
ATOM 8465  C CG   . LEU A 1 9  ? -2.008  -15.886 -0.587  1.00 0.00 ? 9  LEU A CG   8 
ATOM 8466  C CD1  . LEU A 1 9  ? -0.657  -16.524 -0.302  1.00 0.00 ? 9  LEU A CD1  8 
ATOM 8467  C CD2  . LEU A 1 9  ? -1.919  -14.970 -1.800  1.00 0.00 ? 9  LEU A CD2  8 
ATOM 8468  H H    . LEU A 1 9  ? -5.110  -18.499 -0.969  1.00 0.00 ? 9  LEU A H    8 
ATOM 8469  H HA   . LEU A 1 9  ? -4.708  -15.872 0.035   1.00 0.00 ? 9  LEU A HA   8 
ATOM 8470  H HB2  . LEU A 1 9  ? -2.983  -17.676 0.012   1.00 0.00 ? 9  LEU A HB2  8 
ATOM 8471  H HB3  . LEU A 1 9  ? -2.855  -17.477 -1.724  1.00 0.00 ? 9  LEU A HB3  8 
ATOM 8472  H HG   . LEU A 1 9  ? -2.280  -15.284 0.269   1.00 0.00 ? 9  LEU A HG   8 
ATOM 8473  H HD11 . LEU A 1 9  ? -0.762  -17.597 -0.290  1.00 0.00 ? 9  LEU A HD11 8 
ATOM 8474  H HD12 . LEU A 1 9  ? 0.049   -16.239 -1.068  1.00 0.00 ? 9  LEU A HD12 8 
ATOM 8475  H HD13 . LEU A 1 9  ? -0.300  -16.190 0.659   1.00 0.00 ? 9  LEU A HD13 8 
ATOM 8476  H HD21 . LEU A 1 9  ? -2.074  -15.548 -2.699  1.00 0.00 ? 9  LEU A HD21 8 
ATOM 8477  H HD22 . LEU A 1 9  ? -2.676  -14.204 -1.728  1.00 0.00 ? 9  LEU A HD22 8 
ATOM 8478  H HD23 . LEU A 1 9  ? -0.942  -14.510 -1.832  1.00 0.00 ? 9  LEU A HD23 8 
ATOM 8479  N N    . TYR A 1 10 ? -4.581  -16.182 -3.268  1.00 0.00 ? 10 TYR A N    8 
ATOM 8480  C CA   . TYR A 1 10 ? -4.783  -15.416 -4.500  1.00 0.00 ? 10 TYR A CA   8 
ATOM 8481  C C    . TYR A 1 10 ? -6.133  -14.718 -4.448  1.00 0.00 ? 10 TYR A C    8 
ATOM 8482  O O    . TYR A 1 10 ? -6.254  -13.535 -4.766  1.00 0.00 ? 10 TYR A O    8 
ATOM 8483  C CB   . TYR A 1 10 ? -4.736  -16.310 -5.742  1.00 0.00 ? 10 TYR A CB   8 
ATOM 8484  C CG   . TYR A 1 10 ? -3.633  -17.345 -5.736  1.00 0.00 ? 10 TYR A CG   8 
ATOM 8485  C CD1  . TYR A 1 10 ? -2.385  -17.065 -5.194  1.00 0.00 ? 10 TYR A CD1  8 
ATOM 8486  C CD2  . TYR A 1 10 ? -3.839  -18.598 -6.295  1.00 0.00 ? 10 TYR A CD2  8 
ATOM 8487  C CE1  . TYR A 1 10 ? -1.378  -18.010 -5.205  1.00 0.00 ? 10 TYR A CE1  8 
ATOM 8488  C CE2  . TYR A 1 10 ? -2.838  -19.547 -6.309  1.00 0.00 ? 10 TYR A CE2  8 
ATOM 8489  C CZ   . TYR A 1 10 ? -1.610  -19.250 -5.762  1.00 0.00 ? 10 TYR A CZ   8 
ATOM 8490  O OH   . TYR A 1 10 ? -0.607  -20.194 -5.776  1.00 0.00 ? 10 TYR A OH   8 
ATOM 8491  H H    . TYR A 1 10 ? -4.327  -17.131 -3.319  1.00 0.00 ? 10 TYR A H    8 
ATOM 8492  H HA   . TYR A 1 10 ? -3.998  -14.668 -4.565  1.00 0.00 ? 10 TYR A HA   8 
ATOM 8493  H HB2  . TYR A 1 10 ? -5.676  -16.834 -5.829  1.00 0.00 ? 10 TYR A HB2  8 
ATOM 8494  H HB3  . TYR A 1 10 ? -4.601  -15.687 -6.615  1.00 0.00 ? 10 TYR A HB3  8 
ATOM 8495  H HD1  . TYR A 1 10 ? -2.210  -16.094 -4.752  1.00 0.00 ? 10 TYR A HD1  8 
ATOM 8496  H HD2  . TYR A 1 10 ? -4.804  -18.828 -6.726  1.00 0.00 ? 10 TYR A HD2  8 
ATOM 8497  H HE1  . TYR A 1 10 ? -0.414  -17.778 -4.778  1.00 0.00 ? 10 TYR A HE1  8 
ATOM 8498  H HE2  . TYR A 1 10 ? -3.021  -20.517 -6.748  1.00 0.00 ? 10 TYR A HE2  8 
ATOM 8499  H HH   . TYR A 1 10 ? 0.000   -20.031 -5.050  1.00 0.00 ? 10 TYR A HH   8 
ATOM 8500  N N    . MET A 1 11 ? -7.143  -15.470 -4.028  1.00 0.00 ? 11 MET A N    8 
ATOM 8501  C CA   . MET A 1 11 ? -8.494  -14.948 -3.910  1.00 0.00 ? 11 MET A CA   8 
ATOM 8502  C C    . MET A 1 11 ? -8.539  -13.883 -2.826  1.00 0.00 ? 11 MET A C    8 
ATOM 8503  O O    . MET A 1 11 ? -9.185  -12.845 -2.979  1.00 0.00 ? 11 MET A O    8 
ATOM 8504  C CB   . MET A 1 11 ? -9.459  -16.083 -3.578  1.00 0.00 ? 11 MET A CB   8 
ATOM 8505  C CG   . MET A 1 11 ? -10.923 -15.687 -3.678  1.00 0.00 ? 11 MET A CG   8 
ATOM 8506  S SD   . MET A 1 11 ? -12.038 -17.049 -3.288  1.00 0.00 ? 11 MET A SD   8 
ATOM 8507  C CE   . MET A 1 11 ? -13.628 -16.267 -3.548  1.00 0.00 ? 11 MET A CE   8 
ATOM 8508  H H    . MET A 1 11 ? -6.971  -16.404 -3.782  1.00 0.00 ? 11 MET A H    8 
ATOM 8509  H HA   . MET A 1 11 ? -8.770  -14.506 -4.857  1.00 0.00 ? 11 MET A HA   8 
ATOM 8510  H HB2  . MET A 1 11 ? -9.276  -16.902 -4.259  1.00 0.00 ? 11 MET A HB2  8 
ATOM 8511  H HB3  . MET A 1 11 ? -9.267  -16.417 -2.570  1.00 0.00 ? 11 MET A HB3  8 
ATOM 8512  H HG2  . MET A 1 11 ? -11.111 -14.879 -2.989  1.00 0.00 ? 11 MET A HG2  8 
ATOM 8513  H HG3  . MET A 1 11 ? -11.123 -15.354 -4.686  1.00 0.00 ? 11 MET A HG3  8 
ATOM 8514  H HE1  . MET A 1 11 ? -13.478 -15.245 -3.864  1.00 0.00 ? 11 MET A HE1  8 
ATOM 8515  H HE2  . MET A 1 11 ? -14.172 -16.803 -4.311  1.00 0.00 ? 11 MET A HE2  8 
ATOM 8516  H HE3  . MET A 1 11 ? -14.191 -16.281 -2.627  1.00 0.00 ? 11 MET A HE3  8 
ATOM 8517  N N    . ALA A 1 12 ? -7.826  -14.142 -1.735  1.00 0.00 ? 12 ALA A N    8 
ATOM 8518  C CA   . ALA A 1 12 ? -7.759  -13.204 -0.623  1.00 0.00 ? 12 ALA A CA   8 
ATOM 8519  C C    . ALA A 1 12 ? -7.229  -11.867 -1.095  1.00 0.00 ? 12 ALA A C    8 
ATOM 8520  O O    . ALA A 1 12 ? -7.623  -10.833 -0.583  1.00 0.00 ? 12 ALA A O    8 
ATOM 8521  C CB   . ALA A 1 12 ? -6.892  -13.756 0.499   1.00 0.00 ? 12 ALA A CB   8 
ATOM 8522  H H    . ALA A 1 12 ? -7.321  -14.982 -1.684  1.00 0.00 ? 12 ALA A H    8 
ATOM 8523  H HA   . ALA A 1 12 ? -8.761  -13.056 -0.241  1.00 0.00 ? 12 ALA A HA   8 
ATOM 8524  H HB1  . ALA A 1 12 ? -6.063  -14.307 0.078   1.00 0.00 ? 12 ALA A HB1  8 
ATOM 8525  H HB2  . ALA A 1 12 ? -6.515  -12.940 1.098   1.00 0.00 ? 12 ALA A HB2  8 
ATOM 8526  H HB3  . ALA A 1 12 ? -7.482  -14.414 1.120   1.00 0.00 ? 12 ALA A HB3  8 
ATOM 8527  N N    . ALA A 1 13 ? -6.347  -11.893 -2.086  1.00 0.00 ? 13 ALA A N    8 
ATOM 8528  C CA   . ALA A 1 13 ? -5.793  -10.667 -2.630  1.00 0.00 ? 13 ALA A CA   8 
ATOM 8529  C C    . ALA A 1 13 ? -6.886  -9.882  -3.343  1.00 0.00 ? 13 ALA A C    8 
ATOM 8530  O O    . ALA A 1 13 ? -6.939  -8.658  -3.263  1.00 0.00 ? 13 ALA A O    8 
ATOM 8531  C CB   . ALA A 1 13 ? -4.645  -10.974 -3.579  1.00 0.00 ? 13 ALA A CB   8 
ATOM 8532  H H    . ALA A 1 13 ? -6.075  -12.750 -2.466  1.00 0.00 ? 13 ALA A H    8 
ATOM 8533  H HA   . ALA A 1 13 ? -5.413  -10.074 -1.807  1.00 0.00 ? 13 ALA A HA   8 
ATOM 8534  H HB1  . ALA A 1 13 ? -4.912  -11.811 -4.207  1.00 0.00 ? 13 ALA A HB1  8 
ATOM 8535  H HB2  . ALA A 1 13 ? -4.446  -10.110 -4.197  1.00 0.00 ? 13 ALA A HB2  8 
ATOM 8536  H HB3  . ALA A 1 13 ? -3.762  -11.220 -3.008  1.00 0.00 ? 13 ALA A HB3  8 
ATOM 8537  N N    . ALA A 1 14 ? -7.774  -10.601 -4.024  1.00 0.00 ? 14 ALA A N    8 
ATOM 8538  C CA   . ALA A 1 14 ? -8.880  -9.967  -4.726  1.00 0.00 ? 14 ALA A CA   8 
ATOM 8539  C C    . ALA A 1 14 ? -9.801  -9.291  -3.722  1.00 0.00 ? 14 ALA A C    8 
ATOM 8540  O O    . ALA A 1 14 ? -10.090 -8.100  -3.828  1.00 0.00 ? 14 ALA A O    8 
ATOM 8541  C CB   . ALA A 1 14 ? -9.647  -10.989 -5.554  1.00 0.00 ? 14 ALA A CB   8 
ATOM 8542  H H    . ALA A 1 14 ? -7.692  -11.578 -4.038  1.00 0.00 ? 14 ALA A H    8 
ATOM 8543  H HA   . ALA A 1 14 ? -8.474  -9.221  -5.395  1.00 0.00 ? 14 ALA A HA   8 
ATOM 8544  H HB1  . ALA A 1 14 ? -8.950  -11.608 -6.099  1.00 0.00 ? 14 ALA A HB1  8 
ATOM 8545  H HB2  . ALA A 1 14 ? -10.243 -11.610 -4.899  1.00 0.00 ? 14 ALA A HB2  8 
ATOM 8546  H HB3  . ALA A 1 14 ? -10.294 -10.477 -6.249  1.00 0.00 ? 14 ALA A HB3  8 
ATOM 8547  N N    . VAL A 1 15 ? -10.238 -10.063 -2.731  1.00 0.00 ? 15 VAL A N    8 
ATOM 8548  C CA   . VAL A 1 15 ? -11.108 -9.547  -1.682  1.00 0.00 ? 15 VAL A CA   8 
ATOM 8549  C C    . VAL A 1 15 ? -10.376 -8.479  -0.875  1.00 0.00 ? 15 VAL A C    8 
ATOM 8550  O O    . VAL A 1 15 ? -10.944 -7.449  -0.527  1.00 0.00 ? 15 VAL A O    8 
ATOM 8551  C CB   . VAL A 1 15 ? -11.570 -10.673 -0.737  1.00 0.00 ? 15 VAL A CB   8 
ATOM 8552  C CG1  . VAL A 1 15 ? -12.530 -10.137 0.314   1.00 0.00 ? 15 VAL A CG1  8 
ATOM 8553  C CG2  . VAL A 1 15 ? -12.211 -11.802 -1.530  1.00 0.00 ? 15 VAL A CG2  8 
ATOM 8554  H H    . VAL A 1 15 ? -9.954  -11.001 -2.696  1.00 0.00 ? 15 VAL A H    8 
ATOM 8555  H HA   . VAL A 1 15 ? -11.980 -9.108  -2.149  1.00 0.00 ? 15 VAL A HA   8 
ATOM 8556  H HB   . VAL A 1 15 ? -10.701 -11.068 -0.230  1.00 0.00 ? 15 VAL A HB   8 
ATOM 8557  H HG11 . VAL A 1 15 ? -12.123 -9.237  0.750   1.00 0.00 ? 15 VAL A HG11 8 
ATOM 8558  H HG12 . VAL A 1 15 ? -13.482 -9.915  -0.147  1.00 0.00 ? 15 VAL A HG12 8 
ATOM 8559  H HG13 . VAL A 1 15 ? -12.669 -10.880 1.086   1.00 0.00 ? 15 VAL A HG13 8 
ATOM 8560  H HG21 . VAL A 1 15 ? -11.513 -12.160 -2.272  1.00 0.00 ? 15 VAL A HG21 8 
ATOM 8561  H HG22 . VAL A 1 15 ? -12.471 -12.609 -0.860  1.00 0.00 ? 15 VAL A HG22 8 
ATOM 8562  H HG23 . VAL A 1 15 ? -13.102 -11.437 -2.019  1.00 0.00 ? 15 VAL A HG23 8 
ATOM 8563  N N    . MET A 1 16 ? -9.104  -8.742  -0.595  1.00 0.00 ? 16 MET A N    8 
ATOM 8564  C CA   . MET A 1 16 ? -8.259  -7.818  0.164   1.00 0.00 ? 16 MET A CA   8 
ATOM 8565  C C    . MET A 1 16 ? -8.111  -6.475  -0.539  1.00 0.00 ? 16 MET A C    8 
ATOM 8566  O O    . MET A 1 16 ? -8.305  -5.421  0.065   1.00 0.00 ? 16 MET A O    8 
ATOM 8567  C CB   . MET A 1 16 ? -6.878  -8.440  0.389   1.00 0.00 ? 16 MET A CB   8 
ATOM 8568  C CG   . MET A 1 16 ? -6.820  -9.375  1.578   1.00 0.00 ? 16 MET A CG   8 
ATOM 8569  S SD   . MET A 1 16 ? -7.113  -8.527  3.142   1.00 0.00 ? 16 MET A SD   8 
ATOM 8570  C CE   . MET A 1 16 ? -5.807  -7.302  3.110   1.00 0.00 ? 16 MET A CE   8 
ATOM 8571  H H    . MET A 1 16 ? -8.719  -9.585  -0.910  1.00 0.00 ? 16 MET A H    8 
ATOM 8572  H HA   . MET A 1 16 ? -8.726  -7.649  1.115   1.00 0.00 ? 16 MET A HA   8 
ATOM 8573  H HB2  . MET A 1 16 ? -6.596  -8.994  -0.491  1.00 0.00 ? 16 MET A HB2  8 
ATOM 8574  H HB3  . MET A 1 16 ? -6.165  -7.664  0.544   1.00 0.00 ? 16 MET A HB3  8 
ATOM 8575  H HG2  . MET A 1 16 ? -7.571  -10.125 1.449   1.00 0.00 ? 16 MET A HG2  8 
ATOM 8576  H HG3  . MET A 1 16 ? -5.846  -9.838  1.609   1.00 0.00 ? 16 MET A HG3  8 
ATOM 8577  H HE1  . MET A 1 16 ? -5.039  -7.612  2.417   1.00 0.00 ? 16 MET A HE1  8 
ATOM 8578  H HE2  . MET A 1 16 ? -6.213  -6.351  2.796   1.00 0.00 ? 16 MET A HE2  8 
ATOM 8579  H HE3  . MET A 1 16 ? -5.382  -7.202  4.098   1.00 0.00 ? 16 MET A HE3  8 
ATOM 8580  N N    . MET A 1 17 ? -7.753  -6.523  -1.809  1.00 0.00 ? 17 MET A N    8 
ATOM 8581  C CA   . MET A 1 17 ? -7.568  -5.310  -2.596  1.00 0.00 ? 17 MET A CA   8 
ATOM 8582  C C    . MET A 1 17 ? -8.891  -4.578  -2.773  1.00 0.00 ? 17 MET A C    8 
ATOM 8583  O O    . MET A 1 17 ? -8.949  -3.350  -2.709  1.00 0.00 ? 17 MET A O    8 
ATOM 8584  C CB   . MET A 1 17 ? -6.961  -5.645  -3.960  1.00 0.00 ? 17 MET A CB   8 
ATOM 8585  C CG   . MET A 1 17 ? -5.548  -6.205  -3.880  1.00 0.00 ? 17 MET A CG   8 
ATOM 8586  S SD   . MET A 1 17 ? -4.353  -4.997  -3.279  1.00 0.00 ? 17 MET A SD   8 
ATOM 8587  C CE   . MET A 1 17 ? -2.853  -5.977  -3.285  1.00 0.00 ? 17 MET A CE   8 
ATOM 8588  H H    . MET A 1 17 ? -7.606  -7.393  -2.225  1.00 0.00 ? 17 MET A H    8 
ATOM 8589  H HA   . MET A 1 17 ? -6.884  -4.668  -2.057  1.00 0.00 ? 17 MET A HA   8 
ATOM 8590  H HB2  . MET A 1 17 ? -7.588  -6.375  -4.452  1.00 0.00 ? 17 MET A HB2  8 
ATOM 8591  H HB3  . MET A 1 17 ? -6.935  -4.746  -4.559  1.00 0.00 ? 17 MET A HB3  8 
ATOM 8592  H HG2  . MET A 1 17 ? -5.547  -7.048  -3.208  1.00 0.00 ? 17 MET A HG2  8 
ATOM 8593  H HG3  . MET A 1 17 ? -5.247  -6.530  -4.865  1.00 0.00 ? 17 MET A HG3  8 
ATOM 8594  H HE1  . MET A 1 17 ? -3.039  -6.916  -3.788  1.00 0.00 ? 17 MET A HE1  8 
ATOM 8595  H HE2  . MET A 1 17 ? -2.074  -5.440  -3.805  1.00 0.00 ? 17 MET A HE2  8 
ATOM 8596  H HE3  . MET A 1 17 ? -2.544  -6.169  -2.269  1.00 0.00 ? 17 MET A HE3  8 
ATOM 8597  N N    . GLY A 1 18 ? -9.958  -5.342  -2.988  1.00 0.00 ? 18 GLY A N    8 
ATOM 8598  C CA   . GLY A 1 18 ? -11.268 -4.749  -3.165  1.00 0.00 ? 18 GLY A CA   8 
ATOM 8599  C C    . GLY A 1 18 ? -11.800 -4.145  -1.883  1.00 0.00 ? 18 GLY A C    8 
ATOM 8600  O O    . GLY A 1 18 ? -12.216 -2.990  -1.863  1.00 0.00 ? 18 GLY A O    8 
ATOM 8601  H H    . GLY A 1 18 ? -9.854  -6.316  -3.020  1.00 0.00 ? 18 GLY A H    8 
ATOM 8602  H HA2  . GLY A 1 18 ? -11.203 -3.975  -3.917  1.00 0.00 ? 18 GLY A HA2  8 
ATOM 8603  H HA3  . GLY A 1 18 ? -11.956 -5.511  -3.505  1.00 0.00 ? 18 GLY A HA3  8 
ATOM 8604  N N    . LEU A 1 19 ? -11.782 -4.928  -0.810  1.00 0.00 ? 19 LEU A N    8 
ATOM 8605  C CA   . LEU A 1 19 ? -12.262 -4.463  0.485   1.00 0.00 ? 19 LEU A CA   8 
ATOM 8606  C C    . LEU A 1 19 ? -11.435 -3.273  0.944   1.00 0.00 ? 19 LEU A C    8 
ATOM 8607  O O    . LEU A 1 19 ? -11.971 -2.261  1.401   1.00 0.00 ? 19 LEU A O    8 
ATOM 8608  C CB   . LEU A 1 19 ? -12.194 -5.598  1.512   1.00 0.00 ? 19 LEU A CB   8 
ATOM 8609  C CG   . LEU A 1 19 ? -10.785 -6.030  1.926   1.00 0.00 ? 19 LEU A CG   8 
ATOM 8610  C CD1  . LEU A 1 19 ? -10.215 -5.085  2.977   1.00 0.00 ? 19 LEU A CD1  8 
ATOM 8611  C CD2  . LEU A 1 19 ? -10.799 -7.462  2.440   1.00 0.00 ? 19 LEU A CD2  8 
ATOM 8612  H H    . LEU A 1 19 ? -11.432 -5.836  -0.890  1.00 0.00 ? 19 LEU A H    8 
ATOM 8613  H HA   . LEU A 1 19 ? -13.290 -4.152  0.367   1.00 0.00 ? 19 LEU A HA   8 
ATOM 8614  H HB2  . LEU A 1 19 ? -12.724 -5.284  2.398   1.00 0.00 ? 19 LEU A HB2  8 
ATOM 8615  H HB3  . LEU A 1 19 ? -12.700 -6.458  1.098   1.00 0.00 ? 19 LEU A HB3  8 
ATOM 8616  H HG   . LEU A 1 19 ? -10.140 -5.990  1.061   1.00 0.00 ? 19 LEU A HG   8 
ATOM 8617  H HD11 . LEU A 1 19 ? -10.925 -4.296  3.176   1.00 0.00 ? 19 LEU A HD11 8 
ATOM 8618  H HD12 . LEU A 1 19 ? -10.021 -5.632  3.887   1.00 0.00 ? 19 LEU A HD12 8 
ATOM 8619  H HD13 . LEU A 1 19 ? -9.294  -4.656  2.612   1.00 0.00 ? 19 LEU A HD13 8 
ATOM 8620  H HD21 . LEU A 1 19 ? -11.724 -7.648  2.963   1.00 0.00 ? 19 LEU A HD21 8 
ATOM 8621  H HD22 . LEU A 1 19 ? -10.711 -8.144  1.607   1.00 0.00 ? 19 LEU A HD22 8 
ATOM 8622  H HD23 . LEU A 1 19 ? -9.968  -7.609  3.114   1.00 0.00 ? 19 LEU A HD23 8 
ATOM 8623  N N    . ALA A 1 20 ? -10.120 -3.393  0.794   1.00 0.00 ? 20 ALA A N    8 
ATOM 8624  C CA   . ALA A 1 20 ? -9.216  -2.321  1.164   1.00 0.00 ? 20 ALA A CA   8 
ATOM 8625  C C    . ALA A 1 20 ? -9.448  -1.132  0.249   1.00 0.00 ? 20 ALA A C    8 
ATOM 8626  O O    . ALA A 1 20 ? -9.308  0.017   0.656   1.00 0.00 ? 20 ALA A O    8 
ATOM 8627  C CB   . ALA A 1 20 ? -7.769  -2.788  1.086   1.00 0.00 ? 20 ALA A CB   8 
ATOM 8628  H H    . ALA A 1 20 ? -9.755  -4.215  0.405   1.00 0.00 ? 20 ALA A H    8 
ATOM 8629  H HA   . ALA A 1 20 ? -9.430  -2.033  2.183   1.00 0.00 ? 20 ALA A HA   8 
ATOM 8630  H HB1  . ALA A 1 20 ? -7.605  -3.295  0.146   1.00 0.00 ? 20 ALA A HB1  8 
ATOM 8631  H HB2  . ALA A 1 20 ? -7.111  -1.934  1.153   1.00 0.00 ? 20 ALA A HB2  8 
ATOM 8632  H HB3  . ALA A 1 20 ? -7.565  -3.466  1.901   1.00 0.00 ? 20 ALA A HB3  8 
ATOM 8633  N N    . ALA A 1 21 ? -9.824  -1.428  -0.993  1.00 0.00 ? 21 ALA A N    8 
ATOM 8634  C CA   . ALA A 1 21 ? -10.099 -0.389  -1.974  1.00 0.00 ? 21 ALA A CA   8 
ATOM 8635  C C    . ALA A 1 21 ? -11.332 0.401   -1.576  1.00 0.00 ? 21 ALA A C    8 
ATOM 8636  O O    . ALA A 1 21 ? -11.357 1.627   -1.666  1.00 0.00 ? 21 ALA A O    8 
ATOM 8637  C CB   . ALA A 1 21 ? -10.275 -0.994  -3.359  1.00 0.00 ? 21 ALA A CB   8 
ATOM 8638  H H    . ALA A 1 21 ? -9.930  -2.370  -1.250  1.00 0.00 ? 21 ALA A H    8 
ATOM 8639  H HA   . ALA A 1 21 ? -9.257  0.276   -1.998  1.00 0.00 ? 21 ALA A HA   8 
ATOM 8640  H HB1  . ALA A 1 21 ? -10.791 -1.938  -3.277  1.00 0.00 ? 21 ALA A HB1  8 
ATOM 8641  H HB2  . ALA A 1 21 ? -10.852 -0.320  -3.975  1.00 0.00 ? 21 ALA A HB2  8 
ATOM 8642  H HB3  . ALA A 1 21 ? -9.305  -1.151  -3.809  1.00 0.00 ? 21 ALA A HB3  8 
ATOM 8643  N N    . ILE A 1 22 ? -12.344 -0.313  -1.113  1.00 0.00 ? 22 ILE A N    8 
ATOM 8644  C CA   . ILE A 1 22 ? -13.581 0.317   -0.675  1.00 0.00 ? 22 ILE A CA   8 
ATOM 8645  C C    . ILE A 1 22 ? -13.305 1.217   0.521   1.00 0.00 ? 22 ILE A C    8 
ATOM 8646  O O    . ILE A 1 22 ? -13.520 2.425   0.461   1.00 0.00 ? 22 ILE A O    8 
ATOM 8647  C CB   . ILE A 1 22 ? -14.657 -0.719  -0.295  1.00 0.00 ? 22 ILE A CB   8 
ATOM 8648  C CG1  . ILE A 1 22 ? -14.938 -1.653  -1.470  1.00 0.00 ? 22 ILE A CG1  8 
ATOM 8649  C CG2  . ILE A 1 22 ? -15.939 -0.028  0.148   1.00 0.00 ? 22 ILE A CG2  8 
ATOM 8650  C CD1  . ILE A 1 22 ? -15.429 -0.937  -2.708  1.00 0.00 ? 22 ILE A CD1  8 
ATOM 8651  H H    . ILE A 1 22 ? -12.249 -1.284  -1.054  1.00 0.00 ? 22 ILE A H    8 
ATOM 8652  H HA   . ILE A 1 22 ? -13.957 0.918   -1.487  1.00 0.00 ? 22 ILE A HA   8 
ATOM 8653  H HB   . ILE A 1 22 ? -14.286 -1.297  0.535   1.00 0.00 ? 22 ILE A HB   8 
ATOM 8654  H HG12 . ILE A 1 22 ? -14.033 -2.175  -1.729  1.00 0.00 ? 22 ILE A HG12 8 
ATOM 8655  H HG13 . ILE A 1 22 ? -15.691 -2.371  -1.179  1.00 0.00 ? 22 ILE A HG13 8 
ATOM 8656  H HG21 . ILE A 1 22 ? -15.701 0.774   0.830   1.00 0.00 ? 22 ILE A HG21 8 
ATOM 8657  H HG22 . ILE A 1 22 ? -16.448 0.374   -0.716  1.00 0.00 ? 22 ILE A HG22 8 
ATOM 8658  H HG23 . ILE A 1 22 ? -16.580 -0.742  0.643   1.00 0.00 ? 22 ILE A HG23 8 
ATOM 8659  H HD11 . ILE A 1 22 ? -15.864 0.011   -2.428  1.00 0.00 ? 22 ILE A HD11 8 
ATOM 8660  H HD12 . ILE A 1 22 ? -14.600 -0.769  -3.379  1.00 0.00 ? 22 ILE A HD12 8 
ATOM 8661  H HD13 . ILE A 1 22 ? -16.175 -1.543  -3.203  1.00 0.00 ? 22 ILE A HD13 8 
ATOM 8662  N N    . GLY A 1 23 ? -12.809 0.622   1.602   1.00 0.00 ? 23 GLY A N    8 
ATOM 8663  C CA   . GLY A 1 23 ? -12.498 1.399   2.789   1.00 0.00 ? 23 GLY A CA   8 
ATOM 8664  C C    . GLY A 1 23 ? -11.516 2.512   2.486   1.00 0.00 ? 23 GLY A C    8 
ATOM 8665  O O    . GLY A 1 23 ? -11.704 3.654   2.912   1.00 0.00 ? 23 GLY A O    8 
ATOM 8666  H H    . GLY A 1 23 ? -12.643 -0.347  1.591   1.00 0.00 ? 23 GLY A H    8 
ATOM 8667  H HA2  . GLY A 1 23 ? -13.410 1.828   3.178   1.00 0.00 ? 23 GLY A HA2  8 
ATOM 8668  H HA3  . GLY A 1 23 ? -12.069 0.746   3.536   1.00 0.00 ? 23 GLY A HA3  8 
ATOM 8669  N N    . ALA A 1 24 ? -10.472 2.176   1.733   1.00 0.00 ? 24 ALA A N    8 
ATOM 8670  C CA   . ALA A 1 24 ? -9.458  3.149   1.356   1.00 0.00 ? 24 ALA A CA   8 
ATOM 8671  C C    . ALA A 1 24 ? -10.077 4.294   0.570   1.00 0.00 ? 24 ALA A C    8 
ATOM 8672  O O    . ALA A 1 24 ? -9.813  5.458   0.847   1.00 0.00 ? 24 ALA A O    8 
ATOM 8673  C CB   . ALA A 1 24 ? -8.361  2.487   0.537   1.00 0.00 ? 24 ALA A CB   8 
ATOM 8674  H H    . ALA A 1 24 ? -10.387 1.252   1.419   1.00 0.00 ? 24 ALA A H    8 
ATOM 8675  H HA   . ALA A 1 24 ? -9.015  3.542   2.259   1.00 0.00 ? 24 ALA A HA   8 
ATOM 8676  H HB1  . ALA A 1 24 ? -7.917  1.687   1.110   1.00 0.00 ? 24 ALA A HB1  8 
ATOM 8677  H HB2  . ALA A 1 24 ? -8.784  2.085   -0.372  1.00 0.00 ? 24 ALA A HB2  8 
ATOM 8678  H HB3  . ALA A 1 24 ? -7.605  3.217   0.289   1.00 0.00 ? 24 ALA A HB3  8 
ATOM 8679  N N    . ALA A 1 25 ? -10.904 3.957   -0.412  1.00 0.00 ? 25 ALA A N    8 
ATOM 8680  C CA   . ALA A 1 25 ? -11.558 4.970   -1.231  1.00 0.00 ? 25 ALA A CA   8 
ATOM 8681  C C    . ALA A 1 25 ? -12.405 5.901   -0.372  1.00 0.00 ? 25 ALA A C    8 
ATOM 8682  O O    . ALA A 1 25 ? -12.255 7.120   -0.423  1.00 0.00 ? 25 ALA A O    8 
ATOM 8683  C CB   . ALA A 1 25 ? -12.413 4.314   -2.304  1.00 0.00 ? 25 ALA A CB   8 
ATOM 8684  H H    . ALA A 1 25 ? -11.081 3.009   -0.589  1.00 0.00 ? 25 ALA A H    8 
ATOM 8685  H HA   . ALA A 1 25 ? -10.788 5.549   -1.721  1.00 0.00 ? 25 ALA A HA   8 
ATOM 8686  H HB1  . ALA A 1 25 ? -11.837 3.549   -2.805  1.00 0.00 ? 25 ALA A HB1  8 
ATOM 8687  H HB2  . ALA A 1 25 ? -13.284 3.869   -1.848  1.00 0.00 ? 25 ALA A HB2  8 
ATOM 8688  H HB3  . ALA A 1 25 ? -12.723 5.059   -3.021  1.00 0.00 ? 25 ALA A HB3  8 
ATOM 8689  N N    . ILE A 1 26 ? -13.290 5.321   0.429   1.00 0.00 ? 26 ILE A N    8 
ATOM 8690  C CA   . ILE A 1 26 ? -14.152 6.106   1.301   1.00 0.00 ? 26 ILE A CA   8 
ATOM 8691  C C    . ILE A 1 26 ? -13.344 7.092   2.144   1.00 0.00 ? 26 ILE A C    8 
ATOM 8692  O O    . ILE A 1 26 ? -13.567 8.299   2.077   1.00 0.00 ? 26 ILE A O    8 
ATOM 8693  C CB   . ILE A 1 26 ? -14.986 5.203   2.234   1.00 0.00 ? 26 ILE A CB   8 
ATOM 8694  C CG1  . ILE A 1 26 ? -15.840 4.234   1.414   1.00 0.00 ? 26 ILE A CG1  8 
ATOM 8695  C CG2  . ILE A 1 26 ? -15.873 6.041   3.149   1.00 0.00 ? 26 ILE A CG2  8 
ATOM 8696  C CD1  . ILE A 1 26 ? -16.627 3.259   2.262   1.00 0.00 ? 26 ILE A CD1  8 
ATOM 8697  H H    . ILE A 1 26 ? -13.361 4.344   0.436   1.00 0.00 ? 26 ILE A H    8 
ATOM 8698  H HA   . ILE A 1 26 ? -14.835 6.660   0.676   1.00 0.00 ? 26 ILE A HA   8 
ATOM 8699  H HB   . ILE A 1 26 ? -14.306 4.641   2.849   1.00 0.00 ? 26 ILE A HB   8 
ATOM 8700  H HG12 . ILE A 1 26 ? -16.543 4.798   0.821   1.00 0.00 ? 26 ILE A HG12 8 
ATOM 8701  H HG13 . ILE A 1 26 ? -15.199 3.665   0.759   1.00 0.00 ? 26 ILE A HG13 8 
ATOM 8702  H HG21 . ILE A 1 26 ? -15.576 7.078   3.090   1.00 0.00 ? 26 ILE A HG21 8 
ATOM 8703  H HG22 . ILE A 1 26 ? -16.903 5.945   2.840   1.00 0.00 ? 26 ILE A HG22 8 
ATOM 8704  H HG23 . ILE A 1 26 ? -15.768 5.696   4.166   1.00 0.00 ? 26 ILE A HG23 8 
ATOM 8705  H HD11 . ILE A 1 26 ? -16.110 3.097   3.198   1.00 0.00 ? 26 ILE A HD11 8 
ATOM 8706  H HD12 . ILE A 1 26 ? -17.608 3.663   2.459   1.00 0.00 ? 26 ILE A HD12 8 
ATOM 8707  H HD13 . ILE A 1 26 ? -16.721 2.320   1.738   1.00 0.00 ? 26 ILE A HD13 8 
ATOM 8708  N N    . GLY A 1 27 ? -12.413 6.576   2.946   1.00 0.00 ? 27 GLY A N    8 
ATOM 8709  C CA   . GLY A 1 27 ? -11.611 7.443   3.797   1.00 0.00 ? 27 GLY A CA   8 
ATOM 8710  C C    . GLY A 1 27 ? -10.701 8.375   3.020   1.00 0.00 ? 27 GLY A C    8 
ATOM 8711  O O    . GLY A 1 27 ? -10.609 9.559   3.340   1.00 0.00 ? 27 GLY A O    8 
ATOM 8712  H H    . GLY A 1 27 ? -12.279 5.603   2.969   1.00 0.00 ? 27 GLY A H    8 
ATOM 8713  H HA2  . GLY A 1 27 ? -12.277 8.041   4.403   1.00 0.00 ? 27 GLY A HA2  8 
ATOM 8714  H HA3  . GLY A 1 27 ? -11.010 6.839   4.452   1.00 0.00 ? 27 GLY A HA3  8 
ATOM 8715  N N    . ILE A 1 28 ? -10.021 7.854   1.996   1.00 0.00 ? 28 ILE A N    8 
ATOM 8716  C CA   . ILE A 1 28 ? -9.125  8.684   1.194   1.00 0.00 ? 28 ILE A CA   8 
ATOM 8717  C C    . ILE A 1 28 ? -9.868  9.943   0.791   1.00 0.00 ? 28 ILE A C    8 
ATOM 8718  O O    . ILE A 1 28 ? -9.386  11.057  0.970   1.00 0.00 ? 28 ILE A O    8 
ATOM 8719  C CB   . ILE A 1 28 ? -8.590  7.932   -0.055  1.00 0.00 ? 28 ILE A CB   8 
ATOM 8720  C CG1  . ILE A 1 28 ? -7.200  8.447   -0.442  1.00 0.00 ? 28 ILE A CG1  8 
ATOM 8721  C CG2  . ILE A 1 28 ? -9.538  8.045   -1.244  1.00 0.00 ? 28 ILE A CG2  8 
ATOM 8722  C CD1  . ILE A 1 28 ? -7.199  9.841   -1.036  1.00 0.00 ? 28 ILE A CD1  8 
ATOM 8723  H H    . ILE A 1 28 ? -10.127 6.907   1.780   1.00 0.00 ? 28 ILE A H    8 
ATOM 8724  H HA   . ILE A 1 28 ? -8.287  8.961   1.815   1.00 0.00 ? 28 ILE A HA   8 
ATOM 8725  H HB   . ILE A 1 28 ? -8.515  6.893   0.198   1.00 0.00 ? 28 ILE A HB   8 
ATOM 8726  H HG12 . ILE A 1 28 ? -6.576  8.464   0.439   1.00 0.00 ? 28 ILE A HG12 8 
ATOM 8727  H HG13 . ILE A 1 28 ? -6.767  7.777   -1.170  1.00 0.00 ? 28 ILE A HG13 8 
ATOM 8728  H HG21 . ILE A 1 28 ? -9.681  9.084   -1.496  1.00 0.00 ? 28 ILE A HG21 8 
ATOM 8729  H HG22 . ILE A 1 28 ? -9.116  7.526   -2.091  1.00 0.00 ? 28 ILE A HG22 8 
ATOM 8730  H HG23 . ILE A 1 28 ? -10.487 7.602   -0.990  1.00 0.00 ? 28 ILE A HG23 8 
ATOM 8731  H HD11 . ILE A 1 28 ? -8.165  10.299  -0.885  1.00 0.00 ? 28 ILE A HD11 8 
ATOM 8732  H HD12 . ILE A 1 28 ? -6.438  10.437  -0.554  1.00 0.00 ? 28 ILE A HD12 8 
ATOM 8733  H HD13 . ILE A 1 28 ? -6.992  9.779   -2.094  1.00 0.00 ? 28 ILE A HD13 8 
ATOM 8734  N N    . GLY A 1 29 ? -11.078 9.740   0.307   1.00 0.00 ? 29 GLY A N    8 
ATOM 8735  C CA   . GLY A 1 29 ? -11.921 10.854  -0.064  1.00 0.00 ? 29 GLY A CA   8 
ATOM 8736  C C    . GLY A 1 29 ? -12.263 11.700  1.146   1.00 0.00 ? 29 GLY A C    8 
ATOM 8737  O O    . GLY A 1 29 ? -12.268 12.928  1.075   1.00 0.00 ? 29 GLY A O    8 
ATOM 8738  H H    . GLY A 1 29 ? -11.411 8.820   0.236   1.00 0.00 ? 29 GLY A H    8 
ATOM 8739  H HA2  . GLY A 1 29 ? -11.402 11.465  -0.791  1.00 0.00 ? 29 GLY A HA2  8 
ATOM 8740  H HA3  . GLY A 1 29 ? -12.835 10.480  -0.502  1.00 0.00 ? 29 GLY A HA3  8 
ATOM 8741  N N    . ILE A 1 30 ? -12.536 11.033  2.270   1.00 0.00 ? 30 ILE A N    8 
ATOM 8742  C CA   . ILE A 1 30 ? -12.865 11.727  3.512   1.00 0.00 ? 30 ILE A CA   8 
ATOM 8743  C C    . ILE A 1 30 ? -11.753 12.704  3.903   1.00 0.00 ? 30 ILE A C    8 
ATOM 8744  O O    . ILE A 1 30 ? -11.900 13.917  3.758   1.00 0.00 ? 30 ILE A O    8 
ATOM 8745  C CB   . ILE A 1 30 ? -13.114 10.723  4.667   1.00 0.00 ? 30 ILE A CB   8 
ATOM 8746  C CG1  . ILE A 1 30 ? -14.315 9.843   4.337   1.00 0.00 ? 30 ILE A CG1  8 
ATOM 8747  C CG2  . ILE A 1 30 ? -13.347 11.449  5.986   1.00 0.00 ? 30 ILE A CG2  8 
ATOM 8748  C CD1  . ILE A 1 30 ? -15.606 10.614  4.174   1.00 0.00 ? 30 ILE A CD1  8 
ATOM 8749  H H    . ILE A 1 30 ? -12.505 10.049  2.265   1.00 0.00 ? 30 ILE A H    8 
ATOM 8750  H HA   . ILE A 1 30 ? -13.777 12.286  3.347   1.00 0.00 ? 30 ILE A HA   8 
ATOM 8751  H HB   . ILE A 1 30 ? -12.238 10.092  4.776   1.00 0.00 ? 30 ILE A HB   8 
ATOM 8752  H HG12 . ILE A 1 30 ? -14.124 9.326   3.416   1.00 0.00 ? 30 ILE A HG12 8 
ATOM 8753  H HG13 . ILE A 1 30 ? -14.455 9.121   5.130   1.00 0.00 ? 30 ILE A HG13 8 
ATOM 8754  H HG21 . ILE A 1 30 ? -12.621 12.238  6.098   1.00 0.00 ? 30 ILE A HG21 8 
ATOM 8755  H HG22 . ILE A 1 30 ? -14.341 11.870  5.995   1.00 0.00 ? 30 ILE A HG22 8 
ATOM 8756  H HG23 . ILE A 1 30 ? -13.246 10.751  6.803   1.00 0.00 ? 30 ILE A HG23 8 
ATOM 8757  H HD11 . ILE A 1 30 ? -15.573 11.506  4.781   1.00 0.00 ? 30 ILE A HD11 8 
ATOM 8758  H HD12 . ILE A 1 30 ? -15.732 10.887  3.137   1.00 0.00 ? 30 ILE A HD12 8 
ATOM 8759  H HD13 . ILE A 1 30 ? -16.436 9.997   4.487   1.00 0.00 ? 30 ILE A HD13 8 
ATOM 8760  N N    . LEU A 1 31 ? -10.638 12.163  4.391   1.00 0.00 ? 31 LEU A N    8 
ATOM 8761  C CA   . LEU A 1 31 ? -9.498  12.982  4.801   1.00 0.00 ? 31 LEU A CA   8 
ATOM 8762  C C    . LEU A 1 31 ? -8.858  13.663  3.599   1.00 0.00 ? 31 LEU A C    8 
ATOM 8763  O O    . LEU A 1 31 ? -8.525  14.848  3.650   1.00 0.00 ? 31 LEU A O    8 
ATOM 8764  C CB   . LEU A 1 31 ? -8.460  12.113  5.514   1.00 0.00 ? 31 LEU A CB   8 
ATOM 8765  C CG   . LEU A 1 31 ? -7.184  12.840  5.939   1.00 0.00 ? 31 LEU A CG   8 
ATOM 8766  C CD1  . LEU A 1 31 ? -7.501  13.925  6.955   1.00 0.00 ? 31 LEU A CD1  8 
ATOM 8767  C CD2  . LEU A 1 31 ? -6.174  11.853  6.505   1.00 0.00 ? 31 LEU A CD2  8 
ATOM 8768  H H    . LEU A 1 31 ? -10.580 11.189  4.476   1.00 0.00 ? 31 LEU A H    8 
ATOM 8769  H HA   . LEU A 1 31 ? -9.857  13.747  5.487   1.00 0.00 ? 31 LEU A HA   8 
ATOM 8770  H HB2  . LEU A 1 31 ? -8.920  11.690  6.396   1.00 0.00 ? 31 LEU A HB2  8 
ATOM 8771  H HB3  . LEU A 1 31 ? -8.182  11.305  4.852   1.00 0.00 ? 31 LEU A HB3  8 
ATOM 8772  H HG   . LEU A 1 31 ? -6.742  13.313  5.075   1.00 0.00 ? 31 LEU A HG   8 
ATOM 8773  H HD11 . LEU A 1 31 ? -8.334  13.612  7.567   1.00 0.00 ? 31 LEU A HD11 8 
ATOM 8774  H HD12 . LEU A 1 31 ? -6.639  14.095  7.582   1.00 0.00 ? 31 LEU A HD12 8 
ATOM 8775  H HD13 . LEU A 1 31 ? -7.757  14.838  6.439   1.00 0.00 ? 31 LEU A HD13 8 
ATOM 8776  H HD21 . LEU A 1 31 ? -6.694  10.996  6.908   1.00 0.00 ? 31 LEU A HD21 8 
ATOM 8777  H HD22 . LEU A 1 31 ? -5.506  11.531  5.720   1.00 0.00 ? 31 LEU A HD22 8 
ATOM 8778  H HD23 . LEU A 1 31 ? -5.604  12.329  7.289   1.00 0.00 ? 31 LEU A HD23 8 
ATOM 8779  N N    . GLY A 1 32 ? -8.683  12.911  2.518   1.00 0.00 ? 32 GLY A N    8 
ATOM 8780  C CA   . GLY A 1 32 ? -8.081  13.470  1.322   1.00 0.00 ? 32 GLY A CA   8 
ATOM 8781  C C    . GLY A 1 32 ? -8.788  14.732  0.882   1.00 0.00 ? 32 GLY A C    8 
ATOM 8782  O O    . GLY A 1 32 ? -8.148  15.720  0.538   1.00 0.00 ? 32 GLY A O    8 
ATOM 8783  H H    . GLY A 1 32 ? -8.965  11.972  2.531   1.00 0.00 ? 32 GLY A H    8 
ATOM 8784  H HA2  . GLY A 1 32 ? -7.045  13.699  1.524   1.00 0.00 ? 32 GLY A HA2  8 
ATOM 8785  H HA3  . GLY A 1 32 ? -8.130  12.745  0.522   1.00 0.00 ? 32 GLY A HA3  8 
ATOM 8786  N N    . GLY A 1 33 ? -10.117 14.699  0.909   1.00 0.00 ? 33 GLY A N    8 
ATOM 8787  C CA   . GLY A 1 33 ? -10.895 15.857  0.518   1.00 0.00 ? 33 GLY A CA   8 
ATOM 8788  C C    . GLY A 1 33 ? -10.635 17.053  1.413   1.00 0.00 ? 33 GLY A C    8 
ATOM 8789  O O    . GLY A 1 33 ? -10.281 18.126  0.934   1.00 0.00 ? 33 GLY A O    8 
ATOM 8790  H H    . GLY A 1 33 ? -10.572 13.882  1.204   1.00 0.00 ? 33 GLY A H    8 
ATOM 8791  H HA2  . GLY A 1 33 ? -10.643 16.121  -0.500  1.00 0.00 ? 33 GLY A HA2  8 
ATOM 8792  H HA3  . GLY A 1 33 ? -11.944 15.608  0.564   1.00 0.00 ? 33 GLY A HA3  8 
ATOM 8793  N N    . LYS A 1 34 ? -10.816 16.866  2.719   1.00 0.00 ? 34 LYS A N    8 
ATOM 8794  C CA   . LYS A 1 34 ? -10.604 17.943  3.682   1.00 0.00 ? 34 LYS A CA   8 
ATOM 8795  C C    . LYS A 1 34 ? -9.185  18.498  3.590   1.00 0.00 ? 34 LYS A C    8 
ATOM 8796  O O    . LYS A 1 34 ? -8.983  19.714  3.460   1.00 0.00 ? 34 LYS A O    8 
ATOM 8797  C CB   . LYS A 1 34 ? -10.894 17.451  5.108   1.00 0.00 ? 34 LYS A CB   8 
ATOM 8798  C CG   . LYS A 1 34 ? -10.054 16.270  5.561   1.00 0.00 ? 34 LYS A CG   8 
ATOM 8799  C CD   . LYS A 1 34 ? -10.355 15.902  7.009   1.00 0.00 ? 34 LYS A CD   8 
ATOM 8800  C CE   . LYS A 1 34 ? -11.844 15.700  7.248   1.00 0.00 ? 34 LYS A CE   8 
ATOM 8801  N NZ   . LYS A 1 34 ? -12.393 14.591  6.424   1.00 0.00 ? 34 LYS A NZ   8 
ATOM 8802  H H    . LYS A 1 34 ? -11.102 15.985  3.041   1.00 0.00 ? 34 LYS A H    8 
ATOM 8803  H HA   . LYS A 1 34 ? -11.296 18.735  3.441   1.00 0.00 ? 34 LYS A HA   8 
ATOM 8804  H HB2  . LYS A 1 34 ? -10.720 18.256  5.796   1.00 0.00 ? 34 LYS A HB2  8 
ATOM 8805  H HB3  . LYS A 1 34 ? -11.931 17.161  5.165   1.00 0.00 ? 34 LYS A HB3  8 
ATOM 8806  H HG2  . LYS A 1 34 ? -10.267 15.424  4.929   1.00 0.00 ? 34 LYS A HG2  8 
ATOM 8807  H HG3  . LYS A 1 34 ? -9.010  16.532  5.482   1.00 0.00 ? 34 LYS A HG3  8 
ATOM 8808  H HD2  . LYS A 1 34 ? -9.837  14.986  7.250   1.00 0.00 ? 34 LYS A HD2  8 
ATOM 8809  H HD3  . LYS A 1 34 ? -10.000 16.695  7.652   1.00 0.00 ? 34 LYS A HD3  8 
ATOM 8810  H HE2  . LYS A 1 34 ? -12.000 15.473  8.292   1.00 0.00 ? 34 LYS A HE2  8 
ATOM 8811  H HE3  . LYS A 1 34 ? -12.362 16.615  6.998   1.00 0.00 ? 34 LYS A HE3  8 
ATOM 8812  H HZ1  . LYS A 1 34 ? -11.669 13.859  6.285   1.00 0.00 ? 34 LYS A HZ1  8 
ATOM 8813  H HZ2  . LYS A 1 34 ? -13.215 14.166  6.899   1.00 0.00 ? 34 LYS A HZ2  8 
ATOM 8814  H HZ3  . LYS A 1 34 ? -12.691 14.949  5.494   1.00 0.00 ? 34 LYS A HZ3  8 
ATOM 8815  N N    . PHE A 1 35 ? -8.202  17.609  3.657   1.00 0.00 ? 35 PHE A N    8 
ATOM 8816  C CA   . PHE A 1 35 ? -6.809  18.015  3.586   1.00 0.00 ? 35 PHE A CA   8 
ATOM 8817  C C    . PHE A 1 35 ? -6.532  18.666  2.238   1.00 0.00 ? 35 PHE A C    8 
ATOM 8818  O O    . PHE A 1 35 ? -6.062  19.802  2.165   1.00 0.00 ? 35 PHE A O    8 
ATOM 8819  C CB   . PHE A 1 35 ? -5.890  16.810  3.797   1.00 0.00 ? 35 PHE A CB   8 
ATOM 8820  C CG   . PHE A 1 35 ? -4.584  17.173  4.439   1.00 0.00 ? 35 PHE A CG   8 
ATOM 8821  C CD1  . PHE A 1 35 ? -3.732  18.079  3.837   1.00 0.00 ? 35 PHE A CD1  8 
ATOM 8822  C CD2  . PHE A 1 35 ? -4.215  16.617  5.654   1.00 0.00 ? 35 PHE A CD2  8 
ATOM 8823  C CE1  . PHE A 1 35 ? -2.535  18.428  4.431   1.00 0.00 ? 35 PHE A CE1  8 
ATOM 8824  C CE2  . PHE A 1 35 ? -3.019  16.960  6.253   1.00 0.00 ? 35 PHE A CE2  8 
ATOM 8825  C CZ   . PHE A 1 35 ? -2.178  17.868  5.641   1.00 0.00 ? 35 PHE A CZ   8 
ATOM 8826  H H    . PHE A 1 35 ? -8.422  16.659  3.757   1.00 0.00 ? 35 PHE A H    8 
ATOM 8827  H HA   . PHE A 1 35 ? -6.628  18.740  4.373   1.00 0.00 ? 35 PHE A HA   8 
ATOM 8828  H HB2  . PHE A 1 35 ? -6.387  16.092  4.432   1.00 0.00 ? 35 PHE A HB2  8 
ATOM 8829  H HB3  . PHE A 1 35 ? -5.678  16.355  2.841   1.00 0.00 ? 35 PHE A HB3  8 
ATOM 8830  H HD1  . PHE A 1 35 ? -4.013  18.519  2.892   1.00 0.00 ? 35 PHE A HD1  8 
ATOM 8831  H HD2  . PHE A 1 35 ? -4.872  15.908  6.133   1.00 0.00 ? 35 PHE A HD2  8 
ATOM 8832  H HE1  . PHE A 1 35 ? -1.880  19.138  3.950   1.00 0.00 ? 35 PHE A HE1  8 
ATOM 8833  H HE2  . PHE A 1 35 ? -2.741  16.520  7.199   1.00 0.00 ? 35 PHE A HE2  8 
ATOM 8834  H HZ   . PHE A 1 35 ? -1.243  18.140  6.108   1.00 0.00 ? 35 PHE A HZ   8 
ATOM 8835  N N    . LEU A 1 36 ? -6.858  17.943  1.169   1.00 0.00 ? 36 LEU A N    8 
ATOM 8836  C CA   . LEU A 1 36 ? -6.670  18.449  -0.186  1.00 0.00 ? 36 LEU A CA   8 
ATOM 8837  C C    . LEU A 1 36 ? -7.332  19.812  -0.338  1.00 0.00 ? 36 LEU A C    8 
ATOM 8838  O O    . LEU A 1 36 ? -6.785  20.706  -0.976  1.00 0.00 ? 36 LEU A O    8 
ATOM 8839  C CB   . LEU A 1 36 ? -7.251  17.473  -1.211  1.00 0.00 ? 36 LEU A CB   8 
ATOM 8840  C CG   . LEU A 1 36 ? -7.062  17.877  -2.674  1.00 0.00 ? 36 LEU A CG   8 
ATOM 8841  C CD1  . LEU A 1 36 ? -5.584  18.012  -3.003  1.00 0.00 ? 36 LEU A CD1  8 
ATOM 8842  C CD2  . LEU A 1 36 ? -7.726  16.864  -3.597  1.00 0.00 ? 36 LEU A CD2  8 
ATOM 8843  H H    . LEU A 1 36 ? -7.246  17.054  1.296   1.00 0.00 ? 36 LEU A H    8 
ATOM 8844  H HA   . LEU A 1 36 ? -5.608  18.554  -0.359  1.00 0.00 ? 36 LEU A HA   8 
ATOM 8845  H HB2  . LEU A 1 36 ? -6.787  16.508  -1.062  1.00 0.00 ? 36 LEU A HB2  8 
ATOM 8846  H HB3  . LEU A 1 36 ? -8.311  17.375  -1.025  1.00 0.00 ? 36 LEU A HB3  8 
ATOM 8847  H HG   . LEU A 1 36 ? -7.529  18.837  -2.838  1.00 0.00 ? 36 LEU A HG   8 
ATOM 8848  H HD11 . LEU A 1 36 ? -5.037  17.203  -2.541  1.00 0.00 ? 36 LEU A HD11 8 
ATOM 8849  H HD12 . LEU A 1 36 ? -5.448  17.975  -4.073  1.00 0.00 ? 36 LEU A HD12 8 
ATOM 8850  H HD13 . LEU A 1 36 ? -5.217  18.955  -2.626  1.00 0.00 ? 36 LEU A HD13 8 
ATOM 8851  H HD21 . LEU A 1 36 ? -8.406  16.248  -3.026  1.00 0.00 ? 36 LEU A HD21 8 
ATOM 8852  H HD22 . LEU A 1 36 ? -8.274  17.385  -4.368  1.00 0.00 ? 36 LEU A HD22 8 
ATOM 8853  H HD23 . LEU A 1 36 ? -6.970  16.240  -4.050  1.00 0.00 ? 36 LEU A HD23 8 
ATOM 8854  N N    . GLU A 1 37 ? -8.512  19.967  0.266   1.00 0.00 ? 37 GLU A N    8 
ATOM 8855  C CA   . GLU A 1 37 ? -9.240  21.230  0.201   1.00 0.00 ? 37 GLU A CA   8 
ATOM 8856  C C    . GLU A 1 37 ? -8.372  22.348  0.762   1.00 0.00 ? 37 GLU A C    8 
ATOM 8857  O O    . GLU A 1 37 ? -7.976  23.266  0.040   1.00 0.00 ? 37 GLU A O    8 
ATOM 8858  C CB   . GLU A 1 37 ? -10.553 21.136  0.989   1.00 0.00 ? 37 GLU A CB   8 
ATOM 8859  C CG   . GLU A 1 37 ? -11.576 22.213  0.642   1.00 0.00 ? 37 GLU A CG   8 
ATOM 8860  C CD   . GLU A 1 37 ? -11.062 23.626  0.850   1.00 0.00 ? 37 GLU A CD   8 
ATOM 8861  O OE1  . GLU A 1 37 ? -10.242 24.089  0.031   1.00 0.00 ? 37 GLU A OE1  8 
ATOM 8862  O OE2  . GLU A 1 37 ? -11.481 24.269  1.836   1.00 0.00 ? 37 GLU A OE2  8 
ATOM 8863  H H    . GLU A 1 37 ? -8.894  19.220  0.770   1.00 0.00 ? 37 GLU A H    8 
ATOM 8864  H HA   . GLU A 1 37 ? -9.460  21.439  -0.838  1.00 0.00 ? 37 GLU A HA   8 
ATOM 8865  H HB2  . GLU A 1 37 ? -11.005 20.176  0.796   1.00 0.00 ? 37 GLU A HB2  8 
ATOM 8866  H HB3  . GLU A 1 37 ? -10.331 21.214  2.043   1.00 0.00 ? 37 GLU A HB3  8 
ATOM 8867  H HG2  . GLU A 1 37 ? -11.855 22.102  -0.394  1.00 0.00 ? 37 GLU A HG2  8 
ATOM 8868  H HG3  . GLU A 1 37 ? -12.449 22.071  1.263   1.00 0.00 ? 37 GLU A HG3  8 
ATOM 8869  N N    . GLY A 1 38 ? -8.059  22.258  2.054   1.00 0.00 ? 38 GLY A N    8 
ATOM 8870  C CA   . GLY A 1 38 ? -7.220  23.272  2.672   1.00 0.00 ? 38 GLY A CA   8 
ATOM 8871  C C    . GLY A 1 38 ? -5.939  23.490  1.888   1.00 0.00 ? 38 GLY A C    8 
ATOM 8872  O O    . GLY A 1 38 ? -5.619  24.615  1.490   1.00 0.00 ? 38 GLY A O    8 
ATOM 8873  H H    . GLY A 1 38 ? -8.389  21.496  2.584   1.00 0.00 ? 38 GLY A H    8 
ATOM 8874  H HA2  . GLY A 1 38 ? -7.770  24.202  2.717   1.00 0.00 ? 38 GLY A HA2  8 
ATOM 8875  H HA3  . GLY A 1 38 ? -6.971  22.961  3.676   1.00 0.00 ? 38 GLY A HA3  8 
ATOM 8876  N N    . ALA A 1 39 ? -5.211  22.404  1.651   1.00 0.00 ? 39 ALA A N    8 
ATOM 8877  C CA   . ALA A 1 39 ? -3.966  22.468  0.899   1.00 0.00 ? 39 ALA A CA   8 
ATOM 8878  C C    . ALA A 1 39 ? -4.209  23.040  -0.492  1.00 0.00 ? 39 ALA A C    8 
ATOM 8879  O O    . ALA A 1 39 ? -3.343  23.700  -1.065  1.00 0.00 ? 39 ALA A O    8 
ATOM 8880  C CB   . ALA A 1 39 ? -3.340  21.088  0.802   1.00 0.00 ? 39 ALA A CB   8 
ATOM 8881  H H    . ALA A 1 39 ? -5.526  21.537  1.981   1.00 0.00 ? 39 ALA A H    8 
ATOM 8882  H HA   . ALA A 1 39 ? -3.283  23.114  1.434   1.00 0.00 ? 39 ALA A HA   8 
ATOM 8883  H HB1  . ALA A 1 39 ? -3.344  20.620  1.776   1.00 0.00 ? 39 ALA A HB1  8 
ATOM 8884  H HB2  . ALA A 1 39 ? -3.910  20.485  0.111   1.00 0.00 ? 39 ALA A HB2  8 
ATOM 8885  H HB3  . ALA A 1 39 ? -2.323  21.176  0.450   1.00 0.00 ? 39 ALA A HB3  8 
ATOM 8886  N N    . ALA A 1 40 ? -5.398  22.785  -1.029  1.00 0.00 ? 40 ALA A N    8 
ATOM 8887  C CA   . ALA A 1 40 ? -5.756  23.284  -2.349  1.00 0.00 ? 40 ALA A CA   8 
ATOM 8888  C C    . ALA A 1 40 ? -5.976  24.788  -2.294  1.00 0.00 ? 40 ALA A C    8 
ATOM 8889  O O    . ALA A 1 40 ? -5.745  25.499  -3.272  1.00 0.00 ? 40 ALA A O    8 
ATOM 8890  C CB   . ALA A 1 40 ? -6.997  22.578  -2.875  1.00 0.00 ? 40 ALA A CB   8 
ATOM 8891  H H    . ALA A 1 40 ? -6.050  22.256  -0.524  1.00 0.00 ? 40 ALA A H    8 
ATOM 8892  H HA   . ALA A 1 40 ? -4.935  23.073  -3.019  1.00 0.00 ? 40 ALA A HA   8 
ATOM 8893  H HB1  . ALA A 1 40 ? -7.792  22.653  -2.149  1.00 0.00 ? 40 ALA A HB1  8 
ATOM 8894  H HB2  . ALA A 1 40 ? -7.310  23.041  -3.800  1.00 0.00 ? 40 ALA A HB2  8 
ATOM 8895  H HB3  . ALA A 1 40 ? -6.769  21.536  -3.055  1.00 0.00 ? 40 ALA A HB3  8 
ATOM 8896  N N    . ARG A 1 41 ? -6.403  25.271  -1.130  1.00 0.00 ? 41 ARG A N    8 
ATOM 8897  C CA   . ARG A 1 41 ? -6.628  26.697  -0.934  1.00 0.00 ? 41 ARG A CA   8 
ATOM 8898  C C    . ARG A 1 41 ? -5.332  27.371  -0.486  1.00 0.00 ? 41 ARG A C    8 
ATOM 8899  O O    . ARG A 1 41 ? -5.192  28.592  -0.565  1.00 0.00 ? 41 ARG A O    8 
ATOM 8900  C CB   . ARG A 1 41 ? -7.736  26.925  0.098   1.00 0.00 ? 41 ARG A CB   8 
ATOM 8901  C CG   . ARG A 1 41 ? -8.092  28.388  0.303   1.00 0.00 ? 41 ARG A CG   8 
ATOM 8902  C CD   . ARG A 1 41 ? -9.230  28.547  1.300   1.00 0.00 ? 41 ARG A CD   8 
ATOM 8903  N NE   . ARG A 1 41 ? -9.535  29.951  1.570   1.00 0.00 ? 41 ARG A NE   8 
ATOM 8904  C CZ   . ARG A 1 41 ? -8.709  30.784  2.200   1.00 0.00 ? 41 ARG A CZ   8 
ATOM 8905  N NH1  . ARG A 1 41 ? -7.539  30.351  2.655   1.00 0.00 ? 41 ARG A NH1  8 
ATOM 8906  N NH2  . ARG A 1 41 ? -9.058  32.048  2.386   1.00 0.00 ? 41 ARG A NH2  8 
ATOM 8907  H H    . ARG A 1 41 ? -6.556  24.655  -0.382  1.00 0.00 ? 41 ARG A H    8 
ATOM 8908  H HA   . ARG A 1 41 ? -6.930  27.117  -1.879  1.00 0.00 ? 41 ARG A HA   8 
ATOM 8909  H HB2  . ARG A 1 41 ? -8.625  26.403  -0.224  1.00 0.00 ? 41 ARG A HB2  8 
ATOM 8910  H HB3  . ARG A 1 41 ? -7.418  26.519  1.048   1.00 0.00 ? 41 ARG A HB3  8 
ATOM 8911  H HG2  . ARG A 1 41 ? -7.223  28.913  0.673   1.00 0.00 ? 41 ARG A HG2  8 
ATOM 8912  H HG3  . ARG A 1 41 ? -8.394  28.811  -0.644  1.00 0.00 ? 41 ARG A HG3  8 
ATOM 8913  H HD2  . ARG A 1 41 ? -10.111 28.069  0.900   1.00 0.00 ? 41 ARG A HD2  8 
ATOM 8914  H HD3  . ARG A 1 41 ? -8.950  28.065  2.225   1.00 0.00 ? 41 ARG A HD3  8 
ATOM 8915  H HE   . ARG A 1 41 ? -10.400 30.293  1.260   1.00 0.00 ? 41 ARG A HE   8 
ATOM 8916  H HH11 . ARG A 1 41 ? -7.274  29.396  2.528   1.00 0.00 ? 41 ARG A HH11 8 
ATOM 8917  H HH12 . ARG A 1 41 ? -6.922  30.982  3.126   1.00 0.00 ? 41 ARG A HH12 8 
ATOM 8918  H HH21 . ARG A 1 41 ? -9.942  32.377  2.054   1.00 0.00 ? 41 ARG A HH21 8 
ATOM 8919  H HH22 . ARG A 1 41 ? -8.438  32.674  2.860   1.00 0.00 ? 41 ARG A HH22 8 
ATOM 8920  N N    . GLN A 1 42 ? -4.385  26.555  -0.026  1.00 0.00 ? 42 GLN A N    8 
ATOM 8921  C CA   . GLN A 1 42 ? -3.098  27.026  0.419   1.00 0.00 ? 42 GLN A CA   8 
ATOM 8922  C C    . GLN A 1 42 ? -2.249  27.506  -0.755  1.00 0.00 ? 42 GLN A C    8 
ATOM 8923  O O    . GLN A 1 42 ? -2.561  27.262  -1.921  1.00 0.00 ? 42 GLN A O    8 
ATOM 8924  C CB   . GLN A 1 42 ? -2.370  25.899  1.159   1.00 0.00 ? 42 GLN A CB   8 
ATOM 8925  C CG   . GLN A 1 42 ? -2.854  25.687  2.584   1.00 0.00 ? 42 GLN A CG   8 
ATOM 8926  C CD   . GLN A 1 42 ? -2.103  24.578  3.295   1.00 0.00 ? 42 GLN A CD   8 
ATOM 8927  O OE1  . GLN A 1 42 ? -0.889  24.656  3.481   1.00 0.00 ? 42 GLN A OE1  8 
ATOM 8928  N NE2  . GLN A 1 42 ? -2.822  23.535  3.694   1.00 0.00 ? 42 GLN A NE2  8 
ATOM 8929  H H    . GLN A 1 42 ? -4.553  25.605  0.013   1.00 0.00 ? 42 GLN A H    8 
ATOM 8930  H HA   . GLN A 1 42 ? -3.258  27.848  1.096   1.00 0.00 ? 42 GLN A HA   8 
ATOM 8931  H HB2  . GLN A 1 42 ? -2.522  24.978  0.616   1.00 0.00 ? 42 GLN A HB2  8 
ATOM 8932  H HB3  . GLN A 1 42 ? -1.315  26.113  1.186   1.00 0.00 ? 42 GLN A HB3  8 
ATOM 8933  H HG2  . GLN A 1 42 ? -2.718  26.605  3.137   1.00 0.00 ? 42 GLN A HG2  8 
ATOM 8934  H HG3  . GLN A 1 42 ? -3.903  25.435  2.561   1.00 0.00 ? 42 GLN A HG3  8 
ATOM 8935  H HE21 . GLN A 1 42 ? -3.784  23.538  3.509   1.00 0.00 ? 42 GLN A HE21 8 
ATOM 8936  H HE22 . GLN A 1 42 ? -2.360  22.804  4.155   1.00 0.00 ? 42 GLN A HE22 8 
ATOM 8937  N N    . PRO A 1 43 ? -1.152  28.189  -0.429  1.00 0.00 ? 43 PRO A N    8 
ATOM 8938  C CA   . PRO A 1 43 ? -0.203  28.728  -1.401  1.00 0.00 ? 43 PRO A CA   8 
ATOM 8939  C C    . PRO A 1 43 ? 0.771   27.682  -1.928  1.00 0.00 ? 43 PRO A C    8 
ATOM 8940  O O    . PRO A 1 43 ? 1.756   28.017  -2.586  1.00 0.00 ? 43 PRO A O    8 
ATOM 8941  C CB   . PRO A 1 43 ? 0.538   29.798  -0.604  1.00 0.00 ? 43 PRO A CB   8 
ATOM 8942  C CG   . PRO A 1 43 ? 0.454   29.360  0.824   1.00 0.00 ? 43 PRO A CG   8 
ATOM 8943  C CD   . PRO A 1 43 ? -0.764  28.478  0.953   1.00 0.00 ? 43 PRO A CD   8 
ATOM 8944  H HA   . PRO A 1 43 ? -0.707  29.184  -2.240  1.00 0.00 ? 43 PRO A HA   8 
ATOM 8945  H HB2  . PRO A 1 43 ? 1.563   29.846  -0.939  1.00 0.00 ? 43 PRO A HB2  8 
ATOM 8946  H HB3  . PRO A 1 43 ? 0.060   30.755  -0.751  1.00 0.00 ? 43 PRO A HB3  8 
ATOM 8947  H HG2  . PRO A 1 43 ? 1.342   28.804  1.087   1.00 0.00 ? 43 PRO A HG2  8 
ATOM 8948  H HG3  . PRO A 1 43 ? 0.355   30.226  1.463   1.00 0.00 ? 43 PRO A HG3  8 
ATOM 8949  H HD2  . PRO A 1 43 ? -0.522  27.564  1.470   1.00 0.00 ? 43 PRO A HD2  8 
ATOM 8950  H HD3  . PRO A 1 43 ? -1.567  28.992  1.466   1.00 0.00 ? 43 PRO A HD3  8 
ATOM 8951  N N    . ASP A 1 44 ? 0.485   26.418  -1.653  1.00 0.00 ? 44 ASP A N    8 
ATOM 8952  C CA   . ASP A 1 44 ? 1.319   25.328  -2.117  1.00 0.00 ? 44 ASP A CA   8 
ATOM 8953  C C    . ASP A 1 44 ? 0.475   24.331  -2.895  1.00 0.00 ? 44 ASP A C    8 
ATOM 8954  O O    . ASP A 1 44 ? 0.405   24.408  -4.120  1.00 0.00 ? 44 ASP A O    8 
ATOM 8955  C CB   . ASP A 1 44 ? 2.048   24.648  -0.949  1.00 0.00 ? 44 ASP A CB   8 
ATOM 8956  C CG   . ASP A 1 44 ? 1.176   24.467  0.279   1.00 0.00 ? 44 ASP A CG   8 
ATOM 8957  O OD1  . ASP A 1 44 ? 0.783   25.486  0.883   1.00 0.00 ? 44 ASP A OD1  8 
ATOM 8958  O OD2  . ASP A 1 44 ? 0.884   23.306  0.634   1.00 0.00 ? 44 ASP A OD2  8 
ATOM 8959  H H    . ASP A 1 44 ? -0.316  26.209  -1.141  1.00 0.00 ? 44 ASP A H    8 
ATOM 8960  H HA   . ASP A 1 44 ? 2.058   25.742  -2.792  1.00 0.00 ? 44 ASP A HA   8 
ATOM 8961  H HB2  . ASP A 1 44 ? 2.390   23.674  -1.268  1.00 0.00 ? 44 ASP A HB2  8 
ATOM 8962  H HB3  . ASP A 1 44 ? 2.904   25.249  -0.673  1.00 0.00 ? 44 ASP A HB3  8 
ATOM 8963  N N    . LEU A 1 45 ? -0.186  23.410  -2.190  1.00 0.00 ? 45 LEU A N    8 
ATOM 8964  C CA   . LEU A 1 45 ? -1.028  22.411  -2.840  1.00 0.00 ? 45 LEU A CA   8 
ATOM 8965  C C    . LEU A 1 45 ? -0.161  21.417  -3.606  1.00 0.00 ? 45 LEU A C    8 
ATOM 8966  O O    . LEU A 1 45 ? -0.299  20.206  -3.450  1.00 0.00 ? 45 LEU A O    8 
ATOM 8967  C CB   . LEU A 1 45 ? -2.040  23.092  -3.782  1.00 0.00 ? 45 LEU A CB   8 
ATOM 8968  C CG   . LEU A 1 45 ? -3.074  22.171  -4.447  1.00 0.00 ? 45 LEU A CG   8 
ATOM 8969  C CD1  . LEU A 1 45 ? -4.046  22.987  -5.284  1.00 0.00 ? 45 LEU A CD1  8 
ATOM 8970  C CD2  . LEU A 1 45 ? -2.395  21.122  -5.313  1.00 0.00 ? 45 LEU A CD2  8 
ATOM 8971  H H    . LEU A 1 45 ? -0.109  23.405  -1.217  1.00 0.00 ? 45 LEU A H    8 
ATOM 8972  H HA   . LEU A 1 45 ? -1.566  21.882  -2.069  1.00 0.00 ? 45 LEU A HA   8 
ATOM 8973  H HB2  . LEU A 1 45 ? -2.577  23.836  -3.212  1.00 0.00 ? 45 LEU A HB2  8 
ATOM 8974  H HB3  . LEU A 1 45 ? -1.493  23.595  -4.565  1.00 0.00 ? 45 LEU A HB3  8 
ATOM 8975  H HG   . LEU A 1 45 ? -3.639  21.663  -3.679  1.00 0.00 ? 45 LEU A HG   8 
ATOM 8976  H HD11 . LEU A 1 45 ? -4.054  24.009  -4.935  1.00 0.00 ? 45 LEU A HD11 8 
ATOM 8977  H HD12 . LEU A 1 45 ? -3.739  22.964  -6.319  1.00 0.00 ? 45 LEU A HD12 8 
ATOM 8978  H HD13 . LEU A 1 45 ? -5.038  22.569  -5.195  1.00 0.00 ? 45 LEU A HD13 8 
ATOM 8979  H HD21 . LEU A 1 45 ? -1.466  21.516  -5.696  1.00 0.00 ? 45 LEU A HD21 8 
ATOM 8980  H HD22 . LEU A 1 45 ? -2.197  20.243  -4.720  1.00 0.00 ? 45 LEU A HD22 8 
ATOM 8981  H HD23 . LEU A 1 45 ? -3.043  20.862  -6.137  1.00 0.00 ? 45 LEU A HD23 8 
ATOM 8982  N N    . ILE A 1 46 ? 0.724   21.942  -4.441  1.00 0.00 ? 46 ILE A N    8 
ATOM 8983  C CA   . ILE A 1 46 ? 1.619   21.114  -5.248  1.00 0.00 ? 46 ILE A CA   8 
ATOM 8984  C C    . ILE A 1 46 ? 2.236   19.988  -4.417  1.00 0.00 ? 46 ILE A C    8 
ATOM 8985  O O    . ILE A 1 46 ? 2.222   18.834  -4.833  1.00 0.00 ? 46 ILE A O    8 
ATOM 8986  C CB   . ILE A 1 46 ? 2.764   21.930  -5.875  1.00 0.00 ? 46 ILE A CB   8 
ATOM 8987  C CG1  . ILE A 1 46 ? 2.259   23.285  -6.393  1.00 0.00 ? 46 ILE A CG1  8 
ATOM 8988  C CG2  . ILE A 1 46 ? 3.422   21.139  -6.998  1.00 0.00 ? 46 ILE A CG2  8 
ATOM 8989  C CD1  . ILE A 1 46 ? 3.323   24.128  -7.058  1.00 0.00 ? 46 ILE A CD1  8 
ATOM 8990  H H    . ILE A 1 46 ? 0.772   22.913  -4.519  1.00 0.00 ? 46 ILE A H    8 
ATOM 8991  H HA   . ILE A 1 46 ? 1.037   20.678  -6.046  1.00 0.00 ? 46 ILE A HA   8 
ATOM 8992  H HB   . ILE A 1 46 ? 3.499   22.087  -5.112  1.00 0.00 ? 46 ILE A HB   8 
ATOM 8993  H HG12 . ILE A 1 46 ? 1.472   23.120  -7.112  1.00 0.00 ? 46 ILE A HG12 8 
ATOM 8994  H HG13 . ILE A 1 46 ? 1.869   23.856  -5.566  1.00 0.00 ? 46 ILE A HG13 8 
ATOM 8995  H HG21 . ILE A 1 46 ? 2.841   20.251  -7.202  1.00 0.00 ? 46 ILE A HG21 8 
ATOM 8996  H HG22 . ILE A 1 46 ? 3.472   21.749  -7.888  1.00 0.00 ? 46 ILE A HG22 8 
ATOM 8997  H HG23 . ILE A 1 46 ? 4.420   20.855  -6.700  1.00 0.00 ? 46 ILE A HG23 8 
ATOM 8998  H HD11 . ILE A 1 46 ? 4.299   23.768  -6.772  1.00 0.00 ? 46 ILE A HD11 8 
ATOM 8999  H HD12 . ILE A 1 46 ? 3.214   24.067  -8.129  1.00 0.00 ? 46 ILE A HD12 8 
ATOM 9000  H HD13 . ILE A 1 46 ? 3.211   25.158  -6.742  1.00 0.00 ? 46 ILE A HD13 8 
ATOM 9001  N N    . PRO A 1 47 ? 2.817   20.297  -3.240  1.00 0.00 ? 47 PRO A N    8 
ATOM 9002  C CA   . PRO A 1 47 ? 3.432   19.272  -2.402  1.00 0.00 ? 47 PRO A CA   8 
ATOM 9003  C C    . PRO A 1 47 ? 2.389   18.397  -1.726  1.00 0.00 ? 47 PRO A C    8 
ATOM 9004  O O    . PRO A 1 47 ? 2.667   17.249  -1.377  1.00 0.00 ? 47 PRO A O    8 
ATOM 9005  C CB   . PRO A 1 47 ? 4.226   20.072  -1.372  1.00 0.00 ? 47 PRO A CB   8 
ATOM 9006  C CG   . PRO A 1 47 ? 3.515   21.377  -1.280  1.00 0.00 ? 47 PRO A CG   8 
ATOM 9007  C CD   . PRO A 1 47 ? 2.945   21.644  -2.648  1.00 0.00 ? 47 PRO A CD   8 
ATOM 9008  H HA   . PRO A 1 47 ? 4.096   18.647  -2.980  1.00 0.00 ? 47 PRO A HA   8 
ATOM 9009  H HB2  . PRO A 1 47 ? 4.222   19.551  -0.426  1.00 0.00 ? 47 PRO A HB2  8 
ATOM 9010  H HB3  . PRO A 1 47 ? 5.243   20.200  -1.715  1.00 0.00 ? 47 PRO A HB3  8 
ATOM 9011  H HG2  . PRO A 1 47 ? 2.722   21.311  -0.550  1.00 0.00 ? 47 PRO A HG2  8 
ATOM 9012  H HG3  . PRO A 1 47 ? 4.212   22.156  -1.007  1.00 0.00 ? 47 PRO A HG3  8 
ATOM 9013  H HD2  . PRO A 1 47 ? 1.990   22.121  -2.561  1.00 0.00 ? 47 PRO A HD2  8 
ATOM 9014  H HD3  . PRO A 1 47 ? 3.623   22.254  -3.223  1.00 0.00 ? 47 PRO A HD3  8 
ATOM 9015  N N    . LEU A 1 48 ? 1.179   18.928  -1.568  1.00 0.00 ? 48 LEU A N    8 
ATOM 9016  C CA   . LEU A 1 48 ? 0.098   18.160  -0.966  1.00 0.00 ? 48 LEU A CA   8 
ATOM 9017  C C    . LEU A 1 48 ? -0.245  17.021  -1.892  1.00 0.00 ? 48 LEU A C    8 
ATOM 9018  O O    . LEU A 1 48 ? -0.565  15.909  -1.469  1.00 0.00 ? 48 LEU A O    8 
ATOM 9019  C CB   . LEU A 1 48 ? -1.144  19.057  -0.729  1.00 0.00 ? 48 LEU A CB   8 
ATOM 9020  C CG   . LEU A 1 48 ? -2.493  18.577  -1.329  1.00 0.00 ? 48 LEU A CG   8 
ATOM 9021  C CD1  . LEU A 1 48 ? -2.498  18.678  -2.844  1.00 0.00 ? 48 LEU A CD1  8 
ATOM 9022  C CD2  . LEU A 1 48 ? -2.832  17.158  -0.890  1.00 0.00 ? 48 LEU A CD2  8 
ATOM 9023  H H    . LEU A 1 48 ? 1.002   19.838  -1.889  1.00 0.00 ? 48 LEU A H    8 
ATOM 9024  H HA   . LEU A 1 48 ? 0.448   17.762  -0.026  1.00 0.00 ? 48 LEU A HA   8 
ATOM 9025  H HB2  . LEU A 1 48 ? -1.276  19.171  0.334   1.00 0.00 ? 48 LEU A HB2  8 
ATOM 9026  H HB3  . LEU A 1 48 ? -0.929  20.031  -1.145  1.00 0.00 ? 48 LEU A HB3  8 
ATOM 9027  H HG   . LEU A 1 48 ? -3.272  19.216  -0.977  1.00 0.00 ? 48 LEU A HG   8 
ATOM 9028  H HD11 . LEU A 1 48 ? -1.582  19.128  -3.177  1.00 0.00 ? 48 LEU A HD11 8 
ATOM 9029  H HD12 . LEU A 1 48 ? -2.594  17.692  -3.272  1.00 0.00 ? 48 LEU A HD12 8 
ATOM 9030  H HD13 . LEU A 1 48 ? -3.332  19.288  -3.158  1.00 0.00 ? 48 LEU A HD13 8 
ATOM 9031  H HD21 . LEU A 1 48 ? -2.051  16.783  -0.255  1.00 0.00 ? 48 LEU A HD21 8 
ATOM 9032  H HD22 . LEU A 1 48 ? -3.767  17.162  -0.351  1.00 0.00 ? 48 LEU A HD22 8 
ATOM 9033  H HD23 . LEU A 1 48 ? -2.921  16.523  -1.760  1.00 0.00 ? 48 LEU A HD23 8 
ATOM 9034  N N    . LEU A 1 49 ? -0.181  17.331  -3.167  1.00 0.00 ? 49 LEU A N    8 
ATOM 9035  C CA   . LEU A 1 49 ? -0.491  16.395  -4.203  1.00 0.00 ? 49 LEU A CA   8 
ATOM 9036  C C    . LEU A 1 49 ? 0.218   15.062  -3.993  1.00 0.00 ? 49 LEU A C    8 
ATOM 9037  O O    . LEU A 1 49 ? -0.396  14.056  -3.636  1.00 0.00 ? 49 LEU A O    8 
ATOM 9038  C CB   . LEU A 1 49 ? -0.079  17.004  -5.548  1.00 0.00 ? 49 LEU A CB   8 
ATOM 9039  C CG   . LEU A 1 49 ? -1.003  18.101  -6.074  1.00 0.00 ? 49 LEU A CG   8 
ATOM 9040  C CD1  . LEU A 1 49 ? -0.536  18.586  -7.439  1.00 0.00 ? 49 LEU A CD1  8 
ATOM 9041  C CD2  . LEU A 1 49 ? -2.440  17.604  -6.144  1.00 0.00 ? 49 LEU A CD2  8 
ATOM 9042  H H    . LEU A 1 49 ? 0.081   18.238  -3.421  1.00 0.00 ? 49 LEU A H    8 
ATOM 9043  H HA   . LEU A 1 49 ? -1.560  16.246  -4.191  1.00 0.00 ? 49 LEU A HA   8 
ATOM 9044  H HB2  . LEU A 1 49 ? 0.915   17.436  -5.431  1.00 0.00 ? 49 LEU A HB2  8 
ATOM 9045  H HB3  . LEU A 1 49 ? -0.029  16.216  -6.283  1.00 0.00 ? 49 LEU A HB3  8 
ATOM 9046  H HG   . LEU A 1 49 ? -0.970  18.940  -5.396  1.00 0.00 ? 49 LEU A HG   8 
ATOM 9047  H HD11 . LEU A 1 49 ? 0.178   17.885  -7.846  1.00 0.00 ? 49 LEU A HD11 8 
ATOM 9048  H HD12 . LEU A 1 49 ? -1.384  18.662  -8.105  1.00 0.00 ? 49 LEU A HD12 8 
ATOM 9049  H HD13 . LEU A 1 49 ? -0.070  19.555  -7.337  1.00 0.00 ? 49 LEU A HD13 8 
ATOM 9050  H HD21 . LEU A 1 49 ? -2.466  16.646  -6.642  1.00 0.00 ? 49 LEU A HD21 8 
ATOM 9051  H HD22 . LEU A 1 49 ? -2.834  17.501  -5.145  1.00 0.00 ? 49 LEU A HD22 8 
ATOM 9052  H HD23 . LEU A 1 49 ? -3.040  18.312  -6.696  1.00 0.00 ? 49 LEU A HD23 8 
ATOM 9053  N N    . ARG A 1 50 ? 1.513   15.077  -4.243  1.00 0.00 ? 50 ARG A N    8 
ATOM 9054  C CA   . ARG A 1 50 ? 2.347   13.892  -4.149  1.00 0.00 ? 50 ARG A CA   8 
ATOM 9055  C C    . ARG A 1 50 ? 2.665   13.461  -2.717  1.00 0.00 ? 50 ARG A C    8 
ATOM 9056  O O    . ARG A 1 50 ? 2.792   12.266  -2.442  1.00 0.00 ? 50 ARG A O    8 
ATOM 9057  C CB   . ARG A 1 50 ? 3.638   14.158  -4.916  1.00 0.00 ? 50 ARG A CB   8 
ATOM 9058  C CG   . ARG A 1 50 ? 3.414   14.301  -6.412  1.00 0.00 ? 50 ARG A CG   8 
ATOM 9059  C CD   . ARG A 1 50 ? 4.705   14.594  -7.157  1.00 0.00 ? 50 ARG A CD   8 
ATOM 9060  N NE   . ARG A 1 50 ? 4.492   14.651  -8.602  1.00 0.00 ? 50 ARG A NE   8 
ATOM 9061  C CZ   . ARG A 1 50 ? 3.758   15.582  -9.208  1.00 0.00 ? 50 ARG A CZ   8 
ATOM 9062  N NH1  . ARG A 1 50 ? 3.234   16.584  -8.512  1.00 0.00 ? 50 ARG A NH1  8 
ATOM 9063  N NH2  . ARG A 1 50 ? 3.561   15.521  -10.518 1.00 0.00 ? 50 ARG A NH2  8 
ATOM 9064  H H    . ARG A 1 50 ? 1.925   15.915  -4.529  1.00 0.00 ? 50 ARG A H    8 
ATOM 9065  H HA   . ARG A 1 50 ? 1.827   13.087  -4.645  1.00 0.00 ? 50 ARG A HA   8 
ATOM 9066  H HB2  . ARG A 1 50 ? 4.082   15.071  -4.548  1.00 0.00 ? 50 ARG A HB2  8 
ATOM 9067  H HB3  . ARG A 1 50 ? 4.314   13.346  -4.748  1.00 0.00 ? 50 ARG A HB3  8 
ATOM 9068  H HG2  . ARG A 1 50 ? 2.997   13.381  -6.791  1.00 0.00 ? 50 ARG A HG2  8 
ATOM 9069  H HG3  . ARG A 1 50 ? 2.718   15.109  -6.584  1.00 0.00 ? 50 ARG A HG3  8 
ATOM 9070  H HD2  . ARG A 1 50 ? 5.094   15.543  -6.821  1.00 0.00 ? 50 ARG A HD2  8 
ATOM 9071  H HD3  . ARG A 1 50 ? 5.419   13.814  -6.937  1.00 0.00 ? 50 ARG A HD3  8 
ATOM 9072  H HE   . ARG A 1 50 ? 4.897   13.943  -9.146  1.00 0.00 ? 50 ARG A HE   8 
ATOM 9073  H HH11 . ARG A 1 50 ? 3.390   16.645  -7.528  1.00 0.00 ? 50 ARG A HH11 8 
ATOM 9074  H HH12 . ARG A 1 50 ? 2.683   17.279  -8.975  1.00 0.00 ? 50 ARG A HH12 8 
ATOM 9075  H HH21 . ARG A 1 50 ? 3.964   14.775  -11.050 1.00 0.00 ? 50 ARG A HH21 8 
ATOM 9076  H HH22 . ARG A 1 50 ? 3.009   16.219  -10.974 1.00 0.00 ? 50 ARG A HH22 8 
ATOM 9077  N N    . THR A 1 51 ? 2.826   14.415  -1.811  1.00 0.00 ? 51 THR A N    8 
ATOM 9078  C CA   . THR A 1 51 ? 3.169   14.079  -0.434  1.00 0.00 ? 51 THR A CA   8 
ATOM 9079  C C    . THR A 1 51 ? 2.050   13.334  0.268   1.00 0.00 ? 51 THR A C    8 
ATOM 9080  O O    . THR A 1 51 ? 2.303   12.507  1.141   1.00 0.00 ? 51 THR A O    8 
ATOM 9081  C CB   . THR A 1 51 ? 3.535   15.334  0.363   1.00 0.00 ? 51 THR A CB   8 
ATOM 9082  O OG1  . THR A 1 51 ? 4.606   16.028  -0.254  1.00 0.00 ? 51 THR A OG1  8 
ATOM 9083  C CG2  . THR A 1 51 ? 3.946   15.039  1.791   1.00 0.00 ? 51 THR A CG2  8 
ATOM 9084  H H    . THR A 1 51 ? 2.731   15.355  -2.072  1.00 0.00 ? 51 THR A H    8 
ATOM 9085  H HA   . THR A 1 51 ? 4.027   13.425  -0.473  1.00 0.00 ? 51 THR A HA   8 
ATOM 9086  H HB   . THR A 1 51 ? 2.679   15.990  0.396   1.00 0.00 ? 51 THR A HB   8 
ATOM 9087  H HG1  . THR A 1 51 ? 5.276   15.400  -0.527  1.00 0.00 ? 51 THR A HG1  8 
ATOM 9088  H HG21 . THR A 1 51 ? 4.649   14.220  1.801   1.00 0.00 ? 51 THR A HG21 8 
ATOM 9089  H HG22 . THR A 1 51 ? 4.409   15.916  2.221   1.00 0.00 ? 51 THR A HG22 8 
ATOM 9090  H HG23 . THR A 1 51 ? 3.074   14.773  2.369   1.00 0.00 ? 51 THR A HG23 8 
ATOM 9091  N N    . GLN A 1 52 ? 0.817   13.628  -0.096  1.00 0.00 ? 52 GLN A N    8 
ATOM 9092  C CA   . GLN A 1 52 ? -0.320  12.968  0.534   1.00 0.00 ? 52 GLN A CA   8 
ATOM 9093  C C    . GLN A 1 52 ? -0.823  11.828  -0.322  1.00 0.00 ? 52 GLN A C    8 
ATOM 9094  O O    . GLN A 1 52 ? -1.216  10.786  0.187   1.00 0.00 ? 52 GLN A O    8 
ATOM 9095  C CB   . GLN A 1 52 ? -1.419  13.979  0.813   1.00 0.00 ? 52 GLN A CB   8 
ATOM 9096  C CG   . GLN A 1 52 ? -0.889  15.164  1.584   1.00 0.00 ? 52 GLN A CG   8 
ATOM 9097  C CD   . GLN A 1 52 ? -1.962  16.152  1.985   1.00 0.00 ? 52 GLN A CD   8 
ATOM 9098  O OE1  . GLN A 1 52 ? -2.999  15.778  2.532   1.00 0.00 ? 52 GLN A OE1  8 
ATOM 9099  N NE2  . GLN A 1 52 ? -1.697  17.429  1.742   1.00 0.00 ? 52 GLN A NE2  8 
ATOM 9100  H H    . GLN A 1 52 ? 0.663   14.303  -0.795  1.00 0.00 ? 52 GLN A H    8 
ATOM 9101  H HA   . GLN A 1 52 ? 0.020   12.559  1.476   1.00 0.00 ? 52 GLN A HA   8 
ATOM 9102  H HB2  . GLN A 1 52 ? -1.831  14.326  -0.124  1.00 0.00 ? 52 GLN A HB2  8 
ATOM 9103  H HB3  . GLN A 1 52 ? -2.197  13.509  1.395   1.00 0.00 ? 52 GLN A HB3  8 
ATOM 9104  H HG2  . GLN A 1 52 ? -0.399  14.805  2.476   1.00 0.00 ? 52 GLN A HG2  8 
ATOM 9105  H HG3  . GLN A 1 52 ? -0.164  15.667  0.953   1.00 0.00 ? 52 GLN A HG3  8 
ATOM 9106  H HE21 . GLN A 1 52 ? -0.837  17.649  1.331   1.00 0.00 ? 52 GLN A HE21 8 
ATOM 9107  H HE22 . GLN A 1 52 ? -2.373  18.096  1.970   1.00 0.00 ? 52 GLN A HE22 8 
ATOM 9108  N N    . PHE A 1 53 ? -0.782  12.013  -1.626  1.00 0.00 ? 53 PHE A N    8 
ATOM 9109  C CA   . PHE A 1 53 ? -1.227  10.972  -2.536  1.00 0.00 ? 53 PHE A CA   8 
ATOM 9110  C C    . PHE A 1 53 ? -0.371  9.723   -2.372  1.00 0.00 ? 53 PHE A C    8 
ATOM 9111  O O    . PHE A 1 53 ? -0.889  8.605   -2.298  1.00 0.00 ? 53 PHE A O    8 
ATOM 9112  C CB   . PHE A 1 53 ? -1.129  11.455  -3.982  1.00 0.00 ? 53 PHE A CB   8 
ATOM 9113  C CG   . PHE A 1 53 ? -1.618  10.451  -4.986  1.00 0.00 ? 53 PHE A CG   8 
ATOM 9114  C CD1  . PHE A 1 53 ? -2.957  10.096  -5.037  1.00 0.00 ? 53 PHE A CD1  8 
ATOM 9115  C CD2  . PHE A 1 53 ? -0.736  9.850   -5.868  1.00 0.00 ? 53 PHE A CD2  8 
ATOM 9116  C CE1  . PHE A 1 53 ? -3.404  9.159   -5.950  1.00 0.00 ? 53 PHE A CE1  8 
ATOM 9117  C CE2  . PHE A 1 53 ? -1.178  8.916   -6.785  1.00 0.00 ? 53 PHE A CE2  8 
ATOM 9118  C CZ   . PHE A 1 53 ? -2.514  8.570   -6.825  1.00 0.00 ? 53 PHE A CZ   8 
ATOM 9119  H H    . PHE A 1 53 ? -0.435  12.860  -1.987  1.00 0.00 ? 53 PHE A H    8 
ATOM 9120  H HA   . PHE A 1 53 ? -2.260  10.732  -2.308  1.00 0.00 ? 53 PHE A HA   8 
ATOM 9121  H HB2  . PHE A 1 53 ? -1.717  12.352  -4.097  1.00 0.00 ? 53 PHE A HB2  8 
ATOM 9122  H HB3  . PHE A 1 53 ? -0.093  11.670  -4.203  1.00 0.00 ? 53 PHE A HB3  8 
ATOM 9123  H HD1  . PHE A 1 53 ? -3.655  10.557  -4.354  1.00 0.00 ? 53 PHE A HD1  8 
ATOM 9124  H HD2  . PHE A 1 53 ? 0.308   10.120  -5.838  1.00 0.00 ? 53 PHE A HD2  8 
ATOM 9125  H HE1  . PHE A 1 53 ? -4.450  8.890   -5.980  1.00 0.00 ? 53 PHE A HE1  8 
ATOM 9126  H HE2  . PHE A 1 53 ? -0.479  8.457   -7.468  1.00 0.00 ? 53 PHE A HE2  8 
ATOM 9127  H HZ   . PHE A 1 53 ? -2.861  7.838   -7.539  1.00 0.00 ? 53 PHE A HZ   8 
ATOM 9128  N N    . PHE A 1 54 ? 0.948   9.919   -2.327  1.00 0.00 ? 54 PHE A N    8 
ATOM 9129  C CA   . PHE A 1 54 ? 1.874   8.802   -2.200  1.00 0.00 ? 54 PHE A CA   8 
ATOM 9130  C C    . PHE A 1 54 ? 1.911   8.255   -0.783  1.00 0.00 ? 54 PHE A C    8 
ATOM 9131  O O    . PHE A 1 54 ? 1.915   7.039   -0.576  1.00 0.00 ? 54 PHE A O    8 
ATOM 9132  C CB   . PHE A 1 54 ? 3.272   9.235   -2.640  1.00 0.00 ? 54 PHE A CB   8 
ATOM 9133  C CG   . PHE A 1 54 ? 3.344   9.544   -4.105  1.00 0.00 ? 54 PHE A CG   8 
ATOM 9134  C CD1  . PHE A 1 54 ? 2.610   10.589  -4.645  1.00 0.00 ? 54 PHE A CD1  8 
ATOM 9135  C CD2  . PHE A 1 54 ? 4.123   8.771   -4.946  1.00 0.00 ? 54 PHE A CD2  8 
ATOM 9136  C CE1  . PHE A 1 54 ? 2.656   10.852  -6.001  1.00 0.00 ? 54 PHE A CE1  8 
ATOM 9137  C CE2  . PHE A 1 54 ? 4.177   9.033   -6.300  1.00 0.00 ? 54 PHE A CE2  8 
ATOM 9138  C CZ   . PHE A 1 54 ? 3.441   10.074  -6.828  1.00 0.00 ? 54 PHE A CZ   8 
ATOM 9139  H H    . PHE A 1 54 ? 1.311   10.840  -2.388  1.00 0.00 ? 54 PHE A H    8 
ATOM 9140  H HA   . PHE A 1 54 ? 1.533   8.019   -2.866  1.00 0.00 ? 54 PHE A HA   8 
ATOM 9141  H HB2  . PHE A 1 54 ? 3.560   10.122  -2.093  1.00 0.00 ? 54 PHE A HB2  8 
ATOM 9142  H HB3  . PHE A 1 54 ? 3.973   8.441   -2.429  1.00 0.00 ? 54 PHE A HB3  8 
ATOM 9143  H HD1  . PHE A 1 54 ? 1.996   11.207  -3.995  1.00 0.00 ? 54 PHE A HD1  8 
ATOM 9144  H HD2  . PHE A 1 54 ? 4.699   7.956   -4.533  1.00 0.00 ? 54 PHE A HD2  8 
ATOM 9145  H HE1  . PHE A 1 54 ? 2.080   11.668  -6.413  1.00 0.00 ? 54 PHE A HE1  8 
ATOM 9146  H HE2  . PHE A 1 54 ? 4.791   8.422   -6.945  1.00 0.00 ? 54 PHE A HE2  8 
ATOM 9147  H HZ   . PHE A 1 54 ? 3.479   10.279  -7.888  1.00 0.00 ? 54 PHE A HZ   8 
ATOM 9148  N N    . ILE A 1 55 ? 1.927   9.149   0.190   1.00 0.00 ? 55 ILE A N    8 
ATOM 9149  C CA   . ILE A 1 55 ? 1.964   8.733   1.588   1.00 0.00 ? 55 ILE A CA   8 
ATOM 9150  C C    . ILE A 1 55 ? 0.647   8.087   2.000   1.00 0.00 ? 55 ILE A C    8 
ATOM 9151  O O    . ILE A 1 55 ? 0.632   7.029   2.626   1.00 0.00 ? 55 ILE A O    8 
ATOM 9152  C CB   . ILE A 1 55 ? 2.284   9.916   2.525   1.00 0.00 ? 55 ILE A CB   8 
ATOM 9153  C CG1  . ILE A 1 55 ? 3.667   10.485  2.195   1.00 0.00 ? 55 ILE A CG1  8 
ATOM 9154  C CG2  . ILE A 1 55 ? 2.225   9.480   3.984   1.00 0.00 ? 55 ILE A CG2  8 
ATOM 9155  C CD1  . ILE A 1 55 ? 4.790   9.492   2.392   1.00 0.00 ? 55 ILE A CD1  8 
ATOM 9156  H H    . ILE A 1 55 ? 1.909   10.109  -0.036  1.00 0.00 ? 55 ILE A H    8 
ATOM 9157  H HA   . ILE A 1 55 ? 2.756   8.002   1.691   1.00 0.00 ? 55 ILE A HA   8 
ATOM 9158  H HB   . ILE A 1 55 ? 1.539   10.682  2.374   1.00 0.00 ? 55 ILE A HB   8 
ATOM 9159  H HG12 . ILE A 1 55 ? 3.683   10.799  1.162   1.00 0.00 ? 55 ILE A HG12 8 
ATOM 9160  H HG13 . ILE A 1 55 ? 3.861   11.338  2.830   1.00 0.00 ? 55 ILE A HG13 8 
ATOM 9161  H HG21 . ILE A 1 55 ? 2.339   8.407   4.043   1.00 0.00 ? 55 ILE A HG21 8 
ATOM 9162  H HG22 . ILE A 1 55 ? 3.022   9.957   4.535   1.00 0.00 ? 55 ILE A HG22 8 
ATOM 9163  H HG23 . ILE A 1 55 ? 1.274   9.765   4.406   1.00 0.00 ? 55 ILE A HG23 8 
ATOM 9164  H HD11 . ILE A 1 55 ? 4.397   8.583   2.821   1.00 0.00 ? 55 ILE A HD11 8 
ATOM 9165  H HD12 . ILE A 1 55 ? 5.247   9.272   1.438   1.00 0.00 ? 55 ILE A HD12 8 
ATOM 9166  H HD13 . ILE A 1 55 ? 5.531   9.913   3.057   1.00 0.00 ? 55 ILE A HD13 8 
ATOM 9167  N N    . VAL A 1 56 ? -0.457  8.727   1.637   1.00 0.00 ? 56 VAL A N    8 
ATOM 9168  C CA   . VAL A 1 56 ? -1.779  8.211   1.970   1.00 0.00 ? 56 VAL A CA   8 
ATOM 9169  C C    . VAL A 1 56 ? -2.079  6.910   1.230   1.00 0.00 ? 56 VAL A C    8 
ATOM 9170  O O    . VAL A 1 56 ? -2.624  5.979   1.818   1.00 0.00 ? 56 VAL A O    8 
ATOM 9171  C CB   . VAL A 1 56 ? -2.890  9.236   1.662   1.00 0.00 ? 56 VAL A CB   8 
ATOM 9172  C CG1  . VAL A 1 56 ? -4.261  8.656   1.978   1.00 0.00 ? 56 VAL A CG1  8 
ATOM 9173  C CG2  . VAL A 1 56 ? -2.659  10.520  2.446   1.00 0.00 ? 56 VAL A CG2  8 
ATOM 9174  H H    . VAL A 1 56 ? -0.382  9.562   1.135   1.00 0.00 ? 56 VAL A H    8 
ATOM 9175  H HA   . VAL A 1 56 ? -1.795  8.013   3.032   1.00 0.00 ? 56 VAL A HA   8 
ATOM 9176  H HB   . VAL A 1 56 ? -2.857  9.471   0.609   1.00 0.00 ? 56 VAL A HB   8 
ATOM 9177  H HG11 . VAL A 1 56 ? -4.154  7.839   2.677   1.00 0.00 ? 56 VAL A HG11 8 
ATOM 9178  H HG12 . VAL A 1 56 ? -4.887  9.421   2.412   1.00 0.00 ? 56 VAL A HG12 8 
ATOM 9179  H HG13 . VAL A 1 56 ? -4.715  8.292   1.068   1.00 0.00 ? 56 VAL A HG13 8 
ATOM 9180  H HG21 . VAL A 1 56 ? -1.633  10.835  2.326   1.00 0.00 ? 56 VAL A HG21 8 
ATOM 9181  H HG22 . VAL A 1 56 ? -3.318  11.290  2.078   1.00 0.00 ? 56 VAL A HG22 8 
ATOM 9182  H HG23 . VAL A 1 56 ? -2.861  10.343  3.493   1.00 0.00 ? 56 VAL A HG23 8 
ATOM 9183  N N    . MET A 1 57 ? -1.732  6.836   -0.055  1.00 0.00 ? 57 MET A N    8 
ATOM 9184  C CA   . MET A 1 57 ? -1.991  5.631   -0.817  1.00 0.00 ? 57 MET A CA   8 
ATOM 9185  C C    . MET A 1 57 ? -1.128  4.492   -0.306  1.00 0.00 ? 57 MET A C    8 
ATOM 9186  O O    . MET A 1 57 ? -1.573  3.353   -0.191  1.00 0.00 ? 57 MET A O    8 
ATOM 9187  C CB   . MET A 1 57 ? -1.724  5.872   -2.303  1.00 0.00 ? 57 MET A CB   8 
ATOM 9188  C CG   . MET A 1 57 ? -0.247  5.945   -2.665  1.00 0.00 ? 57 MET A CG   8 
ATOM 9189  S SD   . MET A 1 57 ? 0.020   6.256   -4.421  1.00 0.00 ? 57 MET A SD   8 
ATOM 9190  C CE   . MET A 1 57 ? 1.807   6.178   -4.513  1.00 0.00 ? 57 MET A CE   8 
ATOM 9191  H H    . MET A 1 57 ? -1.295  7.597   -0.497  1.00 0.00 ? 57 MET A H    8 
ATOM 9192  H HA   . MET A 1 57 ? -3.024  5.368   -0.680  1.00 0.00 ? 57 MET A HA   8 
ATOM 9193  H HB2  . MET A 1 57 ? -2.169  5.072   -2.864  1.00 0.00 ? 57 MET A HB2  8 
ATOM 9194  H HB3  . MET A 1 57 ? -2.189  6.802   -2.592  1.00 0.00 ? 57 MET A HB3  8 
ATOM 9195  H HG2  . MET A 1 57 ? 0.212   6.741   -2.098  1.00 0.00 ? 57 MET A HG2  8 
ATOM 9196  H HG3  . MET A 1 57 ? 0.219   5.005   -2.405  1.00 0.00 ? 57 MET A HG3  8 
ATOM 9197  H HE1  . MET A 1 57 ? 2.192   5.693   -3.629  1.00 0.00 ? 57 MET A HE1  8 
ATOM 9198  H HE2  . MET A 1 57 ? 2.098   5.615   -5.388  1.00 0.00 ? 57 MET A HE2  8 
ATOM 9199  H HE3  . MET A 1 57 ? 2.207   7.179   -4.580  1.00 0.00 ? 57 MET A HE3  8 
ATOM 9200  N N    . GLY A 1 58 ? 0.114   4.824   -0.005  1.00 0.00 ? 58 GLY A N    8 
ATOM 9201  C CA   . GLY A 1 58 ? 1.051   3.836   0.484   1.00 0.00 ? 58 GLY A CA   8 
ATOM 9202  C C    . GLY A 1 58 ? 0.721   3.319   1.872   1.00 0.00 ? 58 GLY A C    8 
ATOM 9203  O O    . GLY A 1 58 ? 0.776   2.114   2.110   1.00 0.00 ? 58 GLY A O    8 
ATOM 9204  H H    . GLY A 1 58 ? 0.400   5.753   -0.124  1.00 0.00 ? 58 GLY A H    8 
ATOM 9205  H HA2  . GLY A 1 58 ? 1.063   3.002   -0.202  1.00 0.00 ? 58 GLY A HA2  8 
ATOM 9206  H HA3  . GLY A 1 58 ? 2.029   4.279   0.502   1.00 0.00 ? 58 GLY A HA3  8 
ATOM 9207  N N    . LEU A 1 59 ? 0.387   4.218   2.800   1.00 0.00 ? 59 LEU A N    8 
ATOM 9208  C CA   . LEU A 1 59 ? 0.065   3.800   4.158   1.00 0.00 ? 59 LEU A CA   8 
ATOM 9209  C C    . LEU A 1 59 ? -1.215  2.968   4.176   1.00 0.00 ? 59 LEU A C    8 
ATOM 9210  O O    . LEU A 1 59 ? -1.413  2.138   5.062   1.00 0.00 ? 59 LEU A O    8 
ATOM 9211  C CB   . LEU A 1 59 ? -0.024  5.009   5.099   1.00 0.00 ? 59 LEU A CB   8 
ATOM 9212  C CG   . LEU A 1 59 ? -1.070  6.072   4.754   1.00 0.00 ? 59 LEU A CG   8 
ATOM 9213  C CD1  . LEU A 1 59 ? -2.441  5.672   5.279   1.00 0.00 ? 59 LEU A CD1  8 
ATOM 9214  C CD2  . LEU A 1 59 ? -0.654  7.420   5.324   1.00 0.00 ? 59 LEU A CD2  8 
ATOM 9215  H H    . LEU A 1 59 ? 0.363   5.169   2.572   1.00 0.00 ? 59 LEU A H    8 
ATOM 9216  H HA   . LEU A 1 59 ? 0.875   3.167   4.493   1.00 0.00 ? 59 LEU A HA   8 
ATOM 9217  H HB2  . LEU A 1 59 ? -0.239  4.642   6.088   1.00 0.00 ? 59 LEU A HB2  8 
ATOM 9218  H HB3  . LEU A 1 59 ? 0.944   5.488   5.120   1.00 0.00 ? 59 LEU A HB3  8 
ATOM 9219  H HG   . LEU A 1 59 ? -1.137  6.168   3.681   1.00 0.00 ? 59 LEU A HG   8 
ATOM 9220  H HD11 . LEU A 1 59 ? -2.459  4.610   5.475   1.00 0.00 ? 59 LEU A HD11 8 
ATOM 9221  H HD12 . LEU A 1 59 ? -2.645  6.209   6.194   1.00 0.00 ? 59 LEU A HD12 8 
ATOM 9222  H HD13 . LEU A 1 59 ? -3.192  5.917   4.546   1.00 0.00 ? 59 LEU A HD13 8 
ATOM 9223  H HD21 . LEU A 1 59 ? 0.391   7.595   5.110   1.00 0.00 ? 59 LEU A HD21 8 
ATOM 9224  H HD22 . LEU A 1 59 ? -1.249  8.202   4.876   1.00 0.00 ? 59 LEU A HD22 8 
ATOM 9225  H HD23 . LEU A 1 59 ? -0.806  7.422   6.394   1.00 0.00 ? 59 LEU A HD23 8 
ATOM 9226  N N    . VAL A 1 60 ? -2.058  3.157   3.163   1.00 0.00 ? 60 VAL A N    8 
ATOM 9227  C CA   . VAL A 1 60 ? -3.292  2.387   3.042   1.00 0.00 ? 60 VAL A CA   8 
ATOM 9228  C C    . VAL A 1 60 ? -2.994  1.050   2.376   1.00 0.00 ? 60 VAL A C    8 
ATOM 9229  O O    . VAL A 1 60 ? -3.326  -0.014  2.897   1.00 0.00 ? 60 VAL A O    8 
ATOM 9230  C CB   . VAL A 1 60 ? -4.357  3.129   2.204   1.00 0.00 ? 60 VAL A CB   8 
ATOM 9231  C CG1  . VAL A 1 60 ? -5.605  2.273   2.038   1.00 0.00 ? 60 VAL A CG1  8 
ATOM 9232  C CG2  . VAL A 1 60 ? -4.707  4.466   2.834   1.00 0.00 ? 60 VAL A CG2  8 
ATOM 9233  H H    . VAL A 1 60 ? -1.832  3.806   2.465   1.00 0.00 ? 60 VAL A H    8 
ATOM 9234  H HA   . VAL A 1 60 ? -3.690  2.214   4.035   1.00 0.00 ? 60 VAL A HA   8 
ATOM 9235  H HB   . VAL A 1 60 ? -3.945  3.317   1.222   1.00 0.00 ? 60 VAL A HB   8 
ATOM 9236  H HG11 . VAL A 1 60 ? -5.548  1.420   2.699   1.00 0.00 ? 60 VAL A HG11 8 
ATOM 9237  H HG12 . VAL A 1 60 ? -6.480  2.858   2.282   1.00 0.00 ? 60 VAL A HG12 8 
ATOM 9238  H HG13 . VAL A 1 60 ? -5.673  1.931   1.016   1.00 0.00 ? 60 VAL A HG13 8 
ATOM 9239  H HG21 . VAL A 1 60 ? -3.805  4.958   3.153   1.00 0.00 ? 60 VAL A HG21 8 
ATOM 9240  H HG22 . VAL A 1 60 ? -5.219  5.084   2.110   1.00 0.00 ? 60 VAL A HG22 8 
ATOM 9241  H HG23 . VAL A 1 60 ? -5.349  4.304   3.687   1.00 0.00 ? 60 VAL A HG23 8 
ATOM 9242  N N    . ASP A 1 61 ? -2.356  1.127   1.213   1.00 0.00 ? 61 ASP A N    8 
ATOM 9243  C CA   . ASP A 1 61 ? -1.992  -0.049  0.446   1.00 0.00 ? 61 ASP A CA   8 
ATOM 9244  C C    . ASP A 1 61 ? -1.009  -0.934  1.199   1.00 0.00 ? 61 ASP A C    8 
ATOM 9245  O O    . ASP A 1 61 ? -0.872  -2.119  0.894   1.00 0.00 ? 61 ASP A O    8 
ATOM 9246  C CB   . ASP A 1 61 ? -1.382  0.382   -0.888  1.00 0.00 ? 61 ASP A CB   8 
ATOM 9247  C CG   . ASP A 1 61 ? -2.397  1.037   -1.806  1.00 0.00 ? 61 ASP A CG   8 
ATOM 9248  O OD1  . ASP A 1 61 ? -3.427  0.397   -2.103  1.00 0.00 ? 61 ASP A OD1  8 
ATOM 9249  O OD2  . ASP A 1 61 ? -2.159  2.185   -2.235  1.00 0.00 ? 61 ASP A OD2  8 
ATOM 9250  H H    . ASP A 1 61 ? -2.119  2.006   0.858   1.00 0.00 ? 61 ASP A H    8 
ATOM 9251  H HA   . ASP A 1 61 ? -2.892  -0.615  0.259   1.00 0.00 ? 61 ASP A HA   8 
ATOM 9252  H HB2  . ASP A 1 61 ? -0.581  1.093   -0.699  1.00 0.00 ? 61 ASP A HB2  8 
ATOM 9253  H HB3  . ASP A 1 61 ? -0.978  -0.482  -1.384  1.00 0.00 ? 61 ASP A HB3  8 
ATOM 9254  N N    . ALA A 1 62 ? -0.323  -0.364  2.184   1.00 0.00 ? 62 ALA A N    8 
ATOM 9255  C CA   . ALA A 1 62 ? 0.636   -1.129  2.967   1.00 0.00 ? 62 ALA A CA   8 
ATOM 9256  C C    . ALA A 1 62 ? -0.033  -2.363  3.559   1.00 0.00 ? 62 ALA A C    8 
ATOM 9257  O O    . ALA A 1 62 ? 0.575   -3.425  3.660   1.00 0.00 ? 62 ALA A O    8 
ATOM 9258  C CB   . ALA A 1 62 ? 1.234   -0.267  4.067   1.00 0.00 ? 62 ALA A CB   8 
ATOM 9259  H H    . ALA A 1 62 ? -0.466  0.583   2.389   1.00 0.00 ? 62 ALA A H    8 
ATOM 9260  H HA   . ALA A 1 62 ? 1.432   -1.443  2.308   1.00 0.00 ? 62 ALA A HA   8 
ATOM 9261  H HB1  . ALA A 1 62 ? 1.189   0.771   3.777   1.00 0.00 ? 62 ALA A HB1  8 
ATOM 9262  H HB2  . ALA A 1 62 ? 0.677   -0.410  4.981   1.00 0.00 ? 62 ALA A HB2  8 
ATOM 9263  H HB3  . ALA A 1 62 ? 2.264   -0.551  4.227   1.00 0.00 ? 62 ALA A HB3  8 
ATOM 9264  N N    . ILE A 1 63 ? -1.300  -2.213  3.929   1.00 0.00 ? 63 ILE A N    8 
ATOM 9265  C CA   . ILE A 1 63 ? -2.066  -3.311  4.500   1.00 0.00 ? 63 ILE A CA   8 
ATOM 9266  C C    . ILE A 1 63 ? -2.128  -4.493  3.533   1.00 0.00 ? 63 ILE A C    8 
ATOM 9267  O O    . ILE A 1 63 ? -1.569  -5.553  3.815   1.00 0.00 ? 63 ILE A O    8 
ATOM 9268  C CB   . ILE A 1 63 ? -3.486  -2.853  4.900   1.00 0.00 ? 63 ILE A CB   8 
ATOM 9269  C CG1  . ILE A 1 63 ? -3.393  -1.849  6.049   1.00 0.00 ? 63 ILE A CG1  8 
ATOM 9270  C CG2  . ILE A 1 63 ? -4.353  -4.040  5.304   1.00 0.00 ? 63 ILE A CG2  8 
ATOM 9271  C CD1  . ILE A 1 63 ? -4.738  -1.340  6.524   1.00 0.00 ? 63 ILE A CD1  8 
ATOM 9272  H H    . ILE A 1 63 ? -1.732  -1.346  3.803   1.00 0.00 ? 63 ILE A H    8 
ATOM 9273  H HA   . ILE A 1 63 ? -1.553  -3.630  5.397   1.00 0.00 ? 63 ILE A HA   8 
ATOM 9274  H HB   . ILE A 1 63 ? -3.942  -2.368  4.049   1.00 0.00 ? 63 ILE A HB   8 
ATOM 9275  H HG12 . ILE A 1 63 ? -2.901  -2.319  6.888   1.00 0.00 ? 63 ILE A HG12 8 
ATOM 9276  H HG13 . ILE A 1 63 ? -2.810  -0.998  5.727   1.00 0.00 ? 63 ILE A HG13 8 
ATOM 9277  H HG21 . ILE A 1 63 ? -4.358  -4.769  4.508   1.00 0.00 ? 63 ILE A HG21 8 
ATOM 9278  H HG22 . ILE A 1 63 ? -3.953  -4.489  6.201   1.00 0.00 ? 63 ILE A HG22 8 
ATOM 9279  H HG23 . ILE A 1 63 ? -5.361  -3.702  5.489   1.00 0.00 ? 63 ILE A HG23 8 
ATOM 9280  H HD11 . ILE A 1 63 ? -5.481  -2.114  6.395   1.00 0.00 ? 63 ILE A HD11 8 
ATOM 9281  H HD12 . ILE A 1 63 ? -4.673  -1.073  7.567   1.00 0.00 ? 63 ILE A HD12 8 
ATOM 9282  H HD13 . ILE A 1 63 ? -5.019  -0.472  5.946   1.00 0.00 ? 63 ILE A HD13 8 
ATOM 9283  N N    . PRO A 1 64 ? -2.802  -4.348  2.377   1.00 0.00 ? 64 PRO A N    8 
ATOM 9284  C CA   . PRO A 1 64 ? -2.887  -5.435  1.408   1.00 0.00 ? 64 PRO A CA   8 
ATOM 9285  C C    . PRO A 1 64 ? -1.505  -5.855  0.935   1.00 0.00 ? 64 PRO A C    8 
ATOM 9286  O O    . PRO A 1 64 ? -1.303  -6.986  0.497   1.00 0.00 ? 64 PRO A O    8 
ATOM 9287  C CB   . PRO A 1 64 ? -3.712  -4.855  0.254   1.00 0.00 ? 64 PRO A CB   8 
ATOM 9288  C CG   . PRO A 1 64 ? -3.680  -3.376  0.449   1.00 0.00 ? 64 PRO A CG   8 
ATOM 9289  C CD   . PRO A 1 64 ? -3.522  -3.147  1.925   1.00 0.00 ? 64 PRO A CD   8 
ATOM 9290  H HA   . PRO A 1 64 ? -3.388  -6.290  1.827   1.00 0.00 ? 64 PRO A HA   8 
ATOM 9291  H HB2  . PRO A 1 64 ? -3.264  -5.137  -0.687  1.00 0.00 ? 64 PRO A HB2  8 
ATOM 9292  H HB3  . PRO A 1 64 ? -4.721  -5.236  0.304   1.00 0.00 ? 64 PRO A HB3  8 
ATOM 9293  H HG2  . PRO A 1 64 ? -2.845  -2.952  -0.088  1.00 0.00 ? 64 PRO A HG2  8 
ATOM 9294  H HG3  . PRO A 1 64 ? -4.609  -2.945  0.102   1.00 0.00 ? 64 PRO A HG3  8 
ATOM 9295  H HD2  . PRO A 1 64 ? -2.947  -2.255  2.113   1.00 0.00 ? 64 PRO A HD2  8 
ATOM 9296  H HD3  . PRO A 1 64 ? -4.491  -3.081  2.399   1.00 0.00 ? 64 PRO A HD3  8 
ATOM 9297  N N    . MET A 1 65 ? -0.550  -4.942  1.060   1.00 0.00 ? 65 MET A N    8 
ATOM 9298  C CA   . MET A 1 65 ? 0.825   -5.229  0.678   1.00 0.00 ? 65 MET A CA   8 
ATOM 9299  C C    . MET A 1 65 ? 1.429   -6.171  1.714   1.00 0.00 ? 65 MET A C    8 
ATOM 9300  O O    . MET A 1 65 ? 2.252   -7.024  1.398   1.00 0.00 ? 65 MET A O    8 
ATOM 9301  C CB   . MET A 1 65 ? 1.636   -3.933  0.607   1.00 0.00 ? 65 MET A CB   8 
ATOM 9302  C CG   . MET A 1 65 ? 2.755   -3.938  -0.422  1.00 0.00 ? 65 MET A CG   8 
ATOM 9303  S SD   . MET A 1 65 ? 3.861   -5.356  -0.282  1.00 0.00 ? 65 MET A SD   8 
ATOM 9304  C CE   . MET A 1 65 ? 2.994   -6.567  -1.277  1.00 0.00 ? 65 MET A CE   8 
ATOM 9305  H H    . MET A 1 65 ? -0.771  -4.065  1.445   1.00 0.00 ? 65 MET A H    8 
ATOM 9306  H HA   . MET A 1 65 ? 0.819   -5.713  -0.289  1.00 0.00 ? 65 MET A HA   8 
ATOM 9307  H HB2  . MET A 1 65 ? 0.967   -3.122  0.370   1.00 0.00 ? 65 MET A HB2  8 
ATOM 9308  H HB3  . MET A 1 65 ? 2.074   -3.748  1.571   1.00 0.00 ? 65 MET A HB3  8 
ATOM 9309  H HG2  . MET A 1 65 ? 2.312   -3.947  -1.399  1.00 0.00 ? 65 MET A HG2  8 
ATOM 9310  H HG3  . MET A 1 65 ? 3.335   -3.034  -0.304  1.00 0.00 ? 65 MET A HG3  8 
ATOM 9311  H HE1  . MET A 1 65 ? 2.124   -6.109  -1.724  1.00 0.00 ? 65 MET A HE1  8 
ATOM 9312  H HE2  . MET A 1 65 ? 3.650   -6.928  -2.056  1.00 0.00 ? 65 MET A HE2  8 
ATOM 9313  H HE3  . MET A 1 65 ? 2.687   -7.394  -0.656  1.00 0.00 ? 65 MET A HE3  8 
ATOM 9314  N N    . ILE A 1 66 ? 0.975   -6.022  2.957   1.00 0.00 ? 66 ILE A N    8 
ATOM 9315  C CA   . ILE A 1 66 ? 1.437   -6.867  4.051   1.00 0.00 ? 66 ILE A CA   8 
ATOM 9316  C C    . ILE A 1 66 ? 0.806   -8.248  3.936   1.00 0.00 ? 66 ILE A C    8 
ATOM 9317  O O    . ILE A 1 66 ? 1.488   -9.266  4.045   1.00 0.00 ? 66 ILE A O    8 
ATOM 9318  C CB   . ILE A 1 66 ? 1.104   -6.233  5.428   1.00 0.00 ? 66 ILE A CB   8 
ATOM 9319  C CG1  . ILE A 1 66 ? 2.003   -5.021  5.678   1.00 0.00 ? 66 ILE A CG1  8 
ATOM 9320  C CG2  . ILE A 1 66 ? 1.249   -7.234  6.568   1.00 0.00 ? 66 ILE A CG2  8 
ATOM 9321  C CD1  . ILE A 1 66 ? 1.650   -4.257  6.934   1.00 0.00 ? 66 ILE A CD1  8 
ATOM 9322  H H    . ILE A 1 66 ? 0.293   -5.340  3.137   1.00 0.00 ? 66 ILE A H    8 
ATOM 9323  H HA   . ILE A 1 66 ? 2.514   -6.963  3.972   1.00 0.00 ? 66 ILE A HA   8 
ATOM 9324  H HB   . ILE A 1 66 ? 0.077   -5.904  5.409   1.00 0.00 ? 66 ILE A HB   8 
ATOM 9325  H HG12 . ILE A 1 66 ? 3.024   -5.356  5.773   1.00 0.00 ? 66 ILE A HG12 8 
ATOM 9326  H HG13 . ILE A 1 66 ? 1.929   -4.345  4.843   1.00 0.00 ? 66 ILE A HG13 8 
ATOM 9327  H HG21 . ILE A 1 66 ? 0.965   -8.217  6.231   1.00 0.00 ? 66 ILE A HG21 8 
ATOM 9328  H HG22 . ILE A 1 66 ? 2.276   -7.251  6.903   1.00 0.00 ? 66 ILE A HG22 8 
ATOM 9329  H HG23 . ILE A 1 66 ? 0.608   -6.936  7.386   1.00 0.00 ? 66 ILE A HG23 8 
ATOM 9330  H HD11 . ILE A 1 66 ? 0.627   -3.915  6.872   1.00 0.00 ? 66 ILE A HD11 8 
ATOM 9331  H HD12 . ILE A 1 66 ? 1.761   -4.902  7.793   1.00 0.00 ? 66 ILE A HD12 8 
ATOM 9332  H HD13 . ILE A 1 66 ? 2.307   -3.406  7.035   1.00 0.00 ? 66 ILE A HD13 8 
ATOM 9333  N N    . ALA A 1 67 ? -0.502  -8.273  3.703   1.00 0.00 ? 67 ALA A N    8 
ATOM 9334  C CA   . ALA A 1 67 ? -1.224  -9.523  3.559   1.00 0.00 ? 67 ALA A CA   8 
ATOM 9335  C C    . ALA A 1 67 ? -0.800  -10.234 2.283   1.00 0.00 ? 67 ALA A C    8 
ATOM 9336  O O    . ALA A 1 67 ? -0.333  -11.372 2.317   1.00 0.00 ? 67 ALA A O    8 
ATOM 9337  C CB   . ALA A 1 67 ? -2.724  -9.274  3.565   1.00 0.00 ? 67 ALA A CB   8 
ATOM 9338  H H    . ALA A 1 67 ? -0.989  -7.430  3.617   1.00 0.00 ? 67 ALA A H    8 
ATOM 9339  H HA   . ALA A 1 67 ? -0.977  -10.141 4.405   1.00 0.00 ? 67 ALA A HA   8 
ATOM 9340  H HB1  . ALA A 1 67 ? -2.918  -8.243  3.306   1.00 0.00 ? 67 ALA A HB1  8 
ATOM 9341  H HB2  . ALA A 1 67 ? -3.200  -9.922  2.844   1.00 0.00 ? 67 ALA A HB2  8 
ATOM 9342  H HB3  . ALA A 1 67 ? -3.119  -9.477  4.548   1.00 0.00 ? 67 ALA A HB3  8 
ATOM 9343  N N    . VAL A 1 68 ? -0.953  -9.547  1.157   1.00 0.00 ? 68 VAL A N    8 
ATOM 9344  C CA   . VAL A 1 68 ? -0.574  -10.108 -0.130  1.00 0.00 ? 68 VAL A CA   8 
ATOM 9345  C C    . VAL A 1 68 ? 0.930   -10.338 -0.186  1.00 0.00 ? 68 VAL A C    8 
ATOM 9346  O O    . VAL A 1 68 ? 1.396   -11.301 -0.792  1.00 0.00 ? 68 VAL A O    8 
ATOM 9347  C CB   . VAL A 1 68 ? -1.002  -9.191  -1.296  1.00 0.00 ? 68 VAL A CB   8 
ATOM 9348  C CG1  . VAL A 1 68 ? -0.597  -9.794  -2.634  1.00 0.00 ? 68 VAL A CG1  8 
ATOM 9349  C CG2  . VAL A 1 68 ? -2.502  -8.941  -1.254  1.00 0.00 ? 68 VAL A CG2  8 
ATOM 9350  H H    . VAL A 1 68 ? -1.320  -8.640  1.194   1.00 0.00 ? 68 VAL A H    8 
ATOM 9351  H HA   . VAL A 1 68 ? -1.075  -11.060 -0.238  1.00 0.00 ? 68 VAL A HA   8 
ATOM 9352  H HB   . VAL A 1 68 ? -0.496  -8.240  -1.188  1.00 0.00 ? 68 VAL A HB   8 
ATOM 9353  H HG11 . VAL A 1 68 ? -0.494  -10.864 -2.530  1.00 0.00 ? 68 VAL A HG11 8 
ATOM 9354  H HG12 . VAL A 1 68 ? -1.356  -9.576  -3.372  1.00 0.00 ? 68 VAL A HG12 8 
ATOM 9355  H HG13 . VAL A 1 68 ? 0.344   -9.369  -2.950  1.00 0.00 ? 68 VAL A HG13 8 
ATOM 9356  H HG21 . VAL A 1 68 ? -3.025  -9.887  -1.259  1.00 0.00 ? 68 VAL A HG21 8 
ATOM 9357  H HG22 . VAL A 1 68 ? -2.753  -8.398  -0.355  1.00 0.00 ? 68 VAL A HG22 8 
ATOM 9358  H HG23 . VAL A 1 68 ? -2.796  -8.363  -2.117  1.00 0.00 ? 68 VAL A HG23 8 
ATOM 9359  N N    . GLY A 1 69 ? 1.686   -9.455  0.463   1.00 0.00 ? 69 GLY A N    8 
ATOM 9360  C CA   . GLY A 1 69 ? 3.131   -9.595  0.481   1.00 0.00 ? 69 GLY A CA   8 
ATOM 9361  C C    . GLY A 1 69 ? 3.563   -10.821 1.258   1.00 0.00 ? 69 GLY A C    8 
ATOM 9362  O O    . GLY A 1 69 ? 4.339   -11.638 0.763   1.00 0.00 ? 69 GLY A O    8 
ATOM 9363  H H    . GLY A 1 69 ? 1.261   -8.712  0.940   1.00 0.00 ? 69 GLY A H    8 
ATOM 9364  H HA2  . GLY A 1 69 ? 3.490   -9.678  -0.536  1.00 0.00 ? 69 GLY A HA2  8 
ATOM 9365  H HA3  . GLY A 1 69 ? 3.569   -8.720  0.937   1.00 0.00 ? 69 GLY A HA3  8 
ATOM 9366  N N    . LEU A 1 70 ? 3.044   -10.956 2.476   1.00 0.00 ? 70 LEU A N    8 
ATOM 9367  C CA   . LEU A 1 70 ? 3.364   -12.104 3.314   1.00 0.00 ? 70 LEU A CA   8 
ATOM 9368  C C    . LEU A 1 70 ? 2.935   -13.379 2.621   1.00 0.00 ? 70 LEU A C    8 
ATOM 9369  O O    . LEU A 1 70 ? 3.653   -14.379 2.612   1.00 0.00 ? 70 LEU A O    8 
ATOM 9370  C CB   . LEU A 1 70 ? 2.644   -12.003 4.656   1.00 0.00 ? 70 LEU A CB   8 
ATOM 9371  C CG   . LEU A 1 70 ? 2.928   -13.150 5.630   1.00 0.00 ? 70 LEU A CG   8 
ATOM 9372  C CD1  . LEU A 1 70 ? 4.407   -13.203 5.988   1.00 0.00 ? 70 LEU A CD1  8 
ATOM 9373  C CD2  . LEU A 1 70 ? 2.074   -13.009 6.881   1.00 0.00 ? 70 LEU A CD2  8 
ATOM 9374  H H    . LEU A 1 70 ? 2.419   -10.278 2.811   1.00 0.00 ? 70 LEU A H    8 
ATOM 9375  H HA   . LEU A 1 70 ? 4.431   -12.123 3.477   1.00 0.00 ? 70 LEU A HA   8 
ATOM 9376  H HB2  . LEU A 1 70 ? 2.927   -11.076 5.121   1.00 0.00 ? 70 LEU A HB2  8 
ATOM 9377  H HB3  . LEU A 1 70 ? 1.581   -11.980 4.468   1.00 0.00 ? 70 LEU A HB3  8 
ATOM 9378  H HG   . LEU A 1 70 ? 2.669   -14.085 5.154   1.00 0.00 ? 70 LEU A HG   8 
ATOM 9379  H HD11 . LEU A 1 70 ? 4.956   -12.520 5.358   1.00 0.00 ? 70 LEU A HD11 8 
ATOM 9380  H HD12 . LEU A 1 70 ? 4.537   -12.923 7.023   1.00 0.00 ? 70 LEU A HD12 8 
ATOM 9381  H HD13 . LEU A 1 70 ? 4.777   -14.207 5.838   1.00 0.00 ? 70 LEU A HD13 8 
ATOM 9382  H HD21 . LEU A 1 70 ? 1.102   -12.625 6.613   1.00 0.00 ? 70 LEU A HD21 8 
ATOM 9383  H HD22 . LEU A 1 70 ? 1.963   -13.976 7.351   1.00 0.00 ? 70 LEU A HD22 8 
ATOM 9384  H HD23 . LEU A 1 70 ? 2.553   -12.328 7.569   1.00 0.00 ? 70 LEU A HD23 8 
ATOM 9385  N N    . GLY A 1 71 ? 1.746   -13.327 2.044   1.00 0.00 ? 71 GLY A N    8 
ATOM 9386  C CA   . GLY A 1 71 ? 1.210   -14.476 1.350   1.00 0.00 ? 71 GLY A CA   8 
ATOM 9387  C C    . GLY A 1 71 ? 2.080   -14.911 0.189   1.00 0.00 ? 71 GLY A C    8 
ATOM 9388  O O    . GLY A 1 71 ? 2.563   -16.037 0.159   1.00 0.00 ? 71 GLY A O    8 
ATOM 9389  H H    . GLY A 1 71 ? 1.225   -12.493 2.096   1.00 0.00 ? 71 GLY A H    8 
ATOM 9390  H HA2  . GLY A 1 71 ? 1.120   -15.296 2.048   1.00 0.00 ? 71 GLY A HA2  8 
ATOM 9391  H HA3  . GLY A 1 71 ? 0.226   -14.229 0.974   1.00 0.00 ? 71 GLY A HA3  8 
ATOM 9392  N N    . LEU A 1 72 ? 2.282   -14.012 -0.764  1.00 0.00 ? 72 LEU A N    8 
ATOM 9393  C CA   . LEU A 1 72 ? 3.092   -14.303 -1.940  1.00 0.00 ? 72 LEU A CA   8 
ATOM 9394  C C    . LEU A 1 72 ? 4.520   -14.642 -1.546  1.00 0.00 ? 72 LEU A C    8 
ATOM 9395  O O    . LEU A 1 72 ? 5.210   -15.391 -2.238  1.00 0.00 ? 72 LEU A O    8 
ATOM 9396  C CB   . LEU A 1 72 ? 3.075   -13.117 -2.910  1.00 0.00 ? 72 LEU A CB   8 
ATOM 9397  C CG   . LEU A 1 72 ? 3.660   -11.811 -2.370  1.00 0.00 ? 72 LEU A CG   8 
ATOM 9398  C CD1  . LEU A 1 72 ? 5.178   -11.796 -2.500  1.00 0.00 ? 72 LEU A CD1  8 
ATOM 9399  C CD2  . LEU A 1 72 ? 3.049   -10.617 -3.090  1.00 0.00 ? 72 LEU A CD2  8 
ATOM 9400  H H    . LEU A 1 72 ? 1.877   -13.133 -0.675  1.00 0.00 ? 72 LEU A H    8 
ATOM 9401  H HA   . LEU A 1 72 ? 2.652   -15.154 -2.431  1.00 0.00 ? 72 LEU A HA   8 
ATOM 9402  H HB2  . LEU A 1 72 ? 3.633   -13.394 -3.789  1.00 0.00 ? 72 LEU A HB2  8 
ATOM 9403  H HB3  . LEU A 1 72 ? 2.052   -12.931 -3.197  1.00 0.00 ? 72 LEU A HB3  8 
ATOM 9404  H HG   . LEU A 1 72 ? 3.419   -11.730 -1.322  1.00 0.00 ? 72 LEU A HG   8 
ATOM 9405  H HD11 . LEU A 1 72 ? 5.543   -12.803 -2.618  1.00 0.00 ? 72 LEU A HD11 8 
ATOM 9406  H HD12 . LEU A 1 72 ? 5.457   -11.210 -3.366  1.00 0.00 ? 72 LEU A HD12 8 
ATOM 9407  H HD13 . LEU A 1 72 ? 5.611   -11.356 -1.615  1.00 0.00 ? 72 LEU A HD13 8 
ATOM 9408  H HD21 . LEU A 1 72 ? 2.647   -10.936 -4.040  1.00 0.00 ? 72 LEU A HD21 8 
ATOM 9409  H HD22 . LEU A 1 72 ? 2.257   -10.199 -2.487  1.00 0.00 ? 72 LEU A HD22 8 
ATOM 9410  H HD23 . LEU A 1 72 ? 3.809   -9.867  -3.254  1.00 0.00 ? 72 LEU A HD23 8 
ATOM 9411  N N    . TYR A 1 73 ? 4.946   -14.101 -0.415  1.00 0.00 ? 73 TYR A N    8 
ATOM 9412  C CA   . TYR A 1 73 ? 6.286   -14.339 0.094   1.00 0.00 ? 73 TYR A CA   8 
ATOM 9413  C C    . TYR A 1 73 ? 6.509   -15.827 0.307   1.00 0.00 ? 73 TYR A C    8 
ATOM 9414  O O    . TYR A 1 73 ? 7.545   -16.376 -0.066  1.00 0.00 ? 73 TYR A O    8 
ATOM 9415  C CB   . TYR A 1 73 ? 6.482   -13.583 1.410   1.00 0.00 ? 73 TYR A CB   8 
ATOM 9416  C CG   . TYR A 1 73 ? 7.857   -13.749 2.007   1.00 0.00 ? 73 TYR A CG   8 
ATOM 9417  C CD1  . TYR A 1 73 ? 8.949   -13.060 1.493   1.00 0.00 ? 73 TYR A CD1  8 
ATOM 9418  C CD2  . TYR A 1 73 ? 8.065   -14.614 3.071   1.00 0.00 ? 73 TYR A CD2  8 
ATOM 9419  C CE1  . TYR A 1 73 ? 10.214  -13.231 2.028   1.00 0.00 ? 73 TYR A CE1  8 
ATOM 9420  C CE2  . TYR A 1 73 ? 9.325   -14.788 3.614   1.00 0.00 ? 73 TYR A CE2  8 
ATOM 9421  C CZ   . TYR A 1 73 ? 10.395  -14.094 3.088   1.00 0.00 ? 73 TYR A CZ   8 
ATOM 9422  O OH   . TYR A 1 73 ? 11.651  -14.266 3.624   1.00 0.00 ? 73 TYR A OH   8 
ATOM 9423  H H    . TYR A 1 73 ? 4.337   -13.536 0.097   1.00 0.00 ? 73 TYR A H    8 
ATOM 9424  H HA   . TYR A 1 73 ? 6.995   -13.974 -0.640  1.00 0.00 ? 73 TYR A HA   8 
ATOM 9425  H HB2  . TYR A 1 73 ? 6.320   -12.531 1.239   1.00 0.00 ? 73 TYR A HB2  8 
ATOM 9426  H HB3  . TYR A 1 73 ? 5.762   -13.940 2.131   1.00 0.00 ? 73 TYR A HB3  8 
ATOM 9427  H HD1  . TYR A 1 73 ? 8.801   -12.381 0.665   1.00 0.00 ? 73 TYR A HD1  8 
ATOM 9428  H HD2  . TYR A 1 73 ? 7.220   -15.154 3.477   1.00 0.00 ? 73 TYR A HD2  8 
ATOM 9429  H HE1  . TYR A 1 73 ? 11.054  -12.689 1.618   1.00 0.00 ? 73 TYR A HE1  8 
ATOM 9430  H HE2  . TYR A 1 73 ? 9.469   -15.464 4.445   1.00 0.00 ? 73 TYR A HE2  8 
ATOM 9431  H HH   . TYR A 1 73 ? 12.290  -14.367 2.915   1.00 0.00 ? 73 TYR A HH   8 
ATOM 9432  N N    . VAL A 1 74 ? 5.522   -16.475 0.906   1.00 0.00 ? 74 VAL A N    8 
ATOM 9433  C CA   . VAL A 1 74 ? 5.592   -17.903 1.172   1.00 0.00 ? 74 VAL A CA   8 
ATOM 9434  C C    . VAL A 1 74 ? 5.003   -18.703 0.015   1.00 0.00 ? 74 VAL A C    8 
ATOM 9435  O O    . VAL A 1 74 ? 5.440   -19.815 -0.272  1.00 0.00 ? 74 VAL A O    8 
ATOM 9436  C CB   . VAL A 1 74 ? 4.852   -18.269 2.474   1.00 0.00 ? 74 VAL A CB   8 
ATOM 9437  C CG1  . VAL A 1 74 ? 5.043   -19.741 2.809   1.00 0.00 ? 74 VAL A CG1  8 
ATOM 9438  C CG2  . VAL A 1 74 ? 5.326   -17.388 3.621   1.00 0.00 ? 74 VAL A CG2  8 
ATOM 9439  H H    . VAL A 1 74 ? 4.719   -15.979 1.174   1.00 0.00 ? 74 VAL A H    8 
ATOM 9440  H HA   . VAL A 1 74 ? 6.635   -18.172 1.285   1.00 0.00 ? 74 VAL A HA   8 
ATOM 9441  H HB   . VAL A 1 74 ? 3.797   -18.092 2.326   1.00 0.00 ? 74 VAL A HB   8 
ATOM 9442  H HG11 . VAL A 1 74 ? 6.097   -19.957 2.897   1.00 0.00 ? 74 VAL A HG11 8 
ATOM 9443  H HG12 . VAL A 1 74 ? 4.550   -19.964 3.743   1.00 0.00 ? 74 VAL A HG12 8 
ATOM 9444  H HG13 . VAL A 1 74 ? 4.617   -20.347 2.023   1.00 0.00 ? 74 VAL A HG13 8 
ATOM 9445  H HG21 . VAL A 1 74 ? 5.162   -16.350 3.369   1.00 0.00 ? 74 VAL A HG21 8 
ATOM 9446  H HG22 . VAL A 1 74 ? 4.773   -17.634 4.515   1.00 0.00 ? 74 VAL A HG22 8 
ATOM 9447  H HG23 . VAL A 1 74 ? 6.379   -17.554 3.792   1.00 0.00 ? 74 VAL A HG23 8 
ATOM 9448  N N    . MET A 1 75 ? 3.998   -18.142 -0.648  1.00 0.00 ? 75 MET A N    8 
ATOM 9449  C CA   . MET A 1 75 ? 3.366   -18.830 -1.755  1.00 0.00 ? 75 MET A CA   8 
ATOM 9450  C C    . MET A 1 75 ? 4.089   -18.569 -3.069  1.00 0.00 ? 75 MET A C    8 
ATOM 9451  O O    . MET A 1 75 ? 4.717   -19.461 -3.629  1.00 0.00 ? 75 MET A O    8 
ATOM 9452  C CB   . MET A 1 75 ? 1.903   -18.412 -1.856  1.00 0.00 ? 75 MET A CB   8 
ATOM 9453  C CG   . MET A 1 75 ? 0.946   -19.440 -1.280  1.00 0.00 ? 75 MET A CG   8 
ATOM 9454  S SD   . MET A 1 75 ? 1.399   -19.997 0.377   1.00 0.00 ? 75 MET A SD   8 
ATOM 9455  C CE   . MET A 1 75 ? 1.078   -18.525 1.342   1.00 0.00 ? 75 MET A CE   8 
ATOM 9456  H H    . MET A 1 75 ? 3.672   -17.255 -0.387  1.00 0.00 ? 75 MET A H    8 
ATOM 9457  H HA   . MET A 1 75 ? 3.406   -19.884 -1.543  1.00 0.00 ? 75 MET A HA   8 
ATOM 9458  H HB2  . MET A 1 75 ? 1.767   -17.484 -1.319  1.00 0.00 ? 75 MET A HB2  8 
ATOM 9459  H HB3  . MET A 1 75 ? 1.652   -18.257 -2.895  1.00 0.00 ? 75 MET A HB3  8 
ATOM 9460  H HG2  . MET A 1 75 ? -0.030  -18.995 -1.231  1.00 0.00 ? 75 MET A HG2  8 
ATOM 9461  H HG3  . MET A 1 75 ? 0.918   -20.295 -1.939  1.00 0.00 ? 75 MET A HG3  8 
ATOM 9462  H HE1  . MET A 1 75 ? 1.322   -17.652 0.758   1.00 0.00 ? 75 MET A HE1  8 
ATOM 9463  H HE2  . MET A 1 75 ? 0.034   -18.494 1.615   1.00 0.00 ? 75 MET A HE2  8 
ATOM 9464  H HE3  . MET A 1 75 ? 1.684   -18.541 2.236   1.00 0.00 ? 75 MET A HE3  8 
ATOM 9465  N N    . PHE A 1 76 ? 3.997   -17.349 -3.565  1.00 0.00 ? 76 PHE A N    8 
ATOM 9466  C CA   . PHE A 1 76 ? 4.643   -17.000 -4.823  1.00 0.00 ? 76 PHE A CA   8 
ATOM 9467  C C    . PHE A 1 76 ? 6.150   -17.236 -4.772  1.00 0.00 ? 76 PHE A C    8 
ATOM 9468  O O    . PHE A 1 76 ? 6.777   -17.478 -5.804  1.00 0.00 ? 76 PHE A O    8 
ATOM 9469  C CB   . PHE A 1 76 ? 4.361   -15.540 -5.189  1.00 0.00 ? 76 PHE A CB   8 
ATOM 9470  C CG   . PHE A 1 76 ? 2.975   -15.294 -5.727  1.00 0.00 ? 76 PHE A CG   8 
ATOM 9471  C CD1  . PHE A 1 76 ? 1.852   -15.569 -4.964  1.00 0.00 ? 76 PHE A CD1  8 
ATOM 9472  C CD2  . PHE A 1 76 ? 2.799   -14.785 -7.004  1.00 0.00 ? 76 PHE A CD2  8 
ATOM 9473  C CE1  . PHE A 1 76 ? 0.585   -15.343 -5.462  1.00 0.00 ? 76 PHE A CE1  8 
ATOM 9474  C CE2  . PHE A 1 76 ? 1.533   -14.557 -7.506  1.00 0.00 ? 76 PHE A CE2  8 
ATOM 9475  C CZ   . PHE A 1 76 ? 0.425   -14.837 -6.734  1.00 0.00 ? 76 PHE A CZ   8 
ATOM 9476  H H    . PHE A 1 76 ? 3.477   -16.672 -3.084  1.00 0.00 ? 76 PHE A H    8 
ATOM 9477  H HA   . PHE A 1 76 ? 4.224   -17.639 -5.588  1.00 0.00 ? 76 PHE A HA   8 
ATOM 9478  H HB2  . PHE A 1 76 ? 4.487   -14.930 -4.309  1.00 0.00 ? 76 PHE A HB2  8 
ATOM 9479  H HB3  . PHE A 1 76 ? 5.071   -15.227 -5.938  1.00 0.00 ? 76 PHE A HB3  8 
ATOM 9480  H HD1  . PHE A 1 76 ? 1.972   -15.968 -3.970  1.00 0.00 ? 76 PHE A HD1  8 
ATOM 9481  H HD2  . PHE A 1 76 ? 3.665   -14.564 -7.609  1.00 0.00 ? 76 PHE A HD2  8 
ATOM 9482  H HE1  . PHE A 1 76 ? -0.281  -15.560 -4.854  1.00 0.00 ? 76 PHE A HE1  8 
ATOM 9483  H HE2  . PHE A 1 76 ? 1.410   -14.159 -8.503  1.00 0.00 ? 76 PHE A HE2  8 
ATOM 9484  H HZ   . PHE A 1 76 ? -0.566  -14.658 -7.125  1.00 0.00 ? 76 PHE A HZ   8 
ATOM 9485  N N    . ALA A 1 77 ? 6.736   -17.161 -3.580  1.00 0.00 ? 77 ALA A N    8 
ATOM 9486  C CA   . ALA A 1 77 ? 8.168   -17.361 -3.433  1.00 0.00 ? 77 ALA A CA   8 
ATOM 9487  C C    . ALA A 1 77 ? 8.496   -18.773 -2.979  1.00 0.00 ? 77 ALA A C    8 
ATOM 9488  O O    . ALA A 1 77 ? 9.181   -19.521 -3.678  1.00 0.00 ? 77 ALA A O    8 
ATOM 9489  C CB   . ALA A 1 77 ? 8.746   -16.341 -2.463  1.00 0.00 ? 77 ALA A CB   8 
ATOM 9490  H H    . ALA A 1 77 ? 6.201   -16.962 -2.789  1.00 0.00 ? 77 ALA A H    8 
ATOM 9491  H HA   . ALA A 1 77 ? 8.619   -17.195 -4.388  1.00 0.00 ? 77 ALA A HA   8 
ATOM 9492  H HB1  . ALA A 1 77 ? 7.970   -15.652 -2.161  1.00 0.00 ? 77 ALA A HB1  8 
ATOM 9493  H HB2  . ALA A 1 77 ? 9.135   -16.850 -1.592  1.00 0.00 ? 77 ALA A HB2  8 
ATOM 9494  H HB3  . ALA A 1 77 ? 9.543   -15.796 -2.946  1.00 0.00 ? 77 ALA A HB3  8 
ATOM 9495  N N    . VAL A 1 78 ? 8.019   -19.122 -1.799  1.00 0.00 ? 78 VAL A N    8 
ATOM 9496  C CA   . VAL A 1 78 ? 8.273   -20.438 -1.233  1.00 0.00 ? 78 VAL A CA   8 
ATOM 9497  C C    . VAL A 1 78 ? 7.291   -21.490 -1.754  1.00 0.00 ? 78 VAL A C    8 
ATOM 9498  O O    . VAL A 1 78 ? 7.356   -22.652 -1.350  1.00 0.00 ? 78 VAL A O    8 
ATOM 9499  C CB   . VAL A 1 78 ? 8.223   -20.409 0.310   1.00 0.00 ? 78 VAL A CB   8 
ATOM 9500  C CG1  . VAL A 1 78 ? 8.668   -21.743 0.889   1.00 0.00 ? 78 VAL A CG1  8 
ATOM 9501  C CG2  . VAL A 1 78 ? 9.076   -19.272 0.848   1.00 0.00 ? 78 VAL A CG2  8 
ATOM 9502  H H    . VAL A 1 78 ? 7.497   -18.474 -1.292  1.00 0.00 ? 78 VAL A H    8 
ATOM 9503  H HA   . VAL A 1 78 ? 9.269   -20.725 -1.525  1.00 0.00 ? 78 VAL A HA   8 
ATOM 9504  H HB   . VAL A 1 78 ? 7.205   -20.238 0.618   1.00 0.00 ? 78 VAL A HB   8 
ATOM 9505  H HG11 . VAL A 1 78 ? 9.292   -22.257 0.171   1.00 0.00 ? 78 VAL A HG11 8 
ATOM 9506  H HG12 . VAL A 1 78 ? 9.229   -21.572 1.796   1.00 0.00 ? 78 VAL A HG12 8 
ATOM 9507  H HG13 . VAL A 1 78 ? 7.802   -22.348 1.110   1.00 0.00 ? 78 VAL A HG13 8 
ATOM 9508  H HG21 . VAL A 1 78 ? 8.744   -18.338 0.417   1.00 0.00 ? 78 VAL A HG21 8 
ATOM 9509  H HG22 . VAL A 1 78 ? 8.979   -19.226 1.923   1.00 0.00 ? 78 VAL A HG22 8 
ATOM 9510  H HG23 . VAL A 1 78 ? 10.110  -19.443 0.587   1.00 0.00 ? 78 VAL A HG23 8 
ATOM 9511  N N    . ALA A 1 79 ? 6.384   -21.093 -2.652  1.00 0.00 ? 79 ALA A N    8 
ATOM 9512  C CA   . ALA A 1 79 ? 5.414   -22.035 -3.208  1.00 0.00 ? 79 ALA A CA   8 
ATOM 9513  C C    . ALA A 1 79 ? 4.521   -22.615 -2.118  1.00 0.00 ? 79 ALA A C    8 
ATOM 9514  O O    . ALA A 1 79 ? 3.383   -23.007 -2.377  1.00 0.00 ? 79 ALA A O    8 
ATOM 9515  C CB   . ALA A 1 79 ? 6.129   -23.152 -3.954  1.00 0.00 ? 79 ALA A CB   8 
ATOM 9516  H H    . ALA A 1 79 ? 6.366   -20.153 -2.948  1.00 0.00 ? 79 ALA A H    8 
ATOM 9517  H HA   . ALA A 1 79 ? 4.795   -21.504 -3.917  1.00 0.00 ? 79 ALA A HA   8 
ATOM 9518  H HB1  . ALA A 1 79 ? 6.930   -23.539 -3.343  1.00 0.00 ? 79 ALA A HB1  8 
ATOM 9519  H HB2  . ALA A 1 79 ? 5.430   -23.944 -4.174  1.00 0.00 ? 79 ALA A HB2  8 
ATOM 9520  H HB3  . ALA A 1 79 ? 6.536   -22.764 -4.877  1.00 0.00 ? 79 ALA A HB3  8 
ATOM 9521  N N    . MET A 1 1  ? -3.751  -29.667 -1.828  1.00 0.00 ? 1  MET A N    9 
ATOM 9522  C CA   . MET A 1 1  ? -4.199  -28.366 -1.259  1.00 0.00 ? 1  MET A CA   9 
ATOM 9523  C C    . MET A 1 1  ? -3.493  -27.178 -1.909  1.00 0.00 ? 1  MET A C    9 
ATOM 9524  O O    . MET A 1 1  ? -3.864  -26.027 -1.682  1.00 0.00 ? 1  MET A O    9 
ATOM 9525  C CB   . MET A 1 1  ? -3.948  -28.367 0.254   1.00 0.00 ? 1  MET A CB   9 
ATOM 9526  C CG   . MET A 1 1  ? -4.811  -29.354 1.028   1.00 0.00 ? 1  MET A CG   9 
ATOM 9527  S SD   . MET A 1 1  ? -4.313  -31.072 0.792   1.00 0.00 ? 1  MET A SD   9 
ATOM 9528  C CE   . MET A 1 1  ? -2.663  -31.051 1.490   1.00 0.00 ? 1  MET A CE   9 
ATOM 9529  H H1   . MET A 1 1  ? -3.583  -29.529 -2.844  1.00 0.00 ? 1  MET A H1   9 
ATOM 9530  H H2   . MET A 1 1  ? -2.877  -29.945 -1.336  1.00 0.00 ? 1  MET A H2   9 
ATOM 9531  H H3   . MET A 1 1  ? -4.509  -30.359 -1.669  1.00 0.00 ? 1  MET A H3   9 
ATOM 9532  H HA   . MET A 1 1  ? -5.252  -28.270 -1.436  1.00 0.00 ? 1  MET A HA   9 
ATOM 9533  H HB2  . MET A 1 1  ? -2.912  -28.612 0.433   1.00 0.00 ? 1  MET A HB2  9 
ATOM 9534  H HB3  . MET A 1 1  ? -4.145  -27.378 0.637   1.00 0.00 ? 1  MET A HB3  9 
ATOM 9535  H HG2  . MET A 1 1  ? -4.744  -29.119 2.080   1.00 0.00 ? 1  MET A HG2  9 
ATOM 9536  H HG3  . MET A 1 1  ? -5.836  -29.243 0.703   1.00 0.00 ? 1  MET A HG3  9 
ATOM 9537  H HE1  . MET A 1 1  ? -2.714  -30.741 2.524   1.00 0.00 ? 1  MET A HE1  9 
ATOM 9538  H HE2  . MET A 1 1  ? -2.236  -32.041 1.432   1.00 0.00 ? 1  MET A HE2  9 
ATOM 9539  H HE3  . MET A 1 1  ? -2.046  -30.360 0.936   1.00 0.00 ? 1  MET A HE3  9 
ATOM 9540  N N    . GLU A 1 2  ? -2.479  -27.459 -2.717  1.00 0.00 ? 2  GLU A N    9 
ATOM 9541  C CA   . GLU A 1 2  ? -1.728  -26.407 -3.394  1.00 0.00 ? 2  GLU A CA   9 
ATOM 9542  C C    . GLU A 1 2  ? -2.611  -25.651 -4.387  1.00 0.00 ? 2  GLU A C    9 
ATOM 9543  O O    . GLU A 1 2  ? -2.574  -24.425 -4.458  1.00 0.00 ? 2  GLU A O    9 
ATOM 9544  C CB   . GLU A 1 2  ? -0.521  -27.002 -4.125  1.00 0.00 ? 2  GLU A CB   9 
ATOM 9545  C CG   . GLU A 1 2  ? 0.421   -25.955 -4.700  1.00 0.00 ? 2  GLU A CG   9 
ATOM 9546  C CD   . GLU A 1 2  ? 1.061   -25.094 -3.629  1.00 0.00 ? 2  GLU A CD   9 
ATOM 9547  O OE1  . GLU A 1 2  ? 1.769   -25.650 -2.765  1.00 0.00 ? 2  GLU A OE1  9 
ATOM 9548  O OE2  . GLU A 1 2  ? 0.854   -23.862 -3.656  1.00 0.00 ? 2  GLU A OE2  9 
ATOM 9549  H H    . GLU A 1 2  ? -2.229  -28.391 -2.861  1.00 0.00 ? 2  GLU A H    9 
ATOM 9550  H HA   . GLU A 1 2  ? -1.379  -25.715 -2.645  1.00 0.00 ? 2  GLU A HA   9 
ATOM 9551  H HB2  . GLU A 1 2  ? 0.037   -27.616 -3.434  1.00 0.00 ? 2  GLU A HB2  9 
ATOM 9552  H HB3  . GLU A 1 2  ? -0.876  -27.619 -4.937  1.00 0.00 ? 2  GLU A HB3  9 
ATOM 9553  H HG2  . GLU A 1 2  ? 1.202   -26.457 -5.252  1.00 0.00 ? 2  GLU A HG2  9 
ATOM 9554  H HG3  . GLU A 1 2  ? -0.137  -25.317 -5.368  1.00 0.00 ? 2  GLU A HG3  9 
ATOM 9555  N N    . ASN A 1 3  ? -3.391  -26.392 -5.165  1.00 0.00 ? 3  ASN A N    9 
ATOM 9556  C CA   . ASN A 1 3  ? -4.269  -25.787 -6.164  1.00 0.00 ? 3  ASN A CA   9 
ATOM 9557  C C    . ASN A 1 3  ? -5.250  -24.808 -5.525  1.00 0.00 ? 3  ASN A C    9 
ATOM 9558  O O    . ASN A 1 3  ? -5.326  -23.645 -5.919  1.00 0.00 ? 3  ASN A O    9 
ATOM 9559  C CB   . ASN A 1 3  ? -5.033  -26.872 -6.928  1.00 0.00 ? 3  ASN A CB   9 
ATOM 9560  C CG   . ASN A 1 3  ? -5.938  -26.297 -8.002  1.00 0.00 ? 3  ASN A CG   9 
ATOM 9561  O OD1  . ASN A 1 3  ? -6.860  -25.536 -7.711  1.00 0.00 ? 3  ASN A OD1  9 
ATOM 9562  N ND2  . ASN A 1 3  ? -5.677  -26.660 -9.253  1.00 0.00 ? 3  ASN A ND2  9 
ATOM 9563  H H    . ASN A 1 3  ? -3.371  -27.368 -5.075  1.00 0.00 ? 3  ASN A H    9 
ATOM 9564  H HA   . ASN A 1 3  ? -3.650  -25.246 -6.855  1.00 0.00 ? 3  ASN A HA   9 
ATOM 9565  H HB2  . ASN A 1 3  ? -4.326  -27.539 -7.399  1.00 0.00 ? 3  ASN A HB2  9 
ATOM 9566  H HB3  . ASN A 1 3  ? -5.642  -27.432 -6.233  1.00 0.00 ? 3  ASN A HB3  9 
ATOM 9567  H HD21 . ASN A 1 3  ? -4.926  -27.270 -9.411  1.00 0.00 ? 3  ASN A HD21 9 
ATOM 9568  H HD22 . ASN A 1 3  ? -6.245  -26.301 -9.968  1.00 0.00 ? 3  ASN A HD22 9 
ATOM 9569  N N    . LEU A 1 4  ? -6.001  -25.290 -4.548  1.00 0.00 ? 4  LEU A N    9 
ATOM 9570  C CA   . LEU A 1 4  ? -6.988  -24.460 -3.863  1.00 0.00 ? 4  LEU A CA   9 
ATOM 9571  C C    . LEU A 1 4  ? -6.327  -23.378 -3.016  1.00 0.00 ? 4  LEU A C    9 
ATOM 9572  O O    . LEU A 1 4  ? -6.838  -22.264 -2.933  1.00 0.00 ? 4  LEU A O    9 
ATOM 9573  C CB   . LEU A 1 4  ? -7.948  -25.305 -3.013  1.00 0.00 ? 4  LEU A CB   9 
ATOM 9574  C CG   . LEU A 1 4  ? -7.311  -26.386 -2.135  1.00 0.00 ? 4  LEU A CG   9 
ATOM 9575  C CD1  . LEU A 1 4  ? -8.258  -26.766 -1.007  1.00 0.00 ? 4  LEU A CD1  9 
ATOM 9576  C CD2  . LEU A 1 4  ? -6.972  -27.619 -2.965  1.00 0.00 ? 4  LEU A CD2  9 
ATOM 9577  H H    . LEU A 1 4  ? -5.894  -26.220 -4.291  1.00 0.00 ? 4  LEU A H    9 
ATOM 9578  H HA   . LEU A 1 4  ? -7.565  -23.964 -4.629  1.00 0.00 ? 4  LEU A HA   9 
ATOM 9579  H HB2  . LEU A 1 4  ? -8.501  -24.637 -2.370  1.00 0.00 ? 4  LEU A HB2  9 
ATOM 9580  H HB3  . LEU A 1 4  ? -8.649  -25.787 -3.680  1.00 0.00 ? 4  LEU A HB3  9 
ATOM 9581  H HG   . LEU A 1 4  ? -6.399  -26.006 -1.700  1.00 0.00 ? 4  LEU A HG   9 
ATOM 9582  H HD11 . LEU A 1 4  ? -9.278  -26.596 -1.322  1.00 0.00 ? 4  LEU A HD11 9 
ATOM 9583  H HD12 . LEU A 1 4  ? -8.127  -27.809 -0.762  1.00 0.00 ? 4  LEU A HD12 9 
ATOM 9584  H HD13 . LEU A 1 4  ? -8.045  -26.162 -0.137  1.00 0.00 ? 4  LEU A HD13 9 
ATOM 9585  H HD21 . LEU A 1 4  ? -7.464  -27.555 -3.924  1.00 0.00 ? 4  LEU A HD21 9 
ATOM 9586  H HD22 . LEU A 1 4  ? -5.905  -27.670 -3.112  1.00 0.00 ? 4  LEU A HD22 9 
ATOM 9587  H HD23 . LEU A 1 4  ? -7.306  -28.505 -2.448  1.00 0.00 ? 4  LEU A HD23 9 
ATOM 9588  N N    . ASN A 1 5  ? -5.188  -23.681 -2.404  1.00 0.00 ? 5  ASN A N    9 
ATOM 9589  C CA   . ASN A 1 5  ? -4.500  -22.675 -1.599  1.00 0.00 ? 5  ASN A CA   9 
ATOM 9590  C C    . ASN A 1 5  ? -3.845  -21.624 -2.487  1.00 0.00 ? 5  ASN A C    9 
ATOM 9591  O O    . ASN A 1 5  ? -3.590  -20.504 -2.048  1.00 0.00 ? 5  ASN A O    9 
ATOM 9592  C CB   . ASN A 1 5  ? -3.458  -23.303 -0.672  1.00 0.00 ? 5  ASN A CB   9 
ATOM 9593  C CG   . ASN A 1 5  ? -4.080  -23.941 0.554   1.00 0.00 ? 5  ASN A CG   9 
ATOM 9594  O OD1  . ASN A 1 5  ? -4.845  -23.303 1.278   1.00 0.00 ? 5  ASN A OD1  9 
ATOM 9595  N ND2  . ASN A 1 5  ? -3.738  -25.196 0.805   1.00 0.00 ? 5  ASN A ND2  9 
ATOM 9596  H H    . ASN A 1 5  ? -4.800  -24.577 -2.503  1.00 0.00 ? 5  ASN A H    9 
ATOM 9597  H HA   . ASN A 1 5  ? -5.251  -22.182 -0.998  1.00 0.00 ? 5  ASN A HA   9 
ATOM 9598  H HB2  . ASN A 1 5  ? -2.913  -24.063 -1.212  1.00 0.00 ? 5  ASN A HB2  9 
ATOM 9599  H HB3  . ASN A 1 5  ? -2.769  -22.537 -0.347  1.00 0.00 ? 5  ASN A HB3  9 
ATOM 9600  H HD21 . ASN A 1 5  ? -3.112  -25.636 0.193   1.00 0.00 ? 5  ASN A HD21 9 
ATOM 9601  H HD22 . ASN A 1 5  ? -4.125  -25.633 1.593   1.00 0.00 ? 5  ASN A HD22 9 
ATOM 9602  N N    . MET A 1 6  ? -3.584  -21.981 -3.741  1.00 0.00 ? 6  MET A N    9 
ATOM 9603  C CA   . MET A 1 6  ? -2.977  -21.046 -4.677  1.00 0.00 ? 6  MET A CA   9 
ATOM 9604  C C    . MET A 1 6  ? -4.034  -20.123 -5.272  1.00 0.00 ? 6  MET A C    9 
ATOM 9605  O O    . MET A 1 6  ? -3.882  -18.900 -5.254  1.00 0.00 ? 6  MET A O    9 
ATOM 9606  C CB   . MET A 1 6  ? -2.249  -21.786 -5.798  1.00 0.00 ? 6  MET A CB   9 
ATOM 9607  C CG   . MET A 1 6  ? -0.898  -22.354 -5.392  1.00 0.00 ? 6  MET A CG   9 
ATOM 9608  S SD   . MET A 1 6  ? 0.008   -23.056 -6.786  1.00 0.00 ? 6  MET A SD   9 
ATOM 9609  C CE   . MET A 1 6  ? -1.193  -24.211 -7.448  1.00 0.00 ? 6  MET A CE   9 
ATOM 9610  H H    . MET A 1 6  ? -3.815  -22.885 -4.044  1.00 0.00 ? 6  MET A H    9 
ATOM 9611  H HA   . MET A 1 6  ? -2.267  -20.448 -4.128  1.00 0.00 ? 6  MET A HA   9 
ATOM 9612  H HB2  . MET A 1 6  ? -2.871  -22.603 -6.128  1.00 0.00 ? 6  MET A HB2  9 
ATOM 9613  H HB3  . MET A 1 6  ? -2.095  -21.108 -6.623  1.00 0.00 ? 6  MET A HB3  9 
ATOM 9614  H HG2  . MET A 1 6  ? -0.305  -21.559 -4.964  1.00 0.00 ? 6  MET A HG2  9 
ATOM 9615  H HG3  . MET A 1 6  ? -1.049  -23.123 -4.652  1.00 0.00 ? 6  MET A HG3  9 
ATOM 9616  H HE1  . MET A 1 6  ? -2.181  -23.940 -7.112  1.00 0.00 ? 6  MET A HE1  9 
ATOM 9617  H HE2  . MET A 1 6  ? -1.162  -24.182 -8.527  1.00 0.00 ? 6  MET A HE2  9 
ATOM 9618  H HE3  . MET A 1 6  ? -0.959  -25.210 -7.109  1.00 0.00 ? 6  MET A HE3  9 
ATOM 9619  N N    . ASP A 1 7  ? -5.105  -20.710 -5.798  1.00 0.00 ? 7  ASP A N    9 
ATOM 9620  C CA   . ASP A 1 7  ? -6.173  -19.927 -6.394  1.00 0.00 ? 7  ASP A CA   9 
ATOM 9621  C C    . ASP A 1 7  ? -6.978  -19.192 -5.325  1.00 0.00 ? 7  ASP A C    9 
ATOM 9622  O O    . ASP A 1 7  ? -7.389  -18.050 -5.532  1.00 0.00 ? 7  ASP A O    9 
ATOM 9623  C CB   . ASP A 1 7  ? -7.085  -20.813 -7.244  1.00 0.00 ? 7  ASP A CB   9 
ATOM 9624  C CG   . ASP A 1 7  ? -7.722  -21.937 -6.453  1.00 0.00 ? 7  ASP A CG   9 
ATOM 9625  O OD1  . ASP A 1 7  ? -7.426  -22.053 -5.250  1.00 0.00 ? 7  ASP A OD1  9 
ATOM 9626  O OD2  . ASP A 1 7  ? -8.513  -22.703 -7.042  1.00 0.00 ? 7  ASP A OD2  9 
ATOM 9627  H H    . ASP A 1 7  ? -5.178  -21.688 -5.784  1.00 0.00 ? 7  ASP A H    9 
ATOM 9628  H HA   . ASP A 1 7  ? -5.713  -19.191 -7.035  1.00 0.00 ? 7  ASP A HA   9 
ATOM 9629  H HB2  . ASP A 1 7  ? -7.872  -20.208 -7.661  1.00 0.00 ? 7  ASP A HB2  9 
ATOM 9630  H HB3  . ASP A 1 7  ? -6.507  -21.246 -8.049  1.00 0.00 ? 7  ASP A HB3  9 
ATOM 9631  N N    . LEU A 1 8  ? -7.201  -19.836 -4.177  1.00 0.00 ? 8  LEU A N    9 
ATOM 9632  C CA   . LEU A 1 8  ? -7.953  -19.199 -3.101  1.00 0.00 ? 8  LEU A CA   9 
ATOM 9633  C C    . LEU A 1 8  ? -7.179  -18.000 -2.573  1.00 0.00 ? 8  LEU A C    9 
ATOM 9634  O O    . LEU A 1 8  ? -7.766  -16.994 -2.175  1.00 0.00 ? 8  LEU A O    9 
ATOM 9635  C CB   . LEU A 1 8  ? -8.241  -20.196 -1.974  1.00 0.00 ? 8  LEU A CB   9 
ATOM 9636  C CG   . LEU A 1 8  ? -9.203  -19.721 -0.874  1.00 0.00 ? 8  LEU A CG   9 
ATOM 9637  C CD1  . LEU A 1 8  ? -8.580  -18.619 -0.023  1.00 0.00 ? 8  LEU A CD1  9 
ATOM 9638  C CD2  . LEU A 1 8  ? -10.521 -19.254 -1.477  1.00 0.00 ? 8  LEU A CD2  9 
ATOM 9639  H H    . LEU A 1 8  ? -6.850  -20.750 -4.051  1.00 0.00 ? 8  LEU A H    9 
ATOM 9640  H HA   . LEU A 1 8  ? -8.884  -18.856 -3.512  1.00 0.00 ? 8  LEU A HA   9 
ATOM 9641  H HB2  . LEU A 1 8  ? -8.654  -21.091 -2.416  1.00 0.00 ? 8  LEU A HB2  9 
ATOM 9642  H HB3  . LEU A 1 8  ? -7.304  -20.447 -1.513  1.00 0.00 ? 8  LEU A HB3  9 
ATOM 9643  H HG   . LEU A 1 8  ? -9.419  -20.554 -0.219  1.00 0.00 ? 8  LEU A HG   9 
ATOM 9644  H HD11 . LEU A 1 8  ? -7.572  -18.430 -0.354  1.00 0.00 ? 8  LEU A HD11 9 
ATOM 9645  H HD12 . LEU A 1 8  ? -9.166  -17.717 -0.114  1.00 0.00 ? 8  LEU A HD12 9 
ATOM 9646  H HD13 . LEU A 1 8  ? -8.563  -18.932 1.010   1.00 0.00 ? 8  LEU A HD13 9 
ATOM 9647  H HD21 . LEU A 1 8  ? -10.374 -19.001 -2.515  1.00 0.00 ? 8  LEU A HD21 9 
ATOM 9648  H HD22 . LEU A 1 8  ? -11.251 -20.046 -1.402  1.00 0.00 ? 8  LEU A HD22 9 
ATOM 9649  H HD23 . LEU A 1 8  ? -10.876 -18.385 -0.942  1.00 0.00 ? 8  LEU A HD23 9 
ATOM 9650  N N    . LEU A 1 9  ? -5.853  -18.111 -2.583  1.00 0.00 ? 9  LEU A N    9 
ATOM 9651  C CA   . LEU A 1 9  ? -4.994  -17.032 -2.116  1.00 0.00 ? 9  LEU A CA   9 
ATOM 9652  C C    . LEU A 1 9  ? -5.035  -15.874 -3.108  1.00 0.00 ? 9  LEU A C    9 
ATOM 9653  O O    . LEU A 1 9  ? -5.386  -14.751 -2.747  1.00 0.00 ? 9  LEU A O    9 
ATOM 9654  C CB   . LEU A 1 9  ? -3.566  -17.553 -1.912  1.00 0.00 ? 9  LEU A CB   9 
ATOM 9655  C CG   . LEU A 1 9  ? -2.568  -16.568 -1.289  1.00 0.00 ? 9  LEU A CG   9 
ATOM 9656  C CD1  . LEU A 1 9  ? -2.127  -15.508 -2.291  1.00 0.00 ? 9  LEU A CD1  9 
ATOM 9657  C CD2  . LEU A 1 9  ? -3.164  -15.918 -0.051  1.00 0.00 ? 9  LEU A CD2  9 
ATOM 9658  H H    . LEU A 1 9  ? -5.443  -18.936 -2.920  1.00 0.00 ? 9  LEU A H    9 
ATOM 9659  H HA   . LEU A 1 9  ? -5.382  -16.689 -1.167  1.00 0.00 ? 9  LEU A HA   9 
ATOM 9660  H HB2  . LEU A 1 9  ? -3.618  -18.420 -1.271  1.00 0.00 ? 9  LEU A HB2  9 
ATOM 9661  H HB3  . LEU A 1 9  ? -3.181  -17.865 -2.869  1.00 0.00 ? 9  LEU A HB3  9 
ATOM 9662  H HG   . LEU A 1 9  ? -1.692  -17.117 -0.984  1.00 0.00 ? 9  LEU A HG   9 
ATOM 9663  H HD11 . LEU A 1 9  ? -2.899  -15.352 -3.023  1.00 0.00 ? 9  LEU A HD11 9 
ATOM 9664  H HD12 . LEU A 1 9  ? -1.932  -14.582 -1.770  1.00 0.00 ? 9  LEU A HD12 9 
ATOM 9665  H HD13 . LEU A 1 9  ? -1.225  -15.836 -2.786  1.00 0.00 ? 9  LEU A HD13 9 
ATOM 9666  H HD21 . LEU A 1 9  ? -3.747  -16.646 0.494   1.00 0.00 ? 9  LEU A HD21 9 
ATOM 9667  H HD22 . LEU A 1 9  ? -2.369  -15.550 0.580   1.00 0.00 ? 9  LEU A HD22 9 
ATOM 9668  H HD23 . LEU A 1 9  ? -3.799  -15.095 -0.345  1.00 0.00 ? 9  LEU A HD23 9 
ATOM 9669  N N    . TYR A 1 10 ? -4.714  -16.156 -4.376  1.00 0.00 ? 10 TYR A N    9 
ATOM 9670  C CA   . TYR A 1 10 ? -4.748  -15.126 -5.418  1.00 0.00 ? 10 TYR A CA   9 
ATOM 9671  C C    . TYR A 1 10 ? -6.086  -14.412 -5.386  1.00 0.00 ? 10 TYR A C    9 
ATOM 9672  O O    . TYR A 1 10 ? -6.164  -13.186 -5.316  1.00 0.00 ? 10 TYR A O    9 
ATOM 9673  C CB   . TYR A 1 10 ? -4.589  -15.748 -6.809  1.00 0.00 ? 10 TYR A CB   9 
ATOM 9674  C CG   . TYR A 1 10 ? -3.357  -16.598 -7.014  1.00 0.00 ? 10 TYR A CG   9 
ATOM 9675  C CD1  . TYR A 1 10 ? -2.285  -16.567 -6.131  1.00 0.00 ? 10 TYR A CD1  9 
ATOM 9676  C CD2  . TYR A 1 10 ? -3.273  -17.432 -8.117  1.00 0.00 ? 10 TYR A CD2  9 
ATOM 9677  C CE1  . TYR A 1 10 ? -1.166  -17.347 -6.343  1.00 0.00 ? 10 TYR A CE1  9 
ATOM 9678  C CE2  . TYR A 1 10 ? -2.159  -18.216 -8.338  1.00 0.00 ? 10 TYR A CE2  9 
ATOM 9679  C CZ   . TYR A 1 10 ? -1.108  -18.171 -7.447  1.00 0.00 ? 10 TYR A CZ   9 
ATOM 9680  O OH   . TYR A 1 10 ? 0.005   -18.950 -7.662  1.00 0.00 ? 10 TYR A OH   9 
ATOM 9681  H H    . TYR A 1 10 ? -4.470  -17.075 -4.617  1.00 0.00 ? 10 TYR A H    9 
ATOM 9682  H HA   . TYR A 1 10 ? -3.950  -14.414 -5.239  1.00 0.00 ? 10 TYR A HA   9 
ATOM 9683  H HB2  . TYR A 1 10 ? -5.446  -16.370 -7.009  1.00 0.00 ? 10 TYR A HB2  9 
ATOM 9684  H HB3  . TYR A 1 10 ? -4.562  -14.951 -7.540  1.00 0.00 ? 10 TYR A HB3  9 
ATOM 9685  H HD1  . TYR A 1 10 ? -2.331  -15.918 -5.272  1.00 0.00 ? 10 TYR A HD1  9 
ATOM 9686  H HD2  . TYR A 1 10 ? -4.105  -17.467 -8.807  1.00 0.00 ? 10 TYR A HD2  9 
ATOM 9687  H HE1  . TYR A 1 10 ? -0.343  -17.312 -5.645  1.00 0.00 ? 10 TYR A HE1  9 
ATOM 9688  H HE2  . TYR A 1 10 ? -2.113  -18.858 -9.205  1.00 0.00 ? 10 TYR A HE2  9 
ATOM 9689  H HH   . TYR A 1 10 ? 0.161   -19.505 -6.894  1.00 0.00 ? 10 TYR A HH   9 
ATOM 9690  N N    . MET A 1 11 ? -7.140  -15.210 -5.453  1.00 0.00 ? 11 MET A N    9 
ATOM 9691  C CA   . MET A 1 11 ? -8.496  -14.701 -5.447  1.00 0.00 ? 11 MET A CA   9 
ATOM 9692  C C    . MET A 1 11 ? -8.767  -13.944 -4.154  1.00 0.00 ? 11 MET A C    9 
ATOM 9693  O O    . MET A 1 11 ? -9.427  -12.902 -4.157  1.00 0.00 ? 11 MET A O    9 
ATOM 9694  C CB   . MET A 1 11 ? -9.467  -15.861 -5.625  1.00 0.00 ? 11 MET A CB   9 
ATOM 9695  C CG   . MET A 1 11 ? -10.843 -15.433 -6.096  1.00 0.00 ? 11 MET A CG   9 
ATOM 9696  S SD   . MET A 1 11 ? -11.791 -14.582 -4.822  1.00 0.00 ? 11 MET A SD   9 
ATOM 9697  C CE   . MET A 1 11 ? -13.324 -14.272 -5.694  1.00 0.00 ? 11 MET A CE   9 
ATOM 9698  H H    . MET A 1 11 ? -6.999  -16.178 -5.515  1.00 0.00 ? 11 MET A H    9 
ATOM 9699  H HA   . MET A 1 11 ? -8.602  -14.023 -6.280  1.00 0.00 ? 11 MET A HA   9 
ATOM 9700  H HB2  . MET A 1 11 ? -9.051  -16.550 -6.350  1.00 0.00 ? 11 MET A HB2  9 
ATOM 9701  H HB3  . MET A 1 11 ? -9.576  -16.370 -4.679  1.00 0.00 ? 11 MET A HB3  9 
ATOM 9702  H HG2  . MET A 1 11 ? -10.727 -14.766 -6.939  1.00 0.00 ? 11 MET A HG2  9 
ATOM 9703  H HG3  . MET A 1 11 ? -11.385 -16.306 -6.409  1.00 0.00 ? 11 MET A HG3  9 
ATOM 9704  H HE1  . MET A 1 11 ? -13.122 -14.157 -6.749  1.00 0.00 ? 11 MET A HE1  9 
ATOM 9705  H HE2  . MET A 1 11 ? -13.998 -15.101 -5.545  1.00 0.00 ? 11 MET A HE2  9 
ATOM 9706  H HE3  . MET A 1 11 ? -13.777 -13.368 -5.314  1.00 0.00 ? 11 MET A HE3  9 
ATOM 9707  N N    . ALA A 1 12 ? -8.228  -14.454 -3.052  1.00 0.00 ? 12 ALA A N    9 
ATOM 9708  C CA   . ALA A 1 12 ? -8.389  -13.802 -1.760  1.00 0.00 ? 12 ALA A CA   9 
ATOM 9709  C C    . ALA A 1 12 ? -7.746  -12.433 -1.797  1.00 0.00 ? 12 ALA A C    9 
ATOM 9710  O O    . ALA A 1 12 ? -8.236  -11.503 -1.180  1.00 0.00 ? 12 ALA A O    9 
ATOM 9711  C CB   . ALA A 1 12 ? -7.790  -14.648 -0.646  1.00 0.00 ? 12 ALA A CB   9 
ATOM 9712  H H    . ALA A 1 12 ? -7.693  -15.274 -3.114  1.00 0.00 ? 12 ALA A H    9 
ATOM 9713  H HA   . ALA A 1 12 ? -9.448  -13.677 -1.568  1.00 0.00 ? 12 ALA A HA   9 
ATOM 9714  H HB1  . ALA A 1 12 ? -6.935  -15.190 -1.024  1.00 0.00 ? 12 ALA A HB1  9 
ATOM 9715  H HB2  . ALA A 1 12 ? -7.478  -14.005 0.164   1.00 0.00 ? 12 ALA A HB2  9 
ATOM 9716  H HB3  . ALA A 1 12 ? -8.530  -15.347 -0.286  1.00 0.00 ? 12 ALA A HB3  9 
ATOM 9717  N N    . ALA A 1 13 ? -6.658  -12.311 -2.549  1.00 0.00 ? 13 ALA A N    9 
ATOM 9718  C CA   . ALA A 1 13 ? -5.974  -11.037 -2.686  1.00 0.00 ? 13 ALA A CA   9 
ATOM 9719  C C    . ALA A 1 13 ? -6.861  -10.057 -3.435  1.00 0.00 ? 13 ALA A C    9 
ATOM 9720  O O    . ALA A 1 13 ? -6.924  -8.882  -3.102  1.00 0.00 ? 13 ALA A O    9 
ATOM 9721  C CB   . ALA A 1 13 ? -4.651  -11.221 -3.412  1.00 0.00 ? 13 ALA A CB   9 
ATOM 9722  H H    . ALA A 1 13 ? -6.321  -13.086 -3.036  1.00 0.00 ? 13 ALA A H    9 
ATOM 9723  H HA   . ALA A 1 13 ? -5.775  -10.648 -1.692  1.00 0.00 ? 13 ALA A HA   9 
ATOM 9724  H HB1  . ALA A 1 13 ? -4.820  -11.760 -4.334  1.00 0.00 ? 13 ALA A HB1  9 
ATOM 9725  H HB2  . ALA A 1 13 ? -4.225  -10.254 -3.635  1.00 0.00 ? 13 ALA A HB2  9 
ATOM 9726  H HB3  . ALA A 1 13 ? -3.970  -11.780 -2.788  1.00 0.00 ? 13 ALA A HB3  9 
ATOM 9727  N N    . ALA A 1 14 ? -7.570  -10.550 -4.441  1.00 0.00 ? 14 ALA A N    9 
ATOM 9728  C CA   . ALA A 1 14 ? -8.469  -9.699  -5.203  1.00 0.00 ? 14 ALA A CA   9 
ATOM 9729  C C    . ALA A 1 14 ? -9.562  -9.163  -4.287  1.00 0.00 ? 14 ALA A C    9 
ATOM 9730  O O    . ALA A 1 14 ? -9.797  -7.956  -4.221  1.00 0.00 ? 14 ALA A O    9 
ATOM 9731  C CB   . ALA A 1 14 ? -9.070  -10.465 -6.373  1.00 0.00 ? 14 ALA A CB   9 
ATOM 9732  H H    . ALA A 1 14 ? -7.502  -11.503 -4.661  1.00 0.00 ? 14 ALA A H    9 
ATOM 9733  H HA   . ALA A 1 14 ? -7.894  -8.870  -5.593  1.00 0.00 ? 14 ALA A HA   9 
ATOM 9734  H HB1  . ALA A 1 14 ? -9.591  -11.336 -6.003  1.00 0.00 ? 14 ALA A HB1  9 
ATOM 9735  H HB2  . ALA A 1 14 ? -9.764  -9.828  -6.901  1.00 0.00 ? 14 ALA A HB2  9 
ATOM 9736  H HB3  . ALA A 1 14 ? -8.282  -10.774 -7.044  1.00 0.00 ? 14 ALA A HB3  9 
ATOM 9737  N N    . VAL A 1 15 ? -10.206 -10.072 -3.559  1.00 0.00 ? 15 VAL A N    9 
ATOM 9738  C CA   . VAL A 1 15 ? -11.258 -9.699  -2.621  1.00 0.00 ? 15 VAL A CA   9 
ATOM 9739  C C    . VAL A 1 15 ? -10.689 -8.840  -1.497  1.00 0.00 ? 15 VAL A C    9 
ATOM 9740  O O    . VAL A 1 15 ? -11.196 -7.763  -1.211  1.00 0.00 ? 15 VAL A O    9 
ATOM 9741  C CB   . VAL A 1 15 ? -11.929 -10.948 -2.015  1.00 0.00 ? 15 VAL A CB   9 
ATOM 9742  C CG1  . VAL A 1 15 ? -13.080 -10.556 -1.098  1.00 0.00 ? 15 VAL A CG1  9 
ATOM 9743  C CG2  . VAL A 1 15 ? -12.408 -11.872 -3.122  1.00 0.00 ? 15 VAL A CG2  9 
ATOM 9744  H H    . VAL A 1 15 ? -9.955  -11.017 -3.645  1.00 0.00 ? 15 VAL A H    9 
ATOM 9745  H HA   . VAL A 1 15 ? -12.007 -9.133  -3.159  1.00 0.00 ? 15 VAL A HA   9 
ATOM 9746  H HB   . VAL A 1 15 ? -11.192 -11.480 -1.428  1.00 0.00 ? 15 VAL A HB   9 
ATOM 9747  H HG11 . VAL A 1 15 ? -12.824 -9.654  -0.563  1.00 0.00 ? 15 VAL A HG11 9 
ATOM 9748  H HG12 . VAL A 1 15 ? -13.969 -10.387 -1.688  1.00 0.00 ? 15 VAL A HG12 9 
ATOM 9749  H HG13 . VAL A 1 15 ? -13.264 -11.353 -0.392  1.00 0.00 ? 15 VAL A HG13 9 
ATOM 9750  H HG21 . VAL A 1 15 ? -13.052 -11.323 -3.794  1.00 0.00 ? 15 VAL A HG21 9 
ATOM 9751  H HG22 . VAL A 1 15 ? -11.555 -12.246 -3.667  1.00 0.00 ? 15 VAL A HG22 9 
ATOM 9752  H HG23 . VAL A 1 15 ? -12.954 -12.698 -2.692  1.00 0.00 ? 15 VAL A HG23 9 
ATOM 9753  N N    . MET A 1 16 ? -9.626  -9.331  -0.873  1.00 0.00 ? 16 MET A N    9 
ATOM 9754  C CA   . MET A 1 16 ? -8.965  -8.617  0.222   1.00 0.00 ? 16 MET A CA   9 
ATOM 9755  C C    . MET A 1 16 ? -8.465  -7.249  -0.217  1.00 0.00 ? 16 MET A C    9 
ATOM 9756  O O    . MET A 1 16 ? -8.786  -6.228  0.390   1.00 0.00 ? 16 MET A O    9 
ATOM 9757  C CB   . MET A 1 16 ? -7.789  -9.444  0.762   1.00 0.00 ? 16 MET A CB   9 
ATOM 9758  C CG   . MET A 1 16 ? -8.122  -10.246 2.007   1.00 0.00 ? 16 MET A CG   9 
ATOM 9759  S SD   . MET A 1 16 ? -9.440  -11.445 1.736   1.00 0.00 ? 16 MET A SD   9 
ATOM 9760  C CE   . MET A 1 16 ? -9.530  -12.216 3.350   1.00 0.00 ? 16 MET A CE   9 
ATOM 9761  H H    . MET A 1 16 ? -9.276  -10.198 -1.157  1.00 0.00 ? 16 MET A H    9 
ATOM 9762  H HA   . MET A 1 16 ? -9.688  -8.477  1.004   1.00 0.00 ? 16 MET A HA   9 
ATOM 9763  H HB2  . MET A 1 16 ? -7.470  -10.132 -0.003  1.00 0.00 ? 16 MET A HB2  9 
ATOM 9764  H HB3  . MET A 1 16 ? -6.966  -8.785  0.988   1.00 0.00 ? 16 MET A HB3  9 
ATOM 9765  H HG2  . MET A 1 16 ? -7.236  -10.774 2.326   1.00 0.00 ? 16 MET A HG2  9 
ATOM 9766  H HG3  . MET A 1 16 ? -8.430  -9.563  2.786   1.00 0.00 ? 16 MET A HG3  9 
ATOM 9767  H HE1  . MET A 1 16 ? -9.303  -11.484 4.112   1.00 0.00 ? 16 MET A HE1  9 
ATOM 9768  H HE2  . MET A 1 16 ? -10.526 -12.603 3.509   1.00 0.00 ? 16 MET A HE2  9 
ATOM 9769  H HE3  . MET A 1 16 ? -8.818  -13.024 3.403   1.00 0.00 ? 16 MET A HE3  9 
ATOM 9770  N N    . MET A 1 17 ? -7.659  -7.241  -1.259  1.00 0.00 ? 17 MET A N    9 
ATOM 9771  C CA   . MET A 1 17 ? -7.096  -6.004  -1.777  1.00 0.00 ? 17 MET A CA   9 
ATOM 9772  C C    . MET A 1 17 ? -8.201  -5.086  -2.272  1.00 0.00 ? 17 MET A C    9 
ATOM 9773  O O    . MET A 1 17 ? -8.163  -3.881  -2.043  1.00 0.00 ? 17 MET A O    9 
ATOM 9774  C CB   . MET A 1 17 ? -6.106  -6.284  -2.913  1.00 0.00 ? 17 MET A CB   9 
ATOM 9775  C CG   . MET A 1 17 ? -4.912  -7.127  -2.492  1.00 0.00 ? 17 MET A CG   9 
ATOM 9776  S SD   . MET A 1 17 ? -3.697  -7.318  -3.811  1.00 0.00 ? 17 MET A SD   9 
ATOM 9777  C CE   . MET A 1 17 ? -3.206  -5.614  -4.072  1.00 0.00 ? 17 MET A CE   9 
ATOM 9778  H H    . MET A 1 17 ? -7.430  -8.088  -1.680  1.00 0.00 ? 17 MET A H    9 
ATOM 9779  H HA   . MET A 1 17 ? -6.572  -5.514  -0.968  1.00 0.00 ? 17 MET A HA   9 
ATOM 9780  H HB2  . MET A 1 17 ? -6.624  -6.799  -3.708  1.00 0.00 ? 17 MET A HB2  9 
ATOM 9781  H HB3  . MET A 1 17 ? -5.737  -5.341  -3.289  1.00 0.00 ? 17 MET A HB3  9 
ATOM 9782  H HG2  . MET A 1 17 ? -4.437  -6.653  -1.653  1.00 0.00 ? 17 MET A HG2  9 
ATOM 9783  H HG3  . MET A 1 17 ? -5.257  -8.104  -2.198  1.00 0.00 ? 17 MET A HG3  9 
ATOM 9784  H HE1  . MET A 1 17 ? -2.987  -5.153  -3.120  1.00 0.00 ? 17 MET A HE1  9 
ATOM 9785  H HE2  . MET A 1 17 ? -2.326  -5.585  -4.698  1.00 0.00 ? 17 MET A HE2  9 
ATOM 9786  H HE3  . MET A 1 17 ? -4.010  -5.079  -4.556  1.00 0.00 ? 17 MET A HE3  9 
ATOM 9787  N N    . GLY A 1 18 ? -9.189  -5.669  -2.948  1.00 0.00 ? 18 GLY A N    9 
ATOM 9788  C CA   . GLY A 1 18 ? -10.296 -4.890  -3.471  1.00 0.00 ? 18 GLY A CA   9 
ATOM 9789  C C    . GLY A 1 18 ? -11.164 -4.309  -2.378  1.00 0.00 ? 18 GLY A C    9 
ATOM 9790  O O    . GLY A 1 18 ? -11.426 -3.110  -2.363  1.00 0.00 ? 18 GLY A O    9 
ATOM 9791  H H    . GLY A 1 18 ? -9.168  -6.638  -3.089  1.00 0.00 ? 18 GLY A H    9 
ATOM 9792  H HA2  . GLY A 1 18 ? -9.901  -4.082  -4.071  1.00 0.00 ? 18 GLY A HA2  9 
ATOM 9793  H HA3  . GLY A 1 18 ? -10.905 -5.525  -4.099  1.00 0.00 ? 18 GLY A HA3  9 
ATOM 9794  N N    . LEU A 1 19 ? -11.609 -5.160  -1.460  1.00 0.00 ? 19 LEU A N    9 
ATOM 9795  C CA   . LEU A 1 19 ? -12.453 -4.723  -0.357  1.00 0.00 ? 19 LEU A CA   9 
ATOM 9796  C C    . LEU A 1 19 ? -11.719 -3.673  0.463   1.00 0.00 ? 19 LEU A C    9 
ATOM 9797  O O    . LEU A 1 19 ? -12.275 -2.623  0.811   1.00 0.00 ? 19 LEU A O    9 
ATOM 9798  C CB   . LEU A 1 19 ? -12.839 -5.926  0.513   1.00 0.00 ? 19 LEU A CB   9 
ATOM 9799  C CG   . LEU A 1 19 ? -11.703 -6.560  1.318   1.00 0.00 ? 19 LEU A CG   9 
ATOM 9800  C CD1  . LEU A 1 19 ? -11.451 -5.787  2.606   1.00 0.00 ? 19 LEU A CD1  9 
ATOM 9801  C CD2  . LEU A 1 19 ? -12.016 -8.017  1.622   1.00 0.00 ? 19 LEU A CD2  9 
ATOM 9802  H H    . LEU A 1 19 ? -11.359 -6.102  -1.524  1.00 0.00 ? 19 LEU A H    9 
ATOM 9803  H HA   . LEU A 1 19 ? -13.348 -4.283  -0.772  1.00 0.00 ? 19 LEU A HA   9 
ATOM 9804  H HB2  . LEU A 1 19 ? -13.605 -5.615  1.203   1.00 0.00 ? 19 LEU A HB2  9 
ATOM 9805  H HB3  . LEU A 1 19 ? -13.250 -6.687  -0.136  1.00 0.00 ? 19 LEU A HB3  9 
ATOM 9806  H HG   . LEU A 1 19 ? -10.800 -6.528  0.730   1.00 0.00 ? 19 LEU A HG   9 
ATOM 9807  H HD11 . LEU A 1 19 ? -11.931 -4.822  2.551   1.00 0.00 ? 19 LEU A HD11 9 
ATOM 9808  H HD12 . LEU A 1 19 ? -11.855 -6.339  3.442   1.00 0.00 ? 19 LEU A HD12 9 
ATOM 9809  H HD13 . LEU A 1 19 ? -10.388 -5.654  2.743   1.00 0.00 ? 19 LEU A HD13 9 
ATOM 9810  H HD21 . LEU A 1 19 ? -13.065 -8.119  1.860   1.00 0.00 ? 19 LEU A HD21 9 
ATOM 9811  H HD22 . LEU A 1 19 ? -11.781 -8.623  0.761   1.00 0.00 ? 19 LEU A HD22 9 
ATOM 9812  H HD23 . LEU A 1 19 ? -11.423 -8.345  2.464   1.00 0.00 ? 19 LEU A HD23 9 
ATOM 9813  N N    . ALA A 1 20 ? -10.452 -3.952  0.741   1.00 0.00 ? 20 ALA A N    9 
ATOM 9814  C CA   . ALA A 1 20 ? -9.627  -3.030  1.489   1.00 0.00 ? 20 ALA A CA   9 
ATOM 9815  C C    . ALA A 1 20 ? -9.394  -1.777  0.667   1.00 0.00 ? 20 ALA A C    9 
ATOM 9816  O O    . ALA A 1 20 ? -9.253  -0.690  1.212   1.00 0.00 ? 20 ALA A O    9 
ATOM 9817  C CB   . ALA A 1 20 ? -8.308  -3.676  1.871   1.00 0.00 ? 20 ALA A CB   9 
ATOM 9818  H H    . ALA A 1 20 ? -10.063 -4.791  0.418   1.00 0.00 ? 20 ALA A H    9 
ATOM 9819  H HA   . ALA A 1 20 ? -10.153 -2.765  2.397   1.00 0.00 ? 20 ALA A HA   9 
ATOM 9820  H HB1  . ALA A 1 20 ? -8.450  -4.736  2.010   1.00 0.00 ? 20 ALA A HB1  9 
ATOM 9821  H HB2  . ALA A 1 20 ? -7.585  -3.508  1.087   1.00 0.00 ? 20 ALA A HB2  9 
ATOM 9822  H HB3  . ALA A 1 20 ? -7.948  -3.238  2.792   1.00 0.00 ? 20 ALA A HB3  9 
ATOM 9823  N N    . ALA A 1 21 ? -9.382  -1.934  -0.657  1.00 0.00 ? 21 ALA A N    9 
ATOM 9824  C CA   . ALA A 1 21 ? -9.194  -0.797  -1.549  1.00 0.00 ? 21 ALA A CA   9 
ATOM 9825  C C    . ALA A 1 21 ? -10.409 0.106   -1.487  1.00 0.00 ? 21 ALA A C    9 
ATOM 9826  O O    . ALA A 1 21 ? -10.293 1.331   -1.490  1.00 0.00 ? 21 ALA A O    9 
ATOM 9827  C CB   . ALA A 1 21 ? -8.942  -1.248  -2.982  1.00 0.00 ? 21 ALA A CB   9 
ATOM 9828  H H    . ALA A 1 21 ? -9.519  -2.828  -1.037  1.00 0.00 ? 21 ALA A H    9 
ATOM 9829  H HA   . ALA A 1 21 ? -8.335  -0.248  -1.209  1.00 0.00 ? 21 ALA A HA   9 
ATOM 9830  H HB1  . ALA A 1 21 ? -8.679  -2.292  -2.993  1.00 0.00 ? 21 ALA A HB1  9 
ATOM 9831  H HB2  . ALA A 1 21 ? -9.835  -1.097  -3.570  1.00 0.00 ? 21 ALA A HB2  9 
ATOM 9832  H HB3  . ALA A 1 21 ? -8.132  -0.671  -3.404  1.00 0.00 ? 21 ALA A HB3  9 
ATOM 9833  N N    . ILE A 1 22 ? -11.575 -0.514  -1.404  1.00 0.00 ? 22 ILE A N    9 
ATOM 9834  C CA   . ILE A 1 22 ? -12.825 0.224   -1.315  1.00 0.00 ? 22 ILE A CA   9 
ATOM 9835  C C    . ILE A 1 22 ? -12.845 1.047   -0.038  1.00 0.00 ? 22 ILE A C    9 
ATOM 9836  O O    . ILE A 1 22 ? -12.960 2.270   -0.082  1.00 0.00 ? 22 ILE A O    9 
ATOM 9837  C CB   . ILE A 1 22 ? -14.054 -0.708  -1.340  1.00 0.00 ? 22 ILE A CB   9 
ATOM 9838  C CG1  . ILE A 1 22 ? -14.031 -1.581  -2.591  1.00 0.00 ? 22 ILE A CG1  9 
ATOM 9839  C CG2  . ILE A 1 22 ? -15.343 0.101   -1.281  1.00 0.00 ? 22 ILE A CG2  9 
ATOM 9840  C CD1  . ILE A 1 22 ? -14.026 -0.790  -3.881  1.00 0.00 ? 22 ILE A CD1  9 
ATOM 9841  H H    . ILE A 1 22 ? -11.589 -1.492  -1.388  1.00 0.00 ? 22 ILE A H    9 
ATOM 9842  H HA   . ILE A 1 22 ? -12.885 0.888   -2.164  1.00 0.00 ? 22 ILE A HA   9 
ATOM 9843  H HB   . ILE A 1 22 ? -14.014 -1.337  -0.469  1.00 0.00 ? 22 ILE A HB   9 
ATOM 9844  H HG12 . ILE A 1 22 ? -13.147 -2.193  -2.576  1.00 0.00 ? 22 ILE A HG12 9 
ATOM 9845  H HG13 . ILE A 1 22 ? -14.904 -2.218  -2.594  1.00 0.00 ? 22 ILE A HG13 9 
ATOM 9846  H HG21 . ILE A 1 22 ? -15.121 1.116   -0.989  1.00 0.00 ? 22 ILE A HG21 9 
ATOM 9847  H HG22 . ILE A 1 22 ? -15.813 0.102   -2.254  1.00 0.00 ? 22 ILE A HG22 9 
ATOM 9848  H HG23 . ILE A 1 22 ? -16.014 -0.342  -0.560  1.00 0.00 ? 22 ILE A HG23 9 
ATOM 9849  H HD11 . ILE A 1 22 ? -14.399 0.206   -3.694  1.00 0.00 ? 22 ILE A HD11 9 
ATOM 9850  H HD12 . ILE A 1 22 ? -13.017 -0.731  -4.263  1.00 0.00 ? 22 ILE A HD12 9 
ATOM 9851  H HD13 . ILE A 1 22 ? -14.657 -1.281  -4.607  1.00 0.00 ? 22 ILE A HD13 9 
ATOM 9852  N N    . GLY A 1 23 ? -12.708 0.373   1.102   1.00 0.00 ? 23 GLY A N    9 
ATOM 9853  C CA   . GLY A 1 23 ? -12.693 1.082   2.370   1.00 0.00 ? 23 GLY A CA   9 
ATOM 9854  C C    . GLY A 1 23 ? -11.521 2.039   2.452   1.00 0.00 ? 23 GLY A C    9 
ATOM 9855  O O    . GLY A 1 23 ? -11.676 3.208   2.822   1.00 0.00 ? 23 GLY A O    9 
ATOM 9856  H H    . GLY A 1 23 ? -12.601 -0.605  1.080   1.00 0.00 ? 23 GLY A H    9 
ATOM 9857  H HA2  . GLY A 1 23 ? -13.615 1.639   2.475   1.00 0.00 ? 23 GLY A HA2  9 
ATOM 9858  H HA3  . GLY A 1 23 ? -12.620 0.366   3.175   1.00 0.00 ? 23 GLY A HA3  9 
ATOM 9859  N N    . ALA A 1 24 ? -10.343 1.537   2.091   1.00 0.00 ? 24 ALA A N    9 
ATOM 9860  C CA   . ALA A 1 24 ? -9.128  2.337   2.101   1.00 0.00 ? 24 ALA A CA   9 
ATOM 9861  C C    . ALA A 1 24 ? -9.288  3.561   1.219   1.00 0.00 ? 24 ALA A C    9 
ATOM 9862  O O    . ALA A 1 24 ? -8.814  4.642   1.555   1.00 0.00 ? 24 ALA A O    9 
ATOM 9863  C CB   . ALA A 1 24 ? -7.941  1.510   1.633   1.00 0.00 ? 24 ALA A CB   9 
ATOM 9864  H H    . ALA A 1 24 ? -10.296 0.604   1.799   1.00 0.00 ? 24 ALA A H    9 
ATOM 9865  H HA   . ALA A 1 24 ? -8.943  2.654   3.117   1.00 0.00 ? 24 ALA A HA   9 
ATOM 9866  H HB1  . ALA A 1 24 ? -8.168  1.069   0.674   1.00 0.00 ? 24 ALA A HB1  9 
ATOM 9867  H HB2  . ALA A 1 24 ? -7.073  2.143   1.537   1.00 0.00 ? 24 ALA A HB2  9 
ATOM 9868  H HB3  . ALA A 1 24 ? -7.740  0.727   2.350   1.00 0.00 ? 24 ALA A HB3  9 
ATOM 9869  N N    . ALA A 1 25 ? -9.960  3.375   0.084   1.00 0.00 ? 25 ALA A N    9 
ATOM 9870  C CA   . ALA A 1 25 ? -10.191 4.460   -0.858  1.00 0.00 ? 25 ALA A CA   9 
ATOM 9871  C C    . ALA A 1 25 ? -11.122 5.503   -0.260  1.00 0.00 ? 25 ALA A C    9 
ATOM 9872  O O    . ALA A 1 25 ? -10.879 6.706   -0.371  1.00 0.00 ? 25 ALA A O    9 
ATOM 9873  C CB   . ALA A 1 25 ? -10.767 3.919   -2.159  1.00 0.00 ? 25 ALA A CB   9 
ATOM 9874  H H    . ALA A 1 25 ? -10.310 2.483   -0.122  1.00 0.00 ? 25 ALA A H    9 
ATOM 9875  H HA   . ALA A 1 25 ? -9.240  4.921   -1.077  1.00 0.00 ? 25 ALA A HA   9 
ATOM 9876  H HB1  . ALA A 1 25 ? -11.679 3.378   -1.951  1.00 0.00 ? 25 ALA A HB1  9 
ATOM 9877  H HB2  . ALA A 1 25 ? -10.980 4.739   -2.828  1.00 0.00 ? 25 ALA A HB2  9 
ATOM 9878  H HB3  . ALA A 1 25 ? -10.052 3.254   -2.621  1.00 0.00 ? 25 ALA A HB3  9 
ATOM 9879  N N    . ILE A 1 26 ? -12.186 5.036   0.383   1.00 0.00 ? 26 ILE A N    9 
ATOM 9880  C CA   . ILE A 1 26 ? -13.150 5.930   1.002   1.00 0.00 ? 26 ILE A CA   9 
ATOM 9881  C C    . ILE A 1 26 ? -12.486 6.825   2.046   1.00 0.00 ? 26 ILE A C    9 
ATOM 9882  O O    . ILE A 1 26 ? -12.637 8.042   2.005   1.00 0.00 ? 26 ILE A O    9 
ATOM 9883  C CB   . ILE A 1 26 ? -14.312 5.155   1.642   1.00 0.00 ? 26 ILE A CB   9 
ATOM 9884  C CG1  . ILE A 1 26 ? -15.087 4.411   0.559   1.00 0.00 ? 26 ILE A CG1  9 
ATOM 9885  C CG2  . ILE A 1 26 ? -15.236 6.092   2.410   1.00 0.00 ? 26 ILE A CG2  9 
ATOM 9886  C CD1  . ILE A 1 26 ? -15.560 5.297   -0.575  1.00 0.00 ? 26 ILE A CD1  9 
ATOM 9887  H H    . ILE A 1 26 ? -12.323 4.067   0.441   1.00 0.00 ? 26 ILE A H    9 
ATOM 9888  H HA   . ILE A 1 26 ? -13.569 6.547   0.226   1.00 0.00 ? 26 ILE A HA   9 
ATOM 9889  H HB   . ILE A 1 26 ? -13.902 4.442   2.336   1.00 0.00 ? 26 ILE A HB   9 
ATOM 9890  H HG12 . ILE A 1 26 ? -14.463 3.642   0.139   1.00 0.00 ? 26 ILE A HG12 9 
ATOM 9891  H HG13 . ILE A 1 26 ? -15.952 3.963   1.004   1.00 0.00 ? 26 ILE A HG13 9 
ATOM 9892  H HG21 . ILE A 1 26 ? -15.023 7.114   2.135   1.00 0.00 ? 26 ILE A HG21 9 
ATOM 9893  H HG22 . ILE A 1 26 ? -16.265 5.863   2.170   1.00 0.00 ? 26 ILE A HG22 9 
ATOM 9894  H HG23 . ILE A 1 26 ? -15.078 5.964   3.471   1.00 0.00 ? 26 ILE A HG23 9 
ATOM 9895  H HD11 . ILE A 1 26 ? -15.994 6.199   -0.171  1.00 0.00 ? 26 ILE A HD11 9 
ATOM 9896  H HD12 . ILE A 1 26 ? -14.722 5.551   -1.208  1.00 0.00 ? 26 ILE A HD12 9 
ATOM 9897  H HD13 . ILE A 1 26 ? -16.302 4.770   -1.157  1.00 0.00 ? 26 ILE A HD13 9 
ATOM 9898  N N    . GLY A 1 27 ? -11.755 6.221   2.984   1.00 0.00 ? 27 GLY A N    9 
ATOM 9899  C CA   . GLY A 1 27 ? -11.098 7.006   4.021   1.00 0.00 ? 27 GLY A CA   9 
ATOM 9900  C C    . GLY A 1 27 ? -9.994  7.891   3.481   1.00 0.00 ? 27 GLY A C    9 
ATOM 9901  O O    . GLY A 1 27 ? -9.938  9.084   3.795   1.00 0.00 ? 27 GLY A O    9 
ATOM 9902  H H    . GLY A 1 27 ? -11.669 5.241   2.977   1.00 0.00 ? 27 GLY A H    9 
ATOM 9903  H HA2  . GLY A 1 27 ? -11.836 7.633   4.499   1.00 0.00 ? 27 GLY A HA2  9 
ATOM 9904  H HA3  . GLY A 1 27 ? -10.683 6.346   4.760   1.00 0.00 ? 27 GLY A HA3  9 
ATOM 9905  N N    . ILE A 1 28 ? -9.107  7.327   2.659   1.00 0.00 ? 28 ILE A N    9 
ATOM 9906  C CA   . ILE A 1 28 ? -8.028  8.118   2.088   1.00 0.00 ? 28 ILE A CA   9 
ATOM 9907  C C    . ILE A 1 28 ? -8.613  9.354   1.443   1.00 0.00 ? 28 ILE A C    9 
ATOM 9908  O O    . ILE A 1 28 ? -8.163  10.470  1.674   1.00 0.00 ? 28 ILE A O    9 
ATOM 9909  C CB   . ILE A 1 28 ? -7.206  7.336   1.052   1.00 0.00 ? 28 ILE A CB   9 
ATOM 9910  C CG1  . ILE A 1 28 ? -8.077  6.823   -0.087  1.00 0.00 ? 28 ILE A CG1  9 
ATOM 9911  C CG2  . ILE A 1 28 ? -6.473  6.185   1.720   1.00 0.00 ? 28 ILE A CG2  9 
ATOM 9912  C CD1  . ILE A 1 28 ? -7.283  6.139   -1.179  1.00 0.00 ? 28 ILE A CD1  9 
ATOM 9913  H H    . ILE A 1 28 ? -9.185  6.379   2.429   1.00 0.00 ? 28 ILE A H    9 
ATOM 9914  H HA   . ILE A 1 28 ? -7.375  8.421   2.893   1.00 0.00 ? 28 ILE A HA   9 
ATOM 9915  H HB   . ILE A 1 28 ? -6.480  8.006   0.647   1.00 0.00 ? 28 ILE A HB   9 
ATOM 9916  H HG12 . ILE A 1 28 ? -8.785  6.117   0.305   1.00 0.00 ? 28 ILE A HG12 9 
ATOM 9917  H HG13 . ILE A 1 28 ? -8.605  7.650   -0.534  1.00 0.00 ? 28 ILE A HG13 9 
ATOM 9918  H HG21 . ILE A 1 28 ? -7.130  5.706   2.430   1.00 0.00 ? 28 ILE A HG21 9 
ATOM 9919  H HG22 . ILE A 1 28 ? -6.169  5.470   0.970   1.00 0.00 ? 28 ILE A HG22 9 
ATOM 9920  H HG23 . ILE A 1 28 ? -5.600  6.562   2.233   1.00 0.00 ? 28 ILE A HG23 9 
ATOM 9921  H HD11 . ILE A 1 28 ? -6.326  6.628   -1.288  1.00 0.00 ? 28 ILE A HD11 9 
ATOM 9922  H HD12 . ILE A 1 28 ? -7.131  5.103   -0.917  1.00 0.00 ? 28 ILE A HD12 9 
ATOM 9923  H HD13 . ILE A 1 28 ? -7.826  6.199   -2.111  1.00 0.00 ? 28 ILE A HD13 9 
ATOM 9924  N N    . GLY A 1 29 ? -9.660  9.136   0.674   1.00 0.00 ? 29 GLY A N    9 
ATOM 9925  C CA   . GLY A 1 29 ? -10.350 10.234  0.041   1.00 0.00 ? 29 GLY A CA   9 
ATOM 9926  C C    . GLY A 1 29 ? -10.932 11.160  1.086   1.00 0.00 ? 29 GLY A C    9 
ATOM 9927  O O    . GLY A 1 29 ? -10.923 12.379  0.926   1.00 0.00 ? 29 GLY A O    9 
ATOM 9928  H H    . GLY A 1 29 ? -9.983  8.221   0.566   1.00 0.00 ? 29 GLY A H    9 
ATOM 9929  H HA2  . GLY A 1 29 ? -9.655  10.784  -0.578  1.00 0.00 ? 29 GLY A HA2  9 
ATOM 9930  H HA3  . GLY A 1 29 ? -11.150 9.849   -0.574  1.00 0.00 ? 29 GLY A HA3  9 
ATOM 9931  N N    . ILE A 1 30 ? -11.417 10.570  2.183   1.00 0.00 ? 30 ILE A N    9 
ATOM 9932  C CA   . ILE A 1 30 ? -11.980 11.348  3.277   1.00 0.00 ? 30 ILE A CA   9 
ATOM 9933  C C    . ILE A 1 30 ? -10.941 12.332  3.814   1.00 0.00 ? 30 ILE A C    9 
ATOM 9934  O O    . ILE A 1 30 ? -10.980 13.514  3.487   1.00 0.00 ? 30 ILE A O    9 
ATOM 9935  C CB   . ILE A 1 30 ? -12.500 10.437  4.424   1.00 0.00 ? 30 ILE A CB   9 
ATOM 9936  C CG1  . ILE A 1 30 ? -13.778 9.723   3.991   1.00 0.00 ? 30 ILE A CG1  9 
ATOM 9937  C CG2  . ILE A 1 30 ? -12.763 11.246  5.689   1.00 0.00 ? 30 ILE A CG2  9 
ATOM 9938  C CD1  . ILE A 1 30 ? -14.259 8.695   4.990   1.00 0.00 ? 30 ILE A CD1  9 
ATOM 9939  H H    . ILE A 1 30 ? -11.377 9.592   2.260   1.00 0.00 ? 30 ILE A H    9 
ATOM 9940  H HA   . ILE A 1 30 ? -12.819 11.909  2.885   1.00 0.00 ? 30 ILE A HA   9 
ATOM 9941  H HB   . ILE A 1 30 ? -11.745 9.691   4.651   1.00 0.00 ? 30 ILE A HB   9 
ATOM 9942  H HG12 . ILE A 1 30 ? -14.564 10.453  3.862   1.00 0.00 ? 30 ILE A HG12 9 
ATOM 9943  H HG13 . ILE A 1 30 ? -13.604 9.224   3.054   1.00 0.00 ? 30 ILE A HG13 9 
ATOM 9944  H HG21 . ILE A 1 30 ? -13.236 12.181  5.425   1.00 0.00 ? 30 ILE A HG21 9 
ATOM 9945  H HG22 . ILE A 1 30 ? -13.412 10.687  6.346   1.00 0.00 ? 30 ILE A HG22 9 
ATOM 9946  H HG23 . ILE A 1 30 ? -11.828 11.446  6.190   1.00 0.00 ? 30 ILE A HG23 9 
ATOM 9947  H HD11 . ILE A 1 30 ? -13.982 9.004   5.987   1.00 0.00 ? 30 ILE A HD11 9 
ATOM 9948  H HD12 . ILE A 1 30 ? -15.333 8.606   4.927   1.00 0.00 ? 30 ILE A HD12 9 
ATOM 9949  H HD13 . ILE A 1 30 ? -13.805 7.740   4.771   1.00 0.00 ? 30 ILE A HD13 9 
ATOM 9950  N N    . LEU A 1 31 ? -9.997  11.836  4.608   1.00 0.00 ? 31 LEU A N    9 
ATOM 9951  C CA   . LEU A 1 31 ? -8.945  12.687  5.167   1.00 0.00 ? 31 LEU A CA   9 
ATOM 9952  C C    . LEU A 1 31 ? -8.038  13.222  4.066   1.00 0.00 ? 31 LEU A C    9 
ATOM 9953  O O    . LEU A 1 31 ? -7.735  14.420  4.013   1.00 0.00 ? 31 LEU A O    9 
ATOM 9954  C CB   . LEU A 1 31 ? -8.114  11.907  6.187   1.00 0.00 ? 31 LEU A CB   9 
ATOM 9955  C CG   . LEU A 1 31 ? -6.958  12.691  6.814   1.00 0.00 ? 31 LEU A CG   9 
ATOM 9956  C CD1  . LEU A 1 31 ? -7.479  13.910  7.563   1.00 0.00 ? 31 LEU A CD1  9 
ATOM 9957  C CD2  . LEU A 1 31 ? -6.149  11.796  7.743   1.00 0.00 ? 31 LEU A CD2  9 
ATOM 9958  H H    . LEU A 1 31 ? -10.000 10.874  4.815   1.00 0.00 ? 31 LEU A H    9 
ATOM 9959  H HA   . LEU A 1 31 ? -9.419  13.526  5.663   1.00 0.00 ? 31 LEU A HA   9 
ATOM 9960  H HB2  . LEU A 1 31 ? -8.771  11.577  6.977   1.00 0.00 ? 31 LEU A HB2  9 
ATOM 9961  H HB3  . LEU A 1 31 ? -7.703  11.037  5.695   1.00 0.00 ? 31 LEU A HB3  9 
ATOM 9962  H HG   . LEU A 1 31 ? -6.302  13.039  6.029   1.00 0.00 ? 31 LEU A HG   9 
ATOM 9963  H HD11 . LEU A 1 31 ? -8.520  14.067  7.319   1.00 0.00 ? 31 LEU A HD11 9 
ATOM 9964  H HD12 . LEU A 1 31 ? -7.380  13.751  8.627   1.00 0.00 ? 31 LEU A HD12 9 
ATOM 9965  H HD13 . LEU A 1 31 ? -6.908  14.780  7.275   1.00 0.00 ? 31 LEU A HD13 9 
ATOM 9966  H HD21 . LEU A 1 31 ? -6.386  10.762  7.544   1.00 0.00 ? 31 LEU A HD21 9 
ATOM 9967  H HD22 . LEU A 1 31 ? -5.095  11.963  7.575   1.00 0.00 ? 31 LEU A HD22 9 
ATOM 9968  H HD23 . LEU A 1 31 ? -6.390  12.030  8.769   1.00 0.00 ? 31 LEU A HD23 9 
ATOM 9969  N N    . GLY A 1 32 ? -7.606  12.327  3.184   1.00 0.00 ? 32 GLY A N    9 
ATOM 9970  C CA   . GLY A 1 32 ? -6.744  12.730  2.094   1.00 0.00 ? 32 GLY A CA   9 
ATOM 9971  C C    . GLY A 1 32 ? -7.357  13.856  1.295   1.00 0.00 ? 32 GLY A C    9 
ATOM 9972  O O    . GLY A 1 32 ? -6.706  14.860  1.040   1.00 0.00 ? 32 GLY A O    9 
ATOM 9973  H H    . GLY A 1 32 ? -7.879  11.390  3.274   1.00 0.00 ? 32 GLY A H    9 
ATOM 9974  H HA2  . GLY A 1 32 ? -5.797  13.058  2.496   1.00 0.00 ? 32 GLY A HA2  9 
ATOM 9975  H HA3  . GLY A 1 32 ? -6.576  11.887  1.441   1.00 0.00 ? 32 GLY A HA3  9 
ATOM 9976  N N    . GLY A 1 33 ? -8.623  13.697  0.918   1.00 0.00 ? 33 GLY A N    9 
ATOM 9977  C CA   . GLY A 1 33 ? -9.305  14.733  0.164   1.00 0.00 ? 33 GLY A CA   9 
ATOM 9978  C C    . GLY A 1 33 ? -9.367  16.036  0.934   1.00 0.00 ? 33 GLY A C    9 
ATOM 9979  O O    . GLY A 1 33 ? -9.258  17.114  0.355   1.00 0.00 ? 33 GLY A O    9 
ATOM 9980  H H    . GLY A 1 33 ? -9.101  12.877  1.165   1.00 0.00 ? 33 GLY A H    9 
ATOM 9981  H HA2  . GLY A 1 33 ? -8.776  14.897  -0.765  1.00 0.00 ? 33 GLY A HA2  9 
ATOM 9982  H HA3  . GLY A 1 33 ? -10.311 14.407  -0.056  1.00 0.00 ? 33 GLY A HA3  9 
ATOM 9983  N N    . LYS A 1 34 ? -9.531  15.929  2.250   1.00 0.00 ? 34 LYS A N    9 
ATOM 9984  C CA   . LYS A 1 34 ? -9.595  17.102  3.112   1.00 0.00 ? 34 LYS A CA   9 
ATOM 9985  C C    . LYS A 1 34 ? -8.315  17.918  3.003   1.00 0.00 ? 34 LYS A C    9 
ATOM 9986  O O    . LYS A 1 34 ? -8.329  19.059  2.535   1.00 0.00 ? 34 LYS A O    9 
ATOM 9987  C CB   . LYS A 1 34 ? -9.831  16.681  4.568   1.00 0.00 ? 34 LYS A CB   9 
ATOM 9988  C CG   . LYS A 1 34 ? -11.200 16.073  4.816   1.00 0.00 ? 34 LYS A CG   9 
ATOM 9989  C CD   . LYS A 1 34 ? -12.317 17.050  4.489   1.00 0.00 ? 34 LYS A CD   9 
ATOM 9990  C CE   . LYS A 1 34 ? -13.684 16.410  4.673   1.00 0.00 ? 34 LYS A CE   9 
ATOM 9991  N NZ   . LYS A 1 34 ? -13.857 15.207  3.812   1.00 0.00 ? 34 LYS A NZ   9 
ATOM 9992  H H    . LYS A 1 34 ? -9.602  15.037  2.651   1.00 0.00 ? 34 LYS A H    9 
ATOM 9993  H HA   . LYS A 1 34 ? -10.420 17.710  2.780   1.00 0.00 ? 34 LYS A HA   9 
ATOM 9994  H HB2  . LYS A 1 34 ? -9.086  15.950  4.845   1.00 0.00 ? 34 LYS A HB2  9 
ATOM 9995  H HB3  . LYS A 1 34 ? -9.724  17.541  5.206   1.00 0.00 ? 34 LYS A HB3  9 
ATOM 9996  H HG2  . LYS A 1 34 ? -11.311 15.203  4.196   1.00 0.00 ? 34 LYS A HG2  9 
ATOM 9997  H HG3  . LYS A 1 34 ? -11.273 15.789  5.854   1.00 0.00 ? 34 LYS A HG3  9 
ATOM 9998  H HD2  . LYS A 1 34 ? -12.239 17.904  5.144   1.00 0.00 ? 34 LYS A HD2  9 
ATOM 9999  H HD3  . LYS A 1 34 ? -12.216 17.370  3.462   1.00 0.00 ? 34 LYS A HD3  9 
ATOM 10000 H HE2  . LYS A 1 34 ? -13.794 16.119  5.708   1.00 0.00 ? 34 LYS A HE2  9 
ATOM 10001 H HE3  . LYS A 1 34 ? -14.443 17.135  4.421   1.00 0.00 ? 34 LYS A HE3  9 
ATOM 10002 H HZ1  . LYS A 1 34 ? -13.052 15.113  3.159   1.00 0.00 ? 34 LYS A HZ1  9 
ATOM 10003 H HZ2  . LYS A 1 34 ? -13.910 14.350  4.400   1.00 0.00 ? 34 LYS A HZ2  9 
ATOM 10004 H HZ3  . LYS A 1 34 ? -14.733 15.287  3.257   1.00 0.00 ? 34 LYS A HZ3  9 
ATOM 10005 N N    . PHE A 1 35 ? -7.202  17.329  3.429   1.00 0.00 ? 35 PHE A N    9 
ATOM 10006 C CA   . PHE A 1 35 ? -5.917  18.016  3.367   1.00 0.00 ? 35 PHE A CA   9 
ATOM 10007 C C    . PHE A 1 35 ? -5.568  18.320  1.919   1.00 0.00 ? 35 PHE A C    9 
ATOM 10008 O O    . PHE A 1 35 ? -5.059  19.392  1.592   1.00 0.00 ? 35 PHE A O    9 
ATOM 10009 C CB   . PHE A 1 35 ? -4.819  17.156  3.987   1.00 0.00 ? 35 PHE A CB   9 
ATOM 10010 C CG   . PHE A 1 35 ? -3.702  17.971  4.572   1.00 0.00 ? 35 PHE A CG   9 
ATOM 10011 C CD1  . PHE A 1 35 ? -3.907  18.722  5.718   1.00 0.00 ? 35 PHE A CD1  9 
ATOM 10012 C CD2  . PHE A 1 35 ? -2.460  18.011  3.963   1.00 0.00 ? 35 PHE A CD2  9 
ATOM 10013 C CE1  . PHE A 1 35 ? -2.892  19.495  6.247   1.00 0.00 ? 35 PHE A CE1  9 
ATOM 10014 C CE2  . PHE A 1 35 ? -1.439  18.780  4.489   1.00 0.00 ? 35 PHE A CE2  9 
ATOM 10015 C CZ   . PHE A 1 35 ? -1.656  19.523  5.632   1.00 0.00 ? 35 PHE A CZ   9 
ATOM 10016 H H    . PHE A 1 35 ? -7.247  16.412  3.787   1.00 0.00 ? 35 PHE A H    9 
ATOM 10017 H HA   . PHE A 1 35 ? -5.999  18.947  3.917   1.00 0.00 ? 35 PHE A HA   9 
ATOM 10018 H HB2  . PHE A 1 35 ? -5.244  16.549  4.767   1.00 0.00 ? 35 PHE A HB2  9 
ATOM 10019 H HB3  . PHE A 1 35 ? -4.402  16.516  3.225   1.00 0.00 ? 35 PHE A HB3  9 
ATOM 10020 H HD1  . PHE A 1 35 ? -4.873  18.698  6.202   1.00 0.00 ? 35 PHE A HD1  9 
ATOM 10021 H HD2  . PHE A 1 35 ? -2.289  17.428  3.068   1.00 0.00 ? 35 PHE A HD2  9 
ATOM 10022 H HE1  . PHE A 1 35 ? -3.064  20.076  7.140   1.00 0.00 ? 35 PHE A HE1  9 
ATOM 10023 H HE2  . PHE A 1 35 ? -0.474  18.800  4.006   1.00 0.00 ? 35 PHE A HE2  9 
ATOM 10024 H HZ   . PHE A 1 35 ? -0.861  20.128  6.043   1.00 0.00 ? 35 PHE A HZ   9 
ATOM 10025 N N    . LEU A 1 36 ? -5.861  17.356  1.059   1.00 0.00 ? 36 LEU A N    9 
ATOM 10026 C CA   . LEU A 1 36 ? -5.604  17.482  -0.371  1.00 0.00 ? 36 LEU A CA   9 
ATOM 10027 C C    . LEU A 1 36 ? -6.321  18.700  -0.940  1.00 0.00 ? 36 LEU A C    9 
ATOM 10028 O O    . LEU A 1 36 ? -5.771  19.427  -1.764  1.00 0.00 ? 36 LEU A O    9 
ATOM 10029 C CB   . LEU A 1 36 ? -6.072  16.217  -1.097  1.00 0.00 ? 36 LEU A CB   9 
ATOM 10030 C CG   . LEU A 1 36 ? -5.804  16.181  -2.599  1.00 0.00 ? 36 LEU A CG   9 
ATOM 10031 C CD1  . LEU A 1 36 ? -4.319  16.017  -2.870  1.00 0.00 ? 36 LEU A CD1  9 
ATOM 10032 C CD2  . LEU A 1 36 ? -6.598  15.062  -3.256  1.00 0.00 ? 36 LEU A CD2  9 
ATOM 10033 H H    . LEU A 1 36 ? -6.269  16.533  1.400   1.00 0.00 ? 36 LEU A H    9 
ATOM 10034 H HA   . LEU A 1 36 ? -4.540  17.598  -0.513  1.00 0.00 ? 36 LEU A HA   9 
ATOM 10035 H HB2  . LEU A 1 36 ? -5.574  15.373  -0.648  1.00 0.00 ? 36 LEU A HB2  9 
ATOM 10036 H HB3  . LEU A 1 36 ? -7.135  16.111  -0.940  1.00 0.00 ? 36 LEU A HB3  9 
ATOM 10037 H HG   . LEU A 1 36 ? -6.120  17.117  -3.037  1.00 0.00 ? 36 LEU A HG   9 
ATOM 10038 H HD11 . LEU A 1 36 ? -3.765  16.180  -1.956  1.00 0.00 ? 36 LEU A HD11 9 
ATOM 10039 H HD12 . LEU A 1 36 ? -4.125  15.020  -3.237  1.00 0.00 ? 36 LEU A HD12 9 
ATOM 10040 H HD13 . LEU A 1 36 ? -4.012  16.739  -3.607  1.00 0.00 ? 36 LEU A HD13 9 
ATOM 10041 H HD21 . LEU A 1 36 ? -6.783  14.279  -2.534  1.00 0.00 ? 36 LEU A HD21 9 
ATOM 10042 H HD22 . LEU A 1 36 ? -7.538  15.450  -3.617  1.00 0.00 ? 36 LEU A HD22 9 
ATOM 10043 H HD23 . LEU A 1 36 ? -6.033  14.659  -4.085  1.00 0.00 ? 36 LEU A HD23 9 
ATOM 10044 N N    . GLU A 1 37 ? -7.553  18.916  -0.491  1.00 0.00 ? 37 GLU A N    9 
ATOM 10045 C CA   . GLU A 1 37 ? -8.350  20.046  -0.958  1.00 0.00 ? 37 GLU A CA   9 
ATOM 10046 C C    . GLU A 1 37 ? -7.785  21.370  -0.443  1.00 0.00 ? 37 GLU A C    9 
ATOM 10047 O O    . GLU A 1 37 ? -7.474  22.273  -1.224  1.00 0.00 ? 37 GLU A O    9 
ATOM 10048 C CB   . GLU A 1 37 ? -9.803  19.881  -0.503  1.00 0.00 ? 37 GLU A CB   9 
ATOM 10049 C CG   . GLU A 1 37 ? -10.723 21.000  -0.963  1.00 0.00 ? 37 GLU A CG   9 
ATOM 10050 C CD   . GLU A 1 37 ? -12.142 20.822  -0.461  1.00 0.00 ? 37 GLU A CD   9 
ATOM 10051 O OE1  . GLU A 1 37 ? -12.339 20.813  0.773   1.00 0.00 ? 37 GLU A OE1  9 
ATOM 10052 O OE2  . GLU A 1 37 ? -13.058 20.688  -1.301  1.00 0.00 ? 37 GLU A OE2  9 
ATOM 10053 H H    . GLU A 1 37 ? -7.938  18.303  0.170   1.00 0.00 ? 37 GLU A H    9 
ATOM 10054 H HA   . GLU A 1 37 ? -8.320  20.050  -2.039  1.00 0.00 ? 37 GLU A HA   9 
ATOM 10055 H HB2  . GLU A 1 37 ? -10.185 18.950  -0.894  1.00 0.00 ? 37 GLU A HB2  9 
ATOM 10056 H HB3  . GLU A 1 37 ? -9.830  19.845  0.576   1.00 0.00 ? 37 GLU A HB3  9 
ATOM 10057 H HG2  . GLU A 1 37 ? -10.340 21.939  -0.591  1.00 0.00 ? 37 GLU A HG2  9 
ATOM 10058 H HG3  . GLU A 1 37 ? -10.737 21.018  -2.042  1.00 0.00 ? 37 GLU A HG3  9 
ATOM 10059 N N    . GLY A 1 38 ? -7.664  21.482  0.877   1.00 0.00 ? 38 GLY A N    9 
ATOM 10060 C CA   . GLY A 1 38 ? -7.149  22.704  1.475   1.00 0.00 ? 38 GLY A CA   9 
ATOM 10061 C C    . GLY A 1 38 ? -5.757  23.065  0.985   1.00 0.00 ? 38 GLY A C    9 
ATOM 10062 O O    . GLY A 1 38 ? -5.523  24.182  0.509   1.00 0.00 ? 38 GLY A O    9 
ATOM 10063 H H    . GLY A 1 38 ? -7.936  20.731  1.450   1.00 0.00 ? 38 GLY A H    9 
ATOM 10064 H HA2  . GLY A 1 38 ? -7.821  23.513  1.242   1.00 0.00 ? 38 GLY A HA2  9 
ATOM 10065 H HA3  . GLY A 1 38 ? -7.117  22.577  2.548   1.00 0.00 ? 38 GLY A HA3  9 
ATOM 10066 N N    . ALA A 1 39 ? -4.829  22.125  1.116   1.00 0.00 ? 39 ALA A N    9 
ATOM 10067 C CA   . ALA A 1 39 ? -3.451  22.342  0.698   1.00 0.00 ? 39 ALA A CA   9 
ATOM 10068 C C    . ALA A 1 39 ? -3.369  22.751  -0.766  1.00 0.00 ? 39 ALA A C    9 
ATOM 10069 O O    . ALA A 1 39 ? -2.411  23.391  -1.186  1.00 0.00 ? 39 ALA A O    9 
ATOM 10070 C CB   . ALA A 1 39 ? -2.627  21.089  0.937   1.00 0.00 ? 39 ALA A CB   9 
ATOM 10071 H H    . ALA A 1 39 ? -5.077  21.264  1.510   1.00 0.00 ? 39 ALA A H    9 
ATOM 10072 H HA   . ALA A 1 39 ? -3.039  23.136  1.304   1.00 0.00 ? 39 ALA A HA   9 
ATOM 10073 H HB1  . ALA A 1 39 ? -3.220  20.221  0.692   1.00 0.00 ? 39 ALA A HB1  9 
ATOM 10074 H HB2  . ALA A 1 39 ? -1.747  21.112  0.312   1.00 0.00 ? 39 ALA A HB2  9 
ATOM 10075 H HB3  . ALA A 1 39 ? -2.331  21.044  1.973   1.00 0.00 ? 39 ALA A HB3  9 
ATOM 10076 N N    . ALA A 1 40 ? -4.362  22.362  -1.548  1.00 0.00 ? 40 ALA A N    9 
ATOM 10077 C CA   . ALA A 1 40 ? -4.367  22.690  -2.963  1.00 0.00 ? 40 ALA A CA   9 
ATOM 10078 C C    . ALA A 1 40 ? -4.914  24.086  -3.191  1.00 0.00 ? 40 ALA A C    9 
ATOM 10079 O O    . ALA A 1 40 ? -4.434  24.817  -4.058  1.00 0.00 ? 40 ALA A O    9 
ATOM 10080 C CB   . ALA A 1 40 ? -5.162  21.665  -3.741  1.00 0.00 ? 40 ALA A CB   9 
ATOM 10081 H H    . ALA A 1 40 ? -5.099  21.838  -1.171  1.00 0.00 ? 40 ALA A H    9 
ATOM 10082 H HA   . ALA A 1 40 ? -3.345  22.657  -3.311  1.00 0.00 ? 40 ALA A HA   9 
ATOM 10083 H HB1  . ALA A 1 40 ? -5.879  21.193  -3.088  1.00 0.00 ? 40 ALA A HB1  9 
ATOM 10084 H HB2  . ALA A 1 40 ? -5.678  22.149  -4.555  1.00 0.00 ? 40 ALA A HB2  9 
ATOM 10085 H HB3  . ALA A 1 40 ? -4.489  20.923  -4.133  1.00 0.00 ? 40 ALA A HB3  9 
ATOM 10086 N N    . ARG A 1 41 ? -5.914  24.460  -2.405  1.00 0.00 ? 41 ARG A N    9 
ATOM 10087 C CA   . ARG A 1 41 ? -6.502  25.779  -2.527  1.00 0.00 ? 41 ARG A CA   9 
ATOM 10088 C C    . ARG A 1 41 ? -5.704  26.796  -1.713  1.00 0.00 ? 41 ARG A C    9 
ATOM 10089 O O    . ARG A 1 41 ? -5.973  27.996  -1.771  1.00 0.00 ? 41 ARG A O    9 
ATOM 10090 C CB   . ARG A 1 41 ? -7.958  25.754  -2.067  1.00 0.00 ? 41 ARG A CB   9 
ATOM 10091 C CG   . ARG A 1 41 ? -8.136  25.378  -0.606  1.00 0.00 ? 41 ARG A CG   9 
ATOM 10092 C CD   . ARG A 1 41 ? -9.606  25.248  -0.243  1.00 0.00 ? 41 ARG A CD   9 
ATOM 10093 N NE   . ARG A 1 41 ? -9.797  24.899  1.162   1.00 0.00 ? 41 ARG A NE   9 
ATOM 10094 C CZ   . ARG A 1 41 ? -10.982 24.622  1.701   1.00 0.00 ? 41 ARG A CZ   9 
ATOM 10095 N NH1  . ARG A 1 41 ? -12.081 24.653  0.956   1.00 0.00 ? 41 ARG A NH1  9 
ATOM 10096 N NH2  . ARG A 1 41 ? -11.070 24.314  2.987   1.00 0.00 ? 41 ARG A NH2  9 
ATOM 10097 H H    . ARG A 1 41 ? -6.257  23.839  -1.727  1.00 0.00 ? 41 ARG A H    9 
ATOM 10098 H HA   . ARG A 1 41 ? -6.466  26.062  -3.567  1.00 0.00 ? 41 ARG A HA   9 
ATOM 10099 H HB2  . ARG A 1 41 ? -8.385  26.731  -2.217  1.00 0.00 ? 41 ARG A HB2  9 
ATOM 10100 H HB3  . ARG A 1 41 ? -8.500  25.039  -2.667  1.00 0.00 ? 41 ARG A HB3  9 
ATOM 10101 H HG2  . ARG A 1 41 ? -7.644  24.434  -0.427  1.00 0.00 ? 41 ARG A HG2  9 
ATOM 10102 H HG3  . ARG A 1 41 ? -7.687  26.144  0.010   1.00 0.00 ? 41 ARG A HG3  9 
ATOM 10103 H HD2  . ARG A 1 41 ? -10.095 26.189  -0.439  1.00 0.00 ? 41 ARG A HD2  9 
ATOM 10104 H HD3  . ARG A 1 41 ? -10.047 24.478  -0.860  1.00 0.00 ? 41 ARG A HD3  9 
ATOM 10105 H HE   . ARG A 1 41 ? -9.004  24.872  1.735   1.00 0.00 ? 41 ARG A HE   9 
ATOM 10106 H HH11 . ARG A 1 41 ? -12.021 24.885  -0.015  1.00 0.00 ? 41 ARG A HH11 9 
ATOM 10107 H HH12 . ARG A 1 41 ? -12.968 24.443  1.366   1.00 0.00 ? 41 ARG A HH12 9 
ATOM 10108 H HH21 . ARG A 1 41 ? -10.245 24.290  3.552   1.00 0.00 ? 41 ARG A HH21 9 
ATOM 10109 H HH22 . ARG A 1 41 ? -11.960 24.107  3.392   1.00 0.00 ? 41 ARG A HH22 9 
ATOM 10110 N N    . GLN A 1 42 ? -4.722  26.312  -0.948  1.00 0.00 ? 42 GLN A N    9 
ATOM 10111 C CA   . GLN A 1 42 ? -3.895  27.190  -0.134  1.00 0.00 ? 42 GLN A CA   9 
ATOM 10112 C C    . GLN A 1 42 ? -2.933  28.015  -1.026  1.00 0.00 ? 42 GLN A C    9 
ATOM 10113 O O    . GLN A 1 42 ? -3.408  28.917  -1.718  1.00 0.00 ? 42 GLN A O    9 
ATOM 10114 C CB   . GLN A 1 42 ? -3.187  26.377  0.947   1.00 0.00 ? 42 GLN A CB   9 
ATOM 10115 C CG   . GLN A 1 42 ? -2.549  27.236  2.035   1.00 0.00 ? 42 GLN A CG   9 
ATOM 10116 C CD   . GLN A 1 42 ? -3.561  28.090  2.774   1.00 0.00 ? 42 GLN A CD   9 
ATOM 10117 O OE1  . GLN A 1 42 ? -4.455  27.576  3.447   1.00 0.00 ? 42 GLN A OE1  9 
ATOM 10118 N NE2  . GLN A 1 42 ? -3.425  29.406  2.646   1.00 0.00 ? 42 GLN A NE2  9 
ATOM 10119 H H    . GLN A 1 42 ? -4.556  25.344  -0.928  1.00 0.00 ? 42 GLN A H    9 
ATOM 10120 H HA   . GLN A 1 42 ? -4.566  27.886  0.345   1.00 0.00 ? 42 GLN A HA   9 
ATOM 10121 H HB2  . GLN A 1 42 ? -3.912  25.726  1.412   1.00 0.00 ? 42 GLN A HB2  9 
ATOM 10122 H HB3  . GLN A 1 42 ? -2.420  25.767  0.483   1.00 0.00 ? 42 GLN A HB3  9 
ATOM 10123 H HG2  . GLN A 1 42 ? -2.062  26.588  2.748   1.00 0.00 ? 42 GLN A HG2  9 
ATOM 10124 H HG3  . GLN A 1 42 ? -1.817  27.888  1.583   1.00 0.00 ? 42 GLN A HG3  9 
ATOM 10125 H HE21 . GLN A 1 42 ? -2.691  29.743  2.091   1.00 0.00 ? 42 GLN A HE21 9 
ATOM 10126 H HE22 . GLN A 1 42 ? -4.064  29.985  3.111   1.00 0.00 ? 42 GLN A HE22 9 
ATOM 10127 N N    . PRO A 1 43 ? -1.583  27.779  -1.064  1.00 0.00 ? 43 PRO A N    9 
ATOM 10128 C CA   . PRO A 1 43 ? -0.694  28.567  -1.901  1.00 0.00 ? 43 PRO A CA   9 
ATOM 10129 C C    . PRO A 1 43 ? -0.299  27.848  -3.185  1.00 0.00 ? 43 PRO A C    9 
ATOM 10130 O O    . PRO A 1 43 ? -0.697  28.249  -4.278  1.00 0.00 ? 43 PRO A O    9 
ATOM 10131 C CB   . PRO A 1 43 ? 0.522   28.740  -0.989  1.00 0.00 ? 43 PRO A CB   9 
ATOM 10132 C CG   . PRO A 1 43 ? 0.525   27.530  -0.095  1.00 0.00 ? 43 PRO A CG   9 
ATOM 10133 C CD   . PRO A 1 43 ? -0.774  26.786  -0.337  1.00 0.00 ? 43 PRO A CD   9 
ATOM 10134 H HA   . PRO A 1 43 ? -1.112  29.528  -2.144  1.00 0.00 ? 43 PRO A HA   9 
ATOM 10135 H HB2  . PRO A 1 43 ? 1.418   28.790  -1.588  1.00 0.00 ? 43 PRO A HB2  9 
ATOM 10136 H HB3  . PRO A 1 43 ? 0.417   29.649  -0.415  1.00 0.00 ? 43 PRO A HB3  9 
ATOM 10137 H HG2  . PRO A 1 43 ? 1.365   26.897  -0.341  1.00 0.00 ? 43 PRO A HG2  9 
ATOM 10138 H HG3  . PRO A 1 43 ? 0.587   27.842  0.938   1.00 0.00 ? 43 PRO A HG3  9 
ATOM 10139 H HD2  . PRO A 1 43 ? -0.599  25.909  -0.945  1.00 0.00 ? 43 PRO A HD2  9 
ATOM 10140 H HD3  . PRO A 1 43 ? -1.212  26.516  0.596   1.00 0.00 ? 43 PRO A HD3  9 
ATOM 10141 N N    . ASP A 1 44 ? 0.484   26.787  -3.047  1.00 0.00 ? 44 ASP A N    9 
ATOM 10142 C CA   . ASP A 1 44 ? 0.933   26.022  -4.195  1.00 0.00 ? 44 ASP A CA   9 
ATOM 10143 C C    . ASP A 1 44 ? 1.357   24.619  -3.783  1.00 0.00 ? 44 ASP A C    9 
ATOM 10144 O O    . ASP A 1 44 ? 2.297   24.062  -4.345  1.00 0.00 ? 44 ASP A O    9 
ATOM 10145 C CB   . ASP A 1 44 ? 2.098   26.736  -4.882  1.00 0.00 ? 44 ASP A CB   9 
ATOM 10146 C CG   . ASP A 1 44 ? 3.306   26.877  -3.972  1.00 0.00 ? 44 ASP A CG   9 
ATOM 10147 O OD1  . ASP A 1 44 ? 3.834   25.838  -3.523  1.00 0.00 ? 44 ASP A OD1  9 
ATOM 10148 O OD2  . ASP A 1 44 ? 3.721   28.024  -3.710  1.00 0.00 ? 44 ASP A OD2  9 
ATOM 10149 H H    . ASP A 1 44 ? 0.768   26.512  -2.154  1.00 0.00 ? 44 ASP A H    9 
ATOM 10150 H HA   . ASP A 1 44 ? 0.108   25.945  -4.890  1.00 0.00 ? 44 ASP A HA   9 
ATOM 10151 H HB2  . ASP A 1 44 ? 2.394   26.176  -5.757  1.00 0.00 ? 44 ASP A HB2  9 
ATOM 10152 H HB3  . ASP A 1 44 ? 1.781   27.726  -5.182  1.00 0.00 ? 44 ASP A HB3  9 
ATOM 10153 N N    . LEU A 1 45 ? 0.650   24.038  -2.813  1.00 0.00 ? 45 LEU A N    9 
ATOM 10154 C CA   . LEU A 1 45 ? 0.967   22.687  -2.362  1.00 0.00 ? 45 LEU A CA   9 
ATOM 10155 C C    . LEU A 1 45 ? 0.496   21.653  -3.391  1.00 0.00 ? 45 LEU A C    9 
ATOM 10156 O O    . LEU A 1 45 ? 0.398   20.463  -3.097  1.00 0.00 ? 45 LEU A O    9 
ATOM 10157 C CB   . LEU A 1 45 ? 0.320   22.414  -1.005  1.00 0.00 ? 45 LEU A CB   9 
ATOM 10158 C CG   . LEU A 1 45 ? 0.697   23.394  0.105   1.00 0.00 ? 45 LEU A CG   9 
ATOM 10159 C CD1  . LEU A 1 45 ? -0.095  23.096  1.369   1.00 0.00 ? 45 LEU A CD1  9 
ATOM 10160 C CD2  . LEU A 1 45 ? 2.190   23.333  0.384   1.00 0.00 ? 45 LEU A CD2  9 
ATOM 10161 H H    . LEU A 1 45 ? -0.103  24.524  -2.400  1.00 0.00 ? 45 LEU A H    9 
ATOM 10162 H HA   . LEU A 1 45 ? 2.041   22.613  -2.260  1.00 0.00 ? 45 LEU A HA   9 
ATOM 10163 H HB2  . LEU A 1 45 ? -0.745  22.441  -1.132  1.00 0.00 ? 45 LEU A HB2  9 
ATOM 10164 H HB3  . LEU A 1 45 ? 0.601   21.423  -0.687  1.00 0.00 ? 45 LEU A HB3  9 
ATOM 10165 H HG   . LEU A 1 45 ? 0.455   24.398  -0.211  1.00 0.00 ? 45 LEU A HG   9 
ATOM 10166 H HD11 . LEU A 1 45 ? -0.208  22.028  1.479   1.00 0.00 ? 45 LEU A HD11 9 
ATOM 10167 H HD12 . LEU A 1 45 ? 0.432   23.493  2.225   1.00 0.00 ? 45 LEU A HD12 9 
ATOM 10168 H HD13 . LEU A 1 45 ? -1.069  23.557  1.300   1.00 0.00 ? 45 LEU A HD13 9 
ATOM 10169 H HD21 . LEU A 1 45 ? 2.735   23.562  -0.519  1.00 0.00 ? 45 LEU A HD21 9 
ATOM 10170 H HD22 . LEU A 1 45 ? 2.442   24.053  1.150   1.00 0.00 ? 45 LEU A HD22 9 
ATOM 10171 H HD23 . LEU A 1 45 ? 2.452   22.342  0.723   1.00 0.00 ? 45 LEU A HD23 9 
ATOM 10172 N N    . ILE A 1 46 ? 0.211   22.119  -4.606  1.00 0.00 ? 46 ILE A N    9 
ATOM 10173 C CA   . ILE A 1 46 ? -0.242  21.251  -5.684  1.00 0.00 ? 46 ILE A CA   9 
ATOM 10174 C C    . ILE A 1 46 ? 0.629   19.998  -5.792  1.00 0.00 ? 46 ILE A C    9 
ATOM 10175 O O    . ILE A 1 46 ? 0.110   18.899  -5.941  1.00 0.00 ? 46 ILE A O    9 
ATOM 10176 C CB   . ILE A 1 46 ? -0.253  21.988  -7.030  1.00 0.00 ? 46 ILE A CB   9 
ATOM 10177 C CG1  . ILE A 1 46 ? -0.993  23.329  -6.894  1.00 0.00 ? 46 ILE A CG1  9 
ATOM 10178 C CG2  . ILE A 1 46 ? -0.905  21.123  -8.099  1.00 0.00 ? 46 ILE A CG2  9 
ATOM 10179 C CD1  . ILE A 1 46 ? -0.991  24.167  -8.153  1.00 0.00 ? 46 ILE A CD1  9 
ATOM 10180 H H    . ILE A 1 46 ? 0.314   23.069  -4.784  1.00 0.00 ? 46 ILE A H    9 
ATOM 10181 H HA   . ILE A 1 46 ? -1.254  20.951  -5.460  1.00 0.00 ? 46 ILE A HA   9 
ATOM 10182 H HB   . ILE A 1 46 ? 0.763   22.163  -7.317  1.00 0.00 ? 46 ILE A HB   9 
ATOM 10183 H HG12 . ILE A 1 46 ? -2.023  23.138  -6.631  1.00 0.00 ? 46 ILE A HG12 9 
ATOM 10184 H HG13 . ILE A 1 46 ? -0.534  23.914  -6.112  1.00 0.00 ? 46 ILE A HG13 9 
ATOM 10185 H HG21 . ILE A 1 46 ? -0.900  20.092  -7.779  1.00 0.00 ? 46 ILE A HG21 9 
ATOM 10186 H HG22 . ILE A 1 46 ? -1.924  21.447  -8.252  1.00 0.00 ? 46 ILE A HG22 9 
ATOM 10187 H HG23 . ILE A 1 46 ? -0.355  21.218  -9.023  1.00 0.00 ? 46 ILE A HG23 9 
ATOM 10188 H HD11 . ILE A 1 46 ? -0.154  23.885  -8.772  1.00 0.00 ? 46 ILE A HD11 9 
ATOM 10189 H HD12 . ILE A 1 46 ? -1.911  24.007  -8.693  1.00 0.00 ? 46 ILE A HD12 9 
ATOM 10190 H HD13 . ILE A 1 46 ? -0.908  25.213  -7.885  1.00 0.00 ? 46 ILE A HD13 9 
ATOM 10191 N N    . PRO A 1 47 ? 1.970   20.127  -5.716  1.00 0.00 ? 47 PRO A N    9 
ATOM 10192 C CA   . PRO A 1 47 ? 2.846   18.959  -5.791  1.00 0.00 ? 47 PRO A CA   9 
ATOM 10193 C C    . PRO A 1 47 ? 2.725   18.130  -4.520  1.00 0.00 ? 47 PRO A C    9 
ATOM 10194 O O    . PRO A 1 47 ? 2.869   16.901  -4.535  1.00 0.00 ? 47 PRO A O    9 
ATOM 10195 C CB   . PRO A 1 47 ? 4.247   19.556  -5.929  1.00 0.00 ? 47 PRO A CB   9 
ATOM 10196 C CG   . PRO A 1 47 ? 4.147   20.917  -5.330  1.00 0.00 ? 47 PRO A CG   9 
ATOM 10197 C CD   . PRO A 1 47 ? 2.731   21.382  -5.546  1.00 0.00 ? 47 PRO A CD   9 
ATOM 10198 H HA   . PRO A 1 47 ? 2.614   18.343  -6.648  1.00 0.00 ? 47 PRO A HA   9 
ATOM 10199 H HB2  . PRO A 1 47 ? 4.957   18.941  -5.396  1.00 0.00 ? 47 PRO A HB2  9 
ATOM 10200 H HB3  . PRO A 1 47 ? 4.518   19.605  -6.974  1.00 0.00 ? 47 PRO A HB3  9 
ATOM 10201 H HG2  . PRO A 1 47 ? 4.367   20.867  -4.274  1.00 0.00 ? 47 PRO A HG2  9 
ATOM 10202 H HG3  . PRO A 1 47 ? 4.838   21.585  -5.824  1.00 0.00 ? 47 PRO A HG3  9 
ATOM 10203 H HD2  . PRO A 1 47 ? 2.391   21.929  -4.686  1.00 0.00 ? 47 PRO A HD2  9 
ATOM 10204 H HD3  . PRO A 1 47 ? 2.666   21.996  -6.433  1.00 0.00 ? 47 PRO A HD3  9 
ATOM 10205 N N    . LEU A 1 48 ? 2.414   18.816  -3.421  1.00 0.00 ? 48 LEU A N    9 
ATOM 10206 C CA   . LEU A 1 48 ? 2.217   18.159  -2.142  1.00 0.00 ? 48 LEU A CA   9 
ATOM 10207 C C    . LEU A 1 48 ? 1.013   17.243  -2.262  1.00 0.00 ? 48 LEU A C    9 
ATOM 10208 O O    . LEU A 1 48 ? 0.955   16.172  -1.661  1.00 0.00 ? 48 LEU A O    9 
ATOM 10209 C CB   . LEU A 1 48 ? 1.970   19.195  -1.046  1.00 0.00 ? 48 LEU A CB   9 
ATOM 10210 C CG   . LEU A 1 48 ? 1.761   18.624  0.353   1.00 0.00 ? 48 LEU A CG   9 
ATOM 10211 C CD1  . LEU A 1 48 ? 3.042   17.988  0.869   1.00 0.00 ? 48 LEU A CD1  9 
ATOM 10212 C CD2  . LEU A 1 48 ? 1.274   19.712  1.299   1.00 0.00 ? 48 LEU A CD2  9 
ATOM 10213 H H    . LEU A 1 48 ? 2.283   19.786  -3.482  1.00 0.00 ? 48 LEU A H    9 
ATOM 10214 H HA   . LEU A 1 48 ? 3.097   17.577  -1.909  1.00 0.00 ? 48 LEU A HA   9 
ATOM 10215 H HB2  . LEU A 1 48 ? 2.813   19.869  -1.017  1.00 0.00 ? 48 LEU A HB2  9 
ATOM 10216 H HB3  . LEU A 1 48 ? 1.086   19.759  -1.309  1.00 0.00 ? 48 LEU A HB3  9 
ATOM 10217 H HG   . LEU A 1 48 ? 1.003   17.856  0.307   1.00 0.00 ? 48 LEU A HG   9 
ATOM 10218 H HD11 . LEU A 1 48 ? 3.842   18.713  0.835   1.00 0.00 ? 48 LEU A HD11 9 
ATOM 10219 H HD12 . LEU A 1 48 ? 2.896   17.659  1.886   1.00 0.00 ? 48 LEU A HD12 9 
ATOM 10220 H HD13 . LEU A 1 48 ? 3.297   17.142  0.249   1.00 0.00 ? 48 LEU A HD13 9 
ATOM 10221 H HD21 . LEU A 1 48 ? 0.367   20.150  0.905   1.00 0.00 ? 48 LEU A HD21 9 
ATOM 10222 H HD22 . LEU A 1 48 ? 1.075   19.284  2.271   1.00 0.00 ? 48 LEU A HD22 9 
ATOM 10223 H HD23 . LEU A 1 48 ? 2.033   20.476  1.390   1.00 0.00 ? 48 LEU A HD23 9 
ATOM 10224 N N    . LEU A 1 49 ? 0.061   17.685  -3.080  1.00 0.00 ? 49 LEU A N    9 
ATOM 10225 C CA   . LEU A 1 49 ? -1.153  16.938  -3.342  1.00 0.00 ? 49 LEU A CA   9 
ATOM 10226 C C    . LEU A 1 49 ? -0.834  15.488  -3.665  1.00 0.00 ? 49 LEU A C    9 
ATOM 10227 O O    . LEU A 1 49 ? -1.160  14.584  -2.900  1.00 0.00 ? 49 LEU A O    9 
ATOM 10228 C CB   . LEU A 1 49 ? -1.902  17.575  -4.515  1.00 0.00 ? 49 LEU A CB   9 
ATOM 10229 C CG   . LEU A 1 49 ? -2.422  18.989  -4.274  1.00 0.00 ? 49 LEU A CG   9 
ATOM 10230 C CD1  . LEU A 1 49 ? -3.374  19.391  -5.391  1.00 0.00 ? 49 LEU A CD1  9 
ATOM 10231 C CD2  . LEU A 1 49 ? -3.102  19.103  -2.914  1.00 0.00 ? 49 LEU A CD2  9 
ATOM 10232 H H    . LEU A 1 49 ? 0.191   18.541  -3.537  1.00 0.00 ? 49 LEU A H    9 
ATOM 10233 H HA   . LEU A 1 49 ? -1.771  16.977  -2.459  1.00 0.00 ? 49 LEU A HA   9 
ATOM 10234 H HB2  . LEU A 1 49 ? -1.230  17.612  -5.363  1.00 0.00 ? 49 LEU A HB2  9 
ATOM 10235 H HB3  . LEU A 1 49 ? -2.737  16.946  -4.773  1.00 0.00 ? 49 LEU A HB3  9 
ATOM 10236 H HG   . LEU A 1 49 ? -1.588  19.673  -4.287  1.00 0.00 ? 49 LEU A HG   9 
ATOM 10237 H HD11 . LEU A 1 49 ? -3.168  18.798  -6.270  1.00 0.00 ? 49 LEU A HD11 9 
ATOM 10238 H HD12 . LEU A 1 49 ? -4.392  19.220  -5.073  1.00 0.00 ? 49 LEU A HD12 9 
ATOM 10239 H HD13 . LEU A 1 49 ? -3.238  20.437  -5.622  1.00 0.00 ? 49 LEU A HD13 9 
ATOM 10240 H HD21 . LEU A 1 49 ? -3.217  18.123  -2.483  1.00 0.00 ? 49 LEU A HD21 9 
ATOM 10241 H HD22 . LEU A 1 49 ? -2.496  19.712  -2.260  1.00 0.00 ? 49 LEU A HD22 9 
ATOM 10242 H HD23 . LEU A 1 49 ? -4.070  19.560  -3.032  1.00 0.00 ? 49 LEU A HD23 9 
ATOM 10243 N N    . ARG A 1 50 ? -0.193  15.280  -4.808  1.00 0.00 ? 50 ARG A N    9 
ATOM 10244 C CA   . ARG A 1 50 ? 0.172   13.952  -5.245  1.00 0.00 ? 50 ARG A CA   9 
ATOM 10245 C C    . ARG A 1 50 ? 1.129   13.295  -4.257  1.00 0.00 ? 50 ARG A C    9 
ATOM 10246 O O    . ARG A 1 50 ? 0.945   12.139  -3.884  1.00 0.00 ? 50 ARG A O    9 
ATOM 10247 C CB   . ARG A 1 50 ? 0.800   14.026  -6.633  1.00 0.00 ? 50 ARG A CB   9 
ATOM 10248 C CG   . ARG A 1 50 ? -0.154  14.551  -7.693  1.00 0.00 ? 50 ARG A CG   9 
ATOM 10249 C CD   . ARG A 1 50 ? 0.471   14.523  -9.080  1.00 0.00 ? 50 ARG A CD   9 
ATOM 10250 N NE   . ARG A 1 50 ? -0.475  14.944  -10.113 1.00 0.00 ? 50 ARG A NE   9 
ATOM 10251 C CZ   . ARG A 1 50 ? -1.581  14.272  -10.425 1.00 0.00 ? 50 ARG A CZ   9 
ATOM 10252 N NH1  . ARG A 1 50 ? -1.868  13.126  -9.820  1.00 0.00 ? 50 ARG A NH1  9 
ATOM 10253 N NH2  . ARG A 1 50 ? -2.401  14.742  -11.356 1.00 0.00 ? 50 ARG A NH2  9 
ATOM 10254 H H    . ARG A 1 50 ? 0.040   16.042  -5.375  1.00 0.00 ? 50 ARG A H    9 
ATOM 10255 H HA   . ARG A 1 50 ? -0.733  13.361  -5.303  1.00 0.00 ? 50 ARG A HA   9 
ATOM 10256 H HB2  . ARG A 1 50 ? 1.662   14.675  -6.595  1.00 0.00 ? 50 ARG A HB2  9 
ATOM 10257 H HB3  . ARG A 1 50 ? 1.116   13.043  -6.920  1.00 0.00 ? 50 ARG A HB3  9 
ATOM 10258 H HG2  . ARG A 1 50 ? -1.043  13.939  -7.697  1.00 0.00 ? 50 ARG A HG2  9 
ATOM 10259 H HG3  . ARG A 1 50 ? -0.421  15.568  -7.450  1.00 0.00 ? 50 ARG A HG3  9 
ATOM 10260 H HD2  . ARG A 1 50 ? 1.322   15.188  -9.091  1.00 0.00 ? 50 ARG A HD2  9 
ATOM 10261 H HD3  . ARG A 1 50 ? 0.799   13.517  -9.294  1.00 0.00 ? 50 ARG A HD3  9 
ATOM 10262 H HE   . ARG A 1 50 ? -0.279  15.777  -10.592 1.00 0.00 ? 50 ARG A HE   9 
ATOM 10263 H HH11 . ARG A 1 50 ? -1.250  12.758  -9.126  1.00 0.00 ? 50 ARG A HH11 9 
ATOM 10264 H HH12 . ARG A 1 50 ? -2.703  12.630  -10.058 1.00 0.00 ? 50 ARG A HH12 9 
ATOM 10265 H HH21 . ARG A 1 50 ? -2.188  15.600  -11.823 1.00 0.00 ? 50 ARG A HH21 9 
ATOM 10266 H HH22 . ARG A 1 50 ? -3.232  14.237  -11.592 1.00 0.00 ? 50 ARG A HH22 9 
ATOM 10267 N N    . THR A 1 51 ? 2.151   14.036  -3.827  1.00 0.00 ? 51 THR A N    9 
ATOM 10268 C CA   . THR A 1 51 ? 3.124   13.496  -2.879  1.00 0.00 ? 51 THR A CA   9 
ATOM 10269 C C    . THR A 1 51 ? 2.432   12.988  -1.613  1.00 0.00 ? 51 THR A C    9 
ATOM 10270 O O    . THR A 1 51 ? 2.794   11.950  -1.074  1.00 0.00 ? 51 THR A O    9 
ATOM 10271 C CB   . THR A 1 51 ? 4.172   14.550  -2.521  1.00 0.00 ? 51 THR A CB   9 
ATOM 10272 O OG1  . THR A 1 51 ? 4.885   14.955  -3.675  1.00 0.00 ? 51 THR A OG1  9 
ATOM 10273 C CG2  . THR A 1 51 ? 5.186   14.070  -1.504  1.00 0.00 ? 51 THR A CG2  9 
ATOM 10274 H H    . THR A 1 51 ? 2.254   14.961  -4.152  1.00 0.00 ? 51 THR A H    9 
ATOM 10275 H HA   . THR A 1 51 ? 3.617   12.660  -3.363  1.00 0.00 ? 51 THR A HA   9 
ATOM 10276 H HB   . THR A 1 51 ? 3.673   15.416  -2.108  1.00 0.00 ? 51 THR A HB   9 
ATOM 10277 H HG1  . THR A 1 51 ? 5.557   15.592  -3.428  1.00 0.00 ? 51 THR A HG1  9 
ATOM 10278 H HG21 . THR A 1 51 ? 5.660   13.170  -1.865  1.00 0.00 ? 51 THR A HG21 9 
ATOM 10279 H HG22 . THR A 1 51 ? 5.934   14.834  -1.353  1.00 0.00 ? 51 THR A HG22 9 
ATOM 10280 H HG23 . THR A 1 51 ? 4.687   13.865  -0.569  1.00 0.00 ? 51 THR A HG23 9 
ATOM 10281 N N    . GLN A 1 52 ? 1.425   13.716  -1.148  1.00 0.00 ? 52 GLN A N    9 
ATOM 10282 C CA   . GLN A 1 52 ? 0.688   13.305  0.045   1.00 0.00 ? 52 GLN A CA   9 
ATOM 10283 C C    . GLN A 1 52 ? -0.418  12.326  -0.333  1.00 0.00 ? 52 GLN A C    9 
ATOM 10284 O O    . GLN A 1 52 ? -0.833  11.501  0.477   1.00 0.00 ? 52 GLN A O    9 
ATOM 10285 C CB   . GLN A 1 52 ? 0.102   14.517  0.776   1.00 0.00 ? 52 GLN A CB   9 
ATOM 10286 C CG   . GLN A 1 52 ? 1.162   15.452  1.336   1.00 0.00 ? 52 GLN A CG   9 
ATOM 10287 C CD   . GLN A 1 52 ? 0.603   16.442  2.340   1.00 0.00 ? 52 GLN A CD   9 
ATOM 10288 O OE1  . GLN A 1 52 ? -0.264  17.253  2.017   1.00 0.00 ? 52 GLN A OE1  9 
ATOM 10289 N NE2  . GLN A 1 52 ? 1.104   16.380  3.569   1.00 0.00 ? 52 GLN A NE2  9 
ATOM 10290 H H    . GLN A 1 52 ? 1.164   14.534  -1.618  1.00 0.00 ? 52 GLN A H    9 
ATOM 10291 H HA   . GLN A 1 52 ? 1.383   12.803  0.706   1.00 0.00 ? 52 GLN A HA   9 
ATOM 10292 H HB2  . GLN A 1 52 ? -0.517  15.074  0.089   1.00 0.00 ? 52 GLN A HB2  9 
ATOM 10293 H HB3  . GLN A 1 52 ? -0.508  14.167  1.597   1.00 0.00 ? 52 GLN A HB3  9 
ATOM 10294 H HG2  . GLN A 1 52 ? 1.923   14.862  1.823   1.00 0.00 ? 52 GLN A HG2  9 
ATOM 10295 H HG3  . GLN A 1 52 ? 1.604   16.002  0.519   1.00 0.00 ? 52 GLN A HG3  9 
ATOM 10296 H HE21 . GLN A 1 52 ? 1.794   15.709  3.753   1.00 0.00 ? 52 GLN A HE21 9 
ATOM 10297 H HE22 . GLN A 1 52 ? 0.765   17.008  4.240   1.00 0.00 ? 52 GLN A HE22 9 
ATOM 10298 N N    . PHE A 1 53 ? -0.881  12.421  -1.575  1.00 0.00 ? 53 PHE A N    9 
ATOM 10299 C CA   . PHE A 1 53 ? -1.933  11.544  -2.071  1.00 0.00 ? 53 PHE A CA   9 
ATOM 10300 C C    . PHE A 1 53 ? -1.482  10.088  -2.012  1.00 0.00 ? 53 PHE A C    9 
ATOM 10301 O O    . PHE A 1 53 ? -2.160  9.248   -1.421  1.00 0.00 ? 53 PHE A O    9 
ATOM 10302 C CB   . PHE A 1 53 ? -2.307  11.926  -3.509  1.00 0.00 ? 53 PHE A CB   9 
ATOM 10303 C CG   . PHE A 1 53 ? -3.454  11.133  -4.070  1.00 0.00 ? 53 PHE A CG   9 
ATOM 10304 C CD1  . PHE A 1 53 ? -3.316  9.782   -4.347  1.00 0.00 ? 53 PHE A CD1  9 
ATOM 10305 C CD2  . PHE A 1 53 ? -4.677  11.739  -4.312  1.00 0.00 ? 53 PHE A CD2  9 
ATOM 10306 C CE1  . PHE A 1 53 ? -4.374  9.052   -4.854  1.00 0.00 ? 53 PHE A CE1  9 
ATOM 10307 C CE2  . PHE A 1 53 ? -5.737  11.013  -4.821  1.00 0.00 ? 53 PHE A CE2  9 
ATOM 10308 C CZ   . PHE A 1 53 ? -5.586  9.669   -5.092  1.00 0.00 ? 53 PHE A CZ   9 
ATOM 10309 H H    . PHE A 1 53 ? -0.503  13.094  -2.175  1.00 0.00 ? 53 PHE A H    9 
ATOM 10310 H HA   . PHE A 1 53 ? -2.804  11.668  -1.435  1.00 0.00 ? 53 PHE A HA   9 
ATOM 10311 H HB2  . PHE A 1 53 ? -2.585  12.970  -3.535  1.00 0.00 ? 53 PHE A HB2  9 
ATOM 10312 H HB3  . PHE A 1 53 ? -1.451  11.772  -4.149  1.00 0.00 ? 53 PHE A HB3  9 
ATOM 10313 H HD1  . PHE A 1 53 ? -2.369  9.298   -4.163  1.00 0.00 ? 53 PHE A HD1  9 
ATOM 10314 H HD2  . PHE A 1 53 ? -4.796  12.791  -4.101  1.00 0.00 ? 53 PHE A HD2  9 
ATOM 10315 H HE1  . PHE A 1 53 ? -4.253  7.999   -5.065  1.00 0.00 ? 53 PHE A HE1  9 
ATOM 10316 H HE2  . PHE A 1 53 ? -6.684  11.498  -5.006  1.00 0.00 ? 53 PHE A HE2  9 
ATOM 10317 H HZ   . PHE A 1 53 ? -6.415  9.100   -5.488  1.00 0.00 ? 53 PHE A HZ   9 
ATOM 10318 N N    . PHE A 1 54 ? -0.330  9.790   -2.616  1.00 0.00 ? 54 PHE A N    9 
ATOM 10319 C CA   . PHE A 1 54 ? 0.185   8.423   -2.623  1.00 0.00 ? 54 PHE A CA   9 
ATOM 10320 C C    . PHE A 1 54 ? 0.611   7.997   -1.214  1.00 0.00 ? 54 PHE A C    9 
ATOM 10321 O O    . PHE A 1 54 ? 0.512   6.822   -0.863  1.00 0.00 ? 54 PHE A O    9 
ATOM 10322 C CB   . PHE A 1 54 ? 1.332   8.263   -3.643  1.00 0.00 ? 54 PHE A CB   9 
ATOM 10323 C CG   . PHE A 1 54 ? 2.701   8.609   -3.134  1.00 0.00 ? 54 PHE A CG   9 
ATOM 10324 C CD1  . PHE A 1 54 ? 3.036   9.911   -2.832  1.00 0.00 ? 54 PHE A CD1  9 
ATOM 10325 C CD2  . PHE A 1 54 ? 3.649   7.619   -2.952  1.00 0.00 ? 54 PHE A CD2  9 
ATOM 10326 C CE1  . PHE A 1 54 ? 4.292   10.222  -2.357  1.00 0.00 ? 54 PHE A CE1  9 
ATOM 10327 C CE2  . PHE A 1 54 ? 4.905   7.925   -2.478  1.00 0.00 ? 54 PHE A CE2  9 
ATOM 10328 C CZ   . PHE A 1 54 ? 5.225   9.228   -2.178  1.00 0.00 ? 54 PHE A CZ   9 
ATOM 10329 H H    . PHE A 1 54 ? 0.176   10.498  -3.067  1.00 0.00 ? 54 PHE A H    9 
ATOM 10330 H HA   . PHE A 1 54 ? -0.633  7.778   -2.934  1.00 0.00 ? 54 PHE A HA   9 
ATOM 10331 H HB2  . PHE A 1 54 ? 1.361   7.239   -3.977  1.00 0.00 ? 54 PHE A HB2  9 
ATOM 10332 H HB3  . PHE A 1 54 ? 1.130   8.903   -4.492  1.00 0.00 ? 54 PHE A HB3  9 
ATOM 10333 H HD1  . PHE A 1 54 ? 2.305   10.693  -2.970  1.00 0.00 ? 54 PHE A HD1  9 
ATOM 10334 H HD2  . PHE A 1 54 ? 3.397   6.595   -3.186  1.00 0.00 ? 54 PHE A HD2  9 
ATOM 10335 H HE1  . PHE A 1 54 ? 4.544   11.246  -2.127  1.00 0.00 ? 54 PHE A HE1  9 
ATOM 10336 H HE2  . PHE A 1 54 ? 5.637   7.144   -2.339  1.00 0.00 ? 54 PHE A HE2  9 
ATOM 10337 H HZ   . PHE A 1 54 ? 6.209   9.472   -1.806  1.00 0.00 ? 54 PHE A HZ   9 
ATOM 10338 N N    . ILE A 1 55 ? 1.051   8.960   -0.396  1.00 0.00 ? 55 ILE A N    9 
ATOM 10339 C CA   . ILE A 1 55 ? 1.441   8.661   0.983   1.00 0.00 ? 55 ILE A CA   9 
ATOM 10340 C C    . ILE A 1 55 ? 0.215   8.229   1.781   1.00 0.00 ? 55 ILE A C    9 
ATOM 10341 O O    . ILE A 1 55 ? 0.167   7.126   2.323   1.00 0.00 ? 55 ILE A O    9 
ATOM 10342 C CB   . ILE A 1 55 ? 2.078   9.880   1.699   1.00 0.00 ? 55 ILE A CB   9 
ATOM 10343 C CG1  . ILE A 1 55 ? 3.376   10.314  1.016   1.00 0.00 ? 55 ILE A CG1  9 
ATOM 10344 C CG2  . ILE A 1 55 ? 2.345   9.557   3.165   1.00 0.00 ? 55 ILE A CG2  9 
ATOM 10345 C CD1  . ILE A 1 55 ? 4.491   9.292   1.116   1.00 0.00 ? 55 ILE A CD1  9 
ATOM 10346 H H    . ILE A 1 55 ? 1.086   9.885   -0.716  1.00 0.00 ? 55 ILE A H    9 
ATOM 10347 H HA   . ILE A 1 55 ? 2.156   7.854   0.968   1.00 0.00 ? 55 ILE A HA   9 
ATOM 10348 H HB   . ILE A 1 55 ? 1.371   10.696  1.663   1.00 0.00 ? 55 ILE A HB   9 
ATOM 10349 H HG12 . ILE A 1 55 ? 3.182   10.498  -0.028  1.00 0.00 ? 55 ILE A HG12 9 
ATOM 10350 H HG13 . ILE A 1 55 ? 3.724   11.227  1.475   1.00 0.00 ? 55 ILE A HG13 9 
ATOM 10351 H HG21 . ILE A 1 55 ? 2.975   8.681   3.231   1.00 0.00 ? 55 ILE A HG21 9 
ATOM 10352 H HG22 . ILE A 1 55 ? 2.841   10.394  3.633   1.00 0.00 ? 55 ILE A HG22 9 
ATOM 10353 H HG23 . ILE A 1 55 ? 1.409   9.366   3.667   1.00 0.00 ? 55 ILE A HG23 9 
ATOM 10354 H HD11 . ILE A 1 55 ? 4.129   8.330   0.787   1.00 0.00 ? 55 ILE A HD11 9 
ATOM 10355 H HD12 . ILE A 1 55 ? 5.320   9.601   0.495   1.00 0.00 ? 55 ILE A HD12 9 
ATOM 10356 H HD13 . ILE A 1 55 ? 4.820   9.218   2.143   1.00 0.00 ? 55 ILE A HD13 9 
ATOM 10357 N N    . VAL A 1 56 ? -0.779  9.112   1.839   1.00 0.00 ? 56 VAL A N    9 
ATOM 10358 C CA   . VAL A 1 56 ? -2.014  8.839   2.565   1.00 0.00 ? 56 VAL A CA   9 
ATOM 10359 C C    . VAL A 1 56 ? -2.667  7.551   2.078   1.00 0.00 ? 56 VAL A C    9 
ATOM 10360 O O    . VAL A 1 56 ? -3.079  6.718   2.877   1.00 0.00 ? 56 VAL A O    9 
ATOM 10361 C CB   . VAL A 1 56 ? -3.028  9.997   2.418   1.00 0.00 ? 56 VAL A CB   9 
ATOM 10362 C CG1  . VAL A 1 56 ? -4.316  9.682   3.166   1.00 0.00 ? 56 VAL A CG1  9 
ATOM 10363 C CG2  . VAL A 1 56 ? -2.430  11.309  2.909   1.00 0.00 ? 56 VAL A CG2  9 
ATOM 10364 H H    . VAL A 1 56 ? -0.676  9.971   1.382   1.00 0.00 ? 56 VAL A H    9 
ATOM 10365 H HA   . VAL A 1 56 ? -1.769  8.735   3.612   1.00 0.00 ? 56 VAL A HA   9 
ATOM 10366 H HB   . VAL A 1 56 ? -3.266  10.107  1.369   1.00 0.00 ? 56 VAL A HB   9 
ATOM 10367 H HG11 . VAL A 1 56 ? -4.130  8.901   3.888   1.00 0.00 ? 56 VAL A HG11 9 
ATOM 10368 H HG12 . VAL A 1 56 ? -4.664  10.568  3.675   1.00 0.00 ? 56 VAL A HG12 9 
ATOM 10369 H HG13 . VAL A 1 56 ? -5.068  9.351   2.464   1.00 0.00 ? 56 VAL A HG13 9 
ATOM 10370 H HG21 . VAL A 1 56 ? -1.447  11.129  3.315   1.00 0.00 ? 56 VAL A HG21 9 
ATOM 10371 H HG22 . VAL A 1 56 ? -2.358  12.001  2.084   1.00 0.00 ? 56 VAL A HG22 9 
ATOM 10372 H HG23 . VAL A 1 56 ? -3.066  11.731  3.676   1.00 0.00 ? 56 VAL A HG23 9 
ATOM 10373 N N    . MET A 1 57 ? -2.757  7.391   0.763   1.00 0.00 ? 57 MET A N    9 
ATOM 10374 C CA   . MET A 1 57 ? -3.363  6.199   0.185   1.00 0.00 ? 57 MET A CA   9 
ATOM 10375 C C    . MET A 1 57 ? -2.484  4.984   0.422   1.00 0.00 ? 57 MET A C    9 
ATOM 10376 O O    . MET A 1 57 ? -2.974  3.867   0.586   1.00 0.00 ? 57 MET A O    9 
ATOM 10377 C CB   . MET A 1 57 ? -3.597  6.390   -1.316  1.00 0.00 ? 57 MET A CB   9 
ATOM 10378 C CG   . MET A 1 57 ? -4.241  5.188   -1.988  1.00 0.00 ? 57 MET A CG   9 
ATOM 10379 S SD   . MET A 1 57 ? -4.626  5.475   -3.727  1.00 0.00 ? 57 MET A SD   9 
ATOM 10380 C CE   . MET A 1 57 ? -2.986  5.681   -4.417  1.00 0.00 ? 57 MET A CE   9 
ATOM 10381 H H    . MET A 1 57 ? -2.406  8.086   0.170   1.00 0.00 ? 57 MET A H    9 
ATOM 10382 H HA   . MET A 1 57 ? -4.308  6.041   0.671   1.00 0.00 ? 57 MET A HA   9 
ATOM 10383 H HB2  . MET A 1 57 ? -4.236  7.245   -1.463  1.00 0.00 ? 57 MET A HB2  9 
ATOM 10384 H HB3  . MET A 1 57 ? -2.646  6.574   -1.796  1.00 0.00 ? 57 MET A HB3  9 
ATOM 10385 H HG2  . MET A 1 57 ? -3.562  4.351   -1.920  1.00 0.00 ? 57 MET A HG2  9 
ATOM 10386 H HG3  . MET A 1 57 ? -5.156  4.949   -1.465  1.00 0.00 ? 57 MET A HG3  9 
ATOM 10387 H HE1  . MET A 1 57 ? -2.308  6.011   -3.645  1.00 0.00 ? 57 MET A HE1  9 
ATOM 10388 H HE2  . MET A 1 57 ? -2.643  4.739   -4.818  1.00 0.00 ? 57 MET A HE2  9 
ATOM 10389 H HE3  . MET A 1 57 ? -3.019  6.417   -5.207  1.00 0.00 ? 57 MET A HE3  9 
ATOM 10390 N N    . GLY A 1 58 ? -1.184  5.218   0.430   1.00 0.00 ? 58 GLY A N    9 
ATOM 10391 C CA   . GLY A 1 58 ? -0.234  4.145   0.634   1.00 0.00 ? 58 GLY A CA   9 
ATOM 10392 C C    . GLY A 1 58 ? -0.225  3.625   2.059   1.00 0.00 ? 58 GLY A C    9 
ATOM 10393 O O    . GLY A 1 58 ? -0.174  2.415   2.276   1.00 0.00 ? 58 GLY A O    9 
ATOM 10394 H H    . GLY A 1 58 ? -0.866  6.132   0.288   1.00 0.00 ? 58 GLY A H    9 
ATOM 10395 H HA2  . GLY A 1 58 ? -0.481  3.330   -0.032  1.00 0.00 ? 58 GLY A HA2  9 
ATOM 10396 H HA3  . GLY A 1 58 ? 0.750   4.504   0.389   1.00 0.00 ? 58 GLY A HA3  9 
ATOM 10397 N N    . LEU A 1 59 ? -0.275  4.528   3.035   1.00 0.00 ? 59 LEU A N    9 
ATOM 10398 C CA   . LEU A 1 59 ? -0.273  4.116   4.429   1.00 0.00 ? 59 LEU A CA   9 
ATOM 10399 C C    . LEU A 1 59 ? -1.543  3.335   4.749   1.00 0.00 ? 59 LEU A C    9 
ATOM 10400 O O    . LEU A 1 59 ? -1.532  2.430   5.583   1.00 0.00 ? 59 LEU A O    9 
ATOM 10401 C CB   . LEU A 1 59 ? -0.097  5.327   5.356   1.00 0.00 ? 59 LEU A CB   9 
ATOM 10402 C CG   . LEU A 1 59 ? -1.161  6.422   5.253   1.00 0.00 ? 59 LEU A CG   9 
ATOM 10403 C CD1  . LEU A 1 59 ? -2.433  6.005   5.971   1.00 0.00 ? 59 LEU A CD1  9 
ATOM 10404 C CD2  . LEU A 1 59 ? -0.634  7.731   5.823   1.00 0.00 ? 59 LEU A CD2  9 
ATOM 10405 H H    . LEU A 1 59 ? -0.316  5.479   2.815   1.00 0.00 ? 59 LEU A H    9 
ATOM 10406 H HA   . LEU A 1 59 ? 0.572   3.455   4.563   1.00 0.00 ? 59 LEU A HA   9 
ATOM 10407 H HB2  . LEU A 1 59 ? -0.086  4.968   6.370   1.00 0.00 ? 59 LEU A HB2  9 
ATOM 10408 H HB3  . LEU A 1 59 ? 0.864   5.774   5.145   1.00 0.00 ? 59 LEU A HB3  9 
ATOM 10409 H HG   . LEU A 1 59 ? -1.401  6.582   4.214   1.00 0.00 ? 59 LEU A HG   9 
ATOM 10410 H HD11 . LEU A 1 59 ? -2.182  5.397   6.827   1.00 0.00 ? 59 LEU A HD11 9 
ATOM 10411 H HD12 . LEU A 1 59 ? -2.966  6.886   6.300   1.00 0.00 ? 59 LEU A HD12 9 
ATOM 10412 H HD13 . LEU A 1 59 ? -3.054  5.442   5.299   1.00 0.00 ? 59 LEU A HD13 9 
ATOM 10413 H HD21 . LEU A 1 59 ? 0.176   7.527   6.508   1.00 0.00 ? 59 LEU A HD21 9 
ATOM 10414 H HD22 . LEU A 1 59 ? -0.274  8.355   5.018   1.00 0.00 ? 59 LEU A HD22 9 
ATOM 10415 H HD23 . LEU A 1 59 ? -1.427  8.242   6.346   1.00 0.00 ? 59 LEU A HD23 9 
ATOM 10416 N N    . VAL A 1 60 ? -2.624  3.646   4.034   1.00 0.00 ? 60 VAL A N    9 
ATOM 10417 C CA   . VAL A 1 60 ? -3.884  2.933   4.210   1.00 0.00 ? 60 VAL A CA   9 
ATOM 10418 C C    . VAL A 1 60 ? -3.806  1.590   3.494   1.00 0.00 ? 60 VAL A C    9 
ATOM 10419 O O    . VAL A 1 60 ? -4.119  0.545   4.066   1.00 0.00 ? 60 VAL A O    9 
ATOM 10420 C CB   . VAL A 1 60 ? -5.085  3.742   3.661   1.00 0.00 ? 60 VAL A CB   9 
ATOM 10421 C CG1  . VAL A 1 60 ? -6.383  2.969   3.821   1.00 0.00 ? 60 VAL A CG1  9 
ATOM 10422 C CG2  . VAL A 1 60 ? -5.195  5.090   4.355   1.00 0.00 ? 60 VAL A CG2  9 
ATOM 10423 H H    . VAL A 1 60 ? -2.562  4.345   3.350   1.00 0.00 ? 60 VAL A H    9 
ATOM 10424 H HA   . VAL A 1 60 ? -4.035  2.763   5.270   1.00 0.00 ? 60 VAL A HA   9 
ATOM 10425 H HB   . VAL A 1 60 ? -4.924  3.917   2.607   1.00 0.00 ? 60 VAL A HB   9 
ATOM 10426 H HG11 . VAL A 1 60 ? -6.239  1.950   3.498   1.00 0.00 ? 60 VAL A HG11 9 
ATOM 10427 H HG12 . VAL A 1 60 ? -6.682  2.980   4.859   1.00 0.00 ? 60 VAL A HG12 9 
ATOM 10428 H HG13 . VAL A 1 60 ? -7.153  3.435   3.221   1.00 0.00 ? 60 VAL A HG13 9 
ATOM 10429 H HG21 . VAL A 1 60 ? -5.089  4.956   5.420   1.00 0.00 ? 60 VAL A HG21 9 
ATOM 10430 H HG22 . VAL A 1 60 ? -4.418  5.744   3.996   1.00 0.00 ? 60 VAL A HG22 9 
ATOM 10431 H HG23 . VAL A 1 60 ? -6.160  5.526   4.141   1.00 0.00 ? 60 VAL A HG23 9 
ATOM 10432 N N    . ASP A 1 61 ? -3.361  1.628   2.239   1.00 0.00 ? 61 ASP A N    9 
ATOM 10433 C CA   . ASP A 1 61 ? -3.210  0.427   1.435   1.00 0.00 ? 61 ASP A CA   9 
ATOM 10434 C C    . ASP A 1 61 ? -2.010  -0.397  1.890   1.00 0.00 ? 61 ASP A C    9 
ATOM 10435 O O    . ASP A 1 61 ? -1.818  -1.535  1.451   1.00 0.00 ? 61 ASP A O    9 
ATOM 10436 C CB   . ASP A 1 61 ? -3.058  0.803   -0.037  1.00 0.00 ? 61 ASP A CB   9 
ATOM 10437 C CG   . ASP A 1 61 ? -4.355  1.315   -0.636  1.00 0.00 ? 61 ASP A CG   9 
ATOM 10438 O OD1  . ASP A 1 61 ? -5.361  0.576   -0.590  1.00 0.00 ? 61 ASP A OD1  9 
ATOM 10439 O OD2  . ASP A 1 61 ? -4.364  2.450   -1.154  1.00 0.00 ? 61 ASP A OD2  9 
ATOM 10440 H H    . ASP A 1 61 ? -3.112  2.488   1.846   1.00 0.00 ? 61 ASP A H    9 
ATOM 10441 H HA   . ASP A 1 61 ? -4.104  -0.168  1.558   1.00 0.00 ? 61 ASP A HA   9 
ATOM 10442 H HB2  . ASP A 1 61 ? -2.306  1.579   -0.131  1.00 0.00 ? 61 ASP A HB2  9 
ATOM 10443 H HB3  . ASP A 1 61 ? -2.743  -0.062  -0.590  1.00 0.00 ? 61 ASP A HB3  9 
ATOM 10444 N N    . ALA A 1 62 ? -1.208  0.164   2.785   1.00 0.00 ? 62 ALA A N    9 
ATOM 10445 C CA   . ALA A 1 62 ? -0.057  -0.553  3.298   1.00 0.00 ? 62 ALA A CA   9 
ATOM 10446 C C    . ALA A 1 62 ? -0.521  -1.811  4.020   1.00 0.00 ? 62 ALA A C    9 
ATOM 10447 O O    . ALA A 1 62 ? 0.173   -2.825  4.031   1.00 0.00 ? 62 ALA A O    9 
ATOM 10448 C CB   . ALA A 1 62 ? 0.758   0.333   4.228   1.00 0.00 ? 62 ALA A CB   9 
ATOM 10449 H H    . ALA A 1 62 ? -1.402  1.064   3.117   1.00 0.00 ? 62 ALA A H    9 
ATOM 10450 H HA   . ALA A 1 62 ? 0.563   -0.836  2.461   1.00 0.00 ? 62 ALA A HA   9 
ATOM 10451 H HB1  . ALA A 1 62 ? 0.206   1.235   4.440   1.00 0.00 ? 62 ALA A HB1  9 
ATOM 10452 H HB2  . ALA A 1 62 ? 0.955   -0.195  5.149   1.00 0.00 ? 62 ALA A HB2  9 
ATOM 10453 H HB3  . ALA A 1 62 ? 1.694   0.586   3.752   1.00 0.00 ? 62 ALA A HB3  9 
ATOM 10454 N N    . ILE A 1 63 ? -1.715  -1.745  4.608   1.00 0.00 ? 63 ILE A N    9 
ATOM 10455 C CA   . ILE A 1 63 ? -2.268  -2.885  5.317   1.00 0.00 ? 63 ILE A CA   9 
ATOM 10456 C C    . ILE A 1 63 ? -2.471  -4.065  4.360   1.00 0.00 ? 63 ILE A C    9 
ATOM 10457 O O    . ILE A 1 63 ? -1.842  -5.108  4.543   1.00 0.00 ? 63 ILE A O    9 
ATOM 10458 C CB   . ILE A 1 63 ? -3.571  -2.528  6.069   1.00 0.00 ? 63 ILE A CB   9 
ATOM 10459 C CG1  . ILE A 1 63 ? -3.281  -1.455  7.120   1.00 0.00 ? 63 ILE A CG1  9 
ATOM 10460 C CG2  . ILE A 1 63 ? -4.177  -3.764  6.718   1.00 0.00 ? 63 ILE A CG2  9 
ATOM 10461 C CD1  . ILE A 1 63 ? -4.492  -1.072  7.942   1.00 0.00 ? 63 ILE A CD1  9 
ATOM 10462 H H    . ILE A 1 63 ? -2.232  -0.916  4.553   1.00 0.00 ? 63 ILE A H    9 
ATOM 10463 H HA   . ILE A 1 63 ? -1.534  -3.180  6.056   1.00 0.00 ? 63 ILE A HA   9 
ATOM 10464 H HB   . ILE A 1 63 ? -4.278  -2.133  5.368   1.00 0.00 ? 63 ILE A HB   9 
ATOM 10465 H HG12 . ILE A 1 63 ? -2.520  -1.816  7.793   1.00 0.00 ? 63 ILE A HG12 9 
ATOM 10466 H HG13 . ILE A 1 63 ? -2.923  -0.565  6.622   1.00 0.00 ? 63 ILE A HG13 9 
ATOM 10467 H HG21 . ILE A 1 63 ? -3.463  -4.574  6.686   1.00 0.00 ? 63 ILE A HG21 9 
ATOM 10468 H HG22 . ILE A 1 63 ? -4.427  -3.547  7.746   1.00 0.00 ? 63 ILE A HG22 9 
ATOM 10469 H HG23 . ILE A 1 63 ? -5.069  -4.051  6.183   1.00 0.00 ? 63 ILE A HG23 9 
ATOM 10470 H HD11 . ILE A 1 63 ? -5.009  -1.966  8.260   1.00 0.00 ? 63 ILE A HD11 9 
ATOM 10471 H HD12 . ILE A 1 63 ? -4.176  -0.512  8.810   1.00 0.00 ? 63 ILE A HD12 9 
ATOM 10472 H HD13 . ILE A 1 63 ? -5.156  -0.465  7.344   1.00 0.00 ? 63 ILE A HD13 9 
ATOM 10473 N N    . PRO A 1 64 ? -3.326  -3.951  3.313   1.00 0.00 ? 64 PRO A N    9 
ATOM 10474 C CA   . PRO A 1 64 ? -3.505  -5.055  2.371   1.00 0.00 ? 64 PRO A CA   9 
ATOM 10475 C C    . PRO A 1 64 ? -2.194  -5.382  1.684   1.00 0.00 ? 64 PRO A C    9 
ATOM 10476 O O    . PRO A 1 64 ? -1.968  -6.509  1.249   1.00 0.00 ? 64 PRO A O    9 
ATOM 10477 C CB   . PRO A 1 64 ? -4.524  -4.531  1.355   1.00 0.00 ? 64 PRO A CB   9 
ATOM 10478 C CG   . PRO A 1 64 ? -5.185  -3.385  2.031   1.00 0.00 ? 64 PRO A CG   9 
ATOM 10479 C CD   . PRO A 1 64 ? -4.157  -2.788  2.945   1.00 0.00 ? 64 PRO A CD   9 
ATOM 10480 H HA   . PRO A 1 64 ? -3.882  -5.935  2.861   1.00 0.00 ? 64 PRO A HA   9 
ATOM 10481 H HB2  . PRO A 1 64 ? -4.012  -4.217  0.457   1.00 0.00 ? 64 PRO A HB2  9 
ATOM 10482 H HB3  . PRO A 1 64 ? -5.232  -5.311  1.118   1.00 0.00 ? 64 PRO A HB3  9 
ATOM 10483 H HG2  . PRO A 1 64 ? -5.503  -2.659  1.299   1.00 0.00 ? 64 PRO A HG2  9 
ATOM 10484 H HG3  . PRO A 1 64 ? -6.024  -3.738  2.603   1.00 0.00 ? 64 PRO A HG3  9 
ATOM 10485 H HD2  . PRO A 1 64 ? -3.589  -2.044  2.427   1.00 0.00 ? 64 PRO A HD2  9 
ATOM 10486 H HD3  . PRO A 1 64 ? -4.642  -2.368  3.799   1.00 0.00 ? 64 PRO A HD3  9 
ATOM 10487 N N    . MET A 1 65 ? -1.321  -4.385  1.613   1.00 0.00 ? 65 MET A N    9 
ATOM 10488 C CA   . MET A 1 65 ? -0.017  -4.558  1.008   1.00 0.00 ? 65 MET A CA   9 
ATOM 10489 C C    . MET A 1 65 ? 0.838   -5.448  1.901   1.00 0.00 ? 65 MET A C    9 
ATOM 10490 O O    . MET A 1 65 ? 1.679   -6.208  1.423   1.00 0.00 ? 65 MET A O    9 
ATOM 10491 C CB   . MET A 1 65 ? 0.645   -3.198  0.818   1.00 0.00 ? 65 MET A CB   9 
ATOM 10492 C CG   . MET A 1 65 ? 2.026   -3.268  0.205   1.00 0.00 ? 65 MET A CG   9 
ATOM 10493 S SD   . MET A 1 65 ? 2.025   -4.014  -1.436  1.00 0.00 ? 65 MET A SD   9 
ATOM 10494 C CE   . MET A 1 65 ? 3.766   -3.923  -1.848  1.00 0.00 ? 65 MET A CE   9 
ATOM 10495 H H    . MET A 1 65 ? -1.555  -3.512  1.997   1.00 0.00 ? 65 MET A H    9 
ATOM 10496 H HA   . MET A 1 65 ? -0.147  -5.036  0.046   1.00 0.00 ? 65 MET A HA   9 
ATOM 10497 H HB2  . MET A 1 65 ? 0.021   -2.595  0.176   1.00 0.00 ? 65 MET A HB2  9 
ATOM 10498 H HB3  . MET A 1 65 ? 0.727   -2.714  1.780   1.00 0.00 ? 65 MET A HB3  9 
ATOM 10499 H HG2  . MET A 1 65 ? 2.411   -2.266  0.129   1.00 0.00 ? 65 MET A HG2  9 
ATOM 10500 H HG3  . MET A 1 65 ? 2.665   -3.851  0.852   1.00 0.00 ? 65 MET A HG3  9 
ATOM 10501 H HE1  . MET A 1 65 ? 4.335   -3.701  -0.957  1.00 0.00 ? 65 MET A HE1  9 
ATOM 10502 H HE2  . MET A 1 65 ? 4.089   -4.870  -2.254  1.00 0.00 ? 65 MET A HE2  9 
ATOM 10503 H HE3  . MET A 1 65 ? 3.923   -3.144  -2.579  1.00 0.00 ? 65 MET A HE3  9 
ATOM 10504 N N    . ILE A 1 66 ? 0.586   -5.361  3.206   1.00 0.00 ? 66 ILE A N    9 
ATOM 10505 C CA   . ILE A 1 66 ? 1.301   -6.170  4.186   1.00 0.00 ? 66 ILE A CA   9 
ATOM 10506 C C    . ILE A 1 66 ? 0.734   -7.583  4.194   1.00 0.00 ? 66 ILE A C    9 
ATOM 10507 O O    . ILE A 1 66 ? 1.478   -8.563  4.176   1.00 0.00 ? 66 ILE A O    9 
ATOM 10508 C CB   . ILE A 1 66 ? 1.208   -5.546  5.601   1.00 0.00 ? 66 ILE A CB   9 
ATOM 10509 C CG1  . ILE A 1 66 ? 2.051   -4.273  5.673   1.00 0.00 ? 66 ILE A CG1  9 
ATOM 10510 C CG2  . ILE A 1 66 ? 1.653   -6.527  6.681   1.00 0.00 ? 66 ILE A CG2  9 
ATOM 10511 C CD1  . ILE A 1 66 ? 1.869   -3.500  6.961   1.00 0.00 ? 66 ILE A CD1  9 
ATOM 10512 H H    . ILE A 1 66 ? -0.117  -4.750  3.517   1.00 0.00 ? 66 ILE A H    9 
ATOM 10513 H HA   . ILE A 1 66 ? 2.345   -6.208  3.896   1.00 0.00 ? 66 ILE A HA   9 
ATOM 10514 H HB   . ILE A 1 66 ? 0.177   -5.293  5.792   1.00 0.00 ? 66 ILE A HB   9 
ATOM 10515 H HG12 . ILE A 1 66 ? 3.094   -4.536  5.591   1.00 0.00 ? 66 ILE A HG12 9 
ATOM 10516 H HG13 . ILE A 1 66 ? 1.786   -3.624  4.854   1.00 0.00 ? 66 ILE A HG13 9 
ATOM 10517 H HG21 . ILE A 1 66 ? 1.209   -7.494  6.499   1.00 0.00 ? 66 ILE A HG21 9 
ATOM 10518 H HG22 . ILE A 1 66 ? 2.729   -6.615  6.664   1.00 0.00 ? 66 ILE A HG22 9 
ATOM 10519 H HG23 . ILE A 1 66 ? 1.336   -6.161  7.646   1.00 0.00 ? 66 ILE A HG23 9 
ATOM 10520 H HD11 . ILE A 1 66 ? 0.829   -3.234  7.079   1.00 0.00 ? 66 ILE A HD11 9 
ATOM 10521 H HD12 . ILE A 1 66 ? 2.181   -4.112  7.795   1.00 0.00 ? 66 ILE A HD12 9 
ATOM 10522 H HD13 . ILE A 1 66 ? 2.468   -2.601  6.930   1.00 0.00 ? 66 ILE A HD13 9 
ATOM 10523 N N    . ALA A 1 67 ? -0.593  -7.679  4.202   1.00 0.00 ? 67 ALA A N    9 
ATOM 10524 C CA   . ALA A 1 67 ? -1.257  -8.970  4.194   1.00 0.00 ? 67 ALA A CA   9 
ATOM 10525 C C    . ALA A 1 67 ? -0.969  -9.697  2.891   1.00 0.00 ? 67 ALA A C    9 
ATOM 10526 O O    . ALA A 1 67 ? -0.445  -10.811 2.888   1.00 0.00 ? 67 ALA A O    9 
ATOM 10527 C CB   . ALA A 1 67 ? -2.756  -8.801  4.394   1.00 0.00 ? 67 ALA A CB   9 
ATOM 10528 H H    . ALA A 1 67 ? -1.132  -6.864  4.202   1.00 0.00 ? 67 ALA A H    9 
ATOM 10529 H HA   . ALA A 1 67 ? -0.866  -9.548  5.014   1.00 0.00 ? 67 ALA A HA   9 
ATOM 10530 H HB1  . ALA A 1 67 ? -3.127  -8.045  3.719   1.00 0.00 ? 67 ALA A HB1  9 
ATOM 10531 H HB2  . ALA A 1 67 ? -3.254  -9.738  4.196   1.00 0.00 ? 67 ALA A HB2  9 
ATOM 10532 H HB3  . ALA A 1 67 ? -2.950  -8.499  5.413   1.00 0.00 ? 67 ALA A HB3  9 
ATOM 10533 N N    . VAL A 1 68 ? -1.295  -9.045  1.782   1.00 0.00 ? 68 VAL A N    9 
ATOM 10534 C CA   . VAL A 1 68 ? -1.054  -9.615  0.467   1.00 0.00 ? 68 VAL A CA   9 
ATOM 10535 C C    . VAL A 1 68 ? 0.438   -9.797  0.244   1.00 0.00 ? 68 VAL A C    9 
ATOM 10536 O O    . VAL A 1 68 ? 0.878   -10.839 -0.228  1.00 0.00 ? 68 VAL A O    9 
ATOM 10537 C CB   . VAL A 1 68 ? -1.631  -8.723  -0.649  1.00 0.00 ? 68 VAL A CB   9 
ATOM 10538 C CG1  . VAL A 1 68 ? -1.456  -9.383  -2.010  1.00 0.00 ? 68 VAL A CG1  9 
ATOM 10539 C CG2  . VAL A 1 68 ? -3.096  -8.417  -0.378  1.00 0.00 ? 68 VAL A CG2  9 
ATOM 10540 H H    . VAL A 1 68 ? -1.695  -8.155  1.852   1.00 0.00 ? 68 VAL A H    9 
ATOM 10541 H HA   . VAL A 1 68 ? -1.540  -10.580 0.423   1.00 0.00 ? 68 VAL A HA   9 
ATOM 10542 H HB   . VAL A 1 68 ? -1.085  -7.788  -0.656  1.00 0.00 ? 68 VAL A HB   9 
ATOM 10543 H HG11 . VAL A 1 68 ? -0.656  -10.108 -1.959  1.00 0.00 ? 68 VAL A HG11 9 
ATOM 10544 H HG12 . VAL A 1 68 ? -2.373  -9.880  -2.291  1.00 0.00 ? 68 VAL A HG12 9 
ATOM 10545 H HG13 . VAL A 1 68 ? -1.214  -8.631  -2.747  1.00 0.00 ? 68 VAL A HG13 9 
ATOM 10546 H HG21 . VAL A 1 68 ? -3.382  -8.836  0.575   1.00 0.00 ? 68 VAL A HG21 9 
ATOM 10547 H HG22 . VAL A 1 68 ? -3.241  -7.349  -0.357  1.00 0.00 ? 68 VAL A HG22 9 
ATOM 10548 H HG23 . VAL A 1 68 ? -3.707  -8.848  -1.158  1.00 0.00 ? 68 VAL A HG23 9 
ATOM 10549 N N    . GLY A 1 69 ? 1.214   -8.778  0.604   1.00 0.00 ? 69 GLY A N    9 
ATOM 10550 C CA   . GLY A 1 69 ? 2.656   -8.852  0.445   1.00 0.00 ? 69 GLY A CA   9 
ATOM 10551 C C    . GLY A 1 69 ? 3.258   -10.005 1.224   1.00 0.00 ? 69 GLY A C    9 
ATOM 10552 O O    . GLY A 1 69 ? 4.096   -10.744 0.708   1.00 0.00 ? 69 GLY A O    9 
ATOM 10553 H H    . GLY A 1 69 ? 0.807   -7.972  0.985   1.00 0.00 ? 69 GLY A H    9 
ATOM 10554 H HA2  . GLY A 1 69 ? 2.887   -8.976  -0.602  1.00 0.00 ? 69 GLY A HA2  9 
ATOM 10555 H HA3  . GLY A 1 69 ? 3.097   -7.928  0.792   1.00 0.00 ? 69 GLY A HA3  9 
ATOM 10556 N N    . LEU A 1 70 ? 2.831   -10.158 2.473   1.00 0.00 ? 70 LEU A N    9 
ATOM 10557 C CA   . LEU A 1 70 ? 3.335   -11.231 3.319   1.00 0.00 ? 70 LEU A CA   9 
ATOM 10558 C C    . LEU A 1 70 ? 2.918   -12.575 2.748   1.00 0.00 ? 70 LEU A C    9 
ATOM 10559 O O    . LEU A 1 70 ? 3.717   -13.510 2.675   1.00 0.00 ? 70 LEU A O    9 
ATOM 10560 C CB   . LEU A 1 70 ? 2.806   -11.077 4.748   1.00 0.00 ? 70 LEU A CB   9 
ATOM 10561 C CG   . LEU A 1 70 ? 3.512   -11.935 5.804   1.00 0.00 ? 70 LEU A CG   9 
ATOM 10562 C CD1  . LEU A 1 70 ? 3.210   -13.412 5.599   1.00 0.00 ? 70 LEU A CD1  9 
ATOM 10563 C CD2  . LEU A 1 70 ? 5.013   -11.687 5.764   1.00 0.00 ? 70 LEU A CD2  9 
ATOM 10564 H H    . LEU A 1 70 ? 2.163   -9.538  2.832   1.00 0.00 ? 70 LEU A H    9 
ATOM 10565 H HA   . LEU A 1 70 ? 4.414   -11.170 3.331   1.00 0.00 ? 70 LEU A HA   9 
ATOM 10566 H HB2  . LEU A 1 70 ? 2.902   -10.042 5.034   1.00 0.00 ? 70 LEU A HB2  9 
ATOM 10567 H HB3  . LEU A 1 70 ? 1.758   -11.337 4.752   1.00 0.00 ? 70 LEU A HB3  9 
ATOM 10568 H HG   . LEU A 1 70 ? 3.154   -11.654 6.783   1.00 0.00 ? 70 LEU A HG   9 
ATOM 10569 H HD11 . LEU A 1 70 ? 2.366   -13.521 4.933   1.00 0.00 ? 70 LEU A HD11 9 
ATOM 10570 H HD12 . LEU A 1 70 ? 4.072   -13.901 5.170   1.00 0.00 ? 70 LEU A HD12 9 
ATOM 10571 H HD13 . LEU A 1 70 ? 2.976   -13.866 6.551   1.00 0.00 ? 70 LEU A HD13 9 
ATOM 10572 H HD21 . LEU A 1 70 ? 5.208   -10.736 5.289   1.00 0.00 ? 70 LEU A HD21 9 
ATOM 10573 H HD22 . LEU A 1 70 ? 5.403   -11.674 6.770   1.00 0.00 ? 70 LEU A HD22 9 
ATOM 10574 H HD23 . LEU A 1 70 ? 5.492   -12.475 5.201   1.00 0.00 ? 70 LEU A HD23 9 
ATOM 10575 N N    . GLY A 1 71 ? 1.657   -12.663 2.343   1.00 0.00 ? 71 GLY A N    9 
ATOM 10576 C CA   . GLY A 1 71 ? 1.146   -13.898 1.776   1.00 0.00 ? 71 GLY A CA   9 
ATOM 10577 C C    . GLY A 1 71 ? 1.829   -14.265 0.470   1.00 0.00 ? 71 GLY A C    9 
ATOM 10578 O O    . GLY A 1 71 ? 2.213   -15.413 0.267   1.00 0.00 ? 71 GLY A O    9 
ATOM 10579 H H    . GLY A 1 71 ? 1.068   -11.881 2.430   1.00 0.00 ? 71 GLY A H    9 
ATOM 10580 H HA2  . GLY A 1 71 ? 1.298   -14.698 2.488   1.00 0.00 ? 71 GLY A HA2  9 
ATOM 10581 H HA3  . GLY A 1 71 ? 0.085   -13.787 1.598   1.00 0.00 ? 71 GLY A HA3  9 
ATOM 10582 N N    . LEU A 1 72 ? 1.979   -13.285 -0.418  1.00 0.00 ? 72 LEU A N    9 
ATOM 10583 C CA   . LEU A 1 72 ? 2.615   -13.513 -1.712  1.00 0.00 ? 72 LEU A CA   9 
ATOM 10584 C C    . LEU A 1 72 ? 4.090   -13.844 -1.534  1.00 0.00 ? 72 LEU A C    9 
ATOM 10585 O O    . LEU A 1 72 ? 4.658   -14.627 -2.295  1.00 0.00 ? 72 LEU A O    9 
ATOM 10586 C CB   . LEU A 1 72 ? 2.447   -12.291 -2.621  1.00 0.00 ? 72 LEU A CB   9 
ATOM 10587 C CG   . LEU A 1 72 ? 3.071   -10.996 -2.110  1.00 0.00 ? 72 LEU A CG   9 
ATOM 10588 C CD1  . LEU A 1 72 ? 4.588   -11.029 -2.253  1.00 0.00 ? 72 LEU A CD1  9 
ATOM 10589 C CD2  . LEU A 1 72 ? 2.487   -9.800  -2.848  1.00 0.00 ? 72 LEU A CD2  9 
ATOM 10590 H H    . LEU A 1 72 ? 1.655   -12.393 -0.199  1.00 0.00 ? 72 LEU A H    9 
ATOM 10591 H HA   . LEU A 1 72 ? 2.123   -14.354 -2.173  1.00 0.00 ? 72 LEU A HA   9 
ATOM 10592 H HB2  . LEU A 1 72 ? 2.891   -12.520 -3.574  1.00 0.00 ? 72 LEU A HB2  9 
ATOM 10593 H HB3  . LEU A 1 72 ? 1.390   -12.121 -2.768  1.00 0.00 ? 72 LEU A HB3  9 
ATOM 10594 H HG   . LEU A 1 72 ? 2.840   -10.892 -1.066  1.00 0.00 ? 72 LEU A HG   9 
ATOM 10595 H HD11 . LEU A 1 72 ? 4.875   -11.874 -2.862  1.00 0.00 ? 72 LEU A HD11 9 
ATOM 10596 H HD12 . LEU A 1 72 ? 4.928   -10.117 -2.720  1.00 0.00 ? 72 LEU A HD12 9 
ATOM 10597 H HD13 . LEU A 1 72 ? 5.040   -11.121 -1.276  1.00 0.00 ? 72 LEU A HD13 9 
ATOM 10598 H HD21 . LEU A 1 72 ? 2.499   -9.991  -3.911  1.00 0.00 ? 72 LEU A HD21 9 
ATOM 10599 H HD22 . LEU A 1 72 ? 1.471   -9.638  -2.523  1.00 0.00 ? 72 LEU A HD22 9 
ATOM 10600 H HD23 . LEU A 1 72 ? 3.078   -8.920  -2.634  1.00 0.00 ? 72 LEU A HD23 9 
ATOM 10601 N N    . TYR A 1 73 ? 4.699   -13.258 -0.509  1.00 0.00 ? 73 TYR A N    9 
ATOM 10602 C CA   . TYR A 1 73 ? 6.107   -13.494 -0.215  1.00 0.00 ? 73 TYR A CA   9 
ATOM 10603 C C    . TYR A 1 73 ? 6.364   -14.986 -0.063  1.00 0.00 ? 73 TYR A C    9 
ATOM 10604 O O    . TYR A 1 73 ? 7.306   -15.532 -0.633  1.00 0.00 ? 73 TYR A O    9 
ATOM 10605 C CB   . TYR A 1 73 ? 6.509   -12.766 1.072   1.00 0.00 ? 73 TYR A CB   9 
ATOM 10606 C CG   . TYR A 1 73 ? 7.951   -12.991 1.467   1.00 0.00 ? 73 TYR A CG   9 
ATOM 10607 C CD1  . TYR A 1 73 ? 8.986   -12.330 0.817   1.00 0.00 ? 73 TYR A CD1  9 
ATOM 10608 C CD2  . TYR A 1 73 ? 8.275   -13.889 2.476   1.00 0.00 ? 73 TYR A CD2  9 
ATOM 10609 C CE1  . TYR A 1 73 ? 10.306  -12.558 1.164   1.00 0.00 ? 73 TYR A CE1  9 
ATOM 10610 C CE2  . TYR A 1 73 ? 9.591   -14.119 2.831   1.00 0.00 ? 73 TYR A CE2  9 
ATOM 10611 C CZ   . TYR A 1 73 ? 10.602  -13.452 2.172   1.00 0.00 ? 73 TYR A CZ   9 
ATOM 10612 O OH   . TYR A 1 73 ? 11.913  -13.681 2.521   1.00 0.00 ? 73 TYR A OH   9 
ATOM 10613 H H    . TYR A 1 73 ? 4.184   -12.659 0.070   1.00 0.00 ? 73 TYR A H    9 
ATOM 10614 H HA   . TYR A 1 73 ? 6.695   -13.114 -1.043  1.00 0.00 ? 73 TYR A HA   9 
ATOM 10615 H HB2  . TYR A 1 73 ? 6.364   -11.704 0.937   1.00 0.00 ? 73 TYR A HB2  9 
ATOM 10616 H HB3  . TYR A 1 73 ? 5.884   -13.110 1.882   1.00 0.00 ? 73 TYR A HB3  9 
ATOM 10617 H HD1  . TYR A 1 73 ? 8.749   -11.627 0.030   1.00 0.00 ? 73 TYR A HD1  9 
ATOM 10618 H HD2  . TYR A 1 73 ? 7.477   -14.410 2.988   1.00 0.00 ? 73 TYR A HD2  9 
ATOM 10619 H HE1  . TYR A 1 73 ? 11.100  -12.036 0.650   1.00 0.00 ? 73 TYR A HE1  9 
ATOM 10620 H HE2  . TYR A 1 73 ? 9.825   -14.820 3.621   1.00 0.00 ? 73 TYR A HE2  9 
ATOM 10621 H HH   . TYR A 1 73 ? 12.456  -13.709 1.730   1.00 0.00 ? 73 TYR A HH   9 
ATOM 10622 N N    . VAL A 1 74 ? 5.502   -15.637 0.706   1.00 0.00 ? 74 VAL A N    9 
ATOM 10623 C CA   . VAL A 1 74 ? 5.607   -17.069 0.940   1.00 0.00 ? 74 VAL A CA   9 
ATOM 10624 C C    . VAL A 1 74 ? 4.899   -17.843 -0.167  1.00 0.00 ? 74 VAL A C    9 
ATOM 10625 O O    . VAL A 1 74 ? 5.282   -18.960 -0.512  1.00 0.00 ? 74 VAL A O    9 
ATOM 10626 C CB   . VAL A 1 74 ? 4.987   -17.454 2.300   1.00 0.00 ? 74 VAL A CB   9 
ATOM 10627 C CG1  . VAL A 1 74 ? 5.165   -18.940 2.583   1.00 0.00 ? 74 VAL A CG1  9 
ATOM 10628 C CG2  . VAL A 1 74 ? 5.590   -16.618 3.418   1.00 0.00 ? 74 VAL A CG2  9 
ATOM 10629 H H    . VAL A 1 74 ? 4.769   -15.140 1.124   1.00 0.00 ? 74 VAL A H    9 
ATOM 10630 H HA   . VAL A 1 74 ? 6.655   -17.339 0.953   1.00 0.00 ? 74 VAL A HA   9 
ATOM 10631 H HB   . VAL A 1 74 ? 3.927   -17.247 2.259   1.00 0.00 ? 74 VAL A HB   9 
ATOM 10632 H HG11 . VAL A 1 74 ? 5.163   -19.488 1.653   1.00 0.00 ? 74 VAL A HG11 9 
ATOM 10633 H HG12 . VAL A 1 74 ? 6.105   -19.098 3.091   1.00 0.00 ? 74 VAL A HG12 9 
ATOM 10634 H HG13 . VAL A 1 74 ? 4.356   -19.287 3.208   1.00 0.00 ? 74 VAL A HG13 9 
ATOM 10635 H HG21 . VAL A 1 74 ? 6.659   -16.767 3.443   1.00 0.00 ? 74 VAL A HG21 9 
ATOM 10636 H HG22 . VAL A 1 74 ? 5.376   -15.573 3.241   1.00 0.00 ? 74 VAL A HG22 9 
ATOM 10637 H HG23 . VAL A 1 74 ? 5.161   -16.917 4.363   1.00 0.00 ? 74 VAL A HG23 9 
ATOM 10638 N N    . MET A 1 75 ? 3.853   -17.241 -0.717  1.00 0.00 ? 75 MET A N    9 
ATOM 10639 C CA   . MET A 1 75 ? 3.082   -17.878 -1.770  1.00 0.00 ? 75 MET A CA   9 
ATOM 10640 C C    . MET A 1 75 ? 3.829   -17.901 -3.102  1.00 0.00 ? 75 MET A C    9 
ATOM 10641 O O    . MET A 1 75 ? 4.349   -18.937 -3.508  1.00 0.00 ? 75 MET A O    9 
ATOM 10642 C CB   . MET A 1 75 ? 1.737   -17.176 -1.919  1.00 0.00 ? 75 MET A CB   9 
ATOM 10643 C CG   . MET A 1 75 ? 0.777   -17.486 -0.784  1.00 0.00 ? 75 MET A CG   9 
ATOM 10644 S SD   . MET A 1 75 ? 0.160   -19.179 -0.835  1.00 0.00 ? 75 MET A SD   9 
ATOM 10645 C CE   . MET A 1 75 ? -0.807  -19.234 0.671   1.00 0.00 ? 75 MET A CE   9 
ATOM 10646 H H    . MET A 1 75 ? 3.590   -16.353 -0.402  1.00 0.00 ? 75 MET A H    9 
ATOM 10647 H HA   . MET A 1 75 ? 2.900   -18.893 -1.461  1.00 0.00 ? 75 MET A HA   9 
ATOM 10648 H HB2  . MET A 1 75 ? 1.901   -16.112 -1.941  1.00 0.00 ? 75 MET A HB2  9 
ATOM 10649 H HB3  . MET A 1 75 ? 1.280   -17.480 -2.845  1.00 0.00 ? 75 MET A HB3  9 
ATOM 10650 H HG2  . MET A 1 75 ? 1.292   -17.340 0.154   1.00 0.00 ? 75 MET A HG2  9 
ATOM 10651 H HG3  . MET A 1 75 ? -0.058  -16.807 -0.842  1.00 0.00 ? 75 MET A HG3  9 
ATOM 10652 H HE1  . MET A 1 75 ? -0.207  -18.884 1.497   1.00 0.00 ? 75 MET A HE1  9 
ATOM 10653 H HE2  . MET A 1 75 ? -1.677  -18.603 0.564   1.00 0.00 ? 75 MET A HE2  9 
ATOM 10654 H HE3  . MET A 1 75 ? -1.121  -20.250 0.860   1.00 0.00 ? 75 MET A HE3  9 
ATOM 10655 N N    . PHE A 1 76 ? 3.883   -16.762 -3.785  1.00 0.00 ? 76 PHE A N    9 
ATOM 10656 C CA   . PHE A 1 76 ? 4.557   -16.692 -5.081  1.00 0.00 ? 76 PHE A CA   9 
ATOM 10657 C C    . PHE A 1 76 ? 6.041   -17.044 -4.991  1.00 0.00 ? 76 PHE A C    9 
ATOM 10658 O O    . PHE A 1 76 ? 6.617   -17.551 -5.952  1.00 0.00 ? 76 PHE A O    9 
ATOM 10659 C CB   . PHE A 1 76 ? 4.406   -15.298 -5.704  1.00 0.00 ? 76 PHE A CB   9 
ATOM 10660 C CG   . PHE A 1 76 ? 3.020   -14.989 -6.200  1.00 0.00 ? 76 PHE A CG   9 
ATOM 10661 C CD1  . PHE A 1 76 ? 2.363   -15.857 -7.060  1.00 0.00 ? 76 PHE A CD1  9 
ATOM 10662 C CD2  . PHE A 1 76 ? 2.375   -13.831 -5.810  1.00 0.00 ? 76 PHE A CD2  9 
ATOM 10663 C CE1  . PHE A 1 76 ? 1.090   -15.572 -7.513  1.00 0.00 ? 76 PHE A CE1  9 
ATOM 10664 C CE2  . PHE A 1 76 ? 1.104   -13.539 -6.260  1.00 0.00 ? 76 PHE A CE2  9 
ATOM 10665 C CZ   . PHE A 1 76 ? 0.459   -14.412 -7.112  1.00 0.00 ? 76 PHE A CZ   9 
ATOM 10666 H H    . PHE A 1 76 ? 3.449   -15.960 -3.424  1.00 0.00 ? 76 PHE A H    9 
ATOM 10667 H HA   . PHE A 1 76 ? 4.074   -17.411 -5.730  1.00 0.00 ? 76 PHE A HA   9 
ATOM 10668 H HB2  . PHE A 1 76 ? 4.660   -14.555 -4.962  1.00 0.00 ? 76 PHE A HB2  9 
ATOM 10669 H HB3  . PHE A 1 76 ? 5.086   -15.211 -6.535  1.00 0.00 ? 76 PHE A HB3  9 
ATOM 10670 H HD1  . PHE A 1 76 ? 2.855   -16.765 -7.373  1.00 0.00 ? 76 PHE A HD1  9 
ATOM 10671 H HD2  . PHE A 1 76 ? 2.877   -13.146 -5.147  1.00 0.00 ? 76 PHE A HD2  9 
ATOM 10672 H HE1  . PHE A 1 76 ? 0.591   -16.255 -8.185  1.00 0.00 ? 76 PHE A HE1  9 
ATOM 10673 H HE2  . PHE A 1 76 ? 0.612   -12.631 -5.944  1.00 0.00 ? 76 PHE A HE2  9 
ATOM 10674 H HZ   . PHE A 1 76 ? -0.537  -14.187 -7.465  1.00 0.00 ? 76 PHE A HZ   9 
ATOM 10675 N N    . ALA A 1 77 ? 6.666   -16.761 -3.853  1.00 0.00 ? 77 ALA A N    9 
ATOM 10676 C CA   . ALA A 1 77 ? 8.087   -17.038 -3.688  1.00 0.00 ? 77 ALA A CA   9 
ATOM 10677 C C    . ALA A 1 77 ? 8.344   -18.403 -3.068  1.00 0.00 ? 77 ALA A C    9 
ATOM 10678 O O    . ALA A 1 77 ? 9.018   -19.247 -3.658  1.00 0.00 ? 77 ALA A O    9 
ATOM 10679 C CB   . ALA A 1 77 ? 8.747   -15.947 -2.860  1.00 0.00 ? 77 ALA A CB   9 
ATOM 10680 H H    . ALA A 1 77 ? 6.175   -16.343 -3.122  1.00 0.00 ? 77 ALA A H    9 
ATOM 10681 H HA   . ALA A 1 77 ? 8.531   -17.021 -4.661  1.00 0.00 ? 77 ALA A HA   9 
ATOM 10682 H HB1  . ALA A 1 77 ? 8.069   -15.114 -2.755  1.00 0.00 ? 77 ALA A HB1  9 
ATOM 10683 H HB2  . ALA A 1 77 ? 8.997   -16.336 -1.882  1.00 0.00 ? 77 ALA A HB2  9 
ATOM 10684 H HB3  . ALA A 1 77 ? 9.649   -15.617 -3.354  1.00 0.00 ? 77 ALA A HB3  9 
ATOM 10685 N N    . VAL A 1 78 ? 7.828   -18.602 -1.869  1.00 0.00 ? 78 VAL A N    9 
ATOM 10686 C CA   . VAL A 1 78 ? 8.024   -19.857 -1.156  1.00 0.00 ? 78 VAL A CA   9 
ATOM 10687 C C    . VAL A 1 78 ? 7.032   -20.934 -1.604  1.00 0.00 ? 78 VAL A C    9 
ATOM 10688 O O    . VAL A 1 78 ? 7.141   -22.088 -1.192  1.00 0.00 ? 78 VAL A O    9 
ATOM 10689 C CB   . VAL A 1 78 ? 7.932   -19.662 0.376   1.00 0.00 ? 78 VAL A CB   9 
ATOM 10690 C CG1  . VAL A 1 78 ? 8.106   -20.986 1.107   1.00 0.00 ? 78 VAL A CG1  9 
ATOM 10691 C CG2  . VAL A 1 78 ? 8.973   -18.656 0.844   1.00 0.00 ? 78 VAL A CG2  9 
ATOM 10692 H H    . VAL A 1 78 ? 7.321   -17.884 -1.450  1.00 0.00 ? 78 VAL A H    9 
ATOM 10693 H HA   . VAL A 1 78 ? 9.020   -20.199 -1.385  1.00 0.00 ? 78 VAL A HA   9 
ATOM 10694 H HB   . VAL A 1 78 ? 6.956   -19.272 0.617   1.00 0.00 ? 78 VAL A HB   9 
ATOM 10695 H HG11 . VAL A 1 78 ? 8.971   -21.501 0.718   1.00 0.00 ? 78 VAL A HG11 9 
ATOM 10696 H HG12 . VAL A 1 78 ? 8.243   -20.798 2.161   1.00 0.00 ? 78 VAL A HG12 9 
ATOM 10697 H HG13 . VAL A 1 78 ? 7.227   -21.596 0.961   1.00 0.00 ? 78 VAL A HG13 9 
ATOM 10698 H HG21 . VAL A 1 78 ? 9.738   -18.552 0.091   1.00 0.00 ? 78 VAL A HG21 9 
ATOM 10699 H HG22 . VAL A 1 78 ? 8.500   -17.700 1.009   1.00 0.00 ? 78 VAL A HG22 9 
ATOM 10700 H HG23 . VAL A 1 78 ? 9.417   -18.999 1.766   1.00 0.00 ? 78 VAL A HG23 9 
ATOM 10701 N N    . ALA A 1 79 ? 6.074   -20.569 -2.455  1.00 0.00 ? 79 ALA A N    9 
ATOM 10702 C CA   . ALA A 1 79 ? 5.096   -21.540 -2.945  1.00 0.00 ? 79 ALA A CA   9 
ATOM 10703 C C    . ALA A 1 79 ? 4.862   -21.376 -4.443  1.00 0.00 ? 79 ALA A C    9 
ATOM 10704 O O    . ALA A 1 79 ? 4.504   -22.330 -5.134  1.00 0.00 ? 79 ALA A O    9 
ATOM 10705 C CB   . ALA A 1 79 ? 3.785   -21.414 -2.185  1.00 0.00 ? 79 ALA A CB   9 
ATOM 10706 H H    . ALA A 1 79 ? 6.024   -19.636 -2.765  1.00 0.00 ? 79 ALA A H    9 
ATOM 10707 H HA   . ALA A 1 79 ? 5.492   -22.530 -2.766  1.00 0.00 ? 79 ALA A HA   9 
ATOM 10708 H HB1  . ALA A 1 79 ? 3.565   -20.373 -2.019  1.00 0.00 ? 79 ALA A HB1  9 
ATOM 10709 H HB2  . ALA A 1 79 ? 2.990   -21.861 -2.761  1.00 0.00 ? 79 ALA A HB2  9 
ATOM 10710 H HB3  . ALA A 1 79 ? 3.870   -21.919 -1.234  1.00 0.00 ? 79 ALA A HB3  9 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  GLU 2  2  2  GLU GLU A . n 
A 1 3  ASN 3  3  3  ASN ASN A . n 
A 1 4  LEU 4  4  4  LEU LEU A . n 
A 1 5  ASN 5  5  5  ASN ASN A . n 
A 1 6  MET 6  6  6  MET MET A . n 
A 1 7  ASP 7  7  7  ASP ASP A . n 
A 1 8  LEU 8  8  8  LEU LEU A . n 
A 1 9  LEU 9  9  9  LEU LEU A . n 
A 1 10 TYR 10 10 10 TYR TYR A . n 
A 1 11 MET 11 11 11 MET MET A . n 
A 1 12 ALA 12 12 12 ALA ALA A . n 
A 1 13 ALA 13 13 13 ALA ALA A . n 
A 1 14 ALA 14 14 14 ALA ALA A . n 
A 1 15 VAL 15 15 15 VAL VAL A . n 
A 1 16 MET 16 16 16 MET MET A . n 
A 1 17 MET 17 17 17 MET MET A . n 
A 1 18 GLY 18 18 18 GLY GLY A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 ALA 20 20 20 ALA ALA A . n 
A 1 21 ALA 21 21 21 ALA ALA A . n 
A 1 22 ILE 22 22 22 ILE ILE A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 ALA 24 24 24 ALA ALA A . n 
A 1 25 ALA 25 25 25 ALA ALA A . n 
A 1 26 ILE 26 26 26 ILE ILE A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 ILE 28 28 28 ILE ILE A . n 
A 1 29 GLY 29 29 29 GLY GLY A . n 
A 1 30 ILE 30 30 30 ILE ILE A . n 
A 1 31 LEU 31 31 31 LEU LEU A . n 
A 1 32 GLY 32 32 32 GLY GLY A . n 
A 1 33 GLY 33 33 33 GLY GLY A . n 
A 1 34 LYS 34 34 34 LYS LYS A . n 
A 1 35 PHE 35 35 35 PHE PHE A . n 
A 1 36 LEU 36 36 36 LEU LEU A . n 
A 1 37 GLU 37 37 37 GLU GLU A . n 
A 1 38 GLY 38 38 38 GLY GLY A . n 
A 1 39 ALA 39 39 39 ALA ALA A . n 
A 1 40 ALA 40 40 40 ALA ALA A . n 
A 1 41 ARG 41 41 41 ARG ARG A . n 
A 1 42 GLN 42 42 42 GLN GLN A . n 
A 1 43 PRO 43 43 43 PRO PRO A . n 
A 1 44 ASP 44 44 44 ASP ASP A . n 
A 1 45 LEU 45 45 45 LEU LEU A . n 
A 1 46 ILE 46 46 46 ILE ILE A . n 
A 1 47 PRO 47 47 47 PRO PRO A . n 
A 1 48 LEU 48 48 48 LEU LEU A . n 
A 1 49 LEU 49 49 49 LEU LEU A . n 
A 1 50 ARG 50 50 50 ARG ARG A . n 
A 1 51 THR 51 51 51 THR THR A . n 
A 1 52 GLN 52 52 52 GLN GLN A . n 
A 1 53 PHE 53 53 53 PHE PHE A . n 
A 1 54 PHE 54 54 54 PHE PHE A . n 
A 1 55 ILE 55 55 55 ILE ILE A . n 
A 1 56 VAL 56 56 56 VAL VAL A . n 
A 1 57 MET 57 57 57 MET MET A . n 
A 1 58 GLY 58 58 58 GLY GLY A . n 
A 1 59 LEU 59 59 59 LEU LEU A . n 
A 1 60 VAL 60 60 60 VAL VAL A . n 
A 1 61 ASP 61 61 61 ASP ASP A . n 
A 1 62 ALA 62 62 62 ALA ALA A . n 
A 1 63 ILE 63 63 63 ILE ILE A . n 
A 1 64 PRO 64 64 64 PRO PRO A . n 
A 1 65 MET 65 65 65 MET MET A . n 
A 1 66 ILE 66 66 66 ILE ILE A . n 
A 1 67 ALA 67 67 67 ALA ALA A . n 
A 1 68 VAL 68 68 68 VAL VAL A . n 
A 1 69 GLY 69 69 69 GLY GLY A . n 
A 1 70 LEU 70 70 70 LEU LEU A . n 
A 1 71 GLY 71 71 71 GLY GLY A . n 
A 1 72 LEU 72 72 72 LEU LEU A . n 
A 1 73 TYR 73 73 73 TYR TYR A . n 
A 1 74 VAL 74 74 74 VAL VAL A . n 
A 1 75 MET 75 75 75 MET MET A . n 
A 1 76 PHE 76 76 76 PHE PHE A . n 
A 1 77 ALA 77 77 77 ALA ALA A . n 
A 1 78 VAL 78 78 78 VAL VAL A . n 
A 1 79 ALA 79 79 79 ALA ALA A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-11-19 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-11-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' pdbx_struct_assembly  
3 4 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_abbrev'          
2 4 'Structure model' '_citation.page_last'               
3 4 'Structure model' '_citation.pdbx_database_id_DOI'    
4 4 'Structure model' '_citation.pdbx_database_id_PubMed' 
5 4 'Structure model' '_citation.title'                   
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A LEU 48 ? ? H   A GLN 52 ? ? 1.51 
2 1 O A PRO 47 ? ? HG1 A THR 51 ? ? 1.54 
3 2 O A PRO 47 ? ? HG1 A THR 51 ? ? 1.45 
4 4 O A PRO 47 ? ? HG1 A THR 51 ? ? 1.43 
5 4 O A LEU 36 ? ? H   A ALA 40 ? ? 1.55 
6 5 O A PRO 47 ? ? HG1 A THR 51 ? ? 1.48 
7 5 O A LEU 48 ? ? H   A GLN 52 ? ? 1.57 
8 6 O A PRO 47 ? ? HG1 A THR 51 ? ? 1.48 
9 8 O A ASP 44 ? ? H   A ILE 46 ? ? 1.59 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 30 ? ? -59.73  -71.53  
2  1 MET A 75 ? ? -75.03  -76.04  
3  2 PRO A 43 ? ? -38.38  -25.74  
4  3 GLN A 42 ? ? -61.21  -177.01 
5  3 PRO A 43 ? ? -48.81  -71.58  
6  3 ASP A 44 ? ? -146.09 46.94   
7  3 MET A 75 ? ? -70.07  -74.57  
8  4 ILE A 30 ? ? -61.88  -72.54  
9  4 PRO A 43 ? ? -32.78  -33.21  
10 4 ASP A 44 ? ? -141.02 29.30   
11 4 MET A 75 ? ? -82.14  -74.99  
12 5 ILE A 30 ? ? -60.39  -72.30  
13 5 PRO A 43 ? ? -56.05  -7.44   
14 5 MET A 75 ? ? -82.34  -70.04  
15 6 ILE A 30 ? ? -57.92  -72.94  
16 6 PRO A 43 ? ? -38.06  -25.20  
17 6 ILE A 63 ? ? -58.15  -70.39  
18 6 MET A 75 ? ? -75.44  -74.97  
19 7 ILE A 30 ? ? -55.03  -70.90  
20 7 PRO A 43 ? ? -61.12  1.71    
21 7 MET A 75 ? ? -78.04  -74.71  
22 8 ILE A 30 ? ? -56.45  -74.22  
23 8 ASP A 44 ? ? -125.22 -83.87  
24 8 LEU A 45 ? ? 69.87   -51.53  
25 8 LEU A 49 ? ? -48.61  -73.49  
26 8 ALA A 77 ? ? -98.59  -62.15  
27 9 ILE A 30 ? ? -58.17  -77.49  
28 9 GLN A 42 ? ? -71.85  -108.57 
29 9 PRO A 43 ? ? -101.48 -68.37  
30 9 ASP A 44 ? ? -158.95 36.36   
31 9 MET A 75 ? ? -73.21  -76.13  
#